4LBEB

Structure of kcsa with r122a mutation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeB01
4JRXB 2EDJA 4JREC 3GSRA 1LO2L 1MWAL 2BJML 3QEQB 3SBWA 1LEIA 5GRUL 1K3IA 3IETA 3TNNB 5F6HI 1LO4H 1A6TA 4MCYA 4RMRA 2VXUH 4GG6E 2VIRA 3WO4B 1KB9K 4PGJA 4NKDB 2R0KL 5BCAA 3K3QA 4QO1A 4PJBB 5HI5D 4ZFGH 3U36B 4Z7VA 4LNRB 3MLYL 2DLTA 1ZK9A 5AD0A 1GVIA 5JW5A 3TCLA 3U6RB 3BUTA 1SY6A 1VFAB 4ETQA 1QYGL 3Q6GH 4UT6H 3MLTB 2NY2B 4QRRB 4PRNA 4R0LC 1RFDL 2FJFA 1KCVH 3LRGA 4RWYL 5EUOF 3ULVL 4LSTL 3GI9L 2XNAB 4W70A 2HJFA 1H3UA 5F1SA 5IHLB 5EWIH 3IGAA 3FB7B 3IAPA 4PJEF 4EUPG 5I16B 4NP4L 1P84K 2JJTC 5C0DA 1CFNA 4FQHB 5DS8A 3C2SA 5ACZA 2YK1L 4NO2B 5D2NE 1INQA 1CIUA 1S3KH 1T04A 4R4ND 1A1OB 1CXKA 3FHQA 4L8DB 4Z5RB 5DVOA 1ZHLB 4AG4L 4AMKH 4BM7A 4FS0A 1RU9L 4WWKD 4NYLB 3QQ4B 1C5DA 2YHGA 3EYOB 4OFIA 4JANB 2HRLA 2RAMA 4Z7WB 4KRLB 1WZ1L 4JG0L 3LB6D 3UYPA 4ALAL 3MRCB 1KIRB 4FMFA 4XXDA 5K9JL 3LEXA 1JPFA 4K7PL 3W0WD 5GXBB 2VZUA 3BP4A 1G6RL 2LVEA 2UVEA 4LSDA 4ODSH 3T8XA 1UM5H 1MJUL 1NC4D 1ITCA 4FQCH 2P5EA 3RKPA 3QSKB 5I75C 2BOBB 4GG8B 1J7VR 4I13B 3FT2A 2MOVA 4F37F 1D5ZA 4P2RB 3IDMA 2VSDA 1JP5A 1UH4A 2MFNA 1IGFL 4R2GD 1E4XH 1JGEB 1MHPH 3ARQA 2HRPL 3UTQA 2H9GA 4P5TB 3R4DA 3V4UL 2D7OA 5DD5H 4FABH 4P46B 3DOSA 2R1XA 2AJZB 4XBGB 4HDIA 4LFHD 3FB5A 3CX5K 1DQQB 3IRPX 3P11H 1NEZA 3PABA 1BHGA 2ADJA 4Q9QL 1TCRA 5I1JL 1BECA 4JDZB 5TE6L 3GMNA 3RWEA 5KN5A 3WS6A 2MCG1 3OKKA 4P3DA 2BRQA 5AZEL 2JB6B 3QXDB 5JR1L 5DQDL 4DVRL 1N6QH 2X4PA 3BIKB 3OXSB 3NMEA 4XH2A 1ZT4A 3FO1B 1T22B 3PHOA 1TZHB 2VQTA 3H9SA 4ODXA 4I0CC 4FQXC 3MRKA 4LPWA 2EXYD 2HVKA 5CJOH 1J0KA 2BNRD 3N1MC 4LCWA 2F54E 2V7NA 1CDBA 2DL9A 3F7QA 4Z7UE 5HHME 4ODWA 4FP8H 1EVUA 4MCZA 3TBYA 1CLZH 1B6DA 2IQ9H 5D1XD 1FE8H 1F3DH 5E8PA 1XR9B 4FXLA 1JF5A 1L9MA 3JWOL 2A83B 5HBBA 3V0AC 1D5ZB 4LEOB 2EYRB 1S7RA 2I25N 2JCCE 3PP4H 4PB9H 3S4SG 1KV3A 3MXVL 4HWNA 2IG2L 4O2EB 2AP2A 3O2WL 1MFBH 1JYXA 5JDJA 2ATPB 3BKCL 3KJ4C 3BGMB 3UP1A 4DWHA 5D6DC 5SWQA 4M48L 4ZTPL 3DMMC 5E1AB 1ZT1A 4P4RA 1W0VB 3PE9A 5TE4L 2AABL 3VWKA 4ONOA 3ESVF 3HC3H 3VFUB 3IU3A 5BVJA 3U79A 1NEZB 2R2CA 1WJ3A 4PJHF 4WW2B 3UZVB 5HYSB 2P46B 4ORGB 1X5JA 1FDLH 3EOYG 1G7MB 5H37H 2Q76A 4XPTH 3ZTNH 1KFAL 3RFZC 4C83B 5IT2H 4UIMA 3OXSA 5CJXC 3HPJA 3VI3E 5D7LE 1RJCA 1X5FA 4P4KA 5GS1C 4Z95L 1EO8H 3S4SA 2NYYD 3WEXB 3LEYH 3VFSB 4NCC2 1SYSB 4LCWB 1H3PH 3X14A 5JHDA 5DVNA 3L5WB 1EO7A 4BUGA 4NN6C 1MCWW 3GMQA 2Z8WC 2XQYG 2JCCF 3IRZA 3S36H 2VTFA 4UMGA 1IAKB 4U1SB 1XGTB 1TMCB 1RK1A 4L4TD 3PV6B 1YNTA 4PP1C 4HXBH 4OQTH 4R97C 5T1DH 1BVKA 5KSVA 2FX7L 4NKQB 4J3VA 4PJHE 5ISZB 4RFOH 3MRJB 3QULB 3NPSC 4L4TE 2R15A 5C0RL 5D93B 5DJ0A 3O4OC 1AGBB 1FYTA 5DMIL 1DDHB 5E7FA 3MBXL 3K80A 5JTWA 1FC1A 3B6SA 4OZFH 3BUYB 2AJYH 2CGRH 3O41B 1T0MA 1MRCL 1UFUA 1MFNA 4HKBB 3T3PF 1NBYA 1VERA 3HZMA 2KUTA 4LLUA 4NC1C 5KZCB 5ICXA 5ETUB 1DANU 1BF2A 2APVA 5CD5C 3TYFA 5TGBB 2HVJB 1SBSL 3BPLB 3ALWA 1GYAA 4CL7A 1KJ3L 3FQUA 2A83A 4ISVA 3OKMB 3S35H 1UWGL 3M1BB 3LQMA 4PG9A 5CILH 3IXAA 1GGUA 3ZKSD 3UJTH 3VFPB 1OWWA 3ZE2F 2F8VA 1MFEL 3D0VB 4YDIL 1QSFA 5TJWK 4FNLL 2CK0H 4JM2F 4GUPB 2KL6A 1T3FA 4QXGH 1BOGA 5E2TH 1KJMA 1YYMH 4IDLA 3KYKH 3RUGA 3V6OA 1CR9H 3LV3B 4U1JB 4X6BB 4EIGB 3BEWA 5I17B 2F54A 1OGTB 2K7QA 2BSTA 1YQ2A 3NCCB 1WGOA 2RR3A 1YMME 5DUPL 3B3IB 1ZV5A 4RGOL 3MLWL 4X7EC 2XWJB 1CLYL 2APXA 3S37L 2X1XR 3PQYB 1LO3H 5I19L 3EYSL 4WHTB 2D4FA 1CGSH 2R0ZH 1ZLWH 4OZGE 2WLZA 1KB5H 3TO4A 1QFWL 3TA3C 5L0QB 2LQRA 4Z95H 1TNNA 4PLOB 1OD7A 5EBMA 5IHZB 1NMAL 3QUYB 4JM2B 2KZ1B 4RGNC 3QFJA 1HHGA 1CE1H 2IANB 3AB0C 3C60B 4ODUA 2L0DA 4S1RH 2Q6WA 1IGJA 5DD1H 3AB0B 4Y16B 3KYOB 1KLUB 4PY7A 4U05A 2CLVB 2HFGL 5GRVK 4O5LL 4BQCA 1YN7B 3WLBA 4M1DL 2DAVA 5F7KC 2DLHA 1KUMA 3KPLB 3B8SA 3G5YB 4RGMC 4PJ9D 4ZFGL 1HIMH 1AGBA 4OM1H 5F7YC 5I76B 4YHIA 5CJ5A 2VKXA 2VC2L 3PUCA 3SGDI 2FR4A 2R29H 3VXMA 3RTQD 2HMIC 4LPXA 5IMMA 4CW1B 1T1YB 1CDHA 1QZ1A 4MDJB 1QOKA 1OSZA 2NY0D 4KC3B 2EYTB 3OZ9L 2J6EA 4UT7H 2ICWB 3IFPB 3RNKA 2XZCL 4JZJC 2XXMB 5TGBA 3K1KC 5LGKA 1JNLL 1MRCH 4YEFA 1IEAB 1T6VN 1QFUH 5K9QI 2D0GA 3EYUH 4JCMA 4AYFA 3QUXB 5KSBA 4JFHE 5CEXA 2EDLA 4BZ2H 2OR8A 3VFWB 4WY7L 1CGYA 4I4WB 3BPNB 4MXVF 4HXAH 4OGAD 3DTXB 2XNAA 4Y2DD 2W9EL 5DJ6B 4UAOC 4Q9CA 2PYFA 2VXVH 3D9AL 5FCUH 5FV1L 4NPYA 3CLEL 3TT3H 1EUUA 3PP3K 5JW5B 2NR6C 2CIKB 2CO6B 5GZND 4N8CH 3QEUA 2CPCA 3RZCB 2ICEA 5JA9A 2AV7A 4MDIB 1OTUD 3MLTA 1ZHLA 1YUHA 4KV5E 2LTQC 4LU5H 4PLKD 4DAGH 1T1ZB 5JPNA 1J05B 1JGDB 1HSAB 1A4JB 1OF2B 4H8WH 3S34L 4NQXA 4U3XA 4HCRH 5I16A 1DUZA 2R2HA 4HJGA 1YQVH 4OJFH 1ZT7A 1T6WA 2V5MA 1A9EB 3TO4B 1BD2D 1CF8H 2CRIA 4EXKA 4ELME 5FYKD 4H26B 1ZEAL 4EOWL 4F7EB 2VLJA 2HRPH 4WWKB 2NY3D 4GMSL 5EUKB 4NQED 5BO1L 3T2PA 3RDTA 3ZDZF 3AS1A 4YDLB 1MIMH 5DD6A 2DWEB 4BH8B 1CE1L 3HB3D 2BDNL 4LBEB 4M00A 3JSSA 4PJ7F 2XZAH 1U8JA 1RVFL 5BMFL 4JY6A 1JGEA 5SX4H 4ZUTA 4PJXA 5GSVB 4IBLT 3O6FC 1YMHA 4TVPE 1IEBA 3G04B 1IQWL 5CP7A 2NY6C 5C0EB 3HC0A 3UC0L 2XKSA 3MA7B 2QADD 3HUJA 4Y19D 2EEAA 1Q72L 4Y4HD 5CJOL 3RHWF 4CW1A 1TVDA 5DYOA 1UA6H 4L29A 3HE7B 4G9FD 4Y5VA 3SCMC 1EXUA 3QFJE 3BXNA 3H9SD 4ZS7H 2QHLA 3QB7C 4NGHH 1CXIA 1SHMA 4NQTA 3QUXA 3VWJA 1SYVA 4MAYB 3DUUA 1EFQA 1ODAA 1BD2B 4QTIH 3FO9A 3MODL 4R7DA 1UKTA 1HHKA 4OLUL 1BQLH 4MAYC 1W8OA 3KVQA 3UROR 1JPST 1DFBL 1VEOA 5GJTL 2ESVD 2MPAH 5J1SC 4KZDH 4RAUA 1INEH 2VE6B 5DR5H 5CSZB 4GRWB 2EE6A 2HH0H 2W38A 3GMNB 1HQ4A 4LIQE 1S7VA 3C8HA 2IANE 3PHOB 3HA0A 3CSYA 4MNQA 2KZWA 2NXZD 3VXME 3QEUB 1AR1C 1QNZL 3WHXA 2ADGA 4P3CH 3ET9F 5INDA 3MSPA 3BMWA 1AR1D 2JIXA 5IBTH 3MLUH 2J8OA 5DJDA 4R8WL 3MUY1 4U6XB 1I9RL 1U8HA 1GOHA 1JF6A 4EQ2A 4GAGH 3UPAA 2OR9L 3QUMB 3PQYE 4GSDH 5KSBE 4HWBL 2R4SH 5C09B 5FHBH 4Y0GA 2R0WL 3ZDZE 3BAEH 2VRAA 3LRSA 4LDOB 3ALXA 4X5XA 3BOVA 3SDDA 1CXHA 3KPSB 2EKSA 4HCRL 3ZYJA 1AXIB 1J10A 3RVVC 3RI5F 1L7IH 1JHTA 4UIMB 4Z7OF 5IESL 1OTSC 2Y7QB 3L5HA 3C08L 3P40A 3RDTB 4UUJA 1CF8L 4P5KA 4PJ7A 4WFFE 3BZFB 2NW3B 2AXFB 3SOBH 3T2NL 3GSNA 5HHPA 3BWAB 4XMKH 5ID1B 2PR4H 4JPVL 3RWCA 2C4XA 3FN3A 4IOIB 4K2UH 1AFVL 5BVJB 1YEGH 3GKWH 3DURA 3UEZA 43CAB 5I71C 1FFOA 2UUDH 5D70L 4GXUM 4KKNA 5KSAD 4NZTH 2ZWLT 3NN8B 1G7IB 1BAFL 2W65A 3CFJA 3EOAA 4PJBA 2AJUL 5SWSD 4IDJH 4PRNB 4PBVC 3GBNH 4LEXH 3MLYH 3TLRA 1EEYB 2D7PA 5INDB 4LPCA 1QEWB 5C07D 5TE7L 5KJRH 1FGNL 2WQRA 5BS0B 1VEPA 4X4MA 4XWOD 5ALCH 2APTA 4U0RB 3QAZC 4WEBH 2ATKB 4XRCA 2BHYA 4PS4L 2UWEF 3T2OA 4ENED 5LVEA 1H8SA 4L8BB 2HP4A 2BSSB 1KJ2B 4RAVA 3VWJB 1CTOA 1NCTA 1TJIL 4CJ1A 1MIEL 3N1QC 4XCCH 4R7DB 4WI4A 2Y6SC 3DV6A 1OHQA 1UVQB 1YMMD 4K3HA 2FJGB 1M7DA 5F3BB 4GAJH 1LQSR 3IDJA 3E6FB 1I3VA 2ARJA 3KPRB 3EYOA 1OM3H 1DVFB 3QRGH 5EZOL 2G5RA 1S7VB 5FHAL 5EUOA 3U1SH 1WF5A 1U3HD 4KZDL 1CL7L 1J8HB 2Z31C 5H37G 1A7NH 4EN3A 4L1DA 3EDDA 2UWEB 5A40E 1PX4A 1HE7A 3H7BA 5FYJE 5HYJA 1TJHL 3JWDC 3MLWH 4D94A 2AEPH 1KACB 2VR4A 2P8MB 3B9KA 1T5WA 5EU6D 4MD5B 1DLHB 3CLFL 4GRLC 1OP5H 4P3CL 5BRZA 5HVHC 4N1EA 1GAFL 2YBRA 3BDYH 3UO1L 1PD6A 5E6IB 2PN5A 1ORSB 2BY2A 4RZCA 3LOWA 3OKMA 1KC5H 3T4YB 3MPCA 3MUZ1 3CFBB 2D9CA 2J88H 2EIDA 3V2AR 4WI2A 2CKBB 4PJHB 2IQAB 1VA9A 4F57H 3EYFB 3JBG7 5K93A 1F6AA 3F7VB 4WWID 3LPWA 3GHEL 4GAYB 2SEBB 2C9AA 4Y1AE 3BWAA 5D1XA 3CPLA 4AL8H 4NJAL 5D5MF 3AU1B 1HDMB 4I9WD 1FSKC 4LSUL 5I1DA 2DLIA 2BSED 4U1NB 3HR6A 4AH2A 1DBBL 4EN3D 2C3GA 3P73B 2VZ3A 1BQHA 1T5XA 1EZVX 1HEZB 1QHOA 3PQYA 1KGCE 5GS0D 2OQJA 3DETC 4GLRH 5B38G 4HV8B 3LKSB 3MNWB 4QXTA 1X6LA 5JR1H 1N6QL 1BZ9A 3PG2A 3BGFB 2OK0L 2WWKO 1U8MA 2HVKB 3BP6B 4K94H 2RBLA 4B7LA 2CDFB 2QADC 3PL6D 3SDXA 4S1DC 1DZBA 5I2IA 4BH7A 3W9EB 1G7QA 4FQ1H 2FJHA 1ETZA 3H6JA 4Y16D 5F1NA 3CIQA 5KANI 3HTLX 4JRYB 5DFTA 4PS4H 1IGJB 1NUDA 2ZSWB 3FONA 5DJ8B 3B4NA 4ODUB 4JFFE 1B0RB 4O51B 4OCSL 3QIWD 3C5SB 5FYJD 2JJSA 5C0BA 3V5KA 5JNYB 4RMQA 2PUQT 5ANME 2LFGA 3MREB 3UTSE 3U30C 1EHNA 2GTWA 3FZUD 3V5DB 3QIBB 3MA9L 5D7JD 1MHEB 3ARBC 2HKFH 4WHDA 5SWSA 1C5BL 3N1PC 1KIQB 5D1QD 4QHLB 3VFVB 5L2JB 4CBPA 4NWUL 3UTSB 4X4ME 3OXRA 1R3KA 1E4JA 4UU9A 5FM8A 1RIVL 3GI8H 4NO5A 3B9KB 3LKRB 1JK8B 3RVTD 4P2YA 4NO0A 5FCSH 2CQVA 1NBZB 2C3HA 4RMUA 4WI5A 3VH8G 4MMZC 5JHDB 4OAWB 1Q9OA 1HNFA 2D2OA 2BY0A 3UBXI 3O2DA 1H5BA 1FL6A 1F5WA 5DZNA 2IGFH 3ARPA 3LD8C 3U0WL 5I73B 4MD0B 2VDOL 1G7LA 2ICES 5F1NB 5C0CE 3IB4A 2X40A 4JO3L 1GCFA 4HUMB 4ONHA 3CXHJ 1WBXB 5T1MA 3ROOA 5EIQA 1JWSB 2DM4A 2AQ1A 1NPUA 1JE6A 1VADB 2X9YA 1A6VL 3ARGC 1S78D 4WWKA 3BZEA 2JJUA 2ZPKH 4UDTB 3QR2A 5SWZD 4JN1L 3WKML 3MNZA 4LSUH 1MRFH 3AAZB 1RIUH 3F5WB 4LLDA 4QRQA 3T0VA 2ED9A 4XPAL 3FB8A 3VRIB 1ZHKB 1VCAA 2Z35A 4OV5A 1CU4L 1LK2A 1WEJL 3DO7A 5EWIL 5T3XH 3I75A 1QA9B 5FO9B 1VFAA 5A2FA 1XIWA 4HIXL 4Y5XC 5F6HJ 1ZHBA 4MXQC 5K9OA 2YD1A 4JHBA 2ADFH 2WLYA 3GNMH 3OKYA 4D9LL 5GGUA 4GG6B 3C8KA 4QHMA 5AUMB 1JTTA 2VABA 4WU5B 4X4YB 5CIPB 2FHCA 5D7SH 1EEZA 4J1UB 3QH3A 2AKRB 3TBSB 1LO0L 4QYOA 4XHQA 4M7ZB 5IB3B 1BFVH 2CDEA 2EKJA 1Q38A 3L5IA 1QD0A 1T3FB 1MFEH 4L5FH 5FGCE 5C7XH 4ZUUB 4M7ZC 2Q8AH 4ELKB 1FNSH 1A3RH 3WIFA 4OQ1A 3AREC 3HG1A 3X13B 5AAWA 1J0HA 4NQEA 2ICCA 1CWVA 4DOHE 2QKIA 4NZUL 1P2CB 3OKNB 4HK3N 4N5UA 4I5BA 1PKQE 2CLRA 2WP3O 2E6QA 4HK0A 3TJEH 4MA1C 1CLYH 1KTLB 4UBDC 2GJ6E 2DIJA 1Y6MR 4QRRE 5E5UB 4JRXA 2BNRA 1I9JH 2OMNA 5IFHH 3DLQR 3RHWK 1AIFB 4X6FB 4J4PC 4P2QA 5BV7L 3P30L 2Z8RA 3KYMB 1D5MA 3BP5B 3SQOL 3MUHL 3F65A 1S7XA 3W39A 5SWSE 4JM2C 2GY5A 3P77B 1H3VA 2QQLH 1Z3GL 2EE3A 1AE6L 3TCLB 2Q6WB 4G9FA 1F8TL 1AXSA 3AM8C 4PJIE 4IRSD 5GGRY 4CU8A 1A5FL 4HIHB 3SKOA 4R6UA 1L7TL 5D6DA 4GAGL 1FIGL 4X8JB 2OR9H 2CDEB 1BFOA 5FO8B 1XR8A 2LVCA 3UDWC 4PRID 3GSXB 3RL1B 3CVIH 5JOFB 1FNFA 2A2QT 3FRUA 3LKNB 5LGHH 4X80H 4XP5L 2AXFA 4PJFE 3UX9B 4G8IB 1ZHKA 1RZ7L 2O5YL 1ZSDB 3H3PH 1NUFA 3ELAT 4KRMB 2YRPA 2VH5H 1WTLA 2EKSB 4XAKD 2DLEA 2EDHA 2DQCL 1JHLL 5IJVA 3UBXG 2PR4L 4JPVH 2XZCH 5I1JH 4WHYG 5T3XL 3BYYA 5KSBB 2GT9B 4HDIB 4LHUB 2Y5EA 3FTGB 1X5AA 1R6VA 3PIQA 3EYUL 2AGJL 2XTJC 2DL2A 2NY3B 3IDYB 3MV9B 3P4OB 3ORJA 1A3LL 5FYJU 3D87B 1E6JH 3BPNC 1KTKE 3ECBB 4YBLC 4ZAKD 2GI7A 5E24E 4XC3L 4KAQH 3LDBC 2VLJD 1FRGL 3CVHB 5DFVD 5ID0A 4HEPG 4XC1H 1RUQL 1A4KA 5JOPE 2XWBA 3CLEH 2Q7YA 1LEGB 5DUML 5C0AE 3NOIA 3T1FB 1WK0A 1MCQA 2EDEA 4P9HH 5FDWB 2FZ3A 4Y4HC 1I7UA 2Q8AL 3SN6N 3HS0B 5L88L 1JN6A 4M6AA 5TF0A 1WZMA 4XBEH 1C08B 3MRQB 4XGZB 1M71A 3GO1H 4Y4HB 1XR9A 2VUOA 4G8FA 2J6EL 1RZKL 4L8BA 1IAII 2KPNA 5FYKL 4O2FB 1A9EA 2B39A 4C83A 4NUJA 1U93B 1BVZA 2AABH 3ETBF 1EHLH 2P5WA 1ADQH 4LLQB 1IQDB 1NLBL 3QQ3A 4JQIL 2CR6A 5IEHA 3ZYOA 3VFRA 3QRGL 4MQ7B 1T0NB 2XKNA 4YO0A 1ZOXA 1H5BC 5DC4B 3GSNH 4X9BA 5GHWH 4QRSA 4EI5B 4TOYL 5E2UL 2VXQL 3Q1SL 2Q7NA 4OZHB 5JIIA 4Z7VE 4N0UA 4RFOL 4F8TA 1UENA 5JORB 3TPKA 3EFFA 2EXWC 2NY7L 4XCFH 3KLAB 1FHGA 4DQOH 5FFLA 1JJUA 3NIFF 2YUZA 2Z8VC 3P0GB 4YHPA 3ALPA 4EI6B 5J57B 2RQ8A 5C3TA 5KW9L 3O8XA 3BD4A 4QRRA 4JRXE 1XT5A 1QP1A 3I6GB 2EDOA 2G5BB 2Z91B 5CZKA 4NM8L 4P2QE 2GJ6B 5IVXE 4GAFB 4P5MA 1J86A 3U4AA 1NAKL 4PGEA 3VG9C 1R3JB 5D2NA 3KDMA 3EYFA 1CG9A 3CJJA 4JHWH 4YJZL 5I8CB 2YXFA 3MGAA 1AD0B 4C59B 1FZKB 2C7UA 3S35L 4FQHA 3DSNA 2IAMC 4RNRB 3V52H 1TNMA 1AGDA 1A1OA 1IC1A 2JF1A 4IMLB 5C0RH 1QSED 3WS3A 1X5IA 1FQ9C 1OAKH 4OCXH 4CU7A 5C2BH 2XOTA 4QTIL 3ULVE 2G2RB 1VKXA 3NIGF 1YZZA 5DJ0B 3RWDB 3OHXB 1FL3B 3HMXH 3P73A 1NCDH 4ZYKB 4MA7H 1S7TB 1DN2A 2HLFC 3O6KH 3TPUA 1U95B 3SGJC 1FC2D 1B0RA 3HC4H 5IHBA 1AO7D 4X6CE 2IAMD 1HCFX 2M2DA 4JG1H 4OM0L 3VXTA 1JYVA 1WIUA 1AY1H 4HX1A 5DGQA 1AKJB 1CGSL 1G0YR 5I15L 2AVGA 4UINL 5ETUA 4QT5A 3CC5B 3RI5K 4M93B 5IVXF 3FRPA 2VZVA 1MFCL 4U6YB 4D0DA 4M1CD 3VDBA 1U92B 5HHNA 4Z7VF 1ES0B 2CXKA 3JV6A 1U93A 5FOBB 1OAYL 4QXGL 2R4RH 4M5ZH 1V7NL 4LGSB 3KYNA 3V5KB 4JR9L 5JNYA 4EI5A 4XP9H 1S3KL 1BQSA 2R69L 4DUWA 5DFWH 5ALBL 4Y4FA 5H8DA 3WL9A 1D3CA 3SGEH 2IMNA 1RHFA 1FJ1B 3FQNA 2E3VA 4KXZI 4H1LB 3KPTA 5DQ9A 3D5OF 3FL7A 2OJZH 5F7NC 2VXQH 3Q1SH 4U1HA 2CUMA 4XXCA 5DMYA 1MRFL 3MUGA 3HZMB 1MLCA 4YBHA 15C8L 1JWMA 3K4DA 1CXFA 4UTAL 3V95A 4QTHA 1K6QL 3L3DA 2VAJA 4LCCC 4HKJB 4NIKB 1XF5B 4OLYH 5I1CL 2R1YB 1WITA 3L3JB 3ME0A 1I1AC 5TE7H 2BSSA 2PXYA 1KJ2A 5D5MB 1FFNB 3QAZB 4MA8L 1K4CB 1R3LB 2ADFL 1VFOA 4PRBB 2NCMA 5HGHB 4L8CA 1F4YL 3LQAL 3Q5YA 5FXCH 3QXTA 2YN3A 4CRPA 1HIML 3FKUS 4KVCL 1Q94B 4PTTB 2G60H 2K1MA 3IFPA 3RNKB 1YEDB 4X98B 4X6DA 1TPXC 5FO9A 3DVNB 3MRFA 3C5ZA 3MBEB 3BEWB 1IARB 1I8KA 3NZHL 3LMJH 3P11L 4L9LA 2ARJQ 4S1SL 3VRIA 3UCRA 4MA1B 3OZ9H 4FXGB 4UT7L 1X5HA 1QO3B 4J12A 1ED3A 5FV2A 5LWYH 4OGAC 1DSFL 2BVPB 5E9DB 2YPKA 5AZEH 5DQDH 4GQPH 5IVXA 1G6RA 1XGQB 4MX7B 2G75A 5CHNB 3BKJL 4L8SC 1KPUB 3MLZH 5JW4N 3T3ME 2DM2A 2OM5A 3FQWB 1S9XB 4K7FA 3ZKNC 3MRIB 4ZOEA 2PXYD 5DD0L 5LBSL 2AV7B 3CLFH 4KJWC 3C60A 5FB8B 4LVHC 2D3VA 5IQ9A 4OUUA 3HAEA 2VLLA 4I18A 2AERT 3DV4B 5KSUB 4PB9L 1JZ5A 4N8CL 3QIWC 1D5XB 4XMPH 3LAFA 4PV8B 3PWUB 43C9A 2F5BH 5F1OB 1Z3GH 2X05A 4HUVA 1IKNC 3HN3A 4H26A 1FYTE 2H1PH 2IFFL 4HPOL 2GITA 1LE5A 4L4TB 3MRFB 1ACZA 1I1AD 2IPKB 2BVEA 2C26A 5A16B 1U3ZA 4JFOA 1EDQA 4NT6A 1DJSA 4N9GA 1T1XB 3MLPA 5T1KB 5JIKA 2BRRL 1G9EA 3F6LA 1FDLL 3C6LD 3T77A 1P1ZB 2NNAB 2ZKHH 5E8OB 2Y4SA 4X7SH 3NACH 1RZFL 3L3JA 2XN9B 4HD9A 5A43C 1N26A 3O9WD 1HN1A 2FJHB 4GRMA 3F12A 3GSVB 4HG4K 3DTXA 1SJEB 3L7FA 1M6OB 4ODWB 3ZSSA 4OZIA 4AIZB 1AE6H 3IYLW 3ZYIA 4OCWH 4G8IA 3GJEA 3W5NA 5D7LD 4IRZH 1IBGH 3INUL 3THMH 1YEEH 1MJ7L 2EDRA 3QWQB 1D9KD 1TVHA 1BFTA 1TXKA 4Y4KD 1E6JL 4H0HB 1QTYT 5DJCA 4E9LA 4GUPA 4DGYL 1B0GB 2E8ZA 5LGHL 35C8L 1KPRB 1ZKAA 3G6AB 1OGAB 4GJTB 1JGDA 1XF1A 1WWCA 4XWGL 4HT1H 5E5MA 3QNXA 3MLUL 1V3KA 3TYGH 4R90H 3WUWA 4XHJD 2VE6A 1H3TA 2E9IA 2V2WB 5DMIH 2HLAA 3T0WA 2EIBA 4P9HL 4N9GB 3VGBA 3RKDD 2R56L 4M7JH 1EJ6A 3MRGB 3AROA 1A14L 4TTDD 1JK8A 1FFRA 5FAAA 5KVDH 2O5ZL 4DZ8B 1YPZF 4LARL 3GFUA 4HGWA 4JZOA 2CMRH 3TJHD 3QIUB 3FMGL 4L4VA 5K59F 3MLRL 4PJEA 4DGIL 3IF1A 4IRJD 5CINH 5HYFA 5FK9A 4LBEA 3ZTJH 3DV4A 3VFTB 4A2MA 5CJ8A 4JPIB 3ARFD 4ZFFA 4ZUTB 4LLMB 4YHLL 3L3GA 3WJLC 2E6PA 3I84A 3FCTA 1MPAL 1KOAA 1QPXA 4M9OA 5I8OL 3KPNA 2N4IA 3T65B 3KXFE 4P2OA 4TVSa 3QNZA 3MV7A 3GHBL 1I7UB 4ZFOA 5E7BA 4YHIB 1MJUH 4L29B 1YPZB 3SDCA 4FQ2L 4ZOCA 3OQ3B 4I48B 3CUPA 4UDUB 1MCSA 5JZ7D 5DA0B 3TWCH 3TIDA 5I66A 1H0DA 3FQRB 3ARFC 4HUWA 3SPVB 2CKNA 4IS6A 3QCTH 5EU4A 3EO9L 4O4YL 1K8DB 3LB6C 2D7TL 2RJMA 3HMWH 1ORQB 3EHBC 4TOYH 4LLQA 1Z6JT 2DQUL 1J87A 1LDSA 3EO1A 1EEYA 4PGDB 1NGQH 4GG6A 4N90E 2BOCA 3P4LA 3KGRA 3MCG1 4I1NB 4BUHA 3IF1B 4ZODA 3V0WL 3V0VA 1AGEB 3TN0C 4Q2ZB 4JPIA 4S1RL 3MRCA 4UOW1 2IF7A 3QO1A 4P2OD 5LAXA 1G7IA 3KPQA 2RB8A 5E8NB 5J6HA 2YMXL 1TFHA 3MTRA 4TNVK 1OPGL 5DHVA 3L9RB 2NXYD 4IMLA 4PV9A 4XP1H 2H8PA 4URTB 4P2CG 5E4EC 1IAOA 3RUGB 3R06A 5I30L 3TVMD 4K3EL 2E27L 2P4AB 1EBPA 5D2NB 2YC1B 4OZIE 2FO4B 5JUEL 5JIPA 1Z9OA 1KC5L 1OW0C 1T89A 2ESVB 1VDGA 3DHMA 4GAJL 5F7LB 4PJ7B 3HLAB 3DECA 2EO9A 4YK4B 4KQ3L 4YC2C 4N8PA 2HFEA 5EZOH 1FFPB 3HZVB 4P59L 4M5ZL 4QXUH 3QCVL 3VD4A 3NCJH 4OD2B 2VDNH 5IIEB 2OZ4H 1PDKA 4PJDF 3MOAH 1S7WA 1MAJA 1A7NL 1NCDL 1G9ML 3PWNB 4JDZA 1FO0B 4XX1E 3QDAA 2DQEH 2MQCA 4DGIH 5CD3A 5CINL 4EJ1C 3DBXA 4Z7UB 5HHMB 4PJXE 4TVPH 3CFBA 5IV2A 5EU6A 4WW1B 3CDGA 1J1OL 5IGXL 4HWZA 4JJ5B 1F6FB 3TT3L 4UNTA 3QG6B 5T5NF 1ERNA 5M95B 2BC4A 1NDMA 5HPMA 5BV7B 1T21A 4WDIA 2KH2B 3ZDYE 3UBXB 2DICA 1H8NA 4OFYD 3JV0A 1HI6A 5FYLD 2YD2A 4GFTB 2P42B 4PJEE 2BNQD 5LCVL 1K8DA 4B0MM 4TUJB 1N0XH 3TWCL 1Q9LB 3RY6A 4CU6A 1RMFL 5K9QG 4M6ML 2VDKL 4G9DB 3P9MB 2EIZA 1XF4A 3HNTL 2B8OT 1J5OL 5HGBA 3LQAH 5EU3B 1U8PB 3WD5L 5J4MA 4YFLI 3WLWD 1FJ1A 3FQNB 3CDFA 3QISA 2FX7H 2FWOA 4LRNL 4WFHE 2BSRB 5CFHA 3MA9H 1AGEA 3MV9A 2QL1A 2VNCA 4U1HB 3TNMA 4DJMA 3NGBB 4F3FA 1DLFL 5GS0L 3LMJL 1P6AB 2NY1B 4OBRA 2C3VB 4NJ9L 3NA9H 3SE3C 5BS0D 3IKKA 2Y6SD 4LCWE 2Y9RT 2J5LB 4XB8A 2UZXB 3GEWB 4JJHA 1N59A 2R23A 1GZQA 3CK0L 5GISL 3N85L 5HHQA 3BQUB 4WFFD 4MQTB 3FN0L 1OP5K 5DUMH 2HJFB 1PBYA 4P49A 3O3UN 1KIQA 5GRJL 1XGTA 3DVIA 1JGLH 3P9LB 4M93C 4DFIA 1JWUB 3HNVH 2G9HA 3PWJB 4PJXF 5CP3H 4K71C 3QQ3B 4U6TA 2VDOH 1ZVHA 3DIFA 3BZDA 5DTFB 1I3GH 3FAWA 5J11B 1QFWM 4LPVA 3VFRB 4XMPL 4YFEA 5H94B 4NKIL 4Q9BA 4AMKL 4JY5L 4JKLA 3BFOA 3E6HB 3WYRA 1K9TA 4PRHA 4UNUA 1V7MH 3BI9X 2BSRA 3IETB 5E2UH 3QZWA 1G9MH 1I1CA 4N5ED 5IVXB 1BVLA 4YHML 5CZVL 3PWPA 5IBLC 4N5EC 4PJ5B 5IB5B 4ZS6C 3KPPA 4MJIE 1QQDB 2RHEA 3CZFA 5TQ2L 1T83C 4KKAC 4AJ0A 3ARSA 5CBAA 1OB1B 5J8OA 2R23B 3ILQD 2H2SC 5ERWA 1IJ9A 1Q9OB 4K8RL 5KVGL 3OAUL 1IC5H 4KI1A 4PGEB 2O61A 3CCHB 4JO4H 1UB5B 3LVEA 2OMBA 1UH2A 3BN9C 4Z78B 25C8L 1FVDA 3LS5L 1P1ZA 2WP3T 3D0VA 2HJKB 4IRZL 5F7FA 3ARYA 2OSLB 5LJYH 2AJZA 3JWDH 4PYGA 4XBGA 4L4TA 5GZNC 2AK4B 5EO1A 1BIIB 1UXWB 4A6YA 3MJ9H 4OGZA 4Y8DC 1GIGH 1W8NA 3OHXA 5T1KD 2IPKA 1LO5B 4UU9B 3OKKB 5HYJD 4Q74A 3MNZB 2XTJD 4NDMB 3VFMA 5E1HB 4QHMB 3TYGL 3ES6B 3WNKA 3BISA 1HQ4B 4FFVD 4WFED 1IM3A 1ZGLA 1KCUH 4LF3B 2NY2C 4ODTL 3UJIH 4J4PD 5JW4R 3WLWC 1RUKH 4DN4L 4RMVA 1DUYB 5HDOA 3P9WB 4YDLC 3RTQA 3BX7C 4MLSA 1IC4H 1P4BL 2DQTL 4KKBD 3FO0H 4FG6D 2A6IA 5I8EB 3EUUA 1FE8L 1EGJL 1YEJH 4LKXB 4TPRH 5E8DL 3SQOH 3LKOA 2NLJB 4GMTH 3MV9E 3P2TA 5FOBA 3U7YL 4KGLA 4WU5A 4X4YA 2CKBA 2X4OB 4Y1AA 3KWWA 5EZJA 2GJJA 4LCYB 4E5XB 1EMTL 3N1GC 5KSAA 4NNXA 3QIWB 1I8LC 2Y5TA 4NO3A 4BFBD 5IOPA 2W1NA 4R7NB 4PG2C 2YOCA 4OSUL 4N0YL 1EFXA 1VGKB 4RISL 5B21A 2HT3D 3GSNB 4N9OB 4AENA 5D71H 3CX2A 4ORZC 2ZOLB 3MRGA 1XAUA 2O5XH 5EZLA 2I07B 4G9FB 1Z5LA 1SEBB 1JGVL 4OJFL 5L2KB 5C70A 4LHUG 4LVOC 1IM3B 1RJZA 3SDXE 2N7BA 3H9HB 1XF5A 5FGBA 3LQZA 2J3SA 1CD1B 1FIEA 4XCNA 4RGNE 3SCMA 5IF0B 3E0GA 4LCWD 1GAFH 4G6FB 5D7LB 1G7QB 4JFFA 3CMOL 3O3AB 4DVBA 1LHZA 1OP9A 1ZGLP 4M4RA 4KK8D 2PW1B 4P5TC 3ZMRA 1AXSB 2WINA 3LS5H 1LE9B 3VXPA 4HPYL 4KVNH 5C0FB 4V1DB 4Z8FH 4PY8I 4MJ5B 3IDJB 1CVSC 1KLGB 4Q0XL 2X4NA 2WZPD 2LTQB 3WDHA 1NFIB 1ZSDA 3G08A 4HWUA 2R0LL 1TVBB 1VENA 2VDPH 1P9MA 2HKHH 4J6RH 4JE4B 3QFDA 4P5TD 3GO1L 1KJVB 4F7EA 3IDGB 1MI5D 3SPVA 2OL3A 1LD9A 3KYMA 2OK0H 4L3AA 4GW4B 5JW4M 5TH2B 3BKJH 5D6CA 4PJGA 3H9HA 2NPLX 5AEAA 3SY0A 1LEGA 1UT9A 4XHJC 2VISB 3B43A 5IFAH 4X7TB 1FL6B 5DEZA 1KTDB 4U2YA 2NLJA 5D2LB 3C2AL 2NQCA 3FO0L 1D5XA 4LCUB 1F3JA 3HAEG 3TV3L 2YD9A 1WBZA 4GT7A 5MERB 4X8JA 4Y4KC 4GBXC 5ESQA 3W81A 1JI1A 3UJJH 3TJHC 1MREH 4Z7QE 3SDXF 1JCKA 2CR3A 3VRJB 1LP9E 5DQJB 3ZYZA 5K9JH 4XBEL 4HFUL 5E00A 3SO5A 1J1PH 2VXTL 1YYML 1BBJB 1RZIB 2MKWA 1F58L 4QRPD 3MV8D 4XP6H 2H8PB 1CFQB 2H1PL 2BNUA 3GSWA 1H15A 2HFFB 1BM3H 4R0LB 2FD6H 4K3JH 5DJ2A 4X0KA 4J8RB 4I3SL 4OBSA 4WI7A 4DUVA 3DXAA 3OR6A 4GQ9L 3TH3T 4LDLB 5D96B 3PDDA 3ZLQC 3IDXH 1VPOH 2R0ZL 1CTNA 2XTJE 1KB5A 4JJ5A 2A9NL 2QQKL 3EDFA 5IHZA 1WAAA 1T2QH 3CH1B 5GS3A 3QEGH 3VDCA 3MMEA 4NQDD 3QUYD 1NL0H 2HVJA 4NQCE 3RZCC 3SE4C 4YZFE 3BD5A 4L9LC 3QJHB 1KJ2L 2ERJC 3W2DH 1KULA 1NUGA 3VRLF 3NTCL 4F7PB 4N0UB 3RVVD 3DBXB 2V2XB 3WN5C 1YEEL 3DX6A 1LP9F 2HWZL 8CGTA 1NCCH 3AXLA 5DDHB 4M1DH 3PGCA 5DJYA 2DIAA 4FA8A 3LEVL 4FRWA 1KJMB 3STZA 1BZQK 2D0FA 5E00B 2OCFD 2MKLC 5E2WH 5KBNC 4KGJA 5DMGD 3T09A 4AT6A 4MWFA 1HQRA 4OCYH 3QUZC 1LILA 1T4KB 4JN2B 1NH6A 2GJ6A 4NFDA 3PF2A 2FGWH 1MJ8H 3PDOA 2Z4QA 2CLRB 4YK4C 3KS0H 4FFYL 3TPUB 3W82A 2H6PB 2EIZB 3WXWL 3LKRA 5FKAA 1S9WB 1JHTB 1UWEH 3WNPA 3X12B 3OX8B 1CBVL 4JFDB 5SX5K 1KYOJ 3C6LA 4LRNH 2AS5M 1KB5B 1LP9B 3DJ9A 4HJ0D 4P46C 1IFHL 43CAA 5IKCB 5MENA 4KK5C 3VXUA 5E4IA 2R69H 5JORA 5D8JL 5F96H 1OGAE 5SWZA 2OLDA 3HC4L 2X1WL 4IRSA 4P23B 4XPHH 1A64A 3IDIB 2X4TB 1WTGT 4RAVB 1U6AH 5DXWA 2L4OA 1I1YA 2A38A 3TV3H 2V2XA 3AVEA 3MV7B 4HWEH 3K1DA 1GZQB 3ARGA 1TETL 5D1ZD 2W0FB 5J12B 5A2KH 15C8H 1R3IL 1A3RL 4NRXB 3GGWB 1QSZA 7FABH 2NXYB 3AS2A 4JVPA 4X5WA 4YZFF 5EG6C 4LQFH 4S0SD 3UTTE 4ENEC 1WAAF 1P4LA 1H0DB 4OCRH 1E27A 3A0OA 5DGRA 1ORQA 3KG5A 2J88L 2E6JA 4NCDA 4PJ7E 3S5LB 1K2DB 4NKOB 1JNJA 1JWMB 3CDYA 4ZD3H 4JFXA 4YNYB 1Q0YL 5T1LB 2HG5A 4PBXA 1NDGB 4GMSH 2YBRB 5DLML 4NJAH 2FO1A 3C60C 1LP9A 2V6HA 7CGTA 3TP4A 2YUVA 3MO1B 5J3HD 1B6UA 5LQBL 4WUUD 3QT2A 2BY3A 1IL1B 3MBXH 3AY4C 3TA3B 2PYFB 5CEZD 4W6XB 3DXAE 4XAWH 1V5JA 1GGIH 1IAOB 1HKLH 1QQDA 2VDRL 4TUKL 5JHLL 4PV9B 1QBBA 1OPGH 2YD8A 4HIEA 4IOSD 3QA3A 5E6IA 4CADA 5BW7A 1WAAE 1AJ7L 1UM4H 3MRJA 2I26N 1A4JA 5ESAB 5C08D 4JZNB 4NQCA 2MHAA 3OKNA 1A6ZB 1QSEB 4OB5H 4QGTA 1QRND 2D7QA 4OCNC 5EO0A 2P24A 1OP3H 1UADC 4Z7OE 3WFHB 5I1EH 4RA3A 4V2CB 1W2KT 4U7KA 2QHRH 2SEBA 3WXWH 2DQCH 2OBGA 2DMBA 3QJFA 4R4FH 4DCQB 4H1LA 3MODH 5KVEL 4LSPH 1BQHB 5F7EL 4KUZL 3LKPB 1ZA6B 4AEIL 4ISVB 1XH3B 1E4XI 3QDMA 4EVNA 1LO4L 4AH2B 2K7PA 1FVCB 3RDTD 1NFDF 3SJVE 3QI9B 3W39B 5C0BD 3UJIL 1CK0L 4PJ8C 1CYGA 1S9VA 1F4HA 1I7TB 4NN7B 3W11D 3GRWA 3QQ9C 1JPTL 1IILE 5C6PB 2BVPA 3RPIA 1YC8A 1OTSD 5BRZE 4PG9B 3X3FH 4M7LL 2X4RA 4LLAA 4KHXL 4ZUWA 3QIWA 2GTZB 4HULB 3RL2B 3SKJH 3KJ4B 4KK5D 2WWKT 5IG7B 3TGXA 4XCEB 4KV5F 4TPRL 2AJVH 1CXLA 1T7VA 1ZLVH 4PRBA 4HWBH 5C07B 1D5IL 4PPTA 5D1QA 3A6CL 4ZSOB 2PYED 3LS4L 4YBQD 4NZJA 1PZUB 3U4BH 3RVXC 1PLGL 4HPOH 1U8PA 4YXKL 4RNRA 5CGMA 4WI6A 2CRZA 3PWVA 2H2SD 3WIHA 4RISH 1NLBH 3FFCA 5C8JB 1NC2B 2HN7A 3O0RH 2R2BB 2XKUA 2DJUA 4NC2B 5IF0A 3LY6A 5MI0B 1II4E 3H8NA 1AFVH 3B3IA 5GZOC 3GSQB 3OKLB 2YEZA 4FQPA 4YHOH 4HQQL 3ULUE 4ONHB 3CSYB 1HZHH 3NA9L 3UDWA 1B3JA 1F90H 4ODSL 2YA2A 1S9YB 4PY7B 1DR9A 3AUVA 4OAWA 2B0SL 5MEQB 2JKXA 4FQCL 2CDGA 4XRCB 4OI7A 3HAEB 2AJXH 4N8VG 4PB0H 3V6OC 2BVOA 1A6ZA 5J3HC 1ZS8A 5TQ0H 5T5FL 3NCFB 3G9AB 2HAZA 3NZ8B 5C0BE 5IFAL 5ANMA 1A7PH 2EEBA 3HB3C 5IMMB 3MBED 2XY2A 3TFKC 1FZMA 2DOCA 3B2VL 3L7EA 3MNVB 5IR1B 4HPYH 4KVNL 4HZLB 2PYEB 2AXHA 1CVRA 1JWSA 3MR9A 4U1MA 5DK2B 3BGAA 4OFVA 2NW2A 4XNMB 2A9ML 2ILLA 5H94A 1NC2A 3L6FA 3DROB 1T1XA 2H3NA 3ARED 5L7XH 2C3WA 2GKIA 3T0ED 4HAGA 5E5MB 1DQML 1YJDL 4Y2DC 4F33B 1KG0B 5EDXA 1U3HB 1W72A 4MQXC 1GL4B 3NFNB 2V2WA 3PV7A 5D7KD 4H25B 3ULUF 3G9VA 3D39D 1F3JB 5HYQB 3UXFA 3MRDB 4LLMA 2BVQA 4YHMH 3ROLA 3VXNA 4ZUWB 1UZ8B 2CMRL 4B5EA 2XACC 2YSSA 5BZDB 3QHFH 4APQB 5I75B 2FRGP 4JAMB 4HKJA 4MVBD 1YDPA 1QEWA 3L5WA 5C07A 1P69B 3QIUA 5E6ZA 5BV7H 4O9HL 4XVSH 4MJID 4PD4K 3JV4B 3GSWB 1NC4A 1VFUA 2MJWA 3I3EA 1EHAA 3QH3B 3TBSA 2DKSA 4QHNB 3D25A 5HI3D 3I3BA 3VCLA 4AY0A 4X6DE 2EICA 4L3EA 3KDMB 1OW0A 2NR6D 3CZJA 1FLTX 4UILH 1TQBB 3NTCH 1G9NL 1OGAD 1F13A 1M7IA 4LIQL 4LLWB 1A5FH 2YZ1A 4FQ2H 5HJ3A 5EOQH 2X6MA 2WK2A 3PGDA 2FJGA 3HC3L 4U1IB 4I3SH 1DDHA 4RX4D 5DEFB 5C08B 4YXLL 1S7XB 1BJMA 4NWTH 3DX8A 3RVUC 2V5YA 3IDXL 2ZCHL 2OTUB 5C08E 5EC2B 4OF5A 1ZT4B 1PW3A 3KHQA 3REWB 1A6WL 3EDJA 1NGYA 2E27H 2UZIH 3X17A 4JHAH 4UBDD 4E41E 3F8UB 3QEHB 4JM4H 3BH8B 1NL0L 3UTTD 4Z0BL 5E9DD 5KZCD 4P2RE 4KU1A 3UPRB 1S5IH 2OZ4A 1MY5A 1S5HA 3FFCE 4O2CB 3TCXA 3MQIA 1IZJA 1OWRM 2AGJH 1OSPH 3T0BA 1IFHH 1YY8A 1M4KA 2W0KA 4NNYA 4Q9RL 3ZT5A 2FO4A 4KMTL 1DE4A 1A2YB 3WUZA 5B8CC 3NABL 3MFFB 4XPHL 1D6VH 4IJ3B 4N68A 5ADOL 1CGTA 2VLKE 3PGFL 4ZO9A 2GEEA 3V4VH 4LVNB 3O4LD 3NPZB 4Y4KB 2X9WA 4NQEE 1HHKB 1JBJA 3VXUD 3I02B 4JDTL 1OGTA 1PKQA 2ESVE 3MC0A 4LSTH 3QBTB 1LDPH 3PNWA 5DT1L 5L88H 3HUJF 3MROA 4H20L 4N8VB 4FQXA 4HS3A 2GK2A 3BXNB 1CN4A 5I1HL 3P4NA 3PQYD 2FH8A 2J6EH 1ZANH 3QCVH 1K8IA 3DX7B 3MLSL 3O6MH 1IC7L 1NGPL 4KJPD 3PHQA 4DUXA 3S3PA 1AXTL 4FG6C 1JFQL 4GKZB 4LSRL 4JFZL 5LBSH 2R1WB 3QUKB 2ZSVA 3TNNA 5D2NC 3V8CA 1G7PB 3GJFB 4MNQD 4YPJA 1F3DJ 4IRSB 4Z9KB 4TVPD 2PW1A 4O9HH 4XVSL 2H26B 3LRSB 3P4MA 2AJSL 2GSIA 3OR7B 1JHKL 3FT2B 1R5WB 2W07A 1P53A 1CFNB 4RA0C 2ZSWA 5F9JB 2CLVA 2XZZA 3EJYD 2GAZA 5GS0H 1P7KB 1U8NB 3U9UB 2WNGA 1BZ7A 3P0VH 4F80A 5CGYD 4G9DA 2VDQL 1NCBH 2XTLA 4YO0B 4JFHD 1CR9L 4KY1H 4MJ5A 3UTPE 1FGNH 4X5WB 1GHFH 4IMKC 1Z0MA 4NRXA 2GSGA 4DKAA 4UOW0 3HI5H 4KROB 4XGZA 3VXQA 4O2FA 4YXLH 3D69B 3S37H 1MFAH 4JKPH 3PJSA 5CCKL 1J5OH 4LGPB 4OLWH 4RFNC 1CICD 2EDDA 1FSKB 2DLFH 2WWMC 3DVGA 3QDHA 4L4VE 4OLZH 2M1KA 1RZFH 4MXQD 5J06A 3W0WA 1CDUA 1MF2H 3MRKB 5IMOA 4ZPTA 4OZHA 5IW6B 2B5IB 3M17A 3ILQC 2OTPA 3G6JA 4K07A 5LQBH 3RNQA 5D1QC 2APWA 2XRAL 4JANA 4EZMA 4Y5YA 3ZDXE 3DURB 1R3HB 1G0XA 1P7QD 1DTUA 4ZFFB 5DURB 4H5SB 4XNZC 1MJ7H 4YR6B 5FA4B 4PBWD 2PNDA 3BKML 3MV7E 3NH7L 4BKLA 4YHPB 4BJLA 4MB4A 4NQDA 2Q3ZA 4YHKL 3ZKXC 5C6WH 5I1AA 1B90A 4P2OB 1J88A 4ZO7A 4PJBF 4PGZA 5GRJH 4M7KL 4C56A 3TBTB 4LL9A 3A6OA 3VXOA 1R24A 1WIPA 1ZTXH 3OG4B 4HFUH 4Y2DA 5DJXB 5KSBF 1FORH 1M7DB 5F3BA 4P2RA 1NUNB 1DBAL 4UQ2B 4U6VL 4YWGH 4ETYA 3QHZH 1J0IA 4JZNA 4HUNB 4NQCB 1FL3A 5HVFB 1BM3L 1J0YA 3VWKC 3OWEA 1JWUA 4ZOAA 1AGDB 1TZGH 1IVLA 1J8HA 5I74B 1WFTA 4IS6B 3TJEL 4GS7B 4LRIA 1DN0A 3WDIA 4CVZA 4M8QB 3KPPB 3ZT7A 2ITCB 3ARBD 4YDVA 4F57L 2DLGA 5GGTH 4KUZH 2ZUUA 3O9WC 4OKDA 1MNUL 4PRAA 1I3RA 4PJAE 3P30H 4S2SB 2AEWA 1RZ8B 4XP9L 4G6KL 3FMGH 3ZDXF 2IH1A 4ZYKA 1P5UA 3P77A 5I1LA 4TSCH 3RWDA 1WICA 2LAGB 4G7VH 3CSPA 4AM0A 1XCQA 2Q8BH 2DQIH 4BA8A 3GRWL 1R0AL 1U95A 2X2YA 4XPTL 4KHXH 4CVXA 2CRMA 3QO0A 5ITBH 4C56D 5KSAC 3HC0B 2V5SA 4G7YH 3OAUH 3C60D 3P0VL 4Z76B 2XA8L 2DQJH 4P2RD 4LU5L 2BHUA 3FZUC 1F90L 3N9GL 1FCGA 2VSCA 1ES0A 3A6CH 1J11A 3JV6B 4W6YB 1CD9B 2L7UA 4G43B 4CJ0A 4EI5C 3MV8A 2A73B 5T3XD 4YIQB 2ATPA 3O2VL 4OZHF 5E8EB 1X4ZA 4U1KB 3RIAF 3U7AA 4Y5XB 2WWMD 3I2CL 1IMHC 4KFZC 5FGBC 4PJAF 4HXBL 1T0MB 1V8HA 4WTZG 2D7TH 1AHWC 1CGUA 4ZNEA 4A6YL 4KK6D 3BPCB 5EB9A 2DJ4A 1WFOA 2N7AA 5C8JA 1H3WM 4ZUSA 1DQTA 4ODVH 5GS1A 1DBKH 3X3GL 3GMLA 1ZVYA 3U48A 3L1OH 1MCJA 1C1EH 2YEZB 5D8JH 4JO2H 5BJTB 4U33A 3H42L 4LVOB 4OZ4A 5ANMB 1I1YB 3GMMB 3L3DB 4MSWB 4U6HB 3WCYA 5LWYL 4FXKA 4D3CL 4QWWD 1B2WL 3S4SB 3CFEA 4GXUN 2CIKA 2R1YA 3V5DA 2QV2A 3OF6D 1NQBA 1JGVH 4LGRB 4KDVA 1TETH 1PZ5B 2KDGA 2XWTA 4XPBL 3QHFL 2XQBH 1UCBL 4FN0A 3RGVB 4Z7WF 2F58H 3QEQE 4GOSA 1A1NB 1FORL 4POUB 4OZHE 4F33A 3KPSA 3WJJA 4NM4L 3U83A 4WW2C 3MOBH 5DVKA 1ND0B 4MNHB 2X70A 4WFEE 3DRTA 4MA3A 3U4EB 2FH6A 1XFPA 5L7XL 4NNXB 4GS7C 2F5BL 2RCSH 4ERSL 1Q8MA 5I1IH 2X5PA 1ZVSA 5LXGL 4R4NC 4HJJH 4ZQKA 4NQDE 5D7IB 2D03H 4EI5D 1T7ZA 1V3LA 5IB4A 3H0TA 3HPLB 1FVEB 4F2MA 4JCLA 3HE7D 1WIOA 2HH0L 2V5RA 1D6EB 5EN2B 4I2XE 4C57C 3QO0B 4PLJC 3K2UH 3L3HA 5HVGB 3IAQA 4WW2F 2VUYA 3ULUL 2BRRH 1HHHA 4G80B 3U6RA 5AD0B 2WUCH 3OGCA 2XG5A 3AS3A 5AG8A 5IGXH 3FOMB 3SKMA 4W68A 2R39A 4OD1H 1HKLL 3BH9B 2A77H 4S11A 4HIXH 5FDWA 3F5WA 1KCSL 2R0WH 4PJAA 3MRQA 4GLRI 1OOAA 1FH5L 4BSWB 2MHAB 3GMRB 1RURL 3FAXA 4GW5B 1HILB 2ORBH 5LCVH 2C1OA 3RWGB 1MHHA 3TEUA 3V4UH 3N50A 4FABL 2NXZC 1UXSB 3O3DB 5BQ7A 2HFGH 4X99B 4HUVB 3T0AA 4CN4A 1JV5B 1UCTA 2GUOA 4PRHE 1N4XL 3U0TB 4KPHL 4Y19E 4I2XB 3B8YA 2R0LH 3SGEI 1LWRA 3AAZA 3PWPE 1NAMB 1FBIL 5D96C 5F7EH 3IJHA 3LDBB 3QI9A 5JQ6L 2VL4A 4MJIA 3EOTL 2HTLD 3VXRB 3QQ4A 1QBMH 1YY8B 3K8MA 4NZTL 1OL0A 1C1EL 4K3JL 1N6VA 5IV2B 3MV8E 2B1AH 4KUCD 4ZXBA 5I0DA 3QXAA 1H3GA 4G80A 1JNLH 2UYLA 5IHUL 4U7MA 5FF6B 2F5AL 3EBAA 4Y4KA 4IHOB 5IROC 2EO1A 4LLYA 1JGUH 1PJ9A 3V7MA 1Z9SA 4OIIL 4KZEL 5BS0E 5J9PB 1KNOA 1HH9A 1IGYB 3S7GA 3C8KB 1HI6B 3VXSA 5IJKC 3HZKA 3HNVL 4YDJB 5T3ZL 1H8OA 4PP2B 2VXVL 3NCBB 2ICWJ 3KS0J 1WQVT 2HN7B 4I5BB 3WDJA 4BELD 4NNPL 4XNYL 3PWVB 4LLVB 4U3CA 4YFDB 1MPAH 4JZOB 4P57B 1CFTB 5IMLB 1C7TA 3U9PL 1D6EA 4FQIL 4FTVD 3V5HA 4ERSH 5I1IL 1X44A 1BX2B 5GIRB 3QNYB 4F7TA 8FABA 4NBZB 4R96B 5EC1A 4LHJB 1V7ML 3SBWC 3AREB 1AGFB 5FYLE 2E9WA 5E2WL 2X4PB 3BIKA 1LD9B 2YPLE 1MAKA 1OAZL 3LQAC 3NN8A 4HUUB 5E99L 1S8DB 3TVMB 4P3DB 1KTLA 3RX7A 5B22A 3KPSE 4UT9H 5ITFA 4QNPF 3DX6B 4Z7NE 1A7OH 3DUHA 2OJEB 2B5IC 4X9IA 5E2VH 4YH6A 3O6FD 4HIJB 5EOTB 4PRIE 1I3UA 1MCBA 3G04A 3WJLA 2DQUH 1OF2A 1E28B 5TE6H 3L3GB 3VXQB 1Y0LB 5EBLB 4H8WC 1HWGB 4LSQH 5ESVA 1G7HA 2XZAL 4JLRB 5BOPA 4KRPB 3QUZA 3OKDB 4MGXA 4OQTL 1SMOA 4HIHA 2J12B 5T1DL 3U0TA 12E8H 2NTFB 3MUJA 4KVCH 3DV6B 2WBJC 2G60L 4NO3B 1SJHB 4JDVA 4Y5VC 5DUBB 1YNKH 4S1QL 1GRWA 4P4RB 4I0PA 4POYA 4G8GB 5DJYB 3T3MF 1EFXB 4OCLC 1JYWA 5DJ2B 2FGWL 1N4XH 2JCCA 1HSAA 4MCYB 3DVFA 1MFAL 4JKPL 3VWKB 1ZLVK 3D69A 4OV6F 2IBZX 3DYMA 4HJGB 1MOEA 1K4DA 5CSZA 3PJSB 3MCLH 2WBJD 3DVGB 5HVHB 1KCUL 2AXGB 3LQZB 2FJFB 1ULVA 5HYSG 2GT9A 1PEZA 3MGOA 4P59H 3CSBA 4APQC 1A6TB 2QSCL 3HE6C 2VN4A 5DJXA 3IJYB 2F15A 4Y19A 4FQQB 2CJUL 4KZEH 4Y4HA 4G6KH 4LFHG 5DRWA 5KSUA 5C09A 4BZ1L 4KDTA 5MEPB 4NBXB 3IGAB 3PV6A 1RHHB 4L3EB 5M94B 3GKZA 2FB4L 4O02L 1TQCB 1MAMH 2FDBP 5JHDE 1J1OH 7FABL 5EZIL 4X4XA 1EUTA 1PEWA 2XV6B 4NSKA 4A6YB 1MVUA 1NANI 3BJLA 4KH2A 1T89C 1OVZA 3G5ZA 4PD4J 5CKGA 4QY8A 3Q6FA 3OKOB 4M8VA 4XB7A 2YPLB 4PGBA 4WIQA 4YBQC 5D2LF 5DO2C 1PSKH 2CKBL 4GRLA 3BN9D 3ZE1E 2AK4E 3SJVD 5CHNA 1BD2A 4EDWH 2W65B 3EOAB 5IESH 3BP6A 4PJ9C 2AXGA 3V52L 4RFNB 4PRHD 3T8XB 5EFIB 4HG4J 2JIXD 4OZIB 2HA1A 4QRPE 2YD7A 5DF0A 3IDIA 3PWNA 3OPZL 2AI0H 5B38B 1FO0A 3GJFH 5FB8A 1JIBA 1F97A 1ZMYA 4DTGH 5CJQH 4MQXD 5E2JA 3GZKA 4MNQB 4HF5L 5AWNH 1F42A 4CVXB 4BSVA 4IRJB 4DVRH 1KIRA 1A2YA 3HMXL 4XXDB 3MRNB 3IAGC 4WI9A 4HMEA 4QHUB 4I0PB 1U91A 4L3ED 3WIFB 5D72H 1MCPL 2JELL 6CGTA 2F8XC 2Z31B 3VFGH 4UINH 5I17A 4NQCD 1K4DB 3SE8L 4R90L 2ARJB 2W9LA 3OXRB 2VXSH 2W60A 4LAJH 2E5EA 4PGCB 2AJVL 3S5LA 4HS3B 1KXTB 5I1KH 5EUOB 1CU4H 2DQGL 3IU4L 5F44A 1AQKL 5AYQA 3VFNA 3M8OH 2Y7QA 1MQ8A 3V6OE 5IFJA 4UOJA 4Q6IC 4ODVL 2EXYC 3G6DL 4JFEE 3MLSH 1WZKA 1NCAH 2EDNA 4ZNCD 1GPOH 1I7ZA 5GGQH 2LU7A 4OFKA 1JPGB 1MCRA 1VFBA 2ADIB 4HXAL 4NCC1 2WAHA 5IUSA 3QJHA 3RA7L 1IL1A 5CAYB 1ZGLM 4D3CH 1UH3A 2VDLH 1T0PB 3D9AH 1S7RB 5C0CB 2A74A 3ZTNL 3VD7A 4WHCA 3TN0B 1SEQH 3U9UA 3ZE1F 3TH4T 4ACPA 1YEHL 5J1AA 1U2HA 1IKNA 1YN6B 3BO8B 1A6PA 4L5FL 4WRLA 1KB5L 3ZE0F 2XQBL 3G5YA 4D2NA 1UCBH 3ULUH 2IPTL 4U3HA 2D7NA 5I76A 3U2SB 3CU1A 4ZTOL 2B4CH 5DJZB 3BYTA 4PJDB 1AGCA 1NEZG 2R9HD 3U4BL 4HFWA 1PLGH 1INDH 2AJXL 1JMXA 4TULH 2CD0A 3D6GA 1JPSH 1OSZB 4RRPG 4I77H 3ARTA 3FHAA 2RFXA 5DK0A 1TTFA 1GGCH 5I18L 1FH5H 4MD5A 1ZLWK 2IH3B 4TSAL 4NZRH 4KJYB 5HGDA 3QUML 3ZKND 3BSZH 4Z7QF 2NY4C 5ACLA 4OM1L 1U3HC 3OJMB 3QWOA 2P8PA 1U2CA 3LKQB 2VISA 3RRQA 4PJEB 1JPGA 4IRJA 1EBAA 3VG0H 2WUCL 2GW5A 2CLZA 1JMZA 1VESA 3ARBA 5BMFH 3K2MC 5GGVY 4YR6A 4JRYA 4J2XA 3VH8A 3E8UH 1I85C 4KK6C 3FCTB 2BP3A 2AJ3A 4QWWC 5DHVB 3QPQD 3NH7H 1RPQA 4CGTA 2WSKA 4HKZA 2AK4A 5EO1B 4PTTA 2IMMA 5TDNA 3GMOB 2XQYK 2GTWB 3GJFK 5LGJB 5DD0H 3FT4B 3QIBC 1U8OA 1PG7H 2COQA 2P49B 4ZSOA 4RSVA 5JHDD 4GW1A 1UA6L 2YC1A 1P4BH 1FVDB 1EX0A 2FEDC 4JPWL 3TF7C 2VR9A 2QSTA 3RGVC 3NFNA 5F6IC 5KS9F 4L8CB 4ZXBD 4LMQE 4XX1G 3CFCL 1K2DA 4QNPE 3QPQC 2ZCKL 4FNLH 1NC2D 3KR3H 3QPXH 4X7DC 1KPVB 1PFCA 4LLUB 4G42B 1NBZA 2ADIA 3B2UD 3FQUB 4LCCA 5HXMA 1EEQA 3G5XA 1QVOA 1MLBA 3QIBD 5D7JB 5HHOA 5L8JB 5F21B 4V1DD 5TDOB 4LKXA 4Z77A 1EAPB 1MCWM 3BZ4B 3EFDL 2VLRD 2QBWA 4XC3H 4XVUD 1YQVL 5DFVC 5B39B 4YDJA 4EI6A 1KELH 4UV4L 1YEKH 3VXNB 2EDKA 5EA0H 1KXQE 4OIIH 3DX9B 1WT5C 1TZIA 5I8EA 1A21A 4JFEA 3LSOA 3TC9A 2PW2B 4XVTH 3BQUC 4JFOB 4WU7B 3BAEL 2JJTA 2ZOLA 5F93C 5MEND 1BLNA 4AQOA 3PWLA 1N3NB 5TDPA 4YUEL 5C0IA 2O93L 3VXSB 1IBGL 3INUH 5EZJB 2AXJA 2YKLH 4R7NA 3IFLH 3PWUA 4JY4A 5DVLA 4QF1B 4M6MH 2NNAA 4ZUSB 1IQWH 4ZFZA 3QDME 3WFDH 4KI5F 3MYZA 4EIZC 4P46D 4QHLA 5GHWL 1A6VH 3IDNA 4NQUA 3O4LB 2ZCHH 4JQXA 5HD8D 3GI9H 3QFJB 4NRYA 5FYKE 3GDBA 1ZWIA 2H32A 3EYQC 1BQHG 4EUPA 4GH7B 3IFNH 1SM3L 1IGML 3STLB 1BAFH 3VG0L 4NO0B 1GSMA 4OLXL 4RBPK 2ZJSH 5K9KB 3MJ8B 4NHCH 2YD6A 2X4RB 3WNOA 1B2WH 4ODBD 4MAUL 1QUNA 1U58B 2VITA 3JTSA 3R0NA 3I02A 2IANA 3ZL4H 4XPGH 1AXTH 3VA2C 5DR5L 4HMDA 1JGLL 5IW1B 2YWYA 1KT2B 2K9UA 1G9MC 1TJIH 3FO2B 1OAUH 1YNKL 4S1QH 4KKCD 1D5BB 4I8DA 4C54A 1HXMA 2AJSH 1DCLA 4Y2OA 3AMLA 5BXFA 5JMRA 2LU3A 1XMWA 1CICC 1KPRA 2DTMH 4I3RL 1BGXL 4OZFG 3RZCD 3FJTA 3BZFA 3OB0H 5EU3A 4OCXL 5ADPL 3E6HA 1I9RH 4JVUA 2FR4B 2I5YL 1G9NC 1FAIL 3EKCA 4M7LT 1CL7H 4HCRA 1ZANL 1FV1A 4LVHB 4XNUL 3VRLE 3O6KL 4FQXB 2NY6B 1A02N 1IM9D 3QXDA 5F3HA 3L3KB 4OKVA 3CZFB 1TJGH 5HSFA 3T65A 1A1MB 4NO0D 5B8CA 1QLFA 3BW9B 5I8KL 5TPWL 4S0TD 5BW7C 3F6IA 1J05A 2A9NH 2QQKH 3SKJL 3SOBL 1JHKH 4ODHH 4MS8C 1FFNA 1H9VA 1KTDA 4I48A 1N3NA 5KVGH 4CADB 5FA3A 4K2UL 1F02I 3VFTA 5ILTL 4JO4L 4M43H 2FLRT 1YYLH 2FATL 1YJDC 4FOMA 1DEEB 1DBMH 3MR9B 4U1MB 5TF1H 1GHFL 2MCPH 2HFFA 2NXZB 3VI4F 3L6FB 3CVIL 1YY9C 1ZA6A 5FIEA 3OKOA 1KCRL 1QO3A 3VFUA 3S6CA 4ZAKC 3WN5B 2XTJB 2P5WD 4EN3C 1QRNE 5DO2D 4DK6A 5HI4C 4PJGE 4F9PC 3OBAA 4KTEL 3SO3C 1YPZE 3FQWA 3S36X 4MAYD 3MRIA 1QFPA 3QUKA 2B1AL 3EYVB 5F7UA 5GRWA 2YUXA 4HLZG 5EUOE 4PGDA 2PXYC 4EDXB 1IGYA 1BQLL 3UTTB 4MLIA 4MWFB 3S3JA 1GJIA 1CT8A 3GSUB 1WCQA 1U8JB 3RU8L 4M62H 1A7PL 1CCZA 1EXUB 1KFAH 2FL5B 4J3WA 2IQAA 4NKMB 3J7HA 4XCYA 2IBZY 3VFNB 2I9TB 5CWSB 5L9DL 1QBLH 4J23A 1XR8B 3ESUF 3GIVB 3NZHH 1HK6A 5IEHB 3D2UB 4IEFB 1SMAA 5FEBA 1RZ8A 1V05A 2YRZA 5HDBF 5C08A 4PJ8A 4BQ9A 2YPVH 4AEHL 5HHVH 5CJXA 1T4KA 3ARUA 5FHBL 4QRSB 3S36L 5IWLA 4GXVL 3N9GH 4E41A 3T77B 3PDOB 2XYCA 3VGAC 1SEBA 1ONQB 1OAXL 1T5XB 3C6LB 5D1ZA 4WW1A 4OI8A 4KTYA 1DL7H 1EEUA 3OF6A 5EOTA 4K3DL 2WW8A 4K8RC 3FO9B 3DMMD 1TLKA 4JKWA 5IB2A 3VWJD 1X7QB 2CDFA 3QDMD 5E08H 3T08A 4NZDA 3T2NH 5TPWH 5I8KH 4G7VL 2VKWA 1I7RA 1WCBA 4LDEB 3FB7A 4G6FD 3LHPH 3QDJB 2BVOB 2BVTA 1CT8B 4PJDA 4KJQD 3SDCD 4JKKA 1MRDH 1VHPA 2BNQE 5D70H 3CDCA 4G7YL 3EW3B 4AM0B 3QDGB 1SJHA 4JDVB 3L1OL 5EOCH 3IXAB 3WFCL 4F8QA 5A2JH 4X98A 2IH3A 5J1AB 1KN4L 2PF6A 3I50L 1Z9LA 5IM7B 1U8IB 3ARDC 3NGBC 4J3XA 4NUGH 2IWGA 5GISH 1C08A 3QWRD 1PKOA 4FZ8L 4WFGE 4OZIF 1JF1B 4ZUVB 1E0OB 1AGCB 1DN0B 1A0QL 1S7QB 3IDYC 1MI5A 3MV8B 3UTSA 4DEPC 5HGAA 3BP4B 4J6RL 3BSZL 5I0ZA 4HHAA 1BEYH 4GW4A 2UZIL 2CK0L 4XCCL 1W0WB 5FOJA 4KXZH 1T1WB 4JFXB 4YNYA 5I6XB 3VXUE 2CUIA 2RIKA 5MEOB 5HDLA 3LKQA 1X7QA 4BYHA 3QPXL 3F62A 1AKJA 4OT1L 2RCSL 4MZ3A 5HDBE 1QSVA 3M1BA 4LCIL 5HDQH 5E4EB 3WE6B 1RI8A 1WBZB 3E8UL 3KLHD 4G8GE 2C3VA 3PWJA 1N5YL 4IIQC 3VGEA 2NY5C 4MA7L 3C5JA 3C5ZC 1FNLA 1CK0H 1HHIB 3QG7H 1WFUA 1TJHH 1AD9B 1R5IB 5ADOH 3BKYL 4X7CC 3WS3B 1NJ9A 4NSKB 2F53D 2P1YA 1M7IB 1DQDL 5TDNB 5KVFH 1FNSL 5HHQB 4PTUA 3ROOB 3B9VA 3BZEB 3RWEB 1YPZA 5KN5B 1UGNA 2IPUK 1XGYL 4TRPL 3G5XB 3U0WH 2PTVA 2LV4A 2X4NB 3MZTA 2A77L 3OKEA 4M7JL 1I7TA 3G08B 2C7UB 2EC8A 2IG2H 1C5CL 2IFGA 1MFBL 1RQ5A 4GQ9H 2HTLC 1GC1H 1OAYH 3EDKA 5HI3C 1I75A 3WIHH 4JVWA 2V17L 4O5LH 1DL7L 1I8IB 4DN3H 3QUYA 3L5XH 4S10A 3O2DL 3QJFB 5CJBA 4DCQA 4HH9A 4WUUB 5EPMB 1U41A 3MYJB 3WFZA 5HTSA 1AHWB 1JUFB 5J6GA 1QKZL 2VLRB 1RJYB 4Q7DA 5INCB 2AEQH 1EJOL 1CGVA 4FXKB 3T4YA 4D0CB 3BGMA 1EAPA 3HR5B 4PJ5A 1TVHB 4QEGA 4AQ1B 5IB5A 4OF7A 1DE4B 2X89A 2GYSA 1ZT1B 3GB7A 4HBCH 1W0VA 3B5HA 5C0ND 3WJJC 1YNTB 2HWZH 1T20B 2AKRA 5EOCL 1UZ6F 4O58H 4XBPA 4C56B 5MI0C 3N06B 3S98A 3R8QA 1BBDH 3QNXB 2VERN 3V4PL 2W60B 4PGCA 1AC0A 3H3BC 1QLRB 3GNML 1BLNB 1I1RA 2J7LA 1KF9B 3TO4C 1JGUL 4NRYB 4MJIB 2NTSP 4CUCA 2ICWA 5E8DH 4FXGA 1YMMB 3D0LB 1QG3A 5L0QC 1HYRC 2EXWD 2DQGH 3T0EE 3KLSA 2BNRB 3R0MA 1ZVSB 1BFVL 1JHLH 2R2BA 3PL6C 3NBNA 5T3ZH 2EYSB 1EMTH 5BOZG 1BP3B 4XVJL 3MJ6A 3TYFB 3SJVA 3TESA 2HKFL 4U49A 1NCAL 1NGWA 5JQ6H 2DTML 2X7LB 3SE9H 1MHCA 5C0JA 4P9ML 2Q87A 4OT1H 5HGHA 4L4VD 2J2ZA 3LKSA 3MNWA 4QXTB 3O3BB 4DW2H 1RIVH 4W6WB 3VXRA 1YN6A 5IHUH 4M5YH 2X44D 4YDKL 4PLJD 2F5AH 3ARGB 3B9DA 3T3PE 4MYWB 3MBEA 3C5ZB 3KWWB 1XCTB 5KS9B 1S9YA 1SEQL 3G6JF 3SKOB 2F54D 2H3NB 2A6IB 1F11A 5EU7E 5I30H 5K33A 3ARFB 1K4CA 1R3LA 1VGKA 3BUYA 3GBLA 4QRTB 5A16A 3FO2A 3JTTA 4XTRC 3D3VA 2IALB 5FUCE 2G75B 4A2LA 3HE7A 4TUOB 3MRDA 1RVFH 1UB6A 2LAAA 1A3QA 2E7MA 1ADQL 5SX4I 2OI9C 1AC6A 2Y06L 3DVNA 2I07A 4HIIA 3OX8A 1FIGH 4MB3A 4ETQB 2V17H 4LSVL 3KYKL 3EO1B 2EYSA 1YDPB 2IADA 2IFFH 3MOAL 4L9LB 1EZVY 3DROA 3L5XL 1CFTA 3OTTA 3TIEA 3OV6A 3ZKMD 3VXUB 4IM8A 2VIRB 2J8UF 1I1AB 2HTKC 4TVPL 2VJXA 1FNEA 3ULUC 4XZUA 4LHUD 4PREA 3RWFB 1T7XA 4F15B 1HNGA 3F7PC 3KJ6H 3WFBL 3UAJD 4R4BB 4X7SL 5DK3A 2L7JA 5IQ7H 2VDRH 1LO2H 1MWAH 1G1YA 4TUKH 5E70A 1Q9WB 3G6AA 4HKXB 4Z0BH 1S7UA 4HUXA 5A2LH 4MD0A 1T2XA 2XWJA 1L0XA 1NFIA 3TVMC 4P99A 1O7SA 1KLGA 5E8OA 1JZ7A 1I8MB 3EOBB 2BXZA 2H2PC 3MV11 1CI5A 4CVWA 5TF1L 5DSCB 4MAYA 5ESVB 1GZPA 2J8UB 2VDKH 3FOLA 3G5VB 2VWEE 1J1XH 4PJ5E 4EKXA 4GRMB 2XA3A 5HJ3B 2XKNB 4OI9A 4R8WH 4RAUB 4PLKC 1C5DB 3T4AB 3HPLA 5T5NG 2J4WL 3SY0B 1RUAL 5JDSA 4YPGA 3MCLL 2IEPA 2P5WE 1MQKL 1RZKH 5DJ6A 3UZQA 3UTZA 3BH8A 4GKNA 1FFOB 5C92A 1MSPA 1MH5B 2ZNWA 1NBVL 3D39A 3CMGA 2FYYB 4PFEA 2YUWA 1CLOL 1BBJA 3GMPA 3BH9A 3CCHA 3JTTB 4BZYA 3B9EA 1IGTA 4K9EH 1VEMA 4L3EE 1C8PA 1U3YA 4LHQB 1IT9L 1UJ3B 2N1KA 2DS4A 3MGTB 3ZKXB 2R4RL 4P0DA 4ZFZB 3EOBA 5EO0B 3EHBD 3FQRA 5EH1A 3FFCD 3OAYK 3PXHA 4XP4H 4ZUUA 3ARDB 1XF4B 1GZPB 2J8UA 3VI4E 2E9JA 3X11B 2EE9A 2JB5L 4G8GD 1PQZB 1P4IL 1S78C 2VLJB 5KJRL 5ID1A 4JY5H 5F71A 1L0QA 1UVQA 1IEHA 2G2RA 2W9DL 4G3YH 1P2CA 2V7HB 3SCMD 1WCBB 2OJZL 1RZ7H 2JB6A 2O5YH 3KPRA 2H26A 2OTWB 4M6OH 3E3QC 3NFSL 3HE6A 1S9KC 4TTDC 1MJ8L 4P4KC 5K9KA 3QXAB 5T1LD 1K6QH 3EO9H 2OXGA 4O4YH 3GSOB 3KJ6L 1IGIH 2K3TA 2V9TA 4ELMF 4KJWD 5BS0A 1UWEL 5JMOC 5E8NA 5GPRA 1A7BA 1RZGB 5J6HB 2B0SH 4N0CC 5C2BL 4HF5H 5IQ7L 3L9RA 4DZBB 4XI5D 1R5WA 1RZJL 5FHAH 3D85B 4YX2L 1I7RB 4APQD 1HH9B 3WXVH 4WW2A 4F58L 4K55A 1P7KA 1X5YA 2R0KH 2G9HB 2MSPA 1T7WA 5F70A 4BQBA 4F7PA 5DEGA 2VAAB 1KN4H 2PYEA 1Z2KA 4X4XB 3GK8H 1ZLSH 1IGCH 4ZPVB 3OG6B 4Z0XB 4KRPD 1O0VA 4LHUA 4J3OC 2ESVA 3SDDC 1S9WA 5IB1B 3FFCB 2RGSA 1CLZL 1GIGL 1KCVL 4XP1L 1BGXH 2IQ9L 3ARDD 4I3RH 4TNWF 5GGRB 1HKFA 3SE3A 4F7TB 3WHE0 3SHSA 2YPLA 4PGBB 1PYWB 4FQLH 5H35B 3MRLB 1NFDE 3WKNA 3M8OL 2P8LB 3U46B 2VLRE 3O2WH 1KSRA 2NMSA 3MRPB 2D31A 4F7MA 5M7QA 4OLVL 1RJZB 2C3XA 2I9LB 4BKLB 3H9ZA 1ZLUK 2FIKB 4ZTPH 1X5GA 2Y36L 1A1MA 5B8CB 4JEGB 5FYLL 4P3WA 5KSVB 4Y5YB 1IC4L 1R3HA 4JFFB 1LK3H 3BJ91 4NZRL 3VMPA 3FFDB 5GSRA 4K7PX 1EH9A 5DA4A 1DEDA 4ODHL 5CEYB 5CBEB 1FO0L 1UM6H 3KXFD 1RK1B 3QG7L 2IAND 3S88L 1WZ1H 4JG0H 3U7YH 1IAKA 5I1AB 4I0PD 3RX8A 5KG9A 2IPTH 4IOFC 1C7SA 3QZWG 5D1XB 1G9NH 3AU1A 1XGYH 2Z31A 1R5IA 5FGSA 4KKLC 1EA9C 2CUHA 4MJ4A 2VOTA 4NYLA 3FQTA 4LVNC 2Z92B 1P7HL 1AP2B 3VMNA 2XA8H 4S1DD 4YHNB 1RUML 3F58H 3ULVF 3RWCB 1AO7E 2PCPB 4WV1B 2EDXA 1E4WL 4OF0A 3T04D 3ES6A 3LEXB 3NFPB 1E27B 5I6XC 2JIXB 5CP3A 1N0XL 3EJJX 3HLAA 5EBGA 3OJVC 2DMKA 5E9DA 4PRAB 4FQJH 4Q6YA 2VYRE 1N6UA 1J0ZA 3GB7B 5GS2H 5I74C 3G6JE 1MCOH 5BZDA 4OD2A 1X5XA 1A6AB 2CIIB 4WJ5B 3CFCH 3DSFH 4G6JH 4KJYA 5DURD 1YEIL 4N0FA 4WNQA 4RMSA 1OAKL 3ARVA 5DRNA 4HH9B 4WUUA 5EPMA 5C09E 2R8SL 5LGJA 1FP5A 4LCUA 5MP6L 4LP4A 5I1LB 4AEIH 1DBKL 4G43A 4HS6B 2UUDK 1VGEH 4M1GH 5FYJH 4HBCL 5CS7A 4OFYA 1DSFH 3CDGB 3GI8L 3VGHA 4PYHA 2ID5A 3D25B 4JPKH 3B9AA 4RGMB 4JO2L 5GRZA 2KBGA 3H42H 3AS0A 4WENB 3QQNA 3WFHA 3GBNL 3C9NA 4LEXL 2YK1H 4JG1L 3ZSTA 4POZC 3I6GA 3RIFK 3N85H 4YHYC 3QI9C 4DK3A 1KLFA 4OUOA 4EVNB 2NY5H 1RU9H 4JGMA 2GK0A 3CFDA 4XPBH 1J8HE 1MFCH 3FO1A 1FZOA 3EIFA 2P7TA 3O4OB 3MXVH 4ZS6D 4WV1A 1BD2E 3MX0A 4RQQB 1HCVA 4F9LA 2UWEA 1S9VB 2PETA 2V5TA 3E2HB 1I3GL 5L8LB 4QRPA 2P8MA 4YXKH 2BFVH 2V7NB 3CAFA 3GBMH 4WCYH 2DIBA 3UPRA 3VE0B 4NKIH 1L6XA 5E94B 1O7VA 1ITBB 4LCCB 3RL2A 4YHZL 1BJ1J 2A6JB 3OJ2C 3VFOB 5L2KD 3UTSD 1S5HB 1WT5A 3RVWC 4U0RC 1J18A 1MUJA 4F15C 1XZ0B 3O3BA 4WO4D 3R1GL 4GRWF 5GS2D 1E4XL 3CFEB 4YAQA 2V2TB 1NFDA 4XNXH 4ONGL 1XGUA 1WZLA 4JGUA 4WVRA 1HZHL 2ZG1A 3NACL 2Z92A 4DKEH 4X9FA 3STZB 4UQ3B 1N64L 3QDGE 2E7HA 1TPXB 2BNQB 3WUWB 1Y6NR 5CEZE 1A7RL 2FD6L 4QRTA 4OCWL 4PB0L 4MXWH 4Q58C 5D9SB 2EDWA 3EDEA 4MHHI 3QCTL 2F53A 4OZFB 3QFDB 1X6NA 4X9GA 5SV3A 4E42A 1FNEB 3P4NB 4LSVH 4GO6B 4H88L 2A1WL 4U1LA 4G42A 2X9XA 1CDJA 3MRHA 4AEEA 3RVXD 3FOMA 1OAUL 3PHQB 4FQJL 4QTHB 3CNKA 2E7CA 2J5LC 3TZVA 5JOEA 4XWGH 3X14B 5KOMC 3OAZK 4RFEA 5JLZA 1QR1A 5JPNB 2C4FT 3OPZH 4F9LC 3VU2A 2AK4D 4PJHA 5EN2A 1DP0A 1AQDA 1DUZB 2A74B 1VGEL 3RWGA 1WUNT 3EOTH 3H7LA 3SDAC 4GRLD 5A3ID 4ODTH 1QFUL 2KQNA 2MNUA 3TBVA 1IM9B 2N56A 2PKDA 5C0CD 5TE4H 4M7KH 3ILPB 2F19L 4MD4B 2PO6A 4FQ1L 5JO5A 3UYRL 1Z0NA 1WISA 5FGRA 4HV8A 3QHZL 3TIDB 3V7AE 4XVUC 2YPKB 1NMCC 3BP7A 4LKCB 3DXAB 3OR6B 4UDUA 3U7WH 1ACYH 2Y1VA 4QF1A 5ILTH 5HY9A 3D48R 2XFXB 1XGQA 3K7UA 4NBYB 4U1LB 1EO8L 1RJLA 5GGSY 2KKQA 4JAMA 2VDNL 4DKFH 3A6BH 4I2XA 1CD1A 1CZ8L 1MUJB 5IQ9B 1XGPB 1T80A 1DBJL 3S34H 3G6JB 2F74B 1DANT 5F72S 3I85A 2M8XA 1ZHNA 4L3CA 4KTDL 3TO4D 1ZGLB 2Q8BL 5KAQF 1CICB 4WGVB 1CLOH 1P84J 3QQ9D 4UZGA 3R8BB 1QFOA 5JXED 2CSPA 4M6OL 5DS8B 1MH5A 1T20A 4LLWA 4XNXL 5FO7A 1LEKA 4OIAA 4TN9A 5AYUL 3KPQB 2EDFA 4ZSOE 5BO1H 3X11A 1LE9A 3EJZC 4M43L 2IGFL 5DZOA 1XF3A 2Q1EA 4WGWB 2F54B 5FUZL 5IK3B 3EJZD 5DYOB 5FA3B 1E4KA 3UYOD 4KMQA 5FECA 4TULL 3RZWA 2XIDA 4MXWL 4KAQL 1G6VK 3F7YA 1MY7A 2R2EB 4PJ9A 3RGVD 3ULVD 4OV5B 5B3JE 1XIWD 5DHXB 2MQ3A 3WHXB 1Q0YH 4QRUA 4JM2A 3MJGX 1SYVB 5IFJB 4K9EC 1I9EA 1KGCD 4XCNB 2OYPA 4Z5RA 5F1IA 3ARRA 1Q72H 2A0LC 1NGWB 2DF3A 5E6YA 1Q9KA 4C55A 3KNBA 4KDTC 5DRZA 5F88A 1QVOB 1EIBA 1VFBB 4HUUA 3RIAK 1FPTL 4NHUA 2VDML 3L3KA 2X09A 3L95A 1NGXB 4H20H 5CD3B 1IAIH 4K8RD 4TSBH 3WO4C 1EHLL 2XN9A 3WO3B 1EHXA 4UDTA 3KPLA 2XG4A 4OLVH 5HPMB 2PO6B 3WNNA 1DQQA 5GGRA 4HS8H 3VXSE 3L3IA 1FZJA 1I9IH 4R3SB 1N2RA 1AJ7H 5E56A 4PY8J 3K81A 4U1GC 5C0AB 3LN4A 5EU6E 5F9WC 1UG9A 3VXMB 1JYNA 3IDMB 4MNHA