4LBEB

Structure of kcsa with r122a mutation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeB01
1G7LA 4A6YH 4FTVB 1A7RH 3LKSA 2WLZA 1KCUL 4LQFL 4N1EA 2PYFA 3JV4A 5EU6A 1RK0A 1I3GH 5DMGD 2LU4A 4YHYC 4WO4A 4X5XB 1QRND 4YAQB 4Z78B 2PTTA 4NSKA 5DZLA 4I18B 1XGTA 2NY2C 2ATKA 1S7WB 3L5XH 2NY0C 4G9FD 3SEPA 4PY7B 1FHGA 4KZDL 1NBQA 4RBPH 5IIEB 3U0WH 4H8WH 4CU8A 4MNQE 4ZS7L 4LKXB 1GGBH 5GISL 5IMOB 5CZVH 4QY8A 4QRPD 4P46B 3CX2A 3VG9B 4HC1A 2MPAL 1GIGH 2GJZB 2G2RB 5D1XA 4MJ6B 5HHOB 1F90L 1U8JA 5F96H 2ZCHL 5IBUG 3FB7A 4XXDA 4MXQC 1HIML 4TSCL 2X4PA 3V0WL 1T89C 3H9SB 2GCYB 1I1FB 5IB4B 1T3FB 4O02H 1NC2A 4CBPA 1XZ0A 3P0YH 1OWRM 1A6ZB 5J57B 2NXYB 1FE8H 1XF4B 5FAAA 4KJYA 1SM3L 4HIIA 5EO9A 4JRYA 3MJGX 4O5LL 2FO4A 1CDHA 4IOIB 3A6BH 4ODTL 4KKBC 4QHMA 2AEPL 3FB6A 5FUOL 4MLSA 1ZLUK 4E5XB 5HVWA 5J6HA 1WTLA 5DFTA 1NUDA 5IBTL 2RGSA 3EFDL 1XGPB 1KJMA 4A6YA 4LL9A 1WWCA 4NNYA 1IM3A 4DKFH 2QQLH 1YDPA 3B3IB 5F6HI 4LKCA 4RFEA 1JN6B 1RMFH 3LMJH 2I9LB 2IBBA 3OR7A 5JNYB 3HN3A 5E2TL 5C0FA 4KI5F 1D9KB 1S9VB 4HJ0C 2YA1A 4DZBB 1CVSC 5DVLA 2J8OA 1K8DB 3D5OF 1NGQH 1FNSH 3NPZB 4HK0B 2OJZH 4GW4A 5HYQB 4CVWA 4MJIA 3K46A 3RX5A 3F5WB 5EZJA 2PYEE 5J3HC 1LILA 2BVYA 1IC7L 3OKKA 1IEBB 1HXMB 4I0KA 4RFNC 3VG0H 4AEFA 4MJ4A 1ZGLP 4BUHA 1RJLB 2OI9C 4OCNC 1MAML 2BNRD 3RPIB 3TGXA 5KTEH 1H3GA 1R6VA 4M7JL 1MNUL 4HWBH 5IVXA 1UXSB 5EOCJ 3JWNC 4X6CA 4X7TB 3HZMB 2HKHL 3OKLB 1CLYH 2DKSA 3AB0B 4KAQL 1BFOB 4Y88A 3MLVL 4X80L 3L6FA 2BNQE 3QUXD 3NMEA 4R4ND 5EU4A 3U2SA 1U8QA 2O61A 4LSPH 3MGTB 4JFQA 4MCYA 2VISB 4P48A 3GGWB 3KLHC 2CKBA 4NNPH 3QDJE 4NZRL 3ARXA 4KJPD 3MNZB 1EEYA 3EO0A 4GMSH 4LLUB 1HCFX 3RWEB 3MCKB 2FBOJ 3UTTE 3RDTC 1LO5A 5E8EA 4DCQA 3TFKD 4X4YB 1TZIB 3IKKA 2APXA 2VXUL 5EO0B 2X40A 4AEEA 2XPGB 1Z9OA 3V6BR 1MJJA 4HIJB 4HKBA 1D5MA 2DDQH 5JW4N 4UDUB 4FQIL 3PE9A 3X3GL 3P73B 1PZ5A 5LQBH 3AC0A 1XGQB 4ZFZA 5CILH 3LIZH 1FL3B 4E41E 5IMLB 3TA3A 4K3JH 4P0DA 1CL7I 3ARBC 4F7TB 1T03L 2P8PB 1BBDL 4R0LC 2D03H 2EDWA 2X10A 1K4CA 4AIZB 1P53A 4HWBA 5HDQH 3TN0A 3O2WL 3NZHH 1ZLWH 1C1EH 2NTFA 1FLRH 4M43L 3GMQB 4FS0A 2NX5E 1HHJB 2V17H 3T3ME 4HBCH 1HNGA 3BVNB 4ZOEA 1MHCB 1RUQH 3PDDA 4YFDB 5E5RB 5FDWB 5GS0H 4KV5F 3Q48A 4JPWH 3R06B 4H5SB 3BP7B 3D87B 2FLRT 1QYGH 2VSCA 2EO9A 1TCRA 1UENA 1KLUB 5DI8B 1BQUA 3BPOC 2AXGA 4UDTA 5F3BB 2PYED 1FIEA 3L3OA 4DOHB 4WDIA 3O2VL 1IEHA 1MWAH 1E6OH 4XC1H 5GGQL 2FR4A 4X98B 1IAII 4JO3L 4PD4K 3B8YA 3PIQA 2H26B 2IMMA 2CPCA 4S0TD 3O6KL 1NEUA 1Q9LA 1FORL 1I7UB 1QRNB 3QEGH 1NL0L 5IB1A 1G9MH 2NY6D 3MODL 4P59H 3SKJL 5DVNA 4MNGE 2DM4A 3VXOB 3VGEA 4LHUD 3MJ8B 2KQNA 2BNQD 4G9FB 5JW5A 2DIBA 4AMKH 5TF0A 1MHPL 2BZDA 2VL5A 2WIIB 3L3GB 4EEEA 2EE3A 5CEZL 2LAGB 3F7VA 5E6ZA 3F58L 3FQWB 1BEYH 2AP2A 1QA9B 4HT1H 1RFDL 4NHCL 4OCRL 2IBZY 4YDJB 1DQDH 1X3DA 3QDJD 4PUBH 3DIFA 3SDXE 3UTTD 4RMRA 1R3HB 1RQ5A 2BSRA 3BH8A 3KLSA 3W5MA 4YPJA 3QUMB 4R7DA 1I3UA 4AJ0A 4MX7B 4J1UB 3VA2C 3VW3L 5DJZB 3MNWB 1NKOA 3B43A 3CVIH 4TVSa 3MRMA 4OGAD 4JAMB 3T09A 2XV6B 1YEEH 1DBKL 5TE6L 4X6BB 4PTTA 4XPAH 4M61B 2ZUQB 1Z3GH 4XMLL 5C0EB 4OJFH 5FV2A 4L8SA 5BV7C 5BO1L 1QSEE 1F8TL 1I3RA 4E41D 1MWAA 3OKEA 3O4LD 5I1HL 3OG4B 2NR6D 3A6OA 3IJSB 4Y2OA 3UZQA 1A4KB 3C08L 3LQAL 2FSEB 2CXKA 1AJ7H 5I66A 1CFBA 3QCTH 4AH2B 4JN2A 5T1KA 2R29L 4BH8A 5C09A 1VGEH 3QIBA 2VLKE 1FGNL 4NCC2 1YN6A 2NX5D 3VWJD 2EXYD 1PKQA 1EAPB 5D7JD 4ZFOA 3TCXA 4FQLL 4PYGA 4BH7B 3QUYB 3S7GA 2XA8L 1Q8MA 5J13B 3LKOB 2VITB 3CSYA 4JQXA 5L8KB 5FF6B 4P57A 1AO7D 2H3NB 3SKNA 3KS0H 2JJWA 4LDLB 1F4HA 2EDEA 1B4RA 1G7HA 1URLA 1MQKL 3CCHB 1PLGL 2YK1H 3WFZA 4M8QA 1B2WH 4ZAKB 3VGGA 3ZKXC 1MUJA 4JO2L 3GRWH 3V4PH 1BOGA 5C6TL 2IF7A 5F7UA 1FAIH 1P4LB 2HRPH 3PABA 2BCKB 2IPKB 4RGNC 2ZOKB 4XMPH 1MRFL 4Z7VA 3ZO0A 3E6HA 5ID0A 2WANA 3GO1L 4F7EA 5F97E 4NO2B 3O3DB 5DHYA 1DQML 2Z8VC 2GAZB 4YIQA 2HVJB 4M5ZH 1KXTB 2FLBT 3RQ3A 5FV1L 1D6EA 2XYCA 2JB5H 3U0TA 4L8BB 1S7QB 2GI7A 2VH5L 5ISZE 3CXHK 3HE7B 3I9GH 2CO6B 2Y06H 2XKSA 1K6QL 5KSBE 4GLRH 3C5SB 1B4JH 1EGJH 4FFYL 1DZBA 4TTDC 2CIIA 4OF3A 2I9TB 5FCUH 3V0AC 3QXUA 1I8KB 5GGRA 4CVXB 5IWLA 1CYGA 5I76A 4Y4HB 1KFAH 4F9LC 4TOYL 3X12B 4KI5C 4F80A 4OZHB 1EHXA 3BGMA 4XC3L 4HZLA 1V5JA 5GS3A 5JOPD 4U7MA 5DQJA 2DWEA 5IJKC 1KUMA 2DF3A 3BN9C 5DD3L 3PJSA 5FYLL 4MJ2A 4NKOA 1EXUB 1QSED 3GSNA 43CAB 3HZVB 1QHOA 4PPTA 4Y0GA 3CFCH 4HPOH 1HNFA 3D85A 3GRWA 4MCZB 4O2CA 2EH7L 1JRHI 1F3JA 3MRFA 5IT2L 4N9GB 1RY7B 3KPQA 5ETUA 3MR9A 3VD9A 2ZWLT 5D70L 1N2RB 1KPVB 5ITFB 2SEBA 1MAJA 3BUYB 4F57L 3CLFH 1QFWM 2Y1VA 1M05B 3S97C 5LGHH 1I85C 4XCFH 1F4AA 1FRGL 5E5MB 3IRZA 4NQVA 5DA0B 4C57C 5IFHH 1HWHB 3EGSB 3T3MF 2FX7L 1JGLL 1DN0A 4M7ZC 3B9KA 2H41A 2CLRA 4KK6C 4Z5RB 1EGJA 5IM7A 3HPLB 2Q20A 4EN3A 1AQKL 1GZQB 3D0LA 5E2JA 5ICXB 4GW5B 2JB6A 3KPMA 5IFAL 5I1KL 4PY8J 5IP4A 4XNZC 4LHUB 2J7LA 4I3RH 1JK8A 3IDMB 1JBJA 1CDGA 1JV5A 3RIAF 5D71H 2BOCB 1QFUL 4JN1H 1RU9L 5JPMA 2HG5A 2YD6A 3CXDH 4O4YH 4PGEB 3V4VH 1WJ3A 5D6DC 1RZKC 1ZVSA 4GRLD 4U1HA 1INDL 1OGTB 3IJYA 1R5IA 2P5WE 2DYPD 3RZCA 1UM4H 4PGBB 2EDRA 3AS2A 4NZTH 1KCSH 1JPST 5D72L 5ISZD 2EEBA 1QKZL 2A6JA 2Y07L 2VR5A 4HLZG 1GRWA 1VFBB 1WISA 4RMQA 1WBXA 2W0FB 3OGCB 4PJ8C 2B1HH 4HKXA 4X5WA 2YD4A 3T4YB 4EBQH 3JVGC 1KPRA 1NCDH 4K94H 4M1DH 3HCVA 5KSAB 1CLOH 5F7EH 2AEWA 3PF2A 3ZT7A 5I18H 4F33B 1A7BA 3BQUA 1A9BB 2W92A 2YRZA 3O4LB 1QTYT 3MOAH 4HS8H 3THMH 5B4MC 3RVUC 2R56L 1JF1B 1NANH 1QOKA 3CMOL 3KHOA 3MLWH 4B0MM 2Q8BL 1FZOB 3M17A 2VDLL 4RAUB 5T1LD 4GJTB 3I02A 4OM0H 4JFDE 4AZ8A 4N1CA 3QQ3B 2ED7A 4ELKA 4F37K 2XN9D 5D7JB 5DD6A 1BLNA 4RIRA 2AERT 4ONGH 3KYOA 5JQ6H 5AWNH 4YUEL 3FQTB 3G08B 5E8OB 4KJQC 2E7LA 4LASL 1RD6A 5EPMA 3GJFH 3MJ9L 4R4NC 3KJ6H 1AO7B 1X5AA 1BZ7A 2XOTA 3T0DA 2H2SD 1YEFL 3P4MB 1AY1H 3DRTB 4RA0C 4LRIC 1FZMA 1S8DB 4OZFB 5CGYC 3QZWB 4KKLC 5DRZA 3LB6C 4KQ4H 5CBEB 4BSVA 2X4QB 4XMKH 3DRQB 5IROA 3T1FA 2ZUWA 4CU6A 2R69L 3SOBL 4WI3A 3TFKC 3BKCL 3VFTA 4GAYA 4DN4H 4ZFFB 4HDIB 5TDNB 3QO0B 3UYPA 5JOFB 1I1AA 1CZ8H 4WV1A 3ULUE 4R96A 1S9YB 3RTQB 4D0DB 1I8IB 4PRHD 2VAAB 2CRMA 3OJVC 5EWIH 4FG6C 3P0VL 4R90L 1V7MH 3TO4C 4JDZA 5L88L 5B39B 5C07A 1GAFL 3DXAD 4GRMB 5CJOL 2P5WD 3SQBA 3H7LA 2QQKL 1MCDA 3U6RB 5IV2B 3L5JA 1A1MA 1QFHA 3TF7C 4PLJC 1KB9J 4JDVB 3IXTB 5E8DH 3QDGE 4ZUVB 1T7WA 2F54E 3E6FB 2LFGA 3G5XA 3UO1H 2NY1D 1JGEB 5B3JE 5F9JA 5E7FA 5IESL 5KSBF 3GJFA 4MB5A 4WFGE 1I9IL 3JWOH 2ICWJ 1KEMH 2BFVL 1QSVA 2R0WH 4S1RL 4KJWD 1CICA 4I3GA 2O5ZH 3B5TA 3BPCB 2QR0A 2HRLA 1LO2H 2FD6L 4RWHA 4KY1L 4DAGL 3WKNA 3CH1B 1KV3A 2OX5A 1IGYA 5E4EC 5JO5A 4JFEE 1J7VR 4NZUH 4UT6L 4ZTOH 1UH2A 1XFPA 4JFDD 2DB8A 4XWOD 3TIEA 1GPOL 2GUOB 2EKSB 4L29B 2C3WA 2YPVL 1CXLA 4JJ5A 5KS9A 5EU6E 1Q9KB 4RX4D 1BX2A 3QUML 3OJDA 5IB3B 4ELMA 4XPBH 1I8LA 3MLSH 3D18A 3B2VL 4LLVA 1H15B 4PREA 3O8XD 2YN5A 4EDXB 3SDYH 4KK8C 4B50A 4NO0A 1FL5B 3U46A 2X4NB 4JDTH 5HHPB 4CVZA 3V7AG 1FVDA 1ZANH 2OR9H 5EIVA 4RCAA 5TFSH 2FJFA 2HWZH 1F4YH 2GKIA 1PGRB 4U1SA 4PGCA 1PY9A 4F15B 5BW7C 3BDYH 3N06B 2EDFA 3G5ZA 3F12A 4P2RA 3SGJA 1R3KB 4QRRB 5F1IA 1E4JA 2K9UA 3O3BA 1XF5A 3ULUD 1BREA 4OUOA 3I6LE 1IEAB 3FO9B 4M00A 3ARYA 2H1PL 4JRYE 2XNAA 1JNJA 1XR8A 4LPTA 4OGAC 4MXWL 2O5YH 4MA7L 3SCMC 2BHYA 4LK4A 4NJ9H 4FXLA 5FB8A 3OKNA 4UV7H 4I3SH 5DMIL 1S78D 5CJQL 4TNVK 3GIVB 2R1XA 3PHOB 3H9ZA 3ISWA 2H6PA 2EXWD 4IM8A 4P3WA 5E70A 5F89A 1UFUA 3MSPA 4OCXL 3U36A 2AJUH 4XNMA 1I1CA 4JG0L 1BVLB 3QNXA 1KB5B 4N0FB 5CP7A 5JLZA 1H3XA 4TUKH 5HYEA 4OLUH 4ODUA 5FUZL 3L3KB 4DZ8A 2A73A 4QXGL 2VDPH 2RB8A 4WFGD 1J18A 1UM5L 3BD3A 5L2KB 3B9AA 1EIBA 4LDEB 3VWJC 2EXYC 3LEXB 2LAAA 3C5ZB 3VXMA 2V5YA 3QIWC 1EVUA 1I9EA 2VDQH 4BSWA 5L0QC 3D2UD 4H1LG 3KYNB 2ICES 4FFVD 4P9HC 2BC4B 1YYMH 1T7ZA 4C59B 5T1LB 3WDJA 3D25A 1CCZA 1QLEH 2XN9B 1D5XA 5F8RC 3EFFA 3JWDH 2P1YA 3IB4A 5HDOA 1UB5B 1JWUA 1X5YA 5IVXE 1RZJL 2BK8A 1WSST 2F5BH 4J4PA 4JFED 3BMVA 4TVPH 4X6CE 1KJVB 2R1YA 1RUAH 2ZUVA 2I07B 2YC1B 2H32H 2DICA 4P5TA 5EU6D 1GC1L 3WJLA 2BRQA 5J1SC 4XVSH 1TTUA 4JZJA 5F7KC 3LN4A 2BSSA 3QG7H 4HIXH 5DXWA 3ROOB 4NQCB 1UB6B 5LAXA 1HYSC 1UZ8B 2DQFB 3FRPG 4WI8A 1NFKA 4K7FA 4PJAB 12E8H 3UBXI 3C2AL 5D7LA 5IHUL 1ZT4B 5DUPH 4UQ3B 1FH5H 4MAYA 3BIKA 3NFNA 3UAJD 1T66D 4PRHB 2ARJB 3B6SB 4OGYH 2R0ZL 3DV4B 4K8RL 1ODAA 4Q6IB 1J1OL 1R3IH 1VACA 1NC2D 2BJMH 1MCRA 1TPXC 5LWYH 4L4VD 4JHWH 5DUMH 1T1YA 3DXAB 1VFUA 2NLJA 1ZHKB 4ZUWA 4DGYL 4HKJA 5SWQA 4Q9RL 3G5YB 3ULUF 1AE6L 2HFEA 2J1KA 4IRJB 3UZVB 4PRNB 3PWLA 1SEBA 4YHYB 2EZ0C 2V9TA 3WCYA 1OAQH 4UB0L 2ITCB 2QSQA 1HE7A 1T20B 5TQ0L 2HJLA 1IT9L 4GKZB 5HYSG 3MUJA 2NY1B 4XPFL 4ZO8A 1F2QA 1UJ3B 4YDLB 4XNUL 1A6AA 2OP4H 4WIQA 5GGTH 1E4KC 1I7TA 1PJ9A 4G43A 4LCUA 3SO3C 2WWKT 1LD9A 3GI8H 4EVNA 1VFOA 3RX8A 4UBDC 1LEGB 3AS1A 1AR2A 2NXZC 2E9IA 1A7NH 3FT3A 5B3JF 3BZEB 1BWWA 2ZNXA 2Y72A 2X42A 4PRBB 1OOAA 1MLCB 1HWGB 1KEGH 3I85A 5I19H 3S35L 3EDEA 3MXWH 4AIXA 4ZTPL 3B5HA 4JO1H 5K9QI 4QTIL 1EPFA 2JELL 3FO0H 3OAZK 5C0GA 5DQDL 3QYCA 4NHUA 1IC5L 4Q58C 1D5ZB 4WUKH 2EDOA 2HT2D 1IL1B 2JK5B 1NGZB 2YBRA 3O8XB 4LGPB 1KG0A 1UACH 3DV6B 1XF1A 3RWCB 2D9QB 2Q76B 4N8CL 1YEJH 3EDFA 4HW6A 2NY5C 3H7BB 3MUGB 3QXAB 1TTFA 4OTXH 1AI1H 3K7UA 4GXVL 4NRYB 3EYVA 4DUVA 2VQTA 4MD0A 4DVBA 3FN3A 3U7WH 3LEVL 4IOFD 3H8NA 5CSZB 2X1WL 2NW3B 3HAEG 4NPYA 5GGTA 4OD3H 3LKQB 3FO1B 5EUKB 4MB3A 4IDJL 2PW2A 3O4OC 1EFXD 1PEWA 1RULL 3MRNB 5C0ND 2NYYD 3NACL 4K55A 4YHPA 1MEXL 1ND0A 3DX7B 3P2TA 3KWWB 3HMWL 1N7ML 2G9HB 2ESVB 3MLZL 3FQRA 3GBNH 1J0JA 5LXGH 3VE0A 4LVEA 1HHGA 3C5JA 3A67L 1ZHBB 1R5VA 3TA3D 3WEXB 2RR3A 1DLHA 4WWKB 4JFPB 1CXIA 4YDIH 5ELIA 5I30H 3GKZA 4KK5C 3INUL 3QQ4B 5I8KH 2H8PA 3TN0D 1RIVL 3WS6A 1HINH 5DJ0B 5C09E 4RQQA 3TIDB 4NUGH 2HTLC 2QSCH 2IADB 1P1ZB 1WZLA 1PKQE 2X4RA 5DC9B 3UJIH 4PJIE 4JO4L 4XHQA 3D2UB 4Q2ZB 2A6KB 3NCJL 5C7XH 2AJSL 3BP4A 1BZQK 3MREA 1FIGH 2MSPA 3DUSB 4NRZB 3BP6A 5DFWH 5K9OA 4LAJH 2AJZA 3HR5B 3O3AA 5D2LE 5H37G 2H2SC 1P7QD 3WBDA 5GRJL 4AYFA 2DQDL 4JFEB 4MSWA 4JFYB 1S3KH 2IMNA 2IQ9H 5DZOA 4KVCL 5ESAB 4LF3B 5KG9A 4ERSH 2PYFB 2QHRL 4Y1AD 4GS7B 3L95A 3MLUH 1VGKB 1HXYB 3DROA 5GJTL 5FKPB 4XBGB 3R8QA 1JPTH 2IAND 4M5YH 5E2UL 4ISVB 4R0LB 2EDDA 5CD5C 4Z7VE 3FKUS 5IVXF 2ENYA 5MERA 4CAGA 1FO0H 4X6CF 4PD4J 2AKRB 3W82A 2CDGA 5JW4R 3MRGA 3T0EA 1XGRA 4PJXA 5EU5B 3MLXL 4HS6B 1NAKL 3DGGA 5I71B 1CFTB 1CDUA 2JCCA 1H5BC 2YHGA 3PP3H 4PRIB 4PS4L 3AVEA 1X5GA 2B2XH 1K5NA 3EYFB 3MRBB 3U9PL 1J1PH 3BPOB 1YNLL 4LCYA 4UZGA 4L4VB 2XRAH 2X7LA 1KTLA 4JM2A 5GGRY 4UOW0 5GS0D 4IDLA 5JIHA 5FK9B 4GW1B 1H0DA 2F53A 1DQQB 2W0LA 5DK3A 3FQNA 5T3ZH 1T0NB 1Y0LA 1SJVA 2ICWA 4F3FB 4LDOB 3HS0B 4ZSOB 5EZLA 5D7IA 2HT4C 3IFOB 1E6JH 4JPIB 4L1HA 2QADC 4LSQL 4WUUA 1U8LA 2XTJE 3ARSA 1WV7T 5I75C 1OB1B 4C56B 5AZ2L 8FABB 3FO2B 3SQOL 3L7EB 1CDJA 1WLHA 4FQQA 4NKDA 5C09D 1FFOA 3QIBD 1FNGA 5GRUL 2D4DA 1ZT7A 4Q74A 5ACLA 3VI3E 1FGVH 1LK3L 3OB0H 2BMKA 4YR6A 4POYA 1NEZG 4RMTA 1QLRA 3MACH 2EYTA 1AHWC 3EYOB 1AP2A 4X7DC 4IRZL 2DMKA 4OV5A 3V6FA 3WN5B 2E27H 1FFQA 3KPPB 5L9DH 5T3XH 3D3VE 3NN8B 43C9A 4IMKA 4X8JA 1OM3L 2WWMC 4KTDH 1TQCB 2UWEA 4V1DD 3RWGA 2HFFA 1FN4A 4WEUD 3WUWB 1X5FA 3KPRA 3PXJA 4UT7H 1AD0B 3BN3B 5CHNA 2MTPA 2B5IC 3OXRA 1OARH 3MMEB 1ITBB 3T0WA 3QWOB 3BHBA 3EOTH 1BAFH 1KB5L 3Q6FA 1WVZA 1IGFL 5E7BA 3M1BB 2G60H 1NCCH 4HXBH 2CRZA 1R0AH 1ZA3B 5AUMB 5B38B 4U1LB 1ZWIA 4WWID 5HI5C 1RI8A 4OD2A 4JY6A 3TJHC 3FQUB 2DQCH 5BS0A 3CFBA 5D1ZA 3CD4A 5EUOA 4LGRB 2V6HA 3S4SA 5DRXA 2F5AL 2PF6A 2KQMA 1EFXB 3KPNA 4XNQB 5C0AA 2EXWC 2HTKD 4QWWD 1OAUL 1DLFL 5HTSA 4FRWA 4ALAL 1F2XK 2LV4A 3L1OH 2WBJA 2VDRH 4YC2B 2XZCH 2RFXA 3HTLX 4NQUA 5T5FL 1S7UB 3CXHJ 3EOBB 4ODVL 2YA2A 3ARDC 1AXTH 5CSGA 3SDCC 5CZXD 1KCUH 4EI6A 4LQFH 2UY6A 2VZTA 1NSNL 3X13A 2LTQC 1WZ1L 1P4IL 1ULVA 4PRPD 1QPPA 3KPTA 4OSUL 2V7NB 1AR1D 4ZD3L 4ZS6D 4HS3A 1JGDA 4HFUL 3SKOB 3F6LA 1L7TL 2C1PA 3T65B 3LKRB 3Q2CA 2H2PC 3DX9B 4S11A 1NLBL 1KNOB 1INQA 3RHWF 5GISH 3MA9L 2GFBA 3MX0A 5F7MC 2I60L 3OQ3B 5DGQA 2MPAH 2VDKL 1GOFA 5DJYB 2WUCL 1F90H 1LK2A 2BY3A 3VXUE 2ZCHH 4P99A 1LE5B 4LARL 4W6WB 1HIMH 4TSCH 3V0WH 5A43C 4WO4C 1ZLUH 3I75B 3T2NL 1P7QB 1JZ7A 1G84A 4PJIF 5KVMC 1SM3H 5TGBB 4LU5L 4ZO7A 4O5LH 2WMPA 4Y4FA 4ODTH 1FJ1B 4Y1AB 3D3VD 4UIKH 5FUOH 1MFBL 5DK2A 3EYSL 4W6YB 5IFJA 5KVEL 4FQXD 2IANB 3RWIA 3KYKH 1A8JH 3MRLB 1PQZA 2Y4SA 4NJAH 4XI5D 2HT3D 3EFDH 5D2LF 2WINA 5D1XC 1D5BB 4TSAL 1S9WB 2VN7A 4MQXD 3L9RB 2W9EL 5KVDL 1LE9A 1OLZA 4Z7NE 3UAJC 1T66C 3CDFA 5GSRB 3GSUB 2HN7A 1FZKB 4WEMB 3ZDXE 2NY4C 3X11A 3CLEL 5E2TH 4AT6A 3FRUA 3ARFA 1LO4L 5C07E 4UOJA 4Z7VF 3QI9D 4G3YH 5A2KH 1MSPA 1U8NA 2A83B 1YZZA 3JZ7A 1DUYB 2ZJSH 2ZUSA 4XVJL 3GHEH 1KIPB 1FSKC 1CD8A 2EICA 4GLRI 2CLVB 4M7ZB 4PV8B 4R97C 3MYJB 5MEOB 1CBVH 3PGCB 3RWDB 5ESVB 5HGDB 2DQGH 1ZS8B 2VLME 1MNUH 1RURL 1O7SA 3AMKA 4YHLL 3AREA 2HKHH 5IW3A 1QVOA 4KAQH 1T7XA 1MIEH 5FKAB 3MLVH 4X80H 3JTSB 1PG7W 1LMKA 2X4SA 4NCC1 3WLBB 3BQUD 4LRNL 3T04D 1JWSB 3ZHKA 1C16A 3N9GL 4H8WC 2UYLB 2Q3ZA 5J9PA 3HI1A 5I2IB 3IETB 4FQ2H 1KCRL 4HKZB 4DK3A 4L5FH 1HHKA 4LEXH 1M7IA 4LIQL 2VZ3A 4Q6YA 4F7MB 1JZ4A 1SYVB 1IZJA 2Z35B 3D9AL 5KS9E 3TH2T 4PJIB 2VXUH 1EERB 4L3EE 1M4KA 1AXSB 4DN3L 1MCJA 4TRPL 4ELME 3VXUD 1OP3K 4YPGA 5HXMA 3WO3B 2ZG3A 1OPGL 4P57B 3RWJB 1BECA 3TCLB 2HT2C 3NVQA 1YEGL 4K23L 5F6IC 2X89D 5D2LB 5MI0B 5A3ID 3VI3F 1E4XL 1HQRA 4V1DB 1MCWM 4M8QB 4EQ2A 2ZSWA 4FFZH 4LSTH 5IF0B 1I7ZA 3CFJB 5HY9A 2HFGL 3BRGC 1T03H 1BBDH 2C4FU 1JNNL 1QEWA 2ADJA 4JFXB 4I0PB 4P2RE 1YY8A 1CFQA 2PETA 2C1OB 3STZB 2ERJC 3GSQB 2LU7A 2EEDA 2H9GB 4M43H 4DGVL 1QO3A 1M6OB 1KJ2H 1K8IB 5LKNA 3RBGA 1F6LL 1BQHB 1SMOA 2Z31A 5BCAA 4P2QD 5I8EB 4BQBA 1CK0L 5C07D 5BJTB 2Z8RA 2YWZA 3V9FA 3VXRA 1NGYB 1YUHB 4O51B 1L4IA 4M7LT 1IM9A 5EORL 3TA3C 4TYUA 3NFPB 2ATPB 3GKWL 5I76B 1MJ8L 1T6VN 3QAZC 3BPLB 4PV9A 3H9HB 3O2VH 1AD9A 1NBVH 4M6ML 5CP3H 4Z77A 5CCKH 4DUXA 4APQB 5GGQH 1EZVX 4JO3H 3IDYC 1U9KA 2IAMB 1MHHA 1U92B 2WW8A 3O6KH 3JXAA 3BT2H 2CDEB 1FORH 3C6LA 3GMLB 1MHEA 4PRPB 1NL0H 1HKLH 3MODH 3SKJH 5JPNA 3VXME 3MC0A 4XNYL 1FG9C 1CICD 4JEGB 4ZOAA 3GSNB 2EE6A 1KTKE 5HHVL 3LN5A 2C9AA 4O9HL 4PLKD 1MHPH 4U6XA 3KDMB 4H26A 1WFUA 4HXAL 4XAWH 5CEZH 3OKOA 2X4TA 4PR5A 4IRSA 3FFDB 2R23B 2XTLA 3F58H 1RFDH 2DD8L 1DSFL 1RJYB 1NANI 1EH9A 4POUB 3E1F1 3QXDB 2FB4L 3WHXB 4RNRA 3S36L 2IH3A 3S37X 1KJ2A 1FL6A 4JQVA 4L3ED 3F62A 4OCYH 5K9KA 4QRUA 1T83A 3MV8D 3VW3H 3ES6B 2HFTA 4G42B 4PLOB 3V2AR 4EKXA 1T5XB 2GTZB 3X3FH 2R9HD 3D3VB 1UQSA 3EOAB 1DBKH 3SY0B 4NO0D 4C4KT 4FQXB 3GDBA 3PUCA 3O41B 3RUGA 5D7LE 5I1DB 4FZEL 5CZKA 3AY4A 5BO1H 1F8TH 3KNBA 4NN5C 5CP3A 5DEFB 5BQ7B 1GHFL 1EHNA 3IDGA 5DJXB 4G8GB 1UG9A 1WWBX 1P6AB 4KKCD 3F65A 3C60A 3C08H 1W0WB 2YMXL 2FBJL 4ZDHA 1SYSB 4P2RD 4CVUA 3MO1A 5CJXA 4PB0L 3SE8L 4JFZH 5E4EB 2R29H 4X7SL 1FGNH 4HFWA 5ID1A 3QI9B 2V2TA 5GS0C 4M3JA 5DK0B 4P9ML 3ZYOA 1GJIA 3QH3A 5GGVL 2OQJB 5D4QA 4FQLH 4WU7A 3P77B 5D7SL 5DURD 4Z7NF 2A6JB 3GUTB 1OQXA 4L8SC 2XA8H 5I73B 1K2DA 5K59E 3GMNA 1RJZA 1MVUB 3ZDXF 4YX2L 1KJ3L 4RWYL 4RRPA 4CDHA 4OZFG 3QZWG 4WEBL 1UZ6E 1IC4L 4D3CL 2AAVA 4LFHD 2AGJH 1HILB 4XPHH 4NM4H 3MZTA 1MQKH 3KPOA 2AQ1A 1PLGH 5IB5B 2ZUTA 1NPUA 4UV4L 2MNUA 3VGAB 4JO2H 2IPUK 4S1DD 1HOCA 2R0LH 3WXWH 1Q0YL 3KVQA 5C6TH 5BVPL 4HWZA 2P7TB 4X5LA 3WMSA 2DI8A 3QIBC 5D2NA 3GB7A 4QXTB 1QRKA 4ODSL 2W0KA 3PQYA 2ADFL 3QO1B 2J88L 4YHOL 3HC0B 1CU4H 4CNIB 3GO1H 1RIUL 4E0RA 1DQMH 1GGTA 1W8NA 4MA1B 4QRSA 1J12A 1D3CA 2YEZB 2VLRD 3FAWA 3NA4A 1ZT1A 5DD6B 1BLNB 3G6JB 2VH5H 3LQZA 5DJDB 4F7PB 3ELAT 3CFEB 3OGOE 4JZNA 3VXUB 1EX0A 4LVOB 5C9JB 2AJXH 1IKFL 1Q0XL 4FFYH 3FQXB 5DJ6A 2P44B 3HAEH 5IR1A 2PXYD 2I25N 1TQBB 5J12C 3MV9A 4WW2F 1SBSL 1MLBB 1UA6H 4TOYH 2OL3B 4XC3H 5KS9F 1T1ZB 2DQTL 2MHAB 4YDVB 2JJTA 1PAMA 4M6NL 1YEHL 1AXIB 3P4NB 5FGRA 5DJ2B 4N1HB 4QYOB 5DD3H 3NPSC 2EE9A 4Y4KB 3SDAA 1I3VA 2GITB 3G6AB 2DQHL 4HZAA 1MJ7H 5D7LD 2XT1B 1CFSA 5DVOA 4B53A 2X70A 3OAUL 3F7YB 4MAYD 5MHSE 2VDOL 3BWAA 5IJVB 1QSFA 4QWWC 1KTDA 3PWPA 3P11L 1YEIH 1OT1A 4P2QB 2GSGB 4UNTA 5FO8A 4N0RA 4FQJL 4WCYH 4PTUB 4F57H 1EHAA 1JNHB 5CZXC 5FA3A 5T33L 3RNQB 1MREH 5EFIB 2UUDK 1HQ4B 1FRGH 4G9DB 4JFOB 3FB5A 3D69A 4KI1A 1JGLH 1J0IA 3WNNA 4MQ7A 3BEVB 1NJ9A 2AV7A 3BRFA 4HGKC 4LLDB 5ALCH 5H37H 3QNZA 2ARWA 2CK0L 5CKGA 1J1XL 2XTJC 5EZOH 3VDCA 1QBBA 3GK8L 3NGBC 3HAEA 2VC2L 5C6PB 3ZKMD 2Y7QB 1EFQA 4R7NA 1BVKA 2FX9L 4YK4C 3CVHH 2DTMH 5I1KH 4RAVA 5GGSB 3G6DL 3KJ4C 4TSBL 3EO1A 3QIUB 5L2JB 1A3LL 4FTVA 4YZFE 2EIBA 5FHBL 1RU9H 3MV11 1WBYB 4OF7A 1GGYA 1SJXA 1V7NL 4X5XA 4YAQA 1AKJB 2DM7A 3GZKA 5JHLL 1KGCE 2X41A 4I18A 4L3CB 1INDH 3PNWA 1S7WA 3T8XB 3OB8A 4WW2B 1T22B 3B9KC 1JHKL 2W38A 3QEQB 4PY7A 3VMNA 1U8HB 4OLXL 5IW6B 4Y89A 4R2GB 5IIEA 4GKSB 5D72H 1I8MB 4H25B 4LKXA 1QKZH 1CT8B 4L3EB 4EN3C 3WDHA 5IMOA 1CE1L 4P46A 3MV8B 1NLDL 4XI5C 4LPXA 2GJZA 2HT3C 2G2RA 4MJ6A 5HHOA 3VRLE 4JB9H 2VZSA 3KYMB 4GUPB 5JUEH 3IDUA 5D6CB 4DVRL 1Q94B 4E9LA 7FABL 3LOWA 1P9MA 3H9SA 4PJXE 2GCYA 1I1FA 5IB4A 1T3FA 1E27B 2HH0L 3SO3B 2UZIL 2JCCE 2W9DL 4O58L 1A6ZA 1MJUL 1XF4A 1N0LA 3RZCC 4IOIA 1ZLSL 4L8CB 5DUBB 2R56H 3CMOH 2Q8BH 1HDMB 3WFHB 4E5XA 2RJMA 2LVEA 1XF5B 3TZVD 3ZZ1A 2FHFA 5MHSD 5I15L 3OL2A 4GAFB 1XGPA 5D8JL 2OTPA 3S37L 1M7DB 2F53E 2FJHB 2VNCA 4MVBD 3B3IA 5LGJB 1F45A 1WFTA 4YHZH 1NCAL 1JN6A 1MRCL 3N1FC 4YUEH 1H3PL 4PY8I 4KGJA 4RDQG 5JNYA 1OD9A 1G7QA 1LP9B 1D9KA 1S9VA 3MJ9H 4N0YH 2ADGB 2X1XR 4G6FD 2QL1A 4DZBA 4WUUE 4KROD 3DBXB 1K8DA 1NDMB 4HK0A 4CKVX 1YEFH 5HYQA 1V3JA 1CQKA 4YE4H 2F19L 3EO9L 3F5WA 3LH2L 1CTNA 2IBZX 3TVMC 1IEBA 1TVHB 4MB4A 1HXMA 4QCIB 4ONFL 1CIUA 2FEDC 5K59F 1RJLA 2R69H 3SOBH 3RPIA 3BKCH 4HF5L 5I74C 4DTGL 1UZ6F 1UXSA 2CO7B 2XQYG 4X7TA 4FQPA 1B88A 3HZMA 3OKLA 3MRHB 4AEIL 1BFOA 3X14B 4M7KL 1IAKB 2VLRB 3MUHL 2Y36L 4IMLB 3MGTA 3P0VH 4R90H 3O6MH 1KGCD 2VISA 5L88H 2UWEE 1F11B 3GGWA 5CJOH 4GQ9L 5HBBA 4PB9L 4L1DA 5EULV 3MNZA 2PXYB 4LLUA 3HR6A 3RWEA 3K2UL 3V95A 3MCKA 3KLAB 2DQUL 2G75B 1F13A 4PG9B 2B0SL 3P4OB 4OLYH 3MGAA 4X4YA 1TZIA 5T3ZE 1KIUA 3LN4B 4K94C 5EO0A 1HZHL 1I1AC 4WV1C 4HIJA 5CIPB 3N85L 2DQIH 3UJJH 5IESH 5GS1B 3DMMD 3MJ9A 3WSQL 1I9IH 4YO0B 4UDUA 2M2DA 2G5RA 3DYMA 3G5VB 3VGHA 5BS0E 1IC1A 4GRWB 4XP9H 3P73A 1EJ6A 3TC9A 5EUOE 1P7HL 3I3BA 1XGQA 2DTSA 2FD6H 4KY1H 5C0AE 1FL3A 2NY7L 4DAGH 5IMLA 2B8OT 2GW5A 4F7TA 1RUKL 1U3ZA 2P8PA 2EH8L 3TPUB 4KWUA 1PX4A 4AIZA 4R8WH 4UT6H 3BIBX 3BRDA 4JPKH 2N56A 2L7JA 2F53D 2YPVH 3WS3B 4HQQL 1IAIL 3GMQA 1S7TB 4LP4A 3LDBC 1HHJA 4Z7WB 3L3JB 3QUMH 5CEXB 5T3XE 3BVNA 2GT9B 3QR2A 1MHCA 2IBGA 3VJ6B 4AEHL 5TH2B 1CICC 4NCDA 5FDWA 3B2VH 3R06A 4PJEB 4H5SA 4PLKC 3BP7A 4RMWA 4WUUD 4BQ9A 5FCSH 3Q5YA 1G7PB 3SGDH 1KLUA 5DI8A 4L4JA 4LNVA 4FABH 4WI9A 4LCWB 5F3BA 4M48L 4U2YA 1NGXB 5I16B 4I9WD 1TJIL 2H26A 3N50A 2BOBB 2JJSA 1P4BL 1I7UA 1QRNA 2EDKA 5KSUB 1YQVL 5IHZB 1LO3L 3VXOA 4AG4L 4DEPC 4PFEA 1I8LC 3MJ8A 2H1PH 4G9FA 2WIIA 3L3GA 4H0HB 4MXWH 4Z0BL 3WE6B 1Q38A 2R9HC 4YZFF 3QUZD 2ICWI 3FQWA 4KTEL 3GEWB 1QA9A 5DMIH 3FMGH 5DDHB 5CJQH 4OM1L 4LPUA 4YDJA 1T6WA 2DL9A 1GL4B 4OCXH 1A7OL 2RCSH 3U4BL 4OBRA 1YMMD 2A38A 4JG0H 2QADB 4M93C 1R3HA 5JZ7C 2YN3A 3SGJC 3ALXA 5F1KC 3T4AA 5T3ZD 3GSVB 2RQ8A 3JWOC 3QUMA 3RWFB 2MMXA 5GHWL 5D7KD 4J1UA 4QXGH 2OK0L 3UBXG 1W72H 2VLJE 1YN7B 4IIQB 1G7MB 3VRLF 1JI2A 2WAHA 4X6BA 5BS0D 4JQIL 3RP1A 3OBAA 4JKLA 4M61A 3UTSD 5C0EA 1UT9A 3TZVB 4PJXF 4Y5XB 3FOLB 3VFGL 4D0CB 4TNWK 2A0LC 3OR6B 5C0AD 2JCCF 3IJSA 1A4KA 5ICZB 2FSEA 2WBJD 4NUJB 3SGKA 1RZJH 4KVNL 1NFIB 2F9BT 3FN0L 4AH2A 3REWB 3QISA 4UT9L 3UP1A 4S1DC 4QKXB 4GXUN 5E8PA 4JJHA 3BKML 3GMMB 4KQ3L 4JM2F 3CDCA 3MBEB 1RZIB 2OL3L 5T3XD 1EAPA 3ZHDA 1CS6A 1QZ1A 3I50L 3QUYA 4BH7A 1WCQA 2G5BB 4J8RB 2VXVL 4HMDA 3QT2A 3LKOA 2VITA 1CQYA 3LAFA 5FF6A 2WNGA 4S10A 2H3NA 4NZJA 5A40E 3C2AH 1X5ZA 3BPNB 3O0RH 3ZTJH 5IHUH 2RHEA 1P69B 4J4PC 3CCHA 1MCEA 4ZAKA 3U7YL 5E6IA 2K3TA 3B83A 4P5TC 1P4LA 2B39A 4RISL 4XH2B 3WJLC 4K8RH 3QHTC 3ZTNL 1J1OH 2V5RA 2BCKA 4C54A 2IPKA 5I6XC 3MGOB 4JZJC 3WO4C 4KPHL 1OAXL 4WTXA 5F9OL 3ARPA 4NO2A 4RGOL 3O3DA 4Y4FD 3VI4E 4DGYH 2FO1A 2VLLB 3GBML 4XBEL 2GAZA 2Y23A 4EXKA 5K9QG 4XNXH 2HVJA 1AE6H 5SWSB 3L3HB 2XWJB 4W81A 1ZHLB 3ARQA 1U58B 1CDIA 3OG6B 4L8BA 4UB0H 1S7QA 1HI6B 3HE7A 4XP6L 5TQ0H 4LBEB 1FPTH 3SPVB 2UWEF 2VR4A 4XPFH 5LBSL 1F42A 3C5SA 5FOBB 4C83B 4KZEH 5E00B 1A1NB 1NMCC 3DMMB 4XNUH 2I9TA 5GS2H 5SX5H 3EYUL 1I8KA 4CVXA 4L4TB 4MA8L 1FBIL 1GSMA 4Y4HA 3X12A 3DUUB 4OZHA 3S3SA 4ZUUB 3ARFD 2DAVA 3TBYB 3VXRE 5CINH 2VLJD 4AL8L 5AD0B 3RIFK 2QJDA 1Z0MA 1A14L 4LHQB 4KRPC 5H94B 3GNMH 4IJ3B 3WIHL 4BQ6A 5DD0L 3ILPB 3JWDC 1EXUA 2J8UE 5EUOF 43CAA 3HZVA 2VZUA 1TFHA 5B8CB 3S35H 4MCZA 4CW1B 1BQLH 1G0DA 1BGXL 1OSPL 2OS7A 4N9GA 4QTIH 5JIPA 3ARED 1MAKA 2JELH 3P9MB 3QFJE 1UWEH 1CF8H 1XIWB 2BDNH 1N2RA 1KPVA 3S5LB 2VQUA 5ITFA 4OLEA 4G8EB 4Q9BA 1IC5H 3HB3D 4FMFA 3BUYA 5HHME 1D6VL 2GIYA 2DJUA 5DHVB 1M05A 3HMXL 5TE7L 4N8CH 1DBBL 5E5MA 1ZGLM 4XAKE 4GG6B 3EGSA 3LS4H 4GXVH 1H3WM 3TV3L 1ZAGA 3LEVH 2GTWB 4DQOH 3S88L 2VN4A 4HGWA 4LEOB 4Z5RA 5CLWA 3HPLA 2QTEA 3MLYL 1GZQA 5ICXA 1EUUA 1H8SA 4IDJH 4GW5A 4QNPE 1IGTB 3AMLA 4ODXB 1AP2B 4LHUA 1RULH 4LVNC 2QV2A 2W07A 3NACH 5MEPB 3IDMA 2COQA 2BOCA 1KT2B 4OLVH 2YXMA 3HMWH 1N7MH 1NAML 4LCIL 1Z9SA 3QUZB 3FZUD 3MLZH 3RGVB 3PDOB 5DHXB 4PGEA 3OKDB 4BZ1L 1NKRA 4W4OA 2N7AA 3RUGE 5F1NB 3A67H 4U6HB 5C71A 5LJYH 5FGBA 1HHIB 1OGTA 2DMBA 4FXGB 2JKXA 1YMMB 4G6ML 4PGBA 3W39B 1T2XA 3A6CL 5DVKA 1CGSL 2E7HA 3NIDE 1TVDA 5F72S 4OZFH 2WUBL 3BW9B 5HD8D 1LO0L 2NY5L 2ZOLB 3QP3A 2YUXA 5CEYB 3U30C 4N8VB 3U9UB 1VFBA 2W0FA 4BZYA 3OGCA 4RFOL 3T4YA 4MVBC 5JQHC 4JO4H 5CEZE 2Z31D 3PGFL 2R39A 2B7DT 3UTSB 5KSAA 3NCJH 2OZ4L 4WHTA 2AJSH 4X9GA 3VXRD 3RL1B 1AC0A 1N0XL 3W0WB 1IQDB 4F33A 1A9BA 1IM9D 2EDQA 3O4LA 2W1NA 5J11B 5FUCC 5F7DB 1KCVH 2X4UB 4XP4L 1JRHH 2D31B 5GRJH 1JF1A 4MMZC 4CGTA 2PO6D 1FZOA 4KVCH 2DLHA 1KCLA 4JANB 3WS6C 4RAUA 1U8KB 3WL9B 3TBSB 2QHRH 4LLQB 4YHNB 3EJYD 3QQ3A 2DLFL 3C6LD 5GJTH 4K2UL 5D7JA 5E2UH 4P2OB 3QFJD 5BVJB 3PQYE 1N59B 3H42H 1NC4B 3FQTA 3G08A 3LZFH 5E8OA 1WAAA 1A4JB 3BGFC 4XGZB 2YKLL 4IRSD 1AO7A 2GFBB 4XPGL 1U3JA 3MLXH 3O6FD 1NAKH 2XZZA 4K9EL 3P4MA 1MH5B 2K1MA 3UROR 3H0TB 3P0GB 1S8DA 3NOIA 1QBML 1KCKA 2XKNB 3QZWA 4OZFA 2J5LB 1P6FA 2HP4A 5CBEA 2D3VA 2X4QA 3MV9E 3DRQA 1MCWW 5IGXL 1CR9L 4ZFFA 4HDIA 5TDNA 3QO0A 5JOFA 2C3HA 1ED3B 1QR4A 3EYQD 4ODHL 4Y5VB 3V7MA 5E95B 1S9YA 3OKMB 3RTQA 5C08E 1KC5L 4NN6B 1I8IA 2YPLE 2VAAA 5IFJB 3T0EC 4OLWL 4G5ZH 4GMTH 4XVUC 2VZ1A 4U7SA 5DO2D 5B39A 2WQRA 4M9PA 4GRMA 2X09A 3G04B 3U6RA 5IV2A 3C60D 5ABDE 1QSFE 5C1MB 4X99B 3VI4F 4N90D 4NQDA 5AZ2H 3PWPE 4JDVA 3IXTA 4JZOB 2IH1B 3SQOH 3HLAB 1Q72L 4ZUVA 1QNZL 4JY4B 3HRZA 2VLJB 3E6FA 4JM2C 4U0QB 2EE2A 2NZIA 1JGEA 1LK3H 3FFCD 3SJVE 4CU7A 5CEZD 1MCOL 1T2QL 5F93C 5C0IB 2ICEB 2XQYK 2ZKHL 1KYOK 3VD7A 2HMID 4MYWB 1CXFA 4IRZH 1RSFA 1A7PL 3BPCA 2PR4L 3B9DA 5C0BA 4M1GL 4N5ED 1OM3H 1FVEB 3CH1A 5DFVC 1QVOB 2DLTA 4KKAC 1F4XL 4J23A 3PWVB 4NN5B 4FTVE 3RA7L 1VCAA 2GUOA 2P8LB 2EKSA 4L29A 1UWXH 2J8UF 5EOTB 1Q9KA 1KB5H 5FYLE 3PQYD 3IDXH 1KXVC 1IGFH 5D96C 5DMKB 2D7TH 5IB3A 5E94B 4BFEA 1KTRL 4F7CB 4WI2A 3ULVL 1RZGB 1J8HD 1H15A 1BFTA 5EZIL 3OSKA 3HG1B 4EDXA 4IMKC 1BZ9B 3F8UB 4LCCB 3ZSSA 2X4NA 5HHPA 2C26A 2F5AH 5IEHB 1OF2B 4XCCL 4UILL 4BQCA 2MQCA 4N0CD 4NN7C 2P46B 1OAUH 2QKIB 2Z4QB 1DLFH 3K80A 4FFWC 5HHOE 3C8KB 2KH2B 3P9WB 3MV9D 3SE9L 3GI9L 5FM5O 4ALAH 5IBLC 1MCBA 3BWUC 1HQRB 4ZOCA 3DETD 3H9SE 4ODVH 4MD5B 1T1WB 1R3KA 2HKFH 2M1KA 5C3LD 1C5CL 4QRRA 3NA9L 4OLZL 5E8NB 4UIMB 2X2YA 2V5MA 1NSNH 2NZ9D 1TZGH 2AV1B 3FO9A 4OKDA 4QNPF 4R4FL 4YXHL 5C08D 3ZE1E 4DK6A 2AQ2A 2YPLD 1P4IH 3FHAA 3SDAD 1RIHL 2PCPB 4PJ9B 3UZEA 1D5IL 5I1CL 4ZD3H 5D1ZC 4HFUH 1JUFB 2PTUA 1ETZB 3O3UN 5H2BB 2IFFL 3GIVA 3OPZH 3PHOA 5ANMB 3RUGF 1B90A 3MRJA 1NLBH 1QSFD 5M94B 3MA9H 2FIRT 4PP1C 2R4SL 3L5IA 2Z91B 1BVLA 2I60H 1QR1B 2WBJC 4OKVB 4TPRL 1KB5A 4N0FA 2WUCH 4JREC 2I27N 3T77B 2UVEA 3L3KA 4X8XA 1OTUD 3NIDF 5HGBB 4EQ3A 4CMHC 3VXPB 1IKNA 4Z0XB 3SJVD 5L2KA 4XCYB 5C0JB 2W9LA 3H6JA 3SKUD 3WFCL 3LEXA 5KOVC 4LNRB 3C5ZA 1VB9A 2ZPKL 5FM5M 2JTDA 2PO6B 3KYNA 2BC4A 2J8UB 3ECBB 3ULSB 5T1LA 4JKMA 5LGKA 2DI9A 4NNXB 5H35B 4YEFA 3EYSH 2XN9A 4DJMA 4Z76B 5KVEH 5JW3H 5JPNB 3QFJB 5FM8A 2CK2A 1MRDL 1UB5A 4EJ1C 3ORJA 2BP3A 4IS6B 1QBLL 1KJVA 2W9EH 4FTVD 1Q9OB 3V5HB 2I07A 2YC1A 4HWUA 4LSVL 1L9MA 4YXLH 5FYLD 1JPSL 4KRLB 5GXBB 3O6FB 1F5WA 5FYJL 1RK1B 5C9KA 5GJSH 3WLWD 4DW2L 3ROOA 4NQCA 1UB6A 4JGJA 4Y4FC 3K8LA 1UZ8A 2DQFA 1FP5A 2YXFA 5GQBA 3LSOB 4D9RE 4PJAA 3S3JA 4I48B 3WIFB 4WY7L 4I5BB 5T1MB 5TJWK 2NY3B 3DLQR 5DD5H 4OCSL 1JGUL 2AXFB 1IBGH 1ZT4A 1EK3A 5HHOD 4EXPX 2XWTB 1J5OH 4UQ3A 3UPCA 4OFIA 4UAOB 5HHNB 3MRIB 2AEIT 4FP8L 1U8MB 4WHYH 4PRHA 2ARJA 3B6SA 4MJ5B 4J6RL 1RURH 3F7RA 3DV4A 4LSSL 4YHLH 1YECL 4Q6IA 1CFNB 1U6AH 5L7XL 4LPWA 5AG9A 5HHXL 3DXAA 2IFGA 2DKMA 4HC1L 2FH8A 1ZHKA 4N9OB 3HNSL 1A6TB 3G5YA 4ZDHB 3N9GH 4IRJA 1N5AB 4QHUB 2L4OA 1FFRA 4PRNA 1DEEB 4L9LB 4KUCD 1LVEA 1OP3H 1T20A 4JG1L 4LSUL 5JIIA 2BX5A 4GKZA 4NC0B 3D9AH 3FFCB 1UJ3A 4J3SA 3ZYZA 1NCBL 1KN2L 3E0GA 1E28B 3ULUH 3IDIB 5DVMA 1KOAA 1RJZB 4C58B 1OPGH 1JPFB 1EEZB 2DBJA 1LEGA 1YEGH 3PV6B 4K23H 3RL2B 1BIIB 1NUGA 1A7RL 1E4XH 3H9YA 3WXVH 3BZEA 1TJHH 2FX8L 4MQSB 4S1SL 3DARA 1AQDB 1I3GL 1CE6B 4DOHE 4HUNB 4PRBA 2QQQA 1MLCA 1SVCP 1IAMA 4OQTL 1JVKA 1JNNH 5TPWH 4RX4A 5GRZA 3PQYB 2DWDB 4UNVA 1QLFA 5K33A 4H8WL 4WTWA 4E0RB 1LEKB 1GGBL 3R1GH 4ZODA 2ZSVB 4FMKA 4X7CC 3UJTL 4DGVH 5IUSA 3FT2B 3GMOB 3UTZB 2W60B 4G9FE 3ZHLA 3BXNB 1AGEB 1BD2D 1J8HB 2JK5A 5HVHB 4L3AA 3GBLA 3O8XA 1XGUB 3DV6A 3FZUC 5F96L 3RWCA 2Q76A 4H88L 1CK0H 1ZMYA 4NRXB 2XY1A 2FCBA 3BYTA 3H7BA 5IHLB 4YHIB 1QHPA 5IG7B 3MUGA 3I6KB 4NRYA 2CJUH 3MLPA 4Y19D 5EORH 4Q9QL 2KKQA 5HYJB 1MJ8H 5DMJB 5FYJU 2CDFB 4D9RD 1NCWL 5CSZA 2NW3A 4FQCL 4TUOA 3TLRA 5ECJE 3LKQA 1DVFB 3FO1A 5EUKA 5EN2B 3PGDB 1BJ8A 2AJVL 5C08B 3MRNA 4JR9L 1U93B 1JP5A 2YPLB 3TVMB 4NQEB 5F9WB 2F74B 5JDJA 2FWOB 3DX7A 3KWWA 2Z31C 4XNYH 2G9HA 2ESVA 3CJJA 1ROWA 4K3EL 5HHVH 4O9HH 1RMFL 2VWEE 4XT1C 1ZHBA 3CAFA 2A6DB 3WEXA 4PRAB 3MA7B 3IVKB 2FZ3B 1EBAA 4WWKA 2ED8A 1DSFH 5A2LH 2FB4H 2HVKB 1FNSL 2ZCLH 3QQ4A 2OJZL 3S36H 5DJ0A 4M4RA 4B7LA 3SJVB 3TIDA 3SDDD 4HUWB 4ZUSB 1GZPB 1HYRC 3C6LC 1MCKA 2IADA 3DX8B 1P1ZA 3L3DB 4JFFB 3B8SA 1HEZB 3D2UA 4KUZH 5KTEL 2A6KA 4KMTL 3JV6B 1CD0A 1T1XB 4HWBL 1TDQA 3KYAA 4P4KC 3DUSA 1P84J 4NRZA 4IRSC 2YOCA 4J3XA 2MJWA 4ZXBD 3HR5A 4ZNCD 4XVTL 4FZEH 3HHRB 3D48R 4RA3A 2EIEA 4LSPL 1EHLH 3VH8B 4HD9A 4JFYA 1GHFH 4Z8FL 1JTOA 3GIZL 5ESAA 4WJ5B 4HWEH 4LF3A 4UNUA 4NNPL 3BSZH 3RU8L 1VGKA 1HXYA 3W9DA 5FKPA 4XBGA 4JQVC 4OF8A 4PB0H 3BZFB 2MCG1 3SE8H 4ISVA 4R0LA 1T83C 3PNWB 3UXFA 2VJXA 1YY9C 1OTTD 5C8JA 4P9MH 5BRZB 2AKRA 1YMHA 2AXJA 2YR3A 5DEGB 3VFNB 2OTWB 5EU5A 1VKXB 4HS6A 1OT2A 4F37F 4LFHG 1CFTA 3IJHB 1G1YA 4YX2H 4PRIA 3CX5J 1KJ3H 4RWYH 2D0GA 2MQ3A 5LQBL 3M8OL 4U0RC 4WEBH 1LNUB 4D3CH 1IC4H 3GMRB 1FV1B 3C60C 5HGAB 2AJYL 5EBWB 3EYFA 3MRBA 4K3JL 4WGWB 5CJXC 3GHBL 3VWKC 4OZHE 4L4VA 1OW0C 1A3RH 2D03L 1Q0YH 5BVPH 5ENWB 1C7TA 3OMZA 5FK9A 4GW1A 1DQQA 4ODSH 2ADFH 2J88H 1T0NA 4U7KA 1RIUH 2YD3A 2CKBH 1DQTA 1S7VB 4F3FA 4HBCL 3QPQC 3EJZD 3HS0A 1ZHNB 5DMYA 4ZSOA 2XFXB 1RZ7L 3IFOA 3PP4L 4JPIA 4Z18A 3DSFH 3JTTB 3GSXB 4HG4J 4YWGL 1ZLWK 1IQWL 4H0GA 1OB1A 3ZLQC 4C56A 5CLTA 2JE8A 3OHXB 8FABA 3DOSA 3FO2A 1IKFH 1Q0XH 1G7QB 2F58H 3L7EA 1G7JB 3HI6H 2VB5A 2BHUA 1E6OL 5D2NC 1VEPA 2AK4B 2AABL 2R8SL 2DQTH 3ILQC 3QUYD 4M6NH 1YEHH 3EYOA 4JE4B 3AS3A 3BJ91 3WN5A 2R0KL 4ODBD 2X1OA 1BJ1H 1XR9B 3KPPA 5EU3B 2DQHH 3NN8A 3SGDI 3F7PC 4UTAL 3NH7L 5IMMB 4ZFOL 5BMFH 1KPUB 3T0XA 3WUWA 1BEYL 4ZAKD 3OAUH 4HT1L 5E6ID 3FJTA 5I17B 1G9EA 2VDOH 1AD0A 1ONQB 4HCRH 2UUDH 2BVOB 1BD2B 5IQ7L 3MMEA 1JZ6A 5D1QB 4G7YH 3QWOA 5EC2B 2FH6A 5TF1L 4D94A 3PL6D 4OGXL 3TJEL 1MFAL 4PBXA 2O93L 1GGIH 25C8H 2DS4A 3M1BA 2JJTC 5T33H 4PJ7B 1CN4A 5FIEA 4Y19B 5IBUB 3L5HA 5FO9B 3TYFB 1ZA3A 2J4WH 5AUMA 5B38A 4U1LA 3MNVB 3SDAC 1AGCB 3FQUA 2EYRB 3HE7D 2DLGA 4XPAL 1Z3GL 2CK0H 3G9VA 1J1XH 1EFXA 4OJFL 5BXFB 4XNQA 1KENH 4X6DE 3KAAA 3TNNB 3H2WA 4Y4HD 1Z9MA 5FGCB 5ALBL 1S7UA 3EOBA 1PY4A 3VCLB 5FHBH 5L8JB 3VFRA 3RKDD 3O4LE 2Z93B 4NDMB 4U1JB 1CLZH 5JHLH 2V7NA 4G6JL 1OTSD 1F6AB 2APVA 5I6XB 1XT5A 3SKOA 5F7FA 1J10A 1A5FH 3HZYA 2DJSA 3LKRA 3T65A 3VDBA 3DX9A 3SDDB 4HCRA 1IGIL 1KNOA 4K8RD 1CE1H 3D39D 1NLDH 5L6YH 2BY2A 5DJYA 1WAAE 5TDOB 3CGTA 1LE5A 1B2WL 5GGUB 4A2MA 4DVRH 7FABH 4TNVF 1T7VA 1FNAA 1AO7E 4NP4H 2J12B 4ZXBB 4FQ1L 3WKML 1FZJB 1T80A 1BPVA 3E8UH 3I75A 2HH0H 1P7QA 5JIKA 3GMPB 3B2UD 4I18C 3WLWC 3WUZA 4Y5YB 1MJUH 3HC4L 5TGBA 3P3YA 1VSCA 3ZKND 4XMPL 1F4WL 1K9TA 4DKAA 1FJ1A 3AU1B 4XP1L 4Y1AA 4HHAB 3VFMB 1K3ZA 3GSWB 4POZD 5GS2D 3GSRB 1HH6B 3DHMA 3RVXD 2IANA 4M1CD 3BKJL 3NCFB 3MRLA 4P46C 1U3YA 3NIGE 5E6YA 5D8JH 1D5BA 4PJBB 2Y06L 2XZAH 1S9WA 3L9RA 1DBJH 4YQXL 3CH8A 6FABL 1NCAH 4Y2DB 2H32B 5GSRA 3GSUA 5JA8B 1BHGA 1P9MC 1FZKA 3DO7B 4ONHB 3QULB 2BSED 3CDGB 2YRLA 5KAQF 32C2B 1VPOL 4H20H 1V05A 4GBXD 5CUSH 3U1SH 2NXYC 1TZHB 2EIDA 1V3MA 4HSQA 4BK5A 2N1KA 1U3HD 5EU7E 4WFED 4NQDE 2A83A 5F3HB 4ENED 3S8WA 3T4AB 1DUYA 3GM0A 3EO9H 3PWNB 5TE4L 1I9JH 1KIPA 3BAEH 4P4RB 4JM4H 1NCUA 4NBZB 5JOPE 4DKDC 2CLVA 4ONFH 4K3HA 4PV8A 3MYJA 5MEOA 1BJMA 3PGCA 3RWDA 2IWGA 3OX8B 5ESVA 5HGDA 1YNTB 1ZS8A 3MJ7B 3QFDB 4HF5H 4UU9B 2HYMA 3IYLW 4HPOL 4IBLT 5KSAD 3WNOA 5SX4H 4JLRB 4AEIH 5AAWA 4HPYL 4QGYA 2NCMA 5FKAA 3TPKA 5FM4A 3JTSA 3WLBA 1D9KC 4LVNB 4OZHF 3DUHA 2Y36H 5C0BE 2ZG1A 3MRDB 3O9WB 4EDWH 3CLFL 1JWSA 4XWGL 1ZVHA 1NBZB 2IALB 2UYLA 3WD5L 5I2IA 5EBLB 1KN4L 3IETA 3HE6B 3B5GA 3IDNB 4PB9H 4HKZA 5E8PB 4F7MA 3FTGB 3K2UH 4X6EB 1SYVA 1GGCL 2B0SH 2Z35A 2YSSB 4PJIA 3DNKA 5ICYB 1PVHA 5JR1L 1HZHH 1AXSA 2C4FT 3HKFA 5GZND 4B5EA 3N85H 3AB0C 3Q3GB 5GPRA 2FEEL 2CR6A 3RWJA 3TCLA 4I3RL 1HN1A 1QPXA 4NC1E 5D2LA 4JN1L 4V1DA 3GSNH 4R3SB 1LWRA 4BYHA 1RHFA 5E6IB 3LV3B 5IF0A 2NY7H 2FIKB 3CFJA 5JHDE 3ZDYE 1FFNB 1RUKH 2EH8H 3K3QA 3PL6B 3ESUF 4JFXA 4I0PA 4HV8B 3VGFA 2C1OA 1ZTXL 1KCSL 1TJGL 5DEZA 4PP2B 4QRRE 3STZA 3GSQA 2H9GA 3RI5K 3RTQD 4HQQH 4EOWH 1M6OA 1K8IA 5IEKB 3QXWA 1MFNA 1BQHA 2B1HL 1WFOA 1I75A 2ORBL 3UMTA 5I8EA 4KRMB 1PG7X 5BJTA 4K94L 1NGYA 1YUHA 1ZEAL 1CLOL 4O51A 5EDXA 5I8OH 3T0VA 1N8ZB 3AROA 4NQDD 3NFPA 4U3XA 2ATPA 4D8PB 5KJRL 3GSOB 4QTHB 2JIXB 3MOAL 4M48H 3H9HA 5F88B 4HS8L 3THML 2VZVA 4W70A 3P4LA 4APQA 4ORGB 2AK1L 5I9QB 2IAMA 4LRIA 2EKJA 1U92A 1FAKT 3LY6A 3KXFB 5F7LB 5L2KE 1P4BH 2CDEA 1BIHA 3GMLA 1MFEL 3DVFA 4OM0L 2XZQH 4PRPA 2FHCA 3MUZ1 3IU3B 1LO3H 4X6DF 3NABH 5IMKB 2P43B 2P8MB 5HJ3B 5JQ6L 4ONGL 1MQ8A 1BMGA 1R24B 3NAAL 3FOMB 4MD4B 5ESQB 5E24E 1N4XH 4Z0BH 3EHBD 3KDMA 5KN5B 5C0BD 3FFDA 2R23A 3CMGA 4KTEH 2XN9E 5FOJA 4NFCA 1HK6A 3KJ6L 3VFOB 3BYYA 4LVHB 1KYOJ 1RJYA 3CIQA 3D39B 5E99H 3QXDA 2PUQT 5A1AA 2DQEL 1CXEA 3WHXA 3PWJB 3TEUA 1FCCA 3U4BH 2E7BA 3AS0A 2OMNA 1IAOA 1R3LB 1CTOA 4PLNC 1ZVYA 5DMGC 4KQ4L 2JJSC 2Z9TA 4XMKL 4OZ4B 5GHWH 2X5PA 4X4MA 2OK0H 3ES6A 3ARGD 4G42A 4NQCE 3S4SG 1OTTC 2R15A 1T5XA 2GTZA 4HGWB 1WAAF 3D3VA 1DP0A 3EOAA 5GZOD 3SY0A 2GK2A 1MFCL 4IHOB 1YPZB 4OFYA 3AAZB 4PJAE 4FQXA 3O41A 5I1DA 3VFGH 4ZPTB 2Q7NA 5FXCH 1MCHA 5DEFA 1V7ML 5BQ7A 5DJXA 4YDKL 4G8GA 5JHDD 1TENA 1W0WA 4PRHE 4KVNH 4EI5D 4R9HA 2LE9A 1SYSA 5EOCH 4JCMA 5J6GB 3FN0H 4QRRD 4UT9H 4GBXB 3DXAE 1I4FB 3IF1B 3MLRH 3BKMH 3QI9A 1HSBB 3NIGF 1U3HB 5DK0A 2OL3H 2OQJA 3UO1L 5CMAB 3P77A 2R2HB 2WBKA 3GUTA 5F44A 3K4DA 2ZUQC 3I50H 4QGTA 3EJZC 2VWEC 1RV6X 1KEML 5CGTA 5I1EH 5D5MB 1MVUA 3IAQA 3I84A 2QSVA 4X6DB 1RPQA 3AXLB 2UY7A 4NGHL 1MI5E 1LO2L 1HILA 3SGKC 5DR5H 5IB5A 4WHTB 2VKWA 3U7YH 3VRJB 2N4IA 4NFDA 4YEEA 2DN7A 5I1AB 3ZYIA 2P7TA 5L2KD 3ZTNH 1IFHL 1AGBB 3MBXH 5ITBL 4QXTA 3C5ZD 1G6VK 5DJAB 1K4DA 3QO1A 4KPHH 1OAXH 3HC0A 4RGMB 5F9OH 4CNIA 3QUYC 2VMFA 1NBYB 1Z0NA 4XBEH 2Z0BA 5J13C 4XPBL 2YEZA 4L8DB 4GKOA 4XX1E 2CUIA 4QRTB 5JXEA 4LLMB 5TDPB 3G6JA 4JHAL 5FYKD 5DJDA 3U0PB 4DGIL 4F7PA 3QBTB 5ACMA 3CFEA 3SDYL 3VXUA 5C9JA 4ZAKC 4Y16B 4HMEA 3FQXA 5DJ8B 1ZANL 3DURB 3QUXC 4FQHB 1TLKA 3EW3B 3EYUH 4WU5B 3TT3L 1F4YL 1FBIH 1MLBA 2X89A 2OL3A 4OGZA 3BDYL 5FFLA 1T1ZA 2MHAA 4YDVA 3E2HB 4AL8H 2OBGA 4NQCD 3P4NA 2BVQB 4KJPC 4LIQE 5DJ2A 1A14H 4QYOA 3KGRA 4Y4KA 3QCUH 1W0VA 5DD0H 4U3CA 2GITA 3ZKSD 3G6AA 1ORQB 3S34L 3FONB 1QG3A 3V52L 5CWSB 3HE7C 4CN6A 1RZJC 3P30H 4NJ9L 4I3SL 2OXHA 1G9NL 3F7YA 5IOPB 3TO2B 5IJVA 1UEYA 1F00I 3T08A 1BGXH 3IFLL 4HBQA 2VIRB 4Y4HC 3ZDYF 2ESVE 4P2QA 2GSGA 4OB5H 3IKCB 1BFVL 1JMXA 4PTUA 1JNHA 1D6VH 4QXWA 4WI5A 3RNQA 5EFIA 3HMXH 1HQ4A 4NQDB 4IRJD 5TE7H 3RKDC 1DBBH 1KELL 4G9DA 2VDPL 4JFOA 5DRWB 5INDB 2YD8A 1PX3A 1IMHC 3BEVA 4HUMB 3HRZB 2HLAB 1L0XA 4LLDA 2NY2D 3TV3H 1JZ3A 3BP5B 5EG6C 4Z6AT 1UH4A 1MI5D 1T0MB 2P5EB 1RHHB 2Y7QA 2Y5TB 3KPSD 3QDMD 2CSPA 4K8RC 1OGAB 5GGSA 3O2DL 2YUVA 3QIUA 4PJFB 5L2JA 1MPAL 5JDSB 3ZKQD 2F5BL 2A74B 4ZYKB 4TVPL 1Z6JT 1S9XB 5C0BB 2FYYB 4LCIH 1WBYA 4N8PA 1H3VA 4MXQD 1DANU 5LG1A 2NW2B 4BZ1H 1AKJA 3WIHA 4AY0A 3K8KA 4GOSA 1EJOH 4KHTL 3B2UC 4L3CA 4P23B 4Z7UB 1PG7L 4JY5H 1CVRA 3LPFA 4WW2A 3T8XA 1LEIA 1T22A 3QEQA 3ZKNC 4G6MH 3BX7C 1JF5A 1U8HA 5M7QA 2IGFL 5IW6A 4GKSA 1I8MA 4H25A 1CGSH 3NFSL 1CT8A 4L3EA 2NY6C 4NOFA 1OAZL 1Q1JL 1W8OA 1FFPB 1QFWL 3MV8A 1WBZB 3ARGB 4QRQB 4Q0XL 4RFOH 3KYMA 4M7LL 4GUPA 1WITA 1A2YB 2WIMA 5D6CA 3PGFH 1FH5L 1Q94A 3HMXA 3RWHB 2OZ4H 5GSVB 4W4OC 4GT7A 4CDGC 1E27A 5IKCB 4OGYL 5FGBC 4PRIE 2BJML 4JHWL 5KBNC 5JHDB 4L8CA 5MENB 5DUBA 4EI5B 1FDLH 3W2DH 1L9NA 3B9VA 5IQ9A 1JYWA 4MAUL 1HDMA 3WFHA 2FJGB 3ROLB 4L4VE 1T21B 4PJAF 4CL7A 2VRAA 5FECB 5SV3A 1M7DA 1X4YA 2FJHA 5LGJA 2P24B 4PJGB 3M07A 2ESVD 5KSAC 2A9NH 2OP4L 2EDBA 5CIPH 3VXSB 4I2XB 1LP9A 4ZSOE 2Q7YB 3MRJB 1R5WB 1DQLL 2ADGA 2D9CA 4NFBA 2NR6C 3DBXA 4XPGH 2BVPB 4WWKD 1NDMA 4K9EH 4GRWH 4C56E 2GJ6B 1C08B 1BM3L 5BZDB 1QBMH 1A7NL 1YEDB 1JHLH 2ED9A 1WTGT 3KLHD 4NWTL 1TVHA 4QCIA 2DKUA 1UXWB 3JUZA 5D7JC 5IGXH 4K71B 1BFSA 2ZZUT 3MXWL 3IU4L 1P5UA 2OZ4A 3SBWA 5HPMB 4ODHH 3MRHA 1A6VH 4FZ8L 3X14A 2X44D 3FO0L 4QOKB 1IAKA 2VLRA 3BIAX 1GVIA 3NZ8B 3QHFL 3ARZA 4IMLA 4XHJD 4WUKL 4XP5H 1E4XI 3QXTA 4P3CL 1RZ8B 3U83A 4OCMC 1PW3A 1RVFH 1N6QL 1UACL 4WHDA 1F11A 4HUUA 4P3DB 1F3RB 5HI3D 5KVGL 4NKMB 2X9YA 4HH8A 2R2EB 1UADC 3V6ZB 2PXYA 3BI9X 3DI2B 4OTXL 2C7UB 3KLAA 4PG9A 2G75A 3ARBD 3P4OA 4QXUL 1RUPL 2DQJL 4OFPA 1A6WL 2R2CA 1Q72H 3U7WL 1QNZH 4YGVB 3QDHA 3MTRA 2VL4A 3C09B 4LLWB 2EIZB 5CIPA 2GJJA 3RTQC 2DI7A 3CU7A 4NWUL 5GS1A 1T2QH 5GIRB 2CKNA 4RRPG 4YO0A 2YD7A 2XI9A 3G5VA 4OZIF 5ADOH 3ZL4H 1A7PH 2DBLH 4XBPB 4PRID 1F58H 2V5TA 2H45A 3BO8B 5SWZB 5CJ5A 4P4KB 4O2FB 3LEYH 3VFWB 2VDML 1F4XH 1G7IB 3TPUA 4FNLL 4MDIB 3RA7H 3HC3H 2WLYA 5HHQB 3WS3A 2X4OB 5FA4B 1S7TA 1DR9A 1HINL 4BKLB 3L7FB 1T2JA 1QACA 4I8DA 4Z7WA 4LLYB 3L3JA 5EIIB 5CEXA 2XG4A 2GT9A 2QSCL 1FVCB 3RZWA 2V9QA 4F8QA 3VJ6A 2DM2A 5TH2A 1A64A 3V5DB 2NY2B 4G8FB 1K85A 4PJEA 3ULVH 3UX9B 2NY0B 5EZIH 1MI5B 1G7PA 2C3VB 3LRSB 5KANG 4C56D 4H1LB 3KPSB 3QDMB 4LCWA 4XCCH 2OM5A 2ADIA 1EV2E 2Q6WB 1NGXA 5I16A 5KW9H 1S3KL 3GI9H 3IGAB 3MRKB 1K3IA 4PGJA 4ETYA 5LVEA 3DSNA 3VA6A 2BOBA 5KSUA 4H0IA 2I26N 5IHZA 1S7RB 4OLZH 1QSZA 4U1GC 4KXZH 5JMOC 1JPTL 3VWKB 4R4FH 1TNNA 3MFGB 1SJHB 4YXHH 1RIHH 1X44A 4Y1AE 3WE6A 4A2LA 4JKPL 5DRNB 4NC1C 4ZG1A 2M26A 1FO0L 5GZOC 2A1WL 4S2SB 1QLFB 4KK9D 5C0RH 5DDHA 2IANE 2WK2A 4QF1B 2IFFH 1AGFB 4M6OL 2WWKO 1F6FB 4JHBA 4K7PX 1S5HB 3BGAA 4OZIB 4F15C 2R4SH 1XGYL 1VFAB 3UDWA 4F9PA 4MS8D 4TPRH 5J06A 1DBML 2YUWA 2B2XL 3GSVA 4GRLC 3IFNH 3RWFA 4TULH 3VXNB 2VOTA 1X5LA 1ZV5A 4WI7A 3DX6B 3HUJE 3SE4A 1X5JA 1YN7A 3N1QC 1F3DJ 2V2XB 4YFLI 3WFCH 4IIQA 1G7MA 1IZKA 4UQ2B 4CUCA 2ZPKH 2X9WA 4TUOB 5IW1B 4ACPA 2XQBL 3TZVA 4Y5XA 3FOLA 4D0CA 4R26L 3DYOA 3OR6A 3VH8G 4E42B 2YD5A 3MV7B 4YBQD 3J8F7 4RFNB 3UPRB 2WV3A 5ICZA 4XXCA 2OI9B 1MRDH 5DJCA 4CMMB 4NUJA 4WTZG 5C3TA 1NFIA 3SO5A 1A9EB 5HYSB 2DLIA 3REWA 1ADQL 1FYTB 3NCYP 1H8OA 4LSVH 3QA3B 4OIIH 3TP4A 3GMMA 1JPSH 3MBEA 1RZIA 5FYJH 2FNBA 2OMBA 3C5ZC 4U3HA 5E9DE 3TWCH 4F58L 2BY1A 1EO5A 1P5VA 1JTPA 3FN9A 3MCG1 4K3DH 2G5BA 4J8RA 3MFFB 4ZO6A 3F7QA 3KPLB 1YJDL 4N0UB 1JJUA 3MOQA 4CJ1A 1WEJL 35C8L 3IDJB 3RDTB 2E27L 4EIZC 1S7XB 5JXAL 4OT1L 5L9DL 4WY7H 3VFSB 1OSZB 4UINL 4U1NA 5I1IL 4OCSH 1JGUH 4NO3B 5B22A 3WIIL 1XCTB 4FP8H 4X0KB 3NTCL 4BA8A 1ACYL 4ZNEA 4XH2A 2XXMB 4LSSH 3WNPA 1YECH 1E4WH 5D9SB 1JYXA 15C8H 5F7WC 5L7XH 1C7SA 4V1DE 4YFLF 5HHXH 2V7HA 4KI5D 3MGOA 3LD8C 3EOTL 1GOHA 4XRCB 2E8ZA 5DD1L 1T04B 5ILTL 2VLLA 5DHVH 3HNSH 2G60L 2J6EL 1BF2A 1NCCL 5SWSA 3L3HA 3W9DB 2XWJA 3O81A 3ARBB 1S9KC 5BOPA 3WFEH 1ZHLA 1U58A 4PBWD 2YS4A 3BD5A 1Z5LB 1HI6A 3KS0J 4JG1H 4LSUH 3UTQB 4LBEA 1Y6NR 5FOBA 2C4XA 3SPVA 5C8JB 1E0OB 4C83A 5E00A 1A1NA 1YMHB 3DMMA 4N68A 1NCBH 4L4TA 1KN2H 2CIKB 1J88A 1N5YL 1SBBA 5CD3B 1JIBA 3RAJL 3DUUA 4ZUUA 2VDRL 2YD2A 1J87A 3GJEB 3TBYA 1ZE3C 4XCEB 5AD0A 1AXTL 4FXKB 1UCTA 4IRJC 3UCRA 2FX8H 5H94A 2A77L 4PJHB 4S1SH 3KR3L 1A1OB 3C9NB 3ILPA 3QEHB 3IXAB 5C0DB 4OQTH 1DE4B 2NY1C 5B8CA 5E2VL 4KK6D 4CW1A 1UJ3C 4YDLC 1Y6MR 3I3DA 4X6FB 4HMCA 2Z8WC 4PRPE 3ZDZE 4NBXB 3V4UL 1NUFA 1PSKH 3P9MA 1ZLVH 3UJTH 4KJWC 1XIWA 3S5LA 1WWWX 4G8EA 4HUXB 1NMAL 1EEUA 5DHVA 1UGNA 4H88H 5E9DD 4JRXD 5M95B 1J05B 4GG6A 1EDQA 1T4KB 2UZXB 1A6PA 4HK3J 4Q9QH 2HJFB 4GO6B 4XWOC 2GTWA 4HLJA 4LEOA 1D7FA 1NCWH 4FQCH 1CG9B 3NBNA 3OZ9L 4UIKL 1A0QH 2D7NA 4X4ME 5CJ8A 1IGTA 2W59A 2CUMA 4ODXA 2AJVH 1I1YB 4JR9H 3BEWB 3KYKL 3CVHB 3V5KB 4NJAL 5MEPA 4PBVC 4S1QH 4PJ8D 1KT2A 2QQNL 3O8XC 4U6YB 3QUZA 1WK0A 3RGVA 3PDOA 3OKDA 4K3EH 1CXHA 3PXHA 5F1NA 3OTTA 4U6HA 1AGDB 5IVOA 5BV7B 1HHIA 4FXGA 3L3IB 3DWTA 1QP1A 4G8GE 1YMMA 4OQTA 4PRDB 2HJKB 5E2WL 3W39A 4G8IB 5AEAA 5B4MD 3IFPB 4G3YL 4I0PD 3RVUD 2B4CL 1XF3B 3EAKA 3BW9A 3KG5A 2ZOLA 5CEYA 2ZJSL 3ULUC 4U1MB 3GHEL 4N8VA 3U9UA 3WNMA 3RY4A 5JORB 4I77H 3DVNB 5K93A 1CBVL 1C5DB 2DQGL 3UTSA 3UTPD 5ACZB 4KMTH 1S78C 2Y9RT 3RL1A 4B41A 2KZWA 4KJQD 5C0CE 3W0WA 2MWCA 1IQDA 4GKNB 2ITDB 1MIEL 1G6RB 2E6QA 5F7DA 3HUJF 2X4UA 2CH8A 3REVA 2EDJA 5FYKL 4WWKC 5LCVL 4XVTH 2D31A 5FHAH 3S3PA 1I7RB 4LQ1A 1Y18B 4Z8FH 4APQD 3GIZH 3ARTA 4JANA 3RY6A 2IAMD 4PYHA 1U8KA 5CGYD 4FQ2L 4K7PL 2EDHA 3WL9A 3ZKXB 3TBSA 4KKLD 3VFRB 1O5DT 4LLQA 5FO7B 4YHNA 3RU8H 4L5FL 3LB6D 4LEXL 5HGGS 1SVZA 1FYHB 3OJMB 4MNQD 4P2OA 5BVJA 4LMQE 1N59A 3FCTB 4MWFB 2Q8AL 4RGNB 3V8OA 5SX4I 2XWBB 1VEOA 1NC4A 4FFVC 3Q1SL 2VSDA 4RMVA 1A4JA 3H3KA 4KZDH 4XGZA 3HZYB 1NGWB 4ZS7H 1NEZB 4Y8DC 1YC8A 1U8OB 3QRFM 3BOVA 4XHJC 5IB2B 6CGTA 2W65B 3G6JE 4FG6D 1MH5A 1YNKL 4Q7DA 3H0TA 3TO4D 5C70A 4M9OA 2XKNA 5HI3C 3M8OH 3C87A 4I4WB 2AJYH 4FFZL 4GS7C 4LSTL 5T5NF 4R4BB 4PLJD 3GHBH 1L0YA 3QJHB 3EDDA 5C86A 3RBSA 3ARRA 4HJJL 1ED3A 4Y5VA 1OQOA 2YUZA 4PJ5B 3OKMA 2AEPH 2JF1A 1SJEB 5A2FA 1KJ2L 4OFYD 1KIQB 3SHSA 1OHQA 1B0GB 5IBTH 3CFKB 3CNKA 1RZ7H 5I71C 1CDBA 3TYGL 3PP4H 2BRRL 4G8GD 4OD1L 5E1HB 3G04A 4YWGH 1IQWH 3VFVB 4X99A 3NCYS 3CPLB 4U6TA 4U6VL 4JZOA 2IH1A 3HLAA 4P2QE 1XF2B 3HUJB 4JY4A 2VLJA 1NBVL 5CCKL 5B3NA 5I0DA 4NQXB 4HH9B 1JL8A 2AABH 2R8SH 3QG6B 3BZ4B 5C0IA 2ICEA 3BT2L 3STLB 3L5WB 1IC7H 1HKLL 5C0CD 2R0KH 1ES0B 1F3DH 1MAMH 3K1DA 4KKNA 1JWMB 4UTAH 2CRYA 1FVEA 4M7JH 3NH7H 4XAWL 4ETQA 5MP6L 2OJEB 4KK8D 3UYRL 5KAQG 4MXVE 2BSTB 1ZA6B 3PWVA 4QRPB 4XNZB 3I2CL 5IQ7H 2W91A 5FYKU 2P8LA 3CFDB 5EOTA 4YGAB 5TF1H 4OGXH 5GGSY 2OTUB 1MIML 5E9DB 3TJEH 1MFAH 4JRXB 5AYUL 1CIDA 5DMKA 5HYFA 4OAWB 3ZDZF 4UTBL 3CK0L 5E94A 4NZRH 1KIRA 2Q86B 4OCYL 3DTXB 4F7CA 5C6WH 3QEQE 1L0QA 3WN5C 1RZGA 5HI4D 1WIUA 3HG1A 5JXED 1BZ9A 1U42A 4LCCA 3X3FL 5CBAB 4HUVB 1DBAL 3SCMD 1CGXA 4YHKL 4XCNB 1TQCC 2OR7A 4KK9C 4MA3B 5IEHA 1OF2A 2OCFD 3R4DA 4O00A 3MV8E 5J89A 2QKIA 2Z4QA 3C8KA 3O3EB 4PJ8B 3QEUB 4FQIH 3MLTB 1KULA 3X3GH 1J0ZA 5ALBH 4MS8C 1VERA 4MD5A 1NFDA 1T1WA 1MF2L 5E8NA 4KU1A 4UIMA 3ZTJG 1KLGB 2AV1A 4JFZL 4Y4KD 1SHMA 1ZXQA 2PCPA 4LMQI 4PJ9A 4IOFC 2VQ1B 3H3PL 4U1IB 2DLEA 4G6JH 3TBWB 3LRGA 3QIWD 1JUFA 5F70A 1ETZA 5J0BA 3O2WH 5H2BA 5E1AB 1UVQB 4RZCB 3D0VB 5ANMA 5C0NC 2NYYC 2Q3AA 2YZ1A 1LDSA 1IGIH 4YBQC 1FNEA 2Z91A 3BZDA 1QR1A 2BNRB 4OKVA 4YC2C 1JZ2A 2AGJL 3LVEA 4XPHL 3T77A 4NM4L 2CMRL 3SE3A 1LP9E 3O6LL 4NZDA 3BESR 5HGBA 3K8MA 5IVZB 4Z0XA 4RMSA 4WGVB 3VXPA 2OSLB 3QUXB 4XCYA 2R0LL 3WXWL 4FQ1H 3WKMH 5C0JA 1W72B 1QBAA 4LNRA 5J8OA 4ODWA 3HC4H 2PO6A 2P48B 3TN0C 1F4WH 2J8UA 1SMAA 4XPTL 3ECBA 3ULSA 1CU4L 4XP1H 5IVNA 4NNXA 5DZNA 4LHUG 1HYSD 5H35A 2P4AB 5DTFB 4Z76A 4MNQB 3BKJH 3QFJA 3MUY1 3QIUD 5DSCB 1U0QA 3S9DB 4IS6A 3WHE0 1OP5K 3LHPL 1Q9OA 3V5HA 5GRVL 4YQXH 3EIFA 2VLRE 2AJXL 2MKWA 6FABH 3QNYB 1V8HA 1HHHB 4TNWF 4NHCH 1AKJD 3O6FA 4OCRH 3OV6A 1RK1A 2X1QA 3ABZA 1VPOH 1UA6L 3TO4B 1U91B 5BZWB 3QEQD 1IAOB 3BISA 2IG2L 5GRVK 3JBG7 5L8LB 1MCCA 4R2GD 4HJGB 3K0WA 3MRPB 3LSOA 5TE4H 4LOUD 3VXQB 3MRCB 4I48A 3WIFA 2EZ0D 4I5BA 5T1MA 1WZMA 3G6JF 2AXFA 1MJ7L 2F15A 3RNKB 2XWTA 2UVFA 5HHNA 4EUPB 3MRIA 5INCB 5TE6H 1U8MA 2FECL