4LBEB

Structure of kcsa with r122a mutation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeB01
3LIZH 2WQ8A 4Z7QE 1NAKH 3O6LH 5EOCJ 3GGWA 2JK5A 4ELMF 2GSGA 4UIMA 4G8IA 4ZNEE 1CCZA 3KLAB 4LPVA 3HN3A 1G7JA 2LU3A 2X4NA 3QQ4B 4JREB 5DEGB 3TBWA 1AR2A 1IILE 1YEKH 2EDRA 2PTTA 3QCVL 4N9GB 4RIRB 1QLRB 1LE5A 5TDNB 1OGAD 5KS9B 1RUPL 1KJ2A 3HZVB 2X2YA 3MRQB 1G6RA 4N8PA 1EEZA 3QHTC 4PPTA 5BV7L 3SOBL 1U3YA 5DLML 2NXZD 5FA4A 4NPYA 4FMFA 3C8KA 2Q76A 4DUWA 4U49A 5C0DA 4X6EB 2H45A 4KHXH 3CDCA 1X5HA 3PWPA 1Y6MR 3PWPD 5T1LB 3RGVA 3RGVD 1MQ8A 4GJTB 4QTIH 1UVQA 5HYSG 3MLYH 2VLJB 2CLRA 3P3YA 2NZIA 3WFCH 1EMTL 4M7JH 3FHAA 3IF1A 1UJ3A 2F5AL 1FZKB 2YEZB 4AEHH 4Z7VF 5HDBE 3VXNB 5C0BE 5DJYB 4K71C 1S7QB 1HSBB 2D4FA 3SCMA 4S1SL 4WWKA 3SCMD 5IR1A 3KWWA 1LEGA 5EU7E 3WS3A 1FL6B 4B7IA 1VADA 4H20L 4XVJL 1RZ7L 3MZTA 3NVQA 1PSKH 1R24B 2FEEI 3N1GC 3HE7C 5ERWA 1XCTB 1NAML 1ZT7A 2JTDA 3MREB 4OD1H 3NAAH 3V0VB 3MA9H 3SE3C 3UAJC 2MJWA 4PJIA 1EO8L 1WTGT 5K9QI 4YQXL 1GOGA 2W60B 2BC4B 3GMRA 3RNQB 1Z3GH 3AY4C 2HFFB 1U8HB 2AK4B 1FC2D 4PJCA 1BVLB 4J1UB 2QADB 3BEVA 1RJYB 4EUPG 4POZC 5SWSE 4X4MA 2V17H 4G8FB 3UCRA 4R4BB 3O6KL 4IMLA 4OLUL 4P9HL 1UKTA 1HIML 5CSGA 2HRPL 1K6QL 2LAGB 3FMGH 2W0PA 5DI8A 4HAFA 3IDGA 5IVZA 5D2NA 5F7EL 3SDCC 1S7UA 3TCLB 3L3KB 4M8VA 4UT7H 3N1FC 1FSKC 1S9XA 2H1PL 5FCUL 4HWEH 3AB0B 2LQRA 2EXYD 5HI5D 1AY1L 2CUMA 5JUEL 1R5VA 4M48H 1AGBB 3HI5H 5C6WH 4NKIL 2X70A 4DGYL 2D31A 4Y8AA 1JN6A 5GSVB 2ARJA 1GAFL 5C0RL 1NEZB 4RGND 2A6KB 3FQUA 4XVUC 3NIFF 3H6JA 4P3CL 4Y16A 2IALB 4Y16D 4Z6AT 3ZT6A 1TVBA 3EOAA 4LSTL 4X7SL 4FQCL 2FDBP 2YXFA 2P8MB 5I1AA 4CRPA 1RZ8A 5E7FA 1P1ZB 3MA7A 4YK4B 3RZCD 3RWGB 1EFXD 2DQUH 3QWQB 1FNGB 5CIPH 5IMMA 2P8PB 2XN9E 5A16B 4KK6D 1YEJL 4I13B 3CK0L 1TJHH 1U8KB 4H26A 3M1BB 5GRYA 4XNUL 1ZS8B 1MI5A 1FFNA 5B8CB 4N0UB 4JDTH 4OZIA 3V4UH 4JRXA 5DQJA 5I1JL 2G9HB 3HNVH 4JRXD 3QIWA 3CMOL 3QIWD 4Y2DA 4Y2DD 3S36L 4POYA 5F8RC 5DJZA 3ES6A 3MGTB 3MOAH 4DKFH 5DA0B 1HH6A 3LQMA 1HNGA 4PJ7F 1JZ6A 3RWJA 1P9MA 3QDGA 3QDGD 4NKQB 2JJTC 3S98A 4I3GA 4H25B 3IDNA 1JPST 5IROC 1ZHBB 2F53B 4GH7B 1MCCA 4H1LB 1AJ7H 3GUTA 3KYAA 1QBBA 3O45B 4GKZA 4GT7A 2FH6A 3QXAA 3SKMA 2P8LA 3H42H 3ZDYF 4Q2ZA 5KG9B 1A0QL 1IAOA 2IMNA 2ZJSH 1YEEL 2IQ9L 3LQAH 1N6VA 4NQCE 3H3PL 2H32B 3E2HB 3RL2A 3H9HA 2FATL 4Y5VC 4O2EA 3VWKB 5T1KB 4PJEA 5JA8B 3ARZA 2DQDH 5C0FA 3DRQB 3P4OA 3MRHB 4LASL 1QSEB 5IB1A 1DN0A 4PJIF 1I3GH 3MRRA 4P5KB 4WRLA 1VFUA 5EA0L 8FABB 3V6FA 4ZFOB 2GFBB 3SDXE 3QQ3A 4YZFE 5H94A 3QWRA 5C09E 5C2UB 2GHWB 3QWRD 1CE1L 3DPBA 4PJCF 3JZ7A 4JG0L 4HIHB 1OQOA 4PJAF 4LMQI 3HLAA 1HCFX 1AE6L 5HGDA 2AI0L 1T7ZA 1MHPL 3B3IA 4XCEB 1K5NA 4U1HA 3WEXA 5LQBH 1KPVA 2AJXH 2YA0A 4O58L 4NZJA 3WN5B 3UTTA 1NGZA 2BSED 4JB9L 4TNVF 2J8OA 3UTTD 4K7FB 5IVXB 4J3TA 1FPTH 4DTGL 2P5WE 1EZVY 2EKSA 3MRBB 3S4SA 5FKAA 4BFGA 4N5EC 4WW1A 3HPJB 3QCTL 4FQHA 3Q5OA 1VFOA 2CKBB 3LKOA 4XP1H 3G6AA 5GGRB 1MUJA 2UWEA 3L3HB 4C59B 3QO0A 4Q58C 1CXEA 2XRAL 1JV5B 3MR9A 5KVEH 5CIPA 4N0YH 4JZOA 4PY7B 4XZUA 5E8OA 4PJDB 3PQYB 4NJ9L 4NQEE 2DICA 5DJ8B 3UJTL 4A6YL 1J86A 3QIUD 4R0LC 4X7TA 2A0LD 4NRXB 3MRJA 1MCDA 1P6AB 2FWOB 3GIZL 4E5XB 5AWNL 1KENH 1NCCL 4UV4H 1MFEL 1FV1B 3GSQA 5IM7B 3S34L 1WFNA 5BXFA 1U3HB 5TF1L 2BX5A 3O6ML 4IM8A 3QZWB 4Q6IA 3LPWA 1PKQA 5E24E 3NGBC 5HVHB 4OZIF 5JLZA 4OBRA 5DHVB 3U9UB 1ZT1A 4KQ3L 4DAGL 3LKRB 3O6FD 4F58H 5D1XA 1QFWL 1Z0MA 5D1XD 3NPSB 4HJJH 3VW3H 4Y4FD 4GMTL 4PJ8C 2WP3T 3LS4H 3BPLB 3X3GL 1UM5H 1MRFL 4HKJA 3GSOB 2R0WH 1JF1B 4WUUA 4BZ1H 3ARDA 2DS4A 1K2DA 3ARDD 4UT6H 4ERSL 1QR1A 2C1PA 3WHXA 4NDMA 4YBLC 4HUWA 1HHGB 5C0JA 4OZ4B 1NDGB 3NIGF 1BECA 3C9NB 4X4YB 4JM2A 4M7ZB 4JM2D 1IQWH 1NC4B 1YEHH 1QFUH 4WTZA 5FXCH 1A7QL 4PJHE 4OGYL 2X4RB 1F45A 3U0WH 1KB5B 4H8WH 1NUGA 1X4ZA 3QXWA 1ZGLA 5HGHA 5BVPL 1E4XL 3KPRA 1TVHA 3KPRD 4HMDA 4X7EC 4NNXA 1G7IA 4AEFA 4WI7A 5I8OH 4I1NB 1RUMH 2OR9L 4LF3B 4PJEF 1MJ8H 3RHWF 4MJ6B 5DJXA 2FBJL 3VXQA 2BY2A 3MX0A 4HWBL 2XPGA 2D7QA 3B9EA 4Y89A 4R2GC 3WFDL 3IDMB 1ZHKA 5MENB 1T1YB 3IJYA 4LCWA 3D9AH 5DK2A 2ADFH 5FB8B 4LCWD 4MQTB 3W9DB 4JHBA 4JFEE 5E99H 3TJHD 4BSJA 4ZFGL 5B38A 1P5VA 4N0FA 3E1F1 3CSGA 3QP3A 3U7AA 5J6HA 4P4RA 3CJJA 5EDXA 2GT9B 4M4PA 2XZZA 3MRDB 3MNZB 4F9PA 1YNTA 3OGCA 3IFPB 3P40A 2VLLA 4JO4L 2P44B 2NY1B 4C83A 3V6OC 2J1KA 1ZLUK 4NQDE 1T1XB 4U4BA 4W6YB 4K8RL 5LAXB 4WHTA 5DR5H 4JFDE 3AS3A 1GXEA 4KV5E 1Z0NA 4Y5YA 4M6NL 1I9RH 4Y2OA 4CL7A 1CGUA 2P24B 1TPXC 4I8DA 3T1FB 1OSZB 1EVTC 2XV6B 5L7XH 1RJZB 5GQBA 1I75A 3GHEH 3EIFA 2AEPH 4LQFL 1KLGB 3GHBL 5ESVA 2D7PA 1KEMH 4GAGH 1CL7I 3RUGB 2IAMD 1FFPA 2UWEF 1QSVA 4PLKC 4EKXA 2DQJH 5CCKL 1OW0A 1QHPA 3QUYB 4G9FB 3LN4B 2APFA 2ZG1A 4JKKA 1CGVA 1MQKL 3R1GH 4HK3N 1NPUA 2HRLA 4I0PC 1S8DB 3IDIB 4WV1A 4Y5XA 3IU3B 3B9VA 3U30B 1L0YA 1EEUA 5EOCL 4MD0A 3VFRA 1D6EA 3VFVA 2VLKE 4JPIA 3T2QA 3SGEH 1EEYB 4JPWL 1FVCB 1Q0YH 3WXWL 3PWUB 2YPKA 2EIZB 4WY7L 3G9VA 4O2CB 5IT2H 1ZLVK 4TNVK 3NN8A 1UA6H 3S3SA 2AJ3A 1MLBB 3GMLA 4WHYG 1A3RL 2ICWA 4HV8A 4IDJL 1JPFA 1SQ2N 3FOLB 4QHLB 5GGTH 1LK2A 3BIBX 2R1YA 4LNRB 1Q94A 4ZNEA 5F96L 4KJPD 4IRZL 3MRGA 1AI1H 3VXOB 5DVLA 4WGWB 2JCCB 2JB5L 1RD6A 1CVRA 2DJSA 3JXAA 4GMSH 3STZA 5KW9H 3AS2A 1B3JA 2ORBH 5GS2H 3VGAC 4NJAL 1UT9A 3AROA 3BE1H 3DTXB 2ICES 5K33A 2RGSA 4GG6E 4P23C 1GH7A 1K8IA 2IC2A 4JM2F 3TN0A 1VGEL 1U8JB 3TN0D 4PLNC 5EO1A 1MLCA 3WNOA 4HSQA 5GZNC 3GSUB 3VG0H 2PW2B 4OUUA 2A74B 2GJJA 1QBLL 3I3BA 3TV3L 3ZE0F 2O61A 4MCZA 1JZ7A 3DYPA 4P3WA 1OB1B 4U7KA 4HS3A 3VXRE 2P49B 5BCAA 3TH3T 3C09B 4KZEL 4LCCA 2VC2L 1OAXH 5E2WL 1KNOA 3ZL4H 3MCLL 1J1OH 5GS0H 5CD5C 2KBGA 1WUNT 3R06B 5INDB 1VKXB 3BO8A 3RBGA 4OI8A 3U4BH 4R7NB 1DBAL 5FM4A 4JHAL 2YD1A 4M62H 2DLEA 2IANA 4OLVL 2O26U 2DI8A 1T21A 3Q1SH 3TA3C 5FYKH 7FABH 1SVCP 1YYLH 4PGBB 4R9HA 2AXHA 3L7EB 4M93C 1AGEB 3LN9A 1JNHB 4XBGB 4Y4HC 1T22B 5C6TH 3WO4C 4UDUA 1IAKA 5DD0L 4ZO7A 2GTZB 1AD0A 1J5OH 4LVEA 2GJZB 2E9WA 1JI2A 4P2OB 4OFYD 3FB6B 1DJSA 5SWSA 5SWSD 3WV0A 3C2AH 2R2BA 1EDQA 3SHSA 5ID0A 3UTQA 2HG5A 2HKHH 1E4WL 2DD8H 1R3LB 1T66D 4FFZH 3QXDA 5JOPE 2JF1A 5F89A 1MVUA 3PP4H 1IMHC 3SY0A 1KULA 2EC9T 4LARL 1CU4H 2C1OA 3VXME 4BKLB 3MLWH 1IJ9A 4XCNA 4HBCL 5TQ0L 1TZHB 5J06A 2R0LH 3IFNL 3G5VB 2VDNH 1BWWA 3F7VA 5IW1A 4PGDA 5HHVH 4F3FA 3PXHA 1JJUA 4KDTC 3PDOA 1MFBH 2RCSL 3JTTB 4M8QB 1AKJB 2CLVB 1S9YA 3S97C 4KMLB 2W91A 1ACYL 4NYLB 2HTLC 1G9NC 1NGYA 3QCUL 4HX1A 3LY6A 1OY3B 4KI1A 4JCLA 3TT3H 5HHMB 4FQ1L 3ISWA 4MAUH 5GGTA 3I02A 3X12B 2R4SH 2XN9D 5FEBA 3K4ZA 4GSDH 4P59L 1AIFA 3PJSB 2D7TH 2UVEA 4EI6A 4Z7QF 2DAVA 5IEHB 2AEWA 1RUKH 5I1IL 1HDMB 2FIKB 1DBBL 1FAIH 1MJJB 5J6GB 5H35A 1MELA 2OTUB 3A6BL 2DLFH 1B0WA 5GS2D 4J3SA 5EIIB 5D7SL 4R26H 1JK8B 5SWQA 1F11A 1Y18A 3BP7B 4GQ9H 1U8LB 2OP4H 4JFQB 2Z92A 5F88A 3VD3A 1I8MB 4WJ5B 1MCIA 5LG1A 5DTFB 4HLJA 1C5BH 4WENB 3OR7B 1ORSA 4KJQC 5DJDA 2VISA 2DQIH 4APQB 3V79C 1N6QL 3DETD 1AQKH 3T77A 4L5FH 2OXGA 1RVFH 1BIIA 1JWMA 1VGKA 1E6JH 2IGFL 5I76B 4FFWD 3TIEB 4DZBA 5DFWH 1XCQB 4PS4L 5A2KH 3JSSA 4KJWD 1CFSB 2IADA 1HQRB 1NAMB 5LGKA 3WLBB 3OKMA 3MYZA 5D7LB 5IMLA 5FUZH 1N7ML 2AGJH 5GS0D 3SE8L 1F4XL 4NQCA 3V52H 3KR3H 4NQCD 5I2IA 2KQNA 3BAEH 3CX5K 1LVEA 3CXHK 4MA8H 1S9VA 1GL4B 3NCEB 1CLYL 5DQ9A 3EDEA 2WINA 3GBNH 4GBXA 3FAWA 4GBXD 1WICA 4WCYL 4YDLC 2HAZA 4NO0A 2V5RA 2B7DT 4NO0D 4LCIL 1KGCE 4U1GB 5CILH 1HOCA 5ETUA 1I8LC 5EZLA 1RIVH 3TBWB 3L5JA 1A6TB 4RMTA 2VLRB 3EJYC 3PG2A 4GS7B 4UV7L 2VOTA 4XRCA 5C09A 2BNUA 4LPTA 5C09D 2YRZA 4K3GA 3DUUA 4PJ7B 4M6MH 3C8KB 5ENWB 4ZSOE 1DEEB 4TOYL 5L2KB 3IGAB 1D5BB 3HC3L 2C26A 1FN4A 3MLXH 5D1ZA 3OZ9H 5D1ZD 1SJXA 3RGVB 1QNZH 1A6AB 1IM3A 2X44D 1RY7B 5DZNA 1J8HE 4KFZC 3S36X 3BKYL 5AUMB 3IF1B 4MCYA 1UJ3B 5ADPL 2P5WA 2P5WD 2O5ZH 3UBXG 1FNAA 4N8VB 2C3XA 3SDDC 1HHKB 3PF2A 4L9LB 4WWKB 4Z0BH 3V6OE 4DKEL 5IR1B 5E8EB 1GJIA 1P4IL 3BMWA 1AC0A 2D9QB 3LKSB 3SO3C 3TZVA 5L88H 1W0VA 1A1NA 1A5FL 1F58H 3BP5B 1FG2B 4QCIB 4DQOH 1WGOA 4PJFB 1CD0A 1ZT7B 3MGOB 4PJBB 4GXVH 3MV7A 4PJIB 1U2CA 4CMMA 2Q8AL 4NQEA 2XWBB 1CG9B 4ZDHA 4NQED 5CBAA 1Q1JL 3H7BB 3QH3A 1T5WA 1J9CT 1D9KC 1YEIH 2GEEA 2VABA 2HT4D 4CW1A 2B4CH 4JO2H 1DQJB 1GC1H 1YECL 3DUSB 5FHBH 4PJCB 4Z7NE 3BEVB 4GW4B 3HNSH 5F71A 1PYWA 4G43A 4PJAB 4OV5B 1QRNB 3OKLB 4K23L 1QRKA 1P69B 1BBJA 3E8UL 1CTOA 3GO1L 5DD3H 3QUXB 3KJ6L 5FO7A 2APBA 4KQ4H 3DSFH 5D96C 3LB6D 3AU1B 4QGYA 3IDGB 3HG1E 4S0SD 2VKWA 5D2NB 5IVZB 2F5BH 3HI6L 3FO0H 1MJ7L 3ZE1F 4MXVE 4O00A 4LDOB 4D0DA 3SKJL 2I26N 3F5WA 5DJ6A 4F7PA 3NTCL 3AAZA 5I8EB 3BW9A 4KKAC 4GW5A 3IDXL 1IAII 2OM5A 1DLFH 2D31B 2Q3AA 4YXKH 1JN6B 1MIEH 4M61A 4I3RL 3FQUB 5TFSH 4NGHH 5C0AE 1FYHB 3ULVC 4KHTL 3EOAB 1A7RL 2OJZL 5ISZB 3O4OC 4PJHA 5EZIL 3SN6N 1KACB 3CFDB 3VDCA 3QUKA 1RZ8B 2G2RB 3BI9X 3MA7B 1MY5A 3VWJB 4EQ3A 5MEOB 4KI5F 3QT2A 3E3QC 2UZYB 5EU3B 4EN3B 3NZHL 2JB6A 5LCVL 4NBZB 2K7PA 5DURD 1NCAH 5I74C 1B0RA 1MI5B 2JKXA 4CKVX 1M05A 1GYAA 4BSWA 2AXGA 4OZIB 2FECL 5IHUL 1INQA 1ETZA 2CIIB 3DNKA 4JFEA 4AY0A 4JFED 1Q9KB 1X5JA 3BVNA 3WNMA 5C0IB 12E8H 3CLEL 1B0GB 3RWJB 4N0CC 3RU8L 5DQDL 4QRTA 4HIJB 1ZAGA 3OKYA 3CFKB 5HVWA 4NQDA 3IDNB 1YYMH 3HE7A 4NQDD 3HE7D 4HC1H 1EA9C 4KUZH 2MKWA 4ETQB 1P84K 3GUTB 2EYRB 4JFDD 1INEL 4CU6A 3SE3A 3UAJD 4EIZC 1GPOH 1FNLA 1T2XA 1TLKA 3ARBC 2YD6A 2I25N 1DBMH 3QXAB 1OF2A 3QYCA 2A73A 4ZOCA 3NCJL 1I3RB 3AY4A 3D3VE 2GITA 1OVZA 2A6JA 1A21A 1FFRA 2DQEL 2GY5A 4A6YB 1RULH 4XAKE 1RI8A 3H9HB 3TM6A 2CK0H 4POZD 1NFDA 2CRZA 4O2EB 4PJ9C 4RZCA 4U0QB 2G60H 4PJEB 3I9GH 4N1HB 5L8JB 1JP5A 4HFWA 5DVKA 4I18B 5EUOA 2VIRB 3PHQB 2E9IA 3GK8L 4JLRA 1H8OA 3SDCA 1GHFL 1F2XK 3SDCD 3P11H 3QQ3B 4LLDA 4M7KL 2K9UA 5HDQH 2FCBA 3SDAB 3LHPL 1DE4B 5DRZA 5CMAA 2X6MA 3PWVB 4WW2C 5C8JB 3MRFA 1KYOK 3FN3A 4ONHB 1J1XL 5HGDB 5AYQA 3F6LA 4XVUD 5JHLH 1K5NB 3QAZB 4ONOA 4GKOA 1I8KA 4MD4B 3WEXB 5ILTL 2EEBA 4HT1H 4KTEL 3SPVA 3VFTA 4K3DH 2J4WH 4LMQE 2D7OA 3EW3B 1NGZB 3GKWL 4MJIA 4NKOB 5IB2B 2ITDA 1ZA3B 4LIQL 4WI6A 3S4SB 4O02L 2PNDA 4WW1B 3Q6GH 4OLWH 4JO3L 5A2LH 4HG4J 4FQHB 3L3DA 2FRGP 1MJUH 1MUJB 2Q20A 2UWEB 4RBPK 4MNQE 4J3OC 5MP6H 3BZFA 3EKCA 2XA3A 3G04A 3NABH 5EOQH 2D4DA 3BRFA 1HN1A 3QO0B 1F4WL 4PJHF 3T0EB 2VR5A 2Z8WC 5CIPB 4JZOB 3KGRA 4RMUA 1VPOL 1M4KA 4ZFZB 4U1JB 3CVHL 4X7TB 4KRLB 3RDTC 4LSQH 3DUHA 5DMJB 2ADGA 1XGYL 5I30L 2H9GB 3N1PC 2JJTA 2PUQT 1KTLA 5JR1L 1XF5A 3VXRA 4LP4A 3PWNB 3VXRD 1UACL 4HGWB 5BOPA 5E2JA 2BNQB 5ACZB 1AGCA 1PKQB 5IROA 1HK6A 3I75B 3FRPA 43CAA 4N8VG 1F6LL 4L29B 5AYUH 1IEBB 1ZT1B 3MFGB 1UKQA 5D1XB 1YUHA 4JFXA 1JFQL 1NL0L 3HZYA 2BY0A 4JEGB 5L0QC 4TVSa 4NHCL 4P4KC 3BP4B 5KANG 1CLZL 4U1IB 1K4DA 3QXUA 4WUUB 3U79A 4JVPA 5AZEH 1A14H 4NP4H 1K2DB 3U9PL 3K2UL 3WHXB 4NDMB 4NO2A 2X4SA 1I9EA 4Y5VA 5C0JB 5CJBA 1IGML 4YHYC 5CEYA 1IGFL 1AXIB 4KV5F 2FJFB 3LRGA 1SYSA 4QRQB 4KZDH 1FH5L 3ECBA 4YDJA 4X98A 4RFOL 1IARB 5JOPD 4PD4J 5L8LB 3QPQC 1Z5LB 1KTDA 1T7VA 5GGVH 4NNXB 1IC5L 2CKNA 4XCYA 3VXMA 5CEXB 1RAMA 3VXMD 4J12A 1NFDF 4OCYH 1ND0A 3M8OL 3KYMA 1WZLA 5D70L 5CHNA 3RX5A 4RISH 1SBSL 32C2A 1SJVA 4TSCH 1JPGA 3EFDL 5IQ7H 5EUOF 1ZHKB 3IJYB 5FV2A 4ENED 3SKNB 3MLRH 2WBJB 3S35L 25C8H 4X4ZA 2F19H 1C8PA 1PAMA 1L7IH 3ZKMC 1V7MH 2R9HC 3GSRB 1IM9B 2R23B 4KK8C 4CN1A 4CMHB 2XQYK 5DXWA 4N5ED 4JREC 1C5CH 4WDIA 1IKFH 3L5IA 5DA4A 4XGZB 4EOWH 1KPRA 1JRHL 4WHTB 1PEWA 1BQHB 4FXGA 5LKNA 3IDUA 3VXTA 2HVJB 1R5IA 3KPMB 1QQDA 1KSRA 2H8PA 3GJEB 3THML 4R0LA 3QEQE 5CSBA 1JWSB 3X13B 4FNLH 1HHIB 4GO6B 2F74B 4XNXL 2DKUA 3U6RA 3OJVC 3QDME 1G6RL 2O5XH 1R3HA 5ESVB 2YXMA 4IRJD 1FGNH 5GRVK 4AZ8A 3WE6A 2XG4A 3G9AB 4PLJC 2Y5TB 4PFEA 2AEQL 1PG7L 2YR3A 3QNZA 5DVOA 1J0ZA 5DMIH 2JELH 4Z7UA 4IS6B 4RX4A 1JF6A 5KOMC 3U7WL 4PP2B 1GGBL 1IQDB 3VFRB 2HFGH 4L3CA 4MD0B 1D6EB 4PJ8A 5JDJA 2W0KA 2OTPA 4PJ8D 2CQVA 4ZUUA 4LPWA 2PXYB 5MI0B 2BY3A 3I3EA 4WI2A 3R0MA 4X4XA 2D03L 4YUEL 1BZ7A 3VE0B 5KZCB 3NN8B 4OCMC 3GMLB 3ULVE 4V2CB 1NLBH 1T3FB 5DFVC 1LK2B 2R1YB 4JE4B 2QADC 5IVNA 5IMOA 3IDYB 4DZ8A 5I8KH 1Q94B 2Y7QA 4JN1L 1LE9A 5CP3A 3B83A 3MRPA 5EBMA 5EORH 5FF6A 4MA3A 2V5MA 1JMXA 1E27A 1KGCD 4LLWB 2QHRL 3G6DL 4QRSB 5IGXL 2CR6A 4E41E 4U3CA 4U1SB 2BSRA 2RB8A 5D5MB 3D85A 4M3KB 4ACPA 3QI9B 4KVCH 5I71B 2JJUA 3AB0C 3SDYH 4ZSOA 3HC0B 1K8IB 1I1FB 3ARPA 3TN0B 4EDXA 5J1TC 2UZXB 3MFFB 4R2GD 2BVUA 4OF6A 2PYFA 3I6KB 4OKVA 2VDKL 3UBXI 4PRNA 2IEPA 3VI3E 4ZPTB 5HHPA 1H8NA 1MLCB 3RWEB 3I6GA 5IJVA 1FLTX 5E9DE 4D0BA 1J8HD 1OCWL 4HPOL 2O61B 3GI9H 5CFHA 4HIXH 4NQSA 3MV11 2ATPA 5TDOA 1QVOA 4DVRH 4ZXBB 4L3EE 5IUSA 2DLTA 2OL3H 2HFTA 1QLEH 3V6OA 3WMSA 5K9KA 5M94B 2C7UA 1CFQB 4OZGA 3TYFA 1EJOH 5E5MA 1MCKA 1KNOB 3LH2H 5IBUB 1CXLA 2A9MH 1HEZA 1F8TL 1TXKA 3BO8B 5TGBB 1DZBA 1JE6A 1OAZL 2IANB 4N8CL 3T65B 1JI1A 4UIKL 1YEFL 3OX8A 5CINL 4G8GE 5B8CC 3RJDA 1XGRB 4G6KL 3P77A 1NMBH 3IDJA 4U6HA 4PLKD 4L8CA 2ERJB 1P7HL 1UWEH 5CJQH 1VB9A 1Q0XH 1CD1A 5T5NG 4I0PA 4I0PD 1PLGL 4KMTH 4PBXA 2Y5EA 4XC3L 3UTQB 2HG5B 4QXWA 2HFEA 1J0YA 4HKBA 3EO1B 3BPOB 3MCKA 4NO5B 3U36A 4AL8L 3HG1A 3GSVA 5E8NA 3HG1D 4NQVB 4GLRI 1KCKA 2C1OB 2R56H 3DARA 2VZTA 5TPWL 1N5YH 4XP5H 4Z7UF 3NCFB 4YHNB 4JQXC 3OB8A 4G6JH 5LWYH 2NY3D 3LAFA 4PGDB 4F3FB 3WHE1 4XCCH 3LZFH 4LRIC 3WIHH 1KC5H 2WIIA 3E2HC 5GGUB 2VDMH 3PDOB 4FZEL 1BD2E 5C0AD 1FVEA 5EBWB 4KY1H 3VWKC 4LAQL 3WBDA 5B39B 2BY1A 3WNKA 3MXVL 4JJHA 2NY4B 5IIEA 3Q3GA 4C54A 2FLBT 1JGLL 1ADQH 2X42A 1AGFB 1DBKH 3VH8A 5E8DL 4P23A 4XC1H 4M7LL 1AIFB 1YDPB 4P23D 5DF0A 4TUJA 1C12A 5BW7C 4JAMA 1RQ5A 1OM3L 4EI6B 4X9BA 4I77H 1D6VH 2HH0H 1DSFL 2FEEL 4HXBH 1UXSB 1A3QA 3CFIC 4PB9H 3QUZB 5H35B 4FQPA 4JFFE 1I7RB 5DSCA 5GZND 1U92A 4M6OH 1BJ8A 2KKQA 1NCNA 4O2FB 3KPSE 2MMXA 3JV0A 4RCAA 1IC4H 3OAUL 4JJ5B 4Z8FH 1GGIH 3HRZA 3WN5C 1QZ1A 3VXSB 5ICZB 3ALPA 1LD9A 2IPKB 4UAOB 4U2YA 4WNQA 1UM4H 1TDQA 5DJDB 4E42B 2M1KA 3IU4H 4YJZL 2VISB 5CD5D 2AJYH 4BZ2L 3K4AA 3ULUC 3T77B 5C6PB 4FQXB 3MLVL 4NM8H 4R8WL 2K1MA 1JWMB 3WYRA 1URLA 1AD9B 4LBEA 3TA3A 2JIXA 1D5ZA 3TA3D 4DZBB 2JIXD 1EH9A 1QG3A 1BQHG 2OL3A 5EO0A 3MV8B 4YC2C 3O9WB 4MB5A 4X6FA 2XIDA 4XNYH 4YPJA 3SGKC 2FGZA 2IADB 1ZXQA 4Y4HA 4Y4HD 1KV3A 5F7DB 3D3VD 1VFAA 4W6XB 1KIRA 4OZGF 3T2PA 4MD5B 5EFIA 4GOSA 4ODSH 1CLCA 1XGQB 1I8IB 3EYUH 4XAKD 4XPFH 4YHPB 4W6WB 5AZ2H 1U3HC 4IMKC 3P9MB 3N06B 4YHKH 3I2CL 3DI3B 4CBPA 2WINB 4J4PD 4IOIB 5ETUB 3RA7L 5HVHC 2VH5L 4BSVB 3FCTB 5HDLA 2FR4A 4G80A 1LEIA 1KIQB 1KJ3L 1G7HB 4XRCB 4L4JA 4GRMA 2H3NA 3DO7A 4XHQA 3BPLC 1UJTA 3DUUB 1E6OL 2FX9L 3CFEB 3VD9A 4YHML 2A6DB 2D3VA 2D7NA 5J3HC 4KDTA 5DMKA 4HUUB 4UOW1 5D1ZB 3C5ZB 3LD8B 2AJZB 2E5EA 4FXKA 1IC7H 4OF3A 1F3RB 3K3QA 4PB0H 1YEDB 2HTLD 4M7ZC 1Q38A 4R3SB 4PIRF 3HMWL 4MCYB 1BFOB 1C7SA 3BD3A 5C2BL 1U6AL 5FYLE 4LRNH 2V2XA 1T7XA 1NMAH 3WIHA 1G7MB 5E6IB 4CNIA 5E2TH 5LGHL 4YDVA 1KELL 5KS9E 2R2CA 2VXSL 4ZPVA 3BH8A 3QA3A 5DVNA 5FA3A 4AG4H 3TZVB 1W0VB 4MNQA 4HQQL 4MNQD 4KK5C 4MA7H 1FJ1A 3CFBA 5F3HA 1ADQA 5BRZB 2PYEB 3MV7B 4CMMB 1LP9B 3GMPB 4QYOB 5CBAB 2VLJE 1MREL 3QH3B 1T5WB 4WO4B 2ZSWA 1BIHA 2VABB 4CW1B 1NMCC 1PQZA 1I7ZA 3MLTA 3KNBA 1ZA6B 1E0OB 2MHAA 4KJQD 3FQNA 1MCWM 1PYWB 3IVKA 1NCWL 5FGCB 5L9DH 5CSZB 5IFAL 2A9NL 2NY1C 5DRWB 4OIIL 5FFLA 2R8SH 4D3CL 4ZG1A 2Z4QA 4KRMB 4TSAH 3P0YL 5CUSL 1KJMB 1BF8A 5IWLC 5IBUG 5E08L 3ULVH 2C3WA 3ARVA 3VRLE 3F5WB 5DJ6B 3K81A 2NCMA 3QUMA 4F7PB 2YPLB 35C8L 1EO5A 1GIGL 3WUWA 2AK4E 2HKFL 1OAKL 5HGAA 1J0KA 1F90L 4M61B 4QXUL 5GHWH 3TBSB 2DQHL 4V1DA 3MV9B 1KFAL 4ZS6C 3RAJH 5JIHA 1DBJH 5FAAA 2YUWA 5KVFL 5HI3C 4TTDC 3N0PB 2XZAL 1I8LA 4TQEL 2DLGA 4R90L 4RAHA 1WWBX 2CMRH 3LEYL 2CIKA 3U0PA 1FLRL 2NY0B 3HKFA 3VD7A 3EDKA 5DO2C 3W2DH 4DKDC 1BEYH 1HKLH 3LOWA 5KVGL 1OARH 3ZYOA 1EFQA 4JR9L 3QIBB 2XTLA 3DVGB 2NR6C 1UCBH 1IEHA 1J88A 4ISVB 3P73A 4MDJB 2AXGB 1WEJL 1SY6H 4HWUA 1T2QL 1INQB 1VENA 3MBXL 1M7XA 1OTUC 3I6LE 5D7JC 1X5GA 4TVPL 1KG0A 3JV4A 1DUZA 5EUKA 1S9KC 3U1SH 3EYFA 3BVNB 3RIFF 3FAXA 1I3VA 1H8SA 4NZDA 4LFHG 1YY9C 5B39G 3SDDA 3SDDD 4KTDL 4CJ0A 1N59B 1KN2H 3MRMB 1UG9A 3F58L 4PG2C 2QJDA 2D0GA 3BUYB 3BKCH 1XGPB 4FS0A 3UO1H 3WSQH 2D9CA 4FHBD 5EU5A 3RPIA 4F15B 4FQLL 4L8BB 4EUPH 1RFDL 4D9QE 1T1ZA 2XNAA 4N0UE 4P48A 1AXSA 5FCSH 4CDGC 1D9KD 1E28A 2A73B 2AXFA 5EC1B 2GITB 2X4OB 3QDMD 3FRUA 5EOTA 1NFDB 4HZLB 5I66A 1CE6A 1WFOA 1WIUA 4OTXL 3HCVA 3C09C 1MRCH 4JN2B 4PRDA 2VDQH 3L5HA 4XPFL 4HIIA 5EUOB 1UQSA 5EBGA 1BZQK 4HBQA 3RVWC 1JUFB 4LLDB 1FSKB 2I9TA 4N5UA 4JPKL 2VDLH 2E9BA 1BQSA 3G5YB 2X40A 1YNKH 2Y06L 1FDLL 1Z9MA 4AH2A 3NH7H 4KKAD 4LSUH 3BKJH 2A38A 3MRFB 1AR1C 1RU9L 2FHFA 1OQXA 3B9AA 3C60B 3ULVD 3EO0B 4PY8J 4KKCC 3SPVB 4XI5C 3GNML 2AABH 3P0VH 4NUJB 4P2OC 1GGCH 4F7MB 4M5ZH 2UYLB 1QSEE 4MJIB 4P2QA 3OR6A 5D7KD 3PHOB 3WXVH 4WTXA 5KVDL 1JZ2A 3NBNA 1TZGL 1I1AC 4E41A 5C92A 3TNNA 4E41D 3QDJA 3GMOB 4ZYKA 1UYWH 3QDJD 4TNWF 4F7TB 3RZWA 3T4AB 1L0XA 3UJIH 4UT9H 2VXQL 2Y1VA 5MEQB 3KYOA 2XWJB 3ET9F 5HYSA 3GI8L 1WIOA 1JTTA 5I19L 1RIHH 2ZKHH 1YY8A 5I6XB 3DECA 5E9DA 5E9DD 2PTVA 3SQOH 1G9MC 2XQYG 2VMFA 4MWFA 5ESQB 5IVXE 3STBA 1E4XI 5F1NA 4HG4K 4L3ED 3BOVA 1XF5B 4NWTH 1CL7L 2WBWB 4XHJC 4GFTB 3UJJL 5LBSH 5F97E 4DK6A 3S8WA 4MS8D 1FL5A 1PG7X 4KJYB 5K59E 5GGSA 1A2YA 4HS6A 1BQLL 3BYYA 3O2WL 4LU5L 2R1XA 1FE8L 3G5ZB 5DD6B 2N7BA 4UU9B 4MQSB 3ARBA 5E00A 3ARBD 3DXAB 3KLSA 5HDOA 3G08A 3OG6B 4NN5C 4KK9C 4NZRL 5JOFA 3UYRL 3VFGL 1QKZL 2R8SL 4PJDE 3PQYE 3MBEB 2IPTH 3KS0H 1YJDL 1SJHA 4NO2B 2AJSL 1GZPB 1MF2H 2X4SB 4EUPA 3D25B 3V4VL 5TE4H 4X0KB 4PJ9D 1KEGH 1O7VA 5CEYB 1RURL 3EYVB 4G42A 4ONGH 5GXBB 2QKIA 4HXAH 3OHXA 1SYSB 2IBGA 2J8UF 1L9MA 3ECBB 3F8UB 4APQC 1RZJL 4GW1A 5ALCH 4BH8B 4KGJA 2WUCL 4XCYB 1C1EH 3VJ6A 5C86A 5BQ7B 2DL2A 4WW2A 2DOCA 2W0FB 1U93A 1E4JA 1QBMH 3BIKB 2IF7A 3MMEA 3KYMB 4I2XB 3ILQC 1A7BA 1T80A 4G7VL 4KKLC 5CHNB 5EULV 3QG7H 4OGAC 5I17A 4X5LA 1BD2D 3GSNH 3UP1A 1DANT 3N85H 1V3LA 4F57H 3RX7A 3UTZB 2B1HH 3DV6B 4HF5L 2AV1A 2PTUA 2CK2A 3IKKA 4LEOA 4BUGA 3TH2T 4U1GC 2OZ4A 3IXAA 4BH7A 2NX5B 3DX9B 4NWUL 5DD5L 4K3JL 5E2VL 1T20B 5ICXB 3IFLH 2EDKA 3KLHC 4P9HC 2KZ1B 4K2UH 3ULVF 2R69H 4XNQB 4K3EL 5CD3A 1TJGH 4OQTL 2IH3A 3QBTB 4ZTOL 2DQTH 4Q9QH 3WIIH 3DROB 5EO9A 2F54B 2FSEB 4S1QH 5DUBA 1W72H 4JFFA 5MENE 4JFFD 4R0LB 4Y19B 3RDTA 3RDTD 3KPSA 1CFTB 3KPSD 1LQSR 3ROOB 15C8L 2BVOA 3CVIL 1NGQL 1JWUA 1A64A 3BDYH 4X6CF 4YX2L 2Q8BL 4H88L 2VN7A 2EO9A 1TJIH 3FB5A 4NO3A 4AMKL 3S3PA 2YMXH 5F9WB 4ZS7H 3ZKQD 5AEAA 3IAPA 2C3VB 4Z7UB 1BREA 1IGYA 3EYOA 4L9LC 4JY6A 1JTPA 4ODVL 4NRYA 5MHSE 4L3CB 1IBGH 5F3BA 4P4KA 1TENA 4P4KD 3RWDB 2VE6A 3WDJA 3WNPA 1CN4A 5CEZH 4TPRH 1IAIH 5SX5H 4ZQKA 2L7JA 2FX8H 1UZ6E 1D5XB 5FK9B 1H15A 5J56B 5D71H 3RUGE 3OV6A 2WUBL 2DDQL 2MQ3A 3OPZH 4MSWA 4WU5A 3G6JB 4G9FE 1PJ9A 3PGDB 5D8JL 5IMOB 4TNWK 4DZ8B 2XWTA 4P5TB 3P4MA 4DN3L 2E6JA 1YQVL 4K7PY 4U1KB 2X1WL 5DJAA 3QPQD 3W5NA 3QUXC 5EIQA 2UY6A 3NCCB 4ODUB 3LMJH 3HS0B 5GRWA 5JMOC 3FO1A 2BSRB 3D85B 1Z6JT 3B2VH 2Q7YB 1BAFH 3LEXB 3BHBB 4X8JA 4MGXA 5TE6H 4HFUL 3T3ME 3T4YA 3SO5A 1IGJB 2QQLH 3K46A 3TBVB 2PYFB 5JPMB 4E0RA 3GB7A 1H5BB 1HQ4B 4BFBD 2AKRB 4YE4H 1MFAL 4BK4A 4AQ1B 1T7YA 4RMSA 1KOAA 3EHBD 3ZKMD 5IJVB 2VXTH 2YKLL 3HI1A 3KLAA 4XMKH 5D72L 4KK8D 5BS0B 3SBWC 4M5YH 1JGVH 1MFCL 3QQ4A 4FQIH 4WW2F 5DEGA 5F8QC 2ATPB 2JCCE 5FYLD 5HGBB 3VWJC 1EHNA 1QLRA 2EIEA 5TDNA 1QYGH 5I1HL 5KS9A 3HZVA 5KOVC 4OZGB 3GSNA 3MRQA 4DGVL 4I3SL 2Q1EA 5KSUA 1Y6NR 1U8OB 2Y07L 3BEWA 3HB3C 4YXHH 4EN3C 1JPSL 5FGBC 5DRNA 3TT1L 5AD0B 3MODH 4X6EA 5DDHA 1TPXB 4XPTH 4LL9A 3VFPA 4P2RB 2AJUH 5T1LA 3TEUA 4OM1H 3OX8B 1N64L 5T1LD 4LSPH 5FV1L 5FYJL 1R3JA 2VLJD 3P77B 4P57B 1ZHNA 1T03L 1MWAL 4M9OA 4P49A 4BELD 2YEZA 1FZKA 4JFPB 4EBQH 3FO2B 3GRWH 1QA9A 4XT1C 2R0ZL 3J8F7 1UWGH 1S3KL 5I75B 3IYLW 3QR2A 1FL6A 3DX8B 4PR5B 2BMKB 1R24A 2HFEB 2CLZB 4HUVB 5KVMC 1XCTA 1PDKA 4OB5L 3GSVB 1JGUL 5E8NB 4ZUSB 3DVIA 1QFPA 4XNZB 1QSZA 4XP6H 5F70A 4J8RB 2VDRH 3WL9B 3D48R 2W60A 5K9JH 2BC4A 1MIML 4OQ1A 4NZUL 3L3IB 3RNQA 1FNFA 5B21A 2HFFA 1U8HA 3WD5H 3HE6B 1BVLA 4HK0B 4XBEL 4J1UA 4NFBA 3X3FH 3DGGB 2AJVL 2QADD 4CVWA 2WIIB 3FQRB 3MRCB 5F1SA 4YXLH 5T3XH 3ABZA 1SMOA 1EBAA 4F80A 5LXGH 4OT1L 2UZIH 1GOFA 1WZ1L 1SEQH 2HWZH 4I18C 3V6BR 3IB4A 4NBYB 2PF6A 3TCLA 3FFCB 3TH4T 3K4DA 1F4YL 2BVEA 1DQDH 4TUJB 3SDAC 4JAMB 2MPAL 1G7PA 3BGMB 4NQXB 5I9QB 1AGBA 5IVOA 3ZYIA 5CZVH 2R0KL 3HAEB 4O4YH 5GSVA 2CRIA 5CS7A 2A6KA 4JG1L 5DSCB 4UB0H 4OCSL 4FQJL 3I6LD 3JTSB 1MCPH 3ULUH 2CKBH 4OJFH 1AQDB 2BFVL 2P8MA 3BFOA 5EC2B 2WAHA 4YFLF 5IB3A 1P1ZA 1EAJA 3RKDC 2H2SC 1RZGA 3KAAA 5KN5B 1LD9B 3WFEL 5I1DA 5HHME 1FNGA 3KVQA 4WNQB 3HUJA 5A16A 4M1DH 5TE7L 1BLNB 2X4UB 4NOFA 3ZKNC 1F3DJ 2P1YA 4RAVA 3M1BA 5E2UH 1ZS8A 4XPGL 4D9QD 4LBEB 5GJSH 1HHHB 1UM6H 3MO1B 4N0UA 5B8CA 2OL3B 2FD6H 3T04D 2G9HA 4WEBH 3T0EC 3HMXL 4X6FB 3O3DB 1SJEB 2OR8A 2EICA 4J3WA 5E1HB 5KS9F 1VFAB 1L7TH 4QHUA 3CSPA 3OKEB 5EU6B 5AAMA 3B43A 3M07A 1H3XA 2ZG2A 1VDGA 3W0WB 4RAUB 4XB7A 3AC0A 3Q0HA 5DC4B 4JO1H 3PXJA 3S37L 1RUAH 2ZOLA 4H25A 2MCPH 2Z93A 5DUPH 3T8XB 1LEKA 1A8JH 1ZHBA 2F53A 2F53D 2VXVH 2FR4B 3ESUF 3O8XB 4G80B 3NIFE 5GGQL 2ZUXA 5DJ2B 3O45A 3GRWA 1S7RB 3ZDXF 2NLJA 3KPLB 4QEGA 4CUCA 5T1DH 1S7XB 1S5HB 1ED3B 4K8RC 5KG9A 3DSNA 1RZFH 4GRMB 4H0GA 4JQXA 5D7LE 3V5KB 4GUPB 1OT2A 3QDHA 1UEMA 3PNWA 4LRIA 4LVHB 5DMKB 3ZTNL 3VWKA 4FXKB 4JM4L 5T1KA 4OSUH 3VWKD 3QRGL 5T1KD 3BT2L 1IGTB 1KCSH 4HEPG 3DRQA 1N0XH 3MRHA 1QSEA 4Z7OF 1EO7A 1QSED 2Y23A 4WI8A 3LRHA 4P5KA 8FABA 4ZFOA 2GFBA 1FGVH 3MUGB 2JE8A 4LSRH 2FJHA 4F8QA 2MCG1 2XKSA 3E6HB 4HPYH 4OF7A 4C55A 5BW7A 4ODHH 5IMKB 4LLYB 4QXGH 3BH8B 3O11B 4PJ7E 2E6PA 5L2KE 3I84A 1FJ1B 1NBVL 2M2DA 3CFBB 2VZVA 4XCEA 4M03A 4KROB 4XMPL 2EE3A 1JGEB 3QQNA 4RMWA 3WN5A 1HZHH 3NA9H 5IV2A 2WBJC 4IIQB 2CJUL 5IVXA 5BO1H 1PQZB 4KXZI 4AEIL 2V5TA 3KNBB 3ZDYE 4YHOL 3EFFA 2MHAB 4CMHC 4CVZB 3FQNB 3IVKB 2HJFA 4MDIB 4H5SB 3HPJA 4ODTL 4D9LL 1PVHA 5C0EB 3QFDB 1HWGB 3TESA 3ULUD 2CKBA 4W70A 3SQBA 4P9MH 2ZUTA 3M45A 2W65B 2DBLL 1P7QB 3MOBH 1Z2KA 2FECI 5IK3B 4PJFE 1KCRH 2ATKA 4PJBE 3SGKA 5FM8A 4PY7A 1OTSC 2EIDA 4PJIE 4U6VH 3VDAA 3PQYD 2QEJA 1FORH 4TUOB 5SX4I 5D2LB 2FWOA 4XXCC 3HUJF 4E5XA 5EU4A 2X1PA 1C5DB 2J6EL 5IM7A 2HLFC 4X8XA 1U3HA 1U3HD 3NCYS 4IMKA 4JDZB 4PJCE 1NJ9B 4YHLH 3CFCL 2YN3A 1HILB 4V1DB 2W59A 3RQ3A 4PJAE 1QRNE 5K9QG 1J10A 3ZTJG 1JHLL 3KYKH 1A4JB 2L4OA 1KCVH 3U9UA 1BX2A 5T3XL 3LKRA 1CFNB 4LLVB 5D2NE 4AK1A 2OK0L 1TMCB 3PWLA 2B39A 3MLZH 2WK2A 3CH1B 1JPTH 3GSOA 1JF1A 2PXYC 5IHLB 1U8IB 2XZQL 1ZEAL 4HJ0C 2FYYB 1ROWA 4LVOC 1U0QA 3GMQB 5CJXC 5J3HD 4FFVD 2FHBA 5C0BB 3RWIB 1HHGA 4OZ4A 3P73B 5I18L 5CP7B 4FFYH 3VDBA 5JDSA 2VITB 1FAKT 3C9NA 4X4YA 3K1KC 4TULH 1NC4A 4XWGL 4OLYL 1NC4D 3LPFA 1T04A 3JV4B 4PUBL 1DUZB 5ISZE 2FZ3A 3IDYC 2X4RA 4GXUN 4R97B 4ONFL 4ODXA 2Z31C 3MNVB 4IHOB 1DVFB 3SDDB 1BOYA 1IGCH 1AXTH 2EYTB 4ODWA 3QJFB 2FX7H 1HI6B 1ITCA 4MXWH 3IKCB 5M7QA 3HC4H 4KUCD 4OM0L 4LF3A 4KK5D 1F3DH 1RMFH 3QI9C 4MJ6A 1MI5E 2OR7A 5I71C 3BPNB 1CF8H 5C70A 4OZIE 2J8UB 5MENA 4Z77B 4K7PL 1DQQB 3BQUB 5MEND 3V0WH 2PR4L 2EH8H 3HAEG 1E28B 4UNVA 3ARUA 4Z95H 3BN3B 1MCBA 4YPGA 1R3IL 1KJVA 1B2WH 2VN4A 4FQ2H 4X6DF 3UMTA 3MRDA 2XKUA 3MNZA 2APXA 1CE6B 3GBMH 1U8NB 2X05A 4ZXBC 5F9DC 3BIAX 3GEWB 2NY1D 3MUJA 4X7CC 4AIOA 1OAYH 2VR4A 1FYTB 4CN6A 1GSMA 3IRZA 5D96B 5DYOB 3T0AA 1A02N 5IWLA 3NIGE 3MXWL 3KHOA 5MHSD 1NGPH 4ZO8A 2LVEA 2QL1A 3AM8C 4CN4A 1KB9K 2XY2A 3BKMH 5IVXF 5FKPB 1OSZA 1RJZA 3JWOL 3CLFL 5FYKU 3PHSA 4I4WB 2XA8L 2BJML 4PP1C 1L9NA 3D0LA 3VFMB 2F8OA 1KLGA 5K59F 3ULUF 3BXNB 1A9BB 2A2QT 3RUGA 2J88H 2NMSA 4ZS6D 2ZCLH 4KKBC 5HI3D 4TTDD 3LN4A 2Q86A 3QUYD 4G9FD 1U41A 4PJEE 4QXTB 1P7KB 4G6FB 2OCFD 2VRAA 2W9EL 1V7NH 2I60L 4HUNB 4P2QB 1S8DA 3IDIA 2ARJQ 3IU3A 1CD8A 5GISL 6FABH 1YPZA 2NW2B 5E4EB 5DO2D 5SX5K 1PZUB 1B4JL 3BD4A 2GSIB 4S10A 4XCFH 3A67L 3BPOC 1EEYA 1FVCA 2QSQA 2NR6D 5JW4N 4X6CB 4JZJB 1G9MH 1WAAA 3BD5A 3P30L 4OKDA 4YFDB 4Q0XL 1MCJA 3EYSL 3FT4B 2N4IA 1BGXL 3EDFA 1T0MA 4HJGB 3ILPB 1DEDA 3DVNB 4U33A 5D7JA 1OTUD 3FOLA 5D7JD 4QHLA 4YR6B 1WBZB 4UINL 4XX1G 5IHZA 2X7LA 4AIZB 4I9WE 3V6ZB 3UTTE 3QCVH 3UBXA 3VXOA 1RUPH 1YY9D 1F00I 3EDDA 4MWFB 4KRPC 1ODAA 3RVUC 2JCCA 3AUVA 5BV7H 2NY4C 4PG2A 1INDL 3SOBH 5DLMH 4BQ8A 4Z9KB 5GGSY 3OKDB 4O9HL 1FL5B 5A3ID 1TNMA 2NY7L 4R4FL 3T09A 1KPUA 1JL8A 2UWEE 4YBHA 5T3ZL 1U8JA 2IFFL 1R3KB 3RY5A 1EMTH 4LCYB 2F5AH 1FCCA 3QUZC 3HA0A 2PW2A 2A74A 3C5SA 3OB0H 1SJHB 2ITCB 2DQFA 1I9IL 4OGXL 4S1SH 3PGCA 2XICA 2HN7B 4H20H 4YDKL 4XVJH 4Q9CA 1OB1A 1RZ7H 2DIJA 3QO1A 4G8EB 1C08B 2PO6B 1CK0L 4JFZL 4U1NB 2BNQE 1PKQE 1NAMH 3ZKXC 3RVWD 1IEAB 1U3ZA 1MCOL 3R06A 5INDA 3KDMB 1EO8H 3BYTA 1VKXA 4GW1B 2B1AL 4R7NA 4YQXH 4DW2L 5FECB 4FQXC 4L8SB 3WKML 3GSXB 2OQJB 3LKPA 2K3TA 1PX3A 4I48B 3KPPB 1H0DB 4PGBA 4WW2B 4XP9L 1K4CA 1U93B 2XOTA 4WUUE 3MMEB 1AGEA 1FRGL 3O9WC 1JNHA 4XBGA 1CIDA 4KI5C 1T22A 4HD9A 1N8ZA 3E6FB 2ZNWA 2GTZA 2YA2A 5DHXB 1SHMA 5T5FL 4KKCD 4KPHL 3O6KH 4OLUH 3CSBA 4P9HH 4XI5D 1MAJA 1HIMH 2HRPH 2B0SL 4P2OA 4P2OD 5FGRA 1Q9WB 5IP4A 4RMQA 1F3JA 4LHUB 5F7EH 4CDHA 2IMMA 4LEOB 5DD1L 1I1AA 1R3LA 2H1PH 1EAPB 5FCUH 3WFHB 1A4KA 1AY1H 5JUEH 5EZOL 4YIQB 1JIBA 1BBDL 2ARWA 3OF6A 3OF6D 1JHTA 4NKIH 3ZE0E 2H6PB 2R15A 3RUGF 4DGYH 3TO2A 2DB8A 2MWCA 1GAFH 4ORGB 5C0RH 1WJ3A 3G5VA 1B88A 1FNSL 1X4XA 4N90E 1JGDB 4P3CH 1M1SA 4X7SH 4LSTH 4FQCH 1ZLUH 4NNPL 2NTSP 1CDHA 4DUXA 1YPZF 1MAML 4IRSB 1AKJA 4M8QA 1AH1A 1AKJD 1OAUL 2LE9A 3C5ZC 3LD8C 4G3YL 2CLVA 4OCWL 5CZXC 3TJEL 3ULSB 4X9HA 2V6HA 4U2ZA 1S7TB 4NYLA 1YEJH 3CK0H 3OAZH 1WAAF 4DJMA 4GAJL 4XHJD 2EE2A 4NO3B 5HHMD 1YN7A 2MNUA 3T3MF 4XNUH 3X12A 5F1IB 5E6IC 1CR9L 3PJSA 4JY6B 5I1JH 5IEHA 3CMOH 1EXUB 3HR6A 2IFGA 1HDMA 1G9NL 2FIKA 3S36H 3OBAA 4P4KB 4L1HA 3MJ9L 5J6GA 3HNTL 5J9PB 2WANA 5J12B 5C9KA 2OTUA 3TVMB 3VXPA 2JCCF 1IL1A 3DX6A 5KJRL 1B90A 1JK8A 4ZQKB 4BUHA 1BOGB 3AGVA 4JFQA 4WO4C 2A6IB 4X7DC 1I8MA 2VERN 4WJ5A 3LS5L 1MWAB 5DEZA 2YRPA 3GSWB 5DTFA 4AYFA 2B20A 2XWTB 1LO4L 4MXQC 4APQA 4K07A 4APQD 3P4MB 2GCYB 2VB5A 4QF1B 1MEXL 4DEPB 2UY7A 1LNUB 5HD8C 1GRWA 3TF7C 4C4KT 1A0QH 5I76A 1SMAA 1CDIA 3NPZB 3TIEA 1XCQA 1LK3L 1YEEH 1GCFA 5J1AA 2IQ9H 4PRBA 4Q7DA 4OV6F 1CFSA 3H3PH 3CMGA 3RTQC 3MOQA 1HQRA 1NAMA 4EDWL 2FATH 5LJYH 4KKLD 4X8JB 4BM7A 3RWCB 4OGAD 3T4YB 4ZUWA 4LASH 2BSSA 2XTJC 5J0BA 2OSLA 5HVFB 5EA0H 4ZNCD 4OCNC 3VXUB 4RGOL 3HI1B 2ILLA 5FHAL 1LHZA 2NY5L 1CE1H 2BOBB 2NY2B 3QUML 1A6TA 4IEFB 1A7NL 2VLRA 4JG0H 2VLRD 5E0QA 4HS8L 3KLHD 2NY0C 1AO7B 4X6BB 2EEDA 3GSNB 5D5ME 5D4QA 2YD7A 1CI5A 1AE6H 2AI0H 1MHPH 5KSUB 1OSPL 4PJ7A 3BEWB 3QIBC 1UH3A 5ENWA 5DRNB 1DEEA 5DDHB 5L2KA 3VFPB 5L2KD 3ALWA 3IGAA 4O58H 1UH2A 1UXWB 1D5BA 4J6RL 4JB9H 4Z7WA 1A6AA 3KJ4B 2QBWA 3OKNB 1J0HA 4DTGH 1RJLB 5EWIH 1R3JB 4Y7MA 5HVGB 3IJHB 1ZHNB 5AUMA 1YMHB 3L9RA 3QCTH 4RFEB 4N9OB 2E8YA 4NUGL 4EI5B 2ZPKL 1EK3A 3RY6C 1QA9B 1EX0A 4N8VA 1W72B 1HH9A 1ZT4B 3OJDB 1HHKA 4L9LA 4WWKD 5E8EA 3ARGB 2LVCA 1G1YA 2XRAH 5F7WC 3S37X 1YC8A 3LKSA 2FHCA 1QSFB 3BP5A 3NZ8B 1FG2A 4NJ9H 4QCIA 3UJTH 4A6YH 4F15C 4PJFA 1V8HA 2IANE 3MGOA 4PJBA 4FP8L 3GIZH 5CBEB 5AWNH 4AENB 1NCCH 1QD0A 4X99B 1MFEH 2XWBA 1CG9A 3S34H 2Y9RT 2C4FT 3H7BA 5TF1H 3FTGA 1F6FB 3O6MH 1EHXA 1FIEA 2W0LA 4P3DB 1DQJA 3DUSA 4OF5A 3LKNA 4GW4A 3ESVF 1AGDA 4PJAA 4OV5A 4KQ3H 1QRNA 1L4IA 4DAGH 1QRND 3OKLA 1QFWH 5AG8A 4HK3J 3QUXA 4GMTH 3QUXD 3X3GH 1JMZA 3UTSA 1MRFH 2XZCL 3AU1A 4ETYA 1ZVSB 4Q6YA 2B4CC 4ERSH 1GC1C 4TRPL 5LGJB 4WEMB 1SEBA 2R2EB 4QLRA 1G7PB 1QO3B 1X5LA 5I8EA 1ZANL 3EUUA 4G5ZL 4G6ML 3V5DA 1I7UA 1X5IA 4LAJH 3DURA 2K7QA 1A7QH 3ZYZA 4OGYH 2H2PC 1PBYA 1X3DA 5F7KC 3C60C 5CLTA 3SBWA 2W9DL 5BVPH 1E4XH 5ISZA 2EDOA 5ISZD 3LVEA 2YUZA 3CFDA 5IB3B 1SYVA 2G2RA 5MEOA 3VWJA 3VWJD 4EJ1C 1RZGB 5KSVB 4J2XA 1WZKA 4LHUG 1LILA 2OR9H 5I1DB 2EDQA 3O2VL 2FGWL 5DJ0B 4UTBL 4M1GL 2YK1L 2WZPD 3HUJB 5CGTA 2QQNL 5EU3A 2FBJH 1X4YA 3A0OA 4PV8A 2EKJA 4HWBH 4EN3A 4EN3D 5FGBA 3WFDH 1T83C 2VWEC 1RUQL 4RAVB 4CVUA 1C7TA 1MI5D 3JV6A 4ZFGH 4DVBA 2EDJA 1J18A 2CIIA 1U91A 4MZ3A 3V5HB 4EEEA 3UPCA 1Q9KA 5I6XC 3MJ8B 3ZE1E 4JO4H 4HH9B 4QHUB 3ZHKA 3VXSE 1YMMB 5C0IA 4X83A 1SBBA 3WDIA 3AXLB 1B0GA 3WIFB 5MERB 4K8RH 1VACB 3ZT7A 1HHJA 5F93C 4HIJA 1DCLA 5DUML 1L0QA 1BM3L 4JGJA 2ZOLB 3CFKA 2Z93B 4M6NH 4Z7WF 1V5JA 4NHUB 1LEKB 4ETQA 4WHDA 1MHHA 1VEPA 5DC9B 2EYRA 3VRIB 3TP4A 2BRRL 4YO0B 4LQFH 2X5PA 5D1QB 4ZD3L 2NLJB 3V4PL 3MV8E 3GHBH 4MZ2A 4X9FA 5JIIA 5ACMA 3QRFM 4KI5E 1I3RA 3MBEC 1ZVHA 5CCKH 5H37G 4C57C 3W11C 3PNWB 3MTRA 1MQKH 4A6YA 5ABDE 5KTEL 1U8MB 5I1GL 1OP9A 1U36A 4QNPE 2FO1A 3D69B 1XMWA 1A6VL 1V05A 3FB8B 5FM5M 5FYKE 5A1AA 5EOCH 4PJFF 5BJTB 3K8LA 4PJBF 5JIKA 1EUUA 2NXZC 4I18A 4JPWH 2VIRA 3DX7B 3KPNA 3PHQA 3WXWH 4QTHB 3O3BA 3RWFA 2FJHB 4WY7H 4MA1B 2AW2A 5T33L 1FNHA 2GY7B 3SDAA 3SDAD 1DE4A 3WUZA 5CWSB 5D7IA 1A3RH 1MH5B 1W0WB 3PWVA 4X6DB 4IDJH 1NCBL 2V5SA 5C8JA 4ONHA 5HHNB 2AQ2A 5F96H 4IRZH 2DTML 4U6XA 4NM4L 1MY7A 4MD4A 1A3LL 1ZTXL 2WW8A 2JB5H 3TCXA 4I9WD 1S5IL 5IV2B 3H9YA 1TIUA 3RKDD 4NKOA 5IB2A 5C08B 4NJAH 1S7WB 1ZA3A 5EWIL 3DBXB 1K8DB 1F13A 1YNLL 4P99A 4F2MB 3EFFB 5JW3L 4JZNB 2XQBL 2C3HA 1XEDA 2EDLA 3KG5A 2HJFB 1VGEH 5GGRY 3ROLB 2GJ6A 2GJ6D 2LABA 4MHHI 5INCB 3ZKND 2G75B 1DFBL 4LP5A 3BDXA 1N5AB 4MQXC 5GRXG 1DL7L 5DT1L 2X4QA 1MFDL 3BUTA 4OFKA 4YC2B 4ZTPL 2MOVA 3T0EA 4XH2A 3T0ED 2ATKB 1QBLH 5DZOA 5BRZE 3TV3H 2PYEE 1ZLSL 3MV7E 4KAQL 5JQ6L 1LP9E 1BZ9B 4ZFZA 4U1JA 3V2AR 2OZ4L 4HWBA 2NZ9D 1LDPL 1NGWB 4U6TA 4O5LL 5EU4B 3HPLB 4KZEH 2BZDA 2CDFB 3AMLA 2VC2H 3WNLA 2H9GA 5E2WH 3MCLH 5I16B 2KL6A 3PWNA 4GKSB 4HCRL 3ZDZF 5BMFL 4HGWA 5FGCE 3W39B 2BNQA 5ACZA 3QXTA 1DBAH 2BNQD 4JHAH 3I75A 1I4FB 5JXAL 5F9WC 4OLVH 3DO3A 4L29A 1D3CA 2D0HA 3MACL 1U9KA 1BX2B 1IGIL 1IEBA 2IWGA 4U0RC 3FFDB 3OB0K 3PWLB 5HPMB 3BP4A 4U1IA 1R5WA 5DD0H 4WUUD 2NW3A 2RR3A 4CVXB 2YPLE 3O2DL 2YHGA 5DJCB 2ZUVA 1OHQA 5I15H 4JRYA 4HW6A 5F44A 5JDSB 1VESA 5FUOL 1E4WH 3ARWA 5JMRA 3GKZA 3MV9E 1HXMB 5JPNB 1WFTA 2FJFA 3OXRB 1T04B 3K8MA 4QRQA 4TUKL 1A7PL 3QQ9C 2FZ3B 4OD2B 3O41B 4LARH 4ODXB 4P5TC 1QBAA 1K3IA 5I1LB 3RX8A 1N26A 4HBCH 1Z5LA 5TQ0H 5HBBA 3IFNH 4KTYA 4ODWB 5CEXA 2MSPA 3L5WA 2GTWB 3PV6B 4Y4KC 4PREB 2RCSH 1LO3L 1KN4L 4N90D 3ZYJA 3N9GL 3WFZA 5E4IA 2AQ1A 4QT5A 2J3SA 1ACYH 1GGUA 5C3TA 2VDOL 3SKNA 2WBJA 1H5BC 2WBJD 3QCUH 3HFML 3C08L 1A1OB 1NMCB 4FQ1H 1X44A 3DJ9A 4X5WB 3ZSSA 3GSRA 1IM9A 2B8OT 1IM9D 2R23A 4P59H 4YPGB 5D7IF 4XPHL 1KJVB 1A7OL 2Y36L 1FVDB 3RY4A 4XGZA 5I1IH 4LIQE 3FQWB 1DBBH 2W38A 3L1OL 1A6UL 1A1MA 1BQHA 3A6BH 5HHXL 4KKNA 2HVJA 4I0KA 3KPMA 5D7SH 2G5BB 1OTSD 1CFVL 2BSTB 3GJEA 3GDBA 4ZODA 3LQZB 1JWSA 3X13A 4XXCA 1HHIA 5FYLL 3OAZK 1EV2E 2F74A 4ELKA 3D0LB 1RJCA 2FJGB 3F7PC 1CDJA 2B2XL 5IESL 1N6QH 3QFJB 2Y5TA 1NFDE 3CFJB 4FTVB 1FO0L 2Q86B 3T3PF 4IS6A 2IGFH 5FOJA 3KPQB 4JHWL 5I75C 4LSVL 4PS4H 5EUOE 4PRPB 2N7AA 4PP2A 2MQCA 1YPZB 1IQDA 2FL5B 3GBLA 1CDUA 1N7MH 4X9GA 5T5NF 3SE8H 1F4XH 1U8PB 2PXYA 1KT2A 1BFVL 2PXYD 4HJ0D 4IOSD 1QUNA 1ZHLB 4UOW0 5CJXA 4S2SB 1PKOA 3DMMB 4XNZC 2ZCHL 1CLYH 3BP6B 4QHKJ 3VE0A 1CLOL 4PG9A 5KZCD 3W9EB 1T0MB 1WCQA 1BQUA 4YHZL 4WCYH 3IJSB 3Q6FB 4OCXL 4RBPH 4LCIH 5D7JB 1T3FA 3HE6C 3RL1B 3PV7A 4S1RL 1I85C 5IHZB 2X7LB 1UADC 2Z31A 2Z31D 1OD7A 5TQ2L 4UV7H 4MJIE 3UBXB 4AM0A 1XGUB 2CRYA 4BK5A 4CU7A 4WVRA 5F9OL 1IT9L 4LLWA 4EXPX 4QRSA 2QQKL 4U1SA 4TOYH 3NFNB 5D5MA 2BVTA 1KPUB 4BFIB 3QI9A 4WUKL 3HC3H 5JW5B 2RIKA 3QI9D 3O3AB 3QIUC 4NCDA 3H9SB 5F9JB 3HC0A 1I1FA 4YH6A 1FZJB 3MFFA 3UC0L 5I9QC 3I6KA 1U42A 5I1CL 3BKYH 2YZ1A 4ZPTA 3RWEA 2E7LC 5ADPH 3CSYB 1H9VA 2PW1B 4UTAL 3C5SB 4JFOA 2DQFB 3H9ZA 3RBSA 2OTWB 3QWOB 3PGCB 4DFHA 4DKEH 3S96B 3MJ6A 2CXGA 3BSZL 1P4IH 4KWUA 1OAQL 4ZXBA 3O6FC 4ZXBD 3MQIA 3QO1B 1A5FH 3X17A 2YC1B 4Y4FC 2APTA 2O5YL 1CFQA 1M7DA 5B3JE 4G9DB 1X5FA 5FDWA 4F7EB 4KVNL 4LEXL 5A43C 4Y1AB 3AM8A 3DGCR 3KYNB 1QEWA 2Q8AH 1OL0A 3MLSL 3I50L 4NT6B 1Q1JH 1MRDL 2ZCKH 2F15A 3DXAE 5TGBA 1FFOA 3ZT5A 3T65A 2IAND 3LKPB 2YWYA 2R4RL 4F7CB 2W07A 2PCPA 2DQGL 5DRXB 4L4VB 1YECH 4PP1D 1XGRA 1K4CB 1UWXH 4XTRC 1PZ5B 4U1MA 4I5BB 4LGPB 1N8ZB 4FG6C 1WTLA 4K23H 4PTUB 5L6YL 4KKBD 3OJMB 3E8UH 3GO1H 5IB4A 2EDFA 1RV6X 3KJ6H 5M95B 1JZ5A 2VAAB 2VUOA 1MNUL 4B53A 1F3JB 5HTSA 5I15L 2GUOA 3AS0A 3HI6H 5ALBL 1MJ7H 4G7YL 4GRLB 3EOTL 1I1AB 3SKJH 5DEFB 3EO1A 4HUXB 4NO5A 1A4KB 1RIUL 1KCUL 4OD3L 1JYXA 1AHWB 4LQ1A 3O8XC 4NQVA 3NTCH 3UZVB 5C9JB 4H0HB 1VA9A 1JHTB 3IDXH 4JQIL 3H3BC 1K85A 3AFLA 3TO2B 2EDWA 1IKNC 3V7MA 4I3RH 4I2XE 1CXFA 4XPBL 3QHZL 4YHNA 4KHTH 4XP4L 1A7RH 1VEMA 2OJZH 5EPMB 4M1CD 3OWEA 5EZIH 1XR8B 4LVHC 5GGUA 4P5MA 5EBWA 1Q72L 2EYSA 3ALXA 3LEVL 4KXZH 3AREB 5B39A 4LFHD 4KRPD 2Y25A 3RVUD 4MAYB 2EDBA 3BDBA 5IBTL 3TPUB 2QSCL 2NY4D 4LPCA 4NOBA 5TDPB 5KAQG 3NZHH 5LCVH 1DP0A 1YN7B 2NX5E 5DGRA 1AGFA 4NN6C 1LO0L 4L4TB 1YDPA 5IHUH 3UPAA 2FB4L 2FIRT 3S9DB 3NA4A 3MROA 4NN5B 1UXSA 3BH9B 5BV7B 2F54E 3QUZA 3QUZD 2IAMC 5SX4H 2RBLA 1I7RA 4ZFOL 1C16B 3U83A 4Y19E 2ZUSA 1DQML 4O2FA 3VXPB 3QSKB 1IL1B 4KROC 3CLEH 3A6CL 3DX6B 1MPAL 4JJ5A 3RU8H 5DQDH 5IG7B 5D5MF 3REVB 3P9WB 1HXYA 4IIQC 3VXSA 5ICZA 3VXSD 1HINL 5EZJB 2IPKA 2RAMA 4U6YB 4E42A 1GZQB 1INEH 4Z7UE 2F58L 5DK3A 4BJLA 1H3PL 2BCKB 5ANMA 4FQXA 5GRUL 4FQXD 2EDEA 1WBYA 3QPXL 1AD9A 1K9TA 3NCJH 1CZ8L 3MV8A 5J1AB 3MV8D 1NFIB 4PRBB 4U7SA 3O9WA 4LKCB 4OCRL 4GRWB 2DQEH 3O9WD 4PJGB 4KI5D 2VZ1A 4FZ8L 5FUCC 1G7QA 5F7DA 4NFCA 4LSSL 4MD5A 1XGQA 3QHFL 4NNYB 1I8IA 2ICEA 4ZUWB 4YHPA 2BSSB 2OSLB 4YGVB 2BDNL 5JO5B 3P9MA 3G6JE 3GK8H 4BQCA 5FYKD 1UZ8A 1GHFH 4JKMA 3V8OA 4X80L 4IOIA 4M7KH 2A1WL 2E3VA 4BSVA 3LHPH 3FCTA 4K9EL 1RZKL 1FBIL 1KIQA 2XYCA 1G7HA 1X7QA 3PL6C 1KXQE 1I7TB 1MCEA 1XF1A 3ZE2E 1J1XH 4WFFE 5GJTL 2CH8A 3U46B 5I1EL 1NDMB 2PKDA 3CFEA 5GRJL 5ILTH 3TBTB 2A6DA 4KTEH 5ADOL 4JGMA 4M43L 4HUUA 1BJ1J 3GKWH 3R8QA 4Z7WB 1YEGL 3C5ZA 4Q9RL 2AJZA 3RP1A 3C5ZD 3BESR 5CZXD 4LIQH 3EYQC 1YEDA 4O02H 5BS0E 1YC7A 4R3SA 2R39A 4JO3H 3L9RB 1BFOA 1WFUA 4XBPA 4R97C 3F12B 1F5WA 3HHRB 1DVFC 1G7MA 4J3UA 1HH9B 5E6IA 5E6ID 5E94B 3MRIA 5CJOL 2YD4A 4OZGE 2QV2A 1F4WH 2VL5B 3VFWB 2LAAA 1X5ZA 4C58B 3TZVD 3CZFB 3K7UA 1VPOH 3GMMB 3BZEA 3JWDL 3CCHA 1ZGLP 4JRWA 3CVHH 4LLUA 4P2RE 2EDNA 1KB5L 4JQVC 4OZFB 5BRZA 2PYEA 3BPNC 5BRZD 2YPVL 2PYED 3QNYB 3MV7D 1XGYH 3INUL 1LP9A 5I30H 3GMPA 4QYOA 5C07A 2ZCKL 5C07D 4XWOC 3FTGB 3BQUC 3NFSL 5JR1H 5IFHL 2EH7L 4WO4A 4WO4D 1UACH 2IG2L 2ZOKB 1ZA6A 1WWAX 2C3GA 3S88L 2NQCA 3LKNB 3ZHDA 4N68A 1AGDB 2DWDA 4MXQD 4TSBL 4XMLL 5BZDB 5CSZA 3V7AG 2WMPA 4LK4A 1JFQH 4G6AC 1NL0H 1IZJA 5DRWA 5HD8D 4NHCH 1CLZH 2AERT 3UTSB 4JKWA 4ZOBA 1KJMA 2HTKC 3U9PH 3K2UH 3RTQA 4WI4A 4PJXB 3FONA 1IGMH 3MUHL 1SEBB 5KSBF 5HI4C 1UC6A 1IGFH 2YPLA 4EQ2A 2YPLD 2KH2B 3QEGL 3P4LA 2BHUA 2XTJD 4F8TA 3V5DB 1I7UB 3DURB 3TBSA 1FH5H 3KLDA 1YJDC 3MV9A 4DOHB 3MV9D 4RFOH 4ALAL 1WVZA 4OFPA 1NLDL 1IC5H 1FIGL 4PY8I 1SYVB 5DHYA 1U58B 3MC0A 3BRGC 3EO9L 3GJFH 2NY0D 3M8OH 4MJ5A 2DWEA 5D70H 5E4EC 3KPTA 3FFCE 4XAWL 4LGSB 4C56A 1D5IL 4C56D 1SBSH 3QIBA 4PV8B 5SWZA 1RZJC 3DVGA 3QIBD 4QNPF 5D9SB 3EFDH 4JZJC 5IQ9B 4LLMB 4ISVA 3S35H 4CAGA 2ENYA 1BVZA 3JV6B 4MDJA 4DVBB 5C0GA 1U91B 3N1QC 3LSOB 2EIBA 2WWKO 4W81A 4XVSL 2ZUWA 3DIFB 3RY6A 1N3NB 4OCLC 2I9LB 1PY9A 3K0WA 5D93C 1PG7W 1JRHH 1N59A 3MRMA 1HHJB 1TETL 3BUYA 2DIAA 5F9AC 1XGPA 3THMH 3VD5A 4URTB 1PD6A 3L7FB 4L8BA 1MHHB 1R0AL 4X5XA 5FYJU 4XNXH 3FN0L 5JORA 1G6RH 1AP2A 4K3HA 3ARQA 3VMPA 5HY9A 1VEOA 4HMEA 1T1WA 3MLUL 3L6FA 5EC1A 2AEQH 1PG7H 3C8HA 1ERNA 2HJKB 2X4OA 3QEUB 5F6HI 5EU6E 1CDCA 5C3LD 2SEBB 2E27L 3W0WE 4HZLA 5I1KL 3U7WH 1GGBH 2OS7A 2DM2A 2PO6C 4NCC1 3RVXC 4JN2A 3TWCL 1YZZA 1LP9F 1ZE3C 2A77L 4OLXL 4QHNB 2ADJB 3KPNB 1JUFA 3O3BB 4N0RA 3BMVA 3RWFB 1NC2A 4ZFFB 2D03H 4LHJB 3DV4B 5HYJB 4YUEH 3G5YA 3Q48A 4L8SC 1LO2L 5D7IB 3H0TB 4J7RA 2H2PD 4JN1H 2HT3C 2E7CA 3S6CA 4U6XB 3C60A 4AT6B 3C60D 3EO0A 4UILL 1DN2A 3MLPA 4UUJB 3L5XH 1H3VA 1J87A 3EJZC 3TYGL 3P4NB 2P5EB 3OAYK 2QHRH 3BISA 3G6DH 5IGXH 3QJHB 4NUJA 4F7MA 2UYLA 3JV5A 3G5XB 4MJID 3PHOA 3VG9C 1WWWX 5DWUL 4WU7A 3NACL 5BZWA 3SJVB 3GMOA 4F7TA 1KCLA 3T4AA 2GJ6B 1T83A 1TTGA 2X1XR 2VDKH 2HMIC 1Y0LB 2Z8RA 4X9IA 5MEQA 4XPAL 4PGCA 2XWJA 2X4QB 2HT4C 4UNTA 3GJFA 4XH2B 5JW4Q 1OCWH 5LVEA 3B8YA 2P4AB 4HPOH 4DGIL 3NCBB 3P0GB 2IBZY 2ED9A 5A2IH 4NCC2 4PJ5B 4IRSC 2WIMA 1ZLWK 2WLZA 1U95B 3C5JB 5ESQA 4MNHA 4TVPE 2YOCA 3MNWB 1NKRA 1EGJL 1F8TH 4K94L 4AEEA 4JKPL 4UMGA 4KJYA 2X09A 2WNGA 1OAZH 4N8CH 3WJJC 4UIKH 1YEFH 3G5ZA 5DD6A 4UU9A 5CINH 1D5MB 1DQLL 2D7MA 2JJWA 5IJKC 3DXAA 2AK1L 2VL4A 3DXAD 4G6KH 2GK0B 1S78C 2IH1A 4UQ3B 1KXVC 4FABL 1RHHB 4MYWB 1X5XA 3OGOE 4XVTL 3MBEA 1BMGA 3MBED 1N4XL 1ONQA 5FUCE 1R5WB 5J12C 4RQQB 3TVMC 4OZFG 3W11D 3D18B 5D2LE 2NW3B 4HC1A 5ICYB 4O51A 3SKOB 3GM0A 5HHOB 1JZ3A 1GZPA 2BVQA 3D25A 2ZSVB 4X0KA 1AFVL 1PLGH 4JRYB 3U82B 1OGAA 4XC3H 1TNNA 4V1DE 3EYVA 1WQVT 2V7NB 1ORQB 3T0VA 4AL8H 4YHIB 1T4KB 4OIAA 1FO0B 2DM4A 3R8BB 3K80A 4BH8A 1P4BL 1UWXK 4LNVA 4DEPC 3DRTA 1TVDA 1NSNL 5TPWH 1RK1B 5K9OB 3L5WB 2V2WB 1G6VK 5BQ7A 2W0FA 3C6LB 4LKXB 3T2NL 3BIKA 4I2XA 4UDTB 4FZEH 1WCBB 4OLZL 3MJ7B 1U3JA 4LAQH 3B6SB 4QT5B 1EHLL 2NTFB 3MXVH 3UDWC 3O3UN 1QACA 4R96B 9CGTA 5E95B 1MCWW 2Q7NA 1JGLH 3UTZA 3DV6A 4LPUA 4YDIL 5E8DH 3D2UB 4M7LH 5EH1A 5ESAA 1OM3H 2NX5A 3DX9A 4OI9A 2NX5D 2NY2C 4OF0A 4F33B 1DSFH 5ICXA 1T20A 4MQXD 1LMKA 4XNQA 4PRAB 4DN4L 3VD4A 1A1MB 3R4DA 3RVVC 1UENA 2BVYA 1I9JL 3SE9L 1WT5C 1P4LB 2R29L 3DROA 3OAUH 2F54A 5JNYB 2FSEA 2F54D 5ID1B 3ZTJH 2J8UE 5A2JH 3BPCA 3VGFA 2CPCA 3EJJX 4Y19A 1JNNL 5HGGS 1S9WB 4Y19D 1X9QA 1CFTA 4Z76A 2VQ1B 1P2CB 2CUHA 3KJ4C 3ROOA 1ZV5A 4ELKB 4JPVL 5C7XL 4Q9BA 3GFUA 1KJ2L 1BJMA 1SM3L 3O0RL 2ICWJ 1OPGL 3F65A 4Y88A 4NZTL 2CXKA 4BZ2H 1P53A 5IEKB 4LVNC 1AC6A 4EI5C 3MLVH 4R8WH 2C3VA 1TZIB 1X5KA 4RX4D 4D9RD 1FYTE 4MQ7B 3ARGC 1NCDL 3T0DA 3OJ2C 2CGRL 4NIKB 2X9XA 3CDGB 1CXKA 3RWDA 3RFZC 2LV4A 1L6XA 1KT2B 3B9KB 4LVOB 3QULB 4R4NC 3DYOA 4LDLB 3ME0A 2CDGA 3RZCA 5B3JF 1FC1A 4LLQB 4NKDB 3I2CH 1EFXA 4PG9B 1D5XA 1FP5A 5FK9A 2JJVA 2YS4A 4RMVA 3RNKB 3RA7H 2VH5H 3G6JA 3FT2B 3PGDA 4ZAKB 3QQ9D 4DK3A 1XF2A 2Z31B 4LPYA 4P5TA 5ITBL 4P5TD 1KJ3H 4P2QE 1F6AB 2OYPA 4U1KA 4AM0B 3L5XL 5D7KE 1CBVL 3E3QE 4ODUA 3HAEH 3HS0A 1P84J 1E6OH 2FX9H 3QDJE 1RZIB 1A6WL 2JLLA 4YHMH 4Y4KA 4Y4KD 3MRLA 1IFHL 4X6CE 3PGFL 3U7YL 2Q7YA 3D85D 4WFFD 3LEXA 3BHBA 3OSKA 1XR9A 1J1PL 2VXUL 4LHQB 4RWYL 1IGJA 2DQCL 3TBVA 3FQTB 2Z0BA 5JPMA 2M8XA 4PTTB 2WP3O 1H5BA 1HQ4A 2AKRA 3HMWH 4JY5L 2FH8A 2N56A 3EGSB 5HYQB 5C2BH 1U6AH 1J8KA 4U31A 2UUDH 4JFOB 5BS0A 4M02A 1JHKL 5BS0D 1Z9OA 3WO3B 5LGHH 3WDHA 1KELH 3WFBL 2VXSH 2AEIT 5IF0B 4F37F 5HGBA 4Q97A 3JUZA 4HQQH 3IRPX 1M7DB 1XIWB 2AAVA 5FDWB 1CGSL 3MZGB 1U8OA 3K2MC 1QEWB 3VGDA 5AD0A 3NOIA 3PABB 3K74B 1YQ2A 1KBGL 1MREH 1FFOB 4P2RA 3TO4B 4P2RD 2Z35B 1KYOJ 4DCQA 3H3KA 2PCPB 4HKZB 4JFHE 3VI4F 4U1MB 1ES0B 4P57A 3LIZL 1EZVX 3V95A 1NAKL 1NCWH 3O6LL 4KH2A 4NKMB 4JFPA 5IFAH 1NFKA 1M71B 5F21B 2A9NH 3FO2A 4EVNB 5IB4B 2AP2A 1BFTA 4OIIH 4D3CH 3IETB 4IBLT 4ZO6A 3P0YH 1YEKL 5CUSH 1HE7A 1WZMA 3DX8A 4PR5A 2GUOB 5E08H 3L95B 2BMKA 2YD5A 2NYYC 5GIRB 2CLZA 4HUVA 1QLFB 2EC9U 4QO1A 1MCHA 5I8CB 4U1LB 4Y8DC 4ZUSA 35C8H 1O0VA 1P6FA 5AG9A 1GIGH 5D1QC 4J8RA 4KHXL 4ENEC 3WL9A 2HKFH 1OAKH 4QXUH 1F90H 1UCTA 5D6CB 5FO9B 3L3IA 2DIBA 2DQHH 4QTIL 3D0VA 3IS0X 1KFAH 5HYFA 3MLYL 5IBLC 3SE4C 5KVFH 5JOEA 3HE6A 3WFCL 2XZAH 3HE6D 4HK0A 5HHQA 2DTSA 1I85A 3DGGA 4M7JL 3LN5B 2DMCA 4TQEH 1Q9LB 3FQRA 3BZ4B 3MRCA 4XXDB 4P5MB 4R90H 4AEHL 3LEYH 3VFNA 1FLRH 2EYSB 2RFXB 3F7QA 4KRPB 1ZWIB 5FDYA 5KVGH 2OJEB 4JR9H 2Z91B 3D39B 1PSKL 3FFCA 4MA1C 3FFCD 3QIUA 2OMNA 4L8DB 5CKGA 3TPKA 2F9BT 1WEJH 4OD1L 3NAAL 3UTPE 3BGMA 3MA9L 3NFPB 4NQXA 3G6JF 1T2QH 5EN2A 3MROB 3MBXH 1N2RB 4IRJC 3WKNA 4TVPH 3HAEA 2E7LA 2HJLB 1Z3GL 1UB5B 3T1WA 4YEEA 1G0DA 1DQTA 2MTPA 3JTSA 5C0NC 1AQDA 4KTDH 3GJFK 2DL9A 5EC2A 3F58H 3ZE2F 3O6FA 5F6IC 1HXYB 3SGJC 2V17L 5KN5A 4PRIB 4Y4FA 2NXYB 3LCYA 5KSBB 4FQLH 3FMGL 2KDGA 3ZKXB 1RFDH 1BLNA 2X4UA 4D8PB 4UT7L 1ZVYA 4HWEL 5ANMB 2J12B 3ZMRA 1WBYB 1FNEB 2EXWC 1HHHA 3VFOB 4M48L 3MO1A 3HI5L 2UVFA 4XTRD 3T0XA 3WLWC 3O3DA 1SJEA 4FG6D 1G7QB 2QR0B 3IXTB 5FYJE 3OKEA 4OTXH 4OZHB 5EU6A 5EU6D 1JVKA 2ICEB 1RK0B 1VERA 2GAZB 1IZKA 5CAYB 1H3TA 4RAUA 3W0WA 3W0WD 2NY6B 2ZUQB 1UZ8B 2DQUL 3VMOA 3OKKA 3T8XA 4JPKH 1X5AA 4QWWC 3UROR 4PRHB 2Y06H 1FDLH 4NRZA 3QXVA 2YD9A 1TJHL 2E7HA 3O8XA 3O8XD 3L3JB 5DJ2A 1S7RA 1X7QB 3KPLA 4R6UA 5IFJB 1IKNA 3WJLC 1S7XA 1S5HA 2E9JA 1ED3A 1A6ZB 1RU9H 1NEZG 3ARFB 4HDIB 2XXMB 4JDTL 4QHMB 3V4UL 2LTQB 3HNVL 3V5KA 1UB6B 4GUPA 3VFSA 1N0LA 3GNMH 3BJLA 3O3EB 4AQOA 1A22B 4L1DA 2E8ZA 3MOAL 3JWOC 4F37K 4DKFL 1IGTA 2ED8A 4Z0XB 5KVDH 3CC5B 3VXUE 3B2UC 1TZGH 5J11B 3UYOD 5GZOC 3W5MA 3QEHA 4XBPB 2X10A 3MUGA 3FB7B 3OKOB 2VXQH 1VFBA 3E6HA 2W92A 1HYSC 3MRIB 1AO7E 1AJ7L 5IMKA 4LLYA 2Q3ZA 3GI8H 3O11A 5F7NC 5E1AB 1DTUA 3MRNB 5KSAB 1J12A 3H42L 5I19H 2YD3A 2X4PB 3BZEB 3CCHB 2IAMA 3CUPB 4NN7C 4LLUB 1ZSDA 2ZJSL 4JY4A 3LQAL 4KROD 5C07B 1JGEA 1FZOA 1XAUA 1F02I 1CL7H