2IEPA

Crystal structure of immunoglobulin-like domains 1 and 2 of the receptor tyrosine kinase musk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
187
structure length
187
Chain Sequence
LPKAPVITTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSALRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords Muscle-specific kinase receptor
publication title Crystal Structure of the Agrin-responsive Immunoglobulin-like Domains 1 and 2 of the Receptor Tyrosine Kinase MuSK
pubmed doi rcsb
source organism Rattus norvegicus
total genus 39
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iepA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iepA02
3MBED 3TWCH 5IBLD 1B0GB 4FQ1H 2XRAH 4TNVK 3MRDA 4IRJA 4UILH 2O5ZL 3DVNB 1MQKH 1O5DT 4WRLA 1WCQA 4PRID 5ERWA 5KOMC 4PUBL 4ZUTA 3VJ6A 2HJFB 1JWSB 1P4BH 2X2YA 5J11B 3HUJB 3B2VH 1U8MB 4XCFH 2AJSH 3SOBH 5IWLA 3QIBA 1EEZA 4F7PA 2AXHA 1D5ZA 4CU6A 3W9DA 3TA3D 3FZUD 3U4EA 3WIHH 1NBZA 2O5YH 4X7SH 2UZIH 5DJAA 3HE6C 1FNGA 5CJBA 3FQRA 5L0QB 1Z3GH 2NXZC 5ADPH 4OD3L 4YJZL 1DVFC 3DETD 2VKXA 5GGQL 2VOTA 4KTEL 4KI1A 2J6EA 3EYOB 2J4WL 3HMXA 2FNBA 3ZO0A 3G04A 4ZQKA 1G1YA 5B8CB 4N0CC 1CLOL 5GS2D 4CL7A 1IQDA 3SGKC 4P3WA 2DDQH 4S1SH 2F54B 5CLTA 1NL0H 1ETZB 3PWVB 3PGFL 3ZTNL 1IGJA 1HHGB 5GJTH 4LSRH 4JG0L 2DLTA 1KB9K 3VGAB 2QBWA 3UTTA 4R8WH 1G7IB 5C7XH 3ZE0E 1FVDA 1HHKB 4OJFL 4MXWH 2Z31D 4YGVB 3L3IA 1SVZA 3MJ7B 4JFDE 3KDMB 3S37X 1RJZA 4HH8A 5DJZB 4PTUA 3QEQD 1RJLA 3ILQC 5E70A 4BJLA 4TTDC 4MNGA 4O58H 4GRLD 5DJCA 3C5ZB 1N6QL 1QSFA 2YOCA 2E6QA 1L6XA 4XMLH 3X12A 3QFDA 4PB9L 1BJ8A 2ZJSH 4EUPH 1JTOA 4MDIA 2WBKA 2HKFH 2V9QA 1P4LB 4XP5H 1AQKL 1MI5E 4HS6A 1OTTD 4JRWA 4ZNCD 5I19L 4HFWB 1JP5A 4DVBB 4LGRB 5ID0B 3MYJB 2ENYA 4HWEL 4M6NH 2P43B 4HLZH 4MJIA 4JN2B 2WK2A 4X8JA 2YMXL 3EDFA 3MV7B 1T04A 3D39D 4K8RL 3S88L 3AY4C 3V5HB 5DJDB 1GVIA 4YE4L 1XGYH 5T5NF 2FB4H 4W4NA 1MF2L 3C8KB 1DQDL 4M6OH 4YC2B 3BWAB 3OR6B 4NSKB 3GHBH 1JNHA 5HJ3A 2E9IA 2VXUH 3FO0L 4TUJA 4FQQB 3GGWA 4CBPA 4LLMB 1AHWA 4QOKE 4GJTB 4WWKA 4PGZA 3AC0A 4HCRL 1Q9WA 5SX5K 3BQUA 5ENWB 3U46A 1ZSDB 3PL6B 3LH2L 3MUHL 4O00A 4LHUB 1KTDA 1W0VB 2X6MA 4AMKL 1KTLB 5D7JA 3QP3A 1MELA 4W68A 5I1CL 5IT2L 4J3SA 2DIJA 3SCMD 4DGYH 4LPCA 3VGGA 4OCMC 5CJOH 4JFZL 3H9SE 3BI9X 4J4PA 3UJTL 2J8UB 3UBXA 4OBRA 5GS0L 1ES0A 1UM5L 2X09A 4PJEA 1QG3A 5EU5B 3FQWB 3MOQA 3OPZH 2R29L 4JFQA 5K9OA 5B38A 4AY0A 3ALWA 3VI4E 4F2MB 5I1GH 4XC1L 3FRPG 1BGXH 4ZD3L 4I2XB 3WCYA 3BEWB 2EE2A 2C3GA 3EDEA 1CLYL 1FFRA 2XZCL 5JDSB 3VWKB 1J9CT 2VDMH 4X99B 1CFSA 4PJ9C 5C0EA 4J3UA 2DQTL 2WUCH 4IHOA 1YNLL 3UTSD 5BO1H 4EDXB 3QJFA 5I76B 1KB5B 3SDDC 4MQSB 3TIEA 4U2YA 3UJIH 2W0FA 1EHXA 3FMGH 1AO7A 5EUOF 1I1AD 5IHZA 2GK0A 5I1DB 4JHWL 5I16A 2OQJB 1I7UB 5LQBH 2I5YH 1XIWB 3MLSL 5F7EH 1BP3B 3DI3B 4XI5C 3RDTD 3RZWA 2NPLX 4EVNB 3L3DA 5KSAD 3F7VB 3QIWA 3G5VB 3I6KB 5IROC 3BD5A 1G9MH 3RBSA 4Y7MA 4HJ0D 1UH2A 4MA7H 3NIDE 5CUSL 3ZDXF 4NQDE 4NNYB 1ZVYA 1MRCH 4NC0B 1KG0A 1NCWH 5DI8B 1F4XL 1TDQA 3K7UA 1ZA6A 5BMFH 3NN8A 5F9OL 4J1UB 2BSRB 4PJCF 2QL1A 3CFJB 1NEZB 4ONFH 1EO8H 3VMOA 1F6AA 3P11L 1I3GL 4OZIE 5C0RH 5AUMA 1EUUA 3QCTL 4HJGA 4MX7A 3HZYA 4FTVE 2F53A 4NHUB 2ZUQC 3BE1H 4YPGB 5HHMB 5IB1A 2VQ1B 1CK0L 1I7TB 2XA8L 2LTQC 4WTZG 4JFYB 1JRHI 4XZUB 4YNYA 1XGRA 4IOFC 3U9UA 1KT2B 5T5FL 2AKRB 4JDZB 4GW1B 3QEHB 3HN3A 4OLZL 1EH9A 2EDBA 2NCMA 1U2HA 4MDJB 4QGTA 5AYQA 1YN7B 4MWFB 3VE0B 4NNXA 1UB5A 1CE1H 1MLBB 2H9GB 3HLAB 3ZYOA 3MA7B 5BRZB 1FZMA 3WL9A 1J8HB 3DXAA 1J0KA 4W6WB 4OLXL 3V79C 1OLLA 3PDOA 4KKCD 4U7SA 5HPMB 3GJFK 3QPQD 4R7NA 2I9TA 5EFIA 2W65A 3WHE0 4Y8DC 3HUJE 4IEFB 4ZOEA 4KAQH 5BZWA 5IEHA 3HE7A 2R1YA 3NCYP 3I6GB 4X80H 2R0ZH 5C6TH 3ULVL 4UTBL 2GIYA 3RWJB 4KRMB 4R6UA 2NLJB 4LF3A 2OMNA 2F74B 3BDXA 2BVPB 3KPSB 3S35H 1KEML 2WLZA 4CMHB 1QFPA 1I4FA 3FOMA 4M4RA 3NA9H 2JF1A 1QFWH 1Y0LA 3MRFB 5SWZA 1JL8A 3BPCA 4MZ3A 4L8DA 3HG1D 4NJAH 2EC8A 2K1MA 3ARFD 3VMPA 3CLFH 2CKBL 4JM2A 4Y2DD 5JXEC 3OTTA 3SKMB 5DJXA 2WP3T 1F4YH 4N8VB 5HVHB 4XP4L 2XPGA 5C0FA 4Q58C 1ZVSA 3ZTJG 1R5VA 3GIZL 3WUWB 4U4BA 4G7VH 5F7LB 1EHNA 3VXRD 5CAYB 3REWB 3IKCA 4WFGD 4IOIB 2MQ3A 4MS8D 4RMVA 1YEGH 1BVLA 4JGJA 1TNMA 5TFSL 2HMID 4QRRD 3RWFB 1VGKB 3VG9B 3PNWA 2CH8A 4TSAL 5EPMA 2KZWA 4UTAL 2NY2C 4DKEL 2D0GA 5FM8A 4AYFA 4F9LA 5DO2C 5E99H 1Q1JH 3I3DA 5JOEA 1YNKH 1MHPH 2C5DC 2HVJA 1TZHA 3MX0A 4NZUH 1DEEB 3QA3A 1JBJA 1BECA 1WJ3A 1UT9A 1OARH 5TQ2L 4P3CL 1BFVL 2CK0L 3T08A 3VXNA 5TQ0H 4X6DE 3DRTB 3V0WH 4OCLC 4GKSA 4GG8A 4PGBA 1IGTB 1KTKE 3GSQA 4Z77B 1RI8A 4ELKA 4GXVL 3FHQA 3S3SA 3BMWA 4JLRA 1JYXA 2F5AL 1BM3L 3WLWD 1NLDH 4ZSOB 3STLA 3MV7E 4PLOB 3VG0L 1AGEA 4KHTH 2NY6B 4U1GC 4FMFA 3FB8B 3X11B 4U1HB 4ZYKA 4LARH 4DN3H 2YPKB 5ELIA 1QO3A 5J12C 2BJMH 2AEWA 4OGXH 2FO1A 2PW2B 4HQQH 3T0VA 3ECBB 3RVXD 3BZFB 3L5WA 3UO1H 3MRQB 3O2VH 2N7AA 2H2SC 2O61A 1EPFA 3TT1L 4MQXC 1N5AB 3EOAA 5L6YL 4HXAL 4G7YL 1FZKB 3MV11 3DX9B 4HIXH 3BRGC 5KW9H 1RUKL 4E41D 4LLDB 4UINL 2WIMA 2WIIA 3L7EA 5EU7E 1ZLVH 3ZZ1A 3W9EA 2R69L 3ORJA 4DZBB 1QRNA 2BK8A 4G8EA 3T4AB 5ETUA 5KAQG 4WHTA 1U3HD 3PP3K 3QYCA 4KZDL 4QHMB 4GAYA 1AGFA 1R0AL 4UV4H 4YUEL 1CGWA 1X5XA 3T2NL 3CIQA 3N85L 4PJ5A 4TUOB 4P46D 5HHOA 3ZT7A 1D5BB 1UM6H 3KLHC 3FAXA 5HDQL 3MOAL 1UCBL 4LASL 2HG5A 5KVMC 1F3RB 3DV4A 4KJQD 2EDWA 1FBIL 2H45A 5DUPH 5I71B 3QG7L 5IMMA 4LLYB 4LVOC 2G5BB 4JB9H 1LDSA 1KN2H 1KENL 4G5ZL 3X14B 4Q0XL 2EDYA 5CJ8A 3SJVA 1N0LA 2W9EL 2B2XH 4CNIA 4E0RA 4I18C 2BCKA 2ZOKA 3DJ9A 1C5DA 1CI5A 4HUUB 1A4JB 5DRNB 3TESA 5IIEA 1YEDA 1OP5K 3BKCL 4PJ7F 4Y16A 5K9JL 1IAMA 5I1HL 4JO4L 3ZE2E 1JTTA 2XKNB 4DGIH 5KVEH 1CT8B 1BEYL 2PO6B 1BD2A 2O93L 1G7MA 2C1OA 4WU5A 2R23B 4U1KA 4NO0D 1IFHL 1VFOA 3ARBD 1OAKH 3LSOB 4WW2F 5F9WB 3TT3L 3R8BB 1JVKA 5BOPA 3O9WA 3CFBA 3EYFB 4NQUA 5KTEL 4O9HL 5FO7A 5F1OB 5CEXB 2DQFB 4WJ5A 3RWIA 2F54D 2XNAB 2F8VA 1N59B 4TYUA 2DS4A 4NBXB 2Q86A 5E56A 4RBPH 4B50A 3HAEG 1KFAL 5D7IB 4DCQA 4F9PC 2EIDA 3CVHH 1FIGL 1JWMA 2KKQA 3VWJD 3QUMH 1CGSH 4FXGA 3NZHH 4JQVA 3TM6A 3PUCA 4E5XA 1H3PH 4ODHL 3SE3C 4KJWC 3L1OL 3LKQA 2YKLL 2IH3A 4X0KB 4D3CH 5E6IC 4V1DE 2ZCLH 4OCXH 1YC7A 4WEUD 4AIXA 5DS8B 5EOQH 5FEBA 4OCYH 4U05A 4ZFZB 2BSTA 3QDJD 1J8HE 2EC9U 3Q1SH 4YDVA 3SDAB 1C12A 1XGQA 1XF2A 4ODXB 1LO5B 2DKUA 2Q1EA 2EXYD 2X4SA 2JB5H 3GKZA 5IW1B 4AIOA 2CXKA 1JMXA 3VW3H 1EFQA 3GBMH 4LK4A 4MVBC 5EU6B 2PYFB 2G2RB 2DICA 1P5UA 3B9VA 1JWUA 3MREA 2PYEE 1R6VA 2OXHA 1FV1B 1UWEH 1VEOA 1JZ4A 2CLVA 5SV4A 1DEDA 4UQ3B 1MFBH 1RIVH 1MPAL 2BC4B 1BWWA 1MCOL 1X5ZA 4I5BA 5HI5C 3ZYZA 5DD3H 3BXNA 4F58H 3CDFA 2J5LB 3Q3GA 4XRCB 1GL4B 2EDNA 3ALXA 4I9WE 3QHFH 3MV9B 2C9AA 2DMCA 1BJMA 4JANB 1CFQA 3MODL 3BPNC 4BKLB 4HCRA 3QXWA 1PX3A 2F8OA 5GRZA 3L5XL 5J0BA 2VERN 4PJBF 3GSVA 2VN4A 1MRDH 5EDXA 3UDWC 1NPUA 4NQEB 4JG1H 4OT1H 3W2DL 4R96B 1CE6A 3PL6D 4Y4HB 1KJ2B 4LHUD 5GRJH 1BZ7B 3PV6B 3WXVL 4OFDA 2OI9B 12E8L 3OKLA 2WSKA 5IVXB 5DTFA 4Y1AB 1EGJH 1EVUA 1S9VB 4YHZL 3GRWH 4KKAC 5C0GA 1S7UB 1U8OA 3CZJA 5DRXB 4JQIH 4S2SA 4JO2H 1LO3H 1NAMB 2VISB 5HHXL 2OYPA 4Z7WA 3TZVA 3DO7B 2ERJC 3T0BA 1A6AA 2DQGH 2FJHB 3WFDL 2QR0B 3ET9F 4Y5YB 3WSQL 4TSCH 3UZQA 4XXDB 5HYIA 4M43L 3UTPE 3KJ4B 1RULL 2CO7B 3REVA 1IKFL 3VWKD 3RPIB 2GYSA 4MSWA 4R26L 3RWGA 3ULUF 3D85A 5JLZA 2A9NH 5F7KC 5C2UB 1QR1A 2ZG2A 4RIRA 1CXIA 2PXYB 1CL7L 1X7QA 2ESVE 4U1JA 2GJJA 4KMLB 1BPVA 4JRYA 1OF2B 4YAQA 2ICES 5LVEA 4HZLB 1XF4A 1RHHA 2CIKB 3V4UH 2A77H 4OZHB 2W0KA 3Q5TA 5BV7L 2GQHA 3VD9A 2NXYC 4IS6A 4PG9A 4YGAB 4IDLA 1XIWD 4KHXL 4LP4A 1MRFL 1OTUC 2DYPB 5ACMA 4M3KB 4KY1L 3U82B 5CGTA 1FVCA 2DJUA 1BIIA 3E6HA 2Q7NA 5I1IH 3I9GH 1AR1C 4DKFL 3T09A 1M71A 1WFNA 5FYKH 3SE9H 4OKDA 1I3RA 2IPTH 3PWLA 1IAOB 4DFHA 1QYGL 5I30L 3O2DL 4LGPB 3HNTH 2ADGA 2BNRB 3VXQA 2XACC 3H7BA 3OV6A 3HPJB 3WO3B 3MRIB 2VE6A 4L8SB 5HHMD 5I17B 4JKPL 2OJZL 1G9NH 1PG7W 1QNZL 1FZOA 2Z8VC 4AJ0A 3VDAA 4I3SL 2FIKB 4X6BA 5L8KB 1JHKL 3KPOB 3ARGC 2P48B 1EXUB 2X9XA 4NUGH 4J6RL 1NANH 4QXGH 4O2EA 3ZDZF 1T83A 3MZGB 4LPUA 1QPXA 4ZXBB 4F7EA 1YY9D 4CVXB 1W0WA 5GZOD 5INCB 3QRGL 5GRVK 2P5EB 1YMMA 4GRWF 4XPGH 5EORL 4BZ2L 5BRZD 1CG9A 2VIRA 2GJ6A 2VO5A 3CCHB 2LU3A 4N1HB 3X3FL 3Q2CA 3GMNB 1TQCC 1WCBB 3MJ9L 1F6LL 3QO1A 3KR3L 1T4KA 1G6RA 1MUJB 2AK1L 1IM9A 2UUDK 2IANB 2NQCA 1CD0A 1D3CA 5DUBA 1E6OH 1AE6H 4NQSB 3QUZC 4PJHA 1S5HA 4XCYB 2WANA 1KCSL 1JYWA 3HMXH 4I0PC 1T1ZB 5I1KL 3KG5A 3RZCD 1NLBL 1JCKA 1C08B 3MGOB 2WAHA 1X5HA 3KPSD 1FIEA 5EZOL 3S4SB 3I6LE 2BOCA 2ARWA 2Z91B 3T0DA 4MXVF 4OB5H 3EDJA 1VFAB 2CKBA 5ABDE 3L3KA 5ALCL 4K7FB 4Y2OA 5DQDL 1VADA 4OBSA 4GSDH 2IPKB 2EDEA 3RJDA 3NZ8A 3S6CA 3WHXA 4OGYH 2BVYA 3AB0C 4PJFB 1G9NC 3B9KB 4L9LA 2LU4A 3QUYC 2FGWL 2F5BL 3RTQC 4H5SA 1SY6L 4ZUWA 4CDGC 5BS0B 2AJXH 3QHZH 1IAKA 4JY4B 2DJ4A 1FFPA 1JHTA 4OF7A 3WEXA 3T1FB 5IK3A 4K7PX 5BJTA 4RA0C 3O6FC 3ZE1E 4QRQA 4LHJB 1GCFA 1LO2H 1LK2B 5TDOB 3RGVB 2WW8A 4DW2L 1VACA 3M17B 1ZANH 3M8OH 4DZ8A 1AKJA 3SQOH 2HFGH 5F9AC 1WC7B 4LLQB 3IU4L 4PLNC 3A6BL 1BBDH 1S9YA 5C09B 2VAAB 3OKYA 1OP9A 4U1NB 4BSVB 4ZO8A 5KSVB 2FL5A 1JGDB 4XNUL 3BGFC 3VFNB 4XCCL 1MJ8H 5KAQF 4LCUA 1JPGB 4JR9H 4MA1C 5J06A 1RY7B 2HFFB 4KRLB 4Z5RB 3BGAA 4PY8J 2ZCHL 4LCYA 5C0BB 5EU6E 2EZ0D 1CFNB 1NC4A 3WJLC 4JKWA 5HGHA 1RMFH 5F1IA 1VKXB 1RZFH 2E27H 1OAYH 2FBOJ 3T3ME 4KROC 4RQQB 4FNLH 2NY6D 3SPVA 4XNQA 4YEFA 4QHUA 4Z7UB 5LWYL 4XVSL 3VXUE 3QFJB 2YR3A 4OAWA 5IMKB 5CD3A 4HS8H 5SX5H 4KKBC 2Y7QA 4MNQB 2C7UB 3FO9B 3NPZB 3FQXA 1INDH 1FRGH 2HJLB 3QSKB 5HI4C 5C07A 3FTGB 5D2LF 4K2UL 4NQEE 3F5WA 4PJIF 4JN1L 3IRZA 3E6FA 5T3ZE 5T1KD 1GIGL 1FNEA 3THML 1DQTA 1DVFB 4DKDC 5KSUA 5JW3H 2X1QA 2Y1VA 1B0RB 4JFDA 1OLZA 4K7PY 3HC0B 4RGMC 2OR9H 3RVTC 1I85A 1R3IL 1QLEH 4G8FA 1A7NH 3WN5A 2EIZA 3Q0HA 4NRYB 5C92A 1L7IH 4LLAA 1KSRA 3HR5B 1Q0YL 4RX4A 4DK6A 1EAPB 5FECA 5KG9A 4APQC 3EKCA 4H25B 1MI5A 2DBLH 2CRIA 3QNZB 4OCWH 5ESVA 3QR2A 4NQCB 3QXAA 4OV5B 2QEJA 1HSBA 4PRBB 4X7FC 2WWKO 3A6CH 2BERA 5HVWA 4JFPA 1P2CB 3KYMB 5I18H 4UDUB 3BGMB 15C8L 4Q74A 4Q9CA 5GS1B 5DDHA 1QLFA 1ZEAH 3F62A 4KK6C 3KLAB 4FZEH 5HGAA 1NGYA 3IXAA 1W72L 4R90H 5ICZB 2XTLA 3BD4A 3W0WE 4DTGL 2F9BT 1WGOA 3VGFA 2N4IA 2SEBA 5DT1L 4S0SD 4MA3A 5J3HD 2H32B 1FH5H 1RZJC 3FFDB 4X4MA 4X6EB 3KPLB 2LAAA 5IVOA 4D0BA 4UU9B 3PQYB 4S1QL 1OAXH 4MXQD 4PBWD 5BXFA 3L3GB 1CF8L 3T0EA 3DSNA 3EYVB 4PRHB 1BQSA 3FO1A 5E2JA 4YWGH 4ISVA 1QEWB 5J6GA 4QNPF 3EYUL 1ZLWK 2Z35A 4C54A 5H8DA 5EUOA 2NY5H 4N0FA 5HGDB 3IFOA 4L29A 2MHAA 2CSPA 3H9SA 3DMMC 4P4RA 4LMQE 32C2B 4GMTL 2X4UA 2I07B 4MQTB 1E4XH 3MGAA 1A6WH 4WW2C 4H26B 1PD6A 3WIFA 4EBQL 4TTGA 1B4JH 2NTFA 2P47B 2NR6D 3ULSB 2ATKA 2X1WL 4HMEA 4XPFH 1MFAL 5EBWA 4FQLL 1NMAH 2P46B 1YMHB 2DD8L 5TF0A 3L95A 4RMWA 3QUXC 3KPRB 1G7HB 5JO5B 3GBNH 1NCAL 1I7RA 1A64A 2N7BA 5FGRA 2P42B 2ITCA 1R3LB 5JW5A 3O8XA 3GJFH 1P6AB 1ZLUH 4EUPB 4P49A 5JPNA 1K3IA 3EGSB 1RJYA 5K33A 4TVPH 4HPOL 1S7VB 4RGNC 4GBXD 2BVOB 3QZWG 4PG2C 3BPLC 2BY3A 3TVMD 43CAA 4K7PL 3EJYC 3SY0B 5BQ7B 4JPIB 5MEQB 3WKNA 3QCUL 1BOYA 3D9AL 1KIPA 4O2FB 1Z0MA 1CFTA 4PJ9B 3GBLA 1K5NA 2NY5C 3DV6B 4X5XA 2ED8A 2VDLL 4NFCA 4NZTH 1OSZB 3O11A 4M1DH 1U95B 3HMWL 3KXFA 3BX7C 4ELMB 1XGTA 3O3EB 3CXDH 4Z7NF 4HD9A 1YPZE 3B3IB 3CNKA 3MV9D 4WTXA 1R3KB 1UB6A 4ZTPL 3SQBA 4OZIA 4JDVA 2AV7A 5JNYA 3CSPA 3KYKH 1D6EB 4H20H 3MLPA 1J11A 4XC3L 4IRSC 4HWBL 1Z9MA 8FABB 5MENB 2XFXB 4YFDB 3AXLA 5GXBB 4J3TA 2GTWA 4F15B 4U6YB 3F7RA 1BQUA 3KPMA 4QTIH 5CBAB 4NN5B 2EXWD 5BZDA 4ZUUA 3C60C 4OZGA 1P7KB 4ETQB 1A3LL 2DQHH 5L9DH 2ADFH 2OMBA 3G6AB 1RFDL 4KXZH 4U1MA 1FAIL 1S7XA 2JIXB 5IHUH 3LEVL 5EU3B 4LVHB 2RJMA 2FX9H 5IEKA 3DYOA 2GCYA 1MCPL 3I3BA 1L0QA 3P4LA 3DX6A 2DM2A 2ZSVB 3IDMA 1JPST 2BSSA 4PP1D 1JN6A 1KNOA 2PF6A 4W6XB 1N7ML 4U6TA 5GPRA 5I8CA 1RURL 1SVCP 3MUGA 4EI5C 1JGVH 4KUCD 2KUTA 1EJ6A 5E8DL 4Y19B 5HI3D 3IVKA 4KQ4H 1KCUH 3PWPE 4NKMB 4LKCA 2V2TA 1I9JH 5JUEH 3DI2B 4XWOD 1MAMH 3ULUC 4WDIA 3T8XA 3E8UL 4Q9QH 4HUVB 4X98A 2HT3C 3PGDA 3T4YB 2AS5M 1P9MA 3QFJE 2HT2D 3RPKA 3FT3A 2J88H 5F89B 3CFIC 4MNQE 4S1RH 1AY1L 2UV3A 4ZS7H 1WAAE 4P2QD 3H3BC 4ODTH 2AJVH 1OAUL 5HDBE 4EN3A 1Y18B 3CH1A 1DJSA 3DX8A 3CPLB 2X4NB 1UA6L 3O2DA 5AZ2H 1LO4L 2KDGA 3K81A 4FQ2H 4G3YH 4LHUG 5DJ8B 1Q0XH 3IFPA 1QFWI 4PJGE 2N56A 2VLRA 4NGHL 4PBVC 5FYLL 2DQJL 3I75B 1HN1A 3JV6B 2BNRD 4P23B 3WS6A 1NJ9B 1GGBL 3MNZB 1TNNA 3PP3H 3O45A 3MV8B 4OI7A 2O5ZH 3LKPB 1E6JL 4XAWH 3B9DA 3QJHB 2FDBP 4PUBH 4YEEA 3GDBA 4HUWB 4X6DA 2DQUL 3LHPL 1F4WL 1XGPB 4NQCE 4JM4H 2ENSA 3DUHA 3WE6B 3ZE0F 1HE7A 5IR1B 3MJ9A 4L3CB 1ZHBA 4KV5E 3G5XA 2P5ED 3FQNA 3TN0C 1FC2D 1NCTA 5GGSY 2NTSP 1YJDL 1RU9L 2DB8A 3P77A 3D18A 4KTEH 4TRPL 2AJYH 3UJJL 2J4WH 2JCCB 3LEXB 1BJ1J 2D3VA 2IAND 1OP5H 5HYJA 4FP8L 1P7QB 4WI7A 1CLOH 3LQAL 2OJEA 4M5ZL 4YBQD 1RZKC 4LRIA 4P9ML 4MD0A 5IV2A 4XNYL 5DD5L 2ZG3A 2UVFA 4MAYA 4UV7L 2QJDA 3PQYE 3ZHDA 4QRRE 3QI9B 5I2IB 4V2CB 3JWDC 2EKJA 1IGCH 1YY8B 3MXVH 4PRHE 4I3GA 4CGTA 4PGCB 3AREA 1YQ2A 3GSNH 1Q94B 2WWMC 4YHKH 1MCKA 1F3DH 5F6IC 4WIQA 4OJFH 1SY6A 2FR4B 4Y4FB 5C9KA 4U1GB 3MLZL 1HQ4A 4ZAKA 4BH7A 4D0CA 1FNAA 1LEKA 3B9KD 4X7DC 1NEZG 2ARJB 3D3VA 5F3BA 1QQDA 5BS0D 1OW0A 1Q72H 3CDGA 2Z9TA 2Y36H 3RI5K 4ZMAT 1A6PA 4YXKL 4OD1L 4PB9H 4Q9RL 3H0TA 2Y9RT 5B3JF 2N1KA 4P2OB 4H1LH 3MUY1 2VLJE 1AQKH 1MOEA 1ZKAA 5T1DL 3KPRE 1HOCA 3EYSL 1HIMH 2ZCKH 4R7DB 4HIEA 5GHWH 5C09D 1BQHG 1FG2B 1NC2B 4K71C 4PJ8A 1J0HA 2Q7YB 4K8RH 5E00B 2HLFD 3S88H 4M7JL 5IG7A 3V6OE 1CICB 2W60A 4OUOA 1C1EL 4KGJA 1DQDH 4XCEA 1H8SA 1ZT7B 4IDJH 3MO1B 3RY5A 4KI5E 3FO0H 1FNFA 5C0BD 1OGAE 4Q6IB 1ACZA 1U42A 3TBWA 1OD7A 1UZ6E 4X7CC 4YZFF 4DAGH 5F72S 5DSCA 5C0CD 5CCKL 5JOFA 3OHXB 3O2WL 2DLEA 5I6XB 1T21B 5IGXL 2GEEA 4M6ML 4PJDB 3IDYB 1QFHA 1QTYT 2OTWB 5D5MB 4OLWH 3FOLA 1WIPA 3CFCL 2WM0A 1YEHL 3WNMA 1XH3B 3FRPA 3H2WA 5I1CH 3FQTB 3NCBB 5CHNA 5IBTL 4L4TA 1RZIA 2C1PA 3L7FA 3TO4B 5J1TC 1JFQL 3LDBC 1UFUA 1DLHA 1JUFA 2NW3A 3V2AR 4ZPVA 1PG7X 4CADB 5IQ9B 5MENE 4N8VG 1WWWX 3MRCB 2DQEL 3ES6B 4RAVA 1VEMA 2XTJB 3HE6D 1KGCD 4N5EC 2IBGA 2JK5A 2YD4A 4OZFH 5EA0H 4P0DA 2LVCA 4ZD3H 1DVFD 3WUWG 3C87A 3GM8A 3NIDF 4XMPL 3VXTA 5D2NB 5FFLA 3WKMH 3PWJA 1AGBB 4Y4KC 4KZEH 4N0CD 1K2DB 2DQTH 3KPPA 1YNLH 4LLUA 3VI3E 2VR4A 2NY7H 1CGYA 5D8JL 5D4QA 2X9WA 2NZ9D 4M7LT 3LQZA 5D1XC 4MJ5A 2HVKA 1HINL 2A6KA 3MCKB 3CAFA 3DURB 5IUSA 4MD5A 2MCG1 4I4WB 4WI4A 4KQ3H 2CQVA 4JHWH 2PYEA 4ODVH 4KK5C 4FA8A 5AWNH 1G1CA 5F9DC 3MLSH 4JREC 1YEFL 2AEPL 1A1MB 1MSPA 1W72A 1VFBA 4C56D 4M03A 3I2CL 1YUHA 3V4PH 1HXMB 2A6IB 3KJ6L 3VFVA 3ILQD 5ANMA 4HAGA 4WTZA 5CUSH 4RFOL 2D31B 1AJ7L 4DQOL 4X7TA 4PGDB 4X4XB 5F9OH 4OKVA 4U7KA 1H15B 4ODWB 5IBLC 5F88A 1X5YA 3HUJF 1T20A 3LQMA 1I3GH 1KXVC 3TBVB 3D5OF 4YHYC 2YD6A 1HYSC 3IDGB 3EIFA 1MY5A 3I02A 4LAQH 5DEFB 4GFTB 3OKDA 4GW5B 4J7RA 4WV1A 3ARDC 1A7PH 4XGZA 2DJSA 4OLZH 5DD1H 2X70B 4JKLA 4WHYG 3GSXB 3DBXB 3BPNB 1VHPA 4JY5L 4QWWC 3TV3L 2CDFB 3U9PL 2R56H 3SDXA 5KOVC 3CVHB 2BVUA 1MLCA 1YEEL 3CZFB 1J7VR 3QUMB 4OLXH 4R0LB 4QXUL 2P5WB 5F96H 3U7AA 2FATL 2ORBL 1CDUA 5SWSA 4HS3A 3VXSA 4X6CB 1TIUA 1VGEH 3IDXL 3T0WA 2AV1A 3D0VB 3GMPB 2DQCL 1T0MA 5FCUL 3ULVH 1FFNB 1G6RH 3TBSA 2ESVA 1SEQH 3S37H 3OR7A 3TO2A 1IEAA 2UUDH 4HWNA 4IIQA 4L4JA 4EQ3A 2DM7A 2A6DA 4I1NB 2QKIB 2VDKL 2WQ8A 3BIAX 1U8KA 5FGCE 4XPAL 4MYWB 3KYNB 4NO2A 3N0PB 3W39B 3DUUB 4PD4K 1ZA3A 3GMMA 3V0AC 2E9JA 3IGAB 4PRNB 1X5LA 5JXAL 3QXDA 4OD2A 4GRLC 5JQ6L 2XIDA 1ZT1B 4TPRL 3FHAA 1P69B 4PJ9D 4D9QE 4HT1H 4XP4H 3ZKXC 4JZJC 1A6UL 1PDKA 4QY8B 4HKZB 4M5YL 1UZ8A 1WFUA 1OTTC 4MJ2A 2XZQH 5EZLB 2EKSB 5L7XH 3BZEB 1AD0A 1FCGA 2IH1B 4MCZB 3SDDD 5MI0C 4HWBA 4IMKA 2RBLA 5TFSH 4NHCH 4Y5VB 3VXMA 5CBEB 5FDWA 1MCRA 3ARYA 4TSAH 3O6ML 4QT5A 2G75A 3L5JA 4DKEH 3CFDA 4KKLC 3VFGL 3TGXA 5EBMA 1KJMA 3L5IA 3CDCA 4L5FL 4XI5D 3VU2A 3G6DL 2VABA 1MHHA 3JWNC 5DD0L 1U8JB 3QDGE 5BVPL 5TQ2H 1BFVH 3FCTA 4B41A 1Q38A 3GI8L 2ZOLB 5IFAL 3LN5B 2NX5A 1HH6B 3QQ3B 3MFFB 2VXSH 2QSVA 4JFXB 4GXVH 1V3KA 4U1SB 2WINB 1J88A 1H3UA 1U3YA 4C57C 1MCWW 2JIXD 2F5AH 1P6FA 2J8UF 4U1IA 1KYOK 4LQFL 4L3EE 3H9HB 2VWEC 5HPOA 5JW4R 5KBNC 4X5WA 2FYYB 4HSQA 4WFFD 5DA0B 5JW4N 4GG6E 3K8KA 5MHSD 4PV9B 4WU7A 1NANI 3MV01 5IB4A 3AROA 5CP7A 4Q97A 4JJ5A 3HRZA 3QIUA 1J86A 4Y19D 3LEYH 3B4NA 4PGEB 1YDPA 1XF5A 4G8GD 1A14H 3FQUB 3QWOB 4B53A 2IQAA 4L4VD 1S7SA 1H3VA 3RX7A 3SBWC 4KUZH 5D5ME 3MRGB 5L6YH 4HXAH 1I8KA 3ARRA 4G7YH 2F8XC 4WFHD 4WNQA 2IG2H 3G5YA 2X4RA 3GMOB 4RAHA 1DQQB 1RUKH 4ETYA 2APFA 3ME0A 1YEKL 5ICYA 3QUZB 2MPAL 2PR4L 1I3UA 2BNUB 4M61B 5EIIA 2R69H 1IC7L 3HI5H 3CC5B 4PR5B 1FJ1A 2V2XB 1U8PB 1XGUA 4QRPB 2V2WB 2BHZA 4YH6A 4P5TA 4YUEH 1QRKA 5FV2A 1MCJA 1F2XK 3RDTC 3OAUH 3N85H 2AK4A 5D2NE 1YN6A 4AEHH 5KSAC 2VLKE 2YSSB 5HDQH 1CXEA 1N64L 5CJXC 3ROLB 1G0XA 2UZYB 4FFWC 5IFHL 2OZ4H 4K94L 3RWEA 8CGTA 1WZ1H 4HJ0C 3MV8D 3QG7H 5JXED 4LCWA 1JIBA 1UACL 2V17L 1KENH 4G5ZH 2XY2A 2Z4QA 3MRDB 3P4NA 4IRJB 2QADB 3VRLF 4FABL 3EOBB 2XY1A 3WFBH 1JPSL 2R8SL 5ERWB 2VQTA 4ZUTB 3VJ6B 3CSBA 4G6AD 5T1MA 1EEZB 4F7PB 1D5ZB 1H9VA 1DBJH 3B8YA 4WY7L 1NBZB 5K9JH 5I1HH 1WUNT 5ESQA 5DJAB 2NY2D 1A5FH 1FNGB 3FQRB 3NBNA 4YXHL 1JPFA 5EOTA 1RVFH 2ZPKH 4JZOA 3VXUA 3AS2A 2JJTC 3U0WL 4HIJA 4RDQG 3JVGA 3TT3H 3G04B 1OQXA 4ZQKB 3EFDH 2OL3L 3FFCE 5FGBA 4NQXA 2GSGA 2A0LC 4OLYH 5D7LA 2E7CA 3ARZA 1ZLWH 3TBYA 1IQDB 3QI9D 3MBEA 3H3KA 1QKZH 1KFAH 5LBSH 3OJDA 3C6LC 3P3YA 1R24A 3V8OA 1F8TL 1IGJB 4UDTA 4QO1A 2GUOA 1KCVH 4PRIA 5TPWL 1OB1A 5FOBA 2ICWA 3UTTB 4Y4FD 2JELL 4QHNA 1FVDB 3L1OH 3ZKMC 3BKMH 2YKLH 1RUMH 1IT9H 2EO1A 2Q8AL 1RJZB 3TA3A 2EE3A 1IRAY 2I60L 1RJLB 4JCLA 1QBBA 1NUFA 4MNGB 3H8NA 4LOUD 5DJCB 1BVKA 1QSFB 4OUUA 4DUWA 2XKSA 2KL6A 3X12B 3OL2A 3ARFC 3QFDB 1KPUA 4P2OD 3UBXI 3CX5J 4MDIB 2E7HA 2H2SD 4HKBA 4HBCH 4MQXD 3B9AA 4XX1E 2DI8A 1JZ5A 4HS6B 1J8KA 1MCEA 4RGMB 1SBSL 1IGMH 3WXWH 1EZVY 1EIBA 2A6JA 3SO3B 35C8L 2DKSA 3QNYA 2YEZA 1MPAH 2VXTL 3D0LA 4OCRL 2HH0L 1MCOH 4HFUL 5D1ZA 1RUQH 4X8JB 3BDYL 1QSZA 1U2CA 5LAXA 1T04B 2EDDA 2HMIC 1CICD 2I26N 4J23A 4O4YH 1T1WA 5FUOH 2CRYA 2EC9T 5I15H 4NM8L 4P5KB 4G9FE 2YN5A 2Z31A 1JNHB 5HJ3B 4UB0H 4W4OC 2V7NA 4NQVA 2IAMA 1CU4H 5E5MA 1AHWB 1G7LA 3N50A 3QEQA 1NAKH 4UAOB 4RMTA 5C3LD 3W2DH 1LE9A 1Q9WB 3MOBL 3BQUB 1YEIL 1AP2A 3WD5L 3U46B 5ISZE 5IBUB 2B1HL 1PEZA 1NGXB 2DM4A 3WXVH 1KTDB 2DL2A 4HKJA 5D7JB 1U8HB 1NFIA 4YHZH 5GGSA 1OHQA 1IL1B 1F13A 4P99A 3CSYA 1N3NA 5J13C 4FFYL 1FGNH 2BNQB 4MCYB 3UBXB 1ES0B 4JRXD 4PJEB 1D5IH 4K94C 1GRWA 3F65A 3P0VL 3K4AA 2QQKL 2XTJD 3E3QE 4JFQB 3UCRA 5K9OB 5E2VL 3DROA 2VXQH 5B38B 3P9MA 5I1JL 4M43H 3GSUB 1RULH 1BBJA 5EC2A 1A7QL 4TNWF 1IKFH 5EZJA 3V52L 4MHHI 1HSAA 1FYTE 4LDLB 5FOJA 3ABZA 3DMMB 1HCVA 3G6JA 1PW3A 5C0EB 1TLKA 1I8IA 4IHOB 3T2OA 1E4XI 3OKEA 1IGIL 1JZ8A 4NRXA 2VDQL 3MQIA 3QJFB 1KACB 4P3DA 3TIEB 4LKXA 1FO0H 4OLVL 2W0FB 1DBBH 2LFGA 4WUUE 1AO7B 3BSZL 5TJWK 1KCRL 1OAZH 3BJ91 4KHXH 5E8EA 5I16B 4LEXL 2Y72A 2FBJH 3SCMA 3R4DA 4CVZA 1XCTA 3E2HC 4A6YH 1J1OH 2WBJC 1U3HC 5CILH 1U8LB 3L3DB 1FN4B 4UT6L 5E6ID 3QIWB 5F1NA 3U4AA 3MCLL 3LN4A 2R2EA 5DK0A 2VDOL 4ZG1A 3BRFA 5CJ5A 2M1KA 3NACH 3OX8A 1KG0B 4HMCA 2D0FA 3O2DH 4M3JA 1ZA6B 1EHLL 3FN9A 1NH6A 4BUHA 2Y06L 3CDYA 5HHQA 5GISL 5JIPA 1F6AB 5EN2A 3SE8H 5EC1A 1IJ9A 5AUMB 4JKPH 1DR9A 4HJGB 4MX7B 2OJZH 3HZYB 2F53B 4U1LA 5IB1B 4OM1H 2WWKT 4F33B 1CDBA 1UVQB 2ZUSA 4I3SH 5HVFB 4YNYB 1DBML 5HI5D 1XGRB 1LP9E 3BP4B 3U9UB 3BO8A 4RNRA 2BZDA 5D9SA 1HKLL 4RAUA 3SDYH 1I1AA 1E4JA 5L0QC 2GSIA 3QRGH 2CRMA 3MRPA 4NC1E 4BZ2H 3U7YL 3N1PC 3D2UD 1MFDH 4M7LL 4NNXB 1UB5B 2E6JA 3X3FH 1FZMB 3MJ9H 2P5WD 3GO1L 3WL9B 1UG9A 3DXAB 1JPTL 3PDOB 5D7IF 2AK1H 4H8WC 5B39A 4OF6A 1BLNA 1NBQA 4R7NB 1ZLSL 5EFIB 2YPVL 2C3WA 1LNUA 4FG6D 2EH7H 4UUJA 5IEHB 1KIRA 4QF1B 2R1YB 2ZG1A 4KKAD 4LF3B 3ROOA 5EZOH 5H2BA 3VGAC 4LQ1A 3GKWL 5SWQA 5GGRY 1W0YT 1I4FB 3NIFE 3ZKSD 3PHOA 1LMKA 1FZJA 4HIIA 4BK5A 2FLRT 3MLYL 3PJSB 5DF0A 5IVZA 5I66A 5SWZB 1HQRA 3BPCB 4G6ML 4L8DB 3B43A 3T3PE 3QDMD 1WAAA 3P73A 3W11D 2FGWH 3C5ZC 1AQDA 1D5MA 2EXYC 5DJXB 2VLLA 1WFOA 1MVFA 2FECI 5E2WH 1T2XA 2XPGB 4B7IA 3TEUA 3IAQA 1ZVSB 4D8PA 5IMLA 5IVNA 1R5VB 4PJGA 1RUPL 2W07A 3IJYA 1U91A 2KPNA 4JFED 5I9QC 5I8KH 5A2LH 1A02N 3IKCB 3OKNA 3J7HA 1BVLB 4LRNL 2UY6A 3MBXL 3IU4H 4UQ2A 3MXWH 3PNWB 5EPMB 2EEDA 4YX2L 1OTUD 2MCPL 1CQYA 3RU8L 4MNGE 1SMOA 4YC2C 4FMKA 3ZKQD 4O5LL 1VEPA 2HVJB 1TZHB 1AR1D 1S7WA 3QA3B 5DVKA 3UPRA 5CSZB 1A1OA 1I75A 3QEUA 2ZCHH 1A8JH 2FJGB 1KLGB 2YD7A 3HG1A 1MIEL 1A3RL 3VXNB 4Z8FL 5IVXF 2X4TA 5B22A 4G8IA 4GKSB 5DMIL 5KJRL 3ZSSA 3GSQB 5CGYC 4ELKB 4G6FB 1FDLH 4JLRB 1TTUA 1JHLL 5DHYA 4MJIE 2CMRL 3H6JA 4EUPG 5C9JA 3B5HA 3VFWA 1A2YB 3H42H 1PLGL 1T1XB 1UXWA 4H0HB 3WHE1 2QQNH 5F7WC 1NMCB 4XVSH 1S9KC 3GI9L 1NGWA 2FO4A 1MHCA 3UZVB 3VXRA 4YHLL 4FQIH 1YQVL 5E08L 3ARGD 1F4AA 4QRRA 1AH1A 4HLZG 5AZEH 1QO3B 2XICA 3ZYIA 4D9RE 1KJVA 5IMOA 4WENB 1WBXA 4JZNA 4N5UA 4ZUVA 3CXHJ 4JN1H 3BUYA 3S36X 3QXTA 3L5WB 3U48A 4ZFOA 3THMH 4G43A 3IFNL 2O61B 1T1YA 5CEZE 1R3IH 3EOAB 4RDQF 2P8PA 4AEIL 3ARVA 1KEGH 4XNXL 5E8OB 4FQCH 3V6FA 3ZHKA 4OZHF 4DUXA 4PJXA 3QUZD 1S9WB 2Y5EA 2IGFL 5DURB 5IP4A 2WIIB 2J1KA 2QQQA 3MNWB 4LDOB 2VLJA 3BESR 4G8EB 5ETUB 4QRPD 4WHTB 3DSFL 1P5VA 1XIWC 5JMRA 1Q9OA 1AGFB 4GAYB 4JPWL 4UT7L 5E1AA 1KELH 4PJ5B 5HHOB 1NCCL 2K7QA 4OFYD 2EIBA 4GQ9L 4M8QB 3VGBA 5DK3A 5B3NA 1FL3A 5FYJU 3DX7A 5GGVL 1A1NA 3DV4B 1D9KA 1IC4H 1W72H 3UTQA 3V6OA 4IRJD 3LKNA 1J05A 2QSCL 2CUHA 4DTGH 1S5IL 2BHYA 4UOW0 5FIEA 3SJVB 1A6VL 4M7KH 1OGAA 2DLHA 5E2TH 2DMKA 4XVJL 4CNIB 4E0RB 1AO7E 1Y6KR 1AGDA 2LV4A 1A6TA 1T3FA 3O6FD 2BCKB 4PLKD 2ZOKB 1C5DB 1O7VA 3Q5OA 3BYYA 5FM4A 3RX8A 3KPNA 1DBKL 3MA9H 4S1QH 3MC0A 5IIEB 1YEDB 4Y16B 1NUDA 4XHQA 1E4WL 3HTLX 3SE4C 4K71B 2OL3A 1N4XL 1A21A 1BD2B 5IQ7L 5JA8B 1G7MB 2C1OB 1WBYA 4WU5B 4U1KB 3SKOA 1FE8H 3TLRA 3QISA 3O9WB 4P46A 3CFBB 3T2PA 4AG4L 1DLFL 5GIRA 4NZJA 1ZHKA 5DRWA 2VYRE 4WJ5B 3RWIB 2ED7A 4N0UE 2Q86B 4EBQH 1K4DB 1TZGL 3B6SB 5CMAA 4KROD 4DCQB 3UC0L 4D9LL 3ARSA 3QZWA 5T3XE 1FL6A 1JWMB 2DD8H 3UTTD 3RAJH 7FABL 4E5XB 4Z7QF 2P8MA 1FFOA 3BKYL 3JWOL 3UYPA 1J10A 4CMHC 3LKQB 2E7MA 1I1RA 4PJFF 2Q76B 4KKBD 5E5RB 3T0AA 2OR8A 1UJ3C 5L2JA 4H1LB 4IMLB 2BSTB 1YC8A 3RP1A 1QFUH 4HPOH 1QSFD 5DEGA 5C0CE 3WIIL 3RWCA 1QBAA 2X4SB 2KBGA 3QCVL 4K7PH 1F6FB 3UPCA 2Y4SA 2CJUL 4NO0A 1AC0A 3ARBA 5B8CA 1G84A 2KZ1B 3RVTD 3D9AH 4YXLH 4NOFA 1SM3L 1JF1B 1JWUB 3TBTA 2MOVA 2VC2L 5CD5C 5E9DE 2VDLH 4LCIL 3NPSC 4XNMB 2CLVB 2F54A 1NBVL 4NCC2 2AVGA 4AQ1B 1QP1A 3F7YB 5H37H 4I5BB 3TYGL 1L6ZA 2F58L 3BXNB 5FO9A 1QFWM 2RCSL 3Q3GB 3VG9C 4ZTPH 5SWZE 3VWJA 3HNSL 1HHKA 1CFQB 4OTXH 5K59F 3RKPA 5D70L 2UWEE 3MJ7A 4FN0A 4XC3H 4EDWL 4D94A 1GPOH 3CVIH 4HWBH 3IYLW 3HNVL 3LKRB 2BXZA 4JPKL 3GSVB 2AXJA 3QDJA 4KK6D 5EOCL 3QBTB 1NDGA 1CE6B 4WHCA 1S78C 5CSBA 2EIEA 4GMSL 4JAMA 5DJ6A 3CJJA 1GAFH 4PB0L 3OKLB 4Z7UF 3IJSA 4M00A 1A3LH 1U58B 1JGEA 4HFWA 4DVBA 1MIML 5C0GB 1U8OB 2BNQD 5FHAH 5ID0A 1MHEA 2GK2A 4GKNA 4S2SB 2NY6C 3TNMA 2ZUVA 4Z7WB 3TZVB 1I7ZA 2OTPA 1MJ7L 2D9CA 1MCPH 1H5BA 4E9LA 4NM4H 3S36L 2KQMA 3CMOL 3V5HA 3D69A 4X9FA 3C8KA 5ILTL 3REVB 3OR6A 4C4KO 2GFBA 5JA9A 2D7TH 4MSWB 4DN4H 5A2JH 5E8DH 3RWGB 3DMMD 4FQQA 3D85B 5JLZB 1QR1B 4GH7B 1F90L 4RIRB 2YD9A 1CXLA 4U1JB 3VGEA 4OF5A 1NMBL 1ZSDA 3PL6A 4ZPTA 1WTGT 5C08B 2IPUK 4LHUA 4YAQB 1W0VA 1U36A 3DUSA 5JORA 1XF4B 1RHHB 5TDPA 2YHGA 2E7LA 4YDJA 5EO9A 2VDPL 1F02I 4W81A 1FSKB 4PG9B 1AY1H 3X17A 5KS9E 3QUXD 4RZCA 1R3HB 1OAUH 2R2HA 2J8UA 4X8XA 1FVCB 1K8IA 1FHGA 5IB3A 1BIIB 1SHMA 3PIQA 3QIWD 2X40A 4OLUH 4KVNL 4XWGH 5HHNA 3T77A 3ZSTA 2VDRL 4AH2A 3K4DA 5I1LA 1R5WA 2D0HA 1I3RB 1U6AL 1MCHA 3PWLB 5FYLH 2DQJH 3U7WL 1AD9A 1R3JA 5I71C 1T2QH 3EJYD 3VWKA 1I8LA 2ADGB 3KGRA 5EBLA 3VXQB 3A67L 4YDKH 3H7BB 1G7PB 4NCC1 2VE6B 3QDGA 2OP4H 2F53D 4EDXA 1P84J 1DQML 1QRNE 1IQWL 3LRSA 1OGTA 1FZOB 4XPBL 1OQOA 3JV4A 1TVHA 2HYMA 1VPOL 4NO3A 4QRTB 3EO1A 2GITB 4XB7A 3ZL4L 5MI0B 4O2EB 4R97C 4PJ5E 5HHOE 3H9ZA 1LGVA 2VL4A 3KYAA 4JFHD 1W0WB 2Q6WB 4L3EA 2PO6C 4UIMB 2PCPA 3IKKA 1YMMB 1RU9H 1ZHLA 4IRSD 2GJ6B 2R0WL 5F9WC 3OXRB 3VFUA 3DXAD 3MGTA 3UJJH 4GG6A 3FN0L 3QO1B 5JPMB 1A0QH 3OJ2C 3C5JA 3IAPA 1T4KB 1G6RB 2PN5A 3GNML 3JV0A 4YDLC 3SJVE 1A7RH 1IM9B 2CO6B 4M5ZH 3RUGE 5DUBB 4PJHB 1S5HB 2BSRA 3CGTA 3GFUA 3F6LA 4AIZA 3HFML 3NCJL 4TVPD 3BKJL 3MNVA 5F7NC 4OI8A 4YBLC 3TPUA 3IS0X 2Z8WC 2BOCB 4HPYH 4OIBA 3AS3A 4Z7VB 4IM8A 2HN7A 4LSSL 4XZUA 4YIQB 1F2QA 5T3ZH 1KJ2H 3L3KB 4P9HC 2GI7A 5JIIA 2ADIA 4R4FL 3U4BL 3NZ8B 5FF6B 3WHXB 4R2GC 4KI5F 4N0RA 2Z8RA 1FPTL 4L9LB 3SDAC 1L4IA 2FIRT 2Y07L 4H5SB 4EI5D 4MWFA 1BQHA 2BRQA 5E7FA 2LAGB 1KLFA 4YXKH 3O41A 2H9GA 1NAMH 4Q9RH 1IAKB 4KDTA 3VXPA 3RIFF 4K9EH 3EFFB 5AYUH 4L8CA 1FFPB 1NGZA 1SYSA 2VLKA 1JHTB 4K3JL 4O2CA 3WEXB 3GJEA 4ELMF 5BJTB 5IK3B 1UYWL 3ULUD 1H0DA 1A22B 3L3OA 4QRQB 4Z78A 3UXFA 2HT3D 3EYSH 2HAZA 1VACB 4Q9BA 5D1QA 4N8PA 4DZ8B 1AKJB 5H94A 3I6GA 1GGIL 4PP2A 2J5LC 3RZCA 1S9YB 1UQSA 1PEWA 2XWBA 2A1WL 2BVPA 3QO0A 4MNHA 3MRNA 1SJXA 1ZXQA 1C1EH 4LCUB 3LS5L 4H0IA 2XA3A 3MLTA 4X5LA 4LCYB 2HA1A 3LVEA 1RIUL 1NC4B 3KWWA 1J1XH 4QHKJ 5HGHB 5CCKH 4Y4HC 5TE4H 1N0XL 4G6FD 2XXMB 2VL5A 4M6MH 3NTCL 4J3WA 3EZ8A 4RISH 5F71A 3SPVB 4XNQB 3FFCA 1DDHA 4N1CA 4QHUB 1Z0NA 1C8PA 4KJYA 4N0YL 4QRUA 3UAJC 2UZXB 4OAWB 5CD3B 2Y7QB 4K9EC 2YD2A 2ED9A 4Y5YC 4WFED 2EDHA 3FQXB 3L5HA 4PP1C 4XBPA 3BZ4A 1BZ9A 2IMMA 4HWZA 3DVIA 3KJ4C 4WCYH 3TN0D 3F5WB 1GC1L 4PYHA 4ORZC 3E6FB 1J1PL 2HRLA 4XMPH 1FNEB 2BX5A 5IJKC 3GMRA 5BW7A 5KSUB 1K9TA 4JFDB 5D93C 4Z95L 2PXYC 1DFBH 5AAWA 4G8FB 5GGRA 3WN5B 5DURD 2EIZB 3HC3H 1T7WA 5D8JH 4JVPA 2XZAL 5ID1B 1FP5A 1V7NL 3O6LH 4XH2A 2H6PA 3L9RA 5FECB 3NIGF 3GHEL 5IOPA 2J8OA 1PKOA 3PE9A 4LSVL 5EU4A 1MI5B 1OM3H 2WWMD 1CLZH 1HI6A 5ESVB 1IGFH 4DVRH 3RA7L 5DMJB 4LIQL 1HSBB 1P53A 1NFDE 3I2CH 3DARA 2VXVH 4DEPC 5JHLL 3KJ6H 1URLA 4JO3H 4LSTL 1QLFB 5J4MA 1YNTB 4Z7OE 1Z9SA 4WEBH 2XN9D 4RFOH 4WO4A 3IXAB 2WNGA 4DQOH 4G9FA 3VH8A 4JRYE 5T1KA 3SGJC 2DKMA 4JGMA 2SEBB 2DWDA 3TNNA 4R4NC 2FX7L 3MACL 4N9GB 2MKLC 5KANI 4L8SC 5I0ZA 5DD6A 3GIVA 2R39A 3DX9A 3S98A 4Y88A 1CIUA 3G5ZB 5E4IA 4Y16D 4MMZC 5BXFB 3T0EB 1TETL 3ZDYE 3FO1B 3S34H 4ISVB 3T4AA 1BD2D 3BIBX 2CXGA 4ZXBC 5TH2A 4QHMA 3RL1B 2JCCF 4N0FB 4U3CA 3LB6C 4L29B 4I13B 3BZDA 3H9SB 3MROA 5FYJD 3O9WD 4ACPA 4P4RB 5D6DC 3TV3H 3U9PH 5C0AE 2X4UB 4PJAA 5E94A 2FD6L 2ICEA 1YECH 2H2PC 4QCIA 4EIGB 2FATH 1A4KA 3TWCL 3R06A 3IDXH 3WIFB 4FQ1L 4UILL 3C9NB 4YBQC 1MQKL 1UGNA 1FYTA 4OF0A 4CU8A 5EBWB 2DQCH 3FB7A 2GAZA 5FCUH 1UWXK 4U6VH 3L95B 3X13B 1EAJA 3TH4T 4CDHA 4XCFL 3SOBL 1IEBA 1I7RB 1X5AA 2ITCB 4KMTH 5JW5B 3O8XB 3CU1A 1GJIA 1IC5H 2QSTA 2VDKH 2O5YL 2BY0A 5JPNB 2GJ6E 2O5XH 1M1SA 2E6PA 4WUUA 3ULVE 3B9KC 43CAB 4NN6C 4HXBH 5JQ6H 4PJHE 2Q3ZA 1AXTH 1KOAA 4Y4KD 1KIPB 4FFZH 1GZPA 1CFTB 4N8CH 2YPLE 1CDIA 1K5NB 2ZZUT 4X5XB 3V5KB 1N59A 4LGSB 1J18A 3UTZB 2DDQL 4S1SL 3RGVC 3O11B 3QULA 2R4RL 5DK2B 5D7IA 1NL0L 5HGGS 2Q8BH 3OGCA 1K6QL 2QV2A 1GC1C 4LSRL 4HH9A 2VR5A 4WGWB 1UB6B 4R8WL 3O6MH 4OZIB 5C7XL 4KK5D 1JNLL 1LO0L 3C08H 1LWRA 3V6ZA 4FTVB 4L5FH 2HLFC 3G6DH 4LCCA 2Y25A 4HX1B 3E2HB 2HRPL 4OIIH 5DD0H 4EKXA 4KKNA 5JIHA 4ZFZA 3AXLB 1A6ZA 2LE9A 4O58L 4ODXA 4NKIL 4PJDF 1UENA 2EDRA 4GBXA 5D5MF 2X89D 5BZDB 3KAAA 4ZO6A 3MRRA 2ZJSL 4KRPB 2ZSWA 5IFAH 5IW1A 4ZDHB 4QEGA 3TVMA 5KSBA 2HKFL 1ZGLP 1S8DA 5FB8A 4ZUUB 4OZGB 4XP5L 1RV6X 1Z9LA 2DI9A 1T7XA 4CN4A 3MJGX 4U1MB 1HYSD 1KLUB 4LQFH 1E4KC 5DLML 1PG7H 4FQXC 3RWHB 4M6NL 4JFFD 25C8L 4Z9KB 5IEKB 4MQ7A 5E6YA 4TN9A 3DX6B 4PS4L 3IDMB 2CDEA 5DGQA 5K9QI 3MV9A 1JN6B 3ARDD 4LEOA 4JANA 1KNOB 1XGYL 2H32H 5MP6H 5I8CB 1ZMYA 4M6OL 3MUGB 4XCNB 3D85D 4CMMA 1WT5A 1NEUA 4QWWD 4M1GL 3IVKB 4MJ6A 2V2TB 1FO0B 3DYMA 4LLVA 3SHSA 3ZT5A 5J7CC 2Y23A 4WDIB 5C08D 3T8XB 1BZ7A 4X98B 3PV6A 1F45A 4JE4B 3PGDB 3L3HA 4A6YB 4BFBD 5IVXA 2B8OT 1S9VA 2NZ9C 2PR4H 4M62L 2P7TA 3FT3B 5CEYA 2H1PL 1IC7H 4DGYL 5DRXA 4YHPA 5JHDD 3MJ8A 5CJOL 3DVGA 3RIAK 4MB4A 4EN3B 1RZ8A 5IJVA 3MLRH 1NUNB 3CH1B 1MFCH 5C07E 4F7MA 4PRDA 2QR0A 4LU5H 3WFEL 1MCNA 4UT9L 3MR9A 4XXDA 4Y5XA 3IFPB 5I1GL 5GS1C 2VH5L 4AENA 1DQLL 1HHHA 2VLRB 2EO9A 1NDMB 2ICCA 5D72L 3OKOB 2VDML 5F93C 1RHFA 1LILA 5C70A 3K0WA 5IW3A 1UACH 3O45B 3S5LG 1MNUH 5HYFA 4V2BA 2WZPD 4I77H 4C83A 2R8SH 1WEJH 5BO1L 3AFLA 1QSVA 5LG1A 5B38G 5JR1H 1OF2A 4X6DB 2MTPA 3QDHA 1GH7A 3UJIL 3FMGL 5I9QB 4P2RD 3RKDC 3BP5A 2L4OA 3BIKA 5LQBL 4DKAA 1ORQA 1ZHBB 1MREL 5F7EL 4KKLD 4P2QA 3G5XB 1U92B 1YMMD 3FQNB 4M93B 4U33A 3NCMA 3IETA 3TH3T 4ODBD 2MWCA 3P77B 5J8OA 4EEEA 3U0WH 5I1AA 4X6CF 3AM8C 3HZMA 3BJLA 1IM9D 2V7HA 5FXCH 3RY6A 5DZNA 5HYJB 2OL3H 6FABH 2QQLL 5DZOA 1NCWL 4X4ME 2XXCB 5F97E 1HXYA 4MD0B 5IV2B 3PXHA 4MAYB 2JJWA 3BRDA 2XWTA 1QD0A 3T0EE 5C0RL 3AREB 3BE1L 1JK8A 5EUOE 2GW5A 3GSWA 3RNQA 4NP4L 3WMSA 1NCBH 4ZAKB 4BH7B 4KFZC 2DWEA 4D0CB 1GOFA 1I9IH 4F7CA 1W8NA 5I8OH 1S7QA 3CX2A 4YK4C 3D3VB 3ARQA 5F3BB 2H3NA 1V3LA 3NCFB 3CDGB 2XWJA 1CE1L 4KI5C 4C58B 4F37K 2B39A 4MHHG 1WCBA 3H0TB 1G6VK 3ZDXE 2AEQL 4PRPE 4OQTH 4NZRH 2FWOB 3MRLA 4K23L 1FNLA 1SBSH 5IHBA 1MJUL 2HTLC 1UH4A 3BHBB 4NQSA 4X9HA 5C0NC 1AKJD 3B5TA 3Q48A 4J2XA 1HOCB 3TFKC 35C8H 4KAQL 3LPGA 2EYRA 4X80L 5C6TL 1NGPL 4LSPH 4PJ8B 5D7KE 1A9EA 2KH2B 1X5GA 5DC0A 1CTNA 3S35L 4HMDA 4WW1A 2DLIA 2W60B 3MSPA 3K2UH 3NA9L 1HWHB 4XCEB 1IKNC 3KYOA 3OKKA 4YHNA 2IPKA 5HYQA 4M6AA 2EYSB 2CR3A 2ATPB 1KBGH 1ZTXL 4NJAL 3ARPA 3G9VA 3TBWB 4F15C 3VFPA 5I73B 5JOFB 4FFWD 4NN5C 1OCWL 5BS0A 5D71L 2FLBT 3MOBH 1YEIH 1YEJH 1NGQH 2E5EA 4DK3A 4D2NA 3WD5H 1F4YL 2B1HH 3KXFE 1HK6A 2FZ3A 4Q7DA 3FOLB 5IESL 3T1FA 4CVUA 4DOHE 3WFHA 1Q8MA 4G7VL 5FDYA 5CHNB 2VQUA 4LVHC 4L4TB 4N0UA 4YQXL 1YEGL 1RZIB 2C1PB 1H3TA 1H3GA 3P0VH 1U8NA 1DLHB 1JUFB 2NW3B 3P9WB 2QQKH 4RAVB 5E2VH 1F11A 5FUCE 1Q1JL 2JK5B 1BFSA 1YNKL 1EV2E 1MHPL 2D7MA 1A7QH 2OK0H 2DRUA 4JFDD 3V52H 3IF1A 3O4LE 1OARL 3PWJB 5C0BA 4V1DB 4OZGE 5TQ0L 5J89A 2A0LD 4LLUB 5CKGA 1VKXA 5C0CA 1IGIH 3FT2A 3BH8B 5DHXB 2AXFB 1AIFB 4NKOA 5DR5L 1A3QA 4EOWL 1RPQA 2OXGA 4MJ5B 2HVKB 1ZLUK 2A6KB 5IFJA 3KS0J 3C6LD 4XXCC 4MD5B 1MI5D 2BVQA 5ACLA 3BSZH 3HPLB 3F7QA 1G9MC 2PYEB 2EDXA 2NYYD 4M02A 1DUYA 4G80B 5E9DA 3VXOB 3ZKMD 1W72B 1M6OA 1NSNH 2Q3AA 2C7UA 3VFSB 4DN3L 1YUHB 4N90E 5C0IA 5F1KC 3GB7A 3VFVB 1UJ3B 2BJML 5ANMB 3HE6A 4OGXL 2I9LA 3SGEI 2VDOH 5HDOA 4HQQL 4P23C 3UO1L 3O2VL 2BDNH 2AJZA 4X7TB 4DGVH 4TNVF 2UWEA 1B0RA 1MWAL 3HC0A 4OKVB 2Y06H 4QOKD 2AI0H 5F88B 2IWGA 2V9TA 4HIXL 3F58L 2G60L 1XAUA 2HWZL 3I02B 3SGKA 3NPSB 2CGRH 4G6AC 1DBMH 1H8NA 1MVUA 4WV1B 3DO3A 4RRPA 5HHVL 3H9SD 4UV4L 2JLLA 2VLRE 1CQKA 3T65A 3U7YH 4C56A 5EWIL 1ZVHA 3MLUH 4UDUA 4GS7B 1UM6L 3SDXB 3BGMA 3NAAH 3RVVC 1RZGA 4MB3A 1MLCB 4PRAA 3KLAA 1KJ3H 2HT4D 2VITA 1JPTH 4NNPH 2XOTA 5SWSB 3DYPA 4HS3B 3VXSB 3C2SA 4JB9L 1ZLSH 1KN2L 1HZHL 2YPVH 2R2BB 2AV1B 1GZQB 1CDHA 5E2UH 4ORGA 4NDMB 3QI9C 1T0MB 3FFDA 3KPLA 3TBSB 3U6RA 4B0MM 5KVGH 2ESVB 1TFHA 5ICXA 4OFKA 1YA5A 1UWGL 1MCCA 1XT5A 3GKWH 3TO2B 5EO1A 4IIQB 3EYVA 4Y4FC 2A6DB 2BY2A 2C3VB 3CK0H 1JJUA 3MJ6A 4HUXA 4DGIL 4NO2B 5KVEL 3SKNA 1FGVH 4L8BA 4CN1A 1ZA3B 3GMMB 5KS9A 3AY4A 5HYJE 1ZGLM 2IFFH 1ZT4A 4QRSA 2GJZA 2NY4B 1OAKL 3QXDB 1KPRA 4OD2B 1RZ7L 5L8LB 3P2TA 4LOUC 4JDTH 4MZ2A 4XP9H 5EZIH 5LXGH 4P2OC 3VD5A 5AG8A 5GSVA 3SDCC 4NQDD 1RUPH 4ZUSA 1UZ8B 1WK0A 2AJ3A 3ULSA 4OCSH 5CWSB 5ESAA 1OVZA 3CVHL 1BREA 4LRNH 1WV7T 4S11A 4XP1L 3MBXH 3QUML 1CGSL 3NZHL 2GT9A 5FDWB 1JE6A 4FTVD 4QT5B 2G75B 2MCPH 3CFDB 4EJ1C 2DQIL 3D3VE 1KJMB 5EBMB 3RU8H 1CICC 4D3CL 1EUTA 5C2BL 4EUPA 2WBJD 5DHVH 1VDGA 2VABB 1IGYB 2I27N 3BFOA 4OCXL 5L2KE 5B4MC 1MHHB 4FZ8L 5EOQL 4BQ6A 5CLWA 3E0GA 4Q6IC 2EYTA 3FCTB 3MTRA 2NY0C 2XQYK 2JB5L 3QPXL 2NX5B 3IU3A 5DMIH 5I6XC 3LMJL 3IDYC 4O2FA 1I9EA 4PJ9A 3DV6A 2CMRH 1JYNA 1GGTA 4BK4A 1UWEL 4KVCH 1IZJA 1PLGH 4PJEF 1OSZA 4H1LG 3K1KC 4RMRA 1RIVL 3RUGA 3BYTA 5KZCB 3TO4C 5E08H 3SDDA 5MEOA 3K46A 1X3DA 3QHFL 1R3KA 4WU7B 2OLDA 2MFNA 5IB4B 4R97B 2XTJC 4RGNE 2MQ0A 3TJEL 5CP7B 1D6EA 4JJ5B 3HRZB 1J0IA 1X5IA 1YDPB 3MLVL 4YDIL 1ZGLA 1DL7H 1XF5B 1XF3A 1S7RA 5D2NC 5HSFA 2IQAB 1S7SB 4QTHB 5IROA 1IBGL 4AEIH 5ACZA 4HGKC 5GRJL 1SQ2N 1QBLL 1I8KB 2APTA 4Z0BH 4YDLB 4WNQB 2X4RB 4JQXC 4L4TE 5ICYB 5CZXC 3G6AA 5FA4A 1DBAH 2JIXA 3TIDB 5EU3A 4JQIL 4KDVA 4C4KT 1CD1A 4YBLB 5F9JB 3VMNA 1KIUA 1FJ1B 3QWRD 3DSFH 4PLJC 2RR3A 5JOPE 3R8QA 2AK4B 1YN6B 3BT2H 4UIKH 5TE7H 4GQ9H 5FO8A 2V5SA 4OFPA 4R2GB 2RIKA 2ICWI 1TJHL 3C5ZD 4PJBE 5CP3A 2PTTA 3INUH 1T89C 2A9NL 4OZFG 3PP4L 2YK1H 4G8GA 1I1YA 1NUGA 2Z4QB 3P4NB 4ODUA 5JMOC 1A6VH 5A2IH 2GTZA 4L4VA 3P4OA 3MFGB 3FT4A 4L1HA 4P4KC 3C6SA 5EOCJ 3V9FA 1RIHH 4LPWA 4FXKB 4ALAH 5T1MB 2A77L 2YD8A 1DBKH 1DQJA 1Z2KA 5IM7A 3MV7D 2R15A 5ESQB 3ZHLA 5ANME 3D25A 3I9GL 4JZOB 3VXUB 3NCEB 2XG5A 3NFNA 4HIJB 3VGDA 3SE9L 4ONGH 1ACYL 1CR9H 2EDLA 4XAKE 2IPTL 3ULUE 4AG4H 5IKCA 3VFRA 4NQXB 4R0LC 1A7BA 2JJSC 4MAYD 5D7LB 3TBYB 1TZGH 3MV8A 5CGYD 5JXEA 3MBEB 1G9EA 3MUJA 3LKPA 5HY9A 3UC0H 3OJDB 1RJCA 1R24B 4FG6C 4D9LH 4UDTB 3IT8D 2GUOB 1G9NL 2YA2A 2X44D 2LVEA 4PRIB 4B7LA 5FOBB 2ICWB 3VRJA 1RK1A 4QHNB 3BKYH 4ZAKD 4NUGL 1QSEE 1E27A 4QXGL 4YO0A 2Y6SC 4PV8A 2X1PA 2BHUA 4P5MA 4G6JH 4YLQT 1IAIL 2BY1A 2DAVA 4G9DA 4L3CA 4LMQI 1EX0A 3SDXE 3IJHA 3OMZA 4YHML 1UWXH 1T7ZA 4XPGL 4XNZB 1BVKB 5SWSE 3VXSE 4OUUB 2CLRA 3W11C 1KPUB 2D7OA 2CJUH 1NFDA 3DLQR 4HKBB 1GGCH 1SM3H 3WS3A 5D93B 1ZWIA 4UZGA 5FCSH 5E8PA 4ODSH 2R4SH 4RGOL 3O0RL 2A6JB 4J3OC 1PKQA 2W38A 2YEZB 3H7LA 3DECA 3D0LB 3W0WB 4PJ8D 1PGRB 5D1ZB 1XCQA 4Y5VC 1Q9KB 1CDJA 2C3HA 5LAXB 3OJMB 4HKXA 1Q9LA 1INEL 1OSPH 4OB5L 1T1WB 3HNSH 1BF8A 3ZDZE 1XZ0A 2VTFA 2BOBB 2Z31B 2D4DA 3MYZA 2V7NB 3OQ3B 4LSQH 2ARJA 3HNVH 4LVEA 4NQVB 3U2SA 2IAMB 1I1FA 3UYOD 1KN4H 3P9LA 5E5MB 3NH7H 4GRWE 4Y0GA 1G7LB 4DEPB 5C0DA 3EO0A 3V7AG 1ADQL 1LE9B 2AJXL 1AP2B 3QHZL 1X5JA 4UOJA 2W91A 3WJJC 5DGRA 1T5WB 1NFIB 5C0AA 2IBBA 3VRIB 3VXME 4HK0A 1GGYA 4ENEC 1LO2L 1MIMH 2X1XR 5GGSB 4R7DA 1ZANL 4TOYL 1NCDH 1N3NB 1WTLA 3SQOL 2HFGL 1D5XB 1MJ7H 2R0LL 1FG2A 3O6KH 5JW4Q 1BBDL 1G7QB 2P24A 3S36H 3DROB 3P9MB 3CLEH 3OZ9H 4NYLA 2EH8L 4Z6AT 4OFIA 5EC2B 1MJ8L 1ZT7A 4QHKI 4NOBA 5EZJB 2NX5E 5ITBL 4V1DD 1HSAB 1BX2B 3G6JB 1J8HD 1F58H 1T2JA 4BSWA 4Z0XA 3OHXA 3BWUC 1RZFL 3OKEB 3U1SL 4NRXB 5GSRA 1NMBH 2E27L 1PSKH 2BRRH 2R0KH 3EJJX 4PJDA 4P3DB 2D03L 2GY5A 4LKXB 4ZTOH 2J6EH 2PYED 4DFIA 2VDPH 2VNCA 4OSUL 4I18A 5E8EB 2AJUL 2YPLA 1V05A 3AAZA 3P30L 5DQJA 5GRYA 1NKRA 3SCMB 3VFOA 3RJQB 4CVZB 4HS8L 1XCTB 3NABH 5FYJE 4KTDH 3EBAA 4CADA 4JRXA 5MERA 1MWAA 4I9WD 5CS7A 5F1NB 1YPZB 1INDL 1FRGL 2VDRH 5FUZL 3FL7A 1RZJL 2R2EB 1E28A 1AI1L 3OGOE 5DK0B 5M7QA 3U7WH 1T5XA 4NC1C 3OX8B 5JW3L 1QBML 4NN6B 4IRJC 3WFZA 1KUMA 2QADC 2FHFA 1A7NL 3U79A 5EC1B 1ORSA 5CD5D 2X7LA 4NFDA 1IQWH 4U1LB 4KPHH 1G7JA 5FYLE 3SGDH 4PLKC 5C6PB 4ZNEA 5IWLC 3DURA 3QIBC 3CFEA 1OP3K 3ZKNC 1TQBB 4F9PA 2VUYA 3ZL4H 3BO8B 4RNRB 2P4AB 4WTWA 2DBLL 4RAUB 4U0RB 2AK4E 4UMGA 1I1AB 5DJYA 1K85A 2B1AH 2GSIB 3Q6GL 2APXA 4LAJH 3GUTB 3MRPB 3SE3A 2YUWA 3WNPA 5I18L 4LCWE 5E6IA 5BOZG 4NWTH 2W0PA 4PJIE 1ZEAL 2E7BA 1EA9C 3UTPD 4BQBA 1UM4L 4R90L 5DUMH 5B39B 1BLNB 5D7SH 1S78D 1MJJA 1LNUB 3HFMH 4UUJB 1MCLA 1KIRB 3PWPB 4JHAH 4AM0A 1S7TA 4GAGH 2ESVD 3BKJH 4YHIA 3ROOB 5H2BB 3BH9A 2FGZA 3IDUA 2GKIA 5SWQB 4FQXB 5TE6L 2CLZB 5E8NB 3PHOB 4R4FH 1RD6A 4X6FA 3U4BH 2X4OB 5I66B 2VLME 2YZ8A 4HHAA 5CEZH 4RWHA 1HQRB 2NY5L 2X70A 3NVQA 3P73B 3DBXA 2OCFD 3NCCB 2Y07H 1AQDB 1D5MB 4PFEA 1AFVH 3QEGH 5D7LE 4ZOBA 3D2UA 1MY7A 5ITFA 4UBDD 3CVHA 1M7DA 3HI6L 3BN3B 3LD8C 3QUMA 1CTOA 4K3JH 5IMLB 1ODAA 3UDWA 4PJGB 4PRIE 2CK2A 3IJYB 3T2QA 3SO3C 1U91B 2FSEA 3GMPA 3OKNB 5DYOA 3VDCA 1NMAL 1HDMA 2ZKHL 4UQ2B 4NN7B 3GBNL 3TCXA 4IRZH 2APVA 5I75B 3FB6A 3B83A 3HC4H 2A74A 4JGUA 2H26A 2HFTA 4QXWA 3MMEA 2QSQA 2LU7A 4ZS6C 3VFTB 1S7WB 4GAJL 3UPRB 4TVPL 3DUUA 1A1OB 2ZNWA 1AHWC 3QEUB 4UAOC 4WWKC 3QDMA 2X4TB 3LZFL 1I9RH 4G8IB 3BQUC 1VA9A 3L6FA 1L7TL 4F3FA 5D7JC 5GRXG 5DHYB 1DANT 5C9JB 4Z7WF 3VFWB 5KANG 5A16A 2HJKB 4N1EA 4M1DL 5KZCD 1EEYB 2NW2A 4Q2ZA 4EXKA 1W8OA 3O3BA 4J4PC 1MHCB 3VXRB 3OAZK 4JFEA 4FS0A 3LKSA 5JDJA 4QRRB 4RWYL 3E1F1 3ULUL 3PWNA 3IFLL 3G08A 1E0OB 4H20L 3QEQE 5IMOB 4QXTA 1WBXB 2PO6D 1P1ZA 2VKWA 4ZUVB 1CD9B 3U36A 3M1BA 3BUYB 3OJVC 4HK3N 4ZFOB 4G43B 4XMKH 1T1YB 2XG4A 3S9DB 1K8DA 5T3XH 4QKXB 4YR6A 2P8PB 3R0NA 2C4FT 4P48A 1S3KL 3LN5A 4MD4B 3V6FB 4Z76A 3CH8A 4PJXB 5DQ9A 4K3DL 5KVFH 1V7NH 1CZ8L 2ADFL 3Q5YA 4PRPA 1XMWA 4NWUL 4LSVH 2VLJB 4TSBH 5LCVL 1D6VL 4Z7NE 3D39E 2P8LA 4PJCA 4RFEA 5CJQH 3P0YL 3RA7H 3DOSA 2VR9A 5E1AB 3ARGA 3QIWC 5GGUB 3DGGA 5JHLH 4R2GD 1FORH 1Y6MR 3QNXA 3G6JE 1D7FA 4LSTH 1FL3B 4PY7A 3SDAD 4PGEA 3DX7B 1JGVL 1A1NB 1C5CL 4YK4B 1D9KB 4X4YB 3VGHA 3UTQB 1KCUL 3LKNB 3EOYG 5JUEL 1MAML 2A73A 2IJ0C 4POZD 3LPFA 4XB8A 1G0DA 5EU6D 3PG2A 1OGAB 1PQZA 3G9AB 5MEPA 5KVDL 1J0JA 1T3FB 5GJSL 1ONQA 2EECA 4ZODA 3QUZA 3KPNB 4YHOL 2J88L 4XPTL 2X10A 4U31A 4I0PA 4ZS7L 4ODTL 4LP5A 1MH5B 2OL3B 3VXUD 4BH8B 1RZKL 4QRPA 2V2WA 5DXWA 4F57H 3ULVF 1WBYB 4GRMA 4FQ2L 3SKOB 1SYVA 4G3YL 4GUPA 1QVOA 3JWDL 1P4IH 4OFYA 4PJHF 5FK9B 4HGMA 4NQED 1ZHKB 5DRWB 4Y4HD 3F12A 3QUYA 5CINL 1UKTA 3RTQA 5T3ZD 1WBZA 3UTSE 4TUKL 5CMAB 1XEDA 3EOBA 1K3ZA 3WFCL 4XAWL 3O4LA 4Z7VF 3HE7C 4Y1AD 3QZWB 2FX8H 1FL6B 5DFVD 3FB5A 3W81A 2CUIA 5E03A 3O6FA 4MAUH 4JM4L 2P8MB 1FFOB 2HKHH 4KK8C 3UAJD 2B4CH 3CFKB 2FH8A 3WLBA 1LD9A 1U93B 2Z92A 4K3EL 3LS4H 2P1YA 5L2JB 1MCSA 4HV8A 5K9QG 1KPVA 3BAEL 3EOTL 1Z5LA 5DEGB 3IXTA 3RWCB 2PW1B 2WBWB 2R2CA 1ZS8A 4JFOA 5CSGA 1DN2A 4JM2C 5AG9A 2IC2A 2AJYL 3DRQA 1WWAX 4NO0B 4OZ4A 3U0TB 2H8PA 4U6XA 3ARBB 3HZVA 2PXYD 4KDWA 2DLFH 5H35A 1JV5A 3TBTB 5AAMA 3WJLA 4M4PA 4UOW1 3W0WD 4XBGB 5D1ZD 2EEBA 2R4RH 5FYJL 4HG4J 5L88H 5DWUH 3RNKA 1K6QH 3CX5K 1IGCL 3MXVL 3NGBB 2R1WB 3P4MA 2FEEL 5FO9B 3GSNL 4YHKL 3VWJB 2DYPD 3WO4C 1FNHA 2GHWB 1JNLH 1LO0H 2DTML 1ADQA 5I8EA 4F9LC 2F19L 5LGKA 4OM0L 2C4XA 3VDBA 2IAMD 4ZFGL 2HRPH 1IM3A 4NKIH 1Q72L 3QDJB 2Y36L 1R5IA 1INQA 1NDGB 2B4CC 1CFBA 2CIIB 4HUKB 1CXFA 4AEFA 4JAMB 5DJ6B 3OXSA 3N9GH 1LEIB 3IJSB 4R4ND 4S10A 3QUKA 1T6WA 1F42A 3K8LA 1JGEB 5FM5O 4ZFFA 1TZIA 1HIML 2ZCKL 1RSFA 5DLMH 1MHEB 4WUKL 4GKNB 25C8H 3TNMB 5GZNC 1NMCC 3ZLQC 1T7VA 1AXSA 1I7ZB 5GHWL 5GRWA 1H5BB 5F8QC 4PS4H 1PFCA 4NKDA 1X4XA 4APQA 1OAQL 3D69B 4ZXBD 3HZKA 2XT1B 4P5KA 3HG1E 4IDJL 2GFBB 1NBYA 3LB6D 3HS0A 3QRFM 1H3WM 1V5JA 5F7UA 5INDA 5LGJA 4M1GH 4FQJL 2E8ZA 4OD3H 2COQA 1M7XA 2NMSA 5GGQH 4DAGL 4HJJL 5FGCB 4YFLI 2H2PD 2XZZA 5AD0A 5B3JE 2YBRB 4FQHA 4ZPTB 3MRBA 1NGXA 3DUSB 3B8SA 1U8HA 4OLWL 5JORB 3DIFA 3VXRE 5TDPB 4YDJB 5EO9B 4WFGE 4M62H 1BFOA 2H1PH 1DCLA 1IL1A 3RHWK 3PGFH 3ZTNH 4RZCB 3K80A 2BNQA 4MCYA 4JG0H 2R2HB 3S5LA 1K8IB 5IB3B 1T66D 3PIQB 1EJOL 3HRPA 3ELAT 4CUCA 4XP6L 1S9XB 3WFEH 5HHNB 3T77B 3PF2A 3TF7C 4UT9H 2AABL 4AH2B 1C16A 5I1LB 3GSUA 1R5WB 2VH5H 5EA0L 1EO7A 3WUZA 1DQLH 4XVTL 4NC2B 1KIQA 1AD9B 1R3JB 4PJ7A 5D72H 4F7TA 4PJXE 4YZFE 2FJFB 3WKML 2DN7A 5EBLB 2YRLA 3DMMA 3IDJB 1N6QH 2CDGA 2FHCA 5L2KA 4KZEL 3HCVA 5IF0A 3QDGB 2NY7L 2ADJA 1T0NA 1GGUA 4WW2A 2B0SL 4WEMB 3LRSB 1CGUA 1OGTB 2X4QA 5CP3H 3RGVD 3SDCB 5I19H 3D87B 4GW4B 3JV4B 1TVHB 1X6LA 1CDGA 1CN4A 4NO3B 3EO1B 4KQ3L 3DTXA 4HWEH 4Y16C 3WDHA 3GEWB 3ILPA 4ODVL 4GXUM 3PWUB 5AWNL 5EUKA 3QUXA 1MREH 2YMXH 4L3EB 2PCPB 4BSJA 1U8LA 1FN4A 1DE4A 3V4PL 4YE4H 1ZHLB 1MF2H 5DJ2B 3VFUB 3VI4F 2X9YA 2Q20A 3MGTB 5BCAA 4GG6B 1KF9B 3O9WC 3C5JB 5LKNA 2W0LA 3IDNB 2QQLH 4AK1A 4PG2A 1TJIL 4J3XA 2NY0B 3C09B 3PWPD 4HCRH 1VENA 4AIZB 3BN9C 3NFPA 4E41E 3LH2H 3MNVB 3TPUB 4AMKH 5CGMA 5E4EB 4JQVC 4FQXD 3B2UC 2CPCA 4F33A 3UYRL 4LAQL 1UVQA 5IT2H 2HN7B 3QFJD 4ONOA 5F7MC 4HF5L 4GOSA 3BP4A 3U30B 4JFZH 2ADIB 2OM5A 4LNRA 4NP4H 4MNQD 3UJTH 5GS0H 2V6HA 2CUMA 2A38A 1UM5H 4M7ZC 1A7PL 5DD1L 2E9BA 1BJ1H 2RFXA 2R29H 4CAGA 4P2YA 3PDDA 4GT7A 1BQHB 2R56L 3O41B 3QAZB 4XC1H 3TCLA 4IRSA 1XR8A 3VXPB 1CLYH 4FRWA 2XZCH 1FC1A 5F96L 2AEQH 3S96A 4BFIA 4L8CB 1OTSD 5GGTL 1SYSB 1NGZB 2VLKB 4O2CB 2PETA 1VGEL 3GJEB 1WIOA 4K23H 1H0DB 4K8RC 3N1FC 3QQ9C 1MJUH 3L3OB 5DMKB 4Z78B 4ERSL 1JI1A 4AT6A 4F80A 3GJFA 5GRVL 5D1QB 4PJBA 4LHQB 5H94B 4QF1A 4OZIF 5DHVB 1G6RL 4NPYA 3C60A 2JB6B 4PP2B 1NGPH 5F3HA 3RZCB 2HFEA 4XBEL 1SEQL 1UQSB 3S37L 2XWBB 4C55A 3QO0B 4MNHB 5DRZA 3MRNB 4KJPD 4EI6B 4NQCD 3QQ4A 3JTSB 3PJSA 4YBHA 3MLTB 4JHBA 1ZTXH 5I0DA 3HKFA 4WI2A 3KWWB 5LJYH 1VB9A 1ZHNB 4OZGF 3GK8L 1OCWH 1TVBA 5D71H 1DZBA 1PZ5A 4EI5A 2F54E 5GS0C 2G5RA 1LDPL 2VL5B 4HT1L 1F4XH 1CDYA 1WICA 5IESH 3RRQA 4LLWB 3FFCB 2XZQL 5L7XL 1DDHB 1PAMA 3P11H 3BW9A 4P4KB 2BMKA 4KJYB 2E3VA 4QRUB 4YQXH 3SO5A 3QCTH 3TZVC 1SBBA 3PQYD 4N9OB 4NHCL 1CK0H 1T0PB 1QHPA 2XA8H 4PRHD 3RKDD 5H37G 1TVDA 1PBYA 5GRUL 4XBPB 5T5FH 3BZ4B 1BZ9B 4BYHA 4HWZB 3QDJE 3O4OC 1SMAA 5T33L 3CUPA 1JGUL 1QSEA 3GMRB 5CSZA 2FJGA 1KLGA 1JZ2A 3UZEA 1C7SA 1JGLL 2VZ3A 1VERA 4ONHB 1IE5A 4MLIA 5GGRB 1TCRA 2VXSL 1ED3A 3CXHK 5DR5H 2E8YA 4P57A 3RVUD 4EOWH 3LIZL 3OSKA 3S3JA 4XH2B 1VFMA 2QHLA 3QG6A 2H6PB 2VLJD 1A2YA 1T1XA 3L9RB 2QTEA 2HLAB 1U8IA 1ULVA 5IOPB 5EU4B 1FSKC 1FG9C 3KPRD 1CLCA 4R4BA 4UTBH 1HI6B 3X3GL 3U0PA 1TPXB 1YYML 3WNLA 3LKOA 4QYOA 1KEMH 4PREA 5EH1A 5T1LA 5HYSB 1D9KD 3LEYL 5BVJA 1YYLL 2OSLA 3TN0A 1PY9A 4WO4B 1A14L 1FVEA 4KI5D 3GSRA 4J8RA 4G9FB 3VH8B 1OGAD 1MWAH 5T1KB 5HD8C 2CKBH 3FRUA 1A9BA 2DWDB 4KUZL 4X6DF 3TNNB 3VFMB 3IDIA 5E8OA 2IG2L 5DD6B 2HTLD 3GIVB 5KN5A 5C0ND 1S9WA 1WVZA 3F58H 2G60H 1EBPA 4KK9C 3TFKD 2J8UE 1U8QB 3GIZH 2HWZH 3M07A 5ISZB 3MNWA 3VCLA 3HI5L <