2IEPA

Crystal structure of immunoglobulin-like domains 1 and 2 of the receptor tyrosine kinase musk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
187
structure length
187
Chain Sequence
LPKAPVITTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSALRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Agrin-responsive Immunoglobulin-like Domains 1 and 2 of the Receptor Tyrosine Kinase MuSK
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
molecule keywords Muscle-specific kinase receptor
total genus 39
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iepA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iepA02
1FZKA 4OM1H 5DVLA 3RWIB 4U6HB 2WM0A 4WUUE 4ZS6C 3V8OA 2I9TA 4S1SH 3MLSH 1JYWA 3T1WA 2VH5L 4HV8A 3KPOA 4HDIB 4PJHA 1X7QA 4JQXA 2PYED 1B4JH 4UNUA 3RWFB 4GKSA 5DK0A 3BT2L 2BNRA 4LLWB 4XPGH 5FA4B 1LEGB 4OJFH 4XP6H 4WFFD 1S7VB 2FYYB 3MGTA 3UP1A 2J8OA 5I0DA 2YKLL 1MCDA 3D2UD 4XCEB 2AAVA 3FB7A 3UTOA 3BW9A 3X11A 1Z3GL 2VC2H 1LK3H 2Q8AL 1RK0B 3QT2A 3IETB 2QQLH 1SYSB 3NAAL 1B6DA 3LSOA 2GTWA 1SYSA 2H32A 5HGDB 1MVUA 3EZ8A 1EZVX 1L4IA 4PGZA 2GJZB 5GIRA 4RFOL 3S6CA 3I6KA 4J2XA 4FS0A 1LEKA 4EDWL 3ZDXF 1JRHL 1S7VA 1T7XA 1WCBA 3MGTB 3MYJB 4POYA 2GQHA 5HPMA 3KYOA 4QNPE 1P7QB 5CJ8A 1HINH 5JXED 2C1PB 1A6PA 2DBLH 3U6RA 4U05A 2V17H 4IBLT 4MDJA 3TH3T 5FA3B 4XGZB 3WIHA 1VESA 1OAKH 3U9PH 5TE7H 3V5HA 1YEGH 2PR4H 5CKAA 2QSCH 5GZNC 4HWBH 4OI9A 5IJVB 3QQ3B 1KCRH 3HE6D 4ORZC 1QNZL 4OGYL 1HHHA 3WXVL 1NGYB 3CD4A 5EA0H 4M1CD 5BVPH 4FQXB 4X83A 5ALCL 2P48B 2DWEA 3FFCB 3OJDB 5F7MC 4PGCA 4NBZB 3CVHA 3OKNB 5MENE 4CJ0A 3CSYA 5EC1A 3E8UL 3ABZA 4XVTL 3RPKA 5C9KA 2XOTA 1UKQA 1MJJB 3BZ4B 5EPMA 3PGFL 3IGAA 4Y5XC 4JY6A 1PZ5B 2WK2A 5F7EH 4WFHD 3MRFA 3GUTB 2Y06L 5GGSB 4H8WL 5C6PB 3IKCB 2CK0L 4KVNH 3F7YA 3IDYC 3JV4A 3RVWC 3MPCA 1XGUB 2YUXA 2A6KA 5AD0A 1I9RL 3QDJD 3CFCH 4P9ML 3QQ3A 1CVSC 4RRPG 1JRHI 5E6ZA 2VYRE 5EOQH 1CIDA 2WANA 1A1OB 1J8HA 2YD4A 4YFDB 5I17A 1EHAA 3CFKA 1I85A 1INQB 2VXUL 5ADPL 3SGJA 2W0FA 3NFNB 1UWGH 3WS6A 3MJGX 5D6CB 3DHJA 5BRZE 3OKEB 4Z7VA 4HJGA 4FQJH 3NZ8B 2NX5E 4NM8L 2JB6B 4IRSD 2NZIA 5I1AB 2FLBT 3W39A 1KEGH 2IPKA 1FGVL 3UTPD 4P2RD 1J12A 3G6JF 3DVIA 3NMEA 2HT2D 2RAMA 4ZDHB 4WJ5A 3ME0A 4UTAL 1FE8L 1A4JA 1QSEA 4G6FB 3SO3C 4JO4H 1SBSL 2R23A 5F1IB 4UT7H 3I50H 1DVFC 1KN4H 2GITA 5IHUH 3CZFB 1H8SA 1FZMA 2XTJB 3W0WB 2DLFH 5D96B 4LIQE 3BEVB 4LKXB 3UX9B 4R4FH 3LD8B 5D1ZA 4YDJB 1NEUA 1E4KC 2ESVA 3B6SA 3GSNB 4PLJC 4G6ML 5JUEH 2OQJB 3UDWC 5C09B 1GH7A 3UPCA 1MHCA 1F45A 1BFOB 3O41B 3VXRA 1A64A 4NKOB 1YA5A 4N1EA 1G84A 1BZ9B 3KPOB 4HDIA 3EFFA 1PLGL 4FFWC 1NCBH 4EDXB 4HIXL 2UYLB 3AREA 2AKRA 3TZVD 4N0YH 5IQ7L 4J4PC 4PV8B 1BFVH 1CD0A 5FGBC 5HGAB 1OAZH 1I9RH 2AQ3A 2CR3A 3MV8D 5I75B 5BZWA 2AEIT 1M05B 1T1WA 5ERWB 4EXKA 1WWAX 2MCPL 3VFOB 2B8OT 2WQRA 3X12A 4NQVA 3LQMA 1KV3A 4EQ3A 3HI1A 4UOW1 3BP4A 3NCYP 2H26A 1T0PB 1WC7B 4ELKB 3HA0A 1R5IB 5KSUA 4W70A 3UYRH 3BXNB 3G6AB 3SBWA 1RZ8B 6FABH 1HHJA 1KB5L 3HMXA 1PY9A 5TQ2H 1YEKL 3OAUH 1X5KA 4TULL 3QDMA 3TV3H 2NY1D 5T1LA 1IAIM 2B4CC 1RZFL 3FN9A 3MRRB 4PJ5D 2BSRB 2FR4B 1YEGL 2PR4L 2IALA 2NY5L 3OBAA 3V4PL 4DEPC 3NA9L 3T0EA 1V5JA 4P3CH 4NM8H 3ULVH 4Z7NE 1GGCH 2BY3A 2YSSA 4JFDD 3MLTA 3L5XL 1FVDA 4UU9B 4X4ZA 1B88A 4WIQA 3LRSB 4QKXB 5B22A 4UQ2B 1DVFB 2ZUYA 5EUOB 5E9DE 4LKXA 1MJ8L 1Y18A 1MCKA 3RWEB 3ZDYE 1SJHB 2FWOB 4GQ9L 5KN5A 1IT9H 4JFFA 1K8IB 5HGHB 5I1HH 5E2JA 5DZNA 4HXBH 1CL7H 4K3DH 1RK1A 2CLRB 1RUKH 4N8VA 5KSBB 1OM3H 1NLBH 4FQIL 3FQWA 3CPLA 4HHAA 3FTGB 1GOHA 5IK3A 4OZFB 4P5TC 1SM3H 2QBWA 3PWPE 5DO2D 2AJUH 3C5JA 3G5XA 5I1DB 2EEDA 5IJKA 2CIIA 2J4WH 5CBEB 5DJAB 2QV2A 5F7KC 3L1OL 4JVUA 1ES0A 1VSCA 2QQNL 3OR6A 4XP9L 1CLYH 3KDMB 1OGTA 3BPNC 1B4JL 1DQDH 1S9WA 4K9EC 1QNZH 2ARJQ 1UB6B 2ADIB 3ESVF 3KXFD 1MCEA 3MLSL 2I9TB 4N90D 2CQVA 3T2PA 5HY9B 1U2HA 4P5KB 5IROC 3M1BA 5DD3L 5I1JH 4JFQA 4JDTL 4X4ME 3BGAA 1I7ZB 1FL6B 4MNQD 2KQNA 5IBTL 1EEYA 1XR8A 5AWNL 4XMPH 1CFSB 5GGTA 2HMID 1RIUL 5FKAA 1MREH 3NH7L 2IANE 3KPSA 4TUKL 3ZHLA 4GBXD 4UOW0 2C4XA 4OGAD 4DUXA 4TVPD 3G9AB 4PJIB 1IAMA 2UVEA 4GUPB 5DYOA 3SJVB 1DUZB 4JFZH 4LLDB 3LV3A 2P4AB 1OB1B 1UG9A 1IC4L 2H41A 3IDUA 2A6DA 4Z0BH 3ULVD 3J7HA 1JHTA 2EO1A 4ODWB 2HVJA 3N1FC 2B7DT 2XA8H 4E41B 3S3JA 3HZYA 5BOZG 3IJHB 1U91A 1J0YA 1D7FA 3UBXG 3VXNA 5CKGA 3MLUH 5D7IE 1IT9L 2VL5B 4RGMC 4G7YH 5IB1B 1MFEH 5AZ2H 3OJVC 1NPUA 4LHUA 1NDGB 2YUVA 3SDAC 2VDNH 2C1PA 3IJSA 1RHHA 2VR4A 3P0GB 3T1FB 4GS7B 4Y5VC 3MYJA 1IEHA 1KF9B 3TBSA 5DJYB 3PWUB 1MOEA 4PJGA 3U2SB 1I8KA 1F4XL 2VXQH 3T09A 5CP7A 5HDBE 3D9AL 3QIWA 1FVCA 2FH6A 3WLBB 2P49B 3S5LG 2EEAA 3D87B 4XWOC 2EH8H 1FVEB 5DI8B 3WFHA 1G9ML 5C0AD 4UV7L 1DQQB 3VH8G 5JNYB 3VRIA 4UTBL 1KPRB 3MV9A 5EIQA 3BRGC 4X6FB 4YXLL 2NLJA 1OTUD 3O6ML 3V2AR 1I3UA 1NGWB 3T0EE 4QHKJ 4C56D 5SWZA 3LN9A 3EW3B 4RIRB 5B4MD 1CBVH 1UXSA 2XZQL 4OGZA 4WI8A 3LN4B 5I16B 2ZZUT 2N1KA 1IGTA 3T4YA 4FFZH 2B1HH 3S88H 5EU7E 4PJIF 3GM0A 4FABL 4NQDB 2NY4D 4X6BA 4JFPB 3AS2A 1R24B 2ADFH 3AS1A 3V6ZB 4P46A 3P0YH 1Z9SA 5GRZA 1N5YH 1JTPA 4XAKD 5H94A 3PNWB 4NO5B 5FECA 3QPQD 3ILQD 1KCVL 2OI9C 4P57B 4CN1A 3A0OA 1J8HE 2EH7L 1AGEA 1AO7E 1A8JH 1S7RA 5HHQA 3S35X 4KK8D 4XMLL 1EJ6A 4NJ9H 1XAUA 1HHGB 3MR9A 4Y1AD 1KUMA 3RY6C 5T5FL 3ZL4L 4M62H 1XIWA 4LOUD 4BH7B 2C5DC 2V7NB 3QPXH 1LO0H 4KK9C 1A1MB 2XXCB 3BP5B 2EKJA 4U0QB 2EDNA 3AMLA 1E4XL 2F54A 3A6OA 3THML 4Y5XA 1BIIA 5SWQB 5DMIL 1DLFH 3RDTC 3LRGA 3BZDA 1MJUL 1H15B 3MOBL 1H3XA 1XGYH 3ARWA 2OK0H 1IARB 2NY2C 3BZEB 2G2RA 2VLKA 3DV6B 1MLCA 1OSPL 1EAPA 4HX1A 1D5ZA 4LIQL 2Q86A 4GT7A 2MMXA 5ANME 2ICES 3IYLW 3BZEA 1IEBA 1I7TB 5T1DH 1YNKH 4CU6A 2FO4B 2VSDA 3AAZA 3ROOA 4LLVA 2I07A 3I6GA 1CR9H 2E6PA 5SWQA 1R3HB 5C0FB 3EYSL 5ICYA 4GJTB 1ZLWK 4TOYH 3R06B 5HI3C 1M6OA 5ID1A 4OZIB 4H0HB 5FYLL 2NXYD 1CLZL 1IZJA 1L0XA 4NN5C 1DUZA 4ONGL 1QSFE 5DFTA 1BGXH 4IMLA 4HUXA 4R8WH 4XPTH 3VFNA 1YY9D 3MRMA 4U3HA 2IH3A 5CBAA 3LPGA 1YUHB 4EKXA 1NCAH 4HUNB 3OHXB 2BSSB 1C08B 3LKSA 4OAWB 2D4FA 2M26A 2EH7H 1RIVL 1JGEA 3H7BB 3BDYL 3FQXA 4MNHB 4ONGH 3P4MB 4K23L 1CXHA 4PY8J 4P5KA 4RRPA 3MLWL 4O2FA 5GS1B 5C0IB 1V7NH 1T66C 3HI5H 5IMMA 2MWCA 1HCVA 4PJ7A 5KSBF 4JZNB 2EDOA 3EHBD 3GHEH 2NX5B 1A3RH 4I48A 5D93C 2LTQB 1CDCA 4U2YA 3MUZ1 3QDAA 4I0KA 4LIQH 3U36A 4M6MH 2V7HA 2HT4C 4FZEH 3B5HA 4M43L 1LO3L 3IXTB 4K3GA 2FHFA 3I02B 4NQEE 4OAWA 5CD3A 4YHLL 1OOAA 5JMRA 3NCFB 3RBSA 1YUHA 4JPVH 4RGNC 2DJ4A 2FHBA 2R56L 3REVB 4NN7B 4HIJB 1MEXH 3TO4C 5IR1A 1PSKH 5TF1H 1NBZB 4N90E 1OTSC 1H9VA 4LCYA 2EC8A 5B38G 1BEYL 2CMRL 2MTPA 3ILPB 5E2TL 2GSGA 1M6OB 5E2WH 4P4RA 3A6CL 2G5RA 2VXQL 5EU3B 1PJ9A 5C0EA 1T4KB 4ONHB 3W11D 3G08B 1SHMA 4Y16B 1DTUA 1JUFA 3RVUC 4MNGB 5E6IC 25C8L 5DJYA 1K5NB 4X7SL 1ZWIA 4QRRA 2B39A 1OP3H 2CGRL 3HAEB 3K0WA 1UB5A 2VKXA 4RAHA 4KJQD 3CC5A 3C08H 1VFBB 4NWTL 1SVCP 1R3KB 1G7PA 3D69B 4QXTA 4UB0H 4DFHA 3HAEA 4OZ4B 3BWUC 3B5GA 3QI9C 4ISVB 3BT2H 1GGIH 3QEUA 4JFYB 1VA9A 1BF8A 1U58B 3LH2L 2CPCA 2A6DB 3MFGB 5I8OL 2NTSP 3UJJH 2PW1B 1KCSH 4MXWH 4NZRL 2WBKA 1A4KB 1NC4D 2R4RL 4UI2A 4ELKA 2R2HB 4YAQA 2BY1A 1D6EA 3FQRA 3OX8A 3UTTD 5FKAB 1J18A 3RWJB 4JO1H 1O7VA 1J0KA 3TJHD 1QSEE 3ZO0A 4BFEA 5IBTH 4QLRA 1FRGL 3MOAL 2AV1B 1V05A 5JW3L 4D0DB 3SCMA 3QDJA 1I8LC 3QCUH 1JZ5A 4ZS7L 3PNWA 3QXAB 4QOKD 3SGDH 1JN6A 4R6UA 2R1XB 3RVXD 3RVVD 1LILA 4I3RH 5C92A 1U8PA 2C1OB 5F7FA 1GJIA 4P49A 5E4EB 4KJPD 2D31A 3AUVA 2D7MA 1H3GA 1AGDA 2EDQA 1JGUH 2XZAH 4NBXB 5E00B 5FKPB 3L3HB 5IMMB 1MHEA 4Q6IB 2NY7L 5J6GB 4MVBD 5GS2D 4HK3N 1KIQA 3BP6B 4HJ0D 3B6SB 2MCG1 4ODVH 4ODTL 3HLAA 4U1GC 3VGAC 1N8ZB 5E70A 3L3JA 4L4VB 3RUGB 2WMPA 3VFTB 4ZXBA 1TETL 4O4YH 1TMCB 1MUJA 5D9SA 2DQFA 5HVHC 5EB9A 4TQEL 1C16A 5GZND 2ICEB 1FNAA 1CLOH 1IRAY 2KKQA 5J57B 3O6KH 1F6AA 1TXKA 1S7XB 4HSQA 1MCPL 4J8RB 3R06A 1GC1C 4P4KB 4PRIA 1DDHA 1U3HB 4GKZA 3CXHJ 2JIXD 4F2MB 5DUBB 5KVGL 3P9WB 3VGEA 3OKOA 1WSST 1J10A 4X4YB 1LO4L 1RZKC 4JHZA 2APVA 3AGVA 5D96C 4X6DF 3O0RL 5KVFH 2WW8A 4H1LG 4KTDH 5EN2B 3VI3E 1MRFH 5C0CA 1HYRC 4M1DH 4PJDE 1ZGLP 2E7LA 3RVWD 3EOAA 4LSRL 3UTSD 1VGEH 3KLDA 5CEYB 3DWTA 3GSQB 1NL0L 5FHAH 4B0MM 3HR6A 3SQOL 4X98B 5BOPA 1IGJB 1QQDA 1OGAA 2VIRA 4YX2L 3G04A 4U0RC 1T2QL 3C5SA 5D70H 2R1WB 3FO9A 2YHGA 2YD1A 1URLA 3GSNH 5IMLB 1OB1A 2MPAH 3PXJA 4ONFL 4XNQA 2QADD 4WW2B 3HFML 4YUEH 3KYMA 1OTTC 2YPVH 4MX7A 1P4BL 2ZUQC 3U9UA 4L4JA 5JW5A 5DJ2A 1WT5C 1EGJH 5CCKH 1HOCA 4HC1H 1NH6A 1OM3L 5SWSD 1S7WB 1FL6A 1BJ8A 4JFDB 4OLUH 5CGTA 5GHWH 4M02A 4NZTL 4RA3A 4ZXBC 3K80A 3TCLA 1EH9A 2CIKB 3UBXB 1UCTA 4XCNA 4OLVH 5GS2H 3T0WA 2ADJB 3QUKA 4PJAE 2H6PB 4PGEA 4KROB 5TPWL 1ND0B 4WO4A 1PAMA 2OJEA 2HTLC 4UILH 4FHBD 4HZAA 4D0BA 4PRDB 1PD6A 4XGZA 3S37L 5LKNA 3BYTA 2PTVA 1R3JA 3PGCB 1EFXB 4R2GD 3L3GB 5HDLA 3VXSA 1HDMB 2NX5D 3QUZB 5GS0D 3QEQB 2MNUA 2NTFA 1ES0B 1T5WA 4NNXB 2EIBA 2HT2C 4PJAB 3SDCA 3MRQA 1I3GH 4L8CB 1F11A 3NN8B 5GSRA 5TGBB 1A3LL 1NAMA 4S1RL 5J56B 3TBYA 4X6CA 5IP4A 4M7LL 3UC0H 1VEPA 3MRGA 5A3ID 5IHUL 3MODL 2GITB 5KJRL 3FTGA 1R3LA 4Z5RA 3K4ZA 3RX5A 4OI8A 1HH9A 1YEIH 2W07A 4DN4L 1MH5B 3FHQA 2HRLA 4XMKL 3EJYD 4K3EH 3TH4T 1QFHA 1GAFH 1R3IL 1HK6A 3V52H 5J11C 3VI3F 2IMMA 1ZANH 4A6YH 1NAMB 2CKBB 4HIHB 3CVHL 4U1IA 1Z9LA 5TQ0H 4TUJB 4UU9A 1NANI 3D0VB 2ESVE 1FN4A 5MEOB 1IGFH 4YDLC 3NABL 1LO4H 1IJ9A 2YC1A 2FX7L 4F58L 4BZ2L 1YQVL 3STBA 5C0CD 3I2CH 4MJIB 4JRXE 4ZQKB 4ERSL 1J8HB 4Y4HB 5LXGH 4K8RD 1JI1A 2HN7A 4OCRH 1NBYA 4XCNB 2R39A 4XNZC 1PEZA 1JHTB 1Q9OB 3PWLB 1CD8A 4LCWD 3VWJB 3EBAA 4WFFE 4PJXF 4PJ8D 3QISA 1Q72L 5C86A 2D2OA 3TJEL 4R4FL 5JW4M 4HKZB 3SGKC 2X4QB 4PJIA 1OLZA 4U7MA 4P2RB 4FP8H 2FATL 5EBWA 2APTA 2OJZH 4WI5A 4PJCA 1T0MA 4X7EC 4XP4L 3V0WH 2G5BA 2QEJA 4PJ8B 1F58H 2F53E 3VXMD 3ARDD 3NPSC 5ALCH 3OXSA 4LSDA 4KV5E 3DJ9A 1QACA 5AWNH 5JHDD 3SE9H 4JRYA 1OP5K 3NIGE 1JYNA 5HHOD 4Q9RH 1CI5A 4LSRH 3GRWL 1T3FB 1JFQH 2DLGA 3MA9L 1JYVA 1U95B 3EFFB 4OM0L 3CK0H 3VCLB 5DF0A 1I1AC 5EUKA 2UZYB 4EUPB 1LD9A 3MJ7A 3IFLH 3O3DB 3TWCH 1U8HA 3O0RH 4PGBA 3RTQA 4E5XA 1C7TA 2ITCA 4G7VH 4NQDE 3VFVA 5IHBA 3L7EA 2OJZL 4XP4H 1AE6L 4FP8L 3VRLE 3BWAA 5LBSH 1XGRB 2IQ9L 3GMMB 1NGXB 3LVEA 4OIIH 1NGQH 3RIFF 4DKDC 3H6JA 4J8RA 5IK3B 4HJJH 4OD2B 1LO5B 4WHYG 5BJTA 1SM3L 4JCMA 3RNQA 2EYTA 3FFCD 3DETC 2ICEA 1A4JB 3H9SA 1F8TL 4NRYB 3BHBB 1NLDL 4QRTA 3IDGB 5D5MB 5DSCA 5FUZL 1WZKA 4F7PA 1HSAA 3MA7B 4I1NB 2WUCH 5IQ9A 5F3BA 3O8XC 4ODBD 4GMTH 5IOPA 1WIUA 1CGUA 1ED3B 4G3YH 4UQ2A 5DDHA 1QFWI 1QLFA 1GZPB 3VXSD 4Q9BA 4LLWA 1G7MA 3L5XH 4X7SH 1A6VH 1V7MH 4MA3B 5EUKB 4EUPA 4OZGA 1RUAL 4CMHB 3L3OB 2IALB 5ENWB 2J5LB 4MDIA 5FOBA 5TE6H 1ZVYA 3OB8A 3QCUL 1JZ7A 3T0ED 1R3IH 4PLKD 5CJOH 2V17L 2R56H 2R8SH 1OAUL 4D9RE 1CG9A 2FJHA 3KS0H 4XAWH 2OI9B 4P2YA 1YQ2A 2NMSA 4E0RA 3VXTA 4HJ0C 1WZMA 3MRIA 4NPYB 4XPAH 4ZUWB 4Y5YA 4Z77A 1FAIH 1L9MA 5F9JA 1X5HA 3QIBB 4BUHA 1MJJA 5ID0A 3K74B 1E6JL 3EOYG 3NCCB 5LQBH 1CU4H 2IG2H 5D2LE 4TTDC 2R2EA 1NKOA 3B83A 5D2LA 4AEFA 2I9LA 3EAKA 4J4PA 3C5SB 4LDLB 4QTHA 5DVNA 5I76B 4KROC 2DQCL 2FZ3A 5JHDA 1BBDL 5HGAA 2BOBB 1QYGH 2E8YA 3P77B 5CILL 1HI6B 1KJVA 4WW2F 4OBSA 4KK5C 3DXAE 2E6JA 1ODAA 1PY4A 4S1QH 3MLRH 3LS5L 4Q58C 5JA9A 3RL2B 4OJFL 4XP6L 2GJ6A 4U1MA 2E8ZA 5EN2A 3QAZB 4LCWA 2XFXB 1KB5A 3HMXL 3D0VA 1QO3A 2OQJA 2VLJE 1QLEL 2GFBA 4I77H 5AAMA 2BVYA 1KENH 1DFBH 4S1SL 2ADGA 15C8L 1FZMB 3AMKA 4QGTA 3JXAA 5FYLH 3O9WB 5E2WL 4D8PB 3B2VH 3D39A 4Y19A 5E2TH 4U1GB 3F6LA 5DMKB 2FB4H 4NN6B 4KMQA 5DK2B 2NY0C 2OR7A 3DVFA 5E8OA 1HHKB 2X4UB 3H42L 2XWJA 3FB5A 1LVEA 4DUWA 3K81A 5C6TH 1ZHBA 4PJEB 5L2KA 3FFCE 4HG4K 1NBQA 1KTRL 1IBGL 4WI7A 4Y4FB 5D71H 4L4VD 4XPFL 3ARUA 1ZSDB 2R29L 5FCUH 1OP9A 4R0LC 4MJ2A 4X6CB 1U8OA 3LKRA 1J1XH 4F7TB 4NUJA 1J0HA 3QUXC 3OGOE 3DO7B 4Y2DA 1DVFD 3HPLB 4Q6IA 1QG3A 1BIHA 3VFGL 5F7WC 2AABL 4LQFH 2CDFA 3MLYH 4W6WB 3SDDC 2YA0A 4IM8A 4Q7DA 5ISZA 2YA2A 3IJYA 1AGDB 1FYTA 5DQ9B 3REWB 3CVIH 4APQC 1I9EA 1ND0A 1WWWX 1RJYB 5EOTB 5F88A 1TQCC 5DMJB 5IKCB 2ADJA 5D93B 3BSZL 4O5LH 5SX4H 1FC1A 3DXAA 2CRZA 5F7HA 4KUCF 5M7QA 1JVKA 2NY2D 3QFJB 1MFNA 3X14B 4JB9L 1R5VA 2LU7A 5TJWK 4MAYA 5DLML 1NCCH 4L3EA 3B5TA 2Z31B 1U9KA 1BECA 5D1QD 2V2WB 2P5WD 1BVKA 1U6AH 1U3HD 1I8MA 2AV7A 3KGRA 5DHVA 1Z2KA 5DEFB 5KSAB 1JNNH 1MHPH 1S5IH 4NJAH 4X0KB 4OLYH 4RNRB 3H0TA 1NCDH 4QHUB 4G8FA 3O3BB 3MV9D 2BVOB 4OCXH 2I07B 5KAQF 2PXYD 4GG8B 3I9GH 4QRRD 5ICXA 4M8VA 1L7IH 1NBVH 2VDLH 1CU4L 4EN3C 2DLIA 3MFFB 1AGBB 3CC5B 5CSZA 4WCYL 2AGJL 3VMOA 5LCVL 3QJFB 1YYML 2R2CA 1F97A 3LS4H 1SMOA 2BOCA 1MJUH 1F2QA 1IEAB 4JPIA 4LSQH 5FB8A 5EU5A 3F5WA 3OTTA 5CJBA 2VAAB 5IBUG 1IC5L 4HIHA 3S35H 4U6YA 1RZJL 3RWGB 2DKSA 3MROA 1TFHA 1EDQA 2APFA 3QG6A 2W65A 8FABB 1QFOA 3GMRA 4R4BB 1P9MA 1T4KA 2F74B 4WDIA 1BWWA 5TE6L 2ATKB 5MHSE 2VJXA 5FGCB 3TNNB 3E2HB 3CLEH 2VDOH 2CLZB 3CFIC 4GH7B 5DWUH 4AMKH 1QLEH 4XVUD 5E9DB 4GLRH 1GOFA 1R3LB 1JYXA 2HT4D 4KQ3H 5E08H 4DUVA 4G8GD 5J13C 5B3NA 4NWUH 4S1QL 3SKJH 5D7KE 3MLUL 4Z0XB 1IKFH 4BYHA 5I8EB 1OTUC 4KXZH 2ZPKL 1RUQH 2WINB 4GKSB 3QUZA 2XA3A 5J3HC 1XF5B 3V0VA 2DRUA 1G7LB 4JHAL 5I9QB 4NRZA 1K6QH 3GMLB 4XTRD 4Y4KD 4HJJL 3UAJC 4JFXB 3HS0B 3NFSL 1WISA 3CLEL 2XZQH 4JE4B 5HYSB 4YDVA 1HQRB 3SKOB 2NY4C 4M9PA 3S5LA 2R4SL 1HILA 2Q3ZA 4JJ5B 4X80L 1PSKL 5TF1L 2Z8WC 1AGFB 4P99A 1X5ZA 4UINL 4F9LC 1SJXA 5JW5B 5L2KD 4NOFA 2F58H 4APQA 5DS8A 3DNKA 3G5VB 5CWSA 1VKXB 1Q9LB 2ICWI 4PV9A 4KKLD 4QRPA 1JHKL 1RULH 5ID1B 3DYPA 5EOCH 4C4KT 4W6YB 5DC9B 4LP5A 1S7TB 3BP7A 4KKCD 3MACH 1BBJB 3G04B 5C2UB 3QHZL 4LEXH 1JWMB 4F7MA 2GYSA 4WTZG 1BQHA 1X44A 5LAXB 1CICA 3WKMH 2I24N 1I7TA 2GY7B 4NJAL 3U79A 1EMTH 1RZIB 1MIML 1MHPL 1R3KA 1S5IL 4MB4A 1M7DB 3GJEB 4ELME 1UJ3B 1X4ZA 2OL3H 3RDTD 1F3DJ 4JO3H 3H9YA 4EOWH 4YHPA 4UIKH 5EO1A 5GPRA 1P69B 3KYKL 3B9KA 1NCCL 5I1GH 3EJYC 5D6DC 3WEXA 3WFCH 3MRNB 5I1IL 2I60L 4PRAA 2C7UB 5F96L 3PHOA 4M93B 2VDOL 1UYWH 3FB8B 1NGZA 2HFFB 2GJJA 4WTZA 5HHNB 1OPGL 4JY5L 4O02L 1JZ6A 4QF1A 1S9XB 2MJWA 4LLDA 4TOYL 5HHPB 4RAVB 5GRJL 3OXRB 4ZFFA 2AJVL 1WEJH 1X5YA 5I19H 2BNQB 5DQDH 1IGFL 5IWLC 2DQIL 4LQFL 3CH8A 4MAYB 1FNGB 1KNOA 4EI5C 3GSVB 4WCYH 1ZTXL 3K8KA 3B4NA 3SJVE 4JFEA 2FX8L 1MCJA 4DKEH 5L88H 1D5XA 2WSKA 3GSXA 1X6LA 3BUYB 4XPFH 4L3CA 1CFNA 1EVUA 3SE9L 5DRNB 1Q8MA 2ZG2A 1LE5A 1T66D 4WUKH 2XICA 1NMAH 2HFGH 5ETUA 3LN4A 4I13B 1I1YB 5JPMB 2PTUA 5ITFB 3RQ3A 5KSVB 3QH3B 1KJ3H 1ZT7A 4PRHE 4XRCA 1I3VA 3GMNA 1QR1B 3JWOC 1U8IA 3T3PF 5JHDE 5GRWA 3GMQA 1UEMA 5LGJA 5DRXB 4XNUL 1ORQA 5FYJD 1J05B 5DMGD 3ULUL 4G9DB 1AKJD 1DL7H 4KVCH 2CKBH 5KAQG 5E03A 1EO8H 4LLYB 4DOHE 2AJSL 3VXUD 2EDBA 4NSKA 1RJLB 1UT9A 4UT9L 4WENB 5E6YA 3GSUB 3QDGB 3V7AG 3KPPB 4Y19B 2C3GA 5I8KL 1FCCA 1AD0A 1PLGH 2VLME 4C56E 4LNRB 3JTTB 5C0FA 4PJGB 4PRAB 1J11A 4IS6A 2AEPL 4UDUB 3AAZB 5L7XH 1RAMA 4C83A 2DTML 3WUWA 4M7KL 4OZIF 2G75A 5HYJB 1NDMA 3SCMD 2YXFA 4RX4A 2EC9U 3H9HA 3S7GA 3T0EB 4DN3H 4PJGE 4HGKC 5C08B 3GEWB 3QUMB 2G75B 4DJMA 5HYJA 3M8OL 3U7AA 1U8JB 4K3JL 4NCDA 4LLQB 4K3EL 2AEWA 4HLZG 2BERA 2ZKHL 4OSUL 3U7YH 1JUFB 5IESH 4KKLC 3WS6C 5MP6L 3QDGE 5FK9B 4Z7OE 2BVQA 3FZUD 3O6LL 3CDGB 1VGEL 2CLVB 4JDZB 1JGVL 1O7SA 1NFDF 3FKUS 1NCTA 2E5EA 4L5FL 2P8MA 4L9DA 3D2UA 2EC9T 1NSNH 4U1HA 1CDIA 1P4LB 3UTQA 1RURL 1VKXA 1L0QA 1A6AA 4XCFH 3RVTC 5F9JB 3KG5A 2MKLC 4KHXH 4U1SB 2A6JA 2UWEF 1FFQA 5CD3B 4LFHD 1WEJL 4XRCB 4RWYL 2DMBA 3ISWA 3QI9A 3S98A 3SDAD 2V7HB 3DETD 5I71B 2E9JA 4FQCH 3PWJA 3WNLA 3CFEB 1DUYB 3V6ZA 2Y7QB 2DB8A 1NCBL 5JIIA 4XNMB 1DL7L 4KVCL 1FH5L 2ARJB 1NLDH 1BOGB 5FUZH 2DQCH 1BZ9A 2I60H 3QXWA 2RJMA 2NXYC 4UDTA 4M03A 5ISZB 4LL9A 4YPGB 2AXGA 2ZNXA 1W72L 1FNHA 3FOLB 4JR9H 2FEDC 4U6VL 4Z7UB 3BGFB 3VXUB 4JO3L 1NAML 5I1DA 1UCBL 4NN5B 3JTSB 1I8LA 5DVOA 4PP2A 4R3SB 1A7NH 1FZOA 2QR0B 4GRWB 3TWCL 1OAUH 2R23B 3PQYA 3RA7H 2JELL 3HI6L 4CMMA 5F6IB 1HHIB 5F6HJ 3SQOH 2BVTA 1ZEAL 4DKEL 4OQTH 4ETQB 5DJXB 4MD5B 4QY8A 2FX8H 4WDIB 5F89B 1CD1B 2ADGB 1ITCA 1ZT1A 3IXAA 5F3HB 1YC7A 3LRSA 3P11L 4B7LA 3DX9A 3NCMA 1MCQA 4PG9A 2O5ZL 1U8HB 4PGBB 2DQDL 3VE0B 5KVEH 2EDKA 4RGNE 3WO4C 2NW2A 1CIUA 1IAKA 4R7DB 4Y4HD 1OL0A 3QFDB 1XGQB 2ZG3A 3U0PB 1OAQH 4DEPB 3ZLQC 4GRWE 3P77A 2EO9A 1RQ5A 4F7MB 4Z18A 1PGRB 4J1UB 4NCC2 3P4NB 4QTHB 4YDLB 3U4BL 4G6KH 3BQUC 3JV4B 1K4CB 4OCRL 1UADC 4KRPB 4L8SC 4OFKA 4XB7A 5T33L 1Q0YL 3W9DA 1UWXK 1QRNB 1T1XA 2YD6A 2JIXA 4KI5D 1MF2H 4K7FA 3ILQC 4HIEA 4NQCB 4QRSB 3OKLB 4BK5A 1A6TB 2V2XA 2YMXL 3K1DA 3PIQA 25C8H 2W0KA 3RHWK 1G6RL 4EIZC 5E2UL 4Y88A 5L2KE 1I7ZA 1YMMD 3QI9D 4LSPL 1NSNL 3A6CH 1C7SA 4PJXB 1BQHG 5EOTA 5F88B 5FOBB 4ZOEA 3QHFH 3MOAH 4FA8A 3MV11 1OGAD 1XF5A 3CFDB 5I8CB 5KJRH 4HKJB 3WL9B 4QT5A 1EJOH 1KIPB 4NUJB 2FATH 4J3TA 1JV5A 2DYPB 5JOEA 4HMDA 4KDWA 4XZUA 1J5OL 3DRTB 3D39D 4U6VH 5F3BB 3MV7B 4JREC 3MJ9L 5F44A 4XPBL 2MHAB 4TUOB 1M4KA 1HSAB 3BMWA 5EZIL 3WNPA 3DX8A 5L2KB 2YD8A 2VLLB 5GGTL 1MQKL 5E9DA 2MCPH 4UNVA 2VDRH 4YIQB 1CZ8L 1MH5A 4HXAH 3PQYD 2W38A 1A6ZA 4FXGB 1LK3L 1YNTA 1WGOA 5D7KD 3EO0B 3IDJB 4TVPH 5TDOA 4KFZC 3I2CL 1JIBA 2W65B 3W39B 4IRSB 1EO8L 2Y1VA 3F7QA 3WFZA 4XVJL 2YPLE 1AD9A 4YLQT 5FB8B 5LGKA 2P8PA 1ONQA 2XKUA 4XXDA 4OLEA 2BOCB 4KUZH 3RL2A 3AM8C 3NBNA 3VW3H 3QZWG 3GSRB 1KJ3L 1L7TL 1S78D 1K4DA 3VXNB 4I2XE 4WV1C 5I17B 1MY7A 1KXVC 1MHHB 2P5EA 3JWDL 5JPNB 3O6LH 2K3TA 1GAFL 3UTPE 1BAFH 4G8FB 5HD8C 5FUOH 2K7QA 4I5BA 1S7WA 4JFDA 1FE8H 4P2QB 3MRJB 1JNJA 4GRMB 3V6OA 3C8HA 1ZKAA 5FHAL 2VB5A 4NIKB 1MFAL 1E27A 1V8HA 2YPLB 4NQEA 5CP3A 1KEGL 3NACL 3QYCA 2D7TL 5C6WH 4ONOA 4NQVB 1CGXA 4OIAA 5IVZA 3LEXB 5TDPA 4YHYC 2MFNA 2P24A 1IILE 4DQOH 1DLFL 5EFIB 2R1WA 5DT1H 5ERWA 1LQSR 3GHEL 2AEQH 1DCLA 2NNAA 2LE9A 3S37H 4Q6YA 3TO4D 2E7CA 4P5TD 1MHHA 2VQUA 3ETBF 1AY1H 1UB6A 2ADIA 4R7DA 5DQ9A 1SEQH 5DTFA 4P5TB 1WFNA 3M07A 1EVTC 3BKJL 1P7QD 1OP5H 3ZHDA 5E0QA 2IADB 1AD9B 2JCCB 3OJ2C 4KQ4H 1BGXL 4M48H 4YUEL 4D0CA 5F97E 3WE6B 4MXVF 4WI4A 3QG7L 3VD7A 3UTZA 4ZXBD 4JZOA 5EBMB 4MJ6B 2PO6D 1HKLH 2E6QA 3WCYA 5D70L 3W82A 3ET9F 1T0NB 1VHPA 2V9QA 3MRGB 2VSCA 4ZXBB 5L88L 2WQ8A 3QB7C 2FIKA 5TE7L 1BD2E 3FT2A 3WHXA 1MRDL 1GYAA 2X9XA 1FNEA 2IADA 2JCCA 4J12A 1LP9A 4RISL 5F7DB 2F58L 1FBIL 1JF1A 2YBRA 1S8DB 4UUJB 2F5AH 3QO1A 2W0FB 3NFNA 1JPTL 2A74A 2Y23A 4Y5VA 5F9OH 4XCCL 3THMH 5KVGH 4KTEL 1FC2D 3FQUA 2OJEB 4WU5A 3ZDZE 4IRJD 4L1DA 5IMOA 1KJVB 3CJJA 4JY5H 5KS9A 2KPNA 4JCLA 3HC4L 4JRYB 1JHLL 3IDNA 5BS0D 3MSPA 1D5IH 3HZKB 1NJ9A 3EKCA 1G6RB 4MJ4A 4OLZL 5I1GL 5MERA 4GG6B 4FOMA 4QRSA 3KYKH 4NC2B 5C70A 3KPSD 4F33B 5I1KH 4FFYH 1E4KA 4MB5A 1T7WA 4UIMA 1CXFA 4K94L 2XZCH 2P8LA 4H1LH 4YAQB 3W2DL 5EPMB 2YKLH 1X5FA 4EVNB 4Q0XH 1EMTL 4F33A 1LE9B 2UVFA 2GCYB 4GFTB 1INDH 1H5BC 3BVNA 1T1WB 5C07A 4MA8L 3TBWA 1JWSA 3MLPA 1YN7B 1GSMA 2C3WA 2Y6SD 3VFRA 4LLQA 1UACH 1YEEL 3QUMA 1U8MB 2J12B 3RDTA 5D7SL 3MCKA 2DI9A 1VFBA 5DD1L 1AQDB 2XXMB 5IW3A 4RZCA 2RFXA 2EE9A 1VEOA 1KB9J 1ZGLB 4LMQE 2VDQL 4F37K 1BFOA 1N5AA 1CGSL 2PYEB 3AXLA 4XMPL 2F5AL 1ONQB 1M7IB 4P4KC 4AENA 2VZVA 1FNEB 3X13A 3BKMH 3RX8A 5T3XL 3BEWB 5D1ZB 3P0VL 3CK0L 2A0LD 1T7VA 4JQIH 1GHFL 1H8NA 3QWOB 1GXEA 2JK5A 3CDFA 4HLZH 3TT1L 2GT9A 1AO7D 5E99L 4MA1C 4NSKB 3HMWL 4CVUA 1G6RH 4PUBH 2YN3A 5K9JL 1N0XL 1MCRA 3F7PC 1R5WA 1XGTA 5I6XB 4ZDHA 5DRXA 1VFAA 3BKYL 4D9QD 3IRPX 2OZ4H 5E7BA 4BM7A 3UTZB 3NGBC 4R96A 2ZWLT 3QO0A 2N56A 4OKVB 5HJ3B 3ZYZA 1UVQB 3S36L 4PTUA 3RGVB 4MQSB 3FB6A 2NY3C 4X9BA 5D7IA 1MIEH 3ZDZF 5D5ME 4HKJA 4HJGB 4G6KL 2AS5M 1E6OL 4E9LA 1KPUA 4NKDB 3TVMB 2HP4A 2JJWA 1N0LA 5HDQL 2W9LA 4WO4B 1U2CA 2GY5A 1YN6B 4OIIL 2FJGB 1AI1H 3V4VL 3JWOL 2AVGA 3GSOB 4ZOBA 3RP1A 2A6KB 3T2QA 1F4YL 1G7HB 1K2DA 1UH4A 2YD7A 2HT3D 4R4ND 2ID5A 3QI9B 5F9OL 1U8NA 4KJWC 4P2OD 3RAJL 1C08A 1EGJA 3LKSB 4KMTH 4PRBB 1XT5A 1KSRA 4HC1A 1SY6H 5IMKA 2Q8BL 5IJKC 3OKDB 3O3EB 3U9UB 3L3IB 2BC4B 3FT4A 4G9FD 3VFNB 1G6VK 4ZUTB 4DZBB 3C2AL 2XYCA 2CJUH 4QXUL 3W9DB 3MX0A 4GXUN 4M43H 3WJJC 3MA9H 4CNIA 3FQNA 3E3QE 2IWGA 3CDGA 2DWEB 5L0QB 3KPNA 4ZTOL 1P5UA 4Y2DD 3VXMA 5JZ7C 1WTGT 3GDBA 2PYFA 1ULVA 3LQAL 1YEIL 1NMCC 3GJFK 4ZFGL 2X42A 4F8QA 5K93A 4L8BA 1PG7L 1X5AA 3HPJA 1DBBH 3P73B 3V0WL 1MCBA 1XGQA 5TH2B 4JHWL 2R9HC 3ARED 3TZVA 1LO0L 3WIFA 1MAMH 3C60D 4N5UA 1ZVSB 1NFDB 3VXUE 4M48L 4JHBA 3ZDYF 5JORB 4PJEF 3U6RB 5DR5H 1B0RB 3SDAB 4XWOD 5HPMB 4C4KO 3ORJA 5F9DC 3O4OB 4NJ9L 2GJ6E 4KZEH 1Y6KR 3SO5A 3BKJH 2XI9A 2Z93A 4ALAH 2XWTB 1UA6H 1FL5B 3MLRL 4G42B 4UMGA 4PRIB 4ONHA 4P23A 3RU8H 2H9GB 3I3BA 2YWZA 4ORGB 2GSGB 1MVUB 1GOGA 3SDXA 4H0GA 5IVXE 4ZAKC 1BQLH 1KGCD 4QRPB 5GHWL 4EI5D 2LQRA 4O00A 1EXUA 5IR1B 3G5VA 4IRZH 5CWSB 4Z5RB 3LKOA 4OZHE 5AYUH 4DQOL 1SYVB 3TVMC 3MLXL 4PP2B 4WI6A 5ACZA 3ULVL 3LKNB 4P2OB 2WBJA 4NM4L 4XCFL 1NFDE 2AJ3A 4QHNB 4LBEB 5EG6C 3TT3L 1P6AB 4O58H 1C8PA 1E6JH 3G6JB 3V6FB 4WWKA 2VLKE 4NNXA 2IFGA 5KVMC 4YXLH 5I8CA 4JGUA 1I3RB 3TVMD 4XAWL 3PGCA 4JANA 5TQ2L 3WJJA 2R2BA 6FABL 1ZHLA 2A0LC 1SEBA 2C1OA 1IGML 3FO0H 3GSWA 5GRYA 3QUKB 5HHOE 3P4MA 3EIFA 5T5FH 1TJHL 1MWAA 4MXQD 1RUAH 3OAZK 1AQKH 2AJ3B 5F9WC 2O5YH 3ARSA 5BCAA 1NMCB 5DO2C 2PCPA 1MCOL 1U93B 5ADPH 4AY0A 2EDWA 5GJSH 2VDNL 3SE3A 1X5GA 4NO0D 1B9ZA 4J3VA 5C8JB 3QFJE 3VXOB 4OLVL 3SOBL 1A02N 5IT2L 5CP7B 3FB8A 5JA8B 3ZT5A 5D7IF 3ULUH 4TSBL 2LAGB 3OKKB 3QG6B 3QIUB 4CDGC 4Z78A 4L1HA 1GC1L 1R0AH 4HC1L 1XF3B 4PJEE 1LDPL 2X89A 4DVRL 4P2CG 3UJIH 2X10A 4OLXH 5F7EL 1IC4H 1L6ZA 3CLFH 1D5MB 1UJ3A 1AGBA 2ZUVA 1KXTB 4PJCF 5FUCC 1BD2A 1UM6H 2ITDB 5IVOA 2WBJC 3O6MH 2DQDH 3BJLA 2GTZB 4UBDD 1TVBA 3RY6A 4HUMB 4UT7L 4L8BB 4MQ7A 1XIWC 5D1XD 3TN0D 4KJPC 4MB3A 4Z78B 5BRZB 1T6VN 2NCMA 4U1KA 3MREB 4PREB 5TDNA 1IAIH 2CDEB 2AI0L 1S7XA 1FGVH 2PXYC 4Y19D 4FQPA 4GSDH 1F4XH 3DX7B 5KS9F 1J8KA 5CFHA 3SGDI 3T8XB 2D7NA 3ES6A 4N0CD 2D4DA 4DGYH 1S9YB 4OBRA 4PJ9B 4O2CA 4Y7MA 1W0VA 4WW1A 1A7NL 2QQNH 2VTFA 3D18A 4L4VA 3DARA 4XWGL 1MF2L 2OMNA 3HLAB 3PP3K 3VJ6B 3VXUA 1FAKT 1MFEL 4D9LH 4P9HC 2DI7A 2GKIA 3ARFD 4ZO7A 4JM4L 1JGLL 1XCTB 1X9QA 3JWOH 4PJDB 1U3JA 2BY2A 1YY9C 2AXGB 2B1AL 2WUCL 4LVNC 3RWHA 5H8DA 4JFPA 2OX5A 4NKDA 5GS3A 3TVMA 4QRQB 4JN1H 1QD0A 1GGIL 1Q9KB 2X9YA 4NP4H 3GMPA 1IGTB 4FQXC 5L8KB 4X9GA 2BJML 2Q8AH 5D4QA 4LRIC 2Q6WB 3QQ4B 1SVZA 2UWEB 3QCVH 3BUTA 3WLWD 2M1KA 5DUPL 2EYRA 3QUXA 3JVGC 5LBSL 3QIWD 4LGPB 1MIMH 5EH1A 1U8OB 4F58H 1JGEB 1M1SA 1VGKA 3P4OB 4GRWH 5HYSG 3HC0A 4JY4B 4XT1C 2EE6A 3ARDC 1KPRA 1N7ML 1NUFA 2AJZB 1S9YA 1GGCL 1QP1A 4OGYH 5D1QA 4JFDE 1KOAA 4NC0B 1J1PH 2L7JA 2P8MB 1W8OA 4QO1A 5DK2A 4GSDL 3SDDD 2HKHH 2XKNB 1JGVH 3L5WA 3O2VL 3MRPA 4ZS7H 4RWHA 4OB5H 3DGCR 1BQUA 3MREA 5EU6D 4LSTL 1II4E 5CLTA 1LGVA 3RA7L 1KB5H 2V9TA 4HFWB 4IRSC 2NXZC 4J7RA 3DI3B 1D9KD 1UCBH 1BQSA 3GIZL 1MLCB 3ARRA 1M7DA 3HKFA 4O58L 4U6TA 5EIIA 3RDTB 1HI6A 2J8HA 1FIEA 5LAXA 3UJIL 4LF3B 2X4PB 2DTMH 4MNGA 5CD5D 4XXCC 5LWYL 4IRZL 4QHUA 4ZNEE 3ZZ1A 4TSBH 5KVDH 1OP3K 3SDCD 4H26A 3KPNB 3CX2A 4ZNEA 5L2JB 1LNUB 3KPTA 1BHGA 1U41A 4JGJA 3WIHL 5JDSB 2F15A 4KJWD 3ZKSD 1Q9LA 2WIMA 1UXWA 3NIFF 4P2OC 1MJ8H 2WLYA 3KHQA 5E94A 2PCPB 3O3EA 2HJFB 1AR1D 3MRDA 4E0RB 1L9NA 4HWUA 3E0GA 4XBGB 4PJ5E 5FM8A 1U8NB 1CGYA 2PO6C 2YPKB 2AJXH 3NA9H 3NGBB 4XHJC 2NY5H 4XC1H 3RGHA 4TTGA 4L5FH 1WBZB 4K94C 3BDXA 4JHWH 2IPUG 4V1DB 2HFGL 4KWUA 2PYEE 2SEBA 3P9LA 4HKXB 3TN0C 4CADA 3C5ZA 4HCRA 4F9PA 2NX5A 3C8DA 1YEKH 4TULH 5E2VH 1T2QH 3U7YL 4L3CB 5F21B 4FXKA 2BMKA 5I66A 1G7MB 4KUCD 5GS1A 3D3VD 4PJDA 4I3SH 2XV6B 3MXVH 5SWZB 4M7LH 5C2BH 5F9WB 4OF8A 1WBYB 3QZWA 3FT2B 3WHXB 1MI5B 4WHDA 5J1AB 5GGRY 4OTXL 4WI3A 2ZUWA 3QWRA 4G8GB 4Y0GA 3N9GH 1PX4A 4D3CL 4LEOA 1UQSA 4IMLB 1NCDL 4RAVA 3BD5A 1ZK9A 3VFMA 1OVZA 4HF5L 4GG6E 5FM5O 2HJKA 4O51B 1HXYB 3MLWH 2ATPA 4J3WA 2ATKA 2VZOA 1KEMH 3O3AB 5JXEC 4ZFZA 5FO9B 1KLUB 1FGNL 2W60A 3HB3D 1I8KB 4LLMB 3SEPA 5KN5B 8FABA 2GIYA 4G42A 3ZL4H 5JHLH 5HHXL 2CKBL 3KPRD 3ARDA 1NEZB 2FO4A 4AENB 1TVBB 1ZLWH 1NKRA 3OKEA 4Z7VB 4XC3L 5F6IC 1N5AB 3CAFA 1FSKB 4H8WH 2Q7YA 4K2UH 4LHUB 5JHLL 3WXWH 3HB3C 4UV4H 3S36H 3FO2A 4QCIA 1U8MA 3E6FA 4UAOC 4ZOCA 3WDIA 3DYOA 3Q6FA 1N6QH 4PB9L 2P47B 3S96B 1W72A 3TPUA 1Z9MA 2EZ0D 3D85D 4OCSH 5C0DA 2WUBL 4PY7B 2AABH 3SQBA 2VN7A 3MACL 4TNWK 4BQ9A 3V5KB 3WV0A 2HVKA 3MTRA 2K9UA 4FTVE 4YHZL 1LK2A 4L8DB 2H1PL 1DQML 5ID0B 4K8RH 2VQ1A 2R29H 3P30H 2ED8A 5A40E 3GGWA 3FT4B 1HHGA 2OK0L 3DGGA 1FRGH 3MOBH 3CSYB 5EC1B 3CMOL 2DBLL 5JW4R 1HINL 3DO3A 4GAGL 3OJDA 4UTBH 5E2VL 4UINH 3MRJA 1EA9C 5T5NF 4XI5D 1TZIA 2VDQH 2IAMA 1XR9A 5J4MA 2FNBA 1T5XB 3PJSB 1CD9B 4JFOB 3RUGF 1FFPA 1WZ1L 3JWDH 4PRPD 5D7SH 3RWCB 2CKNA 2UYLA 3ZSSA 4YK4B 5IMOB 1E4WL 3GMLA 4LPXA 3MYZA 5IB4B 1FYTB 3NCEB 2R2BB 4FZ8H 2Y5TA 5C3LD 1GCFA 3UZVB 1YNLH 2X4NA 2QQLL 5IBLD 2VUOA 3L6FB 2NY3D 3LRHA 2OSLB 1RUQL 3O4LE 2JB5L 3GJFH 5AZ2L 4O2EB 2DM2A 3WIHH 2PETA 3QEHB 1UVQA 3PGFH 3QQ9C 1GIGL 2OL3L 1T04A 3W0WA 5BW7A 1T03H 4HWBA 1AO7A 1YEDA 3HE6A 3EO0A 4LVHC 1KIUA 3B9AA 3TF7C 2YRPA 3MUY1 4MS8C 4ZO9A 5T1MB 1A6ZB 1KB9K 5I1EL 5C0BD 1EUUA 4LCIL 3QDME 2VH5H 1VENA 3TNMB 1DQTA 2CDGA 3ARGA 2GT9B 3RJQB 4S1DC 4OZIE 1CBVL 4GS7C 1T6WA 3G6DH 3MRLB 3OPZH 3FN3A 1OAKL 4NHCH 1T7YA 3O9WD 4OCNC 3TBYB 4D0CB 3JV0A 4KTEH 3GK8L 3TESA 3VXPB 4L8CA 1QSFD 1RHFA 3SE4C 3QIBC 5IB3A 1T5WB 2YSSB 4J4PD 1CGSH 1CL7I 1Y0LA 2R8SL 1OT2A 2BVPB 1PEWA 1FP5A 1EUTA 4N0RA 3RZWA 3D9AH 1FNSH 4AM0B 3FT3A 3UJJL 3RWIA 5I8OH 1NBVL 5HHMB 1EHXA 1K6QL 1CFQB 3QDMB 3RJDA 3AREC 4LCUA 1H3VA 5C07B 1A6VL 3EUUA 1RZ8A 5D2LB 2P24B 3LN5B 3OG6B 3IKCA 5HI5D 4CVWA 4U1NB 4GW1B 4I8DA 4AEIL 1R5IA 1X5LA 2J2ZA 2Y5EA 4M7ZB 1GIGH 4PRHA 4YHIB 4QRUA 3S36X 4NQEB 3SKJL 3L3IA 4U6XA 4I4WB 4U1NA 4Z77B 5I1KL 4ZTPH 2KH2B 4PJAF 1ADQH 5K9OA 4HPYH 1CG9B 2F53A 2F8OA 2FJHB 1CE1L 1SJVA 1BF2A 5K9QI 4WW2C 3IDNB 1CL7L 4K3DL 2OP4H 2VIRB 4Z95H 3ULVF 3IDMB 3BZFB 3L3KB 3W11C 1JGDB 1Z0MA 3U1SL 1IFHH 2C26A 1FO0H 3QFDA 3FO2B 4QCIB 3HTLX 3N85L 4Y4FC 3L5IA 4E41D 5HHOB 3BO8B 4MDJB 1T80A 1Z5LA 2AEQL 2O5ZH 5MENB 2OCFD 4WHYH 3RHWF 2FCBA 1GPOL 2COQA 5H35A 3VFGH 2B2XL 1OSZA 4G8EA 3D6GA 1LEKB 2CKBA 5IM7A 1JCKA 4OKVA 1OSPH 4R96B 1CLCA 1CTOA 1Q1JH 4U1JB 2X1QA 3O3AA 3MV8A 2DD8L 5CEXA 1ZA6B 4LCIH 3IDIA 4JPKL 5FYJL 3T77B 3OAUL 2CUHA 3FRPG 1RK1B 2CLRA 1I7RB 3RZCB 1HKLL 5DJ0B 3DX8B 3PHSA 2UZIL 1F2XK 2QR0A 3SPVB 3LDBC 5FO7B 5GGVH 3B2UD 1RZKL 5AG8A 4YFLF 2A6IB 3L3JB 3T2NH 1MI5A 5JQHC 5IM7B 4JR9L 4M62L 3BMVA 5FDWB 3RKDC 3WXWL 4GXVL 4KQ4L 4UNTA 1NFIB 4JN2A 4LPUA 4LLUB 3T0EC 2FX9L 1J86A 3BH8B 5F7NC 3HMXH 5DK0B 5I18H 3O3DA 4JFHD 3R8QA 5MENA 1F02I 3KPLA 3BPCB 4PJ5A 2VNCA 2CRYA 2J3SA 3QA3B 1JGDA 2Y7QA 3CXHK 4KTYA 5B8CA 4IOFD 2FEEL 4N0CC 3FJTA 2P5EE 1EEUA 3TCLB 3QCTL 1G9MC 4LASH 3U0TA 4HXAL 1AXIB 2XRAL 4OT1H 5EFIA 3Q1SL 4MAYD 5IROA 4FFZL 2V5TA 1RZJC 4GAYB 5C0BA 5DURD 3OKLA 1QZ1A 4RA0C 4A2LA 2R2EB 5T1DL 2BNQD 3AROA 1KPVB 3KNBB 4G6MH 4K7FB 5EBWB 1ZAGA 1MPAH 3R8BB 3IRZA 4MLIA 4UIMB 1J1XL 1KG0A 4NZUL 2I27N 5JO5A 4M7JL 3ULVE 2A9NL 5CMAA 1IMHC 3MV9E 3STZA 3BIKA 3BQUA 3FO9B 4I5BB 2F53D 4X9IA 4DN4H 4KI1A 4P9HL 4S0SD 4Y4HC 1WFOA 4N0FA 3MV7D 4JDVB 4K3JH 3WN5A 4M7JH 5I74C 4MJ5B 2P5EB 2O5XH 3BPOB 3VWJC 4MDIB 2DYPD 4MJIA 1N6UA 4HS8H 3M17B 4UV4L 5I2IA 1A3LH 4PJFA 1PZUB 5C0CB 2HA1A 1QVOB 1BVLA 1UB5B 4ZODA 1SJEA 4BK4A 5C09A 1QLFB 4XMLH 3TN0A 4LRNH 3KLAA 2O26U 4JN2B 3DVNA 1K5NA 3MNVA 4OZGE 1X3DA 2FIKB 4OQTA 3RIFK 3VI4F 3SN6N 4OZFG 1A1NB 4MSWB 4HGWB 3STLB 4FXGA 4NN6C 4NZTH 3H9SB 4NRYA 4ALAL 4MNQA 4XCYB 2XA8L 4G9DA 3FCTB 4P2QE 5GGTH 2AJZA 4PGJA 1IM9A 4G8GA 1BMGA 4GBXA 3I3DA 4GXVH 1QRND 4OTXH 1YJDC 3FB7B 2IQ9H 3WE6A 1FNFA 5LQBL 4JFZL 1K9TA 1JPGA 3GIZH 1W0YT 1OY3B 4WTXA 1FL3B 2AERT 1RD6A 4F3FA 5CEZL 3ULUD 2VO5A 3MJ7B 5I73C 2XTJC 2EXYD 3V4UL 3QNXB 5T3ZD 4Y4KA 5DRNA 1J88A 1UC6A 1KCRL 3P9LB 2OTWB 3MBXH 1HXMB 4J23A 5E8PB 4M7ZC 3RWHB 2VKWA 2J8UA 4OUUA 3RWCA 3VGGA 3PWNB 3U9PL 3PL6B 4NO3A 1S9VB 3QXAA 4ELMA 2CJUL 4QXUH 2YA1A 1J1PL 3DVGB 3GB7A 3SGEH 2YEZB 3B9EA 4FQJL 1N7MH 3OXSB 3D18B 2D7OA 1DLHA 5K59F 4APQD 1JRHH 5CZKA 3R0NA 1A7RH 1MCSA 1CGVA 5HHPA 2CUMA 4Z7QF 1A4KA 4E41E 1LK2B 4BKLB 5EO0A 3VMPA 2XG4A 1T89A 4FN0A 1C5DA 2QADB 3D25A 4Z95L 4AEHL 2CLVA 2R0LH 4GRMA 4OCYH 5JIPA 1INEL 1YYLL 4RAUA 1R3HA 4YHKH 5MEND 1ZHKA 4OF0A 4OFYD 1ADQL 4TSCH 3Q2CA 2OYPA 3KWWB 3ULVC 4NGHL 5DJ8B 3Q6GL 4ZUSA 3RL1A 3DIFB 4WI2A 3HHRB 4ERSH 1YJDH 3HZMA 1I1FB 4JVWA 2BVPA 3B9VA 2Q7YB 2GW5A 3VI4E 4XXDB 3MNWB 2LU3A 4LEXL 4X4YA 4X6EA 2EDLA 4YR6A 4M6OH 4A2MA 3LDBB 3WFBH 4KY1L 3O6FB 4LSTH 3KPMA 2BNQE 3G08A 2GJZA 5C0ND 3RRQA 3VWKC 5FV2A 1Q0XH 4EJ1C 1RJLA 2HJKB 4OQTL 1MI5E 5JW3H 1FDLL 3WIIL 4CMMB 5EZLB 2FLRT 4H20L 5MP6H 1ZV5A 3HE6C 3CXDH 5HGBA 4J3SA 5TFSH 3O45B 1YMME 3A6BH 4ODUA 3DUUA 4S10A 1M7XA 4Q9CA 1BP3B 5E8EB 3P9MA 4P2RE 1YJDL 1XCQB 3IXTA 5KSVA 4JGMA 1I8IB 3VXQA 1KCSL 3MV8E 5DZOA 1I1YA 5ADOL 5GGQL 2Y07L 3WL9A 5DRWB 4YDKH 2OSLA 4MD4A 4P46B 4TNVF 2BJMH 3VFSB 4MA8H 4TPRH 3IS1X 2Y5TB 5B4MC 1F00I 4NQDA 4IDJL 3EDJA 1R0AL 5I30H 3SE4A 2DOCA 4E42A 5C08D 2B1AH 2DLTA 1UENA 4WGVB 3FONB 1T03L 1I9JH 2Z8VC 4M1GL 3FFDB 3PWPA 2CIKA 4KK8C 4KI5E 3SKMA 3UBXA 3GKZA 1DSFH 3VXSE 3VJ6A 3G6JA 5HYJD 1MCHA 1XCQA 4Z7QE 3MZGB 3MMEA 1QRKA 4QHNA 5E08L 3NFPB 2YOCA 4KQ3L 3B8YA 1AHWB 5ACZB 2FECI 2F5BL 4U1SA 1D5IL 1AQKL 3FQRB 4NKIL 2IJ0C 3MRMB 3UTTB 1QRNA 1T1XB 1KACB 3IFOA 2P5WA 4XNQB 3CH1B 1ORSB 3MBEC 2AI0H 1K4CA 1U3ZA 3UXFA 2HVKB 3MNZA 3ARBA 2XWBA 4C56A 3KLSA 5TDNB 5FK9A 5E56A 3BFOA 1FL5A 3KPRA 5C0JB 4U6YB 3QULA 3BE1H 1FYTD 1QPXA 1JNLL 3CMOH 2ZSVB 1YECL 2BFVH 3IVKB 2X1XR 3EOAB 4JJHA 2GAZB 4K8RL 1LO3H 1WCQA 4MA7H 5C7XL 2V6HA 4U3CA 4AQOA 1IL1B 1N6VA 1E4XI 5CSZB 4S1RH 3VE0A 3OGCB 4YHZH 4KKCC 2FD6H 3RKPA 5TH2A 5D72L 3MQIA 1L7IL 4P3DB 3D85A 3I9GL 1FYTE 4LGRB 4UDUA 2HTLD 5DUBA 2AJVH 1DDHB 1U3HA 1FPTL 2UZXB 5FYLE 1CT8A 3IFNH 1JNNL 4X0KA 2CXKA 4UT9H 3GRWA 3GO1L 4CNIB 1ORSA 3ARYA 3CFCL 3KJ6H 2AV7B 4KPHL 1NMBL 4FFVD 3MXWH 4LVOC 3V7AE 5BXFA 4AH2A 4PR5A 4JB9H 1LEIA 1DLHB 4BSWA 3TFKD 4XPTL 1FLTX 3NFPA 4JAMA 1AGEB 1FQ9C 4HWZA 3NTCH 3QFJA 4X8JB 3GFUA 3MRHB 4PRPA 3GI9H 5E6IB 4IMKC 3T2NL 3FOLA 3U36B 4B50A 3VU2A 4MYWB 4ETYA 1FZJB 2IC2A 3EOBB 3DROB 2IEPA 2UZIH 3R1GL 1Q9KA 4ZFGH 1F4WL 2X1WL 3GIVB 4L9LA 3EYUL 3OB0H 2ZCKH 3V95A 4RFNB 3PL6C 1OGTB 3VFSA 5DRWA 4F3FB 1JTTA 2OXHA 3C6LC 1CE6A 4H1LA 2QSCL 1RULL 3KS0J 4NNPL 3LKRB 3H7BA 4EZMA 3R0MA 1IBGH 3OHXA 4QWWC 2EXWD 5IV2B 1OARH 1UM5H 5BXFB 4KKBD 1EIBA 1B3JA 3S34H 5GXBB 1I1CA 4U1HB 4X7DC 2NPLX 3H8NA 2EE3A 4MXWL 3QUMH 5ITBL 2C3XA 4U4BA 2X7LA 5B3JF 4ZYKB 3NFSH 3S9DB 5IGXL 4MWFB 3JVGA 5EUOA 1A5FH 3PE9A 3HG1E 4X6EB 4NQDD 4OV5B 2P1YA 1U8JA 4PBXA 4QHMA 1RHHB 2AK1L 4UB0L 3U46A 3PWPD 3ARBC 3C60A 3EO9L 2KL6A 3ZSTA 4LHUD 3KLHD 3M17A 4KK6D 1V3KA 5AG9A 3HZYB 3C9NA 1CICB 1PG7H 4FQ1L 4MJ5A 4TYUA 2JJSA 5ESAB 1T1YB 2VDRL 4FMKA 5ICXB 4FABH 3O2DH 5GS0H 3W5NA 3TA3C 1B6UA 2P44B 2B0SH 4Y5XB 1T2JA 4FTVD 2Y25A 4HGMA 1S7TA 3BP7B 1A7PL 1A6WL 2PW2B 4KJYB 3I84A 3QNYA 3GSUA 3QDGA 4HWBL 2XKNA 2IG2L 1Z6JT 2V7NA 1LE9A 4R97C 2A77L 5JO5B 3MC0A 1CFVH 4PRHD 2J8UF 5C8JA 3QJHA 1MCWW 1QTYT 1GHFH 3V6OC 3BPLB 1C5CL 2KQMA 5EU6A 4PLNC 3ULUF 3QDHA 2V2WA 4C57C 1U93A 4OLWL 4I9WE 1SY6L 3VGAB 4AG4H 2HLFC 3LEYH 3VXTB 2DMKA 4JPVL 1U3HC 2EEBA 1NJ9B 1YYMH 3LS4L 1RFDH 5IFHH 2JCCF 5D7LA 5ITFA 4NHCL 1IFHL 4I2XB 5B8CB 5GGRB 3RVTD 1AI1L 1LP9E 1RJYA 1UM4H 3UBXI 4LKCA 4I48B 1Q38A 2FSEA 5BMFL 5DK3A 2A74B 3T4YB 1CFNB 2BNRD 3VDAA 1JF1B 2YBRB 3V7MA 5GJTH 2WLZA 3JUZA 1DN2A 4F7TA 3O2WL 3KR3L 2XZCL 4AEIH 1KNOB 1NC4A 3L9RA 1U6AL 4GBXB 1BREA 1WITA 2XNAA 2IH3B 1VFAB 3MV9B 4PJ9A 2B5IB 3RPIB 1R5WB 3KPRE 5JNYA 4FQ2H 5GSVB 1JHLH 2YS4A 4K8RC 3SDXB 5LJYH 5BJTB 1CLZH 1E4WH 3QIWB 5EWIL 5FFLA 1TPXC 1GGUA 5EZJA 3RZCC 3A67L 4R4BA 4JQVA 3O6FA 2C7UA 2F19H 4N9GA 4XNXH 2DKMA 5JIKA 3O3UN 1K8DA 1TVHA 3PWUA 1B0WA 1OTSD 2MQ3A 2VISA 3BKML 1IC5H 3X13B 4PJHE 3LEYL 4P3DA 2WIIA 3X3FH 3IJSB 1T1ZB 4HWEL 2ITDA 4ACPA 1LD9B 3S4SA 1ZVSA 1J87A 1AQDA 3HZMB 2D0FA 1O0VA 4RMWA 4P5TA 4KROD 1QFUH 2BSRA 5GZOD 3HPJB 2X40A 1BQHB 2EDHA 1ZLSH 4GG8A 3EO1A 2NQCA 1QFWL 4KKBC 5I1EH 5C6TL 1F4WH 3UO1L 4N1CA 3WFEH 3IAGC 1PQZA 1IC7L 5KSUB 4OV6F 1N6QL 2XPGB 2ZUSA 2DTSA 1NAMH 3SDDB 4P5MB 4OGXH 2A1WL 12E8H 3BZ4A 2X4QA 2AK1H 1RIVH 5FYKL 1KPVA 2E7MA 4DVRH 4LAQL 2J6EA 4OCLC 5KSBE 1AGFA 5DFWH 3X14A 4FQQA 4UAOB 4OCWH 3MXWL 5JOPD 2E9BA 4HXBL 4RX4D 3DHMA 4CMHC 2QHRH 1MCNA 5D7LD 2IH1A 5ITBH 4N8CH 1BFSA 2HWZH 4M8QB 4A6YA 1QSZA 1MWAH 3BPCA 3D39E 4PJ5B 5I74B 4DGVL 3KXFB 4RWYH 3TIEB 3ULSA 3DUHA 1MCCA 1M71B 3O8XD 3MLYL 5ECJE 4M3JA 2Z31C 4M3KB 4RIRA 4LU5L 4Z0XA 1C12A 3V4PH 1QPPA 4ZD3H 4YDJA 3UYOD 1XEDA 4KDTA 4H5SA 1DBMH 3TJHC 2J1KA 3MRLA 5FCUL 2C3HA 3EFDH 2P7TA 4B41A 4XMKH 1AP2A 3QQ9D 4J3XA 4X7TB 4NFDA 1HHKA 4MXVE 3CFBA 2X1OA 4MHHI 2EH8L 4OD2A 1A1NA 1REIA 3MV8B 3UC0L 5CEXB 4P23B 2HWZL 3GMMA 3X3GH 4G43B 3U83A 3DPBA 3QG7H 3QIBD 3GMRB 1J9CT 1MAKA 2R0ZH 3GI9L 4X6DA 1DQLL 1ZLVK 4XCEA 3SE8L 2EDEA 3TO2B 1Y18B 2R9HD 4XX1E 3VW3L 3H7LA 3NN8A 4HT1L 4FXLA 5GSRB 1A21A 3TN0B 2FBJL 2FRGP 4IOSD 1FIGL 5HD8D 4M1CC 4W4OA 1QVOA 3T3MF 3DMMB 2VL5A 3L95B 4CN6A 3HNTL 3CFKB 1HZHL 4BUGA 4JO2L 4V1DE 5CHNA 2IH1B 4HF5H 5I76A 3LB6C 4DCQA 5I30L 5C0RL 1CZ8H 4HFUH 4KZEL 4ZUUB 1QBLL 3STZB 3N9GL 2F53B 4G6FD 4TTDD 5T1KA 5T3ZH 2YR3A 4Z0BL 3MRFB 5EO0B 1G1CA 3QR2A 1KYOK 1NUNB 1LMKA 4ZPVA 1J5OH 3L3DA 3BP4B 4PRHB 1BVKB 4YHIA 1TZGL 4IJ3C 3WBDA 4I3SL 1XH3A 3JWNC 2Z31A 1BM3H 2EXWC 2BFVL 5E5RB 1RIUH 2I26N 3FFCA 4QHLA 5IEHB 4FTVB 1EEYB 1XR8B 1DEEB 4KJQC 1RI8A 1VACB 3KPQB 2Z8SA 3QDMD 4LCUB 4UV7H 1Y6NR 1WAAA 1NL0H 1PDKA 5CHNB 3AREB 2FJGA 1HXMA 3HUJF 5CGYD 3HC3H 5A2FA 4H8WC 4KRNA 1A0QH 3WJLC 1KPUB 2YC1B 3KPLB 1QA9A 3S8WA 5JR1L 3QO1B 4WFGE 4F37F 1WBXB 4EUPH 4CN4A 1CLYL 4QYOA 4XVJH 2DQJL 5DJAA 3IF1B 3FN0L 1J1OH 4ZNCD 1CVRA 1D9KC 43C9A 4ODXA 1TNMA 5GS0C 2Y4SA 5E4IA 4F9PC 1IM9B 3SPVA 4FQLL 5HGDA 4QRTB 4YO0A 1EO7A 4CJ1A 2VN4A 5E8OB 1IGIH 3LIZL 4HS6A 1F3JB 3FZUC 3ZDXE 4JM2F 1UM4L 2GK0B 1YEDB 3HE6B 3IDYB 1EHNA 4OGAC 4H5SB 4XVSL 2F9BT 1F11B 1JL8A 1OSZB 4R0LA 5L9DL 4QYOB 4YDIL 1LEGA 2ITCB 1AGCB 3QIUC 4RSVA 5J06A 1PX3A 5H35B 3L6FA 1I4FB 3CXDL 3CFDA 2GJ6B 4RGOL 2RFXB 2CR6A 2LVCA 2X6MA 4YFEA 3QSKB 2EKSA 3NIDE 4U6HA 4Q9RL 3PWJB 3BX7C 1G7JB 4Y5YC 5L8JB 2BX5A 1FFRA 1YDPA 4PJBF 4FQQB 3O2DL 3OKMA 4OI7A 3V6OE 1A6TA 5IUSA 3MO1A 4FRWA 3LQZB 4X7FC 1F58L 4N0UA 3RWJA 5DUMH 1H3UA 1T0MB 1PKQA 4RFOH 4HQQL 4CBPA 1XGPA 3OAYK 2MQ0A 3D2UB 1F4AA 4X5WB 1OF2B 2KZ1B 4GW1A 4HUUB 4N0UB 3EYVB 4PJ8C 4KGJA 3HG1B 3OG4B 3LN5A 3V5KA 5FDYA 4H25A 4NP4L 3DV4A 3QXDA 5B8CC 4RBPH 5BZWB 1VPOL 3AFLA 4H0IA 1RUKL 2HTKD 4AT6B 3UPRA 4PBVC 5JPNA 5IT2H 3ZYOA 1HYSD 1CFTB 4WFED 3TO4A 3K4DA 4YHYB 1MFCH 4WU5B 3WSQH 5CEZE 4XBPB 3MLZL 4LNVA 3GSRA 2NW2B 4HBCL 1SMAA 4OLUL 5CIPH 4UUJA 2EDJA 3TBTB 4KK5D 5DHYB 1MJ7H 4YEEA 1EFXD 1YEHL 4R2GB 5CUSL 4L29B 4N68A 4C54A 1A9BA 3C6SB 1HYSC 2ERJC 5TQ0L 4AMKL 5HYQA 1OD7A 2IGFL 4IS6B 3BPOC 4NKMA 5BO1L 2YZ1A 2X7LB 2YD3A 5F89A 5BV7C 3MA7A 4YFLI 1ACZA 3LHPH 5EU4A 3WN5C 1DBAH 4RQQB 3NZHL 1T0NA 1AFVL 3FO0L 4CU8A 3TV3L 1HHIA 2VDKL 1JPSL 5MEQB 3T77A 3IETA 3RNQB 4UQ3A 3U0WL 4YNYA 1AO7B 4Q6IC 2IFFH 2R0KH 5BW7C 3RUGA 2AGJH 3RY4A 5DHVH 3B3IA 3V0AC 5FO8A 3DUSB 3CLFL 5SWZD 1RPQA 2XY1A 1KIQB 3BP6A 5D1ZD 3NZ8A 2NYYC 5FA4A 1QSFA 3NIDF 5JLZA 4HAFA 2J88L 2DLHA 1MNUH 2BMKB 2A73A 1INQA 2XQYG 1MELA 2V5MA 2IPTH 2FECL 4LKCB 4XAKE 4M8QA 4P46D 5INDB 4PGEB 5JOFA 2ZNWA 2X09A 4G8IA 2ZOKA 4Z7WB 4RGNB 2DMCA 1JN6B 4PYGA 5B39G 4M4RA 2NNAB 3WNMA 1KJ2H 2EIZA 3O6KL 2BCKB 4LSSL 2IPTL 5HXMA 2VXSL 1CLOL 3BKCH 1AC0A 1FNGA 3T2OA 2D7QA 1EGJL 4Y1AE 4YPJA 1N2RA 1W0VB 4KV5F 1KCUL 5D72H 2X4SB 1GGYA 4RCAA 2VZSA 4HK0A 4NZJA 4XBEL 1BZ7B 4L8DA 4PY8I 1XF4A 4OZIA 2O5XL 2VE6B 3CVHB 1DBBL 5L2JA 1PQZB 3CVIL 3VD4A 2WBWB 4U1KB 5HYIA 2DAVA 3FMGH 2GUOB 4JO4L 1WLHA 1N4XL 5C0DB 2NR6D 5B38A 5DEGB 2YWYA 4MQ7B 4ISVA 2R0WL 1UWXH 3Q3GA 5DJ6A 5T1LD 4IRJC 4ZTOH 3PGDA 4I18A 5IFAL 1DJSA 1L0YA 4WEUD 3U0PA 2EYSA 4ZO6A 4ENED 3LMJH 3ARZA 3TT3H 2ZCLH 5EU7C 1KCLA 3DV6A 2QQKH 3GJEA 2W0PA 5A2IH 2P42B 4DZ8A 5BS0A 5MEOA 3DURA 4QHMB 3X3FL 1ITBB 1IC1A 1T89C 3TPKA 4OT1L 1KT2A 4L3ED 1TDQA 1S7QA 3KPRB 3VXRE 1BQLL 2FGZA 2WV3A 3T0BA 3LEVH 5DGRA 1AD0B 2W60B 4LLMA 2VRAA 3QPXL 4XXCA 4DGIL 1D5BA 5E5MB 4YZFF 3QXUA 1KENL 4I77L 4WHTB 5FOJA 3KHOA 5KOMC 3REVA 4TQEH 1EFQA 1AP2B 3MR9B 3NAAH 4P0DA 3CX5K 1TETH 4O4YL 3GMNB 1QR1A 1NC4B 1JK8B 1AC6A 5GGQH 4Y8AA 12E8L 32C2A 2CO6B 3QH3A 3D48R 2BSED 5DVKA 3SDXE 1MI5D 3C08L 3PL6D 2FYYA 2QHLA 3S5LB 3QUXB 2JJTA 4H1LB 4XVTH 5HYSA 2UWEE 2RHEA 2K7PA 4XPGL 3D3VB 1AIFA 1DR9A 3MZTA 5BVPL 5FKPA 4UDTB 3LQAH 3GI8L 3TIEA 3ULSB 1WV7T 2ARJA 4HKXA 4U31A 4A6YB 4WWID 5DC0A 5FGCE 3WIIH 4JZNA 1BLNA 4XNMA 4BQBA 5BZDA 3DMMC 1U8QB 4OIBA 2W9DH 4F7CA 5I8EA 1XCTA 4L8SB 4Q74A 1OT1A 4RGMB 4O9HL 5C0CE 3F65A 2IAMB 3HR5A 3VH8A 1T21A 3CCHA 1ADQA 4HWEH 1NFKA 1ZS8B 4XH2B 4BQCA 2DQIH 1F5WA 2A6JB 5FUCE 4PJ9D 2VAJA 3WFDL 4OLWH 3ZT6A 2N7BA 4JZJA 1DQQA 3JSSA 3A67H 3SDDA 3D3VE 4O02H 1A47A 3AB0B 1FO0A 1NCUA 1CT8B 4NQTA 1RJZA 1ZT4A 4NDMA 1QKZH 4NYLB 3GBMH 3GHBL 5DA4A 1DP0A 4BFIA 5MEPA 1CQYA 2YD9A 3PWVB 4LF3A 4M5ZH 1XF2B 4S2SA 5JXAH 4ZTPL 2XIDA 4FQ1H 5CEYA 4JKWA 1BD2B 3OGCA 1NDGA 2A9ML 4MAYC 5GGUA 3H9HB 4NWUL 4PGDA 5GJTL 2OXGA 5B39B 3ZKQD 4U1LA 5JXAL 1H15A 1E4JA 3WUWB 3KWWA 2NY1B 5DJ6B 2HMIC 3U4BH 1YNLL 3U4AA 1Q94A 5LG1A 1W0WB 2BVEA 4NUGH 5JIHA 5K9JH 4MS8D 3TYFA 4FFWD 4MWFA 4PUBL 4FZ8L 4G9FA 4GKZB 1JPFA 3EDKA 3UCRA 3ARBB 3ARVA 3MNZB 4ETQA 1FORH 2H2SD 2WWMD 2YRZA 4PJ7E 2E7HA 4S1DD 3WD5H 3FQNB 2ED9A 4LARH 4BH7A 4BKLA 1LO2L 4I0PA 1RFDL 3VRJA 4LPCA 1I1AB 1EAJA 5DHXB 4MCYB 1JPTH 2ICWB 4R3SA 3P11H 1HEZA 2BSTA 4RISH 5HHVL 5CEZH 1A7BA 1N8ZA 1MWAB 3PDGA 5DD1H 3VGDA 3VH8B 1UWEH 1W2KT 4CRPA 3NIFE 5J1SC 1UZ8B 3TC9A 4W81A 5JPMA 2EYRB 4AIZA 4OUUB 2Q1EA 4G8IB 2Q6WA 5IEKA 2B0SL 1JWUB 3AS3A 4BSVB 5ICZA 1YEFL 4L9LB 4UT6H 4HFUL 1JWUA 2SEBB 4PJ7B 4EBQL 3D3VA 3L1OH 3RNKB 1DN0B 2DM4A 1V7NL 4K71B 4O2FB 5A43C 3WNKA 3N1MC 3EO9H 5GISL 3AB0C 5DRZB 4YBLC 1YMMB 2DWDB 2BSTB 4NNYB 2NLJB 1D3CA 2FIRT 4K7PH 4QRRE 3RZCD 3EGSB 4NQCD 1JF6A 3OX8B 3LKOB 3BISA 3SKNB 5HGBB 3QEGH 1I1AA 1FG9C 5FYKU 5IB2A 2R2HA 4HT1H 5EZLA 5MI0C 4WHTA 5CINL 3QJHB 4N8VB 4CVZA 4BQ6A 1FG2A 4LPVA 1EK3A 1EZVY 4PRID 4WWKD 1NGZB 4NO2B 1U36A 2E7BA 3UJTL 4GKNB 4GQPH 4XCCH 5BRZD 4LRIA 4LCCB 1OCWL 4GAGH 2YUZA 3F5WB 1M7IA 3MNWA 4NHUA 3IDXL 2PTTB 3EYFA 1CK0H 4QXTB 4NCC1 2BVUA 1JZ4A 4PG2C 5EIIB 4EUPG 4RMUA 4O9HH 3QPQC 3P2TA 3U46B 2X05A 5ABDE 4H88H 1RMFH 2IBBA 3MCKB 4XBPA 2BXYA 1MFAH 3K2UH 1RUPH 4X6DE 5BV7L 4J3OC 1HIMH 5D1QC 4C83B 2V5YA 1X5JA 3Q3GB 1ZHNB 4N1HB 1ZHKB 3GI8H 4HWNA 2DS4A 3EYUH 4C59B 4R2GC 2PYFB 3H42H 5I1CL 4ZYKA 3HE7D 5HI4D 3JBG7 4ZOAA 4C56B 5D2NA 5DEFA 4HUUA 3VXOA 5KSAA 1QBMH 4NQED 4CVZB 3DX6B 3MUGA 15C8H 4GUPA 5DHVB 2B4CH 1CICC 3NTCL 2X4TA 3HI1B 4R26H 3RVXC 4HAGA 1KCUH 3QEGL 4L3EB 3MRKA 3SDYH 4KPHH 4HPOL 1HSBA 3LS5H 3ZKXC 1HILB 1PG7W 4JG1L 3Q0HA 5HY9A 2VLMD 5GISH 5D7JC 4XX1G 3JV5A 4JRWA 1ETZB 1H3TA 1VADA 1SQ2N 1TNNA 2NY6C 2OTWA 3ZYIA 4EDXA 4DVBB 4RMVA 3O4OC 5D1XA 2RCSH 2X5PA 3EOBA 4N5ED 2IQAB 1S8DA 1QSFB 1XF1A 3FO1A 4X5XA 1GZPA 4XPBH 2FL5A 2D7TH 1UXSB 2QQKL 2Y07H 4YDKL 5F71A 2ZCLL 1P84K 1I8IA 2FJFA 4N8VG 2ZCHH 3Q5TA 5E95B 5HJ3A 5E8EA 1NQBA 5JW4Q 5SX5H 1AKJB 3RY5A 1OAXL 4BZYA 1IQDB 2X1PA 4LCCC 1I85C 3U0WH 4OD3L 1GL4B 4UQ3B 2Q87A 1UJTA 3QWQB 4YGVB 2C4FT 3FHAA 2H2PC 1E0OB 1MAJA 4MHHG 5DI8A 4YH6A 2CLZA 4AL8L 1IVLA 2BRRH 1IGYA 5FHBL 2BHYA 5DMKA 2FHCA 4PB0L 5IW6A 4W6XB 3O9WA 3KPMB 3PHOB 5GRVK 2VWEC 3B9KC 4LLVB 1TQBC 4KUZL 1S78C 4OZHB 1Q94B 5IW1B 3TBSB 7FABH 1YEHH 1WWBX 2AXFB 4U1LB 3VWKB 3RTQB 3EDEA 2QLVB 4G6JH 1UKTA 4LLAA 1Z5LB 1QA9B 3QIWC 1I1FA 3WO3B 1DSFL 5HHOA 3TIDA 3I75A 2J4WL 2VLKB 3RL1B 1G0XA 1RZGA 4FNLH 2GAZA 1QEWA 4L4TA 4F57H 4WEBH 4I18B 4NGHH 4HIIB 2NW3A 1KFAL 1V3MA 4N0FB 1JWMA 4Y89A 5F70A 1NEZG 5C0JA 1VCAA 4BFIB 4PPTA 2E9WA 3O3BA 3OKKA 1CDBA 2OMBA 5J3HD 5D7JA 1ZT4B 3DSNA 4PG2A 2UUDH 1DEEA 3PP4L 5FV1L 4NQCE 5DC4B 2VDML 2H8PA 3HE7A 4OCYL 4S0TD 4UIKL 4UOJA 5KZCD 1OAQL 4P48A 4NKQB 2CUIA 1AXTL 2DL9A 4MXQC 2XY2A 2R69L 2AJYL 2HYMA 2YPLA 3OSKA 5IFHL 4PJBE 5FGBA 4PJXE 2N7AA 4LGSB 3LZFH 3LQZA 1ZS8A 4I0CC 1PYWA 1F3DH 3DYMA 2Z92B 4JRYD 4P46C 1K2DB 3IU4L 4P3CL 1ZLUH 2EIZB 1C5CH 2XN9A 4ESKA 2HKHL 4QOKA 4Y4HA 5H2BB 3EJZD 3HS0A 3FT3B 3V5HB 3MBXL 4ZQKA 4KY1H 2IGFH 1MRCH 3L95A 3HRPA 1A6WH 1TCRA 5FA3A 2HG5B 3K3QA 5D8JL 4RGOH 3HAEG 3F7VB 3O41A 1Y0LB 4RDQG 3VXRB 1VFMA 3T3PE 4LPYA 4Q2ZB 5DDHB 1LP9B 1PFCA 3UDWA 1NFIA 2AK4D 4WUUB 4XNYL 5KANG 1NGWA 2CIIB 3DUSA 3IT8D 1MFCL 2Z4QA 4X6CF 1ZSDA 4Z7NF 1ZVHA 4ODUB 2IF7A 4XP5H 5TDOB 1TQBB 5FO7A 2IAMC 4IOFC 2MKWA 3QRGL 4HHAB 3BPNB 3BYYA 2Z9TA 5MEQA 4PIRF 2YK1L 2X4UA 1YYLH 1FVEA 1TLKA 4N8PA 5HBBA 5IGXH 2ZPKH 1FVCB 1A3QA 5HGHA 1ZA6A 4YHOL 2H9GA 1AJ7H 5CP3H 43C9B 2AXHA 3MROB 4BZ2H 2VLRD 3AM8A 5K33A 3TBVA 5GJSL 4G6JL 3UMTA 3KLAB 2DBJA 1KTDB 1CFBA 2XFXA 2PYEA 3O8XA 2LV4A 1A22B 3NCYS 2O93L 1TJHH 4NNPH 3QUYB 3TZVB 5F1OB 4Z7OF 2FR4A 2H1PH 4YQXL 3GRWH 4IOIB 3PGDB 5H2BA 2H6PA 5I1LA 4PJXA 4J3UA 4MA1B 3VFRB 5AD0B 2C9AA 1CDHA 4ODWA 4NRXA 1Z9OA 3BRDA 5E9DD 3QUZC 4H25B 4FTVA 1X6NA 4FG6D 2H32H 1F6FB 2Z91A 5DJCB 2QQQA 4XVSH 4KRLB 3FOMB 2ZCHL 2C4FU 2ZUXA 4ZUTA 4DZBA 3C6LD 3CU1A 4ZSOB 1JZ2A 3OKDA 3EZJB 2Z91B 3PP4H 3TA3A 4HMEA 4P2QD 3VD5A 4PGCB 3X12B 1LP9F 2BNRE 4I0PC 4PRNA 2AQ2A 2N4IA 4EN3B 1RZ7H 3DTXB 1Q9OA 1YDPB 3C09B 1NMBH 5EDXA 1CFQA 3FAWA 1KJ2L 3VGHA 4X98A 1BFVL 4Y4KC 1CGTA 1EEQA 1MCWM 1QR4A