1IC7L

Crystal structure of hyhel-10 fv mutant(hd32a99a)-hen lysozyme complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic7L00
2EC8A 3VDBA 3REVA 1K4CB 3O6LL 2VDQH 3L6FA 3MREA 5D8JH 4TSCH 4Y8DC 1X5LA 1EFXB 4DQOH 2XZQL 5IVXB 4UAOC 4YXKH 2CMRH 4UUJA 3KYNB 3TF7C 3ILPB 3I75B 2YXFA 1T7YA 2VDPH 1HHKB 5BVPH 1GGYA 1ZV5A 5BRZE 1VPOH 1PY9A 2F5AL 3ARQA 4P46A 1OL0A 5HHOD 2JJVA 4FXGB 3WS6A 3HLAB 4S2SB 4WU7B 1NCNA 1A0QH 4HEPG 4ZFFB 3LPWA 3UDWC 2V2XB 3C8KA 1ROWA 3OAZK 3S98A 5LXGH 3VW3H 1KPRB 1QG3A 3G9AB 5HVHB 2NZ9D 4IMLA 4UQ2B 1F58L 4RDQG 3BPCA 4NPYA 1MSPA 3ARDC 2WSKA 5BV7B 5JPNA 3WLWC 4D9LH 3PWLA 4NCDA 5EU6D 3OGCB 1R5VB 5EA0H 1UACL 3KNBB 3MRRA 1J0YA 1OTUC 2IBZX 3KVQA 1AQDB 3VXOA 1CK0L 4IRZL 4Z7WE 4O58H 1MFDL 2HKHL 3QDGA 4Y4KB 3S37X 3BZFB 2D31B 3GIVB 1C12A 1WC7B 2EZ0D 1A9EA 3Q1SL 3C8DA 4ZXBD 4W6YB 3T0ED 2DQTH 3FFDA 3EOTH 5EU6B 2FX7L 4XPGH 4OKVA 2X4PA 4S1SL 4Q58C 4PUBH 4RFNC 3OKMA 4MDIB 1YMMB 4Q6IA 4NQDD 2Q87A 4ZXBB 4HZLA 3N9GL 3T0EB 3DV4A 5FHBL 2AEQH 2W92A 1BFTA 5JQHC 5T1DH 3WIHL 2GJ6E 4HBCL 5A43C 4JJ5A 2ICEA 5HDQH 3ZDZF 3TYGL 1GGCH 3T4YA 5J11B 1Q38A 3O4LA 1I1AA 5DZOA 3FQRA 4GMTH 3P0VL 5GJTH 3S88L 1G9NH 4NQDB 3PQYA 3NFNA 1AO7E 3O9WC 3O41A 2EECA 4K8RC 3ZYIA 1MPAH 4NO3B 1FE8H 3U36B 3P9LB 4GQ9L 3FN0L 4P57B 4HIXL 5ABDE 2DQUL 3P30L 5CILH 1GJIA 3GEWB 3VRJB 5MEPA 2IANA 5C08E 2E7LC 2QHLA 2PN5A 1F3RB 1LDPH 4JQXC 1YEFL 2AXGB 4S1RL 4G7VL 2DTMH 2EDTA 5DWUH 4KTEL 3SO3B 1R3LB 3FB6A 1F2QA 1F4HA 3LQMA 5K59E 4OCYH 2EEBA 4RQQB 4LMQE 3AY4C 3DUUB 2IH3B 5GRYA 4WCYL 3TPKA 2GAZB 2VDKH 4K7PL 4CMMA 4PJFF 3W82A 2OMNA 2AK4B 1DLHB 2BHYA 3S36X 3IDXH 1J0ZA 4HJ0D 4LSSL 5GS0C 3WEXB 1R5WB 2BSRB 3AAZB 4YHOH 1CL7L 4P2QD 2DQGL 3OKEB 3VA2C 3UCRA 2A6JB 3MYJA 1FG9C 3I2CH 2CRYA 3GMRB 3L5XL 3D39E 4LQFH 3OHXA 4WRLA 1JHKL 5DJAB 3SGKA 4EVNA 3LV3A 1DEEB 1U3HA 3G6AB 3NABL 4LAQH 2CJUH 4JO2L 1JHTA 1UXWA 5GGTL 4P2QB 4ZO7A 3BE1L 4JKPL 3GSVB 1IGCL 4PRIE 1BZQK 1KXTB 4TNVK 1G7LB 4MD0A 1UVQA 3PWNA 1VFUA 5I76A 4PYGA 4DGIL 2R0WL 1A7NL 2YD7A 1AXSA 3L3JA 4OCSH 1BD2E 4YHKL 5FGCE 1MREL 5D7SH 3K2MC 3W9DB 3C2AH 5C0BE 2ZPKL 1T7VA 3NIDF 3QRGH 3HB3C 3F5WB 1ODAA 3HAEH 4P4RA 4X7TA 5BVJB 5A2IH 3MCLH 1FJ1B 1T89A 1WBXB 2YD1A 2H41A 4PJEF 5DS8B 4M4RA 2MMXA 4QTHA 3GMNA 5IR1A 2F54A 3MLVH 3T04D 3LS5L 4M6NL 4POUB 3OJMB 5K9KA 2DBJA 4PGDB 3F7PC 2VTFA 1Q9WA 5FUZL 4L3AA 1LP9F 5CEZH 2EYTA 5LKNA 5DTFA 1BAFL 2BNUB 3G9VA 5F96L 2D03L 2ITCB 4BQ6A 4LHJB 1I8MB 5T3XH 4EOWH 1XF3B 1L6ZA 5D7IB 3V6FB 3OB0K 2G9HA 2R2EA 3BH8A 3BKMH 1WAAA 5F3BB 1EHAA 1T1YB 1AKJA 5I1EH 1VENA 5JW4R 5KTEH 2X9WA 3HNTL 3MR9B 4CU6A 1MRFL 4RBPH 4K71C 1TQCB 3HE7C 3JUZA 1RZJL 2W59A 3UTOA 5IT2L 3IFPB 5DK0B 2Y7QB 3FN9A 1KPVB 2EDFA 3O3BB 3WNMA 4ETQA 2B7DT 4PRHA 3SQOL 1LO0L 4G8EB 1N0LA 4MYWB 5AWNL 4HG4J 4P3CL 3KPRA 2BSTA 2Q8AL 4FQHA 4OFVA 1F3DJ 1V7NL 3JVGA 5EOQH 5JNYA 1CGUA 1A6VH 5ICZA 43CAB 3RUGB 4U6YB 2MCPH 4G9FA 1IKNC 1PEZA 5DJYB 1A7PH 5HDBE 2QSCH 3OKNA 4GH7B 1UWXK 2IALB 1OTTC 3WJJC 1TVDA 2VITA 4X5XB 5IVXF 3O6FC 1H3PL 4NRYB 2K7QA 2VXUH 3CSPA 3GJFA 5FM4A 4P2OA 4YPGA 3LEVL 3FQTA 4ONGH 1YC8A 2EEDA 4TRPH 4GKSB 5E0QA 1ORQA 4BQBA 3UJTH 2CIKA 3ULUC 4DCQA 2P45B 4P5TA 1VGKA 4OQTL 4OUOA 3V4PL 3WD5L 3UTQA 4BK5A 1HYRC 4P2CG 3GI8H 5HHPA 4OGYL 3O2WH 3SN6N 5BZDA 4V2BA 3QDGE 1YEEL 3ALXA 1MHPH 3I6GA 4JFPA 1FZOB 1EHNA 1Q72L 3WL9B 2PR4L 1RD6A 3VFTA 3C8HA 3RWIA 3RWJB 5CEYB 4PRAB 5ID0B 5IB4B 4YHPB 4HX1B 5E9DA 3VA6A 3RAJH 1Q9LA 2CDEB 3BT2H 2I24N 3JV5A 1KUMA 4BSWA 4HJJL 1BBDL 4B5EA 4HXAL 4JFQA 5DO2D 3R4DA 4LIQL 3KYKH 4LSPH 4OAWA 4IOIB 2QQKH 2BFVH 3U4EA 3MNVB 4J4PC 5GRWA 3RP1A 3KPNA 4HUMB 3DUHA 1H0DB 4ZO9A 4OF7A 3TN0C 2FL5A 1T83A 3O4LE 1LO3H 4DAGH 2P24B 1IGFH 3KLSA 1KJVA 4LEXH 4ZNEA 3T0BA 3HC4L 3QIUD 4YHZL 1MH5A 5LWYH 4JGJA 3L3IA 4X9HA 5E1AB 1KCUL 3F7VA 1YN6B 2VISA 1OGTB 1W8NA 2JK5B 3GDBA 1DQLH 2CPCA 2YRLA 2CLVA 4M3JA 1BJ8A 2ICWA 3QIUB 3ARED 2IANE 4IMKA 2E7BA 2WBJA 3NIFE 1ACZA 4OKDA 5IFJB 4HEME 2B2XL 1T80A 3WNKA 5F6HI 4RAUB 5SWSD 3UPAA 3QCUL 2HRLA 4XRCB 1IGJB 4E9LA 2A9NL 3MNWA 5DFVD 3AREB 4UV7L 5IG7A 1F11A 1T20B 1YEJL 2QSTA 4NQED 4KK9D 5F97E 1XCTA 1ZHKB 3Q0HA 4XP6H 3CFDB 2IQ9L 5DHVA 2C3GA 5SWSB 3BZEA 3T2NH 3IAQA 1Z2KA 3HUJA 3MACL 4XNMB 1AXTH 2MSPA 4LVNB 3UO1L 4NQEB 3EFDH 4J3XA 2ZCKH 4JREC 2R1WA 3V9FA 3ZSTA 1WFTA 4PD4J 4K3HA 4QKXB 3BEWB 1CXFA 1EEUA 4I9WE 5FKAA 3WDJA 4ELMB 4PJHB 3CVHB 2R23A 1YMHB 3MOBH 1T66C 3DV6B 3V5HB 3C09B 1NDGB 3JV4B 3DVNB 3CPLB 4FQLH 4FXKB 3PHOB 4OZ4B 2G5RA 1H8NA 1I75A 3RVUC 2XPGB 2BNQA 5LGJA 4XNZB 5IHLB 5KJRH 5HD8C 3U1SL 3QNZB 3CMOL 2GT9A 3RY6C 5EU7C 5ISZB 2DLHA 4OZGB 2ICWI 2GTZB 4FMFA 1FNSH 3SKUD 1XF2A 4GW1B 1KG0B 4NBYB 1T5XA 5MERA 5ANMA 4LSUL 4JPIA 3UTZB 1WUNT 2F54E 2I07A 4ONHB 1BBJB 2YR3A 2MQCA 4KJPC 4X6DB 1JPSH 5DK3A 2H9GA 3C5SA 5BOPA 5CP7B 2CR3A 3WFBL 5KSVA 1CQKA 4FQCH 4MDJB 4BZYA 1A6AB 4NYLA 1C16A 2NXZC 1CGTA 3P0YH 4HBQA 5DLML 4XXDB 5E7BA 1ZXQA 1FNGA 4HPOH 1NSNH 4WEBL 1YYMH 4HUXA 5J6HB 3HE6A 2AK1H 3MRQA 4CW1A 4U6XB 3H7BA 4KRPD 4GRMA 3CVIH 4P4KD 4NKIH 1W0VB 2HKFL 1JTPA 2OXHA 2HVKA 3CGTA 4O2FA 1AD9B 1WAAE 2VDRH 1KNOB 1IAIM 4IHOB 1N64L 1UT9A 2WLYA 4HD9A 5F71A 2A6KA 4I77H 4ZUTA 4WU5A 1IAMA 4KRPB 3SDDA 4HIJB 4P4KB 1A4JA 4XPHH 3PXJA 3TWCL 2HFEB 4C54A 3ET9F 4M5YH 3PABB 4XMKH 5FGSA 1P6AB 5D7IF 1LO5B 3CFKA 1R3KA 4N1EA 1MWAH 4PRHE 2X4NB 3KPRE 5JORA 2VLRD 1S5HA 1NC4A 3KPQA 4QXUL 4G9FE 3UBXI 1LEIA 3EYUH 1LEKA 1MNUH 1WFOA 4WV1C 5J3HD 1BFOB 1RUML 3ZDYF 1SHMA 5FECB 2OR9H 4DOHE 4KDTA 4ZTOH 4OGXH 5FDWA 3HC3H 2Y07H 3O45A 2VLRB 3SE9H 5EC2A 2WBWB 1XH3B 5GGSB 5AG8A 3C08L 4Y5XA 3LOWA 4LGPB 4CBPA 1YN7B 3NGBB 1JF1A 1ZT1A 3WDIA 4RMRA 4N8CL 5BXFA 1ADQH 3FO1B 1Q9OA 2ILLA 3SCMD 1YEGH 2IBGA 3BWAA 1MHCA 5CBAB 4U1IB 3WN5A 4KQ3H 4OI9A 2LVEA 4M3KB 1YEDB 3MBXL 4GG6B 5C0DB 1SY6H 2KUTA 4PJBE 1I8IA 1OQXA 5GGUA 2B1HL 5DR5L 1J18A 5D5MB 1JGLL 2FSEB 3SCMB 2FYYA 1E4KC 4MSWB 3RKDC 1CICC 4MXQD 5E9DE 1FRGH 3O6MH 1F00I 1BECA 4G6KH 1FL5B 1BOGB 2VLKD 3TO4C 4XWGH 1A6TA 3O4OB 2XNAB 1FZJB 1P7QD 4QF1A 3IB4A 3QHFL 1E4WL 1A9BB 1G7HB 5FYJE 4XMLL 4PJFA 2VR5A 4Y1AA 1P53A 1EO7A 2Z92A 1W8OA 3ABZA 4ZS6C 4FFYH 3FQUA 1K4DA 2L7JA 4ZNEE 2XYCA 1P7QB 5JZ7C 1TCRB 4YBQC 2R0KH 3RGVC 2HTKD 3ZKND 1HSBA 1VADA 3EO9H 5I1KL 4BKLB 1MCWW 3IDYC 1OOAA 1RZ8A 1BGXL 3D85A 5JOFA 4U1LA 1PFCA 5C70A 2B4CH 3G5VB 8FABA 4MQTB 4MS8D 1MCDA 1T03H 4GXUN 25C8H 3FB5A 2QKIA 3DRQB 2P8PA 4FQJH 3MLTB 4JY5L 5E94B 3MV7D 3STZB 1RZKL 5ILTL 5C9KA 1OAYH 1FL3B 3QUYD 2PXYA 4NC0B 4YUEL 1PYWB 3MLXH 2M26A 3BXNA 3CC5B 3JWOC 1IEBA 1Q9KB 1QRNE 3PWVB 1CIUA 1BEYH 4LHUD 3QXDA 4XXCA 3T4AB 3DGCR 2VB5A 4XBGA 9CGTA 3MV7B 4KMTH 3DMMD 2HJLB 4GBXD 4LSTL 4PJEA 3QUYB 1JJUA 1FFPA 2ATPA 2B39A 2VL4A 2RHEA 5HYJA 4R0LA 3DSFH 3VXQA 3HUJE 2FX9H 3VD3A 1IGML 2GW5A 2NXYD 4LHUB 4YDLC 3ECBA 4BA8A 1T4KA 1GZPB 1U2HA 1BQHA 5TGBA 1LE5B 1P4LB 1LP9A 3SHSA 4F9LC 1QSED 4GBXB 3EBAA 2X7LA 3HS0B 2OTWA 1FZKB 4UDUA 3U7WL 1HXYA 2BHZA 5CGMA 3OR6A 2RGSA 2BCKA 3O6LH 2NXYB 1FNHA 4PGEA 3LIZL 5D2NB 2X89D 1OD7A 3EW3B 4H20H 2QR0B 2KH2B 3RVTC 2FZ3B 3IDGA 1QSEB 5EZJA 4QEGA 1KJ3L 2XZQH 4M9OA 2BNQE 2DDQL 1F8TL 5GGRA 3LCYA 3E1F1 5IJVA 5T1MB 3H9YA 4HWBL 1JPGB 4PJ9C 1P7HL 1CN4A 2YPVL 1WWAX 3CJJA 2UYLA 4ODWB 3LQZB 5IOPA 5E8OA 3F12B 4ELMF 4PJHF 3UMTA 4PY8I 2R4SH 4TVPE 3QXTA 1NFIA 5E4EC 1AJ7H 5ANME 1HHIA 3TIDB 5EIIA 1M7DA 4UIMB 4XAWH 2X1WL 3MJ8B 1FGVL 5FUCE 4D0BA 3BIKA 4NRZA 1F58H 4YJZL 6CGTA 3MJ6A 4JM2D 3F7QA 4OZGF 5IKCB 3IVKB 4JR9H 1UACH 4NUGL 1CK0H 1K4CA 4IRZH 1FGNL 1MFDH 4X6DF 2GKIA 4JO1L 3IDMA 3TFKC 5E00B 4JM2B 3Q1SH 1LD9B 3HMXA 5DVMA 1EFXA 4PGZA 5IVXA 1OVZA 4QNPE 3KYNA 4LLQA 3DGGB 5D70H 3I75A 1L7IL 3TLRA 4D0CB 3L95B 3S8WA 1HHKA 4FMKA 4QRRD 4IDJL 3O8XC 1FLTX 4PP1C 4N1CA 2APXA 1TDQA 4FXGA 4JANB 2X10A 4XNZC 3HLAA 4HBCH 1MVFA 3EYFB 4AEHL 4WFEE 1CGVA 1KPRA 1IC7H 4QRRB 4K8RL 5E6IC 4UQ2A 2LABA 4J3VA 3QQ9C 5GPRA 2P5ED 4GRLB 4F15B 2OBGA 3NCFB 3OGCA 1R5VA 5DD3L 5SV4A 4KC3B 4I3SL 3L5IA 3KNBA 3MJ7B 4C57C 5I8CB 1AQDA 1NEUA 3ARBD 4OB5H 1Y0LB 4GQ9H 3FN0H 1UWGH 4XZUB 3WO4B 4Y4KA 1KIRB 4HIXH 1S9WB 2DQUH 3BZFA 1E6JH 2D31A 3GIVA 1WC7A 4MNHB 4JZOB 4OT1H 2XQBH 4I0KA 4U2ZA 4DTGL 2P5EB 4NKOB 3PGDB 3QQ4B 3ZDZE 4OIBA 1YEFH 3DHMA 4G7VH 5EU6A 2HWZL 4OLYL 2VOTA 1ZLWH 2I9TB 2WQ8A 3ARBB 5DJ0B 1QSFD 3W81A 4OSUL 3TCXA 5GS0L 1JGEB 1V3LA 4AL8L 1G7QB 4MDIA 4UTBH 3VG9B 4QOKB 4K7PH 4D9RD 4ZXBA 3BPNC 5HGGS 2RR3A 3T0EA 3SE8L 5JW4M 2VAJA 1KIPA 5LVEA 4LSSH 2LQRA 1FO0B 1PG7L 2J2ZA 5L8JB 4FQXC 1CL7H 2DQGH 2APFA 1QYGL 5C7XH 2AI0H 4NQDA 2B20A 3GSUA 3L5XH 1JWMB 3C6LD 2AJ3A 2HVJB 4GG6F 5GRXG 5MEQB 4JO2H 1T3FA 4L5FL 3SKNB 5GGTH 1LO4H 4NO3A 3QO0A 3U36A 1DEDA 3P9LA 2APVA 1IGCH 4AIOA 4P57A 2NY3C 4PJFE 5D5MF 5GGRY 4Y1AE 1KB5L 1OAQL 4XP1H 1A3LH 3VXNB 3C6LB 2NY4D 2AXGA 2R0WH 4XH2A 1A7NH 4M7JH 1OAUH 1AD0B 4YHKH 1UH2A 1R3LA 5IGXH 1MREH 1I1YB 3RDTD 4PB0L 2A6IB 3LZFL 4RQQA 3DUUA 1NBVH 2IH3A 3AUVA 4GRWB 5C71A 3MJ9H 2XXCB 1AC0A 2FEDC 1FNEB 2GAZA 2ADJB 2NY4B 3BYYA 2EDNA 3QCVL 3L5HA 3LMJH 2AK4A 1DLHA 4OFDA 2CGRL 3UTSD 3UAJD 2W9EH 3SJVD 1R5WA 2BSRA 3MTRA 3RDTB 3WEXA 2G60H 3AAZA 2H2PC 3LS5H 1YQVL 1B0RB 1JN6B 3OKEA 1EO8L 5CMAB 5I73C 1H5BB 2A6JA 4LCIL 3IJYB 2AGJL 4JVPA 4O51B 5DJAA 5FV2A 1AR1C 4GW4B 1DEEA 3G6AA 3UTSB 1X44A 1DQJB 4Y8AA 1TJGL 5F96H 4P2QA 5I1JH 3GSVA 5FGRA 4OZFB 4Y16D 4J3OC 1G7LA 4PJEE 4OD3L 2N7BA 2BOCB 5HYJE 3BSZH 1IBGH 2XZCL 3HE7D 2UVFA 4F37F 1U8HB 3NPZB 1TZHB 4NKDB 5CZKA 5DUPL 4DZBA 1FG2B 2J6EH 5D6DC 4HSQA 1I8LC 4Y16B 4ZFGH 2BK8A 3F5WA 1ZK9A 4HWZB 1LP9E 5I6XC 1TFHA 3V0WL 3BPOB 4KTDL 3ZKMC 1AIFB 5BVJA 5DMIL 4XP5H 1RZJH 1FJ1A 2MNUA 3I9GH 3DROB 3G6DL 3EDJA 3GSNB 5DS8A 5J4MA 4ODSL 4X0KA 4UIKL 3QIWD 4PS4L 4RA3A 2DKUA 5F44A 4ONFH 3SQOH 5B8CC 3PUCA 4U4BA 3HR6A 5FUOH 4PRPD 5AWNH 4PGDA 4NFCA 4P3CH 2L0DA 1HYSD 3HI1A 4PJAB 1S5IL 5BZWB 5TFSL 2JB6B 2ZUYA 1YPZB 3MBEB 1LK3L 1W72B 4OCRL 1JNJA 4I0PB 1IT9L 5IP4A 3QIWB 2BNUA 4Y5VB 1RIUL 3VFWA 1TJHL 2ITCA 1I8MA 4PRPB 3FT2B 1XF3A 3BUYB 1FC2D 4JFHE 3ULUE 5CSBA 4I5BB 5D7IA 3V6FA 2VZ3A 3TT3L 3MRMB 5DMGC 2ZG2A 5F3BA 1IJ9A 3VD7A 2VH5H 3ULUL 4TPRL 1T1YA 5B22A 5BW7A 1G0XA 1ZSDB 2B8OT 1GOFA 5FXCH 1MIEL 4HK3J 1U8OB 2VXVH 2AAVA 2YPLD 5I1IL 5D1XD 1RUPL 4NSKB 3IFPA 3EJYC 4OGYH 5DK0A 2Y7QA 1KYOK 1KPVA 2VNCA 1YEEH 3O3BA 1G6VK 2Z8SA 4G8EA 1Q72H 1BFVL 1MQKH 2CK0H 1KSRA 1UG9A 2IG2L 2V17H 5IVXE 5D1XB 3BDXA 2IPUK 5E99L 2X4UA 1HDMB 43CAA 2FECI 1E6OH 4U6YA 4AQ1B 1X5JA 4J3WA 3SDXB 2AJXL 2CKBB 4QGYA 5DJYA 1UZ6F 4XHJC 3SDAC 4JM2F 4ZOEA 5DRWB 2IALA 4EDWL 4X5XA 1ZEAL 4NRYA 5JHLL 4AT6B 3SOBL 3QXUA 4XWOC 1KFAH 4DGYH 2RAMA 4G8GD 4GKSA 4WTXA 4YHZH 1AQKL 1OARL 4K7FB 3K46A 3KGRA 1KCUH 3EOYG 3OL2A 3WKNA 3ARSA 4DFIA 4MJ4A 2BVQB 4YHYC 3B9VA 4YC2C 1FZOA 3H6JA 3GMOB 4NM8L 4PRDB 4D94A 5D7JD 1FPTL 3BPLB 3WJLA 5DC4B 5EU6E 4CGTA 3GUTB 3RWJA 5CEYA 4PRAA 5IB4A 4YHPA 4HX1A 3V6OA 4LARL 3V5KB 2CDEA 1T04B 2IGFL 4NKQB 3VH8G 1JNNL 2A9NH 1DVFB 1YMME 3FZUC 1AGCB 1MJ7L 4UV7H 3B5TA 1PDKA 5D7JB 2IPKA 3P4LA 1UH3A 3T0EE 4IOIA 1D5MB 3Q48A 2MKLC 1ZLUK 3MNVA 3F62A 4J3TA 2IQ9H 4YX2L 1FVDA 4AZ8A 3GBML 3HI5L 3MGTB 1H0DA 4PJIB 1RK1A 3AS3A 2P24A 1Q0XH 5A2JH 4NQDE 4F58L 2FD6L 1GHFL 3D9AL 2PNDA 1FYHB 5GJSH 1ACYL 4YWGH 5TJWK 5E1AA 3L3HB 5C1MB 4IDLA 3RQ3A 3LRHA 1OGTA 2EXWC 1NAML 2JK5A 4XCFH 1F97A 1QVOB 2GI7A 1WBYB 2VWEE 4HT1H 2V5SA 4ZPTB 3QIUA 3MMEB 5TPWL 3ZT5A 4FFWD 4GRLC 5IFJA 1PLGH 4PLJD 5FKPB 4U05A 2XV6B 3K1KC 1CTNA 4P3WA 3QDJB 4RAUA 3TCLA 3CFEB 4XRCA 5E1HB 1PY4A 3U1SH 1IGJA 3MRJB 3CMOH 3X3FH 4RA0C 3UROR 5D71L 3AREA 2Y06L 3T09A 4PR5B 2AK4E 4NN6C 3WHXB 1ZHKA 5IBLD 3L9RB 3BMVA 2EDJA 5SWSA 3QUKA 1O0VA 1T5WB 1K8IB 1C5CL 3T0AA 5DC0A 1HEZB 3NCJL 4PJ7B 3TNNA 4XNMA 3KJ4C 4NQEA 2XZAH 4GRWF 3TESA 5FA4B 1Z9OA 4GKNB 4X4MA 5AYQA 2LU3A 4OI7A 3GNMH 5CWSB 4MVBC 2Q3AA 3NN8B 3PP4L 1ZOXA 4NN5B 4P2QE 2FGWH 3BEWA 5ADPL 2KBGA 4QRSB 4ELMA 4PJHA 3QULB 5L7XL 3DV6A 3ROLB 1NDGA 4C4KT 2OK0L 3JV4A 3AM8C 3DVNA 4G6AD 4KKAD 3CPLA 4FXKA 3PHOA 4G7YL 4OZ4A 4XC1H 1UA6L 3MROB 2XPGA 2ZOKB 3HA0A 2DBLL 4OD2B 2ZKHH 3QNZA 4FQQB 4L29B 4D2NA 3TWCH 1B90A 3DPBA 4OZGA 5BOZG 2GTZA 3VFPB 4P9MH 2QHRH 4GW1A 1KG0A 4GKZB 3UTZA 3QDMD 5CCKL 4JCMA 2FHFA 4XP9L 3DX9A 4ONHA 4JM4L 2FECL 2BXZA 1A5FH 4X6DA 4UT6L 2GY5A 3MPCA 5CP7A 4E5XB 4MDJA 1A6AA 3U2SB 3AU1B 4QXUH 2HJFB 2Y72A 4XXDA 3QDMB 4R26H 4EBQL 3I3EA 3HHRB 3KPPA 5J6HA 1IGIL 4U6XA 2HLFD 5D7IE 1W0VA 3MRDB 5HGAB 1AD9A 1UH4A 1VB9A 1AFVL 4IHOA 4GG8A 4PJAF 5JIKA 1Q1JL 3C08H 5D1ZD 3TH2T 4FFVC 5JA9A 1YPZF 4LF3B 1B4JL 1A7RL 3GJFH 4HIJA 4P4KA 1I9EA 3F8UB 2HFEA 1TPXB 3IKKA 3LRGA 3S34H 3TNMB 3PABA 3UPRA 1LO5A 3ZDYE 3WXWL 4R4BB 1KCRL 5FGBA 2AW2A 2B1HH 5T5NG 2QL1A 2X4NA 4JFFD 5INDB 5CKAA 3BPOC 1MJUL 1EK3A 1BQUA 2AXJA 4BK4A 1CR9L 2H2SD 5GRUL 5J7CC 2DQDL 3KPTA 3WHE1 3RUGE 3PNWB 1U8NB 4APQC 3WFDH 1BFOA 5F9WB 3FKUS 5FECA 1UGNA 4JFFB 3UYRL 2AKRB 3CZFB 5DC9B 4L3CB 1V3MA 2VLRA 2W38A 1RUQL 4XMLH 4FHBD 3LEYH 1XH3A 3KS0J 5IMLB 5E95B 2FJHB 5GGSA 3MBEC 1IZKA 4ZD3L 2D4FA 2W9DH 5FYJH 4I0PC 3RPKA 1YN7A 1HH6B 1EZVX 4Y5VC 5C0IB 1INDH 3SDXF 1SVCP 4H25A 2WUCH 2BJML 4KJQC 5CBAA 3V2AR 4YDKL 4U1IA 3ARXA 4LNRB 3E3QE 1YEDA 2ED7A 4GG6A 5C0DA 1NDMB 3DX6B 3GI9L 2IBZY 6FABL 2X70B 4Y4HC 5D5MA 3U9PH 2FSEA 4YGAB 3SCMA 4L9LB 1OAKL 5EO0B 2KKQA 3JWOL 1OCWL 4JY5H 3C9NB 4MSWA 1CDUA 1RZKH 5ILTH 1X5IA 3V6OE 3OPZL 3BAEH 2PO6C 4R97C 2R0LH 4YUEH 3MA7B 1FL5A 1BOGA 5C2UB 5EH1A 3ARTA 2G75B 2XNAA 2VERN 4K3GA 4R96B 2AJSH 3FB8B 3IDJB 4ZFOL 2QQLH 1A9BA 1G7HA 1L6XA 3FCTB 2BVEA 3U0PB 2CXGA 2FJFB 5DD0L 2VLKA 3PGFL 5KSAD 3D48R 4M03A 3WXVL 1IGMH 5DHVH 3PDDA 2AV1B 5B3NA 3ARRA 1P7QA 5F3HB 1CZ8L 4U1KA 1TCRA 3BRGC 4QO1A 4R90L 1DL7L 3TEUA 4B53A 3NH7L 4U33A 2GY7B 3MRGB 3T77B 4BKLA 4HF5L 3OZ9L 3T8XA 5KSAB 4DKEL 4HGMA 4QGTA 1D6EB 1WGOA 3PGCA 4PJIF 3G5VA 3LIZH 3PIQB 4KHTH 4PRNB 1EJOL 2A1WL 3ORJA 4X6EB 2ICCA 4ZUVB 4OLZL 1IEHA 1GC1H 3DRQA 4RRPA 5JXEC 1A14L 4F7CB 1KJ3H 3STZA 2EXYD 2DDQH 1FL3A 4LPVA 5BQ7B 1TZGL 1LQSR 1YY8B 4HWBH 4OD1H 1PYWA 4YNYB 5J13B 2YPVH 4DW2L 2LV4A 1RAMA 2C9AA 3CD4A 3CC5A 3Q3GB 1PQZB 4YHML 3NFSL 3T4AA 1KIQB 3IDNB 3MV7A 5E6ZA 4PB9L 4AYFA 2HJLA 2DQJL 3QUYA 5SWSE 4P49A 4FP8L 4TVPH 5HYQB 4EN3D 1RI8A 3GO1H 4JPVL 2R9HD 1V7ML 3CU7A 3MA9L 1DVFC 2FJGA 2BVYA 4OJFH 4LHUA 4NQEE 4M5ZL 4F3FB 1GZPA 5L2KB 1LE5A 4X4ME 1P4LA 4Z95L 5M94B 3DMMA 4GBXA 4J1UB 4YLQT 1DN2A 3QNXA 4HMEA 1KXQE 3HFML 3HS0A 3S6CA 4WNQB 1FZKA 4ELME 3GMQB 4NUGH 4PJHE 1E27A 3CH1B 5FF6B 3S5LG 3IFLH 4KI5C 2H45A 5D2NA 2W60B 4P9HL 4PJ7F 2DD8H 2DN7A 4JFZH 4JO1H 4R4FH 4Z7QF 4C83A 3CVHL 2QR0A 2FZ3A 2WNGA 2YUWA 5C0NC 1QSEA 4D9QD 1F6AB 1KENL 1S8DB 2FO4B 5T1MA 1DBML 1JPGA 1MCBA 1Z9MA 4ODWA 4D0DB 3LQZA 1KJ2L 4OFYD 5IROC 2X89A 3F12A 3MNZB 5GSRA 1H15B 4OZGE 4BUGA 5GGSY 1U95B 4GFTB 4XI5C 1NUNB 3VH8B 2MTPA 3RHWK 3TIDA 2A73B 1O7SA 5KAQG 4UIMA 4JN2B 4X6DE 3MJ8A 3UPCA 1D6VL 1SYVB 1URLA 4M43L 1F90L 4K8RH 1MCQA 2YUZA 2AJYL 1XF5B 2LU7A 4NN7C 5DQ9B 5K93A 3P9MB 2FRGP 1B6DA 5IKCA 3IVKA 3BYTA 1N5AB 5DD3H 3OAYK 2NY1C 3VXTB 2WMPA 1OLZA 1G7IB 2GTWB 5IFAL 1I85A 4IRSD 1U8QB 5GS2D 1GCFA 4A6YB 5E00A 1WIOA 4JM2A 1LD9A 4DTGH 3M07A 3MRFB 3DUSB 5DI8B 5GGVL 5IK3B 4NOFA 2L7UA 4LSVL 1WZKA 2CSPA 3DGGA 1ZLVH 1PG7W 5A16B 2AABH 3L95A 5GS0H 1EA9C 4TUJA 3WNOA 4Y4FD 5FOBB 5I8KL 2KZWA 3L3KA 3DVGB 3PWPD 3SE8H 4JY6B 4JANA 2RCSL 1PG7H 3NCCB 3EYFA 3QH3B 2XKNB 2P5WD 1F4WL 1QYGH 4QRRA 4Y4FB 5E2WL 4QXTA 3PWPB 5MI0C 4HDIB 7FABH 4PIRF 2C26A 3RVVC 4JPKL 5E24E 3NIGF 2P5WB 1N26A 2R69L 3MJ7A 2AQ2A 4X80L 5I8CA 1ZWIB 1Y0LA 3DYMA 1F3JB 2HH0L 2N7AA 3MXWL 4RX4D 2VLRE 4XZUA 1EEQA 4OUUB 3EUUA 4MNHA 1KB5H 3WKML 4JZOA 1OAQH 4X8JB 1U93B 3BHBB 4ERSH 3GZKA 2P5EA 5DJXB 1N7ML 1XGYH 3LD8B 2FATL 3PGDA 3QQ4A 1T7WA 3VRLF 5A3IC 1KJMB 3RWDB 2I9TA 4AEEA 2OP4L 3ARBA 4PB0H 5DJ0A 4UBDD 4RAHA 3DXAD 2WBKA 4HCRA 1JGEA 1G7QA 4F9PA 2AEWA 5HSFA 5B3JF 3GHEL 4QOKA 4GG6E 3QCVH 3FQXB 4H8WH 3FO9A 3BKCL 3LKSB 1FO0A 1M6OB 2GHWB 4MCYB 5D5ME 1QSFA 3GHBL 1JRHL 1EO8H 3LKNB 3HMWH 1TPXC 1MQ8A 1RZFH 4ODVL 4LCIH 3ZO0A 2V9RA 1JWMA 2AGJH 1KPUB 2HFTA 1DTUA 4MAUL 1MCFA 2D0FA 1EMTH 3L3OB 2HT4C 5MEQA 3KHQA 3SKNA 4Z7NF 3O2VL 2UZIL 2JLLA 1J7VR 3PDGA 4OD3H 1SEQL 4WTZG 3VXNA 3C6LA 2VLKE 2XZCH 4N5EC 4NC1C 4OLUL 5C2BL 1I1YA 4JZJB 2A6IA 1IILE 4URTB 5H2BB 2ENSA 3ZE0F 4ODTH 3ULVD 3N1GC 4KTDH 3H3PL 4Z8FH 1FNEA 2ADJA 2HT3C 4PJDF 1DBKL 5EN2B 3RDTA 4NQUA 4FS0A 4PS4H 5HHVL 3BP5B 1KC5L 5F72S 4M7KL 1B0RA 1JN6A 4QXGH 5CMAA 3ALPA 2JB5L 1H5BA 1NANI 3K4DA 3EHBD 1OD9A 2AV7B 3VWJC 4JRYD 5FYLD 1CFSB 3I3BA 5JPMB 3IJYA 3F7YB 5KSUB 1SM3L 2ZUTA 4DGVL 4O51A 5CIPB 3MRPB 32C2B 1DUZB 3UTSA 1DQJA 3BMWA 1OW0A 3N0PB 3H8NA 5IBTH 3V4VL 1RIUH 1TJHH 1JNLH 2MQ3A 2A83B 4OZFA 5JO5B 1MRCH 3MV7E 2CRZA 4KKNA 4P23D 1CDBA 2BOCA 4EI5D 3L5WB 3C5JB 1U8HA 4NKDA 3ULUH 1A7QL 4GS7C 5CLTA 4DKFL 3B2UD 1FG2A 4WI4A 3EJYD 5DXWA 5DFTA 2VDML 4Y16A 4E0RB 3RIAF 4HWZA 1BZ9B 3OGOE 1MCPH 1QNZH 2X4TB 4P23B 1AIFA 1XIWD 4EI5B 3LDBB 5F9DC 3DROA 2VDLL 4KJWD 3GSNA 5T1LD 4KU1A 2JIXD 5IEHB 4PYHA 1IFHH 5D2NE 3R1GH 5ADOL 1JZ4A 3FB7B 5CKGA 3VG0L 1BFVH 1O5DT 1QSEE 2IFFL 2IG2H 4N0YH 1XIWB 5C3LD 4KJYB 4PJAA 5BZWA 5J9PB 5CD3B 1MIML 1NEZG 2JB6A 4XHJD 1P4IL 2JIXB 4G6ML 1YPZA 1W72A 3PHSA 5JW4Q 2IMNA 3QIWA 3NTCL 1NMCB 4NWUL 4PRPA 2EH8H 1Z0NA 4Q9RL 3FT2A 5EBWB 2IMMA 3VE0B 3ME0A 5JW3H 4I5BA 4EDWH 3MRMA 1AHWC 1OAZH 2EC9T 2YKLH 3PP3H 5J13C 1ZEAH 4PJ8C 5JHLH 5IMOB 1Y6KR 5DQDL 4NZRL 5DD1L 4DEPC 4MLIA 5L2JB 1G0DA 1M71B 1QR4A 3HG1D 1NFDB 5SX5H 3SDCC 1AQKH 1OARH 5FCUH 4F7PB 4N68A 4NSKA 3WUWG 4AEIH 4Y2DC 3QHZL 4LKCB 3IETA 2V5MA 2DIAA 3THML 4YQXL 1B2WL 4DZ8A 1DQMH 1NBZB 3KG5A 3P40A 4GO6B 3HG1B 3TZVC 2D7MA 2YPLA 5D1XA 1CD0A 1IZJA 1WTGT 3ARFC 1TETL 3BISA 2F9BT 4LARH 5ALBH 1NLBH 4CNIB 5HI4C 3S9DB 4BYHA 3SDXA 4WY7H 3ILQD 1MJ7H 5GS3A 3O0RH 4W4OC 2HG5B 5DRWA 2ADFL 4YX2H 2DI7A 3GBMH 4YGVA 5CJOL 2B0SL 5CJ8A 4AT6A 3RL2A 4QRRE 3B9KC 5HGDB 4F58H 4X7SL 1CLOL 3NCYP 3IGAB 2BVPB 1JPTL 1QHPA 5CFHA 4K7FA 4FXLA 1N6VA 5EBGA 1P5UA 2BVQA 4Z6AT 1HQRB 3CDCA 1B4RA 4HC1L 2GJJA 5FYKL 1N3NB 2G2RA 3MLSL 4G8GA 2VC2L 3GMOA 4RSVA 2P5EE 2MHAB 4PRDA 5TPWH 3KDMB 3BN9D 3S5LB 3V5DB 1T1WA 3I50L 3GUTA 4ELKB 2DQCH 4OCLC 3BEVB 3SE3A 3V5KA 1FP5A 1T04A 1WT5C 4TNVF 4XPBL 5FO8B 3PL6C 1JF6A 1AGCA 1HCVA 4QOKE 5D71H 2Y06H 4XPAL 5D7JA 2W1NA 43C9B 1D5MA 2DYPD 1QPPA 2J5LC 5HHMD 4QRUA 2DQHL 5FDYA 3MGTA 2ADIB 3ZHKA 1QSFE 4PJIA 1C5CH 4TSBL 5TE4L 4NC2B 2Q1EA 4I13B 3NCJH 5FM8A 1H3XA 3WDHA 2ZUXA 5CJXC 4D9RE 4GXVL 2DYPB 5HHMB 3D2UD 1DBAL 2FR4B 4KQ4H 1TTFA 3OAUL 3L3HA 4MQXD 4PBVC 3GMMB 1FNAA 1QVOA 3TYFA 1WBYA 4X9FA 1RPQA 2OZ4A 4ZPTA 2K3TA 4H0HB 3MMEA 1F4YH 1NCDL 3QQNA 3IFNL 4LSQH 2OK0H 1CXHA 2B4CC 4G7YH 4K9EC 5FKPA 4XVJH 1UA6H 2CLZB 4F37K 5DA0B 4ZAKC 3BKJL 3CFEA 2CO7B 3MRJA 5C6TH 4GRWE 4KKCC 1L0YA 3H9ZA 1JI2A 4JGMA 4PR5A 4YE4H 3TC9A 3WHXA 2YN3A 3L9RA 3QUMB 1U91B 2ZUQB 2EDKA 4X83A 3MOAH 1WZ1L 3B43A 1T5WA 1K8IA 2E27H 4JM4H 1N6QH 1TQBC 3TJHD 1HEZA 4LPWA 2UZXB 3PJSA 4PJ7A 2VMFA 3OXSB 4TNWK 5F7YC 3QEUB 5FA4A 3HI6H 4GKNA 3UTSE 3WIFB 5CWSA 5LCVH 3NN8A 3AMKA 1I9RL 2XT1B 5IMKB 2VDQL 3QDGB 3D6GA 4QRSA 1IGIH 3QULA 5CZXC 1XGUB 1QPXA 1FZMB 2C7UB 4NZUH 5F7DB 5D8JL 4TSCL 5IB1B 4ZS7H 4ZUWB 3ROLA 3ULVF 2EYSB 1J1XL 1DANT 5D1QD 3FFDB 3OMZA 3RTQC 3U46A 4HUVB 4Z7OF 2CMRL 1F2XK 4AH2B 3MROA 2ZOKA 1N4XL 5CJQL 3ZTJH 1NC2D 2VDPL 5F7KC 5BVPL 4FQQA 4L29A 1VPOL 3LPGA 4BQCA 4YDVB 4HZLB 1HWGB 5D1QB 3VFPA 1FHGA 1TIUA 3W0WD 3NA9L 3EJZD 4GKZA 1YECH 2ICEB 4DWHA 1A0QL 2V9TA 4NT6B 3T4YB 3DX7B 5ITBH 1NC2B 4PTUB 3VW3L 3HNSL 3UTPD 3PQYB 1UJ3B 4IOSD 3O41B 4PJAE 4E5XA 1CR9H 3W0WB 1RFDL 3U2SA 1R3JB 3RZCD 3AU1A 2A6DB 4D9LL 1YPZE 3BP7B 2HJFA 3QDMA 1X4YA 3OKDB 1QLEL 4OGAD 4O58L 4PRPE 4WI2A 3VFUA 3MRDA 4XBPB 1CBVH 3MLUL 2DQTL 3RZCB 1GXEA 3MFFB 3SBWC 3SY0A 3U48A 1A3RL 1KN4H 4XPGL 5HY9A 5GHWH 4LF3A 2E6PA 3BQUC 2VSDA 5JR1L 4NP4L 2BJMH 4UV4H 1I7UB 1KCVH 3ZKXB 5I71B 3TNMA 1G6RB 2LAGB 1BHGA 5D1ZA 1A64A 2IPUG 5HDQL 2KQMA 1T6VN 2EKJA 2R2BB 6FABH 4ZPVA 4GMTL 4U3HA 4KUZL 5INDA 3MV9D 4OF5A 3JWOH 3NMEA 1EX0A 2C3HA 1NGXB 1NFDF 3EZ8A 1ZHBB 3VGEA 3PNWA 4CDHA 3HRZB 1U8NA 3JWNC 3V0VA 3SDXE 1FVEB 1FE8L 4JFFA 1OSPL 5CD5C 5JMOC 4LCYB 3CZFA 3MV9B 1DSFL 1QP1A 5CILL 4HK0B 5EOTB 1WFNA 3STLB 2CKBL 1CD8A 4YXHH 2DKMA 5IMLA 5DD0H 1VKXB 2FJHA 2YUXA 1ITBB 2DTML 1ZGLP 5DWUL 4MA7H 4M9PA 4LVHB 2JKXA 2VR4A 4OCYL 2C4XA 1HH6A 1MEXL 5DFWH 3WXVH 1GGUA 1F4AA 3VXUD 4POYA 3P77A 4OV5B 1CE1L 1KTDB 4NIKB 1P4BH 4HQQL 1K2DB 2VDKL 3B9EA 3EO0A 3NH7H 4LNRA 1R3HB 3RY5A 4HF5H 3PXHA 3OZ9H 3DX6A 4DKEH 3C60D 1G7JA 3QIBC 2EE2A 4RGMB 4YHOL 3MZGB 1GOGA 2DWDB 4NQTA 1LDSA 2NY5H 3VXUB 3VGBA 2EDHA 2X70A 4UDTB 5DMKB 4L9LA 4HKBB 2DM2A 4F33B 2PW1B 1CI5A 1NGQH 3I2CL 5EO0A 2UWEB 1A14H 1MCEA 5E70A 5KN5B 3C9NA 3F65A 1F4XL 5TQ0L 3LEXB 1TTGA 4LAQL 1TZGH 2CJUL 5GZOD 1C8PA 3MA7A 3C60B 4I18B 3BP4B 4BZ1L 4DW2H 4U1SA 2OSLB 5ICXA 4E42B 2G75A 5DMJB 1NEZB 1SJXA 3C2SA 4YHMH 5TQ2H 4R96A 3NFSH 3FB8A 3IDJA 1JWSA 4BFEA 5MEND 5GS1C 2X4OA 3EAKA 2EDLA 4PJDA 5EG6C 1YY9C 3U0PA 3EDDA 2FJFA 4FP8H 1RURL 1A8JH 3RKPA 4PJIE 2HLAB 3RIFK 1AKJB 2DL2A 5D7SL 2WIMA 3MA9H 2CLRA 2IBBA 2ZUUA 2X4SB 5F3HA 4M5ZH 1A02N 4PGCA 1RVFH 3MCLL 1D5XB 3MRGA 3T77A 5KS9B 4XPFH 2Y6SD 4HFWB 5I75B 5KSAA 4TOYH 3MLVL 1AC6A 4ETQB 2CUMA 3S37H 2JJWA 1D6EA 1U3YA 3F7RA 3PIQA 4PRNA 3WUWB 4U0RB 4L3ED 3EOBB 4P9HH 4X6EA 3ALWA 4ZUVA 4Q9CA 3CVHH 3JBG7 4F7CA 5CEZL 4UT9L 4L8SB 2UUDK 1S78C 5JNYB 3QDJE 1PD6A 3J8F7 5BQ7A 1DBMH 1YY8A 4YNYA 5TDOA 2HFGH 1ORSB 2J88H 5T3XD 1FNLA 1ZGLA 3Q3GA 3RL1B 1PQZA 4L3EB 4I2XB 1FFNB 4FOMA 4YO0B 2VJXA 2D7TL 4G9DB 1KIQA 1RU9L 3BKML 3ZT6A 1YNLH 5F9OH 1BQHG 5HYQA 4JDTH 3FQWB 5I1EL 1JP5A 1D6VH 4PJ7E 4Z7QE 5KTEL 2Y9RT 1NGZB 4F3FA 2APBA 5FYKU 4MZ2A 1VGKB 3VI4F 2I60L 4J1UA 1P9MA 4NFBA 5HHPB 4JFOB 4WNQA 2H26B 4J8RB 4YDIH 4EN3A 1FCCA 5EFIB 3GMQA 4KKBC 4X99B 3CH1A 35C8H 5FF6A 1RZJC 3BIBX 5IHZB 5HVGB 4HH8A 1JPST 2W60A 2O61A 3QAZC 1L9MA 3VFTB 4NWTH 1EAPB 2Q20A 1F6AA 4X6CB 1A6VL 3GKWL 3B3IA 1S8DA 2FO4A 4M8VA 2MCPL 1TJIH 5C92A 3TP4A 4X4YB 4RMUA 5K9JH 4D0DA 2YC1B 4RMVA 3MNZA 1H15A 1A7PL 5DSCB 5I8KH 3UZEA 1IMHC 4DN4L 4KROD 2VSCA 3AB0C 2VXUL 2RCSH 4XBEH 5E2VH 4JN2A 5FK9B 4ONGL 1SYVA 1OSZB 4OFYA 1F4WH 4U7KA 4P46C 2COQA 5E2WH 1OQOA 1CDGA 1XF5A 4KROB 5DQ9A 3WS6C 4E41D 3D87B 3JWDH 1IE5A 3QDME 3GI8L 3P9MA 3K74B 5A2LH 1N5AA 4JPKH 1K3IA 3VXTA 1AE6H 2DLFL 2R69H 1MHPL 1G7IA 2HH0H 3WYRA 2OJZL 2GTWA 2W0KA 1U8QA 4A6YA 3WKMH 1Y18B 4QWWD 5DD5L 1EGJA 2JJTA 3MRFA 1XGRB 3DUSA 2FATH 3G04A 5DI8A 5C07D 2Q8BL 5IK3A 4QYOB 3RAJL 1KCKA 2E6QA 3QPQC 5A16A 3KAAA 4IRSA 1IRAY 4LSPL 1X5XA 4MMZC 3TBVB 1G1CA 2QQKL 4XTRC 2BFVL 3GHEH 5FOBA 3STBA 4ZO8A 3DVGA 5C07B 5FV1L 1WBZB 4JY6A 3BZEB 3NIGE 4HGKC 3H2WA 3QQ3B 1LO3L 4ZUUB 3QH3A 1IGFL 4Z77B 2XKNA 1HINH 4LEXL 4Q6IC 2Z8RA 4Y4FA 4ODVH 3VRLE 4M7ZC 5I15L 4MZ3A 3PWPA 4DUVA 3DWTA 2EC9U 1OPGL 2DQFB 3HNVH 3CU1A 4MA3B 5D7LD 5FKAB 1I1AC 4JFFE 2P5WA 5B3JE 1P7KB 1ZWIA 1F3JA 4HIEB 1HHHB 1OM3H 3ZYJA 4YR6B 4OUUA 2NY6C 2HAZA 1SEQH 1RUKL 4X8JA 3K3QA 1U93A 2Z31D 3BHBA 4OFPA 1T6WA 5DJXA 2WWMD 4QT5B 2JCCB 2I5YH 2ZSVA 2CD0A 4JHAL 5D7LB 1KJMA 4FG6D 3RWDA 1J0IA 5C2BH 1MLCB 4RX4A 1QFWM 2H1PL 2VLJD 4OM1H 4MX7B 1CGWA 5C3TA 2Z31B 5GRZA 4XP6L 1NCWL 3FQXA 3VWJD 3T1FA 1DBKH 1H3UA 2YWYA 1U8IB 5HDOA 4Z7NE 4U3CA 3LKSA 5HYIA 1ZT7B 5I66B 5I16B 4IM8A 4MCYA 5T5FH 1QSVA 2HTLD 1AXTL 3DXAA 3FRUB 2VLJB 3L7EB 3LKNA 4RISH 5CGYC 2W0PA 2OM5A 2ZCKL 1B3JA 5I71C 1ZT4B 5DT1H 1KPUA 1SM3H 1C08A 3ZHDA 4X6BB 2J3SA 3L3OA 3ZE0E 1PX4A 3QG6B 3JV0A 3U30B 4NQSB 3F58L 2EDQA 3CDFA 4OCXL 3KWWB 3SGKC 1WCBB 1KEML 4I3RL 4HFUL 1U3HC 2UWEF 4JPWH 2X44D 2H8PB 2VDNL 3WE6B 1A7QH 2XTLA 5EWIL 4DKFH 2E9WA 4JZJA 4OF0A 1JFQL 1MCWM 3BGAA 5H2BA 1A4JB 4HULB 3GRWA 1NLDH 4O2CB 4TN9A 1FNSL 3DETC 4IOFD 5AEAA 5JXAL 1JV5B 1NGPL 3UP1A 4XC3L 5B39G 1EFQA 3IRPX 1JPSL 4KZEH 5ADOH 3BP5A 5JORB 4A2LA 1EIBA 3VG0H 2N1KA 4FQCL 12E8L 1T89C 3VXRD 2AV7A 5T33L 5A1AA 1CFSA 3W11D 5JPMA 3F7YA 5KSUA 2OS7A 5D9SB 5CIPA 3MRPA 32C2A 4G6MH 4HPOL 1NSNL 2RBLA 2VXTH 4K7PX 4OM0H 1DUZA 4EI6B 5A2FA 5KS9F 2HN7B 2ARJQ 3I3DA 5IB3B 1DN0B 4LCUA 3CVIL 3I6KB 4NWUH 1IAIH 2A83A 5JO5A 4Q9RH 2EDRA 3VXRB 3W5MA 4JRYA 2VDRL 3T2OA 1HK6A 4QHKI 3L5WA 3C5JA 1MCSA 1MFBL 1ZT1B 3MCG1 1RIVH 3FL7A 4NZRH 5DD1H 2BY1A 3LN4B 5TH2B 4XPHL 4JRWA 4F2MB 2OX5A 1BZ9A 4M5YL 3BGFC 4P23A 3V4UH 3Q5YA 4UILL 4EI5A 2BMKB 3QHZH 5GGUB 5J6GB 1A6UL 1MY7A 5IEHA 5EOCL 5HVWA 2APTA 1B2WH 1NAKH 5HI4D 3T08A 2X4QB 3FB7A 2X9XA 5T3ZD 3IS1X 1XIWA 4KJYA 1JWUB 4XNXH 5CD3A 5J9PA 4WO4D 3EYUL 4KK6C 5HYFA 1MNUL 1MWAB 5T1LA 1TETH 2JIXA 2FEEI 2OR9L 4OGXL 3ZTJG 3HC3L 4QCIA 1Z9LA 2OL3B 5I74C 4XNQB 1DFBH 4D9QE 2NY2C 5EBWA 1EPFA 1A1MB 4F80A 3JVGC 5KW9H 5ERWA 4HLJA 3GSXB 2NR6D 4WO4B 4RAVB 2DM4A 2EH7H 3E8UH 3KLDA 4X6CF 4HPYL 2LE9A 2B0SH 3E2HB 4MWFB 5IMOA 3H9SD 2L4OA 5L2JA 1KN2L 3GBNH 1FIGL 1M71A 2GSGB 3GKZA 1NFDA 1JPTH 4KQ3L 1DANU 1CDHA 1AGDB 2ZCHH 4F7PA 3U4AA 3UZVB 4LOUD 1CYGA 4P2OC 1RZ8B 4LKCA 3H9SB 5E5RB 3MO1A 2F19L 4JFDD 5D93C 1NBZA 3IRZA 5FYKH 3MLSH 2VC2H 1QRKA 4P5TC 3HG1A 1HIMH 4NO2B 1D7FA 3LN9A 1FRGL 2A0LC 4YDJB 3I50H 3O6ML 4JHBA 4HS6B 1ZS8B 4BUHA 4HW6A 5HTSA 4XWGL 3R06B 4CNIA 1YJDH 4WHTB 3I6LE 4JFDB 4XPBH 1LO2H 4XPAH 15C8H 4B7IA 1NANH 4TTDC 2HG5A 4WI7A 1KELH 3AROA 2DQHH 4RGND 1XF1A 5TE4H 4TSBH 4AQOA 4UINH 5HGDA 3IXAB 3M1BB 1BQHB 5TGBB 2WUBL 3IGAA 1Q8MA 2BVPA 3PWPE 3O2DL 3EO9L 3HTLX 3DHJA 5INCB 3N1MC 4I8DA 4RGNB 4HMCA 1T83C 4U1MB 2P5WE 4K3EH 2BCKB 1CU4L 2B4CL 2VZ1A 1UM5H 1CD1B 4K9EL 4R2GD 1HQRA 4M7LL 4UMGA 3VDCA 1T03L 1I9JL 4GMSL 3QUZD 25C8L 4LMQI 3IKCB 4FQJL 2DJ4A 4IRJD 1NCDH 2MHAA 3ARWA 2QADC 3KDMA 1SQ2N 3V5DA 1UZ8B 3SGJA 2EDDA 4ELKA 4TTGA 3BEVA 4P0DA 4C4KO 4R2GB 3BKJH 4N0CC 5F6HJ 1EZVY 2XWBB 4XNYH 5FO8A 3QUZB 4IMKC 3UYPA 2WBJC 4IRJB 4KMTL 43C9A 3NVQA 4DN3L 3LHPL 4GRWH 2LVCA 2V7NA 3U0TB 4DJMA 1NCBL 1GPOH 3DSFL 1A22B 2FX9L 2JCCF 2UZYB 1WZ1H 2ADIA 4J7RA 2AXFB 5IFHH 3DXAE 1RMFL 1J11A 3DLQR 1YUHA 5E08L 5FO9B 2DYPA 4X8XA 2QSQA 3TH4T 2FR4A 1UADC 2V9QA 4L1DA 2E9JA 2J8OA 3WIIL 1ZA3B 2DB8A 1I9RH 3WLBB 3GMMA 3B4NA 1V8HA 3ARGD 4JZNB 3IDMB 1UB5B 4H20L 1RZIA 1U8MB 5DYOB 4ENEC 1J1XH 1EDQA 4OZFH 3D2UA 5I18L 4LLQB 2CLZA 1GC1C 2D9CA 1N4XH 5CJQH 3BO8B 5GRVL 5I19H 3TO2B 4UU9B 3LS4H 2X4RB 4NOBA 2R4SL 3RWEA 1GRWA 3RIAK 3WFCH 1U8JB 4JFED 1AJ7L 5FHAH 5IQ9B 1AI1H 1U0QA 2ZUVA 3NA9H 3P4MB 3QUMA 3VD9A 1U91A 4XAWL 3NZ8B 4M48H 2NW2B 2ID5A 3GSNH 3HNSH 2FEEL 5GISH 3ULVE 2WWKT 3OXSA 4J6RL 4PLKD 4JFEB 2HRPH 5HHOB 4Z7OE 3QEUA 4O9HL 3QI9D 1RFDH 4M6MH 4JR9L 4NGHH 3WIFA 4NJ9H 4YIQB 5CEXB 4H1LG 1QLEH 5IMKA 5FUCC 4P5KB 1INQA 2YBRB 1W72H 5ALCL 1XGUA 1FZMA 2C7UA 1KXVC 5F7DA 5FYLE 5IB1A 4ZUWA 3BQUD 5I9QB 4N1HB 3MLUH 2EYSA 3QI9B 4W6WB 3ARZA 4HUVA 4UB0L 1A3RH 2C5DC 2EIEA 2ZSWB 2CDFB 1NH6A 3HE6C 4HKZA 4AH2A 5D70L 3CFBB 5JIIA 3QFJD 1XCQB 1K6QH 3QUXD 1X3DA 5JR1H 4NP4H 4YDVA 1D3CA 1DR9A 3TA3D 4HXBH 5D1QA 3VGAC 4OIIL 3ZHLA 1KIPB 1QEWA 2Y23A 1ZLSH 4NT6A 2EE6A 3SDDC 3DX7A 1NC2A 3QFJB 4PTUA 1H3GA 4YEFA 5DUML 3QUXB 4P3DB 3INUH 1IC7L 4KUZH 1JUFA 1ZA6A 3RNQB 2OR7A 1UJ3A 3TA3B 3C6SB 3EDFA 3GSUB 3JTTA 1FSKB 3W0WA 4MJ5B 2AJ3B 2HJKB 1R3JA 2A6DA 4WENB 3BP7A 5IW6A 1T3FB 3OKDA 5SX4I 3QO0B 4OB5L 5J57B 1UWGL 1OSPH 2YA1A 4L9DA 1E6JL 4WEUD 5FM5O 4OT1L 4Q2ZB 1DSFH 4ZQKB 2DS4A 2XQBL 4XBPA 2CKBH 5EIQA 5C0EA 3RZCA 1BP3B 2D4DA 3MFFA 4XH2B 5C08D 2YS4A 1CLCA 3D69B 4KDTC 1DBJH 1MEXH 1QSZA 1QFHA 4WTZA 4NZTH 1AGEB 2VUOA 1CE1H 4UTBL 5I0ZA 1NFDE 4KTYA 4HQQH 3REWB 1I7UA 4NNXB 3DX8A 2ZG3A 4M6OL 4Y5XC 1G6RA 5DJCB 2P49B 4KK8D 3HN3A 3RVWD 3MSPA 2IAMC 1QA9A 4RWHA 4YFLF 1DBBH 2XG4A 2R2BA 3FJTA 5HHXL 5C7XL 3HG1E 5H35B 2AI0L 3FO2A 2AP2A 3WN5C 2RIKA 5B39B 4OCNC 4Q7DA 1F4XH 1NGXA 2J12B 5TQ0H 3V52H 1ZHBA 3BGMB 4ZOAA 3SO5A 3D39D 3QEQD 3HRZA 1D5BA 4BZ1H 4TSAL 3P11H 1FVEA 1LO4L 5K9QI 2DI8A 1OP3H 2P48B 4X7EC 5IUSA 2FBOJ 2HT2C 4LCYA 3MV9A 3L1OH 4J3SA 3LB6D 4XP1L 4HK0A 5EOTA 3STLA 3F6LA 1A3LL 5DEZA 1YEKL 4S1DD 1VKXA 1RURH 4M7JL 4DVRL 1OAUL 4DZBB 3QEQB 5M7QA 5IGXL 3RVXC 3SE4A 3FOMB 1BD2D 2R1YB 1NBVL 2R56L 3ZDXF 2RFXB 2OI9B 4OV5A 1KTDA 3MJ9L 1JYNA 1K2DA 3V8CA 3LMJL 4XCYB 5HVFB 1R3HA 4KKLC 4X0KB 3KLAB 2W9EL 2O5XL 4KVNL 4XVUD 2G60L 2DWDA 5FCSH 2VZVA 3VXUA 3VD4A 4XGZB 4UDTA 1YEIL 4H8WC 5DMKA 4PJGB 4HKBA 2W65B 4F33A 2PW1A 3HI1B 1J0JA 2UWEA 2P46B 2OZ4H 4YFEA 5KN5A 3RWGB 3FN3A 2ORBH 4UT9H 3WNLA 3LEXA 3KYMB 3Q2CA 3CX5J 5L0QC 4I18A 3C60A 5AYUL 3BP4A 1Z3GL 5I1JL 1I3RB 1QD0A 2OSLA 3VFWB 4E42A 2XTJD 3FAXA 4YK4C 2NYYC 2V7HB 2R4RL 1NEZA 1FLRL 2NLJB 1GH7A 1YQ2A 1FAIH 2D7TH 2ZG1A 3CXDL 3F6IA 5CHNB 5IVOA 3LKRB 2PXYC 1RU9H 3BSZL 1IBGL 1MCNA 3NZHH 3VWKD 2HLAA 5I1CH 3BOVA 2J6EL 2YOCA 2XTJB 2X4SA 4XXCC 4ZFGL 1KBGL 2ERJB 5MENA 5HHME 2X2YA 1A1OB 4XP5L 2I60H 3I9GL 4ISVB 5KG9A 1D5XA 4R0LC 3RWFB 2P47B 4PP2A 3VWKB 2CUHA 5KS9A 4HFWA 4RRPG 2X9YA 5DJDB 3T2PA 4Z7VB 4ONFL 1KOAA 5FUOL 3WUWA 3EOBA 4WWKD 4YBLB 4ZNCD 4L8SA 2X4UB 5E5UB 3T2QA 3GKWH 4JY4B 1IAKB 3FO0H 2HFFB 1WV7T 1ORSA 1ULVA 2BVUA 5CAYB 1IAOB 3RL1A 3FTGB 3VI4E 4L3EA 4I2XA 5KVMC 1FFNA 5EORL 4YO0A 2OLDA 4LL9A 3RX8A 4G9DA 5MEOA 4RGOL 4DN4H 1ETZB 4GKOA 3T3MF 2Z91B 4PY8J 4LHUG 4N9GB 1P84J 2EE3A 4MJ2A 2VH5L 5TDPB 4H0IA 3UYOD 1CF8H 3FQWA 4X4XB 4NNPL 5FA3B 5AAWA 4K94H 1NGZA 4B0MM 3B8YA 2VXVL 3RY4A 2JJUA 5C0RL 4BH7A 1J5OL 2QSVA 3C5ZD 1C7SA 1KCSH 4JFOA 2H26A 4J8RA 5GZNC 1QLFB 5EFIA 2DLFH 1H3TA 5KVGL 4X99A 3CIQA 4KXZI 4LCWD 2OJZH 5IHZA 1I7TB 1MQKL 2CK0L 1T2JA 1WTLA 2V17L 5DD5H 1EAPA 3C5ZB 4XTRD 4CVZA 1EEZB 1R6VA 4X6CA 2Q8BH 1W2KT 1E6OL 2YMXL 4RFEB 1UQSA 4LCWB 1WK0A 4X4YA 2YC1A 2IPKB 1Q94B 2VRAA 5DSCA 5HI3D 5D2LB 1KTKE 4LCCB 1PW3A 1OTSD 3EKCA 3OSKA 3V6ZB 1FVDB 1RK1B 3N85L 3O3DB 4QY8B 3CFIC 5FK9A 1KFAL 4DGYL 3PQYE 1OSZA 1UXSB 1CXKA 1J8HD 4ZO6A 3W0WE 1OP5K 5DMYA 4L8DB 1L4IA 3U9UB 5I15H 2NW3B 4F7MB 2VZUA 1OPGH 5IW3A 4PGJA 3UTPE 3OKOB 4ZODA 4LRIA 4GT7A 5HVHC 5HXMA 4OLWH 5JMRA 5CS7A 1J8KA 1RZ7L 1MFCH 5BV7C 1RUKH 1Y18A 4E41A 2J1KA 1XGRA 1RJZA 2H32B 4KVCH 4QYOA 3TCLB 2XQYG 3EYQD 4JHAH 4RMQA 4MAYD 3KLHD 5CZVH 2NZ9C 4U7SA 4Y4KC 2H1PH 5JA8B 5KSBB 3TBVA 3MUY1 2A2QT 1JK8A 1NCWH 3CXHJ 5C07A 2EKSA 1WBZA 3QUKB 4MAYB 2VO5A 5TF1L 3QQ3A 3CMGA 4ZUUA 4W6XB 1T0MB 1B6UA 1Q0XL 4Z77A 3TNNB 3JTSB 2EZ0C 4ZXBC 3U79A 3T0EC 3MRLB 4RMTA 5GJSL 4KHXH 1BJ1H 4YWGL 3TV3H 3PHQB 1ES0B 3MFGB 5DJ8B 4UOW1 5F7LB 3ZYOA 2DQFA 5L6YH 4NO5B 5J11C 4MA3A 4XCFL 5J06A 4CAGA 4HT1L 3F58H 3QJFB 1P7KA 3MV9E 5F9JB 4HIEA 5K59F 1HHHA 3HR5B 4M00A 4OCXH 1MCRA 4YR6A 4H1LB 1JHLL 5LAXB 1KEMH 1PLGL 4I3RH 4HFUH 2AVGA 4CRPA 2F5BL 1CFVL 4QT5A 5C0JB 2JCCA 2VDNH 3QJHA 4LLAA 1X6NA 3G6JB 4BQ9A 5D7LA 5EWIH 3Q6FB 1CFTB 3H42H 3FT4B 1JGUL 2VWEC 3X3FL 1JFQH 1MLCA 3KHOA 3VFGL 3QPXL 2D0GA 4MX7A 2Q7NA 1U92A 2QTEA 5JXAH 2Z31A 5ICYB 4NBXB 3VFNA 1NGPH 2AQ3A 1T2XA 2FWOA 3SO3C 4LDOB 3BZ4B 2WLZA 4XC3H 4NO0D 1U8IA 3DX9B 3VXUE 2VUYA 4KDWA 4PJXB 5D6CB 1ZT7A 5I66A 2B5IB 5I16A 1FNFA 1TVBA 4BZ2H 1D9KD 1J88A 1MOEA 4O2EB 2J4WL 2QQQA 3FRUA 1X5FA 2VLJA 3L7EA 5D72L 2UWEE 12E8H 2XZAL 1LEGA 5IB5B 5T33H 3WNPA 1ZT4A 3TBTB 3GNML 4YAQA 2VXSH 1RK0B 4NO0B 4X6BA 4WW2B 2FGWL 3KPPB 2EIDA 1M1SA 3QG6A 4NQSA 3MQIA 1D9KB 2GQHA 1PG7X 3D0VA 4KI1A 5I8OL 1VFMA 3KWWA 4Q0XL 4PJGF 1WCBA 3FAWA 3RA7H 4LDLB 4HJ0C 4GG8B 4XC1L 3TPUB 1P69B 1W0YT 5DHYB 2H8PA 4O4YH 1E4XI 1MFBH 3WE6A 3VRIB 1L0XA 2V5YA 2ZKHL 3DI2B 3OAZH 1ED3B 3TT1H 4JO4L 1IGTB 4O2CA 3RHWF 4P9ML 2QHRL 4K2UH 5IWLA 3UPRB 1SEBB 4UILH 1JV5A 5KS9E 2NTSP 4Y5YB 3ULSB 2BERA 1A6UH 4IJ3B 5EOCH 1CLZL 2F58L 5DUBB 3CZJA 1A5FL 4M61B 5HPOA 1JF5A 3BIAX 1EHXA 4NZDA 4OZFG 5F70A 4R26L 4X9GA 5DDHB 5D9SA 1KTRL 4WI3A 4EI6A 2I9LB 5DJZB 2HN7A 1HHJB 5IB3A 1DN0A 3MX0A 4L3EE 4I2XE 4Z7VF 4OLVH 3I6KA 1MF2L 3ISWA 3VXRA 1S7UB 1RUAH 3S35L 5HGHB 4OBSA 2ZUWA 4H5SB 2JTDA 1FYTD 5T3XE 4HPYH 5F6IB 1HNFA 3OJVC 3LN4A 5DJ2B 1X5ZA 1OGAD 2VIRB 4H25B 4LPYA 5TH2A 1KN2H 4EUPG 1NGYB 1FIGH 4F2MA 4GLRI 1HHGB 4KRNA 3S34L 4TQEL 3NPSB 4YHNA 2H3NB 4WI8A 2BMKA 5FAAA 5J6GA 5BW7C 2O5ZL 1OGAB 2F19H 3MV11 1TQCC 5KVFH 2BNRD 2X4QA 2ZCLH 4DKAA 3DECA 4X6CE 1RHHB 1JWUA 4A6YH 3DO7B 1MWAA 4FFZH 1EGJH 3WFDL 4IBLT 3TVMD 2XA8L 4UQ3A 5CUSL 2BNRB 2OL3A 1A6PA 1U36A 2NY0D 4XNQA 2LU4A 3TBYB 2LAAA 3LEYL 4JN1L 3UJJL 1A1MA 5GS2H 3T3PF 3GSXA 4WO4A 2VLKB 2ICES 4RAVA 2W9DL 5FYJL 3TVMB 2XFXB 3EYVB 1YEHH 3PDOB 4MWFA 4GAGL 4H88L 5C6PB 1INDL 4U1KB 2WUCL 2NY0B 4IIQB 5DJ6B 2PUQT 2WUBH 2GSGA 4HS8H 3O2DH 5D2LF 1AGDA 3T8XB 5HYSA 4POZD 3DSNA 1ADQA 3PWJB 2Y36L 5DRNB 3PGCB 5IQ7H 1CU4H 3H9SA 4K9EH 3K0WA 4M7LH 5KANG 3U9PL 1I9JH 4GMSH 4LLVA 2R0ZH 5J56B 1SY6A 2WBJD 4NO2A 4XX1E 2E3VA 5HPMB 3E3QC 4F8TA 4YDJA 3BAEL 5ACLA 2R0LL 4HS6A 1ZS8A 4CVXB 4YFDB 2Q76B 4U6HA 4XPTH 4WHYH 4CMHB 3R06A 3SDYH 2C4FT 1PGRB 4WHTA 5EO1B 5I30L 5JOPE 4JFDA 1IC5H 1GIGL 2AJSL 1QRND 2QQLL 5C0GB 3WJLC 5C07E 4RWYL 1DLFL 4DN3H 3LHPH 3D3VD 3V6OC 5JUEH 1NCBH 3GSQB 1VFBB 3MRCB 3CX2A 3PF2A 4R4ND 2FJGB 1MLBB 2UY7A 1RMFH 4MA1B 1E28B 1KTLB 5E08H 3IXAA 1J0HA 3M1BA 5CINH 3DMMB 5KSBF 3QNXB 3D3VB 1M4KA 3MRKB 1I4FB 5INCA 4U1MA 1E27B 5DGQA 3CLFH 3WIIH 2VZSA 1ONQB 1E4XL 5DO2C 4YFLI 1U8LB 4LASH 1CD1A 2PW2A 4KHTL 4X98B 4C83B 1GC1L 2VKWA 3IKCA 1U58B 1Z6JT 3QZWB 2NY5C 2JCCE 4KMQA 2FX8H 1UZ8A 5I18H 1UB6B 1UENA 5D7LE 1HH9B 2C1OB 4OD1L 4UAOB 2CDGB 5HHNB 3MLWH 4KMLB 4LP4A 5GSRB 2XWBA 3QIUC 4OF3A 3QUZA 4L8BB 2Z35B 4IRJA 4WFFE 2DM3A 4PTTB 3GRWH 2HMIC 4HS3B 4CVUA 3BD4A 4TVPL 3U0TA 1ND0B 3ARDD 3GO1L 3WLWD 1DQDL 3QBTB 3G6JF 2FB4H 2AXFA 3AREC 2CIIA 1OTUD 2VLJE 4OJFL 2ZNWA 4J6RH 5FO9A 4WHDA 2EO1A 4O9HH 1VFOA 3ULVH 4P2RD 1QFWI 3ARDB 4WUUD 3IFLL 1ZA3A 3U7YL 5CIPH 2AQ1A 4JHWL 5DFVC 4PJXF 3WLBA 4BM7A 4LVNC 4PJ5D 5ALCH 2DD8L 4JFZL 4JZNA 4KK9C 1UB5A 4R4FL 5EZIL 1U8MA 5F1NB 5JW4N 5DYOA 5ACZB 2YK1H 1I3UA 1UWXH 4F7TB 4RFOH 4P2RB 2OTPA 4UB0H 4WUUB 5TE6H 5FYLH 1YC7A 4P9HC 5LGHL 2N56A 2YEZA 2YRZA 5I2IB 3BO8A 4WW2F 3P2TA 1FH5L 4UU9A 3TO2A 4PJ5B 3ARGA 3O3AB 4TUJB 2X4RA 3C09C 4RFNB 3L3KB 3QISA 1MAKA 1U8JA 4FABL 5H8DA 5IEKA 5FOJA 3I02B 4OIIH 5IQ9A 3O9WD 3P4MA 5TF0A 5E2TH 4LHQB 4Q9QH 2ATKB 2DWEB 3NZ8A 4EDXB 4LSRH 3K2UL 3BJ91 4K8RD 2NW2A 1S9YA 3WFEH 5DUMH 4XB7A 4F57H 3WO3B 1OB1B 4UNTA 4QXTB 3IDUA 3ESUF 4JFEA 5HHOA 4G3YL 4AENB 1GYAA 1JIBA 3O9WB 1RY7B 4C58B 2AJZB 3HZVB 2XZZA 3P3YA 4YIQA 5CEXA 4P5KA 2W07A 5ETUB 4OLEA 2YBRA 4RBPK 1EVTC 4OF8A 5DVOA 3VXRE 3PE9A 1II4E 3QI9A 5C0FA 3LPFA 3ZE1F 4M1DH 5ESQB 1VEOA 2ZSWA 1ZVSB 2CDFA 5I1GH 3EDKA 4BSVB 3EIFA 5GS0D 3CFBA 2AABL 2UVEA 1XCQA 1RSFA 1S9XB 2IAMD 1RIHH 1TENA 5ESAB 2X09A 3WS3B 4M6OH 4Z0XB 4I1NB 3FO9B 2C3WA 4G8IB 4G6FD 5EDXA 2A77H 4KRPC 1QSFB 3QFJA 4P4KC 3QUXA 4P3DA 3RNQA 5HHXH 4J3UA 2YZ1A 1XGQB 3TA3A 3C6SA 3WIHA 5FGBC 4MJ5A 2C3VB 1V3KA 2HJKA 3NA4A 7FABL 2GITB 4G6FB 4TSAH 3JWDC 4HWEL 4S11A 5T3ZE 3P4NB 3VU2A 4Q2ZA 4ZQKA 3HB3D 4ERSL 4Y89A 1XGYL 3NACH 1YEKH 4DVRH 4RCAA 1R0AH 5DA4A 2E7CA 3D69A 4LPXA 4PJCB 3SEPA 1WIUA 2R56H 4PJBF 3GMPB 1CQYA 1AGEA 3GSWB 4MQ7B 3REWA 2GCYB 4NNXA 4Q6YA 4H8WL 5J3HC 5C08A 3NGBC 3LQAC 1G7PB 2PYED 5DJCA 3GIZH 2O5XH 3H9SE 4KVNH 1QFOA 2ESVD 3DVIA 3OKKA 3OV6A 4HGWB 4HKXB 1FORH 4L8CB 1YEIH 3HMWL 3Q6GH 5H35A 1RZFL 3OG4B 2VLLB 1G9ML 5B39A 1JNHB 5E8PB 3BGMA 2PYEB 4X4ZA 1EMTL 3SJVB 3NIDE 2ESVB 5AYUH 3ZDXE 4JFDE 1Z3GH 1B0GB 3SCMC 4NDMB 4TULL 2R4RH 1FLRH 4R7DB 8CGTA 3CXDH 4XVSL 5E8EB 3DVFA 1EHLL 3OR7B 1FV1B 5GGTA 3D39A 3O4OC 3QEQA 4AK1A 4X7DC 3FRPA 4MNGB 4PV9B 3FOMA 3KYAA 3EFFB 2NTFB 2R1YA 1KBGH 4C59B 1DQTA 2RFXA 2JJSA 4ODTL 4K71B 1TTUA 4MXQC 4Z8FL 2E5EA 3MGAA 3HE7B 1HWHB 5L8KB 4RGNE 4XCYA 4EUPB 4J12A 3KLAA 4OLXH 1BD2A 4TNWF 4QXGL 5EPMA 3U0WH 5IESH 4MA8H 4XGZA 3RI5K 4O02L 4PJGA 2VKXA 2W65A 4G5ZH 1SBSL 2CO6B 3RWGA 4JJHA 4P59L 3MZTA 2OJEB 1T0PB 3K8MA 3KYMA 2VDOH 1OTTD 1S9VB 5IJKA 5FYJU 3MCKA 3O6FD 1UCBL 5IBTL 2Q86B 1I3RA 4HUNB 2HTKC 1JNLL 2V7HA 4OFKA 3ZKNC 2NLJA 1MRCL 5EORH 1BIHA 1HKFA 5I1HL 1QO3B 4RGOH 5CHNA 2Y4SA 3A67L 3LKRA 1UM4L 3ULUD 1JMZA 1WCQA 3O6FB 4NNPH 4MS8C 5EUKB 2MFNA 1CXLA 3QUMH 5SX4H 4PG9B 5LBSL 1MFEH 1MCPL 1QNZL 5C0RH 4N8VG 3QUYC 4JDZB 1A1OA 3B83A 1J5OH 4ISVA 3RWFA 3VWKA 3IETB 4NHCL 5GGQL 4GAJL 1OT1A 4JQVA 1IFHL 5DJDA 4DZ8B 3R1GL 4Z7VA 5KVGH 1IQDB 2C1PB 3A6CL 2FHBA 1S7TB 2XACC 3T3ME 1ZTXH 3DMMC 4GBXC 4N0YL 4NZJA 2YPLB 5KZCD 4MXVF 4GSDH 4J4PD 5JIPA 3HMXL 2YMXH 4JY4A 1IAKA 2NXYC 2HFFA 4HLZG 2DLEA 2VE6A 5D2NC 3TN0D 3U82B 1IAOA 2EH8L 3FTGA 4WWKA 4XB8A 1QKZH 4LPCA 5JW3L 4ACPA 5KZCB 1ETZA 1PSKH 1CFQB 1F42A 2BSSB 2Z91A 4N9GA 1OAZL 2YKLL 4YGVB 5TDPA 3SQBA 4MD5B 3CSBA 5DK2B 1Y6MR 5F21B 3RL2B 3UTTD 4X4XA 5F9AC 3TN0B 3N85H 5FA3A 1K5NB 4ODXB 4JFEE 1JL8A 5HHOE 1EAJA 4DVBB 4W68A 5FCUL 1BJMA 1LE9B 1MUJB 4AEIL 1NBYB 4K7PY 3UTTB 1AXIB 1YDPB 5BV7L 1QLFA 1RJLB 1ERNA 1GL4B 1DQML 1C5BL 2QEJA 4QNPF 2G2RB 4G8GB 2XWTB 4MXWH 4Y4KD 1I7TA 4OQTA 1RZ7H 4MQSB 4HWUA 1EUTA 1T1WB 2M1KA 4NNYB 3C5ZA 2DQEL 1WJ3A 1EEZA 3B9AA 5ALBL 1NLBL 1HQ4B 4WI6A 1BX2B 4RFEA 5F1IB 2AJUH 4LCWA 1I85C 4WY7L 2D9QB 2Z93B 4JM2C 1Q94A 3O0RL 1YMMD 2CKNA 5D2LA 3SGDI 2CR6A 4LCCA 1J87A 4QRUB 5CJ5A 4LRNL 3V6ZA 1YZZA 5TF1H 3HCVB 1G6RH 3QFJE 5C0AD 1A2YB 3O3DA 4QY8A 3OKYA 3M8OL 4L4VD 1UXSA 1H3VA 3IDIA 1GAFH 1T66D 4H26B 4U1NB 1KB9J 3HRPA 4L8DA 3U9UA 2NW3A 4F7MA 4QHUB 4JREB 2FDBP 3RVUD 3TBSB 1G0YR 5C0AB 3OKOA 3FHQA 3TYFB 4L4VB 5HD8D 1J8HA 4G43B 5J1TC 1JHLH 5D7KD 2OXGA 4RZCB 5C8JB 1NAMB 4F15C 2P8MB 2F5BH 4R8WL 1CFVH 2DQCL 1VGEH 1VFAB 2H32A 4CDGC 5EO9B 1EBAA 5F7MC 3WO4C 1JGUH 3BDYH 3VFGH 4KJPD 2GEEA 4LEOB 3QPXH 5KSBA 1YJDC 1C5DB 4CN6A 3RIFF 3RPIB 2NXZD 2AK4D 3MODH 1MI5D 4MAYA 3ARBC 1YYLH 1T0MA 3PJSB 4S0TD 4PJCF 3JTSA 4F9PC 2J4WH 3VG9C 5D72H 5I1DB 4QHNB 4DK6A 3MRLA 4M6AA 1GGIH 3PHQA 1ES0A 3SKJL 5DJ8A 3WV0A 4DUWA 4KQ4L 2NXZB 5J12B 1MI5B 4AY0A 4NO5A 3U4BH 2GFBA 4WHYG 4J2XA 2AEIT 3VFVB 1BREA 4WUKL 3QJFA 1E4JA 5I8OH 5F9JA 3HR5A 5HYEA 1AGFB 1F4YL 4LSQL 4OCWH 3OG6B 3K4ZA 4H1LA 4Q0XH 5LAXA 3U46B 4XVJL 2E8ZA 1QBAA 3QEQE 1ZGLM 5C0JA 1MCKA 5J8OA 3G6JA 4XMPH 5DVKA 3Q6FA 1CFTA 5F7NC 2VXQL 4PLOB 3FT4A 3AGVA 5C6TL 3K4AA 4EKXA 4JO4H 4KXZH 2FBJH 1F45A 4KAQH 3ZLQC 2XY1A 3C6LC 4BJLA 4YE4L 5ICYA 4WI5A 3BZ4A 2DTSA 1NKRA 3MOAL 1CLZH 2F58H 2E27L 1N6QL 4PJXA 5D6CA 3ARPA 2C4FU 2JELH 3CLEL 2NQCA 4O2EA 4PJGE 1SBBA 1ZVHA 1KLFA 5F88B 2NY4C 5IB5A 3GGWB 3HI6L 3TBTA 3ZKSD 1MCOH 5LCVL 1RK0A 4PG2A 3RDTC 4NO0A 4HV8A 4WW2A 4WV1B 3BESR 3VFUB 1D9KA 1H5BC 4NZUL 3VXMD 1MF2H 2YZ8A 4ZS7L 1KIUA 4BELD 3SY0B 3GSOB 3S35H 3D5OF 3LKPB 3TPUA 5HY9B 4LKXB 3UAJC 4JFYB 5DHYA 4QRQA 1X5KA 1OW0C 3VRIA 4IS6B 2XTJE 4KZDL 1ED3A 2VZOA 3VXMB 4QRPD 3B6SB 1IGTA 3O6KH 2EDEA 1WWWX 3DARA 4TQEH 2FHCA 1SEBA 5IB2B 1V3JA 5D1ZB 3RKDD 2YRPA 1YECL 4PY7B 4Y5YA 3ULSA 1LGVA 1CICD 3G5XA 1QZ1A 4Z7VE 5ITBL 3SGEI 5DUBA 4ZPVB 4Y16C 5GRVK 3TO4D 5BCAA 2O5ZH 2MOVA 4QRPB 4M61A 4CN4A 4JG0L 3TIEA 5TE7L 1LNUB 1RZGA 4YHLL 3HPLA 4YXLL 2GUOB 1CICB 5DDHA 1F5WA 1DJSA 3TBWB 3V0VB 5ITFB 3ULUF 4ZS6D 3DYPA 4MNQD 3IU4L 2I9LA 4LGSB 1L0QA 5DJZA 3TO4B 1HHJA 1BFSA 2XA8H 5CUSH 3AXLB 1LILA 3MLRL 5JZ7D 4MGXA 4YBQD 1CBVL 2NZIA 4JN1H 3UJJH 3RGVD 1QFUH 2KZ1B 1S7UA 1MCIA 1KN4L 5HGHA 5FB8B 3X13B 2BRRH 5KVDH 4H5SA 1SMAA 4JKLA 3QIWC 4MNQB 3EDEA 5GHWL 4G8FB 1HI6B 4GAGH 4H88H 3P77B 2YSSA 5DJ2A 1FN4B 2VIRA 1HYSC 1NGYA 4UV4L 1KCVL 3EO0B 1HHGA 4U6TA 3RGVB 2XY2A 1KLGB 4OBRA 1JPFB 3RU8H 2H3NA 1FFRA 5J1AB 4ODHL 1FYTA 2XRAH 2P8LA 2NMSA 4M8QB 1G7JB 2Y36H 1M7IB 3BD3A 1HN1A 5DZNA 3IDYB 1XZ0B 4FZEL 1I3VA 1OGAA 3I85A 5EZOH 3KPOB 4BH8B 5GRJH 1C1EL 5B38B 3T3PE 1MRDL 1TVHA 3OX8B 4K3JH 4HK3N 1WISA 4MHHG 1RHHA 3DO7A 3X11B 4U7MA 4LCWE 3RBGA 4LFHD 4U1SB 5ICXB 4PJBA 5I30H 5FM5M 5E8DL 1N59B 1GIGH 3RGHA 2BNRA 1JWSB 5D2LE 5IHUL 4M62H 5D1XC 4BFGA 3TBYA 2X4OB 4PJDB 4RWYH 4YXHL 1DLFH 1CLYH 4LLMB 4V2CB 4MA7L 1TNNA 5HBBA 3CSYB 3KYOA 4LIQE 3TVMA 2XFXA 3EYVA 3PDOA 2CLRB 1HSAA 3DTXB 4ZFOB 1SJVA 5IBUG 4TVSa 1OAXH 5HHQB 4IIQA 5DJ6A 1P4BL 3O3EB 4FRWA 1CGSH 4HUWB 1P6FA 2EE9A 4PGCB 4YDLB 5K9OB 3KPLB 1I1FB 3RVTD 2E7HA 1B88A 5HGBA 5SWQA 3I84A 5IMMA 1ZLWK 3PWJA 1BIIB 5DRNA 1E4XH 4N8VB 2NY5L 4U6VH 1VEPA 4PJ9D 1JGDB 4WW1B 1J8HE 1V5JA 1MHEB 4XNUH 1NBQA 2WQRA 1NGQL 5AUMA 1E0OB 4WFGD 2KQNA 5HPMA 3VI3F 2I27N 3FONB 1S9KC 1MHHB 4CVXA 3FT3B 2HMID 5TDOB 2Q76A 5H37G 1ZGLB 1IQWH 1XR8B 4PJ9B 5EO1A 2OTUB 5TQ2L 5KSBE 1I8KB 2MKWA 3W2DH 4M1CC 4JQIH 5C0GA 5L88H 3BPLC 1NFKA 3QNYB 4Q74A 5E4EB 5DURD 1ZANH 3SE3C 3GSQA 4NUJB 1MAML 1VFBA 3MRCA 1DQDH 2FLRT 1LVEA 5BMFL 5HI5C 1MLBA 1RV6X 1E28A 1KTLA 3OBAA 5T1KD 5D7JC 1QRNA 4UTAL 4HJGB 2Z9TA 1RVFL 1A6WH 3TFKD 5DURB 1HOCB 2FNBA 3D3VA 1S3KL 3BUTA 2JF1A 4XPFL 2D7PA 2VLMD 3MRKA 1I4FA 2WWKO 4EN3B 5BS0D 1D5IL 4TOYL 5DD6B 4LQ1A 3S37L 1ONQA 3U7YH 4JHWH 1U8LA 2AEPH 4YZFF 5T1KB 2O61B 5I8EB 4WGWB 4X98A 1J1OL 2DMBA 5EZIH 3RFZC 5GQBA 1K85A 1U58A 3O8XD 4GLRH 3QZWA 1QQDB 4PP1D 1S7XB 3B3IB 5BS0B 3G6JE 1UB6A 4PREB 4UT7H 5LGHH 1HH9A 2C1OA 3ES6B 2CDGA 2HFGL 2J88L 1N0XL 5HHNA 5CGTA