1IC7L

Crystal structure of hyhel-10 fv mutant(hd32a99a)-hen lysozyme complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic7L00
5AZ2H 2X44D 5EOCH 3BZFA 3HI6H 1T2QH 4LRNH 3P4OB 4RBPH 5CHNA 1NC4A 4P2OA 4RGOL 4N0UB 1ZK9A 4B41A 2PYEA 4U1LB 4RRPA 2J2ZA 4PRDA 3CMOL 4PGEB 3L3IB 4EN3B 5H2BA 5EOCL 3IDMA 1IAOA 4UDUB 3FN9A 1Q72H 3C6LA 3RL2A 3DX6A 3W9EB 1TZGH 3FQWA 5IJKA 3NABH 4HG4K 1WBZB 4LOUC 2APVA 3TJHD 4LLAA 2X4UA 4KMTL 4JREC 1T0NA 3R1GL 1JPGB 2YUXA 5ANMB 1M4KA 1KIQA 3SBWA 2EH7H 3L3GA 1JYWA 3MV8A 4X6BB 3WJJA 3DUUA 4GW5B 2JJVA 2ZKHH 1MHCA 1S7TB 1A7NH 3IF1B 3HNTL 1FNHA 1S7WB 5DJ6B 4HZAA 5I18L 3L9RB 4KMTH 2A6IB 4N9OB 5E8NB 4HMEA 1NFIB 2NR6C 1CD1B 2XZQH 3BW9B 2E7CA 3RVWD 4DVBB 4HUUB 4RBPK 4NWUL 1WC7A 3AAZA 4D9QD 3H0TB 2V7NB 5KVEL 2FWOA 4GSDL 2OR9H 5E1HB 5BS0E 1JYVA 4ONHB 4LKCA 3JVGA 1XGRB 5FF6B 3T8XB 2Y6SD 1HEZB 2WWMD 4WY7H 5DHVB 4ODSH 1G0DA 3GSOA 4IOIB 1C7SA 1UC6A 4R3SA 3HMWL 4NWUH 3W0WB 5HVGB 5IMKB 5KSVB 2R0ZH 4XVUD 5HGHA 1FIEA 3GHEL 3IJYB 5BVJA 3S3PA 5F7UA 2NNAB 4GBXB 5KBNC 5C6WH 3TPKA 5IW3A 4YDKL 4YHLL 1IARB 5D1XA 5K59F 1CL7L 1UWEH 1QQDB 2ZUTA 2A73B 4X7CC 3QAZC 4Q9QL 4N0YH 1Z0NA 3MLSH 1CTNA 4OD1L 1KXQE 5IROC 1MIEL 5C0JA 3MJ9A 4Z7VB 1OP5K 3HR6A 2H45A 4PTUB 5JIPA 4HK3N 3QH3B 5I17B 1SJEB 1T21A 3MLPA 3VWKA 4R4ND 5E6IC 4Z7UF 3QUMH 4OIBA 4BH7A 3GO1H 1I9RH 2D4DA 4LAQL 4QRRD 2EO9A 3KYKL 3UPAA 4NKOB 3WV0A 1FLTX 4HC1L 1J05B 4WI8A 1WISA 5DJYB 1MCOL 4MA7H 4NQVA 5IOPB 2YPLA 4NQVB 5D7KE 1RPQA 2VIRA 4HIIB 3RX8A 4UOJA 2VLKB 5EZLB 1F4XL 3VH8B 1N59A 2XY1A 5I73B 1KC5H 3EKCA 3WIIH 5FOJA 1FE8H 1CWVA 1K5NB 2R2CA 1F02I 4KK5D 4MXVE 4IHOB 3P30L 3QH3A 1YMME 1IAKA 3NZ8A 5I17A 3S7GA 4ZS7L 4NWTH 4FZ8H 3RJQB 3BP4B 4U1JA 3RIAF 1VPOH 1O7VA 5IB5A 4KH2A 5JOEA 1GGYA 3B5HA 3MRGB 3T4AB 1FL5B 5KSAD 2Q8AL 3TFKC 2JCCE 5T1LA 5E99H 1R5VB 5GRUH 2VXTH 5DHVH 2GEEA 4NQXA 15C8L 4F7TA 5IJVB 5EWIL 4Z95H 4JPKH 1OB1B 3MV9E 2VKXA 2X4QA 1FV1B 1F90H 4LP5A 1HYSD 2X9WA 4LIQL 5I74B 3EDKA 1NBZA 1XGUA 1UB5A 1YUHA 5GS0L 1MJJB 1FO0H 1EO8L 3GKWH 2FL5B 4HCRL 4QRQA 1K4DB 3WN5B 3P11L 1FBIH 5J6GA 1IGJB 1KB5H 2P5EE 4ZOEA 3RI5F 1IZJA 3UPRB 1J1OL 2XACC 3PP4L 3MLWL 2EZ0C 3O9WC 2EDJA 3QBTB 1G6RA 5E94B 3SKOB 3QQNA 4HPYL 2IC2A 3O4LB 5EA0H 4KHXL 5GISL 3FTGB 3D85B 3O3DA 4CADA 4X99A 1I8KB 5EUOB 1JE6A 1YEGL 2BVPA 2OZ4L 3JTTB 5I0DA 1KB5L 1PG7X 1FV1A 2ZG1A 4JY5H 4L1HA 3LKQA 1W0YT 3S97C 1HIML 2UVEA 4YQXL 3EYFA 4PJXA 3KR3H 1OAUL 4Y4KD 2GT9A 1I7RB 4HLJA 5CD3A 1QYGL 2EICA 3C2AH 4NM8H 1DQLH 2DI9A 4LMQI 4JPWH 5J57B 2PN5A 4XPHH 5CEYA 1NANH 5LGJB 2X4UB 1YEEL 3BIAX 5D6CA 3PNWB 4IM8A 4FTVB 4JFEA 3LHPH 4FTVE 1CLZH 1QQDA 3BI9X 1BWWA 1NBZB 2DTSA 3C6SB 5D5MF 1KYOK 4MS8C 5DMIH 2JLLA 3HLAB 3GI9L 1B4JL 5IW1B 2ZUQC 1AI1H 1NC4B 2EYRB 3KYKH 3GSOB 2PW1A 3CC5B 3CNKA 1ZHKB 4PJ8B 4U0RB 4K7PY 4LCIL 3IKKA 4OFVA 4PJ8D 3HI1B 1QBLH 3L5XL 4ONOA 4X7SH 3RGVA 4MQTB 4MVBC 4HUXA 5AEAA 2X1WL 1J1PH 1L7IH 2AEPH 3U7YL 1T1YA 2MHAA 3GIZL 1CZ8H 3QIUB 3RGHA 2V9QA 4H1LA 1LD9A 4L8DA 4O58L 3ROLB 3SDYL 4JZJC 3P77B 1HN1A 3V9FA 2MJWA 5ESAB 1I8LA 1RHHA 4FFWD 1N59B 3MLRL 4NQDE 4MLSA 3FO1A 3WJLC 5IEKA 1HXYA 4PJFA 4XHJD 3T04D 4UINH 1JF1A 1YEIH 2CGRL 2Z8WC 2K1MA 2Z93A 3Q6GL 4BZYA 1BWMA 5AZEH 3T0EB 5HDLA 4MX7B 4BYHA 3F6LA 3MRLB 1MSPA 4RFEA 5GHWL 2WZPD 4MJIE 2CK0H 2J4WL 1AKJA 1FVCB 1D5MA 1JHKH 3HLAA 4ODXB 1JWSB 4KHTH 3IJSA 2OQJA 1DEDA 4HD9A 3BP7A 4HWUA 4IMLA 2R2BB 2DL9A 2XA3A 2HFEB 3UTPD 5I66A 2AXGA 3DLQR 2GY5A 5C0EA 1I8MB 3GMRA 4P23D 4XBPB 3MRQB 4G9FA 4LPUA 4PJHB 4NN7B 4X80L 3DRQA 1FAKT 3DWTA 3GFUA 4MJID 4EN3D 3MO1A 5FHAL 4XCEA 5JPNB 1GGTA 2OR7A 2H2PC 1Y0LA 4Z7UA 5FDWB 4YXKH 2GY7B 2DQDL 2PCPB 3ARVA 4KK9C 1F6AA 1EVUA 1RFDL 3HE6D 1AGEA 4YHOH 3UTSB 3MLUH 4TUOB 1H8NA 1U58A 4KUCD 1IEAB 2YOCA 4ZUVB 3T8XA 1AXIB 1A6AA 3RWEB 4PY8I 3SY0B 2X1OA 3QIWB 3BISA 2VLJA 2VUYA 2HN7B 5IMLB 4G6AD 2XTJE 2BVUA 4FQJL 1Q9WA 2OTPA 3BT2L 1FN4A 1BOGA 4QT5B 1F2QA 3RPIB 1R3LA 4DZ8B 1B0WA 4H25A 4MXWL 1MCPL 1G9MH 2WANA 3LCYA 5L7XL 4YHYB 2X10A 4L3EE 3S37X 2VLMD 2XN9E 3HUJA 5I1AB 1FYTB 2P5WE 3I85A 1IILE 1KIQB 2EDWA 3KLDA 5HHPA 1CDUA 4PJAF 3MBEA 3TC9A 3WFEH 3IDJA 5L9DL 5E70A 3MJ8B 1FNEA 1IQDA 2CKBH 4TSAL 5J13B 3OXRB 4ZUUB 3B5TA 4ODXA 1QHPA 2P48B 1EFXD 4M93B 3WUZA 3KS0H 1YEFL 5E9DE 5DJAA 5HGBB 1QSFB 3IRPX 3BP4A 4U1JB 4B53A 1JFQH 1X4XA 4E42A 5C2BH 1J1PL 1L7IL 2QHRH 3BKCL 3QUYB 4XPBL 4ZS6D 5FYLE 5IG7A 1NCCL 1NFKA 4JFFA 3EZ8A 3VRIB 3IETB 4FFVC 2JIXA 2GAZA 5DZOA 1VFAA 4U2YA 1AE6H 3L3KA 4XNYH 3L3KB 2SEBB 2J8UB 1JGLL 1S7QA 2E9JA 1CD8A 3TNNB 4ZAKD 5CCKL 4FG6D 5IQ7H 1JMXA 1JNLL 2VSDA 2AJUH 2IAMA 3N1QC 3B9KB 3QJFB 4XI5C 5EC1A 4F37K 2GITB 2ZSVA 5IFHL 2RHEA 4K7FA 1FZMB 3W0WD 4MMZC 3T2OA 1XR8A 1F4XH 3WUWB 3IDJB 4MNGB 1JGVH 2IPUK 3EBAA 5CZXC 5DHXB 2AJUL 1U8LA 3HE6C 4PRIB 3RWGB 2AJYL 4G6JH 1F5WA 4HV8A 3BP7B 1NSNL 4WV1A 1BD2E 4D0BB 3ARFD 5IBUG 1XF2B 3ZE0E 4C56B 4JG1L 4HKJA 4F15C 4Z7NF 1WLHA 25C8L 4YPJA 1NLBL 3HUJE 5I18H 3MACH 2P43B 1J0JA 4RA0C 5FCSH 5GRUL 4AJ0A 3U7WH 1GGCH 4UT7L 3S35X 2VLLB 3ZTJG 5C70A 2OJZL 2NZ9D 5FO7A 1EV2E 1BAFH 3FRPA 5EOQH 1PLGL 1TJGL 3CGTA 4KU1A 3LMJH 4XGZA 5J8OA 2AV7B 2NY6B 2EE6A 1DQDL 2W59A 4QHLB 1LK3H 3KDMB 5I16B 4UDTA 2WW8A 2DWEB 1T5WB 1MAMH 3LDBB 3P11H 4ZFGL 1N5YL 4PJGE 5FYKH 2R39A 4P4RA 5LJYH 1D3CA 4POYA 2GTZB 1FRGL 1OAXL 4OCYH 5JW5B 4Y8DC 3QT2A 4IIQB 3GMRB 2IMNA 5ILTH 5J1TC 4GG6A 2VLRA 2BVQB 1C1EH 2HKHH 1MY5A 2FL5A 4WW1B 3S96A 1FL6B 1DN0A 2DIJA 5GZND 3NZHH 3BOVA 4JB9L 3CXHJ 1YC7A 4HJ0C 3K74B 3ZO0A 2ATKA 2WINB 1X4ZA 3MJ9H 3VFTB 2IBBA 1RZ8B 1SY6H 3NCBB 3JTSB 4OLEA 1LHZA 1U8QA 1J10A 1NFDB 5ICYB 3LAFA 3WLBA 4K2UL 1H5BB 4K71B 4R26L 1QSEB 4L29A 4G9DB 4CRPA 4OKDA 1MLBB 2FD6H 2Y1VA 1PG7H 1EAJA 5HDBE 5IB5B 3TO4C 3DI3B 4RRPG 3QDMA 1MAKA 5CJ8A 4NHCH 4IS6B 3WIHH 1DFBH 2AABL 2QSCH 3Q0HA 5D1QA 1INQB 4PGCB 3PWVB 1KF9B 4M7JL 3OKEA 1GHFH 4QF1B 2V5TA 3GI9H 2BOCB 3LPGA 1NMCC 3MV7A 5DUPL 5E2VH 2GITA 3CVHH 3MYZA 4OD3H 5FYKU 3QXTA 4Y4KB 3UJIL 1YZZA 3TCLA 5TE4L 1L6XA 5H8DA 3U4EB 1R24B 3TJEH 5J1AB 1ZSDB 4AIZB 4J7RA 5FUOH 1KB9K 4JDTH 2AXHA 4AL8L 4CBPA 3U7AA 1F3JB 5A16B 2W0FA 4OD3L 5FM8A 4OFIA 4TNVK 1KEML 4N8VG 2A9NL 2DTML 1EZVX 4KI5E 4JDZB 2G2RB 4AK1A 2F53A 2R29H 2R0WL 3UTZB 5K9OA 2IH3B 5FUOL 1JWSA 4HBCH 5FCUH 4JDTL 4F37F 4XAWL 3LN4A 5D7LD 3BH8B 4TYUA 4UV7L 3RUGB 1U8IB 3VXRA 4NCC1 5HYSB 2EDBA 2NTFA 2A9NH 1ZOXA 3AB0C 1IGIH 1P7KA 3HPJA 3ET9F 4PLOB 3V4PH 2DBLL 3JWOC 5I76A 1JHKL 4GBXA 5T3ZH 2YD4A 3A6BH 3IKCB 3UYRH 5T5NG 5HYEA 5FCUL 3T3PE 4G42B 1AY1L 4XMKL 4CN1A 4H8WH 4DZ8A 2V2WA 1UQSB 2K7PA 3X14B 4LSQH 2C3WA 4BH8A 4X4YB 4YFLF 3PNWA 4KY1L 2DQHL 4L8CA 2O61A 1MCKA 1TCRA 2HVKA 1L0XA 2WBJC 5F7YC 5HVFB 2VAAA 4NM4H 4KZEL 3FQNB 1G7LA 3UP1A 4ZAKC 4JAMA 2PNDA 2YZ1A 2NZ9C 1BZ7B 2E5EA 5IIEA 4RIRB 1U8PB 4IRJD 3VXPA 2V7HA 1T1ZB 2PW1B 3CC5A 5E5MA 2XZAL 2EDOA 1V3JA 5I19L 3MRIA 4ETQA 4XWOC 2Z91B 3V5DA 2JB5L 5DO2D 5EUOE 5ICXA 2FB4H 4LNRB 1AJ7H 4CU6A 1U8NA 3D25B 1CLZL 4P2OD 2CDEA 1NMBH 3STBA 1NMCB 3QDAA 2ARJB 3WFCH 5IMOB 3BO8A 4Z77B 1ZANL 3SDAA 5FIEA 3F7YB 3VFOB 3VXUB 3D3VA 2APFA 4L4TB 3D3VB 1FNSH 4YXHL 3HZVB 4QOKB 5DD0H 4C4KT 2W60B 4MQ7A 3X14A 1R3KA 2ENSA 1XGQA 4KKNA 1JPST 4N1HB 3WIHL 2NX5E 4RMRA 1IGCL 5FM5O 2Q87A 2PXYD 3TLRA 3T0AA 5C0AD 1Q0YL 4P5KB 1D5MB 3BPNC 4JRXE 4L5FH 3ZE0F 3DARA 4LSUH 1F6FB 4R0LB 5ICXB 3RWCB 4PBWD 5HHME 1IGTB 3MXVL 4IRJC 2CDGB 4DGYL 2CR6A 1NBYA 3VI3E 5HI4D 5FGCB 2JKXA 1BM3H 5CMAA 1ZKAA 2VE6B 4CMHB 5DHVA 3HMXA 4RIRA 4PP1D 4XB8A 2OMNA 5JO5B 1CBVL 4HFUH 3ULUL 2FSEA 1BZ9A 4ONHA 4NSKB 2QKIB 3FB5B 2CGRH 3BZDA 3HI5L 1UJ3A 5KG9A 1TCRB 5F96H 4QRQB 3DJ9A 4U6VH 2AVGA 4MA1C 5F7KC 3CK0L 3L9RA 3CFCL 3O6FD 4W4OC 1FGVH 1V7ML 4F33A 2EDTA 4HJGB 5FHBL 5MHSD 2Z8SA 4KHTL 2BNRE 5C0JB 3AS1A 4X7DC 2X7LA 4I0PB 1ITBB 4MNQE 1VADB 5E8EA 4HUWB 1S5IH 4HXBL 4LPXA 4ODWB 5DD3L 1NBQA 3RNQA 5DMKA 5CGYD 5D72L 2HRPH 3LKPA 3BH8A 4LF3A 4H26B 3LS5L 3MRKB 5E8PB 2FGZA 1LK2B 4JKKA 1GIGH 1BQHB 4F7MA 1NGWB 1OGAB 1ZS8A 2ORBL 4U33A 1DQQA 5F7FA 1DN0B 1FNGB 1RUAH 4HF5H 4JFFE 4JO4H 4ZXBC 1V7NL 2Z35A 5LGJA 1YYLL 3QEQB 4OUUA 4M6MH 4JQVA 3DBXA 1VGKA 4KQ3L 5JW5A 2ITCA 3SCMB 3EFFA 3HE7A 3VW3L 3VGFA 3H0TA 4LU5H 3CXHK 1Z9OA 4JEGB 1HHIB 3FOLB 1SJHA 4LHUD 2Z31C 4ZOAA 4K3EL 5FYJE 5E6ID 3WDIA 5C6PB 4M1CD 4O5LH 3TH3T 1GZPB 1VERA 1GGCL 3LEYL 3REVA 4LBEA 4A6YH 1SBBA 5TFSL 4M6ML 5C7XL 5KVGL 3PGCA 3VWKB 2A6KB 3EDJA 1NMBL 5A2FA 1NCNA 5CZXD 3S3SA 5HTSA 3UC0L 1BBDL 5IFAL 5E8DH 3SEPA 2XFXB 1ZANH 1BBJB 1BJ8A 1U8OB 4JJ5B 4MGXA 3SE4C 4LSDA 1T0NB 4MXQC 4TVPD 4JE4B 4M6OH 4KFZC 3UTQA 5C86A 4G9DA 3EZJB 5BV7C 3QWOB 4APQC 2J88H 1NAMA 2VDLL 3L3JB 1FRGH 3TO2B 3ZKQD 3IXTA 3ARPA 1RJLA 2I5YL 3QUZA 4Y19A 5EORH 3VMOA 1S7SB 1X5ZA 5TE6L 3KYAA 1RZ8A 1CICC 3QZWA 3NA9H 4PJ9B 2R0LL 2MPAL 4MAYA 3KYNB 1KIPA 3SGJC 3HRZB 4YDLC 4OCXH 4HPOL 4HS8L 1OCWL 3X12B 4J2XA 1M7IB 1NGQH 4H0HB 4WW2B 4XBGA 2YD6A 1IAMA 3L5WA 3K80A 5D2LB 3TBVB 2G5BA 1E4XL 1K8DA 1ZLSL 3WIHA 4HQQH 3X13A 1JGDB 3UTZA 5K9OB 4K3JH 2IH3A 1HQ4B 3QJFA 3PUCA 3AB0B 3U1SH 1C5DA 4AM0A 1UXSB 4O2EB 3P0YL 4K3DL 5IB4A 4TOYL 5KVFH 4HIHA 4HT1H 3VH8G 2CKBA 1OTUD 2A83A 5IHLB 4KRPD 2DWDB 1ZHNA 2A0LD 4IRSB 4AIZA 1MRFH 3IU3B 4TVPE 4NFCA 2OBGA 3KS0J 4J3WA 2ZSVB 1NJ9A 4NNYB 3QEGL 1VESA 5JZ7D 1QVOB 4XAKD 4BH7B 4HZLA 1VFOA 5DVKA 4QF1A 3ARQA 1KGCD 2FYYB 1WFUA 4W81A 2YN3A 5F71A 1KELH 5HI3C 1MCJA 3UTTA 4ISVA 1NEZB 3QFJE 1ND0B 3VU2A 4LDLB 5KZCD 4QXGL 3QDMB 4QCIB 4HIJB 1BQHG 3ZKSD 5EZOL 3STLA 2KH2B 3X11B 2BRRH 5TE7L 5HJ3B 2CIIA 2GJJA 3S88H 2AGJH 5DJAB 5HGBA 4HK0B 3QSKB 3UTPE 2FNBA 4KKAD 4OI8A 3DHMA 5D5ME 3MOBH 4Q2ZA 3T08A 1V8HA 4WGWB 4BUGA 2YD2A 1KTLA 1HH9A 5IVOA 5FYLL 2BRRL 1CICB 2VC2H 1A7NL 3G6AB 3DO3A 4IBLT 2ZOKA 3UYRL 2Q1EA 1YN6A 1FFQA 1NGZA 5CILL 4KUZL 4Z7VE 2BSED 3GDBA 3QXVA 2JCCA 1A5FH 4PYHA 3ARZA 3ESUF 2XT1B 4Z78B 1HQRA 1VA9A 4ZTOH 4UTBL 1HILB 3UZEA 4O2FB 3QCVH 5AAMA 1PW3A 2UZYB 3QNZA 4NM4L 4OCWL 2GJZA 1KENL 1DDHA 2B0SH 4LSSH 1UM4H 4NQUA 4H88L 1MWAB 4NQDA 4OZGF 1JZ8A 4S2SB 1P7QA 2XXCB 4MAYC 3IVKB 1WGOA 3VFNB 5I1HL 1CICA 4K8RL 3LQAH 4Y89A 4YNYA 5GRJL 4JFHD 3QUZC 2J12B 3MCLH 1AFVH 4FP8H 3L5JA 5I15L 1UCBH 3B9AA 1ZLSH 2YD7A 3FZUD 4JO2H 3SE8L 3MV11 1AD0A 2LU7A 4FQIH 3SE4A 3U36B 2ITCB 4AG4L 5IP4A 1SYSB 1BQSA 1T4KA 3MLXH 1D9KD 2P42B 4JM2C 5EU7C 4R7NB 3O9WD 3X11A 3IU4L 3DV6A 4YHML 3D0VA 5GGRB 3V6OC 1UM5L 5FUCC 5IMLA 1RULL 2VO5A 4M43H 3IFLH 5I6XC 4P3DB 5GGSY 1FPTH 4V2BA 1LO5A 5C9JB 3T2NL 3BZEA 3G5XB 4EI5C 2WUBH 3MRMA 4MZ3A 4R7DA 3BZ4A 2ARWA 2D0FA 4EN3C 3HE7C 1TCMA 2OP4L 3QI9A 4JM2F 4BFIA 2VABA 5JPNA 3OKLB 1CN4A 3KG5A 4V1DB 4NUGL 4LL9A 4AENA 4DK3A 2P24B 5F21B 4F8QA 4ZXBA 2BVOB 3Q3GB 2A6DA 5SWSE 4EKXA 1D9KB 4W70A 2YS4A 5IW1A 4Z0BL 1FZKA 3HC4L 4NN5C 4IOFD 1UGNA 4X6EB 1N0XL 4FXKB 3TN0A 4UTAL 4C56D 3EOTL 2FZ3A 3JV4A 3BVNB 4CMHC 2VDRH 1JHLH 1CLYL 5DLMH 43C9B 1A6ZA 2D03L 4UT6H 3CFEB 2VLJD 5GIRA 4PRID 5D7LB 3MR9A 2APWA 2EYRA 2R69L 1P6AB 3VXSE 4LHUG 1RMFH 4I0PD 4RFNC 4JCMA 2GJ6E 1T3FA 1AH1A 3GIVB 3CVIH 2UYLB 4Z18A 3CLEH 1I8KA 4MQ7B 1E6JL 3VJ6B 3KPLA 2ADIB 3ROLA 4OJFH 3LKNB 2HT4D 1MRCL 1QBBA 4JRXB 1EFQA 3BKYH 2XG5A 3MRRA 4P2QD 4DGIH 4KQ3H 5F7WC 2FH8A 1ZLVH 1JWMA 3P9MA 3VFGH 1J8KA 3QRGL 2HH0L 5F1IB 1AD9A 2WV3A 1NGXB 1AGCA 4DEPB 5DRZA 5CUSH 2X1PA 2BSSB 1R6VA 3OKMB 3KR3L 1J0YA 4H8WC 3ZSTA 3ZE2F 1X5AA 3PWUB 5DK2B 5BO1L 4JPWL 1UYWH 5HGAB 5CLTA 5E8DL 3MUGA 3QDJB 1Q9OA 3SDAC 2A74B 2O5ZL 4OZHB 1P5UA 3QNYB 4FQQB 3OAZK 1A0QL 5DJ8B 1A9EA 1BECA 3CSYA 3I6GA 1M71B 2Z31B 1S9WB 2Z4QA 1F13A 1PZ5B 4HLZH 4G42A 3IDNB 1XF5B 3O6KH 3OJVC 4FFZL 4PBXA 4ZUTA 1CG9A 1OL0A 3QFDB 4LF3B 4NQCE 4H26A 4OLUL 4WFED 4E0RA 1HHGB 4NRYB 5DQJA 4KAQH 1RAMA 3T77A 1HWGB 4DN3L 4OZIA 2WBJA 4S11A 4Q0XL 4UU9A 3GJFA 1JF1B 5KSBA 4C83A 3LZFH 2VNCA 4MA8H 4PLJD 4XNQA 4UUJA 1NUNB 3VXME 3GZKA 2NY6D 1NGYA 4V1DE 4GBXC 3D2UB 3ILPA 2FH6A 3BWAB 2ZP0T 1QHOA 1WZMA 2NY0C 1U92A 1DBBH 3KGRA 4OTXH 3BPCA 2P1YA 1OB1A 4IRZH 4X5XA 1GJIA 2XQYG 5JO5A 3KPSA 4H1LG 1P69B 5GGVH 3AC0A 5JW4R 4XHJC 1U36A 4DW2L 1P4LB 1RK1B 4PJXF 2ZOLB 2BY1A 3MV7B 2BOCA 1FSKC 5FEBA 1NL0H 1OPGH 3S98A 4ZPVA 1XH3B 3JWDH 3QUXB 5F9JB 1K5NA 4HMDA 3NCFB 1BF2A 1A7QL 5EU4B 5BJTA 5KW9L 3KYMB 1I75A 1MCLA 1LEGB 4K9EH 4WI7A 5A43C 3S88L 1NFDA 1BBJA 2AXFA 3CAFA 5GRXG 3DTXB 1I7ZB 5CIPH 3UROR 4PJXB 5TGBB 3T0BA 2MMXA 3VFRA 2ZCLL 1KJMB 1XCTA 2YUVA 4XX1G 4EI6B 1RZKC 1A7QH 5F9DC 4YHIB 1KLUA 4G8FB 3K8KA 5LQBH 5E2TL 1U41A 1EH9A 4G8EA 4RDQG 5D2NA 1HXMA 3FO0H 4M9PA 5GGRY 4FQXD 5I1LA 1B0GB 1R5WB 2ZCLH 2V7NA 1U2HA 2PR4L 5B3NA 1C5BL 4BFEA 4UDTB 1GVIA 1YJDL 2ZWLT 3FRPG 1W0VA 4OLWH 2GJ6A 4OCMC 1LK2A 3VXRE 3OJMB 3RVVD 3G08A 4HWEH 1AXTL 5I76B 2IALB 2GUOB 2BFVH 3T4YA 5C08B 4BFBD 5DA0B 1S7UB 1VKXB 1REIA 4GKSB 4U4BA 2QQNH 4KPHL 3BXNB 1UH3A 4TULL 4YHNA 2F8XC 1VADA 5HYSA 2B1HL 3U0WL 3KLSA 4QHKI 4C56A 3IRZA 3GM8A 2B5IC 5B38G 3C6LB 2P7TB 3V6OE 1QBML 3SOBH 1FP5A 3THML 1IAKB 1RD6A 4D9LH 1BFSA 3G5YB 4GG6F 4L3ED 3VG9C 1MI5B 5DT1H 4G6MH 1EEYA 5DJCA 1IGYA 3V6FB 3F5WA 3PWJA 3WUWA 2WSKA 4WUUB 4GKNB 1YYML 5TF1L 3BKML 4LLWA 2A6DB 3HCVA 5LWYL 3SE9H 1XGTA 3RVUC 4R96B 1R24A 4HZLB 1QLRA 4H20H 5HYQA 4D9LL 4KZDL 3RWJA 5IFHH 1G6RL 1R3IH 3PL6C 2L4OA 2Q3ZA 4R9HA 1V3MA 5IVZB 4BQ8A 4WV1C 5F9AC 5CD5D 1IEBB 3DVNB 1G7QA 4WO4C 5I2IB 4M7ZB 1MFAL 3VGEA 1KN2H 1YQVL 3HE6A 2EE2A 4R7DB 4HX1A 2YPVL 4QRPE 4RGOH 5IBLD 5CJ5A 3LKOB 3W11C 2HVJB 3C5ZC 3GSNH 1MJ7L 3MOQA 4JFOB 1BQUA 1LILA 4PD4J 4OQTL 3MOBL 1R3KB 3K81A 3D0VB 1EEYB 5DJCB 4LARH 2BVTA 4HMCA 4GKOA 5IB3B 5L8JB 1H3TA 4Q9RL 3L3DA 2D7TH 2VRAA 3HAEB 3KPMA 3F7YA 3OR6A 1BP3B 3EOTH 4LIQH 1KB5B 3CFDA 4PLNC 2P5EB 3SDAB 5DUBB 4XPTH 1Y6KR 2R1WA 3GSNL 3U4AA 1OSPH 1WIOA 4NRXB 3DPBA 1MI5E 4FABL 3B2VH 4JZNA 1QRNB 4UT7H 1LDSA 4JPIA 4OT1H 1T7YA 5DJ2B 2IPTH 5GRVK 2ADJA 4LCUB 4ONGH 1DLFL 2AK4A 4LPVA 5DK0B 1RUKL 3G5ZA 5E6YA 2AKRB 3DYOA 2BVQA 5JOFA 1UT9A 1R3LB 4G8GD 5I8OL 4MD0B 3CJJA 3VXSB 1MF2L 1G7HA 3QNZB 3X3FH 4EUPG 1IGFH 2GSIB 3QDGD 3QG7L 4I8DA 4NP4L 4OJFL 5GRJH 4RGND 3C2SA 5DC4B 3STZB 5H35A 1NFIA 5ESVA 1IQWH 2NW3B 3WBDA 3EYQD 1R5WA 1W8NA 4PGBA 3HMXL 3K1KC 2NX5B 3MBEC 2AV7A 3PDOB 3D2UD 5MERA 4DQOL 4M8QB 4U1NB 1NMAL 3MLZH 4B50A 3AFLA 3ARGB 2BRQA 4NN6C 4Q97A 4LCUA 4OV5A 3ETBF 4JHWH 3GHEH 1V05A 5FDWA 2AV1A 5SWSB 2QQNL 1SVZA 4KPHH 5C0ND 3CPLB 2KDGA 1ZLVK 4ZDHA 5CWSB 1HHIA 3FOLA 5B39G 5KS9E 4LLDA 1MCSA 1GZQB 4AH2B 3EOYG 4E5XB 1A4KA 3FT3A 5HHMD 4ZD3H 3HNSL 1WVZA 4F57H 1PQZB 2EC8A 5ALCL 4PTTB 5C07D 3V4UH 1QKZH 2AABH 4HIJA 1L0QA 1KCSL 3KLHD 5JNYB 4CDHA 3TT1H 3MRCB 4YDIH 4XXDB 3BH9B 2AEIT 3JUZA 5EZIH 2WBWB 1YEJH 1JHTB 4PRBA 4HUKB 1J88A 1BLNB 4GG8B 5DEGA 1AGBB 3VA6A 1XZ0A 4X4XA 5T1DH 1CE6A 4XNMB 3IFNH 4HHAB 4JREB 2IFFL 1QO3A 4M6NH 3GI8L 3QPQC 5EZIL 4OI7A 4HFWA 2Y6SC 1T83A 5GHWH 3PWLB 2EC9T 3JV5A 3VXQA 5CBAB 3IETA 5FKPB 4NZUL 3G5YA 4JLRA 5HHOE 5ADPL 2XPGA 2V5RA 4ESKA 5B3JE 1EAPA 2DMCA 4PJEE 4GRWF 2R23A 2KQMA 3TT3H 3VGHA 4X6DF 2HFFB 1GGBL 4WI5A 1KT2B 2G5BB 1A6WH 1P7QD 2G60H 2VB5A 2L7UA 3PWNA 3WJLA 5M7QA 3ALPA 5DEFB 1AHWA 4WWKA 2HFGL 1I8LC 3D6GA 4GMSH 4Y16A 4TPRL 3UTSE 3VXUE 4JZJA 3KYNA 1OPGL 5FHAH 3I6KB 1IZKA 2I25N 3EOAB 1W0VB 3VGGA 1EEQA 3VXOA 1BFOA 3F7VA 5F7DA 4OBSA 3I6GB 3VGAC 1T1WA 4U3XA 5IGXH 4EXKA 2XZQL 2HFGH 3SDXE 3WFDL 3GMMB 1DSFL 4U1HB 4TPRH 3X17A 3QQ9D 5TDOB 2N4IA 1G7HB 1MUJB 3GSXB 1DANT 5F7EL 4GRWH 5D2NB 2D7QA 5D2NE 4MXQD 3SJVB 1TZIB 1OAKL 5AYUH 2VJXA 3EHBD 1JPSH 1AGFB 3G6JE 1J0KA 4GW1B 4RGNE 3V5DB 3AY4A 1QSEE 2RJMA 2IAMD 1VEPA 5I1IH 3AS3A 1T80A 3KPTA 3O2DH 4OCRH 1ORSB 5E2TH 5JDJA 5TGBA 4XCEB 2H9GB 3TESA 3CXDH 5DUMH 2Y06H 3O41A 1L4IA 3O6KL 4MDJA 2V17L 4QRRE 1FCCA 4BELD 4EXPX 2IANE 1HNFA 2ZG2A 2PO6B 5D96B 4XMPL 5CIPA 3RZCC 3S4SB 4FQCL 4DN3H 1WWAX 4UBDD 5SWZE 4NNXB 4MZ2A 3VI4E 3ULSB 3OKDA 5I30L 3O6MH 3ULUD 1ES0B 4M48L 4JCLA 3LZFL 2CLRA 3OKKB 4DGYH 3ARBC 1I1AD 1CU4H 4A6YB 3W5MA 1IAII 2YZ8A 1KEGH 3IB4A 3D69A 5IVZA 3LRSB 2ZSWA 2FBOJ 3DGGB 4TUJB 3BN3B 4DGVH 1KSRA 2DKSA 4I0PA 3L6FB 3FMGH 3WNNA 1ZA6A 1WFOA 4N5EC 1RZFL 3FB7B 3NGBC 4OTXL 3WHXA 1TITA 3P3YA 3ULVD 2VDML 1MRDL 5MEPB 2V2XB 5HHNB 2PTTA 1FO0B 5IF0B 5KSUA 4YIQB 4F7EB 5BZDA 3RU8L 4G6ML 1EFXB 2OXHA 1UENA 4DKFL 1YY8A 2BNQA 2E7LC 5ACZB 3ZE1F 1J8HA 2JTDA 3E8UH 1T7XA 4JM4H 4MWFB 1DP0A 4ORZC 5TF1H 1GGUA 2Y7QB 1JGDA 2P4AB 3GJFB 1XF3B 1YJDC 3QO0B 4N0RA 1CL7I 4BSWB 2J5LB 5KSBE 4XP4H 3HC0B 3KXFE 3TO4B 1I3UA 4NO5B 1OP3K 4P9HL 5C0AA 5C6TH 3BZ4B 1HWHB 4R0LA 1KN2L 1YQVH 1NLBH 5EWIH 3GNML 4ZYKA 4WTZG 4WTXA 5E9DD 1P5VA 1BOYA 1IM3A 3E2HB 1CDHA 1NAKH 5FGCE 1PKQB 1VHPA 3QIWD 5BV7L 5CJXC 3ZDYF 4FTVA 1SYVB 2EEBA 3K3QA 5C08E 4JFYB 5EOQL 3U4BH 2ZKHL 4EVNA 5C6TL 3BAEH 1F11A 2WIIA 4AEHH 1SYSA 4FG6C 1XIWD 2QLVB 4ZFZA 2K9UA 1BIIA 4R8WH 5SWQB 3VWKC 1N7MH 5CJXA 5EH1A 4K8RD 4KRMB 4RAUB 4OT1L 4R3SB 2EIZB 5TDPA 3W0WE 5GS3A 2CDFA 5E5MB 4HK3J 1HIMH 4WY7L 4NC0B 4L4JA 4LVOB 4R0LC 4D0CA 4WCYL 5DUML 4JN2A 3ALWA 5FF6A 4PP2A 3NZHL 3HMWH 4FFYL 2X42A 3GJFH 5J6GB 1DBML 3H7BB 4DVRH 4G43B 2HVKB 4KMQA 1T1WB 4ODHL 5JXAH 3IGAB 5GGTH 4PJDA 2EE3A 3LSOA 5L8KB 3EO9H 2NY4C 4UNUA 4I3RH 3KJ4B 3G5VB 2OK0L 5I30H 1DQJA 2R4SL 3K2UL 3OBAA 3QNXA 1BVKB 2E7LA 3FONB 3PQYB 4P4KD 3FJTA 3PWPD 3OXSA 4AY0A 1FFPA 1KTDA 4B7LA 1B4JH 2CKBL 3VXRD 2X70A 1RK1A 3Q5OA 3TVMB 1KEGL 5I1KH 1IVLA 5DT1L 4HKZB 1U93A 2EKJA 1I7UA 2DF3A 3WS3A 2MNUA 1EBAA 2YA1A 4LHUA 1GGIL 4I0PC 1LO3L 4QKXB 5CJOH 1H8SA 4HK0A 4QTIL 1M6OA 2VDQH 4YGAB 3O2WL 2AP2A 1EJOH 4TSCL 1MRDH 1KGCE 3MUHL 5ELIA 3ZDXF 3EYVA 1X5XA 5TQ0L 3NTCL 2F53B 3CSGA 3RP1A 1X5FA 4EZMA 2VZUA 2F58L 3ARBA 3RU8H 5C0CB 1HHKA 1AXSB 1AQDA 4WFFD 5AZ2L 4GUPA 4YIQA 1ZVSB 1PKOA 4PUBL 4PRPD 4KWUA 4YXLL 3ES6A 4A2LA 5L2KB 3QEGH 3RZCA 2AJSL 2AS5M 5HVWA 5ERWB 1YEIL 5CSBA 2HMID 4JVUA 1PDKA 2F58H 4YR6B 2A2QT 3T77B 1ZGLM 3E6FA 1NBYB 1A22B 5EU6B 3C5SB 1X5LA 4L4TE 3ZZ1A 3OMZA 4XPTL 3I3DA 1SJEA 2OI9B 3O3EA 2QR0A 4RA3A 5SV3A 3AY4C 3BEVA 3LV3A 5TE7H 2GW5A 1G7IA 3HZVA 4F15B 2XV6B 1MQKL 2VWEC 4MJ6B 2Q86B 1C5DB 4FQQA 4M1DH 2DIBA 3EYSL 5EU3A 2A74A 4Z77A 4GW4B 1UKTA 2OLDA 4Y7MA 2NW2B 4QRRA 1F45A 2BJMH 4NFDA 4QHMB 2A0LC 2X1QA 4N9GA 5DQ9B 1AR2A 1RUPH 3HA0A 5J3HD 3O11B 2HMIC 3TV3H 1A7PL 3AS2A 4HJJL 4GKSA 5EUOA 3QIWC 3W9DB 5DSCB 3FZUC 3O81A 4OGAD 1WZKA 3AU1A 4NBYB 4MYWB 4YC2C 1P7QB 1MAJA 2DQCL 1A5FL 2AERT 2NZIA 4Y16C 1XFPA 5IFJA 2VISA 4WWKC 1AHWC 4JJHA 1P2CB 3MMEB 3KPOA 3B2UD 1YEGH 3TCXA 3QCVL 4ODSL 5JMRA 3O0RL 3L5IA 1KACB 1M7DA 5J11B 1T5WA 2NLJA 1X5HA 4ELME 4F58L 1AO7D 2J8UF 1NBVH 4M00A 4U1IB 4U6YA 1SJXA 4I3RL 3PABA 5B22A 1CGYA 1TPXC 1J0HA 5EO1B 2R1YB 5T1MB 3D0LA 3KPPB 4TNVF 5DK0A 1BGXL 5D7IF 2PCPA 1HHHA 12E8L 1T83C 3TWCL 3VE0A 1NDMA 1KULA 3R0MA 1D6VL 1KLGA 4PGDA 4NQEA 1SY6L 3PJSB 4YUEL 4HWBL 4OZFA 1OD7A 2CLZA 2F53D 3P4NA 1X5IA 4YHZH 3PWPE 2DLIA 3IU4H 3MRQA 2IEPA 1LEGA 1HDMA 5C0NC 2IAND 4NKDA 3IFPA 2DM7A 1YEKH 4HV8B 3V4VL 4PRDB 1I1YA 2ARJQ 5IKCA 4UQ3B 4XPAL 2H26B 1NGWA 1BMGA 2AEPL 3D18B 1UWGH 3KPRB 2EXYD 4LCYA 1T7VA 1QNZL 2IFFH 3FO2A 2FYYA 3KWWB 2E8YA 1N64H 3ECBA 5BV7B 3C5SA 3RNQB 1KXTB 1FE8L 1IE5A 1EK3A 4KI5D 5J6HB 3WMSA 1H5BC 5FHBH 1T5XB 4NZUH 4PJBF 4NNYA 4XPAH 1H3UA 1FNAA 1YC8A 5CEZE 1HK6A 1ZEAH 4CU8A 2C4FT 1NEZG 2BHUA 4NYLA 2Q76B 2A1WH 1XR9A 3ZT6A 1FGNH 1XEDA 2F9BT 2JIXB 3OJ2C 2GAZB 1WK0A 1H9VA 1RIHL 2XG4A 4XCNB 2GJ6D 5GZNC 1RUML 3Q6FB 3NFPB 4TVSa 5ID1A 5KN5B 4EBQL 1HDMB 3QQ4B 4M7LT 5ICYA 3RGVB 3RTQA 4AH2A 4LLQA 4Z7NE 1M6OB 5DQDH 5ACLA 4HWZA 1YECH 1IC1A 5HYJB 5JPMA 4CGTA 3L5WB 1FO0L 2ATKB 2ADGA 1H3PH 3WNPA 1SEQL 3U7WL 5FA3A 4YNYB 4EBQH 5C08A 3MV9D 3G08B 4XX1E 4KRPB 3TO4D 1KIPB 4U7MA 4JN1L 4PV9A 5AWNH 3ZYJA 4RISH 1DBAL 4GFTB 4K23H 1K8IB 3QXWA 4PJAA 4OF7A 1NAMB 1D5XA 1Q9WB 5LKNA 1T89C 2Q7NA 3VFOA 3F7RA 3H7BA 3PV6B 1NC2B 3RUGE 4KDTC 4AEHL 2EYTA 4P5MA 5DJXA 3V5KA 5E08L 1J5OL 1Y6MR 4LCCB 3NA4A 4D0CB 2CUMA 1S7TA 3V0WL 1OTSC 2AEWA 4TUOA 1X4YA 1UCTA 3M1BB 5DXWA 5BZWB 2IF7A 5BS0D 1TTGA 3MREA 4M1GH 3D3VE 4UT9L 1Z0MA 4M3KB 1IJ9A 4PV8A 5GJSL 4BK4A 1S9VA 4H1LH 1X7QA 2J6EL 4KROB 2HP4A 3EYOA 2WK2A 3C5ZA 1XCTB 5FA4A 4DZBA 4I2XB 1EEUA 3GMQA 1QZ1A 3U2SA 5SWQA 2ZUWA 4YE4H 4XTRC 4L3CB 5KS9A 2NY1D 4OM0H 1EEZA 2FX9L 4NRZA 4RAVA 4ZPTA 4M48H 4WO4A 1CL7H 4QNPF 4R4BA 3PL6A 4M1GL 3BP5A 5IFJB 1DBMH 4EVNB 2JELH 3ULUE 4NJAH 1YY9D 4OD1H 4Q7DA 5HI5D 1EA9C 5SX5K 4EQ3A 1MI5D 3V7AG 2JB6B 3OGCA 1WWBX 1OAZH 4OM0L 5I9QB 4UNVA 2FX7H 1RZFH 1FIGL 5ISZA 5C07B 1NCAL 3MRKA 5C09B 2E3VA 4HUVA 4LASL 4BUHA 1TQCB 1BM3L 3KPNA 4RQQA 3GHBH 5I1DA 4EQ2A 3CZFB 3LN9A 3RUGF 1CGXA 2D7PA 4DKFH 2ZUUA 1ZA3A 1DQMH 1UG9A 3MRHB 3IDIB 3K1DA 2BHYA 4RDQF 4UIKL 4MNHB 3TPUA 3WKNA 4LSVL 4EJ1C 1BFVL 1JGEB 1NCAH 1Q9KB 2FZ3B 3ES6B 5DWUL 3FAWA 3FO9B 4WUUA 1WICA 3MJ7B 1EXUA 3I02A 2QADC 2QSTA 3Q6GH 5IWLA 2D0GA 3BSZH 3NH7H 1N6QH 3ILPB 4GQ9L 4HW6A 1OD9A 4MDIA 1YNLH 1U42A 4NQEE 2F8VA 2W65B 4UIKH 1ZT1B 3GSRA 5DC0A 3MA7A 5JIIA 1FJ1B 5I75C 2MTPA 4LLMA 1FH5L 3K0WA 4DTGH 3VXTA 1DUYB 4LCWB 3L6FA 2CSPA 1ZXQA 2WBJB 1NAKL 4PYGA 1TJIL 5IR1A 1CIUA 2BMKA 3MJ8A 1IGIL 1PYWA 3UJJL 4RWYL 3W2DL 5DFWH 1JI2A 5D2NC 1TNNA 2OL3B 3MXWL 1MY7A 4GXVL 3A6BL 2K3TA 1NCDL 2VDOH 4OLXL 1FH5H 2CLRB 4DTGL 1S7RA 5LGHL 1T03H 4HF5L 4JO4L 3O4LD 4U1SB 3BRFA 3MTRA 2JF1A 2I07A 1W72B 1F11B 1A21A 4YFEA 5KW9H 5CIPB 2DQJH 1MQKH 2QADD 2DQHH 4F7PA 4GQPH 4P9MH 3EYSH 5T3XE 3T0EC 3RHWK 2IH1A 2XY2A 4KJYA 1BQLH 1J5OH 3CUPA 1I7RA 1HXMB 5DFVD 1CDCA 2J8UE 2P8MA 3O41B 3MBXL 2WQRA 1RUPL 4M62L 1N5YH 3AXLB 4X6FB 5HGDB 4PRPB 4X6CA 4HULB 2IANA 1MCCA 1WIPA 1A7PH 4HJJH 3BYTA 3ZTNH 1HCVA 2QTEA 1NGXA 1BBDH 4JDVA 2R2EB 5FFLA 1U8PA 3CMGA 3EGSA 1JGUH 1OAUH 2VQ1B 3K2UH 2R4SH 3RDTB 3OKYA 3WXWH 4GXUM 2PO6D 4R2GD 4IOSD 3SGDH 5JHDB 2J88L 3O8XB 4L8SA 1NC4D 2FECI 2F54B 3EDDA 4U1HA 5HHOA 1QSFD 4GRWB 1D5XB 5TE6H 2YSSB 5EPMA 5DD0L 3T0WA 4AG4H 3E1F1 3ILQD 4R6UA 2H32H 5SWZA 4JKLA 4PRPA 4OLVL 4MB4A 4NO2A 4PV9B 4E41E 3O6FC 1NCWL 3B9VA 3QEQE 5SX4H 2QHRL 2NY3D 5DRWB 1JL8A 3UTOA 4QOKE 3MRHA 1OQXA 5DMKB 1A1OA 2R0KH 4QRUB 5B38B 1IKNA 4NO5A 2NY3C 3DRTA 4P4KC 3QFJD 1IL1B 1QBLL 3L5XH 4X7SL 3RWDB 1G7MB 1GH7A 4P2RB 1QSFE 4YXLH 3GBNL 5DWUH 4UAOB 1RZJC 1ADQA 1NGPH 1DBJH 2Y23A 3FRUB 3BFOA 3A0OA 4PRHE 1T7ZA 5I0ZA 4G80B 4KK6C 1NPUA 1VEMA 1F4HA 3ZKMD 4RNRA 4IEFB 4JPVH 1U3HB 1V7MH 1BZ9B 2AK4D 3F12A 1YPZB 5JHDE 1BVLA 1EEZB 4RAVB 5J1AA 1Q94B 4UINL 3DUHA 4DK6A 4NHUB 1Q94A 4X9HA 1G7PB 5GS1A 1F97A 1KOAA 3BD4A 4Y19E 1CD9B 3CSPA 3OJDA 4WVRA 1DL7L 4BSJA 5L2JA 4HXAH 1BD2B 4HBQA 1J8HB 3SDCB 4H5SA 5FDYA 5FM4A 4M1DL 1ZEAL 3BPNB 4LVEA 3SKNB 5KOVC 4PGCA 4LARL 1KCLA 4JG1H 3BP6A 4QYOA 5HPOA 3HAEG 2YD8A 4JY6A 2UY6A 1OLLA 2ORBH 1VFAB 4MCZB 3TNMB 4Q9RH 1I8IA 4OB5H 4MJIB 1ZA6B 1IL1A 1RUMH 1CDJA 2AGJL 3SO3B 4URTB 2PKDA 3SN6N 1KLFA 1QLFA 4JHAL 5E00B 3I9GH 2KL6A 1EVTC 3I50L 1OY3B 3UAJC 5JQ6H 5KS9B 3D48R 3WCYA 1NCTA 3W81A 2E7MA 4ONGL 4M5YL 2Y4SA 5IMKA 1X5GA 4AEFA 3ARXA 3ULSA 2FIKB 4KZEH 5EBGA 2BMKB 1NBVL 2HH0H 5KANG 5BVPL 4HWZB 1F8TL 1JRHH 5HYJA 5T1LD 3X3FL 1CVRA 4MQXD 1MNUL 3VD7A 4RISL 1DBAH 3KPRE 5BRZA 1JVKA 5DI8A 1MVFA 4YDJB 2OZ4A 4U1MA 3PHSA 2A77H 3G9VA 3VXNA 4Z78A 1FFRA 3C5ZB 4YUEH 4DZBB 2HJFB 1UB5B 1YUHB 2B5IB 5I16A 4DUWA 4NOBA 1ACYH 4MD0A 4MXWH 2XZCH 5I1HH 3LRGA 3OWEA 5MI0B 3TN0C 1NGZB 2ADFL 4HH9A 4WFEE 2O5XL 3CFJA 3HPLB 3QHZH 2P8MB 2AK4B 4WUUD 3GGWA 1JI1A 4IRSD 3HE7D 1KCVH 32C2A 3ROOA 2YN5A 1R5VA 1VGEL 4FXGB 2CQVA 1RJZA 1JHTA 3WDJA 3QZWG 4YDVB 5JZ7C 1CGSL 4CVXA 5JXED 4PPTA 4UIMB 1I9IH 3F7VB 1INEH 2LQRA 4JKPL 4O51B 5C2BL 3BKCH 3QI9C 4XPBH 5JUEH 4WJ5A 4K3HA 4EN3A 3EAKA 3VXSD 1CGTA 4MJ6A 1U8LB 4PRIA 3PHQA 4C58B 4OZFH 1AR1D 4EI5A 1OTSD 5CZVH 1K4CA 5DFVC 2XNAA 4QY8B 3N1MC 4HLZG 5FECA 3PL6B 2FX7L 2VLKA 3ARDB 5JLZA 3V6OA 4XB7A 3QDGB 4LEOA 4X7TA 5CCKH 3P4OA 3PDDA 3FOMB 4PB0H 3VXTB 1EJ6A 1LE5B 4JM2A 5IVXE 4FXGA 4KTEL 4HUWA 3QQ4A 1FGVL 2C9AA 2IWGA 1JNHA 1IEHA 4HCRA 1U91B 3ARFB 3S36L 1VCAA 4S1RL 1A2YA 1U6AL 1JZ7A 3AROA 3IU3A 3BIKA 3TNNA 4DUXA 2J8UA 5EO1A 2FX8H 3N1PC 1G7JB 3GM0A 1YECL 3V5KB 1YDPA 4IS6A 2JCCF 2I27N 4OZ4A 2E27L 3DSFL 5EG6C 4S1RH 3PGFL 3QULB 3U82B 1LE5A 1FC1A 1AY1H 3DX7A 4XMKH 2G60L 2YD3A 2R69H 5FB8B 4N8CL 4NPYA 3MACL 2PTUA 5D7LE 2VSCA 3CD4A 1DBKL 4XXDA 3M07A 4B5EA 3RWHB 5TPWH 3TA3D 1VACB 4HS3B 5I8EA 2CUIA 1SMAA 3PE9A 4C56E 4H0IA 3PGFH 3MXWH 2ED8A 5FK9A 1F8TH 1QPXA 4NKIL 4QHMA 4L3EA 1ZHLB 3UX9B 2R9HC 5SWZB 1YMHA 1YNKL 1XT5A 5C3LD 5SX4I 1DQDH 4ETYA 4QOKA 4A6YL 3VWJB 1SBSL 5C0RH 4KHXH 5GISH 3UTQB 3GEWB 2NY5C 4UBDC 2ICCA 5FYKL 4FQHB 4MD4B 2JB5H 2DQEL 2FB4L 1AJ7L 2WLZA 4PGDB 1X44A 2APXA 4PLJC 3BEVB 4DKEH 2C1PB 3IJHA 4LK4A 4GMTL 3K8MA 5B4MC 2FX9H 2QL1A 4CVUA 3LOWA 3SKNA 3LVEA 3MGTB 1JF5A 2O5XH 3MGTA 1TFHA 1G9NH 4YHIA 2BVPB 3BD5A 4G8FA 4YGVA 2JELL 3JV6B 2W07A 1D5BA 2HG5B 3H42H 3H9SA 2ERJB 3BDYL 1KPRB 5DJ2A 5EIIA 1KCVL 4W6XB 4L9DA 4ZUWB 4CN6A 5M94B 1ZLWK 1I7TA 2DJUA 3OV6A 3VXPB 3KVQA 3CLFL 4D8PA 3PG2A 4JFDA 4R96A 4D94A 4NO0D 1I3RB 1OT2A 3KYOA 5DMIL 3KLAA 3INUH 3NAAL 4NQCD 4TUKL 4OFPA 1FVDA 1ROWA 1T0PB 4L5FL 3RZCD 1I3GH 1G9MC 3B83A 3OKOB 2VH5H 2Z35B 4P5TA 3DXAD 3K2MC 5LCVL 1UA6H 3T3MF 1FLRH 4RMVA 3J8F7 5D1ZA 3EYVB 5AD0B 1P84J 1QRKA 5CZVL 5IHBA 4BKLA 1DTUA 5DVOA 4PJ8C 4NPYB 4FMFA 2HTKC 1MCEA 3W39A 1JBJA 5HPMB 5JW4N 3DUSB 3CFDB 2DRUA 2ICEB 1BIHA 2VZVA 5F6HI 1HINL 4KXZH 3NFPA 2PO6C 5ID1B 4Z7WE 4NZTH 3ZSSA 1MHHB 1N8ZA 4QTHA 4BSWA 1RU9H 3EJZD 3D3VD 1YPZA 1EHNA 4Z0XB 4GLRH 4AL8H 1RURL 1ZTXH 2W65A 3PGDA 1KCRH 2YR3A 4CJ1A 3P77A 3FKUS 2YKLH 3N9GL 1EFXA 3SGJA 3MFFB 5E1AB 5BW7C 5ICZB 1CS6A 4YK4C 5JW4M 5C0BB 4GRMA 2QKIA 4KVCL 5CJQL 4ZSOE 2R9HD 1MJ7H 3CH1B 2AJ3B 4OQTH 4WHTA 4APQA 3ECBB 4NGHL 3V95A 3LKSB 3DO7A 1JTOA 3SDAD 2D7NA 3WL9A 2R2EA 2RBLA 2XICA 3E3QE 5F93C 1MIML 1RV6X 5E4IA 3VRLE 1B3JA 3RWCA 3VGAB 1Z3GL 2UWEF 1M05A 1W72H 5E6IB 3QFDA 1A3LH 1INQA 3GSVA 5KTEL 5C07A 5ISZB 4FQLL 4FNLH 2DYPB 3B9DA 5EU3B 4RMQA 3OKNB 1MFEL 4X7EC 2Z31A 1UZ6F 5BXFA 2B2XL 1RJCA 3TZVD 5TFSH 3WS3B 3UYOD 5KVGH 2Y72A 2NYYD 4JHAH 1MF2H 5CEXA 3WE6A 4DN4L 2H6PA 3OPZH 2LTQC 4I9WE 3UC0H 4JQVC 4MMXC 3WKMH 1U3ZA 3VFGL 1FFNB 2FJFB 3EYFB 3QRGH 4IMKA 2IQ9H 3AGVA 5GSVA 1AKJD 3CDYA 4H5SB 1HKLH 3H42L 4C54A 2B0SL 4LSSL 2CXGA 5DRXB 3DYMA 3FTGA 3SGKA 2OX5A 5F1IA 3MCG1 4L8SB 1J86A 3CU7A 4LSRH 4ONFH 2VDNL 4WI4A 3RZCB 4OLVH 3ZKXC 5L6YL 4X9GA 1SVCP 2WUCL 2IH1B 1EHLL 1IFHH 4ODHH 2WIIB 1H8OA 1LEKA 1N26A 1NC2A 3OF6A 1KFAH 1K4DA 3WN5A 2OK0H 3EFDL 1MWAL 5I8KH 3I3EA 4QHLA 4JRYE 4W4OA 3DURA 3O8XD 4GBXD 1S7RB 5J7CC 3IXAB 3FB7A 4FFWC 3HNVH 3HRPA 4X98A 4MLIA 4UU9B 4NT6B 3RVUD 4KKCC 1UJ3C 1ZMYA 2DKUA 5T1LB 1WCQA 5JORA 2H8PB 3QA3A 4C55A 5T3XH 2UWEA 4JY4A 4NZTL 5HPMA 3EJYC 1LP9E 3THMH 5MENE 3BVNA 4LAJH 4OD2A 2VLKE 1NCBH 5J9PB 2NY4B 2YD5A 4U1SA 3EIFA 4HAFA 3FO1B 3HG1A 5IQ7L 4IRJA 43CAB 1DN2A 4IHOA 3RWGA 4NUGH 3O4OB 2MCPH 4JZOA 1T66C 1RZGA 3QQ3B 1BJMA 3RA7H 4H1LB 4TVPH 4U6HA 1MCHA 1GYAA 1ZE3C 4JFZL 2X89D 2BP3A 2HTLC 4M03A 1KJ3H 3WL9B 5TQ2H 4OSUL 2VLRD 3MNVA 1A9BB 1CTOA 4NOFA 4QHUB 3SGDI 4BQCA 2HYMA 1XZ0B 4X4XB 2AJ3A 2V2TB 1AO7B 5DRXA 3V52H 4DW2H 1I1RA 1TNMA 1TQBC 3NPZB 2EDEA 2DM2A 3RGVD 5AAWA 4Y4HD 3NFNB 4XMLH 3VI4F 2VITB 2HRPL 1LQSR 1NAMH 3EUUA 4Z7WA 2CKNA 5E24E 4CNIA 3MGAA 1A6WL 4LCWE 3BZEB 1OP5H 4JFFD 4IRJB 43CAA 3P9MB 4BKLB 5DJDA 2KZ1B 3TVMC 5IEHA 5MEPA 1JK8B 1KPUB 5BCAA 4W68A 3MV8E 4M7KL 4U0RC 5FV1L 1HSAB 1S5HA 1J87A 1URLA 4L29B 3ZKXB 5ADOH 3IS0X 4ZAKA 2G75A 3SKMB 4UAOC 2NMSA 4KJPD 1CDYA 3VMNA 4GAYB 1UWXK 4DN4H 5MEOB 3QI9D 2B39A 4L3EB 5LVEA 4X98B 2NNAA 2VXVH 3IJYA 2IQ9L 1IQDB 3PL6D 4G9FE 3MNWA 4OLZH 4YLQT 3LEYH 4XAKE 3KPRD 5ADOL 1M71A 2XTJD 3V7MA 5LQBL 3W11D 3FHQA 3H8NA 1LEKB 3MOAH 5K33A 3P9LA 3FQNA 3U9PL 1A1NA 5IESH 5DURD 4P23A 4JN2B 2XQBH 4LQFL 3WFBH 3EO0B 3RL1A 4FXKA 3Q6FA 1KFAL 2ZCHL 2HJLA 1KN4H 3V6ZA 1MWAH 1CFNA 2AI0H 2PW2B 2X4RB 1NCUA 4L4VA 4WEBL 4LPCA 1KB9J 2V17H 4DFIA 1UCBL 5TDNA 3UTTE 2O5ZH 4BK5A 2PTTB 4K94H 3BDXA 2N7AA 1MHCB 2FR4B 3T0VA 4P49A 3AXLA 3MV8B 2MPAH 4AMKH 4HHAA 2FBJH 2JJWA 3FN0L 3G6AA 1D6VH 1OTUC 5C0AE 2YA0A 4PJIE 4TUJA 5E5RB 4Z7UB 4YFLI 5C8JA 1O5DT 1IBGL 2ZZUT 5HYIA 2Y5EA 1U8HA 1TTUA 3D9AL 4PJCB 2PYEE 4GS7B 4PJ7B 3DX6B 2FGWH 4G9FB 3RBGA 1MHPL 3OGCB 2XYCA 4M7ZC 3L3DB 2QSVA 3FFDB 4ALAH 4S1DD 2HFEA 4LLVB 4PTTA 3MCKB 4NC1C 5D1QC 4R4NC 1H3VA 5DEFA 5GS2H 2M1KA 1QSED 4KKLC 1YYMH 3HC0A 3TO4A 2FGWL 1I9RL 1XIWA 1KYOJ 4ZTPL 2VIRB 3NFSL 2DQGH 1ZLWH 1RJZB 3VFVB 2HFFA 1R3JA 1A6UL 4PFEA 5T1DL 2Q3AA 4LLMB 5D8JL 1AQKH 3JV4B 3U30B 4ALAL 3KNBA 5DHYB 1K6QH 1E27A 1ONQA 3DV4A 4P2QE 5GS2D 4Y2DA 4PJ9C 3VRLF 2EO1A 2YXFA 3T2PA 4PGZA 4ZTPH 3WFHB 4NCDA 4XC3L 5HD8C 1PZUB 2B7DT 4CW1B 4PJIF 1WIUA 5DZLA 1QFWM 2PF6A 2RFXA 1AQKL 5E7FA 4J3OC 2BVOA 4YAQB 2DDQH 2VKWA 1MHHA 1N8ZB 3ARBB 2A9MH 4QTHB 1VFUA 2VUOA 3UTSD 1ZA3B 1RMFL 3ELAT 5E8OB 4WU7A 5EBMA 4HJ0D 1I1AA 5DMGD 3EDFA 2C26A 2KUTA 3TP4A 2X4SA 3RVXC 3CVIL 2FJHA 4EOWH 3UBXA 4ZFOL 4LCYB 5D2LF 4ZXBD 5FA3B 3RAJL 3W0WA 1MRCH 3RNKA 1ED3A 3DETC 3BKYL 4U6XA 2YBRA 1UZ8A 2NPLX 2E6JA 1W72L 4R8WL 5CBEA 1HKFA 1KBGL 2AJZA 1EO8H 3FT2A 5I8OH 3QULA 3F7QA 4UIMA 2VXUH 4MDJB 4P2RD 3T1FA 2R0ZL 5MHSE 2OL3L 5T3ZD 3OL2A 4LP4A 1FORL 4I2XA 1X3DA 1C12B 3AVEA 1QA9B 5T1KD 3QWQB 1FDLH 1UWEL 4F8TA 5D7IE 3BUYB 1UM4L 4HPYH 5EA0L 1CYGA 5JDSB 4XP1H 3M17B 3RVXD 2P5WB 2VXUL 2DICA 4GKZA 4D9QE 2EKSB 4Z9KB 4ZFFB 5ACMA 3HR5A 3K8LA 4PGBB 2X4OA 3GBLA 4I5BA 4Q9CA 3UBXG 4GO6B 4G6FB 1NJ9B 4PJDF 2H2SD 4NHUA 4XHQA 3SE8H 1CCZA 2BFVL 3EHBC 3TVMD 4QNPE 5DUBA 3MMEA 2NY7H 4LEXH 1A6TA 4PJBA 1RK0A 5IW6A 2IAMC 2VISB 4Z7UE 2H26A 3D18A 3H3BC 3O45A 1IAOB 4UDUA 4Y5VC 4M9OA 5KJRH 1AQDB 5C0EB 1I8MA 4HC1H 1OARL 3QIBA 5K59E 3U0WH 4LHJB 1HINH 5IB4B 3UO1L 1Z2KA 5F6HJ 4N0UA 1ND0A 1II4E 4JPIB 2QR0B 3DVFA 1FVEB 3KJ6L 4S10A 3LKOA 5E9DA 2IFGA 2VN7A 2KZWA 5DK3A 2DQGL 1RIVH 1AKJB 1FVCA 3B9EA 3QR2A 4XWOD 2YK1H 1E28B 4WUKL 5CWSA 1OARH 4R4FH 1S78C 3ROOB 1CDGA 4I48B 1NDMB 3MLVL 3DX9B 3IDGB 3CK0H 3TBWA 2W9LA 1CE1H 4N0CC 4OFKA 1MJUL 4Q6IB 2BDNH 4MA1B 3ARGC 3BN9D 5HDQH 3ZYOA 1CQKA 2YPKA 5JR1L 2RFXB 5HBBA 3KXFB 4G6KL 3QYCA 1E6OL 1U3HA 4FQ2L 4J1UB 5DJDB 3SDDD 3ZKNC 3LS4L 5ITFB 4ERSL 1TLKA 1Q0XH 1KJVB 4ZO7A 1A2YB 2J5LC 1A64A 4ACPA 3TYGH 3FT4B 4U1MB 4UTAH 4UV4H 5IG7B 5DI8B 5IT2H 4TN9A 5GS0H 3HZYA 5I1CH 2JIXD 3V8OA 4OGYL 5CS7A 4I18C 2GHWB 3VFPA 3BMVA 4PGJA 3RRQA 4EDXB 1A4JB 3QUMA 1CFQA 4PJ7E 1MCBA 1ZVSA 4M1CC 5T5FH 3F5WB 1NAML 4XVSH 5EO9A 3NABL 4OV6F 5HHQB 1KBGH 3IDYB 3WKML 1FCGA 3VD9A 5E00A 2UY7A 4OFYA 4OZFG 4S1DC 5EUOF 3PWPA 4I13B 3QWOA 1TZHA 3VFMA 2CLZB 3VFMB 4YQXH 2OCFD 2NCMA 3BDBA 4FN0A 1I8IB 4DEPC 1B6DA 2F19L 3VRJA 4TTGA 5F72S 5JTWA 5KOMC 4NM8L 1O7SA 1V5JA 1HHHB 4U7SA 2A6JA 2AJXL 2VDNH 1U58B 2CDEB 3BYYA 3FONA 2DQDH 1IQWL 2BXZA 3BE1L 4M6OL 3WD5L 2VZTA 3TO2A 1EMTL 4RAUA 2C3GA 1WFTA 2DB8A 1CFNB 4L4VB 3O2DL 4OCRL 4L4VE 4W6WB 1OM3L 4AEEA 5IR1B 2NY5L 1NMAH 3GSWB 4D0DA 1XF3A 4HKXA 4IDJL 2C1OB 4LRIA 1U8OA 3NA9L 4JJ5A 1ZAGA 1DJSA 1G0YR 3BRDA 2FHFA 4PJHA 5FYLD 3L7FB 1A7BA 1AP2A 5GGTL 5I9QC 3HG1D 3EO9L 5ACZA 3BWUC 4OUUB 5JA9A 3HFML 4P99A 4PY8J 4YDLB 4MSWA 3ARUA 4RX4A 3RVVC 1MCQA 3UO1H 4QRSA 2W9EH 5IUSA 1EO5A 1OGAA 1ZS8B 4EI6A 2ATPA 2XA8L 3D39D 3FCTA 3LB6C 1HHJB 3MV01 1CIDA 2VL4A 5EU5A 1YPZF 2DQIH 5EUKB 2CPCA 3C09C 1KCSH 1TVBA 3T0EE 3GMLB 3MRLA 3QISA 5F3BA 1QLFB 2VDQL 2X70B 2ZUXA 3SGEH 3RGVC 4TVPL 2XTJB 4NCC2 5EIQA 3FB6A 4RZCB 5FM5M 1MJUH 3BQUC 2C4FU 4HGWB 2YUZA 3DX8A 1A47A 3DURB 3QEUA 3GSRB 3O3EB 4I1NB 5ESAA 4LPWA 4JDZA 5C0IB 1N0LA 5F1SA 5EDXA 3GB7B 4J4PD 1JMZA 3VXUA 2HT3D 3BHBB 3I02B 5CJBA 3TZVA 5CHNB 4UV4L 1T1YB 2A1WL 3E8UL 2V2XA 1FGNL 1P6FA 3GSUB 3KAAA 3R06A 2YEZA 5I71C 4OZIF 4NQDD 2VZ1A 4XVUC 1RY7B 3LN5B 5FA4B 2EDDA 4ZS7H 3QWRA 1NQBA 4LFHG 3ARRA 3BWAA 2D7TL 4NZRH 1RZGB 2BC4A 2VL5A 1KNOB 1T21B 5IIEB 4OB5L 1WBYB 4MB5A 1H3PL 3CMOH 1PVHA 3CUPB 3BJLA 5CLWA 3FO9A 4WHYH 3ZHLA 2AJYH 5M95B 3LH2H 4OLZL 4Z5RA 2NR6D 4Z95L 3O9WA 3ME0A 3QA3B 1FL3B 3DX9A 2FJGA 3BAEL 5EOTB 3N1GC 2IBGA 1GPOH 1LEIA 2AJZB 5EU5B 2DJ4A 1YN7B 2RB8A 2B4CC 3ULVF 3LRHA 4XRCA 5H94A 3IXAA 1OWWA 4NO2B 2A38A 2C3VA 5I8CA 3EYOB 5IBTL 4CADB 4TQEH 3S4SA 4N0UE 2BZDA 4OCWH 4I2XE 3CFEA 4EI5D 1U8IA 1UH2A 3LDBC 3TIDA 2QBWA 4H88H 4IIQA 4R4BB 3C87A 3GJEB 5LXGH 2UV3A 4WEMB 1ZVYA 3CH1A 2VAAB 5HGAA 2GYSA 1FFOB 2XTJC 5FYJH 1C5BH 4BA8A 3HFMH 2ZUSA 1MH5A 2A6IA 1KLUB 2X4OB 3B9KD 4ZO8A 4X4YA 3A67L 4OM1H 4Y1AA 1D5BB 2HG5A 1NUFA 1GAFH 2IJ0C 2NTSP 1Z9SA 3TWCH 4JB9H 4NYLB 1AXTH 5FOBA 1H3GA 3FN3A 3MROB 3PHOB 3U4EA 1U3HD 3SDDA 4Y2DB 1CGVA 4N0FB 1AHWB 2X4PA 3D69B 3CDGA 4WFHD 3UDWC 5A1AA 1HHGA 4BZ1L 4JFXB 2CLVA 3VFVA 3FOMA 4QRPD 35C8L 3ARWA 4CKVX 4E41A 2UWEE 3QDGA 3WIIL 1XF2A 4QHNB 5CP3H 3KXFA 4CN4A 1UWXH 3TN0B 2DQTL 1M05B 5E6IA 5IB3A 2Q6WB 5DJ0B 4LSVH 2UUDH 1VPOL 1QNZH 4Y1AD 3IDGA 3TBWB 3NOIA 4ZSOB 1KTRL 4M7JH 4ODBD 3GSQA 4N8PA 3MUJA 3H2WA 3B9KC 4JRYA 4PJBB 1OOAA 2NTFB 3QUML 3KJ6H 5CKAA 4R2GB 4M6NL 4ZNEA 5JHLL 2VWEE 5IROA 3AREB 3RDTD 5E2UH 1F4YL 1YMMD 3HZYB 4P46A 4P59L 2FIRT 4LLDB 2HT4C 4HGKC 4WNQA 1C16B 5F1KC 4BFIB 4JPKL 5D1XC 5J6HA 2P5ED 4YHYC 1MFAH 3M8OH 4OV5B 1RVFH 3U9UA 4U7KA 3B43A 5ECJE 5FYJD 4PLKD 5KS9F 4FS0A 1EXUB 5JHLH 2VLRB 1CLOH 1QRND 4CL7A 3W2DH 4J3SA 5JNYA 5TDOA 1H0DA 5BS0A 3LY6A 4MNHA 3TPUB 4GXVH 5IM7B 4RMSA 4HBCL 1JNNL 3M8OL 1WWWX 4KK8C 3HR5B 4NN7C 3JVGC 1YEHL 2J8HA 3DETD 3WIFA 5JOFB 5DD6B 3JTSA 4NO0A 1LO0H 4JFPB 4ZUTB 3OR7B 5DVNA 3PJSA 5EO0B 1U3YA 2XI9A 3GSQB 5SWSA 4Q9BA 3MCKA 4NKIH 5C0CD 3U46B 2GUOA 3T4YB 3WJJC 5H94B 3UYPA 2QHLA 3HC3L 4KRNA 4LSQL 5DQ9A 4I4WA 1UADC 1RUKH 3WNOA 3SBWC 4FOMA 3H3KA 3ZT5A 4NKDB 4MJ5B 3H9SE 4UOW0 4PG2A 1L9NA 3G6JB 3WLBB 1JZ4A 4E5XA 3S9DB 3G6JA 1LO2L 4KQ4H 5D93C 3BGMB 4XZUB 4Z7VF 4JFDE 5IJKC 2BXYA 4F9LA 5AG8A 3STLB 5DK2A 3WXVL 4TRPL 3WS6C 5ETUA 4MVBD 3RNKB 1EBPA 1QEWB 2BVEA 3C6LC 5F3HB 3KPOB 4FFYH 3VE0B 4Q6YA 3JWOH 1OP3H 2APBA 3SDDB 3OR7A 1AGCB 4N0YL 1CFSB 1K2DA 4OCSL 5KSAC 4OF5A 1CFSA 1W0WB 2FD6L 4G8IA 4KQ4L 4CMMB 4QRPB 3MYJA 4P2OC 3CDFA 2VR4A 3L3HA 1DFBL 4TRPH 4K71C 4UILH 3PV6A 1KJMA 1QLRB 4PJ5A 3D5OF 4D3CH 4AYFA 1LDPL 2IGFL 2V9RA 3MRFA 5L2KA 1A1NB 2CRZA 5FO9B 1D5ZB 2XNAB 4I3SH 1FYTD 4NDMB 1NDGA 3OHXB 1FNFA 2YK1L 3EOAA 4WUKH 2BY2A 4PRHA 2DQTH 4FTVD 5HHVL 4YO0A 4U6XB 4OGZA 4OZGB 6CGTA 1OWRM 3KHOA 4QLRA 4DGVL 1KTLB 4R97B 2IG2H 3RY6C 2DLHA 3BGAA 3B3IA 4Y5XA 3QDJD 4RGMB 5GS0D 1KEMH 1YEJL 3T09A 5E2UL 4OCNC 4ZS6C 5F89B 2L0DA 1K8DB 5F7MC 3BKJH 4D9RD 4KJQC 4JRYB 2OMBA 3QCUH 4FZ8L 1BFVH 4RMTA 4Z7WF 2R56H 2CXKA 1RVFL 4CJ0A 1OVZA 3PIQA 4YWGL 1I3VA 1QSZA 4NN6B 1JNJA 1F3RB 1IKFH 5BS0B 3TA3B 1XGPA 4MCZA 4GKNA 3PABB 1RZIB 3RY4A 4M8VA 3AMKA 2EDRA 4KVCH 1T2QL 2C7UA 2C5DC 2J7LA 2MHAB 4XH2A 1ZHBA 4P23B 4NGHH 4AM0B 4H8WL 1AO7A 1JGVL 4PBVC 1HQ4A 2F8OA 1NANI 2I26N 1A6AB 4BSVB 2XWJB 1ACZA 2FHCA 3EGSB 1V3KA 4Q74A 4CVWA 5E4EB 2H3NB 4LEOB 4FZEH 5A2JH 1XCQA 5IHZB 3G5XA 5IHUH 5D72H 2CIKA 1ZHNB 4QGTA 1S3KH 1NLDL 1ERNA 5DSCA 3W9DA 5MP6L 1NC2D 2EDNA 4PJCF 1A3LL 2I9LA 1HHKB 1U95A 3UMTA 5GGSB 4EUPB 5DJ0A 3SGEI 2F19H 4KK9D 2LAAA 3O6LL 1EUUA 4K07A 4YBLB 2Y36H 5F7HA 2V9TA 2GSGA 2K7QA 1UXSA 3QP3A 4Y4FA 1G6VK 5KZCB 2GI7A 1RJLB 4Y19B 1GOHA 4JHZA 1KB5A 4P9ML 1GZQA 1NUDA 2HJKB 1BAFL 4HIEB 5GSRB 4BQ9A 1RQ5A 1S7XB 1MJ8H 3RWFB 2AJVH 4YHNB 4RX4D 2VLJB 4XBGB 3EOBA 5ID0B 3B2UC 4RSVA 3QDME 5E95B 3S34L 4LSTH 3IVKA 1I85C 3RKPA 4CU7A 3F7PC 5D6DC 5MERB 1U8NB 3D25A 1DQJB 3DMMB 4JGUA 2ID5A 2WM0A 1CGUA 5I75B 1YNTA 1XF4B 3ALXA 1H15A 3B6SA 1YEFH 2XWTB 2ZNXA 3WXWL 5H35B 2H3NA 3RVTC 1FYTE 1KPVB 4M93C 4M61B 1B2WL 1BVZA 3U83A 1OQOA 1T20B 1S9XA 4G3YL 1JK8A 1VGKB 5I1LB 1KG0B 2OJEB 5L2KE 1MHEA 1Q9LA 3HS0B 3IDXH 3G6DL 4PRIE 1ETZB 4RFNB 1N4XH 2BY0A 4JO1L 3JBG7 4YHKH 3B4NA 2FLBT 3L5HA 3ZDYE 2G9HB 3HG1B 3WEXA 4X4ZA 1U8JA 2AQ3A 2CMRL 4LASH 1QPPA 4X8JA 3GMOA 3BXNA 4J8RA 4M5ZL 3D87B 4NRYA 3G9AB 2XKNB 2W9DL 3RUGA 1WTLA 3AS0A 5IB2A 4K3DH 4LAQH 3VDBA 3HTLX 2VDMH 2Q8BL 3UJIH 4O4YH 2AK1L 4LVNB 4F7CA 4HGMA 5D6CB 1I1FB 3P73A 4PD4K 4L9LA 5ESQA 1OW0A 1TMCB 1A9EB 4XPGH 4GQ9H 2UWEB 4P5TB 4ZOBA 1X9QA 3TBSB 5F3BB 1MFNA 3GMLA 4Y5YA 2YRPA 1B0GA 2YPVH 2YD1A 5DMYA 2XXMB 4QHUA 3LEXB 4L1DA 1XGTB 1CXKA 3DSFH 4XMLL 1YNTB 1MQ8A 2R0WH 3UJJH 2Z8VC 1DCLA 3REVB 2EIZA 4JFQA 2X40A 2HT2C 2BSSA 4G5ZH 1KELL 2VDKL 5EBLA 1T1ZA 5DR5H 5C0IA 5D5MB 4UV7H 3C60A 2P5WA 3OKEB 3SO3C 3WLWD 4QXGH 3DXAA 4ZFZB 1EHXA 4J1UA 1CLOL 2OJEA 3L7FA 1PZ5A 5HHNA 2AXFB 5IV2B 2ERJC 1XGPB 4XNQB 1S7XA 3RWFA 2JJSC 1SM3H 4KGJA 1RFDH 2DQJL 2JJUA 2AQ2A 4I3GA 2VDKH 5HI5C 3T1FB 5JQ6L 1C1EL 2HKHL 1AO7E 2CDGA 3MUGB 1T0MA 2ZCKH 4ZMAT 4M62H 3LD8C 3TH4T 1A7OL 3S37H 2VC2L 3QG6B 5T33H 3V79C 2GJ6B 3O0RH 5HD8D 2FEEI 3EOBB 3QG7H 4NP4H 4ZQKB 5ID0A 4D2NA 5CILH 2V6HA 4YO0B 2BNQD 1ADQH 4PJXE 1OF2B 4PY7B 1A6VH 3QIUD 1Z9LA 4G7VH 3OKOA 3D1MC 1WZ1H 1GAFL 2VZ3A 4Z76A 3QNYA 2DQFB 1NGQL 1Z9MA 3BO8B 2NY3B 5T33L 4Y16D 1PG7L 1PY9A 1SEBA 4DVBA 5HHQA 1CD1A 3Q1SH 3C60B 4DVRL 3BQUB 4YE4L 4K94L 3N0PB 4Y0GA 2IBZY 1MJJA 2I9LB 2ADFH 4WFGD 1FO0A 5IF0A 1A4JA 1UQSA 3U1SL 3QUXC 4X6CB 1JYXA 4YHPA 4NJAL 4TOYH 1A3RH 3U9UB 5IK3A 1UA6L 3HNSH 2D7MA 4WFGE 2EDKA 4Q58C 5I1GL 5DEGB 1QEWA 5F3HA 3SE3C 5C71A 2M26A 5DA4A 4P3WA 2EDQA 3FQWB 1K3ZA 1WBZA 3MV9A 4NKMA 4P46B 4D3CL 1TJHL 5SV4A 4XWGL 1OLZA 2B8OT 3OKNA 2XN9D 2PUQT 4OFDA 2EC9U 5C9JA 3QPQD 5A3IC 2OSLB 2QJDA 4EEEA 1D6EB 2HLAA 1ZHLA 1MFBL 1ZT7B 4FQPA 4PGEA 4JFEE 2DD8L 3L3IA 3K4ZA 1GC1C 3AREC 5FO8A 5JHDD 1T2XA 3FFCB 3L3OB 4KROD 2WUBL 4WWKB 1QFUL 4PIRF 3QUYC 1S7VA 4WFFE 3MR9B 1OGAE 2WP3T 3CVHL 2J6EA 2APTA 2VXQL 3U36A 3Q3GA 1BEYL 1RZ7L 3QUXD 2XWJA 2EXYC 2YUWA 4KKLD 3BZFB 3BD3A 2DD8H 1AGBA 3VD5A 3CPLA 1MREH 4UB0L 1NSNH 4GG8A 2XPGB 5C0BD 4LLUB 5E8OA 5HHXL 2I9TA 4FRWA 4YGVB 1QFUH 5MI0C 3ARTA 4IJ3C 1IKFL 2VXQH 3PGDB 5AZEL 1MWAA 4NQDB 1T1XA 3IJHB 1S5IL 2BHZA 4HFWB 4HXBH 3U48A 1MIMH 2EYTB 3KYOB 5IBUB 4AEIL 1FBIL 2IMMA 1CT8B 3LS5H 3CCHB 1I4FB 3QEQD 4PLKC 3RL1B 1KJ2A 1F42A 2RAMA 4JQXA 2VDRL 4Y4HC 4HWBA 4AQ1B 4U2ZA 2XZAH 4KDVA 3VG9B 5I19H 2O5YH 3MBED 2ESVA 4PP1C 4ZOCA 2QV2A 4OCYL 1BQLL 4WU5B 1KENH 1I9EA 3DOSA 3MA9H 3CFIC 3L7EA 5F88B 1A6VL 3CH8A 4JO3L 1UM6L 3MZGB 3VFUA 1OGAD 2OL3H 3VFSB 2A73A 2VLKD 3RL2B 1F6LL 2BNRD 3KLAB 4PJ7A 5B8CC 1WEJH 3QFJB 1FN4B 2A77L 1R0AH 5E4EC 3K4AA 4NC1E 2YPLD 2AJVL 1DQTA 5JIHA 2HT3C 5F8RC 2VERN 3GGWB 1UM6H 1G7JA 3MYJB 2X89A 3MLXL 4IOIA 2CIKB 3RQ3A 3MXVH 4DOHE 4HX1B 1BFTA 3SJVA 1CLCA 3UTSA 1BGXH 1TENA 5B3JF 1INDL 1U91A 5ALBL 5I1GH 2YWYA 4QXUL 4KTDL 1RI8A 1UYWL 3MRRB 3LN5A 4FQHA 3IFOA 5B39B 2CRMA 2O61B 3WO4C 5ERWA 5FYKE 1QR4A 3N85H 4HEME 4TTDC 3KDMA 2R0KL 2OP4H 3WFHA 2CIIB 1FLRL 5I1EL 2XIDA 4U6HB 3G6DH 3GHBL 3V4VH 3WSQH 4JZJB 2VR9A 5DGQA 3TJEL 3U46A 1OSZA 2D31B 5GRVL 1E27B 2FIKA 1D6EA 2VQUA 1F3DJ 3KNBB 2HA1A 5IVNA 2VZOA 4WW2F 1JWUB 2BSRB 4XT1C 1ULVA 1N64L 4Q6IC 1RIUH 2R23B 3CDGB 1S7VB 4XNYL 1P4IH 1MREL 2X2YA 4UB0H 4QY8A 3SKMA 4DKDC 5C8JB 5FECB 5J89A 3KPMB 4ZSOA 4PJBE 5KN5A 3QIUC 5EUKA 2BNRB 3PHOA 2X7LB 3NN8A 4MAYB 3HI5H 3FQUB 3LS4H 4IRSA 3FL7A 5IEHB 1RUAL 3PDOA 5DS8A 4ENEC 5J12C 4V2CB 1KNOA 3TYFB 4RFOL 2X4RA 4XPGL 2W91A 3G04B 3WNKA 5INCB 1LP9B 4NQCA 1JV5B 4XXCA 5HYSG 1UJ3B 4IRZL 2NY6C 3E6FB 5EU6A 1P53A 1DLHB 1LGVA 3GJEA 4N0FA 2Y36L 3VXSA 1NCDH 1G1YA 5GGVL 5D7IB 1D7FA 5SWZD 3DXAE 3VA2C 4GLRI 2X4NA 1S7QB 1IC4H 1JZ5A 1CQYA 1U2CA 2FRGP 1CF8L 4Y1AB 5TDNB 2JJTA 3S5LG 3MLUL 3GB7A 3O11A 5FO8B 3B8YA 4X6FA 5HGDA 3O4OC 4XNZC 1OGTA 1P1ZB 4BQBA 3OAYH 3RWIB 3QFJA 2IBZX 1LP9F 5JXEA 1YNKH 4GW4A 5BRZB 5EOTA 2GK2A 3F58H 1JZ2A 1RZJH 4E41B 5D7JA 5GS0C 3TIDB 3LQMA 3RI5K 4PJGA 3L7EB 5F88A 3P4NB 2GCYA 5I66B 5FKAA 3TFKD 3RKDD 1X5JA 5EU6D 3AM8C 3LV3B 5ANME 3CX5J 3C5JA 1L6ZA 1E4KA 4WWID 1IGMH 3OZ9H 1JGUL 3JXAA 4JFOA 1B2WH 1XH3A 2HLFC 4LQFH 3WFBL 1PX3A 4WWKD 3CFJB 4HH8A 2FJHB 2E9WA 1A0QH 1PY4A 2HFTA 1EMTH 4JGMA 2RQ8A 2VMFA 5C0AB 3FQTA 3IDXL 3QUZB 1MPAL 1IGCH 3B8SA 5L6YH 1M7DB 1KJ2B 1IC7L 2AEQL 3QHTC 5GJTL 5L8LB 3VFWB 3QO0A 3VCLB 1P9MA 3H3PH 1I7ZA 4HKBB 4KKBD 3PWJB 4NQSB 3RIAK 1TETH 4XVTL 2MQ3A 3G5ZB 1CDBA 2PXYB 5D9SA 3WSQL 4NNPH 4OLWL 2YWZA 5ITFA 3ORJA 4M5ZH 3UJTL 2R0LH 3RVWC 1S9YB 4X5WA 2NXZC 3Q5TA 4X6DE 5FAAA 3L95B 2O26U 1Q9KA 4HS8H 4HPOH 2X4QB 2X41A 2YPKB 2IADB 4LGPB 5MEQB 2Q8BH 4Z7QE 5TQ0H 4RFEB 4HQQL 3BHBA 4P57A 5HJ3A 3FFCA 5CEZL 1WBXB 4ORGA 3DMMD 5BRZD 1GC1H 5CEZD 1EERB 3V5HB 3HZKB 4QO1A 4GRLA 3LN4B 4MJIA 3FCTB 3OX8A 3V8CA 4I18B 8FABB 5HYJD 3H9SD 2R2BA 3DMMC 3QEUB 3WEXB 2ICWB 3L1OH 4DAGL 2G9HA 2ICWA 3P0GB 1PGRB 1S9WA 2MFNA 2QEJA 2G2RA 4PJDB 4P2RA 1QFHA 1U8HB 5T5NF 3MV9B 4NKMB 1OTTD 2RGSA 3QIBB 3PXHA 3BKMH 5CEZH 1GC1L 1G7QB 5CP3A 1AP2B 4J8RB 4EDXA 4S0SD 3OB8A 4QRUA 5B38A 2ED9A 2YRLA 3SY0A 4NFBA 4P0DA 4WO4B 2DYPD 2DI8A 3PP3H 1PEZA 1KUMA 4WO4D 4HUNB 3SCMD 4U1KA 2FR4A 2Y07L 3F12B 4IOFC 1TZGL 3QHFH 2PYFA 3ZYZA 3TZVB 1Z6JT 3DMMA 2RCSH 2X9XA 3QQ3A 3QO1B 3RX7A 2HJLB 4KUZH 1MI5A 3V6ZB 4HIHB 1CLYH 3S5LB 3FRUA 1GOFA 4X5LA 1MEXH 1LK3L 5BOZG 2NY0D