1IC7L

Crystal structure of hyhel-10 fv mutant(hd32a99a)-hen lysozyme complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
b'DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic7L00
1PKQE 3IJYB 2BXYA 2VWEC 4NKDA 2R9HD 4YBLC 1R0AL 1NGZB 4Z78A 4I3SH 3VWJC 2YPLD 2R1WA 3O6MH 4F2MB 2R9HC 5INDA 1MIMH 2H1PL 3V0VA 1XGUA 4OZGF 5ISZE 2VISA 4WNQB 4HIHB 3GSWA 1EDQA 3LOWA 5HYQB 4HXAL 1MLBA 3OAZH 1T21B 3BD3A 3C09C 4ODUA 4PRHD 1P6AB 1DQJA 3ZLQC 3RKDD 4AENB 1X6LA 2AJVL 4X6BB 3MCLL 1M7IB 1R3JB 1XGQB 5CEXA 3MLYL 4HQQH 3RKDC 4UQ2B 5D2LE 4HGMA 3GSQA 1QRNB 3HN3A 4KKBC 4EI5A 1NSNL 4MNQE 8FABA 3VH8A 2RHEA 1T1YB 5MHSE 1A7NH 1EJOH 43CAB 1VFUA 2P45B 2VYRE 1G7QA 1JI2A 5I8EB 5B38B 3RZCD 3IAGC 3QHZH 2W38A 4Q2ZB 5IBLC 4I2XA 4Z6AT 2X89D 1ZHKA 3MROA 1A6UL 1OAXH 3PE9A 4M7KH 4LHUD 1S7VB 4NKQB 4QRPE 3RZCC 5HJ3B 5AD0A 5A40E 1UJ3C 5IHZB 1QSED 4YC2C 2VQ1A 3C2AH 1LEKB 2H41A 4OKVA 1RK1B 3OV6A 1VFMA 1A14H 2P47B 2YKLL 3VFRB 3ARUA 1FBIH 3UTQB 1RHHB 1E27B 4GAGH 4JZJB 2IQAB 5E70A 1I1AA 2EXYD 1NDGA 3GEWB 4JFZH 2PXYA 4QRRD 3QFJA 2Q8AL 1TTFA 4N68A 5BVPH 2EXYC 2QLVB 5HGAA 1C7TA 4OLZH 3NPSC 3B2UC 4L29B 5H94A 2JB5L 3LEVL 3S88L 4NRZA 4YDJA 4E41B 4U6VH 2UZIH 4NGHL 1EBPA 2CRZA 5ISZD 3QEUB 1JPST 1A1OA 4PS4H 4YPGB 3TT3H 1HEZB 4NP4H 2DJSA 2VNCA 5E8PB 3LDBB 3B83A 1JFQH 1AR1C 1DQLH 3CD4A 3NBNA 2Z93A 1NBYB 2DDQL 1ZT1A 4N0FA 1DUYA 4TVPH 4GOSA 1U8LB 3PIQB 2CIKB 1ZLWK 5JHDA 2GAZA 5D9SB 1MUJA 4M61B 4YK4B 1OLZA 4P9ML 4NUJA 3L5XH 1BZ7B 1OGTA 2YD7A 1BBDH 2BY0A 1AY1H 3HI1A 3LKSA 5BMFL 4FQCH 1ES0A 4CGTA 2XACC 4JFFB 4RWYH 2OBGA 5MHSD 5D1ZD 1EO8L 5IJKA 1GGCH 2A38A 4K3EL 1QO3A 1Z9SA 1FC2D 4KMQA 4F80A 3QIWB 3JV5A 7FABL 4HUWA 4L4TD 1SY6H 1ZLWH 5GRWA 4R7NB 3O4LD 5T1MB 1SHMA 4P9HL 5DC4B 3EFDH 1I85C 3O11B 3OX8B 2F5AH 2H26A 2X5PA 1N4XH 1KPUA 1RZ7H 5ILTL 5JR1L 3CFKA 4L9DA 1KNOB 2D4DA 3PJSB 4X6CB 4UV7H 3MV8E 3REVB 4D2NA 1IJ9A 5DZNA 3OKNB 2CJUH 1XZ0B 3HAEG 1BHGA 1Q9LB 1EHLL 5IB2A 3D85A 3MRKB 5GS1B 1NLBL 1FL6B 5T1LB 2R2BA 4LSUL 2NX5B 1F90H 3MRPA 3TZVD 4HD9A 4TSCH 1E4XL 5TDNB 4BSVB 4LLDA 1CZ8H 1XGRA 4G80A 1IL1B 3BKYH 2B20A 5I18L 4LLWB 3TZVC 4NCC1 2Z9TA 3VRJA 4OF5A 4UIMB 3FRPA 1JWMB 5EBLB 1U8HB 1MCFA 3NA4A 1CR9H 4IOSD 3G5ZA 4BSWB 3BPCB 3BH8B 4DGYH 3FB6A 5CEZE 1DVFB 4LSTH 3RDTA 3WS3A 1FZKA 2GSGA 3VW3H 4YWGL 2B5IB 1MAML 3ARGA 5JUEH 5F3HA 5FM5M 3JV6A 3LKRA 1BECA 2ADJA 4OZIE 1IT9L 3UTTA 4XX1G 4KI5F 1BWWA 3GB7B 2OL3A 3HC0B 2AJUL 3QQ9D 4RGOL 4LVHC 4XP4L 1GHFH 2VDNH 4U1IB 4WW1B 2XXMB 4ELMB 4NQSA 3RWHB 3KPLB 3B9VA 1KJVB 5IW1B 4C4KT 3Q3GA 2UWEA 1RULH 3TBVA 4HF5H 3WSQL 4PJFF 1BVKB 1OCWH 4M00A 3LPWA 1YY8B 4R97C 2W65B 3UTZA 3Q1SH 1F6AB 3EOYG 4PJ7A 2RJMA 2PYFA 1YEHL 4F58L 1XAUA 5CP7A 3ILQC 4XP9H 1DQML 3BVNB 1XGYH 4L8SC 5E5MA 2HJKA 3UTPE 2BRRH 3VGDA 1DN2A 1KN2H 5D1XB 4WTXA 3HE7B 5DMJB 4UT9L 5GJTH 4JANA 2PO6A 2QQKH 3F5WA 4BQCA 2JCCB 2FSEB 5HYSB 3IJSA 3QXWA 4YXLL 2VO5A 2HMID 1Z6JT 4H88H 2F19L 2ED7A 4PJAB 4IRZL 3X12A 3S3SA 4PJBE 3T0EE 2PW1A 2OTPA 2XZQL 4AQ1B 1I9IL 5DK3A 3MOAH 4RMWA 4WFFD 4WHDA 1BD2E 1HH6A 3WIHH 2YMXH 4KDTC 1DE4B 2YPVL 2OK0L 2DS4A 4HG4J 1RJZB 4TPRL 2NY3B 4NHUA 4N5UA 4WWID 2YUWA 4P3CH 5TE6L 1ZVYA 5FUCE 3OKMA 1I3GH 2GCYB 1ED3B 3K3QA 4P3DB 2QSVA 4JRWA 1YEGL 1T1WB 2EYTA 4BZ2L 2VXVL 3RVVD 3WNLA 1A47A 2OP4L 4N90E 1OL0A 3BZDA 4HKZA 3DURA 2DQTL 5T3ZE 1UB6A 3RVVC 1F00I 3MUHL 4XMLH 3IU3A 4F7CA 2VLME 5GS0L 3SE8L 1MREH 3E2HB 4K9EL 1EEQA 3EAKA 3VRIA 2P24A 4GJTB 2FX9L 1ONQA 1NFDB 3P73B 2R2CA 4RFOL 1JCKA 3DECA 5FF6A 2B0SL 3C5ZD 1AGEA 1J0ZA 2V2WA 4M9OA 4YHNA 4XPTH 3S8WA 1L7TH 1EK3A 1T1XA 3C5ZC 4Y4HD 3MXWH 1KJ3H 1JF1B 2F53A 3HZMA 1E4KC 1GIGH 5D7IB 3RUGF 5IROA 1DDHB 3U4BL 1DQDL 4Y4HC 3FKUS 3W9EA 2HH0H 4LCCC 3T8XA 3SGDI 3FO9A 5E2WL 5CWSA 3M17B 1JGDA 4P5MB 2NXZC 3ZKSD 1QBML 4NKMA 3ROLA 3QG6B 1U92B 4H26B 4QTHA 3WEXB 1C7SA 2UY6A 4O2CA 1WBZA 4YLQT 1YEFL 3IXAB 1D7FA 4LSVL 1LGVA 4WW2B 4UB0H 4LASL 1VACB 3VD5A 3T0ED 1CG9A 1F2XK 3TIEA 4OCWL 4XWOD 1NGQH 3VXUA 4CVWA 1R3HA 2IANE 4MAYD 3T0EC 3QAZB 4MDIA 5ICYB 4M6NH 3KWWB 4GMSL 3RWDA 2ZJSH 2K7PA 4MAYC 1EEZA 3IKCB 4X7SL 4CL7A 5IFHH 3WFZA 5ACZB 5F6HJ 2A77L 5KG9A 3GMNB 3GUTB 1UGNA 1J8HD 1H8SA 4R0LC 3UTSE 3KYAA 2DB8A 5FUCC 1W0WA 5ESAA 3KLAA 4N90D 4ZYKB 1MHEB 1LEIA 4PV9A 3HUJE 3G6AA 1IC4L 2ZG1A 4ZS6C 5I1HH 2ATKB 4UNVA 4ZD3L 1OQXA 3QDAA 5DD1H 5K9KA 1HIMH 4D3CH 3G6JF 4DVBB 2AGJL 5E9DE 3GRWL 4QNPF 3QO1B 1U0QA 4YFLF 3TBSB 2F8XC 2NY1D 4YHOH 1KCSH 4NO2A 4OI7A 1H5BC 3MV9E 2VMFA 3UPRB 4IRJA 4YO0A 2DYPD 4QWWD 5C7XL 1B0WA 1UWXH 4Y5YB 5HHXL 1K4CA 2ZOLA 2NY1C 4HHAB 4HS3B 1IKFL 3DSFL 3QFDB 1CFNB 1PVHA 1BEYL 2BVQB 5K93A 1SBSL 4HJGB 3UDWA 4DFIA 4LSPH 4NNYB 5ABDE 4TOYL 2EDFA 2YUVA 5DK0B 3ZHLA 3L3DA 5EZJA 3U0PA 3LEYH 4RFNB 3U2SB 1DBKH 3IFNH 3L5WB 3KPNB 4OZHF 4Z95H 4JE4B 3GGWA 5E08L 3VWKB 3F12A 1FO0B 2KZWA 1MCPH 4YX2H 3H7LA 4JB9L 2O5XH 4M48L 4OD2B 4F57H 2NY4B 2VDMH 2L7JA 4NJAL 5JPMA 1I7UA 1X5GA 4K8RD 1SJXA 1HSBA 3P4OB 4NO0B 2KH2B 4XCYA 3ULUL 3MA9L 3VFUA 4CAGA 2A6JB 4K8RC 2IAND 1EGJL 3NZ8A 2HFGL 1CDBA 1B0RA 4U6YA 2YUZA 4WJ5A 4G8GB 1N0LA 1O7SA 1T7XA 1QG3A 4IBLT 5IQ7L 4XX1E 3D39E 3D0LA 5ERWB 4K94C 2EIZB 1XT5A 5DJXB 2IFGA 5KSAA 5DMGD 3ECBA 3O6FD 3JXAA 1OM3L 2Y5TA 3N9GH 5DMGC 5CGMA 2CKNA 4TN9A 4I0PA 3ULSA 3O6FC 3WXWL 2W9DH 1EZVY 2GTWA 3KYOB 4OV6F 4P99A 4OCLC 5TPWL 1GZPA 1Z3GL 4HC1L 3VD9A 4ZNCD 5E99L 4EDWL 3KXFA 5E6IA 5JIIA 4U1GB 4OF7A 2WAHA 5EUKB 2B39A 2C1PA 4YDKH 5I66B 1F8TL 1WZ1L 1BAFL 4NSKB 1ORSA 2APTA 1XGPB 3GKZA 5C08B 3VXRA 4NJ9H 4L1DA 1IGML 4X4YA 1LNUA 2EE9A 3IXTB 3S4SG 3EJYD 4S1RL 1RZ8B 2YZ1A 4WI5A 1R5VA 1UC6A 4FP8H 5FM4A 3BUYA 3BH9B 3OG6B 3FMGL 5KW9H 5T3XE 4TTGA 3BZ4B 4U6HB 4IMLB 5C0BD 4LAJH 3DETD 3QPQD 3GK8L 5GQBA 3U30B 3D18B 3GSUA 2IGFL 4F3FA 2AV7A 3U83A 1AP2B 2YC1A 3DETC 3QPQC 4WEMB 3P3YA 3OAUL 3MRLB 5F9JA 5HHVL 4PRPB 1VCAA 4CNIA 2ADGB 5EOTB 2JJTA 1QSVA 1JWUB 4QHKI 3SDAD 3F6LA 2AJXH 5H2BB 4YBQD 4R2GC 3ZL4H 3AVEA 3B9EA 4M1DH 3WL9A 1NAMA 3SDAC 3SBWC 1TQBB 5I6XC 2YOCA 4MB5A 5J0BA 2HJLB 2J3SA 4NQCA 4NKOA 5JMRA 3V95A 4K7FB 4PLJD 4M8QA 4ZUSA 4OLXH 4JPVL 3ROOB 1KB9J 2DLGA 1MIEL 2G2RA 1MFBL 4GW5A 1E0OB 4PLJC 4TVSa 3CU1A 5DC9B 4XCFH 3QIBA 4NN7B 3VFMA 4I3SL 3HC3H 2CDGA 1A7RH 2G5BA 1I4FB 5I71C 3FQNB 1MIML 2F54B 4JO1H 3HR6A 4P46D 1P4LA 25C8H 3SGJC 3ARFA 3ZDYE 4E42B 4GUPA 3ARBD 3FQUA 5IBUB 2VJXA 1BBJB 2OTUB 4JHWH 2AABH 4P46C 2IJ0C 1VFBA 4K71C 3WLBA 5HYJA 5DUMH 4GXUM 5JQ6L 4Z7VF 4I18C 1M4KA 1R3LA 1UFUA 5GIRA 4BH8B 5HDBF 1J87A 3TBYB 4HQQL 5KBNC 3ZHDA 3FQXA 3F7QA 1D5ZA 2BC4B 2NQCA 4EUPH 3MREA 4XH2A 3I9GH 3O2WH 5IVXA 3WUWB 5DQ9B 1A7NL 1L0XA 4NQEA 4RNRB 1EJOL 2VDQH 5T3XD 3VXTA 3NA9H 4LCWE 4RAUA 2M26A 3RA7H 4XPBH 1BZ9A 1C5BL 1UT9A 5D7SH 5TQ0H 4P2OA 5HXMA 3W39A 1U8QB 1II4E 2DM2A 1K5NB 3CX2A 3DJ9A 3QHZL 4I4WB 4G8FA 2X1OA 5MERA 5DMYA 1OAXL 4M7KL 4X8XA 5HPMB 2BNRB 2NZIA 3V6BR 3WJLA 2G60H 4HLJA 4HFWA 1R24A 3C2AL 1W0YT 2DQFA 3FL7A 3RX8A 3GSNA 1X4ZA 1PY4A 4WFHE 2GYSA 2HTLD 1A14L 5DQDH 5E8OB 4CN1A 1FLRH 5DD6A 1FBIL 4NZTH 3A6BH 4HIXL 4GAGL 4XNXL 2HTLC 2C1OA 3P4NA 3W5NA 1IE5A 2DLFL 2Z31A 4LBEB 3SDXB 5C9JB 4MD0B 1C1EH 1CXKA 4ZAKB 4UT7L 3W9DA 1H3UA 3P9WB 5BVPL 3CUPA 4OLZL 4RX4A 1WTGT 2ESVE 3DWTA 3KDMA 2HAZA 1P7QA 1CDIA 1K8DB 3DIFB 3H9SE 1UCTA 1XF5B 1NJ9A 2UZIL 2R2HA 3BN9D 5LGJA 4PS4L 2VABA 3TT3L 2GQHA 3WS6C 2XFXB 2YWZA 4MJIB 3HFMH 4IM8A 3BT2L 2WP3T 3BN9C 1AD9A 3Q5TA 4PJCA 4TVPL 2PN5A 4GKOA 4OCMC 2ZSVA 3RWFB 1MJJB 2GSIA 5DRZB 1CFVH 5FHAL 3QPXH 1VEPA 3AREA 4R4ND 2C4FU 3L5XL 1BBDL 1DLFH 1AY1L 1JRHH 1YEKH 4JZOA 4NO3B 3BQUA 5IQ9B 3IFPA 5LVEA 2ADFL 4L3EA 2EKSB 3VA2C 3DOSA 4CMHB 4JRYB 1RFDH 1GGCL 5I9QB 2A73A 5EO1A 4KKNA 3AC0A 3GMPA 4WTZG 1KCKA 1BVZA 4KGJA 3EDDA 1T0NB 4JDTH 5GGSY 5GZOD 3NACL 3OXSA 3FONA 4GG8A 3SJVA 1SY6L 3O2DA 4LKXA 4C56B 4JKWA 4TRPH 5SWZD 1FNSH 3QIUB 4UAOC 3EFDL 1ZLVK 2I60H 1LEGA 4GW4B 5FKPA 1N4XL 2E7MA 1CT8A 1RZ7L 2FJFA 4Y5XA 3QEHB 1NDMA 2W59A 3BRDA 1S7RB 4GAFB 2XWTB 3FB5B 2LU3A 3I02B 1HNGA 1ZVHA 4Q6IC 2DMCA 4UV7L 1JL8A 4UINH 4EDXB 4S0TD 3B2VH 2NY6D 2VC2H 4G6JH 4YNYA 1AKJA 2QEJA 5C2BH 4YDVA 5GSVB 2WW8A 1HWHB 3QUMH 4GFTB 4QKXB 2NY6C 1F90L 2BMKA 4X5XA 5K9JH 3CFBA 4TSCL 1MNUH 4WUKL 4WUUE 1CZ8L 1ZLVH 2ZUXA 1T21A 1FL3A 3QDHA 3ULUF 2ESVD 1JHLL 2VH5H 3RWIB 1Z5LB 5JPNB 2W91A 1CR9L 1VGEH 4QCIB 2GK2A 3QDJA 4DGYL 1Q1JH 3H9SD 5A3ID 2X9YA 3LRSB 2EEBA 1XCQB 4LSTL 2DQDH 5BZDA 2VERN 3VW3L 1NEZG 5D2NC 3WMSA 5ADOH 3MLPA 5JUEL 4J12A 5HPOA 5A3IC 3U36B 4OM1H 4KI5E 4JFEA 3CNKA 4JFYA 5DJ0A 1QD0A 3PWNB 1XH3B 4R4FH 5LJYH 1XGTB 4LHQB 4K3JL 2P5WE 2VDNL 4QXUL 4BA8A 5E00B 4KK6C 5GGUA 3PHSA 2NR6C 3MV7E 3VE0A 1BPVA 3H42L 1QPPA 4PJFE 1S7VA 4HF5L 4Y16A 1FO0L 2EECA 5CZXD 1U8PB 3OF6D 4KROB 4PJHB 2PYED 4L8DA 3HZKB 1MHCB 4XVSH 4Q9CA 3TM6A 2K3TA 5CZXC 1VFAA 5DMIH 3O6LH 1RK1A 5CJBA 5C09D 4YFEA 3U0TB 5J13C 4IS6A 1X3DA 5DJ8B 3G5XA 4X6CF 2Q76A 2XA8L 3QA3B 1XGYL 3WDHA 5KJRH 2Z92A 1J5OH 2C3VA 5FECB 2BRRL 3H8NA 2CRIA 4ZOCA 4HJ0D 1JN6B 1KN2L 2FH6A 3WO4B 4R3SA 1EXUB 5CBEA 2JKXA 2ZSWB 5ANMB 2UZYB 4HJ0C 4L29A 2X44D 4MA8H 2QQKL 2VR4A 3FFCE 4GRWH 4KVNH 5DRNA 4PJDB 1CTOA 3S5LB 3VXNB 2HKFH 1QFWH 3MJ7A 3S36L 5AWNH 1I8MA 1RJCA 2VXTH 3R8BB 3O3UN 3PDDA 4W68A 4NQDA 5BO1H 3P40A 1D5MA 5DF0A 1IARB 3CLEH 4LMQE 5JIHA 4MMZC 2RIKA 5DRWB 1YNLH 5CFHA 1KEMH 4JM4L 5MP6H 4HWBA 2YRLA 1KB5A 1KXTB 1XR9B 4HGKC 1V3MA 4HUXB 3O4OC 4PJGB 5IIEB 4NZRH 5ETUB 2MHAA 3QUXD 3V52L 4L8CB 5D5MA 4A6YL 1PEWA 4P3CL 1JWSA 1DBBH 1I3GL 1IAKB 1ZA3B 3CSBA 3QUXC 3MRFB 1YUHB 1DP0A 4JEGB 4LCYB 3RWCB 2I5YL 3QISA 5E1AA 2JE8A 4XVUC 1KLUA 3BPNB 3JBG7 4X6DF 4K2UH 3O9WD 5F7KC 1I7TB 1U8JA 1P9MA 2E3VA 1N6UA 4G6KH 3MV7D 2VUYA 3DX7A 1JPSH 4OD1H 2G75B 4RIRB 4XMLL 2MTPA 5T1MA 4BQ9A 3O9WC 3IRPX 5DJDB 5AYUH 5FUZH 3VXMB 4F9LA 1FN4B 1AGCB 4H8WH 5JORB 3SY0A 4EXKA 1UWEH 1UQSA 4Y19E 3EYSH 2P48B 5TDPA 4JPWH 3SGEI 1UH4A 1RSFA 3PJSA 4KQ4L 2F58H 3VFOA 3CK0L 2ORBH 3OSKA 1L7TL 3S3PA 1QLRA 3BI9X 1KJ3L 4R26H 3D2UA 4GBXB 3RUGE 3LN5A 5DWUH 5SWQA 2FNBA 4OGXH 4JVPA 5CEYA 3BDBA 5T33H 3C8HA 1U93B 5L8LB 1S7UB 1D5BB 1A1NB 4P59L 4LLWA 1P7HL 3HS0B 4PJAF 1QYGL 1TJIL 1WT5A 2YPLA 3EDKA 2E5EA 1OF2B 3FFCD 3WD5L 4Z76A 4X5LA 5TE7H 1DVFA 3PF2A 4WI9A 1OW0A 3DO7B 1JPTH 4W4NA 5ESVA 2QBWA 4CU7A 1CN4A 2IH1A 4LQFH 5ACMA 3KNBB 2IPTL 4UB0L 5D7KE 4F7PA 1K2DA 3LKNA 2XQBH 4MQ7B 4WTWA 3GHBH 1ZGLB 3DX9B 1NGQL 3DX6A 3NFPB 4IIQA 3RI5F 4P5TD 2P5EA 3EIFA 4M6NL 4ELMA 1TQCC 2V5MA 1JYNA 2J8UB 2ZJSL 5IW1A 4P5TC 5IFHL 3H7BA 2VKWA 1NCCH 3PABB 3QNYA 1KYOJ 2DL2A 2ICWA 4KJQC 4MWFA 3VFTA 3FT2B 2YPKA 4X4MA 2XZCH 4M1CD 1U3ZA 1TVHB 5CILH 2EDJA 1U91B 1FPTH 3D0VB 4M1CC 1MCKA 1MJUH 3PQYE 1I3VA 5MEOB 3QUMB 4LCUA 1WV7T 2VSCA 4LHUA 5I1HL 3IU4L 3ZO0A 2NW2A 2ZG2A 1KUMA 3U7AA 3WNOA 5C9KA 5CBAB 3G04B 4EOWH 5JOFB 4GSDL 5DD1L 1HIML 2Y72A 2OI9B 2K1MA 2HVKB 1DEEB 3VGBA 4QNPE 2AKRB 4Y19D 3KLHD 4YHOL 2DWDB 1MFDH 3MLZH 1O5DT 4DGIH 2FYYB 4PJ9D 3KLHC 1REIA 1FNLA 2ZUYA 4WEUD 5MEQB 2D7QA 1ZT7B 2WWMD 1ZA6B 2FEDD 2CIIB 2YD2A 1GGIH 4PJ9C 4PRIA 2MCPL 1IGIL 3AUVA 4LSPL 1TDQA 1JIBA 4JFXA 2WWMC 4QRRA 2FEDC 1A3QA 5I19L 2N4IA 1BMGA 3LEYL 1RD6A 4OZHE 3U7YH 2OR9H 1U3HB 1W0VA 4Z95L 2VTFA 3DVNB 5C0GA 4KV5F 4DZBB 4KVCL 4JKPH 1EAPB 3LKQA 3EO1B 4PJ5D 1OGAD 2W60A 2CKBB 1EBAA 1MCPL 1S5HA 5F96L 1DE4A 3P0YH 3QDGB 4FXGB 4LLMA 3ZE1F 2O5XL 4F57L 1I8KB 4L9LC 1I7ZB 4X98A 4UQ3B 2GCYA 2BNQD 3R06A 4CN6A 4K3GA 1H3XA 1OPGH 1NANH 2NXYD 3I2CL 5D7LB 5JMOC 4L3AA 4AY0A 4GRLA 1JNNH 4ODTH 5AYQA 1Q72H 4WHYG 3FOLB 1PAMA 2NXYC 4M8VA 2O5YL 1G9ML 3ARXA 3OKKB 3HG1A 4PPTA 4PLNC 1A4JB 5C0RH 1WZKA 2AXFA 4P4KA 1G9NC 1SEQL 5D1ZA 2CSPA 2OYPA 4HCRA 2XA3A 1ZAGA 4QHLA 2NTFA 3CFEA 3QDMA 1NFDA 3P73A 4PJXA 5EA0L 2DQIH 3MRHB 1OARH 3DUSA 3IETB 1XIWD 4GRWB 3PL6A 1HOCA 3N9GL 4TNWF 3GBMH 3T0AA 3MNWB 4OF0A 4PY8I 4ZUTB 3BPOC 2F5BL 4UU9B 3U6RA 4L4TA 3HI6H 2W9DL 4RZCA 4P2YA 3O4LA 1MHPH 1HHIB 1XIWC 5KAQF 5CIPH 5EFIB 1KFAH 1WK0A 2GY5A 4Y4FD 5L7XH 2RR3A 5FGBA 1I1RA 3WN5A 3E3QE 5CMAA 2R56L 3GMRB 2OZ4L 3TNNA 5BRZB 5IV2A 4WI3A 1CD8A 1KJMB 4LGPB 4MDJA 4R9HA 1FGVH 4FQJH 2AJYL 3VFGH 1SJHA 1CD0A 4FP8L 1AQKH 1T22A 4WW2A 1U6AH 3BRGC 3KJ6H 5KW9L 1L4IA 5FYLE 1FZMB 5F1IA 1ZHBB 4V1DB 2ICWI 4PGZA 5C07A 2UWEF 5E94A 3UJIL 5GGTA 2E27L 1K8IA 2ATPA 3PV6A 4XC3L 5LCVH 1KGCE 3NN8A 2EE6A 2IWGA 4KKAD 3ZTJH 3QWRA 1FL5A 1W72H 4PV8A 2Y36L 1IBGH 2IALA 3D5OF 4KKAC 4OIIL 1G7IA 5EU4A 3IS1X 3ZL4L 4HS6A 1YEEH 3GFUA 4M1DL 1YMHB 1FVEB 1SVZA 2PW2A 1NMAH 1JYWA 4J3UA 4ENED 3ZKQD 1NCAL 2V5RA 5JLZB 2EO1A 2J6EH 3DV4B 3IDYB 4TNVK 4PYGA 1NMBH 4OLXL 3QHTC 1PG7L 4ENEC 2FWOB 4ZFGL 1CLYL 4YBLB 3P4MB 3BX7C 2R2EB 4N8PA 4Y1AB 5GRJH 5JO5B 5JW4N 2UYLB 1SM3L 4CN4A 4UUJA 1J11A 4XCFL 5C0IA 1HXMB 1QHOA 2ERJC 1CQYA 4UTAH 1UM4L 1AGFB 4HKXA 1F58H 3FQTB 4GH7B 2V7HB 1OAQH 3DHMA 5LXGH 3MYJB 2HA1A 3EOAA 3HTLX 4LSQH 3QUKA 4YHMH 4ZUWB 5I2IB 3C09B 4XP1H 2AABL 3OXRB 4I77L 3RNQB 2SEBB 2ICEA 3RP1A 5DUML 3E3QC 3T4AA 4DGVH 3MLXL 3UAJD 2EXWD 2BY2A 4Z7VE 1JHKH 4J1UB 1VB9A 1NMCC 3DUHA 4PRHB 5HDBE 4Z7UA 3L1OL 3UAJC 2EXWC 3KS0H 1CE6B 5I30H 4J8RB 4JGMA 3DHJA 1SYSA 3I9GL 4P2RD 3VDCA 5I16B 5I73B 3WE6A 2AAVA 4ALAL 4AT6B 1UH3A 5K33A 3OAYH 3V5KB 3M1BA 2VDQL 4IRSA 1IAIL 5FYLD 3NA9L 2YZ8A 3VA6A 4DW2L 3FO1B 5AAWA 5TQ0L 4HUVB 3T77A 2R4RH 3U82B 3FB7A 4O4YL 4JPIB 3VGAC 2P46B 3RZCB 2F74B 1KGCD 1ORQA 2XG5A 3BAEH 4DN4L 3JV4A 4RRPG 4EEEA 4XNQA 4YC2B 1I9JH 3MJ9L 4FTVA 1JPGA 4JDZB 5ENWA 4E0RA 1OP3K 5CEZH 3ULVD 2G60L 1QSEB 3FQRA 4OZFA 1J0IA 3JUYA 1HDMA 1R3IH 5DVMA 2IPUG 3KPTA 2NY5C 3ULVC 5IB5B 4LPTA 3BWAB 5DQDL 3DGGB 5CZVH 5EH1A 1F11B 4NZTL 3VH8G 4FOMA 6FABL 3NAAH 4PG2C 3SPVB 1UM6H 1XCTA 1KB9K 3T1FB 1A6VH 1E6JH 2MNUA 2VLJB 2RGSA 4LFHG 4CVZB 3GSXA 4HH9A 5E56A 4UDUA 3NPSB 3WIHA 1U58B 3TPUA 4LDOB 1PKQB 3QXAB 1XGPA 3PDOB 3L3HA 3KPRD 1V5JA 3IXTA 4KUZL 1AFVH 1L9MA 2DWEA 3RTQD 4HLZH 1R5IB 5FK9B 3VFSB 1IGYB 4P2CG 3RTQC 4PGCB 5ISZB 1FFNA 2VXQH 4NT6A 4YUEH 3MRQB 1UA6H 3HFML 3IFOB 4PP2B 3HE6A 2Z8WC 2ZUSA 3UYRL 2E8YA 4G9DB 2R15A 1GYAA 2E6PA 3N1QC 4LVOC 4JG0H 3D18A 3QPXL 1CLOH 4WFEE 5DYOA 1YEKL 1JRHL 1D5XA 3MJ8B 3RJQB 1MEXH 4C83B 3CH8A 4XTRD 5D2LB 4JFPA 1SMAA 1GOHA 4MNQB 4NWUL 5SWSD 2FH8A 5EOTA 1RFDL 4XTRC 5H37G 2DQEH 3O2VH 4O2FA 4RFEB 1MRFH 1OP5K 5FCUL 3AAZA 4NC0B 5FYJL 3B9KD 4L4JA 5CIPB 1NH6A 1FFPB 2CK2A 4LKCA 5K9OB 2RB8A 3AM8C 3F7VB 3GMLA 1UH2A 2QQQA 3U4EA 3B9KC 2A83A 3DARA 5J6GA 3VGGA 1VENA 4AEEA 3TH2T 1RMFH 3NCEB 1YNKH 2COQA 1NC4D 5IVNA 5F1KC 4KZEL 2D4FA 5HGBB 5JDSA 1M71B 3LQAC 1X5KA 1T4KB 2X10A 5I1LB 1RJLB 4UINL 5FIEA 1GC1H 1OAYL 2VC2L 3GNMH 3IRZA 3QZWB 4U1MA 1ROWA 4YDLB 4PGJA 1U2HA 5IGXL 3QUML 5GGRY 5T3ZH 4E41E 2NLJA 32C2A 1MNUL 4JQVA 4HJJH 1ZSDB 4R90L 4UDTB 2CD0A 3TZVB 2ICES 5EO9A 3S97C 3X11B 1OT2A 2FLBT 2APVA 4XVTH 2FZ3A 1FNHA 1V3JA 3F6IA 2VH5L 5TF0A 1BVLA 4JN2B 1VGEL 5KANI 1W72B 1B4JL 4OCXL 5HDOA 1Q1JL 1XF4B 3NCYP 2BVPA 3IB4A 1T04A 1QR1A 3GMOA 5FO9A 4LOUD 2DF3A 1PX4A 3DPBA 5ADOL 5F6IC 4ZPTA 2BZDA 2VLKD 3LQZB 3BP7A 4OM1L 4AIZA 1KC5H 4B0MM 1F4HA 4LVHB 4S1QH 4R4FL 1C16B 2VZOA 3U9UA 4Q74A 2CLRB 4OFDA 4WFED 3PV7A 2IPKB 1ZEAH 1MVUB 4QRSA 5KAQG 4HUKB 1WBXB 4QY8B 1B2WL 5I15H 3CSYA 2CKBL 2Y5EA 5GRUH 4R97B 1F3DJ 1KLGA 4QEGA 3FT4B 1K85A 3FRPG 1HXYA 4U1LB 1CVSC 3RRQA 5ID1B 1CGUA 2EC8A 4XVSL 5HGDA 1BQHA 4NNPH 4I13B 4HK3J 3E6HA 1J1OH 1GGUA 4NDMB 1LVEA 5DMIL 3TN0D 3O6LL 1J0JA 4ZXBD 5L88H 5E8OA 1HSAA 4D9RE 1FFQA 1QOKA 4QXTB 4L8SB 1T2JA 2FJGB 4KPHL 4X6CE 3TN0C 5IW6A 4ZXBC 4Y2DD 4JO2H 5KJRL 1J5OL 2DQGL 4K94H 4MD0A 4Y2DC 2NX5E 1U36A 4QRQB 1CQKA 5BOZG 1H8NA 3G6DH 3MJGX 3CFCH 8CGTA 4MA8L 3W81A 4N0CD 1CCZA 1AJ7H 6CGTA 2QHLA 4KVNL 3MV8B 2AQ1A 4JFOA 1QFWL 1WIOA 5JXAH 4EBQH 2X4TA 5E8EB 5AWNL 5DJYB 4N0CC 1E28A 4HZAA 5CJXC 2G9HB 2VXTL 1PW3A 1ZWIB 3FN0L 4X4ZA 5BOPA 2OJZH 4GQ9H 3CLEL 3LIZH 4F7MA 1YNLL 3MSPA 1CLCA 1T83A 4LLVA 1K9TA 2XWBA 1S9VA 4X6EA 5ALBH 1S9KC 4ZFZA 1URLA 5FOJA 1FYTE 4J3SA 1JPFA 2BOBA 3B9AA 4NZRL 3MNVA 5KN5B 1PX3A 4OD3H 4OZIB 3S34H 3L9RA 3FO2B 3LY6A 5IB3B 5HVHC 4X6DE 4PJHF 2VXSH 3AXLB 2ITCB 3CC5A 2JK5B 4G6KL 1B0GB 1VDGA 4U1JB 3ARDD 3SKJL 1U8NB 5L2JB 3QI9A 4WO4D 3HAEH 5AYUL 3UBXA 2I07A 5FUZL 3EDEA 5DUBB 2AVGA 4YIQA 3ARDC 3B5GA 3C6SB 4G42A 1UWEL 4BUGA 2WZPD 4OQTL 4WO4C 1YEJH 4JPWL 1CGSH 1S7WA 2JIXD 2XWTA 3C5ZB 5B39B 2F58L 2GI7A 2P7TA 2ORBL 5C0CE 3QXDB 4Q7DA 4G43B 4R26L 4Y4HB 2R1YB 4TUOB 3V7MA 5T5NF 2FIKA 5DWUL 4LCCB 4OGXL 1G7HB 5J89A 1RQ5A 3VMNA 3MRDB 5BJTA 2NXZB 1AR2A 3TCXA 5T33L 4RMSA 2AEQH 3HLAB 2VUOA 2EYSB 2H6PA 4S11A 1FYHB 1Z5LA 5L2KA 3ZE2F 1A0QL 5HGHB 2LTQC 5DC0A 5I0DA 4HKJA 5ESQA 3MRJB 5TE7L 4GO6B 4XXCA 4WHTA 1JPTL 2BCKA 3WFDH 5BV7H 3OR6B 3ARBA 1L6XA 3G5VA 4LQFL 2HFFB 4I2XE 3VJ6A 5DXWA 3MGTB 2XQBL 4GT7A 4PJGF 3GHBL 4N0YH 3T0EB 3KJ4B 2VLRA 1NCDL 3H0TA 5E00A 5ICZB 3VGEA 4MAYB 1BD2B 4PRDB 3A0OA 2QQNH 4J3OC 4MVBD 1FYTD 4GMTL 3NMEA 1CD9B 3ZDZF 2X4NA 4ONFH 1NCCL 5C1MB 4MVBC 4BZ1H 2OTWB 4R0LB 3WIIL 2XZCL 4H25B 2BSED 4KHXL 4LVNC 5CILL 1FPTL 4XAKE 2RFXB 1MJUL 4Y8DC 5T3XH 3CDGA 3KPMA 3QFJE 2NW3A 5KS9A 1LE5A 3KYNB 4EN3D 3MBED 1A2YA 1LO2H 1CGWA 5FECA 3N1MC 3BZFA 1NCTA 1JZ6A 4O00A 4U1NB 3BP6B 1EEYA 3VXOA 3MLZL 4WEBL 4DGIL 5KSVB 3IJHB 4EUPA 3LSOA 5TQ2H 2VDPH 1LILA 2R1XB 1UWGH 4LEOA 5ICXA 2C26A 2NYYD 2PUQT 2X9XA 1FG2B 4MD5A 4XHJD 4FMFA 2NY2D 2NYYC 1ACYL 2EH8H 4EI5D 2BSRB 4OLUH 3U7YL 4PJEF 2OR9L 2JJSA 4XHJC 4KV5E 2NY2C 1MCOH 5TDOA 4MHHI 1OAKH 3MACL 4DUXA 4YR6B 4EI5C 5TF1H 2DKUA 1UXWA 4NFBA 1KULA 5A43C 3P0YL 1MQ8A 5DK2B 1TTUA 4ZQKB 2FJHA 5IHUL 4QF1A 5I76A 4M93C 5HHME 5IIEA 4GS7B 3BP4B 1YDPA 5FO7B 5DHVH 3BIBX 5FXCH 3KPPB 3RX5A 1HH9A 1KTLB 3V6FA 4OFYD 3T4YA 3DRQB 2IANB 1Q72L 3L5HA 1H3TA 2XZAH 1I1YA 4ZO7A 5HHOA 3GJFK 5JHLH 1MCDA 1KTRL 2G75A 1TITA 3OKDB 4MJ4A 5IFJB 2BVEA 4GQPH 1TIUA 3CZFA 1KYOK 2QSCH 3MLSH 3QWQB 4S1SH 2HN7A 3QEQA 5JXED 43C9B 4U1KB 2DQIL 1OARL 1U41A 3O6FB 5DQJA 3UTSB 4K23H 1I1AD 3GBML 4XAKD 5F89B 4TSAL 1CFSB 2YD8A 2XN9D 2PXYD 3H9HB 4FQIL 3D3VA 3QFJD 1JTPA 1MHPL 1I1AC 4LLYA 1KFAL 3V6OA 2PXYC 2XRAL 3LQMA 3GJFH 1GZQB 4F7EB 4MA1C 1KCVH 5E9DB 1ADQL 3EOBA 4XB8A 4PGDA 1A1NA 5IBTL 2X4RB 1N5AA 3MV9B 5LAXA 5E8NB 1H0DB 4X9GA 1FGVL 3PXHA 5ACLA 5BZWB 4EQ3A 3EKCA 3VGHA 4DZ8B 4S10A 3CH1B 1MOEA 3O3DB 2P1YA 3DO7A 2VSDA 1JZ3A 5JHDD 3SCMD 5ALCH 1AQKL 4JDVB 4HX1B 4PRBB 1U6AL 3MFFA 1B88A 2UWEE 3CFJB 4ZSOA 3MFGB 2YA0A 1P7KB 4IHOA 1HQRB 2GUOA 1G7JA 2EO9A 5KVFH 3D69A 3DUUA 3IDGA 3PDGA 1T1ZA 2LVCA 1HILB 3DRTA 2J8UA 2AV1A 1QP1A 1D3CA 1W72L 4HIEB 5IJKC 1MAKA 3GKWH 2CPCA 2FR4A 1IBGL 1UYWH 2EKJA 2GTZB 4MA7L 4R2GB 5GS3A 2DAVA 3KGRA 4Q9QH 1IM9A 3SDAB 4KTDL 5I6XB 1YEEL 1HHHB 2QKIB 4PGBA 5EU3B 5F93C 2QADD 3WNMA 2E7LA 2CMRH 1NMAL 1QZ1A 1NC2A 3TJHD 3AU1A 2J6EL 4P57B 3SE9H 3KPSA 1NMBL 5HVGB 4PJ8A 3D39B 3TJHC 2PYEA 3RHWK 3MPCA 4NYLB 4GLRH 3D85D 4ZMAT 3QG7H 3C60A 4JO3H 3STZB 2G5RA 5I71B 2FYYA 3RVTD 3IDIB 4UTAL 1YEDA 3QNZB 2OQJA 4PY8J 1KIPB 1F58L 5FA3A 5GSRB 1OAQL 5I17A 5LXGL 1BGXH 2F8VA 4XWGH 3I6GB 3RVTC 4XPHH 3WHE0 4P46B 4Z0BH 4K71B 5BS0A 4LSQL 4XP1L 1QNZH 2Q6WB 4U6XB 3RIFK 1J9CT 4I18B 4DGVL 3FAWA 3ARGD 1DLHB 1U3HA 4G8EA 1JP5A 4KHTH 4ZTOH 1TVBA 3CSGA 4GW1B 3RDTC 3GBNH 4DZBA 4HGWB 5D5MF 3UTTD 2ZPKH 2Z4QB 3ARGC 5I30L 4APQB 3IDMB 1T20B 3QDGA 3V6ZA 4RMTA 3MBXH 4XT1C 1RZIB 4LIQE 2XKSA 1I7ZA 5EN2A 2P8PB 4PRPE 4UQ3A 1ND0B 3CFIC 1QFHA 3MLWH 4OCYH 3TYFB 1N5YH 2R4RL 3QNXA 3TJEH 2JJWA 2BVOB 1QA9A 4CDHA 1MFCH 4QHNA 1I9JL 4HW6A 5BXFA 3WV0A 5T5NG 4LVEA 5CEZL 3RL1A 5FOBB 1JGVH 5I1DB 4X5WA 5IMOB 3K4AA 2F53E 4YQXL 4X0KB 1N2RB 4BH7A 1A7OH 1EUUA 5EBMB 1JRHI 5CZVL 5I1KH 1LO3H 3BO8A 4U2ZA 1IGFH 2VDLH 1M7XA 4JFDD 3VXSA 3NAAL 5DZLA 2FDBP 3K8MA 1UM6L 3IFLH 4HT1H 5F3BA 5KSBA 3C5SA 1L7IH 1A6VL 1E6JL 1ZV5A 2PO6D 2CDFB 4RQQA 4NQXB 4U0RC 1X7QB 2N7AA 3QCUH 2I9LB 4LNVA 5HDLA 1L0QA 1S7XB 2PO6C 4KKLD 1Q9KB 5DD5L 5SV3A 3OHXA 2Q1EA 2C3WA 4KKLC 1MCEA 5DHVB 1WBYA 3VXUE 1CXFA 1RHFA 4ODHH 1GCFA 1O0VA 1ZS8A 2VXQL 2Y06H 4U7KA 4YUEL 1UA6L 3ZZ1A 1LO5B 4Z7OF 3M8OH 4WFGE 3BD5A 1WTLA 2EIDA 1RZJC 5GHWH 4KAQH 5C0DB 4OLVH 3MRCB 4GAJH 1T7WA 2OMBA 2FB4L 1P5VA 1CLOL 2B8OT 1ETZB 1F3JA 1UCBH 1X4XA 2WQ8A 4O9HH 1FORH 3NGBC 2DQCL 1YC7A 3M45A 1RUPH 1PYWB 2DQEL 4S2SA 1JHTB 4LCWB 4WWKA 3UZQA 4Q0XL 5IMLB 3QUYA 1C12B 4EI6B 5IHLB 2ZNWA 2FHFA 1CYGA 1WF5A 1AXSB 2N7BA 3ALPA 2XNAB 1YMMA 1N6VA 4UAOB 4E9LA 2ITDB 5TFSH 2WMPA 3P9LB 3WDJA 1MCWM 3IDXH 5D96C 1RMFL 3SO3B 3H3PH 2OCFD 4P5KB 5F1OB 4JVUA 1CIUA 4HUUB 1MCSA 1P2CA 2F53D 2R0KH 2VDKH 1YY9C 4C55A 4IMKA 4Q6IB 1G6RH 1CFQB 1LDPH 1NGWA 1HXMA 3NABH 3MLRH 1WSST 4CRPA 1FIGH 3GNML 2PCPA 5IROC 2I9TB 3L7EB 3STBA 2NY6B 3OJMB 1OD7A 1R5WA 2VITA 4FHBD 1EX0A 2X70B 5T3ZL 4HJJL 2RBLA 1UZ6F 2H1PH 1FLTX 5I2IA 4XVTL 4G6FD 1X9QA 3C2SA 3DI2B 3PWLB 1IM3B 2Z91B 2ESVB 3GJEA 5B3NA 2R0LH 4JQXA 4FFZH 5D2NB 4EVNA 3H9SB 2AJVH 4YBHA 2A74A 5DS8A 1FV1A 1ZKAA 4KTEL 3GSOB 3IGAA 4NPYB 4YHIB 1IQDA 1NSNH 4PJIA 4WFGD 1WISA 4S1QL 5FKAA 5F7HA 5D7JA 1A1MA 3UZEA 3PWUB 5I8CA 3KLDA 4JFQA 4LF3B 5CP3A 5I15L 1HQ4A 2Z8SA 1Y18A 4AMKL 5GRUL 1A6UH 2YBRB 1V8HA 4NNPL 3KXFE 5J13B 1XF2B 4K8RL 5FEBA 2B7DT 1KIRB 4JO4L 5L88L 3DGGA 3S36X 4N9GB 1EVUA 4IRJD 5DTFB 3TV3H 3N1GC 1J1PL 1FVCB 4XPAL 3VXRE 2YEZA 4JO2L 3T08A 3BIKA 3RBSA 1G9NH 4IRJC 4K94L 2VAAB 1XF1A 1CICD 4MJ6B 5DEGA 3LKOB 5GRXG 1MF2H 3H3KA 1RUKH 1NUFA 2KQNA 4K55A 1D9KD 3KHOA 1PKQA 4ODSH 4OUUB 1A4KB 3G6DL 1CS6A 2CDEA 3CFCL 3WHXA 4CADA 3UDWC 1WZLA 1TENA 1AJ7L 3IT8D 3RNKA 4Y4FA 1KTDA 1AC0A 5D6DA 5JXAL 2MQCA 4DK3A 1P84K 5FK9A 1NUNB 3MO1A 3MRBB 3RU8L 4FQLH 3S88H 1KT2B 4PGCA 1UB5A 1JUFB 3L3GB 1FDLH 1RJYB 3MRQA 4NGHH 2E9WA 3C08H 3OKLB 1AGDB 5H35B 1W8OA 3BYTA 4Z7NF 4G9DA 2R4SL 3O4OB 5ALBL 4P49A 3R0NA 3JTSB 1CXEA 4MXQD 4EIZC 5HDQL 5BMFH 4NHCL 3SDYL 3QUXB 5GRVL 3L3JB 4POUB 2YSSA 3VRLF 4OD3L 1TZHA 3MNZB 3S34L 4MXQC 4NQCE 3M07A 1T80A 1RK0A 4PJHE 1EO8H 3Q6FB 4KUCD 2P5WB 3RX7A 2V7NB 3F7RA 1VEMA 3STLB 4LP5A 4O02H 3O9WB 4ISVA 4GKZA 4OLEA 5E6YA 3MV7B 2DKMA 2GFBB 4MD4B 1MCHA 5GGVH 5KSAC 4KDVA 5IG7A 4PJFB 2D7NA 4QRPA 3GSVA 4I0PD 4JVWA 4PRAA 4NNXB 1HHJB 4HV8B 5GS2D 3AS2A 4JRXA 2X4OB 4I0PC 3KXFD 4C54A 1M71A 4FA8A 4H0HB 1I7RB 3TH3T 3VXPB 1IAMA 1JNLH 3BRFA 5E6IC 1G7PB 5DZOA 1MJ8L 3VXRD 5C6TH 1VKXA 1DL7L 3MQIA 3EFFB 1BX2B 15C8L 3QEGH 1NLBH 3C6LB 2AEQL 3VCLA 3LPGA 3GMMB 2HG5B 1E4XH 1KPRB 5IKCB 3TIDB 1WVZA 5IVXE 3OWEA 4NM4H 3U1SL 1FQ9C 5EZIL 4NQEE 5F1NA 2J5LC 3RWGB 2AXJA 2BRQA 3FFCB 5DA4A 3LVEA 3UXFA 4OZ4B 3WFDL 3LPFA 2J7LA 4PLKD 1W2KT 1LWRA 1IQWH 2X7LA 1MI5A 1MCCA 2JF1A 3S37L 1JNHA 5C0FB 4N0YL 4PLKC 3DROB 1AHWB 3E0GA 1XMWA 4JHZA 1TQCB 2E9JA 3FCTB 4H1LG 5KSUB 2VLLA 2AJUH 2QQNL 2JJTC 3PGCB 3DXAE 2E7CA 2X41A 4I8DA 3ZDZE 2CUIA 1KJ2H 2HLAA 1YN7A 5J6HA 1G6RB 4BZ1L 1TETH 3VXME 5IB4B 4U1LA 3BGFC 2EZ0D 2UUDK 4F8QA 5FYLH 5T3XL 5HYFA 2EZ0C 4FFWD 2FJGA 3QIBD 2IC2A 3GMQA 2LU4A 5I1AA 4HIIB 3TVMA 3W5MA 3ZMRA 4FFWC 1LO2L 4KK5D 5DFTA 3QIBC 1SEBB 1KG0A 4FS0A 5DD3H 1NANI 4Y19B 3ARFD 2X2YA 4I3GA 4KK5C 3MUGA 2NY5H 2VDOL 2C3HA 4EIGB 3CSPA 5TQ2L 4PJ9B 1FSKB 5HYJD 3S35X 3PHQA 1JGUL 3ARFC 3HRPA 4CJ1A 3JWDC 4UOW0 4PJCE 3RUGB 4LPUA 3MTRA 4B7IA 4NZJA 3T0BA 4O5LL 4PJEE 2DD8L 5FYJE 4OLUL 4YXLH 3FT3A 1PSKH 2F19H 3QXTA 4IRZH 4LHUG 1ZT4A 3GM0A 4HUMB 1MCOL 3ALXA 4DQOH 1OAKL 1X5FA 4QOKA 1BJ1H 2D3VA 2XZQH 3EO0B 3RBGA 3MRNB 3LV3B 4PJ5B 1OGAB 4L9LB 4P2OD 3UO1H 3FO0L 3BMVA 1Q9OA 2HVJA 5IWLA 2OK0H 3QUZA 4P2OC 4LPYA 3OKOB 1M05B 2PTVA 4QHMA 4TPRH 1ZTXL 4X80H 2APWA 5TE6H 4DFHA 2NXYB 3THMH 4LLAA 1X5XA 1QBBA 2ITCA 1BOGB 5J7CC 2VXVH 2Z35A 3LZFH 1BFOB 3WJLC 3SEPA 2DQTH 4XP5H 2QSCL 5SWSA 4DAGH 3OJDA 5KVMC 5BQ7A 3MLSL 4S1SL 5I1EH 2A6KB 3OGCB 4LSRH 4OGAC 3SE8H 3V5HA 4K9EH 1U3YA 1ERNA 3BPOB 4X6FB 2Z31D 1B9ZA 2NCMA 4K23L 4NC2B 1XIWB 4MNHB 5CGTA 5B39A 2B0SH 3PQYB 4CW1A 3TO4A 1LK2A 2Z31C 1C8PA 1PDKA 4RX4D 4TUOA 3ES6B 3OR7B 5L8JB 1NC4A 4KJWD 1MPAH 2Y25A 1P7QD 1T66D 5AUMA 1KCVL 3QDJE 4LAQL 5TGBA 2H2PC 3FHQA 2WINB 4KJWC 3U4BH 2V17H 4QRTA 1T66C 3O41B 3LQAH 1HNFA 5E2WH 2YRZA 2IBBA 4JFEE 1QBMH 3T2QA 5IB1B 5GGSA 5DMKB 4X9BA 2X4UB 2GK0A 4KWUA 4Z0XB 5ALCL 4BZYA 3QQ3A 5DGQA 1VEOA 2BSTB 3BN3B 1T7ZA 4X4XB 3I6KA 4AL8L 5GS0D 4AM0A 2HFFA 4BKLB 4FN0A 1UKSA 3EYVA 3BQUD 3MGTA 2HJFB 4PJBA 3AREC 4L3ED 4OZHB 2X9WA 4HXBH 1FZJA 4AIOA 3QQNA 2RAMA 2AK4A 5KVFL 3BQUC 3TCLA 4ZFOA 1DN0B 2EDWA 2AJZB 4OCWH 4CVUA 3NTCL 3VDBA 2GITA 2W9EL 3TBWB 4QO1A 3REWA 4Y4KD 1PG7X 3VD3A 2VLKA 1N59A 3GIVA 4GMSH 3N0PB 5HY9B 2VQTA 1UYWL 5FGSA 1UG9A 5AAMA 3SJVD 4OKDA 5B8CB 3Q6GH 1KCUL 4Q9QL 2X4SB 4IDJH 2A77H 2VR5A 2FO4A 3BGMB 4CMMB 2FL5A 3P11H 4JY4B 3L3IA 4XZUA 2CMRL 4X7FC 1N7MH 1NEZB 1UXSA 4UNTA 3SKMA 2X42A 4XI5D 4HIJA 3SKNB 4Y5XC 4ZD3H 4R7DA 4XI5C 5A2KH 2APBA 4JKKA 1Q9WB 1P4BH 4FQQA 3IS0X 4QRUB 3GRWH 4JO3L 3TLRA 1U8OB 1Y0LB 3IJHA 1H9VA 1Z0NA 1PBYA 1YEIL 3HPJB 4B5EA 4NQDE 5C7XH 5DJ6A 4QXWA 3LKPB 5HHXH 1AO7A 4RBPH 2JJVA 4L8BB 2H9GA 2EDTA 4XPHL 5J1TC 1VGKA 5TE4H 2LE9A 4Z0BL 3QDJD 2WIIB 5C0AA 2P8MB 2V2XB 1NFIA 1QNZL 1QRND 1NMCB 1HI6A 5E4EC 3DNKA 2ZWLT 3L3OB 5D5ME 3BZEB 1ZLSH 3GBNL 2ZPKL 1KJ2B 4RAVB 1J7VR 4WHYH 1IEAB 1INQB 1BIHA 3MR9A 3EOTH 1G7MA 2FX7L 1K6QH 2R23B 4KKCC 3MBXL 3HNVH 4N0UA 5DEFA 2BNUB 4LSSH 5FO8A 3BP4A 3DTXA 2W0FB 3KPOB 3BFOA 2HKHL 4JB9H 4RSVA 1GRWA 3X13B 3MLWL 1J1XH 1NLDL 4NJAH 2VZ3A 4Y16D 2BP3A 1X6NA 5C0EB 1CXHA 3CFDB 3MGAA 3MCKA 2OJEA 5J12C 4OT1L 2XIDA 3ULUH 2BSSA 4Y16C 1MFCL 4FXKA 4LNRB 4ZUUB 4L3CA 5DEZA 4MA3B 2BFVH 2VE6B 5IMKB 5IQ7H 3QO0B 3B3IA 1F4AA 1JGVL 2DKSA 4PGEB 2D7PA 1FJ1A 1IKNA 1JGEB 3UTSA 5CS7A 1A7OL 3DVGB 1TZGL 5KVDH 1Q0YH 2CXGA 1CLZH 3HUJA 1SJEB 4X8JA 2VDLL 5EO0B 3FN9A 2D7MA 4U33A 4QYOB 1ZVSB 3IFLL 4V2BA 3RPIA 2YPLE 4MSWA 1L6ZA 5FV2A 1L7IL 2XYCA 3PXJA 1GZQA 3IDNB 5KANG 5CLWA 4HC1H 5CSZA 5KZCB 3HNTH 4EDWH 3QCUL 5F72S 3SHSA 3MV9A 4EQ2A 2ADIB 1BAFH 4NQDD 2KKQA 1ITCA 4PRHE 2H32H 3O3DA 3P77A 3RTQB 1IGMH 4O2EB 2AXGB 4OZFG 4Z7OE 1BIIA 2P5EE 1MWAA 1EMTL 1IEBA 2DIBA 4ONHA 4LVOB 4FZEH 4KAQL 4P2QA 2GKIA 1HQRA 4OLVL 4MZ3A 1YA5A 5BVJA 4F33B 2H3NB 3HAEA 4M7LH 5CD5D 1UCBL 1AD0A 1WICA 4WI7A 5DGRA 4B7LA 1KN4L 1YNTB 1GPOL 4O9HL 1JE6A 1OTTD 4XP6L 3SQOH 1FORL 4YHLH 2IGFH 5CD5C 2PF6A 3ZTNH 2MPAL 1OTTC 2CR3A 3OAUH 5HHVH 1F6LL 4ZO8A 3BXNB 1N3NA 1YQ2A 1P9MC 3D25A 4UNUA 3B9KB 3RGVA 4UV4H 2VRAA 5DJCA 4F9LC 1S5IL 5TFSL 2D03L 2H8PA 3IDXL 1JYVA 3UYOD 3C5JB 4XMKL 5EZLB 1IC7H 3D39A 4D0BB 5EUOA 3QRGH 5IMMA 4MLIA 3CVHB 2CLZA 4HWZA 2DQJH 3CDCA 5I8OH 3D2UD 4PRIE 4JPVH 3C9NB 2Q8BL 3OAZK 1G6RL 3FB8B 1MIEH 3K8LA 3MLRL 4KMTL 3VFVA 2EIEA 1PZUB 4QRRE 4PR5A 4U1HB 1FIGL 2BOCA 4P23A 1EAJA 4MCYB 4LARL 3KPQB 4EN3A 2NZ9D 3E6FB 1F5WA 3MBEA 2DJUA 4PLOB 1H8OA 3LN9A 4UT6H 1UZ6E 2WLZA 3H6JA 3L6FB 2NZ9C 3LRGA 1DVFD 1WT5C 3ILPA 3HR5B 4QHUB 5T1KA 3FQWB 4YHPB 3ZDYF 3QJFB 1DLHA 3KYMA 3QQ4B 3QJHA 3IDJB 3BW9B 1DVFC 4GW1A 4LRNL 1OW0C 1MFEH 3PWJB 2VZ1A 5HSFA 2R0LL 4FMKA 5IVOA 5DJZB 4FFZL 5IEHB 4WU5B 5JQ6H 5JIKA 4APQA 1TTGA 4LU5L 3FRUB 2BY3A 1OB1B 3LD8C 3C8KA 5K59F 3A6OA 3DX8B 4KRPD 2P5ED 3DI3B 1BLNB 1UZ8A 5DDHB 4FQXA 4PRNA 5GPRA 3HG1E 4IIQC 1YPZA 4KRPC 2JB6A 4R96A 3MLTA 4K7PX 4MNGB 1C5BH 2ZUTA 3QDME 5H8DA 3SE4A 4D94A 1LDSA 4PTUB 5EU5B 5DUPH 4NO5B 5DVKA 4XPFL 2NY0D 2DM3A 3CVIH 1TMCB 5ID0A 2IBZX 4L4TE 5F7UA 1CFTB 4YAQB 3O4LE 1ZHNA 2FECL 2Y4SA 4OSUH 1N8ZA 5I1DA 2NY0C 4ORGB 4OFYA 2A6IA 2J2ZA 3B8YA 4Z77A 5A16A 4N8CL 1ZMYA 3JSSA 3TN0B 1QPXA 1DQQB 3TF7C 4ZXBB 4OFVA 5E0QA 4JZNA 1VADA 4D9QD 3VXQA 1WQVT 2EIBA 4LRIA 3TV3L 1RI8A 4HKBA 1V3KA 4D0DA 1MHHA 3PWVA 4F7TA 1G9NL 1S7TB 4Y2DB 3L7FB 4XBGB 3W0WA 5JXEA 4HIXH 4XNMB 4XNXH 4PRID 2DLFH 4D8PA 1CD1B 1MF2L 1S7XA 1RUKL 3TO2B 2QSQA 1LE9B 4XGZA 2XN9A 3UYPA 5FB8A 4ODSL 1QQDB 4UT7H 5DJ2A 4JJ5A 3TBTB 1S9XB 1OVZA 1RZGA 4JAMA 2NY7H 5C07E 4OZGA 4FQLL 1BQHG 2Q86B 4WDIB 2GJ6A 1FDLL 2HWZH 4MYWB 1TZIA 4V2CB 4NRXA 3C08L 4ZUVA 4O51B 5H37H 1KACB 3EYFA 5E7BA 5CINH 4Z7NE 5TH2B 2B4CC 4FZ8H 3BT2H 3MRCA 5AG8A 5C0JA 4WI2A 2OXGA 3RWEA 1IGJA 3IVKA 2O61B 3MJ6A 3OKEB 5FHAH 3SCMA 3DV6A 4GRLD 4F37K 3BDYL 3VRLE 3HG1D 1PYWA 4I5BA 3PNWA 5HVHB 4U1SA 4GRLC 2ADFH 1JHTA 3B6SB 4P4KD 1C12A 4N9OB 3OG4B 4KK9D 2FIRT 5EB9A 1A6ZB 5FYKE 3QDMD 2XNAA 4P4KC 4YJZL 2VOTA 3FTGB 3I84A 4O02L 5D1ZC 3GJFA 5JTWA 4KK9C 3ARDB 3PL6D 5GGVL 5IM7A 3NACH 4ZODA 4P5KA 4WO4B 2D9CA 1WCBB 4XXDA 1UJTA 3X14B 3PL6C 4HUUA 1TJHL 3VI4E 1RIHL 4Q97A 3EGSA 3O3EA 3E1F1 5IJVA 1CFQA 3RWJB 3BP5B 2H32B 2JIXB 2WBJA 1NGYA 1YC8A 1JNLL 5FGBC 4NOFA 2QR0B 3WN5C 3T0DA 1IC1A 4GAYB 4S0SD 5F8RC 3U9PL 5C6TL 4N1EA 2X70A 2ICCA 1DZBA 4Z7UE 3HPLB 4LSDA 4F9PA 2HFEA 3QEGL 4NRYA 4XBPB 2C7UA 2XWJA 2WNGA 1CU4H 4WENB 3X17A 1FZOB 3L3KA 2LTQB 2VAJA 2NNAA 1C08A 4WUKH 4NM4L 5INCB 4WV1A 3UBXG 5HHQB 1JHLH 5C07D 3PGFH 4LK4A 4WW2C 5F7FA 3UP1A 3K7UA 1NKRA 1HHKA 2IADA 1EPFA 4WFFE 5FA4A 1T3FA 3RFZC 2XPGB 4WU7B 2D31B 3ARPA 1QVOB 4J3WA 5EU7E 1IQWL 4YHIA 3BEWA 5BCAA 3QWRD 4J23A 1S9YB 2X1QA 4FTVE 1AGBA 1BF8A 4OLYL 3NFNB 5LQBH 3I50L 3VGFA 3PWUA 5CD3A 4K3JH 4XBEH 4QXUH 1FYTB 3HCVA 5EC1B 1PZ5B 1KJ2L 3QQ9C 1U95A 3H42H 4OFPA 5D8JL 1TETL 2OL3H 3CCHA 3HZVB 3OL2A 4LVNB 4XRCA 1BF2A 1LP9F 1FO0H 1J05B 4FQHB 2CH8A 4NBYB 1P1ZA 3VFWB 1CGTA 4D0CB 4JLRB 4X6DB 5FYKD 3IF1A 1LD9A 5KSBF 1F4XH 1FRGH 5FYLL 4HMDA 4R6UA 1QLEH 3JTTB 5JNYA 4FFYH 3QH3A 1A6AB 3HRZB 4PGDB 5DTFA 4NKDB 4MX7A 4Z78B 3GSRA 2DLIA 4FABH 4MJ6A 2XA8H 5INDB 4RWHA 5DD3L 4OF3A 1HN1A 2PTTA 3V0VB 1I8LA 1XGUB 4NWTL 2Y1VA 2NY5L 2VISB 4ZS7L 3ULVL 5IOPA 4K7PY 1JF6A 5I1JL 5C0CB 3GSWB 4JFDA 3I3BA 1MLBB 3SDDA 4YE4H 1FNGA 1IGTA 4M3JA 4ODUB 1ZLUH 3GIZH 1DQJB 3MRBA 3VWKD 5F7DA 5EU6A 5J1AA 2DQHL 3L3GA 3S36H 1C5CH 1CDJA 4OV5A 5CEXB 4WUUA 4Y8AA 4PFEA 2NY2B 3HKFA 2ID5A 1TNMA 3GSQB 1PSKL 5LWYH 5EIQA 8FABB 3F58H 4DQOL 5F88A 4ELKA 3VH8B 4IRSD 2HMIC 2ZOKA 3MMEB 4M93B 4NZUH 1IAIM 1G7QB 2AJ3A 2J12B 2XY1A 4JM4H 4LPXA 4IRSC 3UO1L 5EBWB 2VKXA 4XPGH 3UTOA 3L3JA 4I2XB 1ZHKB 3Q2CA 3MROB 4X80L 5D6CA 5EU7C 2LVEA 3V52H 5J8OA 4A6YH 4FTVD 3PHOA 3EJZD 3V4PL 5GISL 3THML 5AD0B 3S4SA 2P5WA 1J8HE 2VQ1B 4NC1E 1GAFH 2I5YH 3OJ2C 3EJZC 5IEKA 3LZFL 3I75B 5E1HB 3V5DA 3LS4H 4OKVB 4XP5L 4DAGL 1ZGLP 2RQ8A 4HMEA 1FVDA 4DUVA 1KPVB 5I1EL 4OAWA 2X4OA 3K2MC 5MEPA 4LSRL 1T7VA 4LIQH 3ZKMD 4XAWH 1I1AB 1S9WA 1NDGB 1QBAA 1OSZB 2PXYB 1OD9A 3QFJB 3DO3A 1I1FB 1PY9A 4KQ4H 4GRMA 3CK0H 4MA1B 5HGAB 1HHGA 1MPAL 3O6KL 1K4DA 4K3HA 2GT9A 2EDDA 5H94B 2ED8A 1N64H 4M6MH 5AZ2L 4NRZB 3C6LA 4GKNA 2HT4D 4JKLA 2V17L 1KPRA 3CVHL 3LQAL 1A1OB 4ZTPH 4Z9KB 4HH8A 2HT4C 4P59H 2Q87A 3HE6D 5EOQL 4K3DH 4PJIF 4EJ1C 1QYGH 1TJIH 2Z93B 1ZT1B 4N0FB 5FM8A 1DUYB 4MXWH 4YGVA 4ODWA 3WD5H 3HE6C 5JHDB 2HRLA 1V05A 2GAZB 1MUJB 1JV5B 3UPAA 1MQKH 4NUJB 4GLRI 3HI1B 3LKSB 1ES0B 2XI9A 2IPTH 4HXBL 1AHWA 5J06A 3FCTA 1DANT 3ZE0F 3MRMA 3MRIA 1SVCP 2HRPH 1QO3B 3PGCA 1HKFA 3BHBA 4XWOC 3VFPA 1FIEA 5HHMB 5GGRA 3Q6GL 1AXTL 4HUWB 4IDJL 3FFDA 3W11D 1ZGLM 3LCYA 4FRWA 2C3GA 3P11L 1UWXK 1I9RH 2H26B 4RCAA 4ODXA 2D7TH 5DRXA 1N7ML 3W11C 4ZDHA 2ARJA 4ESKA 1KPUB 3G08A 5FDWA 1UEMA 1PKOA 3CFKB 3MRRA 1BQLH 5C86A 4NC1C 3VI3F 3IU4H 2Z0BA 2WSKA 3JUZA 3PG2A 1SEBA 1WC7A 4GSDH 2OSLA 4DEPC 1QRKA 3EZJB 3NCYS 1P4BL 5IB2B 3D85B 2YD6A 3VG0H 3MRPB 1QSFA 2WUBH 4B53A 3ZT6A 4LLDB 1XGRB 4IOIA 4JQVC 3SDCA 4X99B 2DM7A 5TE4L 3VRJB 4QWWC 2ZP0T 3WFHA 1WGOA 1CICA 3G5ZB 2MCPH 3HMXL 1IGIH 3FB6B 1D9KA 1RUAH 3WS3B 3RDTB 1FZKB 2GSGB 1PQZA 3I3DA 3ARGB 4KU1A 5F3HB 3JV6B 1ZLSL 2J8OA 5I19H 3GZKA 3LKRB 2DMKA 4JJHA 2ADJB 3H9ZA 3EO0A 1J10A 4PTTA 3F7YA 3UTTB 5C0ND 5C0BE 3EOTL 2BVYA 4FQ2H 4KVCH 3MOBL 1K6QL 2OL3B 3HNVL 4LSSL 2ZKHH 5C0NC 5F96H 4LGSB 3S35H 4C57C 4MZ2A 1J1XL 3Q3GB 2UWEB 1IVLA 5DT1L 3TBVB 2YXMA 4Z5RA 2BNRD 4KJYA 3L95A 3RGHA 2JJUA 1BOGA 3I2CH 1IRAY 3O3BA 5T1DL 3UTZB 2BFVL 2O5YH 1G9MH 4PJ7B 5DVLA 2PYFB 4XCEA 1SEQH 5CP7B 1Y6KR 4QLRA 1T0MA 1C5DA 5KVDL 1Q0YL 5EA0H 1CLZL 2HJKB 1XR8A 3FJTA 3KS0J 2F5BH 4KQ3L 2Q3ZA 4NM8L 4U0RB 1M6OA 5L2KE 3G6JA 1NGXA 2V2TA 3RAJH 2BDNH 3G9AB 4JANB 2PO6B 3HNTL 3B8SA 4BFIB 1WFOA 5I1IL 1SMOA 1Z9MA 1YN6A 3IJSB 2R56H 2OZ4H 2MQ0A 1QFWM 4M62H 4M43L 2MCG1 4P3WA 5GS2H 4MJID 4Y5VA 2YK1H 4O58H 1A6TA 1QEWA 1LO4H 3X12B 4ZOBA 4LMQI 2PW1B 1EJ6A 1KENH 2VLRE 2AJYH 5IF0A 4A6YB 1HH6B 4OIAA 1T83C 3EJYC 4FZEL 4OFIA 4OZHA 4NHUB 3UEZA 4Z7WA 5A1AA 1YYLH 3B5HA 1DN0A 3NGBB 3OKMB 4M7LL 3Q5YA 4IEFB 3UJIH 3TBWA 1HKLH 3BJ91 1EIBA 2E27H 3SQOL 4YHLL 2EDEA 2EYTB 3WJJA 4AQOA 4PUBH 4XC3H 1QHPA 3ZTNL 4HKZB 3DURB 5B8CA 1UB6B 1T5XA 3QI9D 5J9PA 2Y36H 1CF8H 1JTTA 1Q94A 4MCZA 1CL7H 3IU3B 4TNVF 4OIIH 3NOIA 2E9BA 3QI9C 3VRIB 1IFHH 3HZYA 5D96B 4UV4L 3ULVF 4JREC 1ONQB 4YEFA 1UVQA 4YBQC 1R3KA 5FF6B 1IC7L 1AGEB 1NCAH 3LRHA 2V2WB 3QRGL 2Y7QA 2DQJL 3WLWD 1T1XB 1NAMH 2H2SD 4OF8A 5I8OL 4TYUA 1PG7H 3MZGB 4ZFGH 2F53B 3HZMB 4HAFA 3Q5OA 1CLYH 4GKSA 4U2YA 4CVXA 5EIIA 1SM3H 2VL5A 3W9EB 1FNEA 2X1PA 4NQUA 3T8XB 3VG9C 2XTJE 3FO9B 4U6TA 5CWSB 1JGDB 3PGDB 4NKMB 5L2KD 3ROLB 4AEIL 4UT6L 1UM4H 4QTHB 2GHWB 4O2CB 1WBZB 3U7WL 1HK6A 2PKDA 2X4PA 4I77H 3L3OA 4PY7A 2DI9A 4XXCC 1MFEL 3DLQR 3IAPA 3MLXH 3QP3A 5IHBA 3ARBC 3CXDH 3JV0A 1MLCA 3DMMA 3TIEB 2VLRD 3JWDH 4HEME 5K59E 3P9MA 3VXUB 3L1OH 1R3HB 4MDIB 4J2XA 3QHFH 5HHOE 3RWDB 2QV2A 4G8IB 4ALAH 1EEZB 5MENA 4RGNE 1IAIH 1VSCA 3GI9H 4KROD 2EYRA 4DW2H 1FH5L 4O4YH 4LNRA 5DUPL 2J88H 1W0WB 5ESAB 1QLFA 3KLAB 4LL9A 2JELL 5E03A 3CVIL 2IAMA 1LEIB 4PV9B 5EPMA 3D3VE 2UV3A 3G6AB 3O3AA 4TUJA 4DN4H 4OSUL 5SWZE 3SE3A 3MJ9H 4JM2A 4YFLI 4JKMA 4ODVH 4UIKL 1FFOB 4ONGL 1E4WL 2VXUL 4NO2B 4YHYC 4IRJB 4YO0B 1JK8A 4HFUH 4GG6A 2ZOLB 6FABH 1RIVH 4L4VA 4G9FA 4YDIH 3GSNH 4AG4H 3E8UH 3PWPA 1S8DA 2VQUA 2EDKA 1D6EA 2XTJD 4RAHA 3L3DB 5EZJB 1ZHLA 3U0PB 3J7HA 2NY7L 4ZSOE 4JY5H 2FGWL 4BM7A 2AEPH 4WI8A 4KUZH 5D2NE 3B5TA 3CAFA 3DBXA 2XTJC 4HK0A 1G84A 1MCJA 3F12B 4XCCH 2JJSC 4JQIH 2HWZL 3MA7A 3T2NL 5CINL 1AE6H 4HZLA 4FZ8L 3BE1H 3LS5L 4Z7VA 3ZSSA 5A2IH 5JPMB 1I7UB 4TULL 3JWOC 2Q7YA 1HSBB 3UYRH 4KY1L 1O7VA 3TGXA 3WIFA 3I85A 3FOMA 1VESA 4XCYB 2JLLA 3VFUB 1SYVB 4AEHH 4PREA 1ULVA 1B0RB 4BFEA 2B1HH 4U6YB 5HHOD 4WJ5B 2VL4A 5DVNA 4R4NC 4N8VA 3K4DA 4RGMB 3KPSE 1E4XI 4NWUH 4ETQA 4RGND 3O45B 1WWBX 3D0LB 3ZHKA 5FCUH 2PYEE 4I48A 3QEQD 5FYJH 4WGWB 5KSAB 3ECBB 4RGNC 4Y4KA 5IK3B 5B22A 5C09E 3C5JA 4JY6A 2Y5TB 5E95B 3D3VD 2CK0L 3ULSB 2YWYA 3LAFA 1F4WL 3TH4T 2GTWB 2YXFA 4BFGA 5GZOC 1XF3A 3K2UH 3BEVA 1IAOA 1LMKA 5EC2B 3KXFB 5E6IB 3TA3A 5BS0E 4KZEH 3V6OC 4JCMA 2C1PB 1MY7A 5IR1A 3MLVH 5CHNA 3IJYA 1EFXB 1NGZA 3VD7A 1ORSB 1OAYH 3K4ZA 3VXRB 4F2MA 3S37X 4J7RA 4X4YB 1JZ4A 1LNUB 4OGZA 5J1SC 5F44A 5IGXH 3BD4A 1CU4L 3FQWA 4YHPA 4WNQA 3QBTB 1R5VB 4HIHA 4R90H 1KEGL 3BUYB 3IDJA 5HYQA 3JZ7A 3PGFL 4AENA 1PD6A 4MS8D 5BW7A 4X6BA 2XQYK 1M7IA 1B4JH 1R3JA 4OCXH 4M4RA 1XGQA 3SGEH 1AIFB 2VB5A 3FHAA 4UQ2A 2MKLC 3GSUB 1QRNA 4F3FB 4MS8C 2AV7B 3EYUH 3S96B 2YC1B 4MJ5B 1T1YA 5F9JB 3OBAA 5EOCH 4OM0H 3L5JA 1CWVA 4CNIB 43CAA 2DL9A 5C92A 4HPYH 5LQBL 2AEIT 1IM9D 4J6RH 2GY7B 3EYOB 2V5YA 4XBEL 3WNPA 5I8EA 5B38A 4Q2ZA 1NAMB 5CJOH 3BGFB 1EA9C 1NC2D 3GRWA 2OL3L 1LP9E 1B2WH 3KPSD 5HJ3A 2E7LC 3VXSE 2CKBH 4MLSA 4NQCB 4POYA 5IHZA 4PJ8D 4NKOB 5DO2D 4ZUSB 3V4UH 5KSBE 3SKUD 4ERSL 1F4XL 1FRGL 2G2RB 4JR9H 1QLEL 4GW5B 4PJ8C 1DFBL 1LEKA 5DO2C 1F3RB 4FFYL 3C60D 3QIBB 3VFMB 3BKCL 1S7TA 4K7PH 3VFRA 3UTQA 2CDGB 2ZCLH 1RHHA 3C60C 4KPHH 4FABL 1E27A 2G5BB 4JZJA 4RISH 4JHBA 2Y6SD 3DSNA 4G6AD 1M1SA 2IQAA 2DQGH 4DKEL 2P4AB 5BS0D 3UMTA 3ARFB 5IUSA 5EORH 4DUWA 4GUPB 2H45A 2Y6SC 1CIDA 3FQUB 4G6AC 1DCLA 3I3EA 4NUGH 3TBTA 5HYJB 3WLBB 4YE4L 1JZ8A 1U3HD 1BZQK 2EDQA 3ARYA 1BQSA 5SV4A 3GIZL 1R3LB 4E41A 1A6WH 1U3HC 5GIRB 4M6OH 1C5CL 2M1KA 3TP4A 5M94B 3FQXB 3QDGD 3QEUA 1D5ZB 4YPGA 3MREB 1HEZA 5LWYL 4XH2B 3BGAA 5MI0B 1EGJA 3F58L 5E8PA 3FN0H 5IVXB 2KBGA 3CGTA 1NBYA 4NQEB 2YUXA 1VA9A 5B3JF 3VXTB 1U8LA 3PIQA 2CIKA 3OKEA 4NZUL 5D9SA 4M61A 4P2OB 5FUOH 5I8KL 5SX5H 3W39B 1BZ7A 4W4OA 1YMME 1FFRA 4XPGL 4G8FB 5MERB 4JFFA 1KBGH 2HP4A 4TTDD 1RZJL 4HWBH 2VN4A 2AQ3A 1KB5H 5JA9A 5EUOF 1QSZA 4TTDC 1GAFL 5F8QC 4HFWB 1R24B 4W6WB 3QIWA 4HC1A 2DQFB 3DXAB 4UILH 3LS4L 3GSNB 1FAIL 3SKJH 1WCBA 4R7NA 4K07A 3GDBA 5DD6B 3VXSD 3O11A 3OX8A 1FHGA 1N0XL 4LIQL 1KIQB 2C1OB 1CGYA 3P4NB 2Y07H 4XAWL 4OQTH 4RMVA 2Z31B 4BQ6A 4N1CA 1T7YA 4L1HA 5K9QG 1KNOA 2OR8A 4LDLB 3W9DB 5BRZD 1F13A 4X6CA 3F7PC 3CUPB 5D71H 4PBVC 5EG6C 1T5WB 3V0AC 3REVA 2DRUA 3KDMB 1EFQA 3OKNA 1XZ0A 1P7QB 1Q9LA 1N64L 4M6ML 3MRKA 1NFKA 5DHYB 5GS1A 4XBPA 1FL6A 5T1LA 1NJ9B 2NX5A 1FZOA 2R2HB 3QT2A 5TDNA 3A67H 4BSVA 5KVEH 5LGJB 4ZTPL 3NH7H 1IL1A 4H1LH 4PJIE 4K3DL 2YA1A 4UIMA 5EBLA 1JWMA 2R0WH 1AD9B 1U8HA 4PJCB 1A0QH 1YPZF 4MXWL 4BSWA 5CCKH 3BPCA 3BH8A 5D1QB 2ZSVB 4PJ5E 1EH9A 1OGAE 2GSIB 5EIVA 3O81A 4XC1H 3AREB 1JMXA 1MQKL 4JZOB 4PJEB 3BQUB 4M3KB 3IFPB 4PB9L 4H8WC 2A0LD 1LQSR 2BNQE 3ZE0E 4NN5C 1GGBL 3GB7A 4M03A 3EYQD 4WWKD 3HC0A 3LEXB 2E6JA 3QUYD 5JQHC 1L0YA 1NCDH 2HRPL 2A0LC 4U1IA 4WW1A 5EO1B 1GGTA 5EC1A 3GMPB 3EYQC 4WWKC 3RWHA 3KPLA 1YMMD 2GJZB 3QUYC 2ARJQ 1KJVA 4GMTH 3I6LE 3OXSB 3FONB 3ET9F 4GG8B 1OLLA 4LKXB 3WFCL 3LN4B 1BVKA 3VFWA 5L0QC 1WEJH 3WIIH 4N5ED 1I9RL 3ESVF 1LEGB 4KHXH 1YY8A 2D7TL 3EDFA 3IDYC 5FKPB 4EKXA 4Y1AD 2W65A 1F6AA 1CT8B 3L5IA 4N5EC 2FJFB 4Y5XB 1NDMB 1BQLL 3VI3E 4IMKC 2APXA 1QBLH 3BVNA 4YNYB 1AKJB 2P43B 2Q7NA 4YDVB 2YS4A 4YH6A 4Y89A 1OWWA 2C9AA 3VG0L 3VMPA 2BMKB 4X5XB 5DVOA 3CFBB 2WUBL 4RRPA 5C0CA 5D1XA 4WEBH 3HE7A 1FL3B 1G1CA 2VR9A 4KKBD 2JCCA 4NN6C 3ZYOA 3P30H 2FSEA 5HYSA 5E4EB 3QDJB 3O8XB 4U49A 1RUAL 2E6QA 5BZDB 4JQXC 4PJAA 3TYGL 1ACYH 2HT2D 3GI8H 5I73C 4JFEB 5DJ0B 4JFYB 3MMEA 3GHEL 5IBLD 3MACH 4FQ2L 2HT2C 5D7JD 5EBWA 2ZKHL 5GGUB 5J57B 3S35L 5D7JC 5IHUH 1RJZA 3VE0B 1FCGA 2EC9U 5J12B 4Y16B 2B4CH 1ED3A 3BKML 2CLVB 4P3DA 1NCUA 4JRXE 5FGRA 1T1WA 5EZOH 1MAJA 1JGLH 1F6FB 1U8IB 4I1NB 4L8DB 2MWCA 3VU2A 2DQUH 3I75A 3IDUA 2EICA 1VFAB 4P48A 3B4NA 5IESL 3I6LD 3IAQA 3O0RL 1UEYA 1KPVA 4IS6B 1OT1A 2PNDA 3G5XB 4H20L 4HDIB 5F7WC 2Q76B 2Z92B 4R4BB 4LDEB 2C3VB 2VLJD 3AY4A 4FQ1H 1OSZA 5D72L 1TFHA 1I1FA 3B2UD 4TSAH 3GBLA 1Q0XL 1A9EB 2GIYA 1AH1A 4R3SB 2NMSA 2XKUA 4FQIH 4HCRH 5CBEB 1JTOA 5L8KB 1IEHA 3RAJL 4OCRL 2BDNL 1JZ7A 3OZ9H 4U0QB 1JF1A 5DRNB 4ZNEA 5D7IA 2XRAH 2XICA 3ZT7A 3F62A 1DDHA 2E7BA 3MJ7B 1X5ZA 1AR1D 4M62L 4Y4FC 1I8MB 3AROA 1ADQH 2YD5A 2EEDA 5D6DC 3M17A 2YK1L 4O58L 1MI5E 5IBTH 4DKFH 3H9YA 4P5MA 5HYEA 1LO4L 5CJQL 5I74C 3QG6A 4NQDB 1U92A 4H26A 1KENL 1D5MB 5GGQL 3WEXA 3ZSTA 1EO5A 1JV5A 3IXAA 1KTKE 4ETYA 1KB5B 4P2RE 2R69H 4MNQD 1VACA 1IGCL 2MHAB 5D5MB 1YYLL 1JWSB 4FG6D 4YHZH 1SY6A 3BISA 1HKLL 3BDXA 2C4XA 1CE1H 5ICYA 4FG6C 5E1AB 3KWWA 5C6WH 1H15B 4PUBL 1KLUB 1U8JB 2B2XL 3IKCA 3DX7B 3JVGA 3HI5H 1D6VH 5ACZA 4QRPD 4MA7H 1CF8L 1IMHC 5GGTH 1CL7L 4PJ7F 3GMNA 3GUTA 3ULVE 4KTDH 1IFHL 4JRXD 3SY0B 2I26N 3RHWF 2DBJA 4ZYKA 1UQSB 5TDPB 4M5ZH 1MHEA 5L6YH 5AG9A 3VFOB 2ATKA 5FYJU 5M7QA 1NAML 1QLRB 1TXKA 4H1LB 3D2UB 3ORJA 3LN5B 4DVBA 5SWQB 2WBWB 3OGOE 3QO1A 3TBSA 5CEYB 4D9LH 4YDLC 3UPRA 3VWJB 3DYOA 4NKIL 3RIFF 4Y5YA 4HHAA 4HS3A 3KPRE 5DJAB 5FYKH 4X99A 1WFUA 2YPLB 4QOKE 3QFDA 1CFNA 2BVQA 3OAYK 4Z76B 4HJGA 1H3PH 4NNYA 2A9NH 5ESVB 5DK0A 2IH1B 1JBJA 2I24N 4RMUA 1MI5D 1S7SB 4Q58C 4LEXL 3U2SA 4F7PB 3CXDL 3L5WA 1K2DB 3LD8B 3KPNA 3LKNB 5GJSH 3PUCA 4JHAH 3D9AL 3VWKA 2QQLH 2R39A 3JWDL 4GXUN 5IW3A 4YZFE 1S3KH 3DX6B 4IIQB 1FO0A 3MXVL 2XY2A 4KRPB 2P5EB 3QHFL 4X9HA 4OD2A 1RVFH 5SWSE 3UZVB 2CO6B 3U46B 3H7BB 3P4OA 4NO0A 3GI9L 3QNYB 4B41A 2ICWB 4MWFB 5D93C 4WHCA 3VFTB 2A6JA 2YPKB 4HBCH 1PEZA 3V8CA 3AGVA 2J88L 1ZANH 4G8GA 2NY0B 3ILQD 4FQPA 1UJ3B 5GXBB 4LCUB 3V4VH 4LHUB 2NW2B 5ERWA 2XKNB 4OBSA 2EIZA 1PLGH 5DURD 3TVMD 5DJXA 1NPUA 4YQXH 4ODVL 3TVMC 1AQDB 4HFUL 3KYOA 4OZFH 3MV8D 1MH5B 1RIVL 4YDIL 1WFNA 3GSNL 4BFIA 3T04D 4AG4L 5EUKA 4PRIB 2D7OA 3E8UL 2X4QB 2E7HA 4E5XB 5I66A 4JFXB 1OWRM 4QRRB 3RVUD 2DIAA 1RIUL 3QCVH 4NSKA 3X3GH 5C08A 4JY5L 5DD5H 2AEPL 2YD9A 1W0VB 3RVUC 5C0GB 4QOKD 2AK4E 4LLQB 2WIMA 1S78D 1J18A 4ZO6A 4A6YA 4XCCL 4JQIL 3LKQB 1RZ8A 2FATH 1EZVX 2W60B 4NBZB 5CEZD 1S5HB 3BH9A 1AE6L 2BERA 1S78C 4LLMB 2VLKE 3BE1L 4IJ3C 4JCLA 3QUZD 3BZ4A 5CUSL 4U6HA 4X98B 4HWNA 4IMLA 1QKZH 3UC0H 5IWLC 3R06B 2FBOJ 3LHPH 3QUZC 2NPLX 4MNGE 2FB4H 1X44A 4AEHL 4GRLB 1AP2A 2B1HL 3MRLA 2R8SL 1NGPL 4PRPA 1LHZA 3HG1B 4U3XA 4HSQA 2DQCH 2OS7A 2ADGA 2AXFB 4P4KB 4I3RH 2IH3B 1JWUA 1D5IH 5D1ZB 5H2BA 5C3TA 4Q0XH 1DUZB 4QHLB 2NTFB 1MCLA 2EDRA 3CFEB 3QDMB 2XZZA 4PJXB 3T3PF 3UROR 3DUSB 3PL6B 1HOCB 2YHGA 4OJFL 2HJLA 3SGKA 3U6RB 4L4TB 4M5YH 3TO4D 1N6QL 3K1DA 4RZCB 3O4LB 1UM5H 4K7FA 3K2UL 1AO7E 3SO5A 4JGJA 3ROOA 3TO4C 4AK1A 3WN5B 3O2DL 2NXZD 5CMAB 5C0AE 3MLVL 3TNNB 3UTPD 4AJ0A 1KIUA 3ZYZA 2IQ9L 3AFLA 3PGDA 1WIUA 3ZKND 5IV2B 1I4FA 2AERT 4MDJB 3FQNA 2F54A 1A7PH 3ZKNC 1SJHB 4E42A 1P84J 2QSTA 3P4LA 4N0UE 4YXKL 3K8KA 1BBJA 2OTUA 5E2UL 1PFCA 1T22B 2YD3A 4XCNB 1F4YL 4MQXD 1MJ7H 5F1IB 5C07B 4ZOEA 2AK4D 4BH8A 3HA0A 4U3CA 5E94B 3TBYA 4MQXC 1BD2D 1K8IB 5D70L 2BC4A 3KJ4C 2ATPB 3EYUL 3PV6B 5IFAH 4KTEH 3NN8B 2LABA 4G8IA 4Y0GA 3WUWA 1FL5B 5DQ9A 4OM0L 4PV8B