1BJ8A

Third n-terminal domain of gp130, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
MDKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The signal transducer gp130: solution structure of the carboxy-terminal domain of the cytokine receptor homology region.
pubmed rcsb
source organism Homo sapiens
molecule tags Receptor
molecule keywords GP130
total genus 20
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bj8A00
1MLBB 3TV3H 4LK4A 1F90H 5D7LA 4PLKD 1AGEB 3AAZA 5C0FA 5CCKL 2NX5B 1T6VN 2QQLL 4KY1H 3C6LC 1C5CH 2EZ0D 1RZFL 1BF2A 1A3QA 3GMOA 2FB4L 4XPFL 1BOGB 5F7LB 5F1OB 3VD4A 3SKNA 5HD8C 3DRQA 5IJKA 5FYLD 1K2DB 1LEKB 3W82A 4X4YB 4BQ9A 3GSQB 1OTSC 5IEHA 5MENE 4L5FL 4ZD3H 1KENL 3HPJB 3FN0H 4Y5XC 4HGKC 3ZKND 1K8IB 1NUDA 4KK5C 5CIPH 3N9GH 3QO0A 4R90L 2H8PB 1NC4D 5AYUH 5D1ZC 2VKWA 1KCKA 1N64H 4LLDB 3IGAB 4PRHA 1TVBB 3FB7A 2A0LC 4J8RB 4F7PB 4M8VA 4UT7L 4XMLL 4YX2L 4JN1H 4LHQB 1TJHL 4HJJH 4FZEH 5AAWA 2XQBH 3FFCD 3QXUA 4IRJC 1QSED 4X0KB 1TCMA 5TJWK 1UEMA 2ADIB 1LMKA 1WZKA 4ALAH 4HC1A 3T4AB 3CDGA 5JHDA 1FL3A 2OL3A 1FZKA 4P4RB 2NW2B 4HD9A 2IQAA 3AU1A 2UVEA 4KK6C 5DYOA 2NXYD 2HN7B 5MP6H 3QXTA 3RVVC 3MUZ1 1OWWA 1SJEB 5E6ID 2XN9A 3CZJA 4U33A 4ZO8A 2ZUQC 2AJ3A 1SYVB 5CIPA 2EIDA 5MERB 4ZPVA 5T3ZD 4YQXL 1IT9H 3JUYA 5FEBA 2P49B 3QCVH 3GNMH 4GT7A 4RGND 4R2GB 2NX5A 2V9TA 4OKVB 4WNQB 5HHMB 1DQQA 4S1DD 1JK8A 4CNIB 1U8PA 1SJHB 3U7AA 1A3LL 4QHKJ 4MNHB 4PREA 4OD3L 4PGZA 3E6HA 1TVDA 4XCYB 5EBGA 3QIUA 4MNQE 3TBVB 2CJUL 2DBLH 1UM6L 3FRUB 1WSST 4DCQB 4XT1C 1N0LA 3BDBA 5JHLL 1R3LA 1A3RH 3UAJD 3Q6FA 2YPKA 3V5HA 4U6XB 3W9DB 2FWOA 3IF1B 2V7NB 3RGHA 1N4XL 3EJYD 1V3LA 4NN6C 4JFZL 2O5XL 1I1AC 5JW5B 1HILB 2Z91B 3IETB 4NHCH 3LCYA 4PJXA 4TSBH 5DMYA 1BZ9A 2JJSA 5DVNA 4JM2D 1JPST 3FT2A 3VGHA 3A6CL 4WUUB 3IDJB 5EO1A 2HJKA 4MHHG 4GKZB 1WJ3A 3BQUC 3RNKB 2DM4A 4Y89A 1PG7H 2IFGA 4W4OA 8FABA 3K4DA 2HT2D 4Y8DC 3E8UL 2W60A 3HZYB 1YDPA 2VXSL 1WTLA 3MFFA 4RMTA 1LGVA 3EAKA 3WFDL 4JB9L 4M5YL 2WP3T 4F37F 1MUJB 2IADA 1QKZH 5B8CC 5FV1L 4U2YA 3TPKA 1RULL 4CMMA 2ARWA 3BDYL 5ESVA 4BJLA 5F7MC 1OSZB 4XNZC 4OLUL 1UZ6F 3AY4C 3AS3A 5ACLA 3TPUB 5GS2D 2IWGA 4M8QA 4QHMB 2X44D 1VGKB 1R0AL 1G7QB 2C4FT 1QFWM 3CVIL 3TCLA 1RVFH 3WFEH 1ZLVH 4Q6IC 2UUDH 5C08A 2VN7A 5LVEA 3QCUH 1TQBC 5ESAA 4NNXA 1TQBB 4QRTA 5EOCL 4MNGE 3HAEA 4I48B 3EYSL 4DKFL 3WS6A 2LAAA 4O9HL 5FYJU 1DBKH 3OGCA 2AEQH 2X7LB 2Z31A 1W72L 3VXNA 4M61B 3S36H 3ZHDA 2BK8A 4CGTA 4U1SB 4J4PC 4WU7A 4FQIH 3CU7A 3MO1A 5DXWA 4PGCA 4MXVE 2D7TL 4BSWA 4LF3A 1EMTL 1GCFA 4PTTB 2MKLC 4W6YB 4KI5E 2E8ZA 3F65A 1AHWB 3BH8A 3AS1A 3PGFH 3V7AG 4W6XB 4DK3A 3LDBC 1DBJL 1H15A 3N1MC 4HQQH 4JPWL 1QPPA 2YD7A 3HS0B 5DVOA 3LH2H 3FMGH 4L8SB 2FSEA 2A83B 1VFBB 3RL2B 3TO4B 3PQYA 1DBBH 1DQDH 4NBXB 5F6HJ 5DRWA 4NSKB 4HV8B 1AR2A 1KOAA 4KI5F 2EDDA 2VLKB 5DURD 2PXYB 1A22B 3DVGA 4YAQB 1BJ1H 5IW1B 2JELL 3QUXD 1WFNA 1QYGH 1N59B 3FCTA 1XCQB 1K8IA 4AYFA 3OMZA 1MUJA 1OCWL 2WUBL 3QO0B 4ZOBA 3LPFA 4LSTH 4A6YH 5HVHB 5D9SB 1S7RB 5I8OL 2DQFB 2WIIA 2OM5A 1D5MA 5BVJA 3RI5K 5BS0B 1UQSB 4AG4L 5EUKB 3I3DA 4BFIB 5IMOA 3KLHD 3MV8D 1Q9WB 2HVKB 4UINH 1KLUB 4G9FE 5T1DH 1BOYA 3HB3D 1MWAA 4P9HL 1OAUH 3VXTA 2D7PA 3Q2CA 4KHTL 3SEPA 4MS8C 1JPGA 2V17H 3A6OA 2ZOLA 4FNLL 4KHXH 4ZQKB 4X5WB 1HH6A 2Q76B 5E94B 4YH6A 1IGTB 4EDWL 1T89A 3LQAH 1FLTX 2ZKHL 4X6DE 5F7DA 3VWJA 4KDVA 4OGAC 3BJ91 1S7UB 4PJHF 4IOSD 4G8FA 1EPFA 3RWJB 4LP5A 3EJZD 2H6PB 2ZUYA 4WFGE 1WEJL 2AXHA 3VCLA 4LKCA 3QIBC 3DV6B 3MQIA 1PZ5B 1S7XA 1F2QA 1H0DA 4LQFL 2R8SL 4F37K 4M6OH 1Y6MR 3P4LA 5E24E 1GH7A 3V5DB 4XVSL 1HQRB 1U8HA 5ANMB 5BXFA 1KCLA 5JQ6L 1P9MA 3O45A 2P8MA 1OCWH 5D72H 5I15L 2BVTA 1KACB 4I0PC 1MREH 4WWKB 4DEPB 3V5HB 1D6VL 4N90D 4DFHA 1SMAA 1GVIA 2PO6C 5F97E 1BX2A 3HI1A 1PZUB 5DMGD 1G6RA 1C7TA 4KKCC 5I8EA 5C1MB 4F7TA 1TPXB 3MRRB 3U83A 1XH3B 4NKDA 3UPRB 2ZSWB 4KJYB 3BE1H 3BQUD 4PJBF 3MRJA 4RDQG 1YPZE 2NX5D 1U8QA 2E5EA 4JFXB 1R5IA 4K3JH 3SDCA 1KPRA 2EDLA 3ZTJG 1TZGL 3TBYB 4ZODA 4DOHE 4ZXBB 2CDFA 2JJUA 2HTKD 4LPVA 4PIRF 2DI8A 4F57L 1L7TL 3OPZL 1YECL 2JJWA 4L8CB 5JHLH 4JFDB 1YY9C 4PJAA 1K8DB 5DJ2B 5GSRA 3ZO0A 3T1FB 3VXOB 4H1LB 2XWJB 3I6LE 1XZ0A 1Z3GH 1AHWC 4UDUA 3EYUH 5GISH 3SOBL 4U7SA 4LIQE 3O2DH 4FA8A 3G5YA 1KT2B 4L3EB 5D71L 4HBQA 4WY7L 5CSZB 3WN5B 3T0VA 3VI4E 5DFTA 1FLRH 2R0KL 5GGSY 4GFTB 4Z77A 1RVFL 4BKLA 5HPOA 1OAUL 2R69L 5E7BA 4M7LT 4YQXH 3G6JB 5E9DE 3ETBF 5E2WH 3EYFB 3BWAA 5C08B 1FFNA 3UJTL 4KZDH 3QEQD 4PFEA 5I1CL 3PDOB 3O6LL 1YEIH 5DMJB 3TFKC 5CMAA 2VL5A 3PJSB 4QTIL 4TSBL 5DJ0A 1ZGLM 4PRHE 2R4RL 1DDHA 3SJVE 1U42A 4HS3B 5JOFA 1T83C 4U1MA 3S4SG 1DE4A 2H26B 3GB7A 1ZA6B 1F8TL 5K9QG 3ZTJH 5JIKA 2F54B 5DO2C 3H9SD 2H3NB 5HGAB 1FGNH 1OAZH 4DFIA 5H35B 3KPNA 1IC5L 4YXKL 1GIGL 4W6WB 4ACPA 1NC2A 4X4ME 3IDNB 1UZ8A 3KPMA 4R2GD 4WI7A 3BZEB 4NHCL 4Y5XA 3QPXH 5KSAA 5JXAL 2ORBL 1JPFA 4XX1G 1JP5A 2C3GA 4TRPL 1KUMA 4ETYA 3FL7A 1RJLA 5E8PA 5D6DA 4PRBA 1BZQK 5DEFA 2ATKA 2DQEH 4TVPL 2DB8A 1F3RB 1XZ0B 3UROR 4Q9RH 1CQKA 4NZJA 4U1KA 2PUQT 2FECL 3DVNA 5EU6A 4KJWC 3WHE0 5EZOH 3CFJA 1MJ7L 5IFHH 4UI2A 4MXQC 4XTRC 4Z77B 2F53E 2EH8H 4L4TB 2R39A 5C6WH 2GEEA 1OQXA 1AGCA 3A6BH 3NZHH 3V52L 1JCKA 2R56H 4UAOC 2HVKA 3RNQA 3UTSD 2I9TB 3UZQA 1YN6B 5D4QA 4CDGC 4PJBA 1BAFH 4G6KL 1A14H 4RRPG 1LP9F 1FNGB 1T7XA 3O9WA 1F45A 4NT6B 1B0WA 1BM3L 2R4SH 3D6GA 1FGVH 4QHLB 1KCSH 1QSEE 1I9JH 1S9YB 1YMME 4IS6A 1CU4H 4PJAF 5A2LH 2AK1H 5DUPH 3B8SA 4RAUB 1FPTH 3S35X 4HUWB 2FZ3B 4XMPH 1UEYA 4LAQL 2V2XB 1TLKA 4U6VL 3GMOB 3TA3D 1XCTB 4U2ZA 1MCEA 1PVHA 4YHLL 3ALPA 1HHGA 5HD8D 3I02B 4OFDA 1G0DA 3TEUA 4MCYA 2VZUA 2LQRA 4OF0A 4OUUB 4UV4H 4RGNE 1NL0L 5DT1H 4X99A 1PSKL 4JJ5B 2JCCB 4N1HB 5IEKB 1DR9A 1WAAF 5LBSH 2J8UF 5E99L 5FUOH 3RGVD 4NM8H 4OZIE 1YZZA 3I3EA 4WWKA 5EZIL 1KV3A 5A2JH 4WO4B 2H2SC 1BFVL 2VUOA 5FYJL 4S2SB 4MLIA 5T5FL 6FABL 2FJGB 1EEYB 4NFCA 4PGDA 1GC1H 2Q7YB 2D31A 4P49A 2X4OB 4IJ3B 4UILH 1FO0A 1CD1A 5GS1A 5AWNL 2AXJA 1T66D 3HPJA 4P23D 3VFRA 1BQHB 1VENA 4ZO7A 3WIFB 5ADPL 5JUEL 2AJSL 2ZUXA 4NZRH 4OF7A 1WCQA 2P5WB 5A2IH 1YEHL 3HFMH 4IOIA 4GKNA 3CC5B 3TBYA 2P24B 3DSNA 3VMNA 8FABB 4P57B 1FGVL 3OJDB 3FO2A 1U8KB 4P48A 1H3VA 1KJ2B 4JCLA 1CWVA 4YWGL 5D7IF 2Y72A 3FQXB 1RFDH 5DVKA 1RZJC 5MHSD 3SDDB 3V0VB 5ESVB 2RCSL 2ICEA 3TNNB 1K4DA 3PWUB 3V4PH 1E27A 1WF5A 4Y5VA 1A6TB 2ADGA 2Y7QA 3K8MA 5GGTL 3RX5A 2CKBH 1ZSDA 1HKFA 2YS4A 3BFOA 2NY3C 5J13B 2XY2A 3N1FC 5T1KB 4OLXH 1TDQA 4PJDB 5F3BB 1W72B 2NY4D 5I1DA 3F7YA 5D1ZB 3H9SE 1IGML 5CUSL 4J4PA 5DC9B 1INEH 1MHHA 4Y16B 4YHMH 4C4KO 3S96B 1Z9SA 5LQBL 2C1OA 4JR9L 5JPMB 5TE7H 2G60L 2EDWA 4WW2B 4TUJA 1IEAB 5CILL 4FXKB 3VFMA 1KB5H 5CEZL 3WSQH 2X4OA 2R4SL 3O8XD 4K55A 3ARYA 1TZIB 4DQOH 3FQRA 1Y0LA 2UZIL 4RRPA 4H8WC 1GSMA 3JWNC 4JG1H 4KKAC 1XGYL 3BPLB 1G6VK 3WL9A 3DXAD 2J6EH 2PCPB 4K3EH 4U1HA 4R4FL 3U0PB 1KLUA 2EDKA 3IDMB 1OAXH 2PTTA 1JHTA 1LD9B 4MA8H 1JGLL 5LGHL 3ARED 5DD6B 1N5AB 2BHZA 2YKLL 5AD0A 3GBLA 5DC0A 4PB0H 5F21B 5B8CB 3QYCA 3WD5L 1OT1A 2F19H 4ZOAA 4Z7NF 2ENYA 1OTTD 1PQZB 4IRZH 5C0BA 3UC0L 1T2XA 4YHKL 3BX7C 3VGBA 3TT3H 3QNYB 4U0QB 4H88H 1NEUA 5BVJB 1P6FA 1XGTB 4RDQF 3P9LB 5F7KC 5ADOH 3LHPL 5I66B 1NUNB 1OTUC 2APBA 2XTJC 4Z0XA 4Z7VA 1DP0A 2YSSA 5E5MA 4FTVE 4RAHA 2LVCA 3F5WA 5F9DC 1SJVA 2PW1A 5DQ9B 3BKYL 3BN9D 4P5KA 5MENB 5DD1L 1YQVL 1G7PB 4JKLA 1CF8L 4U1IA 3GSQA 1QLEL 3D0VA 2LV4A 3KXFA 4MNQA 4FS0A 3UCRA 1YECH 4ZTOL 1MWAL 3FB6A 3S37X 3DECA 4AEFA 5FA4A 3VGGA 3ARXA 2WINB 2XNAB 5EZIH 1EMTH 5H37H 3CDFA 1CVRA 1B4JL 4I0PB 5LBSL 4WWKC 4LKXB 1BX2B 4EBQL 4JDTL 5I6XC 4M3JA 2ZPKL 3MV9D 3K3QA 4KV5E 4IRSA 1UWEL 3IVKA 5DJ8A 1YPZA 1KCUH 5C07E 4O02L 5ACZA 4NC2B 4K9EL 2CR6A 3RVTC 1FCCA 2IAMB 4EIGB 4JZJA 5IROA 4KROC 2YEZB 3S5LB 4NRXB 4PJCB 4QY8B 1VFAB 4L29A 4PRAB 1DQLH 5IK3B 3HZKB 2X6MA 4PS4H 2V7HB 5EUOE 1SJEA 4MA7H 4GAGH 3LEXA 5E0QA 3MV7E 4Y19D 1AGFA 1BD2D 2LAGB 5DUMH 4N0FA 1NGYB 1R3JA 3OAUH 1TPXC 3TYGH 1D5XA 1REIA 3GRWL 3FOMA 1TQCC 4KRPC 4FXGA 1JWSB 4OLWL 3KGRA 1OM3H 3VXSE 1T66C 1LDPL 1BAFL 1BFOA 4G6KH 4HK0A 1OWRM 5IB1B 4JO1H 5E5MB 3VWKA 2R2EB 5C71A 3X13B 5ICXA 4PRPE 1BVLB 4BSVA 3IXTA 1JTPA 3IFNL 3N85L 4HWBA 3DX7B 1HH6B 4FG6C 1MVFA 4J6RL 4YHKH 1J0HA 3WE6A 1N8ZB 2Q8BH 4Y4KA 43C9A 3D2UD 2YPLE 3RAJL 1PJ9A 1I1YB 4IRSC 3GSRA 3K1DA 4M03A 3L9RB 1PEZA 1A1MB 3ZKXC 5E2TH 1RJYA 1JF1A 3NCFB 3RGVA 5FM8A 5KVEH 2X2YA 1D9KC 4M6MH 4XB7A 3BXNB 3DRTA 2PXYC 1LQSR 2R2BB 1R6VA 4FQLH 4LCCC 3RPIA 2APFA 3WIIL 1MHEB 2X5PA 4PY7A 3SDYL 4JKKA 1YJDC 4XCNA 3VI4F 5ID1B 2FYYA 3QPQC 2D9QB 1IC4L 4NRXA 1JIBA 4PJ8D 5E8OA 1ZK9A 5JO5B 3WSQL 3SE4A 3RKPA 2NY0C 4HWBH 1U8NA 1CE1L 2W92A 4LLDA 3MNZA 3STZA 1HNFA 5FO9A 5JOPE 4LEOA 1JNHA 3QHFH 4MJ6B 4KXZH 5IVXB 2HFTA 1EGJA 4JFDD 3STBA 4PGBA 2I5YH 4LCIL 5CHNA 3LS4H 4GRWF 3B9EA 4CJ0A 4PBWD 4Q9QH 5TDOB 3OF6D 1CFTB 4OZGB 5D2LA 3JWDC 2PF6A 1FVDB 5F88A 4Q9QL 3H9HA 4JFDA 1RD6A 3V4VL 3GJEB 4PRIE 5SWSA 4TNWF 5EPMB 3RWCB 5J56B 1V3JA 1CD8A 4LLYB 3HZVB 1BBDL 1C5BH 4JFOA 5HHVL 4GKOA 1HYRC 1MLCA 3EDKA 1JJUA 1OM3L 4YNYA 1A6VL 1I9RH 5HYSG 1J10A 4IS6B 2EO9A 2BOBB 1P69B 1DEEB 2F58L 3VG9B 4QRPE 4JLRA 4N5ED 4K3DH 5I1AB 3GK8L 5EU4B 4U1LB 3O6MH 3QIUB 1XR8B 3RNQB 3TZVB 5H2BA 4DVRL 1G1CA 5J1AB 5L0QC 2FX9H 4MGXA 3KS0J 3O3EA 4HIHA 1M7IA 3HE7C 2DIBA 3BP5A 3KJ4C 4Z78B 1ED3A 2LVEA 4O02H 3QJFA 3W81A 4GKSA 3GFUA 1QSFB 3QEQE 1A6AB 1VADA 4FQIL 4PLKC 3AREA 2J88L 1MREL 2R0ZL 4HWEH 4P4KC 2DDQH 4HPYH 4OFKA 1IKNA 4WI8A 1UZ8B 3KPMB 2B1HH 4BQBA 1CZ8H 3V4UH 4WFFE 2CLRB 4RZCA 1ORQB 2VXVH 2R8SH 5HJ3A 5IM7B 2EIEA 5FDWA 2VLMD 5EN2A 3EOBB 1BQHA 1FH5H 2F8XC 1EO7A 3Q6FB 2AI0L 4DUXA 5DJCA 5EIIB 2EYSB 4U1NA 5CGYD 4JO2H 43CAB 3RWCA 3CLEH 3VXUD 1XGQA 1ZHLB 1N59A 4ODXA 1XF5B 2Z8SA 4CUCA 2ZOLB 2MMXA 5ETUB 1G9NC 3GHEL 3SDAD 1ZGLP 1A6VH 4F8QA 3WIHL 3MUHL 1EFQA 3MLSH 3PNWB 3F58H 3K4ZA 5D7LE 5T3XE 4S2SA 4QCIB 3KWWB 5BS0A 4FZ8L 1OW0A 3UZVB 4MJ5B 4KHTH 2GQHA 2F19L 1HHJB 4Y4KD 5ERWB 3T0BA 1GOGA 4QRTB 3DVFA 1X44A 3C5SA 3BVNA 3CK0H 5DVMA 5AZEL 5J1AA 1A7OL 1OVZA 4H0IA 3OGCB 3SQOH 1CFQB 2VQUA 1U6AH 1IMHC 5L8JB 2CLZA 3VGFA 2E6JA 4N0YH 4OD2B 3MV8B 1IKNC 3PL6B 2XXCB 1FHGA 5CSGA 3C6LD 5TQ0H 5B3JF 5FM5M 2NXYB 3AB0B 1KN2L 5C0AD 1MWAH 4R7DA 4HF5H 5IB3B 4Z0BH 2BXZA 5CINH 1Q38A 4KUCD 1ZLWK 1LO0H 5FO8B 3MOAL 2Z92B 3A67L 2R2BA 2AEWA 1CLYL 2EE3A 2ZG3A 3KNBB 1KCRL 4X99B 4PJDA 4AIOA 1K6QL 2EE6A 1QACA 3QUZB 3NCBB 3BIBX 4ODSL 4HFWA 3LDBB 5KSBE 4OLZL 2J12B 3DGGB 1T3FA 2AJVH 3VG0L 5HHQA 4UQ2A 3EJJX 4G8GA 4ZG1A 1JHTB 4PR5A 1A6ZA 3I6GA 4EIZC 5E2TL 2DQHL 3UC0H 3CSBA 5DA0B 1WCBB 1LDPH 2QSVA 5I2IB 2LE9A 4Z8FL 3GBMH 4I9WE 1UQSA 3RIFK 4FXKA 2X4TB 1CICD 3SQBA 2QEJA 3ZDZE 1INQB 3WO4C 2FHBA 1KN4L 2B2XL 4G6MH 1DQMH 3T0WA 5IFJB 2K7PA 5HYJA 2BNRB 2DTSA 3NABL 4M1GH 5F3HB 3ESUF 4YFDB 3QUYB 2F5BH 4O2EA 3SDCC 1LK2A 1U2CA 4Y2DB 2DDQL 1G7LA 3U46A 1NFIB 2DLGA 5BV7H 4HWBL 4ZXBC 2DIJA 5FCUL 3SHSA 3MCLL 4Q74A 5CEZH 4QRPD 1FYTE 1UACL 2HKHL 3MNWA 1Z6JT 3B2UD 3VXOA 3UBXG 3ARTA 3THMH 1EBAA 5F1IA 4OQ1A 4WUKH 3U30B 5FA3A 3KYOB 1YYMH 3QI9D 3BPCB 2AK4E 4NC0B 3O9WD 3TIDA 3GB7B 1NJ9B 2Z35B 1Q9WA 4GS7B 1H5BC 2BOBA 3E6FB 4RFEA 3HI5L 4MB4A 3IXAB 3WO3B 4I3GA 4JQIL 4P4KA 4KVNH 2HT2C 1K4CB 3QWQB 1AE6L 3VXTB 3DHJA 4K9EH 5JPNB 3P0GB 5C0IB 1FSKC 3D5OF 4MQSB 3OAYK 4NQCB 4X6BB 3H9ZA 4XRCB 5DQJA 4OIAA 4HPYL 4F9PC 3VXME 4YBLB 2P5EA 3P77B 4KTEH 4QHNB 1ES0B 2VITA 1JRHI 1ZWIB 3CFEB 3MCKA 1U8IB 5IVXF 2W59A 2ED7A 1BHGA 4WFHD 5F7HA 4LLQB 3ISWA 2BX5A 2NXZC 4O51A 5JQ6H 4XMPL 2DYPB 2VNCA 4ELMB 2R29H 4YPGA 1B4RA 5CLWA 1RJZA 1S9WA 3MRQA 1UWXK 4E42A 2EEDA 3F7YB 5A43C 1YNTB 1LEGA 2DM2A 5I0DA 4OD3H 1O7VA 3UTOA 3TYFA 4LLVB 3O4OC 5CGYC 2VDQH 4JZJB 1G7HB 3H3PH 3DLQR 2J4WH 5B38B 3T08A 4KRMB 3T1FA 1FV1A 5GS1C 1YY8B 5E1AA 1PG7L 2HVJA 3KPOB 1OTTC 3FQNA 3TA3C 1GAFL 2CUMA 4V2BA 2P43B 1CTOA 1H3XA 4DJMA 4KDWA 1M7XA 5E99H 5FUOL 2A6IB 3A6BL 3GM8A 2DQCH 1QBLL 3UMTA 3OKNA 4ZFOL 3PDGA 5EFIA 3K2UH 3ULUD 1K4CA 3WIIH 3QO1A 5INCA 5HI5C 4MDJB 4XHJD 1OB1B 2CRYA 1NLDL 1JGDA 3VDAA 3TO2B 5ICXB 4KH2A 4OT1L 3RDTD 3BD5A 1WIUA 2LU3A 4Y19E 1A3RL 3RIFF 1HKLL 3FB8B 1FFOA 4YIQB 4DAGL 5DUBB 4HIJB 4V1DE 3D0LA 5LG1A 2I25N 2DL2A 3ULVF 5BMFL 4RNRA 2OZ4A 4LSTL 1UKQA 4L3CB 3FQTA 5DJDB 2DQGH 4EUPH 5JA9A 2F54A 2XWBB 1VEOA 3MRFA 1AIFB 4LU5H 3WXWL 2H3NA 3INUH 1GIGH 1MCWM 2OR9L 2VE6B 4HF5L 3CH1B 4HWZA 4K94L 1S9XA 4R9HA 2VQ1B 4N9GA 2ARJA 2GTZA 4FTVB 4QRUB 1XGUB 2BDNL 1I3RB 5DD5H 4IHOB 3DYOA 3MLZH 3IDXL 4R0LC 3IDJA 3MJGX 5EO1B 4Y5XB 3SBWA 3VFVB 3KPRE 1FO0B 1UXSB 4N0CC 3TLRA 4L8BA 1F8TH 2H2PD 2HG5A 5C7XL 2XA8L 1U6AL 4X7EC 5IBUB 3L5WB 1KJ3H 2XRAL 3L3HA 4KKLC 1U8OA 5DHYB 4S1RL 2YPKB 2A77L 4BFGA 1HK6A 1BGXH 1I3GH 2NYYC 4WI4A 5KOMC 4X7SH 4G6JH 5F70A 1KJ2A 3ZSSA 4UILL 1JGVH 3MODH 1FJ1A 2MPAL 3HN3A 5IBUG 5D71H 3CFBA 2FX7H 4V2CB 1NCTA 1HXYA 4JQVC 2R9HD 3OX8A 4KROB 3UTTB 5JOEA 3X13A 2WQ8A 3MLSL 3CUPB 4PJFE 1Z3GL 3QG7L 1H5BA 3JV5A 3WIFA 1CFTA 3NOIA 3TGXA 1KEGL 3BP4B 4D3CL 4KGLA 1O0VA 4K9EC 4G6AD 4CU8A 5FHAH 1NANH 4KKBD 1NAMH 1HXMA 4GRMA 2BFVH 4K7FA 4DAGH 1DQJA 3S88L 1PBYA 3D0LB 1HCFX 3HE6D 3BQUB 4MA7L 2RB8A 3NCEB 5IB5A 3SE8H 4C83B 1A1MA 2BZDA 1ZANL 3X3FH 2R2HA 1QVOA 5BOPA 1Q9KB 3C60C 3VI3E 3N06B 4QNPE 1A02N 2ADIA 1U8MA 4RISH 4PRDA 1UT9A 3ALWA 2P5ED 4P46B 3WUWA 4DKAA 2YPLD 1ZLUH 5L6YH 4LVOB 4RX4D 1KJ2H 2Q87A 1I9JL 3AU1B 2JIXA 3P9MA 3GMPA 3UJIL 3HAEB 1E28A 4QHLA 5FCUH 5GQBA 5JLZB 2NY2D 2QSCH 1JHKH 5J7CC 5GRVK 5KS9A 2RBLA 1U8OB 4UBDD 1J8HD 2A73B 5DJCB 4U1HB 1ITCA 3VGAB 3VXNB 4JAMA 4WCYH 2OYPA 4RAUA 1EEZA 3RBSA 5F1NA 4OJFH 2EXYD 1I1RA 2PTUA 1MHCA 3U48A 1U8IA 4YGAB 1S7VA 4PJXF 4CU6A 2XG4A 1JBJA 1EEYA 4H20H 4LARL 4PGDB 1T20B 4TSAL 3C5ZB 5IESH 5GRYA 5H8DA 3U82B 5J12B 2NY6D 3G5VB 5I74B 3BN9C 4K23H 3WHXA 3RZCB 2NLJA 4P5TA 4IRJA 1KEGH 3U0TA 3C8HA 1DTUA 5T1LA 4EDWH 3QG7H 3VXRE 2P8PA 4L3ED 4LCYB 3D3VB 1EDQA 1HXMB 2ZSVB 3F7QA 5TF1L 4KV5F 3TT3L 4OZ4B 4XBEH 1X4ZA 2EDEA 1F11A 1W2KT 1IQWL 1C5DA 1AKJB 1FIGL 4FABH 2ICEB 2CRZA 4WUUA 5FKAB 2X05A 2Y23A 1QHOA 4QGYA 5JIHA 1UB5B 1MLBA 3JWDL 3TH2T 2CUHA 4O4YL 4JFFA 3WIHA 3CU1A 4HX1B 2EDOA 1ADQA 2IBZY 3DPBA 1M6OB 4ZOCA 1H8SA 3EFFA 4GKNB 2WUBH 4P57A 2IC2A 3HRZA 5JXAH 2GYSA 4PJIA 1W72A 5TE6L 4UIMA 1T80A 1JPGB 1IBGH 4NQCE 4LHUB 4JFOB 1JGUL 3I50H 4XI5C 4FQXB 1ZGLA 3KYNB 3CK0L 4NNYB 3ARFB 5F1NB 1LDSA 4NN7C 3Q3GA 5HDBE 1ZVSA 3PWUA 3MLWL 1DLHB 2H45A 2NY5L 4UB0L 4M6ML 4Y1AD 5HHXH 5DJXA 2W9EH 3GRWA 3QDGA 5GGUA 2CIIB 4AQ1B 32C2B 1DBJH 4OZGF 5I75C 1CLOL 3PWPA 2BSSA 3AS2A 4M93C 1U93A 3LV3A 1QBBA 1YPZB 3JBG7 1C08A 5H2BB 4BZ2L 3UPRA 3U7WL 1NLDH 3NN8A 3RWIB 3ZE1E 3MACL 4G6FD 5D7JD 5FHBL 4XVUD 3PDDA 5E95B 4Z76B 4HZLB 1FL3B 1QEWB 4R7NB 3MYJA 4XNYH 3T0XA 1S8DA 3QCUL 4OCYH 1KCRH 5DYOB 3SDAC 4G8GB 2ERJC 1OP5K 4HUMB 2DKUA 1WWCA 1NGXA 1SEBB 3DARA 1LO2H 1T1ZB 15C8L 1RMFH 1WWWX 3ZKNC 4FFVD 1VFBA 4MAYC 1I4FB 3ULVD 3SKJL 4B41A 4HLJA 3CFBB 1YJDH 2OCFD 4S10A 4XCFL 2PCPA 4OF3A 4BQ6A 2VXUL 3OKOA 4P99A 4PJ8C 1EO5A 4TQEL 3UBXB 4M6NL 3JV6A 3O2VH 4P2QA 4TTGA 4HUUB 5EBLB 5HHOA 4P9ML 4UNUA 1JVKA 4OFPA 3WFBH 3T09A 1NEZB 5D7SH 4Z7QE 4QTIH 5F7FA 5TDPB 5C0IA 1MCNA 4JY5H 1FPTL 3T4YA 3BZ4A 3HMXH 5D7SL 1NDMB 5GS0C 3UJIH 2H1PH 2VLJA 4PLOB 3QQ9D 1H3GA 2N4IA 3HG1D 3BMVA 3CX5K 1DLHA 3RVVD 4WHTB 5IQ7H 5JZ7D 4LVOC 3AM8A 5DZOA 4P23C 4Z7VB 4Z0XB 1X5ZA 4RISL 4GS7C 3CSGA 3SDDC 2IPUK 1S3KH 2XACC 1RZ8B 3MRIB 3E6FA 1RUPL 4AM0A 2KPNA 4LRIA 4KPHH 3X12A 3NFPA 3BEWA 5EOCH 5GISL 3SOBH 4MNGA 3JZ7A 1P2CA 4CJ1A 3SDAA 3QH3A 4S1DC 4JQIH 4LDLB 4YHLH 5KSAB 4X7TA 4JFEA 5CJXC 4G43B 4HUVA 2YRPA 3QUMB 4G8FB 5MEND 3IJHB 1MI5B 3I9GL 2RJMA 5J4MA 2X89D 3NPZB 1NBZB 2BRRH 5TE4H 4OZHE 1IGIL 1IRAY 4I2XA 1K3IA 3JSSA 2VH5L 4IOFD 3CFDA 1M7DA 2NY3D 1B3JA 3UTSB 5ACZB 5GJTH 2UVFA 5HGDB 1JFQH 3CPLB 3LKOB 4HWEL 2R0ZH 4GG6B 2O93L 4NQVB 1P9MC 3ET9F 4UUJB 1AGCB 1KBGH 1WBXB 3WV0A 2VR5A 1D6VH 3HR5A 1FGNL 1CTNA 1D3CA 1S7WB 4NC1E 5IHUL 1L9NA 4APQB 3PWNA 3QIWC 3ARBC 3IFPA 1T1WB 1J05B 3PIQB 4GUPB 5J57B 3CH8A 2DRUA 1NUGA 4AENB 2VB5A 2I26N 1KSRA 4U31A 3QAZB 2HVJB 2F53A 3VH8G 3MUGA 4K2UH 2UYLB 1QO3A 2XQBL 4EVNA 3O9WC 1QFOA 1CQYA 1CGYA 1CGXA 1ZT4B 3SY0A 4JKPL 2XTJD 3G04B 4L4VE 1FZKB 1G9MC 1WVZA 3U2SA 3QPXL 1NC4A 1D5IH 4MDJA 1U3ZA 5EIQA 4CRPA 3GI9L 3G5XB 1U58A 5C0DA 5JW3H 1T83A 1PLGL 3TO2A 4L8SA 4IDJL 5KW9L 4X4YA 4OM0H 1MQKH 4Z7UF 1CK0H 3VRIB 2W9DH 4NRYA 1LK3L 3L7EB 4ENED 1S9VA 2M2DA 4H1LH 2YA1A 2Z31B 4U1NB 1X4XA 1VEMA 4XP5L 1IT9L 5D96B 1FFRA 3MLRH 3MO1B 4KWUA 1TTUA 2Z35A 3QEGL 1CFVL 3SGJA 4OIBA 3FZUC 3QISA 4GBXB 4J4PD 1I1FB 1TVHB 3LSOA 4LVHB 5JNYA 3PNWA 4LCIH 1FRGH 2WIIB 2BSTA 3HUJF 1WFOA 3HB3C 4OI8A 2YZ8A 5HGDA 4HK3J 3KWWA 2RFXB 1AY1H 4D9QD 3LAFA 3TM6A 3WMSA 3QDMB 5I74C 3H7LA 4ALAL 3QT2A 1LO3L 3LD8C 3RWIA 3EOBA 3VGDA 1ZWIA 2V5RA 1IM3B 4QXGH 2DKSA 4HKBB 1IQDA 1MAKA 2DTMH 4XPGH 3VDCA 1P7QA 4K7FB 3OJVC 2J8UE 2D0GA 2GAZB 4LSRL 4YHOH 4V1DA 4ODWB 5F7DB 3V0AC 3IFOA 1U0QA 1S7UA 4O2FA 2F54E 4U3XA 2GSIB 4FP8L 4WJ5B 4KRLB 4PJDF 5J11C 4LASH 1KEMH 3WFDH 3RNKA 1HYSD 4M00A 3VFTB 5E6IA 1OB1A 5GXBB 4JO3H 1I1CA 1H3WM 5JHDE 1Q0XL 3DUHA 4CNIA 5D1XD 2F74B 2ZWLT 4NP4L 4N0UB 5FAAA 3S8WA 2P24A 4FFZH 5FXCH 5HGGS 5BVPL 2G9HB 1I9RL 5CJ5A 4CVZB 3TZVC 3BZ4B 5D7IB 4FQJH 4IRSD 2DQTL 4HW6A 5IOPB 2BHUA 2OI9B 4NWUH 2QV2A 2EC9T 1DEEA 4TUOB 3DGGA 1HSAA 2WUCL 3OR6A 4LCWE 1YYLL 3CXHJ 3RJQB 2VZ1A 4XMKH 4MNQD 1I8LA 2DOCA 2AQ3A 1AH1A 3DI3B 3NCYS 4PRPA 1ZS8A 3CVHL 3GJFH 5F9OH 1RZ8A 2IQ9L 3MRIA 2G5BB 1MRDH 2A0LD 4L8DB 4QKXB 4PJCF 5ESQA 5MP6L 3I6LD 4GQ9H 5DUBA 3MRJB 1WT5C 4LCCB 4HUXA 3ULVL 3L3GB 4RNRB 3QJHB 3GMQB 5MEOB 5C70A 3L6FB 3V5KA 4UDTA 2G5RA 3FT3A 4HFWB 4PRHB 3NZ8A 4PB9L 1HZHH 4O58L 1EEZB 1JZ6A 3ARBA 2EXWD 1A6ZB 2ESVA 4YO0B 3HE7B 2ZKHH 1P4BL 3MRMA 2OJZL 4OZHB 3WJJA 1F13A 2B2XH 3ARFD 1CXEA 1MJJA 2C26A 2FHFA 2BP3A 3MLYL 3O11A 3FB5B 3A6CH 3RZCC 3G08B 2X70B 4XXDB 1R3HA 3DIFA 5T1DL 2OL3B 1I75A 5DS8B 3EHBC 5LWYH 2DQGL 2BVPA 1U8QB 1P1ZB 4BZ2H 1DVFD 2EE2A 3NAAH 2QKIA 1AO7D 3HG1B 5DD0H 4GOSA 1QSFD 3L95B 5J89A 3QXWA 1VGEH 2HP4A 3GMMB 4Y5VC 1HHHB 5ISZD 3UTQB 4NWUL 2NXZD 4H1LA 4OQTH 3UJJH 2R0LH 3WFHA 4NZUH 4X9HA 3MUGB 4S1QH 4XBEL 1QO3B 4LF3B 1FE8H 1AJ7L 5ERWA 4UNVA 5TQ2H 1PAMA 1BWMA 2DWEA 2V5MA 1S5IL 5E6IC 3CJJA 32C2A 4IRZL 1TXKA 3IAGC 2YBRB 1I7RB 5BV7B 1I8KA 4RWHA 4JM2C 4BZ1L 3D9AL 5F7EL 5D1QA 2ATPB 4OAWA 4J7RA 3NCMA 5I18H 1URLA 3TA3B 4OLUH 4OCRL 3J8F7 3JWDH 4PR5B 5IMLA 1J0KA 3I6GB 3HFML 4R4FH 1YMMB 3PQYD 2F5AH 5ADPH 2IG2L 5SWZB 1X6LA 4HKXB 4X9IA 4YHNA 3FZUD 5DQDL 5CFHA 4F9LA 3G9VA 3PXHA 4JG0L 3T65A 3OQ3B 5C07A 5LAXB 1IGYA 1T04B 5E4EC 1MCWW 4G9DA 4YZFF 1U3YA 1P4LB 1RUMH 3B43A 3DYMA 3IDNA 1E28B 3RVWC 3WHE1 4WHCA 4D0BB 1MHPL 3MLXL 1LK2B 3V8OA 2ZPKH 1UM4L 2FWOB 5TE7L 3Q48A 1L0XA 4LLVA 3O81A 2DYPD 3DX7A 1IAOB 1EK3A 2EDTA 1H8NA 4MJ2A 1NCDH 5GRWA 5L2KD 4XHJC 2OK0L 2E27H 5KSAD 1AD9A 1T0NA 4P59H 1BJ8A 1MY7A 2GJ6A 4NUJA 4ZO6A 1KFAL 4KK5D 5JHDD 1QKZL 2R1WA 5F7WC 2VLJB 3MV8E 3K2MC 3MRPA 3PABB 5GGRA 4FXLA 1F2XK 2Z8WC 1Q9LB 1FYTD 3FQWB 1QR1B 4IRJB 5E2JA 3U0TB 2NR6C 4Y4KC 1A0QL 1F90L 4XVTL 1MCDA 3VWJD 3HUJE 1FL5A 3EDDA 3V2AR 1UJ3C 4KJWD 1DANT 1I3RA 3THML 1MNUH 3QP3A 3LMJH 3O8XA 4MD4B 2HKHH 5BV7C 1JMZA 3NFPB 5DR5L 3LKRB 5HHMD 4XPGL 2IF7A 3CFCL 4FRWA 3O3UN 4YPJA 5E8OB 3LQMA 2HLFC 5C6TL 1CGUA 5KTEL 3GSRB 2AKRB 2R9HC 4QRPB 3MMEA 3KDMA 3BT2H 3RX8A 5I0ZA 1G6RB 2IPTL 5SX4H 4KXZI 2EYRB 4PD4K 1WUNT 5C0BD 4BZ1H 4ZYKA 1I3UA 1YNTA 1Q94B 4AM0B 4QOKE 3F7VB 5D96C 9CGTA 1IGFH 3VXRB 4Y1AE 4ISVA 4WUUD 2NY3B 5AAMA 5CD3B 3UDWA 3T4AA 3O4LA 4NCDA 2PR4L 5EG6C 4D0DA 1WZ1H 3W0WB 1T0NB 1SBBA 1N64L 1JGVL 1DQJB 1UCBL 2A2QT 3BWUC 3MNZB 5EU7E 5H94B 4O51B 2VIRB 2VLJE 2H32B 2NTFA 3KPLB 5D2LF 3TYGL 3C2SA 4U4BA 1J8KA 3QEQA 3JWOH 4Z0BL 3TBSB 5KANG 1H9VA 3BHBB 4NIKB 4LIQH 5GHWH 4S0TD 4IIQB 1JV5B 4G8EA 4LBEA 3OKOB 3UBXA 5I8OH 4JRYE 3UTTA 1FG2A 5L88H 2F53D 2FX8L 2XY1A 4URTB 1BJ1J 5EBMA 4KY1L 5I19H 1LP9B 3O0RL 4XPTH 2UZIH 4LMQE 4X6DF 2BERA 1UKTA 5T1KA 2FIKA 4JPKL 2LTQC 2NXYC 3FO2B 3VJ6A 4QHKI 3CXDL 2NZIA 1WAAE 4XAWL 4DVBB 4QRQA 3IU4L 4LCUB 5C08D 2JKXA 2GITA 3ZTNL 1M1SA 1FDLH 4XC3L 5JZ7C 2Y06L 4RGNC 2B5IC 3LS5H 1Z9LA 4N9GB 2R2EA 4HSQA 1KF9B 1D9KD 1UXWA 4R97B 4POZC 5JW4R 4XNMA 5KVEL 2QADB 1K3ZA 5IG7B 4E0RB 3VFVA 5HGBB 3MLVL 1KPVA 3O6KL 3QHTC 4HGWA 3AXLB 3EOYG 3AREC 4PRHD 4JFYB 1UYWH 4TSCH 3FB8A 3CVHH 2R29L 3N1PC 2P42B 3VRIA 3QIBD 5IROC 1F42A 3RL1B 5JW4Q 3F7RA 2I9LB 3KLDA 5D70L 4PRBB 3TV3L 2CO6B 2AV1B 4J3SA 1NCCH 4P2OD 4PV9A 3OG6B 2O5YH 1FZMA 2IH3A 4OTXL 3KYMB 2KQMA 4JPIA 2EDJA 5B8CA 1IAMA 4UV4L 2CMRH 2VDKH 3BW9B 4LLUA 4ZXBD 5F7UA 5TFSH 3HUJB 5EOQH 1I7TA 4TSAH 2AJZA 3GBNL 4G8IB 2CDEA 1I3GL 1J12A 3MTRA 4QNPF 1QA9A 1UA6H 3S98A 2JB6A 2VLRD 4GW4B 4U1GB 1QQDB 2RAMA 1FC2D 2W1NA 4PJ9C 5I18L 3KLAA 3MRCA 3IGAA 4X8XA 2CXGA 4CDHA 1FNGA 1Z9OA 2A9NL 4P0DA 1DL7H 2DN7A 3MRHB 3IU4H 4YBQC 4ZO9A 3S6CA 4F58H 5HHOD 1F6LL 5LXGH 5CHNB 4ZFOB 1Y18A 1BM3H 2EKSB 5B38G 1U8MB 1AR1C 3PABA 5FHAL 5GGRB 2DQJL 2WZPD 3WUZA 5FM5O 3ROOA 5TE6H 3C8KB 5IVZB 5FB8A 3FQWA 1QR1A 2E7LA 1ZLWH 1CDCA 1FORL 4D9LH 1B9ZA 4HMDA 2XXMB 4PRPB 3B9KD 1WBYB 4GRMB 5CAYB 5DSCA 3RA7H 5DI8B 1T03L 1YMMD 3PQYB 1CVSC 2OS7A 1FNEA 4PV8A 5FGBC 2Y1VA 1CYGA 3L5IA 1BQLH 4GSDH 4ZUUB 2VDRL 5DO2D 2CSPA 3D85B 3ME0A 3DUSB 2X9YA 3MRGB 2J2ZA 4R2GC 1MFDH 1CICB 2AV1A 1KLFA 1Z5LA 3RWDA 3NTCH 1CFSA 1CLOH 1WIOA 1FNSH 4KROD 3UTTD 4M93B 4RGOL 1CXHA 2FJHA 4WUUE 4S11A 2XPGB 5J1TC 4HCRH 3GKWL 4BH8B 3GMLA 4HS6B 2W9EL 3D48R 4NQDB 4XP9L 3IVKB 2G5BA 2F5BL 2IH1B 2NY1B 1Q72L 3VH8B 1SQ2N 2FIRT 5JXED 3BP5B 4CVWA 2X4RB 4PTUB 4X98A 1PG7W 3D39B 3O6FB 4ISVB 4IOIB 4POYA 3VFWB 1W8NA 4HZAA 5FYKH 3FFDB 2Z8VC 1J0JA 4P23A 1HDMA 2R23A 1MQ8A 1UWGL 3QXDA 1O5DT 2C9AA 4ORGB 1KPUA 3TPUA 1B90A 4JHWL 4TVSa 4H5SB 5H94A 4C56D 4O2FB 4WJ5A 4M6OL 2MHAB 4LRIC 4QO1A 3JWOL 7FABH 1NCWL 3QG6A 4P3WA 1EO8H 1LWRA 2RFXA 3TCXA 5LGKA 1I4FA 4NJ9L 4XPBH 1WICA 3P11H 4TUKH 3PWPE 5HDQH 5ICZB 3VCLB 1RUAL 3LEVL 5E1HB 3HZYA 4QT5B 2LU4A 1JN6B 4G6AC 1QZ1A 1BMGA 4U1JB 1J88A 4I9WD 4LVNB 5IQ9B 1LO0L 4PGEB 5E6YA 4ONHB 3MJ9H 1OP5H 5ENWB 4F58L 1L6ZA 1GZQA 1KTDA 5EDXA 4JFDE 5FOBA 5CJOH 4OCLC 2CXKA 3BGFC 1LE5B 2D03H 2V9RA 3ZLQC 5DLML 3JWOC 5C2UB 2QBWA 4JCMA 4R26H 3RHWF 3R1GH 1J5OL 3STZB 1A2YB 2Z93A 3LB6C 3B8YA 3AM8C 5HHPB 2VLRA 4ERSH 5EZLA 2QTEA 1UM4H 2Z9TA 1QRNB 3JV4A 4I48A 5K9OA 5ISZE 1JTTA 1KJMA 1S7QB 1TZIA 2AAVA 4U1IB 2NY1C 4KPHL 3FTGB 3WJLC 4KJYA 4LSSH 1NSNL 3GO1H 3KYNA 1DQLL 3VDBA 4N8CL 1S7TA 2DM3A 4U05A 3V79C 4FG6D 4M43L 4PTTA 4Y0GA 4L8CA 3T8XA 1I8MA 2AQ2A 2DL9A 1YNKL 3S7GA 1T1WA 2FO4B 3QDGB 2FJFA 1CFBA 4MJ6A 5L9DH 2AERT 2BSSB 1NCAH 4ONGH 5IFHL 2XQYK 2FSEB 4EEEA 3QNYA 4HV8A 5B3NA 4HUKB 4ZPTA 2DICA 5BZDB 1BD2E 1I8IB 3IDXH 3EHBD 1N2RA 1F6FB 2VLLA 1VFAA 1KC5H 1QA9B 1CBVL 2NCMA 4NKMA 3SPVA 4KC3B 4ONHA 1KXTB 1I7ZA 4LGSB 4LSVL 4DKDC 3SKJH 4OGXH 2GFBB 3EUUA 3N1GC 1OPGH 5IHZB 4D8PA 3BIAX 3MLPA 2G2RB 3LN4A 2OJEB 4FOMA 2WANA 1ADQH 1JGEA 4MJIB 1VA9A 4OM1L 5E2UH 4RBPK 5DD3L 5DEZA 1UGNA 2H41A 1AO7E 1KNOB 3HC0B 5JOFB 3UTZA 4TOYL 1AIFA 2DQUL 4Q0XL 4BSJA 2EEBA 4N1CA 2EDXA 2P5WA 2FX7L 2MSPA 2NY2C 4YHZH 1JZ2A 3U46B 1MPAL 4JHWH 3R0MA 2DD8H 3FFCA 3ULUH 4YHYC 5ANME 2IBZX 3HMXA 3VFGL 5C7XH 3WUWG 3M45A 3S96A 2GSGA 1KJ3L 1BVZA 2VXSH 3JVGA 4P2QD 3VGAC 3BPCA 4L29B 4OZIA 3QR2A 4KKAD 1V3MA 1Q72H 2R69H 3LQAL 1N26A 4X6EB 2Q6WB 4KQ4L 2A6KB 5DTFA 3MV01 5T33L 1ITBB 3W0WD 2F8OA 5BZDA 4QRUA 4DZ8B 3MYZA 3QI9A 3TBSA 2FYYB 5HVHC 1N2RB 3U6RA 2MQ3A 3K7UA 4OFIA 5ICYB 3U9UB 1RUAH 3LEVH 4X0KA 4KQ3H 5CJQL 1MH5B 3QDMA 5C0ND 1ZT1B 2BNQE 2Q86B 4Z5RB 4ZFFA 5HVWA 1MI5A 5SWSE 1VERA 4GSDL 4PJ7B 1J11A 1JL8A 2BOCA 4EUPB 1ZHLA 2WK2A 1MSPA 2DLFL 4G6FB 3OHXB 5D7JB 1CIDA 4HJGB 4OFYA 2DJUA 4I8DA 4RMUA 2CRMA 1NGPL 2ZCHL 3DWTA 1MEXL 3WXVH 2Z0BA 5E8DL 1ADQL 5DURB 3RWGB 3KYKL 4Z7UA 5MERA 1P84K 1YEFL 2VIRA 2Q8BL 4P2CG 4PG2C 3MRQB 3QQ4A 1AO7A 5I66A 4Z7VE 2OSLA 3FQUB 1IC5H 1KCVL 1FYHB 4QXTA 4WTWA 4OKVA 1I7UB 4PRDB 3OR7A 3BWAB 5K33A 4JY6B 4JO3L 2VWEC 4I5BB 1IGCL 3SDYH 5LGJB 4JY4B 1MCPH 3WLWD 1MJ8H 3B2VH 4L4VD 5FF6B 2IQAB 4WRLA 2JIXB 3OKYA 2GSGB 2GJ6B 3FQNB 4N8VG 1PQZA 5C0BB 3ZKXB 4RGOH 3PP4H 1CLZH 1ZKAA 1U8NB 1J1OH 4KKBC 2A1WL 3ZMRA 1RIHL 3ULVC 2AV7B 3FT3B 3HR6A 3MBXL 1CE6B 2EYRA 5DHVH 4JLRB 5AUMA 2IH3B 4ZUVA 5A3IC 2I60L 1DBKL 1MRCH 1SEQL 4NZDA 3WKNA 3GMRA 5J12C 3F5WB 3QIBA 3G5XA 4YZFE 2Q8AL 1ZHKA 3BZEA 5D2NE 3QWOB 4JRYA 4XGZA 3BW9A 4LLUB 4OGAD 3Q6GH 2ZCLL 3BKJL 2KKQA 2CO7B 3S3PA 1NANI 3KLHC 4Z5RA 1AC6A 1T2JA 4FNLH 5ABDE 1DBAH 1XGPA 5AYUL 1HH9B 4KTEL 3MGOA 2XG5A 1DE4B 3AMKA 1ZEAL 2Y5EA 1KC5L 1TVBA 3FB7B 3V7AE 5D7LB 3V6ZA 1TETH 4XHQA 5GSVB 5IVNA 2D03L 2VQ1A 4JPVL 1F11B 1DANU 3KLSA 2Z31D 2UWEB 4H25A 4P9HC 4NQXB 3VXSA 1CZ8L 4JB9H 4MMZC 4XP1H 3LKQA 3MV7A 5F72S 1D5ZB 4ZOEA 4LPUA 3DO3A 3VWKB 2R1XA 4GBXC 4PRNB 3RZCA 4K3DL 4NFBA 3MCLH 4RFEB 2DTML 1X7QB 5JA8B 5BV7L 5I1AA 3S3SA 1T5XB 3F7PC 4M4PA 4HKBA 3C60A 5DVLA 1CGWA 3H2WA 2FX9L 4DVBA 2QR0B 1YA5A 3UJJL 2NTFB 3QFJA 4I2XE 5TQ0L 4OI7A 1RSFA 2HWZH 5HYQB 4OAWB 3E1F1 1F4YL 3FAXA 4WU5A 5J06A 4R8WL 3L3DB 2E8YA 3T2NH 4PGCB 4GKSB 2V2XA 4HFUH 2V2WB 4XCEA 3OKKA 3MLUH 4I4WB 5LCVL 4Z8FH 3DRTB 2XRAH 3ROOB 3R8BB 4J1UA 2NTSP 1BIIA 5HGBA 4WI5A 1MJ7H 3TVMD 1MI5D 1MJUH 1Q0YH 2Y25A 5C0AE 2CJUH 4XP5H 3H9YA 5ACMA 1F4XL 3LOWA 5GZNC 3O6KH 3QHZL 1RHFA 1EERB 4JRXA 5T3ZH 1P7KA 3LKPA 3PWLB 3QWRD 5HHOE 2CLZB 4JM2A 5HY9B 4C83A 4LPWA 1W8OA 3MROB 1T2QH 3ELAT 5BS0D 4JFPB 2WWKO 2FZ3A 2CDGA 3ABZA 1U91A 3QDGE 1EFXB 2O61A 3U0WL 1EZVY 4WI9A 3KYAA 5EU3B 1VFOA 3B2UC 4JKPH 1GGTA 3O11B 4PGBB 4JGMA 2Z92A 2Z4QB 2R1WB 3KR3L 3I02A 2CIIA 3IDYC 4AEIH 2IPTH 3VFOB 4JKWA 4MCYB 3QG6B 3JTSA 3OKMB 2D7QA 4XCNB 2BY0A 3RL2A 3VRLF 4M9PA 1OAQL 2QSTA 2PTVA 4QT5A 3L95A 1WC7A 5DD3H 2JCCE 1S8DB 4WO4A 5IQ9A 1ZHNB 3KYMA 1OP9A 3EO1B 1BECA 2ITDB 1FIGH 5D1QC 3D87B 5EH1A 1KCUL 1R24A 1UCBH 2GUOA 1MAML 1J1PL 1U95B 2HAZA 5FUZL 4JPWH 4JANB 5HDOA 3GKWH 3N9GL 2CDEB 2ICWJ 4YC2C 1BJMA 2BNRE 4Z7WA 2YRZA 5ECJE 2A9ML 2R0WH 4ODBD 1LILA 4XP6L 1SBSL 1YEHH 4TNVK 5D70H 3P4OA 5ESAB 3ZKSD 1KELH 2QKIB 2MOVA 4X4XA 2GTZB 5A1AA 2P5WE 1F4XH 4BUHA 1YJDL 1FFQA 3MRNB 5AWNH 5IBLD 3LZFL 4CMMB 5IESL 2FR4B 5DJYB 4MQ7A 4XBPB 4K7PX 3P4MB 3D1MC 1CD9B 4GRWH 4WFGD 2RIKA 5JPMA 1VGKA 5KSVA 4FQHA 4AL8L 2LABA 3QUKA 1QBAA 4G3YL 4JFHE 1C1EL 4NOFA 5HYJD 4M6AA 3QUXB 4P3CL 3WEXA 5SV3A 3EFFB 4JKMA 3K0WA 1AC0A 4P2RE 1NGYA 5DMIH 2N7AA 1KYOK 5KBNC 2LU7A 3H8NA 4NKIH 4PV8B 4XZUB 2H1PL 1G7JB 2IG2H 1NMAL 4QHUA 3ARGA 4NHUA 5HXMA 3OL2A 2HT3C 4LAJH 3RQ3A 5C08E 4S1RH 4RMSA 4MXVF 2HRPH 1JWMB 3QJFB 5HYIA 5K9KA 4ZXBA 3VFUA 1HYSC 3C2AL 2K1MA 1ZA3B 3DSFL 1IGJA 3QPQD 2EXWC 4F7CA 1EZVX 5C0EB 2AK1L 3MGTB 4N0CD 1NFDF 3EOAA 1VPOL 3GI8H 4OZFA 3GK8H 4YFLI 3I50L 4DKEL 1JGEB 4HLZH 1CF8H 4H25B 4MAYD 4MXQD 1QSVA 1Q9KA 1PLGH 3FO0H 4D0BA 4PBXA 1XIWB 1MEXH 3TYFB 4X7DC 4OGYH 2X4RA 4PTUA 4XC1L 2CH8A 1J8HE 3GGWB 3U30C 2Q3ZA 3BKJH 1A6WH 2UUDK 5MENA 3DTXA 1FQ9C 5ALCH 2OTWA 1Y6KR 4MX7B 3D0VB 2Q8AH 1LP9A 4NUGL 4UNTA 1CR9H 1HSBB 2EH8L 4AEIL 5JIPA 3HC3L 4R4BA 2V17L 4KHXL 5GS0D 2CPCA 5FOBB 2E7LC 4YHPA 1MCKA 3QUXC 4P9HH 3LVEA 1X5AA 1WWAX 3GBML 5EZOL 2J8UB 5DEGB 2YKLH 3LN5B 2VC2H 3QUYC 1OQOA 2XICA 1AXTL 5GS0H 1F5WA 5E8NB 3AAZB 2R2HB 2OR8A 3SKUD 5EZLB 1BWWA 1L9MA 4J3OC 3BH9B 1YUHA 3TVMC 4YUEL 5SX5H 1XF3A 1KTLA 2VN4A 4R0LB 5D2LE 5T3XL 1HQRA 4TYUA 3W2DH 3ZDXF 2NY5C 1QSEA 3H42H 4NQSA 3WS3A 3LKSA 5L2JA 1I1AA 2PN5A 1IC4H 4WW1B 4LOUC 1HQ4B 4HMEA 4CADB 2NY0B 5M94B 1KB5L 4E5XA 2M8XA 1DN0B 3LRSB 4JDZA 3ULUL 3TH3T 4ZFFB 5F9AC 4J8RA 4P5TD 5K9JL 5MI0C 1OGAE 3HPLB 1SVZA 1I1AD 3SJVB 4NZTL 3TT1H 1OSZA 4OB5L 5EUOA 4FXGB 4XXCC 4XMKL 5I1HL 2HRLA 1YEGL 4QHMA 3P73B 4GLRI 2P45B 1MCJA 3GSVB 1DLFL 4N9OB 4XX1E 5CP3A 5DMGC 4XVJH 4PP1C 1JPTH 5DRZA 1ZT1A 1T2QL 2DQCL 3W0WA 5E8PB 3OAZK 1XGRA 3HI1B 1T1XB 3CX5J 3VGEA 4OZ4A 1RU9L 2D4DA 3SO3C 1AGFB 3UPCA 5T3ZL 4KMTH 5DJ6A 4ETQA 3PGDB 4XWOD 3BPNB 2X42A 2B0SL 5D5MB 5FKAA 1MJUL 1Q0YL 2IALA 2PYEE 2XWTB 2DQDL 4O2CA 4IIQA 1NGWA 4JG0H 3SO5A 1QLFA 1JZ5A 1NAML 3DROA 3RVWD 3UTPE 1CDGA 2MCPL 5CBAA 5HSFA 4U3CA 4OV5A 1GYAA 4GAGL 3CDGB 5GJSL 5JHDB 1V7NH 1A1NB 3ES6B 1MCCA 4WDIA 5E6IB 1KELL 3OAUL 1KPVB 3HR5B 4ZMAT 3C5JB 4XPHL 1E6OL 3P4OB 3B3IA 1ZV5A 4Q6IB 4EN3A 3FRUA 1LNUB 4HEME 5E2WL 4FQCH 5FKPA 5CSBA 3TO4A 4EKXA 5HYSB 5I1GL 5DSCB 2FBJH 2SEBB 4RGNB 3ARDB 3VW3L 2P48B 3M07A 5DF0A 5IW1A 3BRFA 4HZLA 3D39A 2H26A 4PJGA 2YUZA 1BBJB 2XOTA 4MXWH 3MYJB 1DN2A 1DUYA 5C9JA 4LPXA 1R5VB 1BEYL 4LRNH 3J7HA 1JK8B 4P46A 5F7YC 5D9SA 4HHAB 3EYFA 1AHWA 3BH8B 4P2RA 3PP3H 4NDMB 5I17A 3KPPB 4TSCL 3OKDB 4BH8A 2JB5L 3RDTC 5T5FH 3PWPB 4C55A 2KL6A 4XGZB 2GT9B 1EAPA 2X4UB 2IAND 4Y1AA 2HH0H 5EWIL 3GJEA 1U36A 3C5SB 5F1SA 3PWJA 4XBGB 3GMQA 4Y4FD 1A8JH 4Z6AT 3C60B 5DJ6B 4PYHA 4UIKL 3QIWA 1A5FL 2X10A 3IAQA 2KZWA 2WWMC 2AJYH 3WXVL 3A67H 4GAYB 2HJKB 2QLVB 3AFLA 5IVXE 3FQUA 1I7TB 5SWSD 4G5ZH 5D6CB 4R3SB 1F6AA 2NY7H 2CR3A 4G8GD 3TN0D 4QXTB 1L7IL 4JY6A 4PBVC 1FNFA 5K9JH 5CEZE 1KJVB 2B4CH 2OTUB 4QYOA 4KI5D 5FKPB 4EUPA 2E9WA 2J7LA 3BP6A 4E41D 3O3AA 4XH2B 5AG8A 3SQOL 2OI9C 1TITA 3D9AH 3RVTD 3EDFA 3PWLA 5K59E 3GIVB 3RWGA 1BPVA 4WEUD 3OAZH 2FEDD 5JW4N 5E2VL 1N0XH 4WU5B 1IC7H 4M1CD 4RFOL 3SCMB 4HCRL 3BEVB 1YYLH 4FTVA 3OSKA 3E3QC 2E9JA 3INUL 4OBSA 2X40A 1NUFA 5C07B 4NQDA 3C5ZA 4XTRD 1A9BB 3UTTE 4XP4L 3D69B 4OQTL 3WLBA 2VLKE 3X12B 2HG5B 1TCRA 2UZYB 3QFDB 5L2KB 5I1KL 4FQXA 4M7JH 2X1PA 5J9PB 2DQEL 4TVPH 1OP3K 4RFNB 2FECI 3BKMH 1BQUA 1A6AA 4HWUA 3NIGF 1QG3A 5EOCJ 2V5SA 2C3WA 2VDOL 2VE6A 4WCYL 2VAAA 1YMMA 3QWRA 1UB6A 3JUZA 3REVA 5KG9B 2FJGA 1PSKH 4LCWA 3LKQB 3MV7B 3MLYH 5IV2A 4JQXA 3CXHK 4L8BB 3VH8A 2J88H 3Q6GL 4NYLB 3Q1SH 4RA0C 1CBVH 1UCTA 5I76B 1RIUL 4I3SL 4R7NA 4PB9H 4CW1B 2E9BA 5E4EB 2WMPA 2QQKH 3CCHB 3HMXL 2L4OA 1CDIA 5C0RL 4QGTA 3S37H 4LSSL 4J3TA 2BVQA 5CIPB 3PDOA 1S7RA 5KVDL 5IHZA 2EH7H 4JPVH 3HMWH 1YEEL 2ITDA 2ESVE 3E2HC 2GUOB 1HE7A 2CUIA 1MFEL 3OKKB 1KT2A 3CUPA 4JFFE 1GZPB 3IDIA 5C0CE 3CMOL 5CSZA 1PZ5A 1S7XB 1H5BB 3ARBD 3P9LA 1CFNA 5IW6A 1BD2B 1T21A 2XYCA 5EULV 4WI2A 4RSVA 4KDTA 4JVPA 3NFSL 4YPGB 4B7IA 5HI4D 1NBVH 3U2SB 3GMPB 1U3HC 1RHHA 3EFDH 1KCVH 2DJ4A 5CS7A 1CLCA 1NEZG 1NL0H 5DT1L 1LEGB 5BVPH 3EOTH 4OD2A 1R5WA 2C1PA 4KUCF 4G6JL 3B6SB 1A64A 4XWGL 5F89B 4AEHL 4YJZL 4PY8I 5GIRA 5ELIA 2BRQA 5I8EB 3TBWA 1VSCA 5B39G 2VLRB 3LKNB 4JZOA 1FFPB 3MGTA 1RZ7H 1UH2A 4NKDB 4PJ5E 3WNLA 5DJZB 5CWSB 5IBTL 1UWXH 5E70A 3PG2A 2XZCL 4WUKL 4KK9D 3PXJA 3MRBB 3O6ML 1RIUH 4I3SH 5A2FA 1PKQA 2P8MB 3FT4B 3RWFA 3BSZL 5IHUH 1V5JA 4JPKH 4MAUL 5JDSA 5HYJE 2VSCA 3SGEI 1CE1H 3GBNH 3IXTB 1FE8L 2YD2A 4MD5A 3DOSA 4XPTL 3MV7D 3DTXB 4N5UA 4EUPG 2YOCA 1PD6A 2D3VA 3V9FA 4I2XB 4L1HA 1AR1D 1JNLH 3HZKA 4PJ8B 3ARGD 3VJ6B 4PUBL 4G9DB 1RK0A 3LH2L 1LO5B 4H26B 1I3VA 4AEEA 3DMMD 2J8UA 5DEGA 2F8VA 5B3JE 4B53A 4JQVA 2ITCB 4HX1A 5J11B 5D5MF 4RQQA 5DJAA 5BZWB 4Z7WB 1AGDB 3TZVD 3WFZA 3SDCB 3MJ6A 4GJTB 1HINH 3SJVD 3ULUC 2P8PB 1MPAH 4PJDE 1B88A 2ARJB 5FK9A 1UYWL 1G7LB 4TN9A 1MELA 4F8TA 3PWNB 5IF0B 2APVA 4RMWA 3ZT7A 2GY7B 5E5UB 1AD9B 3B4NA 1EV2E 2ZCKL 4JFYA 4EZMA 2FH8A 4OM1H 5E2UL 2BVEA 3Q3GB 3MBED 2AJYL 1HH9A 4JFEB 3MGOB 4QRQB 5EU6E 1GXEA 1D5IL 4K3HA 3V0WH 1CIUA 2BCKA 4GMSH 3X11A 3LKNA 1HNGA 4GH7B 4X6DB 1OD9A 1OGAA 5GSVA 2VDQL 3P11L 4TUKL 4LVHC 1QFUH 3GM0A 4YDIL 5CWSA 4PD4J 5EB9A 3U36B 2GJ6D 5LKNA 2FD6H 1U8PB 3UO1L 1SJHA 1KENH 1WIPA 2VDNL 1AQKH 3HMWL 4AJ0A 4PREB 2VLKA 4DGYH 1RULH 4WV1B 1XF3B 3CIQA 2FX8H 5E9DA 3C87A 2BSRB 2Z31C 1OLZA 2MQCA 4OZGA 5D2LB 4LNRA 1DDHB 1JYXA 1JTOA 4JM4L 1RI8A 4X5XB 3CDYA 3MCKB 4LPCA 3UJTH 2VTFA 1G0YR 1QNZL 5EOTB 1EBPA 5JW4M 3BUTA 4LSUL 4OCXL 5CZVL 2FLBT 3OGOE 1TJHH 4P3DB 1KBGL 3L3IB 3VE0B 5I1JL 3K46A 2YMXL 5IJVB 2NR6D 2K9UA 5C0CB 1RIVH 4JDVA 1MCQA 3DX6A 3EYQD 5I8KH 2W38A 1RV6X 1P7HL 3WNPA 3O2WL 5F1KC 4Z18A 4B50A 5FB8B 4IEFB 3GHEH 5CD3A 3MR9B 5IWLA 3NBNA 1T22A 4ZUWB 3UPAA 1H3PL 4TVPE 1E6JL 4OLWH 1FV1B 4XAKE 3QDJD 5C0DB 1FL6B 3O4LE 1YYML 3X14B 1G9NL 4JFFD 3EOTL 3REWA 3STLA 1TZGH 4Y4HD 5HYSA 2KBGA 1MHPH 3QZWG 3EOAB 3SDCD 3W39B 3V6FA 4GXUN 4DKFH 1VCAA 1T0MA 4HDIA 3I6KB 1ZXQA 1MHHB 4Y16A 4OTXH 4L4TA 1EVUA 3OKEA 2VZTA 5C0GA 2A74A 1DCLA 3P4NA 5ILTL 1EHNA 3O41A 4EI6A 2NY5H 1YUHB 1QLFB 3GIZH 3SKNB 2FHCA 1PYWA 2XPGA 1J1PH 1UC6A 1MHEA 4PY7B 1A1NA 3ES6A 3O4OB 1ZSDB 4LFHD 3Q1SL 3LMJL 5IB2A 1WQVT 3AS0A 4G6ML 4KKLD 4QF1A 1YNLL 4WO4C 3FQRB 4GG8B 5L2KE 3D25A 1N8ZA 1QFHA 1ORQA 5I30L 1P7KB 2VDML 5EC2A 4EXKA 2BY3A 5L8KB 5C86A 3D3VA 2J6EL 3JV0A 1VACA 4YDJA 3RBGA 2PTTB 1GGBL 4LQFH 1NBZA 2NY4B 5HYEA 1CDBA 4R4NC 2EIZB 4GRLA 5T1KD 1CU4L 2R23B 1VADB 3AROA 1XGUA 1ZHKB 5DD5L 4XNUH 3B9KA 3OTTA 4S1QL 3L3JB 3UP1A 3G6AA 4X8JA 5BRZD 3AXLA 3KJ6H 2BNUA 5BQ7A 5JW3L 4H1LG 3CSYB 4UMGA 4GMSL 4X7TB 5SX5K 2JJVA 1ROWA 3DBXA 4M7KH 5GSRB 3O6FA 5CUSH 1JUFA 3V6ZB 2PW1B 3MJ8A 5D7KE 4TTDC 2A38A 3V6FB 4J3VA 3HPLA 1N7ML 4YLQT 3SDDA 3V0VA 4AEHH 1L4IA 3KPSE 3RAJH 2MJWA 2D31B 3DXAB 1ND0A 1N7MH 3FO1B 1HHKA 2A77H 4E41B 4ZAKB 1WZMA 1QOKA 4LMQI 3G6JF 4KQ4H 4UOW1 5TDOA 2OZ4H 1F6AB 3EFDL 3VMPA 4M7ZB 1OTUD 2XN9D 1FVDA 5F88B 3MLWH 4S1SH 1WFUA 4JG1L 2VISA 3I2CH 2ORBH 3IDGA 4QTHB 4WTZA 1QTYT 1YMHA 4HH9A 1MCFA 4MJ4A 4OZFG 3NIDE 3JTTA 4Y5YB 5DJYA 4YNYB 4LCCA 1E4JA 4H20L 3ZDYE 1A5FH 5GGSA 1MRDL 3BSZH 1EFXA 1JZ8A 2O61B 1Y18B 1FAKT 2G75A 3NTCL 2HJFA 1KIRA 4MQXD 2DQIL 5DDHB 4ZTPH 5ITBH 4FMFA 5GJSH 4GO6B 2JIXD 4ZNEE 2YD9A 3VWKD 5C0NC 3MNVB 2YXMA 3MRKA 5FFLA 4X6DA 1DUZA 2QHRH 1UH4A 5BS0E 1NGXB 4R7DB 1TZHA 3X3FL 4U6HB 4OZFB 1T03H 3B9VA 1YEIL 3CSYA 4HJJL 3VD9A 2FO1A 4NO2A 1FVEB 4FABL 4F80A 2W0FA 1QFWI 5D7JC 1YDPB 2FNBA 3MV9B 1XGQB 3M1BA 1F3JB 2DQJH 5KAQF 5C9KA 5EO0B 5FECB 4X5XA 5C09B 4LPTA 3GI8L 3NPSB 1S9KC 4F7CB 4MMXC 1JNNL 1FC1A 1A7PL 1FNAA 1GOFA 1XT5A 3MNWB 4LSQH 3MZGB 5IJVA 1JWUA 3WDHA 2HLFD 3EKCA 5CKAA 3OB0K 1EEQA 2X4TA 3JTSB 3OKMA 4LCWB 1HWGB 3WFEL 4L4VA 4AH2A 4LGRB 1X5IA 2GITB 2J4WL 1PX3A 3FOMB 4X7SL 5DD1H 5J6HA 4J3XA 5FYJE 3PP3K 2AK4A 1OAYL 5DFVD 4TQEH 2VXUH 3SKMB 4RAVB 5GRJL 1IM3A 3PP4L 2RHEA 3HAEG 1XF5A 4BSVB 2COQA 4PJHB 5F71A 4P5MA 1K85A 4MQ7B 1NFDB 3P4MA 2EO1A 1FDLL 4XC3H 1JHLH 4TNWK 5DHXB 2VXQH 5C07D 2AK4D 2BVYA 2ZG2A 2CIKB 4MA3A 1C1EH 5M95B 2R56L 5F9JA 1HSAB 5DK0A 1UWEH 1K5NA 3VFNB 1LE9A 3V52H 1ACZA 3OJMB 1HCVA 4XVTH 25C8H 3HE6C 1DQML 2EDFA 4NKQB 2UWEF 3WJLA 3TBWB 5A2KH 4X4XB 2E6QA 2N56A 5IP4A 1XGYH 4UIMB 2MFNA 5GZND 1QBMH 3M8OH 2I24N 3L1OH 3O3BB 2F54D 2AXFB 5L2KA 3NMEA 3E0GA 3VFSB 1ORSB 4EJ1C 1Q1JL 3FB6B 4HJ0D 3VXSD 5JORB 5I6XB 1K6QH 1N3NA 2XNAA 1U8JB 3C9NB 3VRJB 3RDTA 4HS3A 4ODTH 4DTGL 2XZQH 2DJSA 5JR1L 1SY6H 4LHUD 5D2NC 4W70A 4O5LH 2NMSA 1YEGH 3HZVA 5EO9B 4DK6A 3RWHA 4G9FA 4OZIF 1F00I 2WSKA 3O6FD 5BW7C 4ELMA 2E9IA 1CS6A 1QRNE 1C08B 1R3HB 1T5WB 3DIFB 4PJFB 4TNVF 3L5JA 1ZLVK 3BJLA 2V2TB 3QHZH 5EIVA 3S35L 3GNML 2JB5H 5GRVL 1VHPA 2J5LB 3HCVB 1MVUA 1T7VA 3ZHKA 3CCHA 3DMMA 4NRZA 3D39E 3BGMA 1KB9J 1TENA 3GZKA 4OLVL 1XF1A 4PJ5D 3ARBB 1NDMA 3MFFB 4M62H 3MREB 2O5ZH 3H0TB 1YPZF 3RZCD 2SEBA 3PHQB 3EYVB 2YK1H 1T1ZA 2YA0A 3U0WH 2IEPA 3GHBL 1MLCB 3FB5A 4PJGB 1F4WL 4Z7UB 5J13C 3D3VD 2VH5H 4M5ZH 4QRPA 5I73B 5BO1L 3KDMB 4WY7H 4IM8A 2BRRL 1UADC 2VQTA 1IAIL 4OZGE 2FH6A 4NKMB 3V6OC 3I9GH 1MCOH 3BGFB 4AIXA 3GI9H 5E03A 1RY7B 3DRQB 3W11C 5EUOF 1ERNA 3QEUA 3TZVA 5JORA 1OP3H 4G43A 5HJ3B 1GC1L 3S5LG 4NT6A 3TA3A 3RI5F 3TIEB 3OKLB 1FVCB 4UBDC 2VITB 3CLEL 3KYOA 4ODUB 4WW2A 4HEPG 4NPYA 2CQVA 2MKWA 3CZFB 1WV7T 4BSWB 1XIWD 1T04A 2UY6A 2Y07L 2YN5A 3N50A 3QQ3B 4LVEA 3T0EA 1JHKL 1DSFL 3ARDD 4NQEE 2DKMA 4NQXA 4WI3A 3VXSB 2A6DB 5MEQB 4NQVA 3U7YL 5IUSA 2YPVL 3ZKQD 4HBCH 4MJ5A 1RUML 1HIMH 2FRGP 2AJUL 3LD8B 1V7MH 5TPWL 4RX4A 2OTUA 3EW3B 4QYOB 1JN6A 4JQXC 1NGQL 2YUWA 4R96A 4AL8H 3TBTA 3FHQA 4JZNB 1T6WA 2FIKB 2A1WH 4Q6YA 3GSNB 2XIDA 3UO1H 4ZSOE 2E27L 1EUUA 1KXQE 4JRYD 1P4LA 1E0OB 5KVDH 3WN5A 3UZEA 2EDBA 5DMIL 3VXUB 3L3DA 2X1XR 3BPNC 5BW7A 3GMNB 5C8JB 1DBAL 4F7MA 4ZAKC 1ZE3C 3RVUC 4PLJC 1RUQL 2HJLB 3SO3B 4WGWB 5CJBA 1U58B 5JTWA 1X4YA 2P8LA 3IRPX 2QHLA 5EU5A 1KGCD 1QP1A 1RU9H 2OZ4L 2V9QA 1JRHL 3BP6B 3VXMB 4PG9B 4IDLA 1CLYH 5IMMB 3L3GA 4XPAH 4U1MB 2R1YB 5I1JH 3QUZA 3VI3F 2O5XH 3BUYA 3RL1A 2L0DA 2EC9U 1RIHH 4I0PA 5DWUH 5GGQL 4MVBD 1HINL 4UQ3A 5IVZA 3DYPA 4NN5B 3TO4D 2AJVL 5C0GB 3SDXF 2JJTA 4F9PA 4EOWL 1W0VA 1J7VR 3NAAL 1KEML 1NC4B 4QEGA 4UU9B 3BD3A 4K2UL 4FQQB 2XKNA 4JM2F 5CP7B 1ZAGA 4WTZG 3C6LB 4IDJH 5KW9H 1P7QD 1BZ7B 4CU7A 2ZOKB 5EC1B 5GGVH 3L3KA 1RJLB 1A3LH 1INDH 3FTGA 4Q9CA 2OX5A 5ANMA 3KNBA 5T1MA 1AKJD 2GJ6E 1OSPH 4RIRA 2K3TA 3MV9E 1LHZA 2JB6B 4GW4A 3O45B 4JM4H 2A73A 3I85A 4YFEA 2W0PA 4Q2ZB 4ODHL 2AKRA 1NFIA 3SPVB 1N3NB 3KPSB 3ZHLA 4D2NA 3FRPA 4LDEB 5KSUB 2NY1D 4JDVB 4GRLB 1ZLUK 2V5YA 3MSPA 3P40A 1AQKL 3ZYIA 5SWZE 3D39D 1K2DA 1LEKA 3MRRA 4G9FB 2NNAA 1NAMA 4HKZB 4M3KB 3V4VH 2DLTA 2RGSA 5AZEH 4M1DL 4UOJA 1EJOL 4Q58C 5KVGH 1E4WH 4GKZA 3CFIC 1BVLA 3IDIB 3T3MF 3F12A 5CJQH 2P8LB 3IJSA 3MBEA 2Y5TB 3V0WL 1EJOH 4X6FA 5KVGL 3VFPA 3BDXA 1U92B 5F9WC 4XB8A 4YK4C 3PWPD 1JFQL 5FO7A 1W72H 1FLRL 1DQTA 2AI0H 2OP4L 1I7RA 1RHHB 3KPRD 1JRHH 4MCZB 3BYYA 4WENB 2UWEA 2IANA 3SDXE 4Q97A 3CFKA 3EYUL 4GW1A 4PRPD 1JNLL 2A74B 3K80A 5L0QB 4F2MA 5JR1H 5IFAL 1T1YB 3LPWA 1ZVSB 2HLAB 4NO0B 4ONFL 1A4JB 3BT2L 3IAPA 2ID5A 3T1WA 1GJIA 2Z8RA 4NOBA 1N6VA 5FUCC 2H9GB 4PG2A 3PV6A 1FNHA 4Y4FB 1QLRA 3W11D 4PJIB 5KS9B 1A4KB 5J9PA 2XV6B 3C2AH 3WNNA 1FN4A 1ONQB 3MV9A 4KK9C 1JWMA 2HFGL 3WFCL 2GK0B 4NM8L 5KSUA 1IARB 3O41B 3W9EB 4WIQA 1BFTA 3GIZL 3V6OE 1M71B 3Q0HA 4XNMB 4WEBH 4PJXE 1MJJB 1QSFE 2XI9A 3RP1A 3G5VA 4OLYH 4JDTH 2BVOA 4ZS6C 1VFUA 1ULVA 3SCMC 3FKUS 3V7MA 2VDNH 3SE4C 3BZDA 4XPHH 4C56B 4LCYA 1MRCL 1SEQH 5MEOA 5F6IB 2HFFA 3QNZB 2ZSVA 1KYOJ 1S7TB 2BFVL 2DLIA 1F58H 1VACB 4YDJB 1P84J 2BVQB 3FCTB 1U91B 1G9ML 2WBJB 1H3PH 1R3IH 4EI5D 5T5NG 3CLFL 4LPYA 1J1XH 3VG9C 1T20A 3SGKC 3BDYH 4Z9KB 3QDMD 5HHVH 2I5YL 4N68A 4ELKA 4ZFOA 5CEYB 1G7QA 1H3TA 2C7UA 1OARH 2YHGA 5HHNA 1PGRB 3P2TA 1FZOA 1RIVL 1LVEA 4XXDA 3RWJA 3DX9B 3LS5L 1BFSA 4YHYB 4CVXA 4K07A 3OKNB 1A2YA 2VL4A 2Z93B 2HTLD 1XIWA 1S7SB 3T0AA 5I1LA 3P0YL 1BLNA 1VKXA 1AY1L 1FZJA 3RUGA 2YPVH 1DLFH 4YBQD 4OCSL 4XRCA 5DQJB 1A4KA 5EA0H 5EU5B 4PJEB 1AFVH 1N5YL 4ERSL 3VXRA 3NCYP 2Y07H 4R4BB 1DVFB 3WE6B 2FEDC 4K7PL 5KOVC 5C92A 4Q9RL 4TUJB 4NFDA 1CXLA 2E7MA 2FD6L 4LLMA 1NJ9A 5ITBL 1Q8MA 3BO8A 3RDTB 1DUZB 4IBLT 3IXAA 4OIIL 1AXIB 2PW2B 1OSPL 5CZKA 4Z7OE 4GAFB 1RJZB 3O3DB 5I75B 3DNKA 2OQJA 5CBEB 5GS3A 1DBML 2VR9A 2CGRL 2FR4A 3O3BA 3G9AB 5A3ID 4XBPA 1VFMA 2Y6SC 2AGJH 4BQCA 3MXWH 4UUJA 3ZDXE 1YQ2A 3VFWA 5IMLB 1ES0A 1IAOA 1WT5A 3BP4A 5D8JL 4F3FB 3L5WA 1T5XA 4P2YA 2HMID 1B6DA 1T7ZA 4ZUSB 4D9RE 4CMHB 4U1GC 4LHJB 5FHBH 5EORL 4JZOB 2L7JA 1IGYB 4N0YL 1EA9C 5D93B 3WD5H 5BJTB 3NCJH 1IKFH 1NBQA 2VZ3A 4NJAH 3E3QE 3MFGB 2FL5A 4BFIA 4O9HH 4OV6F 4KI5C 5D5MA 2VDLH 3V4PL 1AGBA 2AK4B 1ZTXL 1P4BH 2NW3B 4XCEB 5CBAB 3MGAA 2EDHA 1NLBH 3C6SA 3F12B 5B4MC 2ARJQ 2HWZL 2GW5A 1UVQB 3CC5A 1FYTA 2OMNA 3QFJE 1HDMB 5IB2B 2NW2A 2ZNWA 4FFVC 4C58B 4MNQB 5I1GH 5SWQA 1IBGL 4O5LL 2XA3A 4PJBE 1CL7L 4DKEH 2C3XA 1T1XA 5KAQG 3ZL4H 1DVFC 2VXTH 4JRWA 1R3LB 4L3CA 5DJDA 2AEPL 4Y2DD 1FVCA 2XZQL 1A7QH 4LLYA 1NDGB 3CFKB 1GPOH 3DO7B 4JY5L 4EBQH 2ILLA 3CH1A 3OKEB 4HWZB 2VKXA 2XWTA 3HE6B 4JO2L 4FQ2L 2CLVA 2YZ1A 2QADC 1IGCH 1U8LA 3G5ZB 4EI6B 3O3DA 5F44A 1WWBX 2AJUH 1DQQB 2ZZUT 5I30H 3QQ3A 3MJ9A 3QXAA 5DWUL 4JY4A 2BSTB 3WKML 1NEZA 2CD0A 5EU4A 5I8CA 3PHOA 2D0FA 2BJMH 4BQ8A 2X1WL 3IYLW 1YC8A 4UIKH 3S5LA 2YD6A 4JRXB 2PYED 1RZKC 1ZEAH 3NACH 5CGTA 5JLZA 1O7SA 4RFNC 3MJ7A 3TJEH 4MWFA 3NACL 2HYMA 1N6QH 1WC7B 3H3KA 5IMKA 1NCCL 4CN1A 5E9DD 4NM4H 1ETZA 3BISA 1N4XH 3GEWB 1V05A 5C0CA 5EO9A 3DXAE 4LSPH 1MFAH 3BP7A 5HTSA 1GL4B 1AXSB 4QRRB 4YDLC 1IILE 4HIXL 2NY6C 4FQCL 4XVSH 5ID0B 2QHRL 3MACH 4U6VH 4X9GA 2B20A 1EGJL 3GJFK 3H3PL 2X4NA 2EKSA 3NPSC 3SGDH 1TMCB 3G6JE 1NFKA 2C3HA 1EX0A 5KZCD 4E5XB 1C16A 2NY6B 2HJLA 2YUVA 5KVFL 4L3AA 1OAXL 5DZLA 4AIZB 5J6GA 2FGZA 4Y8AA 2I9TA 3LHPH 4AENA 1N0XL 3GSWB 2FO4A 3RVXD 1LO2L 3ZKMD 5FF6A 1TJIH 5DD6A 4KMTL 4XNZB 3N1QC 3FONB 4OLEA 4KKNA 1IC1A 3RGVB 3MPCA 4GW5A 3P73A 2V2TA 3RU8H 3RTQB 4HXAH 4ZAKA 4DN3H 4AT6B 4GRLC 1B4JH 1K9TA 2VWEE 4Y19A 4HGWB 3FFCB 4M1DH 4HS8H 3ALXA 5H37G 1CT8B 4U49A 5GHWL 4N0UA 1XF4B 7FABL 4DQOL 1X5KA 3QUZC 4U7KA 1YMHB 4YDVA 4X98B 4MD0B 4N8VA 1CG9A 3NA4A 5K9KB 5HI3D 3AGVA 4ODVH 5KSVB 2WAHA 2Z91A 3IETA 4PJXB 4KVCL 3KAAA 5HGAA 5C6PB 2DM7A 2VDPH 4EI5A 5FYKU 3OR6B 3QUXA 4J23A 3U1SL 1JWUB 2FEEI 4KMLB 4XCYA 3TBVA 2OJZH 3EO9L 4UT6L 2OLDA 4XP9H 4MS8D 1DL7L 4DCQA 2FLRT 4OT1H 2EYTA 4QOKB 3DSFH 1FVEA 4NQTA 1NLBL 3VFRB 5ISZB 1P6AB 1Q9OB 1ZOXA 5HVGB 3BRDA 1Y6NR 4NPYB 1ZHBA 2E3VA 3HZMB 4OCNC 5F6HI 1FNSL 3ULVH 3GSWA 5FOJA 5D93C 4MA1B 2JCCA 3MC0A 1S7VB 3WS6C 3OV6A 1HWHB 5C6TH 3EYOA 3SDXA 3KVQA 4U6YA 3RKDD 3CX2A 4YR6A 2EZ0C 1YEKL 1BQLL 3TH4T 3DURA 3VW3H 3RY6A 3VWJB 1WZ1L 4DN4H 5BQ7B 1XR9B 3C8KA 4PJ5A 4GLRH 4TOYH 4L4VB 4K94H 2FCBA 5GRJH 3H9SA 3L7FB 2WWKT 5EBWB 4PGJA 5HHPA 5CD5D 1BIIB 3QXVA 4H8WH 4YHIB 2QL1A 3NGBC 1SVCP 2GKIA 1KB9K 3JV4B 2F9BT 3R06A 3UYRL 3IKCA 4HH9B 2BNQB 1IL1B 1XF2A 1QSEB 4NQSB 1HHIA 4GAJH 5KSB