1BJ8A

Third n-terminal domain of gp130, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
MDKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords GP130
publication title The signal transducer gp130: solution structure of the carboxy-terminal domain of the cytokine receptor homology region.
pubmed rcsb
source organism Homo sapiens
total genus 20
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bj8A00
4R9HA 4BH7B 4HH9A 4Y4HA 1JPST 5CSGA 1FYTD 3CFEB 1PSKL 5EUOE 4YXHL 4RMVA 1E4WH 3KPTA 3NA9L 4U6VH 4JQIL 2VR9A 4NUGL 2AXGB 5MEQB 3IFPB 3GSOB 4OFKA 3ZT7A 3MRHB 1AHWB 3O9WA 2ZCLH 1MRDL 3QR2A 3WKNA 4LSQL 5DS8A 1V05A 4E9LA 4J2XA 5FUZH 5EBWB 4JQXA 1JYWA 4XVSL 1OSZA 4GRMB 4WU7B 4X98B 3NH7L 5C0AB 1C7SA 3RKPA 4E5XB 4RDQG 5EU4B 1TVBA 2X4UB 4H88L 4OAWB 3O3UN 5DRNB 1PLGL 3QQNA 2DQCH 5F88B 4TSBL 1MFBL 2Y5TA 3B2VL 2NXYC 1J5OL 3EO0A 1W72B 1IKFH 1Q94B 4JJHA 3QEQB 1FIGL 3H9SE 5GISH 4QT5A 4MAYB 3D48R 1N6VA 1OTTC 4XVTH 3HC4L 4YUEH 4NFBA 1QSZA 1UWGL 4PGDA 1A7NL 4M7ZC 5GRVL 4CNIA 3DSFL 2PW1B 3PWNB 1VCAA 1R5VA 3CUPA 4LLWA 5FYLL 1CGWA 4Z8FL 2JK5A 1IC4L 1A3LL 3MC0A 3GSQA 5GS1C 5BZWA 4FFZH 4NNYA 5FHBH 4HEME 4IMKA 1U8KB 5EUOF 5DQ9B 3ARTA 4LDOB 5FECB 4KZEH 1B4JH 1DVFA 2OI9B 2VLJD 4X9BA 5ID0B 1YJDC 3WSQH 3ES6A 3HTLX 2D4FA 1KC5L 1TJHH 4Q9CA 4KK8C 2NY6D 2X09A 2YPLD 2JIXA 2P43B 2R2EA 4C83A 4WW2C 4G80B 4AG4H 4MCZA 3VFWA 2F19L 4F58H 2WBJB 3CFKB 4W6WB 2ADFH 2IH1B 1MREH 3QDGD 2CDGA 2YPVH 2LAAA 1WJ3A 2DJUA 2DJ4A 1D9KD 2QADB 4HC1H 4HWEH 1U2CA 1KN4L 2CRYA 4LCCB 1MWAH 3D0LB 4UU9B 5L2KD 2NY7L 2JJSA 1JFQH 5F96H 3SGKA 5AZ2H 1IAMA 4K8RH 5KW9L 1JPTL 5ECJE 4PJXA 4KHXH 5DO2D 1UH4A 4G6JH 1SYSA 2C1OB 3LB6D 3MRQB 3RVTC 2VJXA 4YFEA 4OLZH 2ATKB 3GNMH 4ZUVB 2GK0A 4PRAB 3VMOA 1LDSA 2KPNA 4TULH 3WD5H 3BN9D 2J8UA 2VRAA 3RIAK 1QG3A 1RUAH 1F11A 1F4XH 2YN5A 3BE1H 1LE5A 4H25A 1WWWX 4P2QB 5DURD 3WV0A 1HXYB 4JPKH 1RD6A 1UA6H 3EJJX 1PY9A 2ZPKH 4J4PA 3MLTB 2CKBA 4ZDHB 4X99B 3GSNB 3OJ2C 5DK2B 1XEDA 1J12A 1WIPA 3W81A 1GGBH 5DMIL 4FRWA 4QXTB 1IGCL 3QAZB 3B9KB 4WHCA 1YEIH 3TNMA 1QA9A 4M6MH 5E95B 1FFOA 4PJAA 3UTSA 4A6YB 4P0DA 1NGYA 1NSNH 4S0TD 1EX0A 4CBPA 2GFBA 4EZMA 4HS8L 1J7VR 5DJDB 3LOWA 5C9KA 4PRPD 3ZE2E 4PGEB 1G7MA 4ZS6C 4ODTH 1A6TB 5EOCL 3UPCA 3KNBA 5D8JH 4FQ2L 3DX7A 1WGOA 5DLMH 4YHLL 1IL1A 3HPLB 3MLZL 3QXTA 5BRZA 5DD6B 1EZVY 4YWGH 1OHQA 1OCWH 1HXMB 5IT2H 5AYUL 1QLRA 3FRPG 1N3NA 3ZT5A 2VTFA 4FQJL 2R0WH 5IVXB 5FIEA 3MXVL 3BMVA 3G5YB 1ZANH 1NAML 2XWTB 1HOCA 1BD2E 1KELH 2CK0L 2HVKB 3HRPA 2FEEI 5JHDB 5D72L 5IBUG 1KNOA 3KPRE 1OGAD 1CGSL 3BZ4A 1CE6A 3BIBX 3NFPB 2GITB 1IGML 5B39A 1KLFA 3GRWA 1QTYT 3MGTA 4G8GE 2HJKB 2WWMC 2VSCA 5IMOB 1VFMA 2ZCHH 4DZ8B 1NC4A 4NGHH 2F58L 3VG0L 1B0GB 1P53A 5F7DA 2IWGA 5ESVB 2VSDA 5HI3D 4H8WH 1A6UH 3JWDC 3PWJA 2ICES 2F54E 3DRQB 3WFDH 1ODAA 1A22B 1NBVH 3AXLB 4V1DD 4QOKA 4MNQD 3ZE2F 5JXEC 2A77L 1VADB 5BO1H 3ULUH 1LDPH 1AR2A 2IALB 3BAEH 5D1QA 1RULL 3D3VA 3KPMB 4NRYA 1F8TL 4OF6A 3DBXB 4G6KH 4OM1H 1HI6B 3QNXA 4L9LA 1ZMYA 1T6VN 4PJGE 1HHJB 3DMMA 5FYJL 3RUGE 4PP1D 1YMHB 1YEDA 2VLKD 3D39B 3E2HB 4MXWH 5A43C 4LQ1A 2V5RA 4O5LL 3MLRL 3PHSA 3V52H 5F9OH 2UVEA 4FQXB 1CDHA 4OCYL 4LPXA 2VLRB 3IDYC 4NJ9H 4Y2DC 3QCTL 4YHOH 2OTUA 4JN2A 4R26H 3T4YA 4D0DB 4PJ5A 4DVRH 5EZJA 2BC4A 3V6OA 4IHOA 3HPJA 5BQ7B 1VERA 2VH5L 1FGVH 5MP6L 3OKEB 5CZVH 3JWOC 4MNGA 2NY2D 4Y8DC 4WTZG 5E9DD 5D6DC 1XCQB 2CH8A 4XI5D 1A6VL 3BGMB 3T2NL 3UYOD 5D5MA 1JYXA 5DC4B 5I0DA 4X0KA 3U1SH 1QNZL 1FAIH 1MI5A 4OGAC 4YBLB 3KLHD 5IKCA 3OXRA 4Y4FC 1K9TA 3MODH 4QY8B 4LPWA 5E94B 4WO4D 5FB8A 3WN5A 5SWSB 4TUJB 5GGSY 1F00I 2N4IA 2O5XH 3QUZC 4X5XA 4D9RE 1ZLSH 5AG9A 1RY7B 2P5WD 4LQFH 4CADB 2MSPA 1ZSDA 2EICA 4LHUG 1L9NA 3DX8B 2XICA 2R2HB 3CFDB 4PJGF 3RUGF 4KRLB 1KN2H 5FOBA 4M5ZH 3STLB 5IFJA 5TF0A 4OLVL 1REIA 2VUOA 4CVXA 3TFKC 3S34H 5ADOH 3RIFK 2ZG1A 1CICC 4L8CB 1GGIL 1WZMA 5F7NC 4AEIL 4XPGH 5D6CA 1NLDL 3VWJA 1JJUA 1MWAB 2R56H 1P5UA 4L4TA 4UTAL 2YS4A 4OSUL 3MJ9A 1J1XL 3V6BR 4Y5VB 3IFOB 3GB7B 1JWMA 4PJDE 4YDVB 4XAKD 4PRHA 2BMKB 2I26N 3DVNB 2ERJC 4K9EL 3CVIL 1KXVC 3OBAA 4KTYA 1Q72L 4X8XA 5D7JB 5JQ6L 2HRLA 5JIIA 5D9SA 2A6IA 3NCJL 1I3RA 4JZJC 4S11A 1C7TA 2OM5A 3QIWC 4HUVA 3QQ3B 3GGWA 4F7MB 3VXRD 4LLYB 1NDGB 4QTHA 1QBML 3QNZA 4MB5A 1AY1L 3DV6A 5IHLB 4RQQA 3VFTA 5JW4N 4N0YL 4MA1C 3NFSH 3LQZA 4FHBD 4UIKH 4QRRA 5C2BH 3QA3B 3BW9B 5F6HI 1WISA 5HPMA 1PQZB 1W0WB 5INDB 2GEEA 3DTXA 3QQ9C 2HA1A 4QHMA 5E5UB 3LIZL 2DN7A 4MQXC 4U1MB 1CQYA 4GMTH 2FJGA 2MJWA 4HK0A 3RVUD 1WTGT 2VWEE 3MLWH 1S7XB 3EJZD 1T22B 1ACZA 4PJDF 1HHKB 2VIRB 35C8H 5FDWB 43CAB 5C0AE 4IRSD 3EOBA 3WFBH 5JPMB 4JM4L 2W59A 5FYJD 4HIEB 2VISA 4WW1A 3QDJB 4WW2F 5D71L 3ARBD 5E00B 2PYED 3QEQE 5INCB 1INQA 1F58L 2FJHB 1A1OA 1S7QB 1XF5A 3EYSH 4K94L 3TVMB 1BGXH 3UTQA 5I16A 2IFFL 3RVVD 1MCWW 15C8L 1URLA 1ORQB 5HGAB 1BFOB 2PYFA 5GSVB 2ADGB 3KDMA 1J11A 3VRLF 4ZODA 1MH5A 1LE9A 2FO1A 2P5ED 5JR1H 4APQB 1T7YA 3AMLA 3GHBH 5IOPB 3MV01 4LASH 4M7JH 3PQYD 3R06A 5I18L 1FN4B 1DBAL 4FQIH 4ZD3H 5ID1A 3CH1A 5CBAB 1NH6A 5L0QB 4Z7QE 3WE6A 4FABH 3DV4B 4WWKA 1GHFH 3TPUB 4GW5A 3O41A 1OP5H 2AQ3A 5MI0C 4P5TB 3VFVA 4KUZL 4U6YA 1TZHB 1AO7B 5FUCC 5I30H 5C8JA 3RWFB 4G7YH 2YD7A 3RAJH 4FTVA 5JLZA 4IDLA 3ZSTA 3WDIA 4XCFH 2X4TA 5JTWA 1OSPL 3LN4B 3GJFA 4N9OB 4I77L 1R5WB 5GSRA 1BAFH 4PB0H 4U1KA 2E7MA 2EYTB 1BZ9A 4MA7L 4K71C 4LVNC 3LV3B 4RMRA 1OD7A 2BJML 3QEGH 3QUMA 3ARZA 4ELME 2FIRT 2PTUA 2P45B 1UWEL 4MJ4A 3F6IA 3Q1SH 5FGCB 1MJ7L 4OIAA 1I3GH 4LSSH 3BPLB 1AGDA 2EDKA 1GL4B 1T1WA 4GQ9H 4WCYL 4Y16D 2FLRT 4AM0A 3P3YA 4P2QE 5F9AC 5GGRB 2Y9RT 2DKSA 1I1FB 1K4DA 3LRSB 2C26A 1MLBA 4MMXC 5I15L 2BHYA 2EXWC 3QZWA 2NNAB 3KVQA 1KTKE 2BNQD 3J8F7 2VZ1A 2IPKB 3SDAA 1D5IL 1GIGH 2D7OA 1CGTA 1MRFL 3FB8B 2EKJA 4Y1AB 3EZJB 4FXGB 1S9XA 2IANB 3ZTNH 1R0AH 2D7TL 3S3PA 5M95B 5GRJL 2VZUA 3M8OH 3OXSA 2F5BH 2HT2C 4XAWL 1L7IH 1H9VA 2O5YL 4AIZB 1Q9OB 4JANA 4IJ3B 5DD1L 4LBEB 4C4KO 1P4BL 1INDL 5L9DL 2B0SH 4R90L 5ETUB 5D7LB 1DSFL 1YJDL 5GHWL 2IPTL 3SJVE 4WV1B 4XBGA 3WO4B 2W65B 2Z8WC 4NDMB 4ZO8A 1WBZB 2M2DA 4ELMF 4Z7OE 4TSAL 4U6TA 4F8TA 3MOBH 4ZMAT 4LPUA 4O51A 4S10A 5E5MA 2DQJH 4PFEA 4H1LH 4GO6B 4XPAH 4OZHA 4QRPE 3RJQB 4N8CH 3MQIA 5EZLB 4F15B 4X7SL 4M1CC 1G0DA 2FDBP 1C5CH 4PG9A 1MJJA 5CFHA 4HMDA 2OSLA 1A4KB 2GJ6B 4G42B 1F6AA 4XBEH 4X4XB 4G8IA 4RNRB 1U8NB 5FFLA 4M5YH 1IRAY 4S1DD 3W9EB 2VLME 2NQCA 3AS2A 4YX2H 3QHZH 1UEYA 3V4UH 4NQCB 3NAAL 1CLZL 3W0WE 5BS0E 1XGPB 2ESVE 4DW2H 1WEJH 2YD9A 3FB6B 2Q87A 3O4LD 4U3XA 1IGIL 4CVWA 2EEDA 3SE8L 4U3HA 2WWKO 5IMKA 2GUOA 4N8VA 1DDHB 4LSTH 1TTGA 3I84A 1IEAB 3V5KB 5AZEH 4JZOA 4MXVE 3CLFL 1H5BC 2Q7YA 2YRZA 2VDRL 1LVEA 3HRZB 4L3AA 1VFOA 4LVHB 4GRLA 2YC1A 2DQFB 1EJOL 1WC7B 2AERT 1W72L 2VLRE 3EFDH 3K7UA 1R24A 4QRTA 4BH8B 1U3JA 4LLVA 4MMZC 2C5DC 1W2KT 3G6JA 3CU7A 4FXKB 5GGVY 4ODUA 1AJ7L 4UUJA 5E8PB 2QL1A 4NBZB 4PGCA 3C60C 3HNSH 4UT7L 5ELIA 3MYJB 4XI5C 2V17L 4K3EH 3SPVA 1YEEL 2F53B 3IVKA 1D5MB 3QUYD 3SCMA 3QJFB 3KLHC 1P9MA 3BZDA 3SBWC 4P2OA 3VXSE 5FA3A 1UB5A 5DQDL 4WV1C 3HZYB 5I1IH 5T5FH 3BEWB 3O8XA 3OWEA 1TZIA 4NQEE 3LEXA 1EUTA 3LH2L 1P5VA 5GZND 4X9GA 1Q9WA 2YXFA 1TENA 4NCC2 4PD4J 5EU7C 4PJHA 4NN7B 4MXVF 2BCKA 2Z0BA 4KVNL 4MX7B 3RVWD 2GSIB 2FJFA 5TQ0H 1U8JA 1NMCB 4S1SH 4W4OC 4HKJB 2VMFA 4NRZA 4KPHL 1HH9A 3T04D 3O3BA 4KROC 5E8NA 1UKTA 5TDOA 3VXUB 4LDEB 3QWOB 2C4FT 3FL7A 5H2BA 2I9TA 3UJIH 3ARSA 4XXCC 4WI6A 4ZYKB 2BSED 2QQQA 3A6OA 1OLZA 1U8OB 2YA0A 5JDJA 4YAQB 2OR7A 4NO0B 5D70H 4TUOA 3IJYB 2AABL 4FQLL 5D93C 3ROOB 3OAZK 4PGZA 5IP4A 2HYMA 2AQ2A 5CJXA 2GI7A 5DDHB 3C5ZB 5TE4L 2AS5M 3PIQB 4ETYA 3O6FD 1QEWA 1CVSC 2DMBA 3B9DA 3FN9A 1I1AA 5IMMB 3ZKMC 2A83B 1CI5A 4KK5D 4N0FA 2WUBL 4JB9L 2R0ZH 5BZDA 1X7QB 3H9ZA 3GSNL 3BI9X 5GS0H 2ZNWA 2APFA 5C9JB 3RBSA 3RVXD 2WV3A 4H0IA 2CLZB 3OGCB 3JWOL 1DUZB 2IH3A 4LSUL 2X5PA 5C0DB 1HN1A 3D0VB 1BVKB 3GBML 3GMNA 3RFZC 3CMOL 1H8SA 5LCVH 12E8L 5B8CB 1NC2A 5E8DH 4TOYL 5KSUA 2QHRH 1TMCB 1KLUB 3B9AA 4OB5L 4X6CB 1FBIH 4WY7L 1FFNB 5DJCA 3JUYA 1EAPA 5I66B 4DKEL 1UYWL 3SOBL 1JN6A 4U6HB 2OJEA 3CLEL 3DROB 3CK0L 2DLIA 4B7LA 1CS6A 3QHTC 4OZGB 2WANA 5DVOA 5KSBA 1WWCA 4P4KD 3VCLB 4G8FB 4J6RL 4NUJB 1QSFE 2H3NB 3FB5A 3GSVB 1EEZB 8FABB 2NZIA 1GOGA 4Z0XA 4MXQC 3HE7B 5CGMA 3EOTH 1T20B 1G0XA 1KLGA 1BVLA 3K1DA 5H94B 1W8OA 1K85A 4ZAKD 3MRGB 1KF9B 2QR0A 4P46C 1YQVH 2Q1EA 2K7PA 3RPIB 3DECA 1FO0A 1RUPL 2ITDA 3QDJE 1IEHA 3P4MA 3BYYA 5EPMB 3BGAA 1XGRA 3MNWB 1JGDA 3ZKND 1U41A 3MRFB 5F9WB 4Q9QH 3VWKC 1X5FA 3QEQD 3MV8D 3RZCA 4O58H 1D5XA 3RHWK 6FABH 1KPUA 4XXDB 2W0LA 1A1MB 1V7NL 4I3GA 4KTEH 1E4WL 2J4WH 3IDUA 4U6VL 4GKSB 5IW3A 3UJTH 4DKAA 3HA0A 2Z91B 4UTBH 5CGTA 3UX9B 4WUUA 3V9FA 3KJ4B 5IV2A 3TYFA 1YEKL 1RJLA 5DMGD 5FUZL 3DGCR 5AUMB 4UQ2B 3UPAA 1MFDH 3QIBD 5HVHC 1UQSA 2EYRB 1N26A 5D7IE 1MHHB 3FQNB 4JFZH 3SO5A 2DQCL 1DN0B 4UNTA 1A4JB 1BIIB 1IKFL 4RMWA 2X4QA 5GISL 4NHCL 1CDIA 3TO2A 3HG1E 4XVTL 3U4AA 4NN5C 4M48H 2G9HA 2PTTA 3D69A 4Z7VA 2QADD 4ZTPH 4O9HH 2R69H 1H15B 5KS9F 1MCHA 3K8MA 4WFFE 1M6OA 3P4OA 1T6WA 3GHEL 1D5BA 4W4NA 4KZEL 3MBXL 3U9UA 1OAZH 3H9HA 4FQQA 5IJKA 1F13A 2H41A 4XHJC 5HI5D 1JTOA 5I8OH 3OJDB 1MEXL 3UTZB 1HNGA 3ABZA 4DFHA 1U92B 2A0LC 1TJHL 4LNRB 5MHSE 3MPCA 3G6DL 3OJVC 4HKXA 5EIIB 1IGFL 1BX2B 4HUWB 3T0EA 3U79A 1Q9KA 1J0JA 3CCHA 4F37K 1Y18B 1VEOA 5GRXG 5GXBB 1MREL 2KBGA 5D7IF 2ZOKA 5IK3B 2I07A 1U3HA 5ENWA 4O4YL 1EBPA 4HWEL 1A47A 4Y1AE 2BVOB 1KXQE 2C7UB 3AB0B 2DQGH 3KWWB 4YK4C 3A6CL 5EO1A 1Q0XH 1FFRA 4A2MA 1JFQL 1S8DA 1T1YA 3TT3H 3BGFB 4M6OL 4G6JL 4P3DB 3I9GH 4XNQB 2DIAA 4PUBL 4X7EC 4OLZL 2E9WA 1G0YR 5D2NB 1RHFA 3OJMB 3GNML 4I18C 5EUOA 2DM4A 1P7QB 5DHYA 3WD5L 3BKCL 5LAXB 2D2OA 3IJHA 4YHKH 4JFHD 1HQRA 2DLGA 4LCWA 5GZOD 3QUXD 4JPKL 1NFDF 1WAAE 1H3XA 1QYGH 1ZHLA 3RY6C 3PWUB 3MFFA 4Z0BH 1JI1A 5J13B 3FRPA 4CAGA 2NYYC 5EU7E 4B0MM 3E8UL 1GGBL 3C6LA 3Q2CA 3V6ZA 1WF5A 4HMEA 2X05A 1YEIL 1T03L 4FN0A 4M6ML 5JHDD 4P23C 4GXUM 4LU5H 2BVYA 4NYLB 1QBLH 2GJ6E 2UZYB 2JF1A 1AI1L 1NSNL 1IQDA 2RHEA 3V7AE 4DUXA 3FT2B 3H9SA 4OFIA 2DB8A 1RZJH 5F71A 2YEZB 4XCYB 3QPXH 3F12A 2EE6A 4JFEE 1A2YA 1OPGH 1BJ1H 2BRRL 3SKNB 4PRIB 4OFYD 4GUPA 5EU3A 5HPOA 1QR1B 5DLML 5IQ7L 1YDPA 2MHAA 2R39A 1CK0L 4NPYA 4HQQH 2I60H 5ESAA 2PXYB 1YN6B 1OCWL 4OM0H 5IT2L 3BZFB 3RWIA 4U1HA 1FFPA 2HVJA 2R0WL 3HLAB 3X11B 1IFHH 3C5SA 5DQJB 5SWZE 2X9WA 2ADJB 4OCWH 1ZANL 4IS6B 3MA7A 4NM4H 2NX5B 3P0VH 1WZLA 2XN9A 1LK2B 3ZTJH 5EBMA 1IGYA 3D39D 3ARYA 4IIQA 2HFTA 4JFOB 4MLSA 3S9DB 5IF0B 1SMOA 4FQXD 3K2UH 1M7DA 4X5WB 5FM8A 5T1MB 2B7DT 4IRJD 4S1QL 5IM7A 5C0FB 5MENA 4QHKJ 1MNUH 1RU9H 1HH6B 4ZS7H 2EEBA 2R4SL 4JY4B 2OS7A 1UC6A 2H26B 4WTZA 1TTUA 3H0TB 4U1SA 4YXKH 2X10A 1TDQA 3KXFE 5M94B 3WFDL 3N50A 5D1XB 2GTZA 3F5WB 2NW3A 4NC1C 1AKJA 1JE6A 1G9MH 4WDIA 1EEYA 4FQ1L 1LDPL 3BAEL 3FO9B 1XGQB 3CSYB 4D0CB 4OM1L 1R3IH 4MWFA 1KIPA 2EIZB 4NC0B 4IOSD 3HMWL 1A7OH 3T4AA 5SWSD 3LRGA 1NUNB 4ZUSB 3V52L 3ULVH 1G1YA 3L7EA 4NJ9L 4YHOL 2GAZB 1UCTA 4DVRL 1ZVSB 4P3CL 4ZPVB 1MCCA 3UEZA 3DIFA 4ERSL 5IGXH 3MUZ1 1FGVL 3VH8G 3TLRA 4LDLB 2XQBH 3R1GL 1C08A 2I25N 4OFVA 1LK3H 1OQXA 5BJTA 5DVKA 5DYOA 3FFCA 5I1CH 3QFJE 5IBTH 3U1SL 1G7IA 3REVB 4BSVA 5K9QG 2DLTA 1NCBH 4EEEA 4ODXA 2R1YA 4E0RB 3V0WH 3K46A 3QHFL 3MODL 5A2LH 4LRIC 1UH3A 5DJ8A 2WQ8A 3TNNA 1AGEB 1BOGB 4K8RD 2V7HA 3P9WB 4W81A 5KSAA 1H3UA 4KJYA 3JXAA 4OUOA 4HUXA 1CT8A 2O5XL 3QQ4A 4YFLI 1L6ZA 1TJIL 4OTXH 5I75B 4Z77B 4M1DH 1I7ZA 2NY4B 3VE0B 1CD0A 3W11D 4F7TA 1KN2L 2ZZUT 3FHQA 3MRLA 1AGBA 1HINL 3ARDB 4YDJA 4B53A 3EGSA 3PWLA 3SDCB 1A14H 3LKNA 1ZEAH 4OD2B 4J8RB 3RI5K 5ADOL 2A9NH 4PR5B 1CBVH 4ENED 1UKSA 3IXAA 4GH7B 3JUZA 4G8GA 1VPOH 4YNYA 1QBAA 4WENB 1OW0A 5E4IA 3TCLB 3NZ8A 2R1WA 1UJ3B 5E2JA 1PZ5A 2IGFH 3C9NA 1KCLA 3OB0K 1G7LB 4OCMC 2NLJB 3QUKB 1Z6JT 2DAVA 4JFFB 4JKLA 4JM2C 4QXUH 3CDFA 2F54A 1ZHKA 5AAWA 1VFAB 1RFDL 2X1QA 5HGBA 2KQNA 3HS0A 3BX7C 1EHNA 2NPLX 3MV11 5J12B 3LQMA 1CLYH 4P4KC 1LEGB 4PJBE 4LEOA 1UCBH 3DX9A 4QRQB 4PJGA 1S5HA 2AJSH 3RUGA 1J1PH 3HZMA 3HI5H 4K07A 1C16A 1MQ8A 1V3MA 2J8OA 4R4BB 1ZGLA 1CN4A 2OCFD 3CX5J 1IE5A 5HDBE 3MRNB 3Q48A 4ZAKC 4ZFFA 5CGYD 3HI6H 5A3IC 2H8PA 5KVDL 3SDXB 3OG4B 2ARWA 1MUJA 3VFMB 1I85C 3QBTB 3WIIH 2R0KL 2X4RB 3RGVC 3IDNB 2RR3A 2K1MA 5KJRH 4X6DB 1DEDA 4MD4B 1UVQA 3TVMD 3HB3D 1I1YA 3BDYH 4BA8A 4ZFGH 4XPTH 2HRPL 4TNWK 3S4SG 3O6KH 3TJHC 2GY5A 3VGAB 5IB5A 4XX1E 3FRUB 4WHTB 3EZ8A 3RDTC 3I6LD 3FOMA 3VRIA 1QLFB 2R23B 2AV1B 3KHQA 4ODHH 4CJ1A 4ZFOA 1VDGA 4YDLC 3ULUD 5C7XH 5IB1B 1PKQE 4CDGC 4PLJC 5DMGC 4M4RA 1V5JA 2EC9U 2ZKHL 5HHOB 3PGCA 2HAZA 3FN0H 4PRNB 5GGTA 2HJFB 4I2XA 3O4OC 4PJBF 4JVUA 4QXGL 5I73B 2NY4C 2EH7H 4P5TD 5FO7B 5F7EH 1AO7D 3PABA 5C3TA 3LMJH 3VGDA 2AXJA 4OJFL 2OMNA 1TJGH 1VGKB 2NY1D 5DSCA 3S96B 4CKVX 3DUHA 1RZKC 3GMMA 3HFMH 4M61A 1ED3B 2OK0L 2BNUA 4XNUH 1BGXL 1SYVA 2CR6A 3BXNB 3DETD 2CKBH 2GHWB 5F1OB 4K3JH 5JR1L 1MQKH 1TQBB 5HYJD 4MAUL 3GHBL 1AD0A 1TQCC 2XZCH 4M7JL 3MUJA 2B1HH 3ET9F 2DM7A 5GS1A 4G8EB 4OV5A 4L1DA 1QFOA 2IADB 4PJDA 4ZD3L 3ARGC 3TH3T 4C4KT 3AGVA 3HC0A 3FQWA 1QSEB 4HH8A 5DEZA 3L3DB 1GHFL 4RAUA 1ZT4B 3C87A 3FOLB 1PVHA 2DQHH 1XF2A 4N0CD 3NN8A 2HH0L 4EI5C 5CIPA 3IDXH 1JWUA 3MCLL 1S9YB 4K55A 4O2CA 4WW2A 2J6EA 4HKBA 4G7YL 5JNYA 2BVTA 1IT9H 2CSPA 1VKXB 2AJXH 4KAQH 3QB7C 3VW3L 2IBBA 1AGFA 4XCFL 4PJFB 3G5XB 5CP3A 3LD8B 1FPTH 4HF5L 1OGTA 1BAFL 4RMUA 5JPNA 2F74A 1JRHI 4PB0L 4DGVH 4Y1AD 2IAND 4D94A 1UZ8B 5DFVD 4MQ7A 3QEGL 5CP7A 1NBZB 1PFCA 3MZTA 5IMLB 4S1RH 1LO2L 3SDDB 2VAAA 3LS5H 2JKXA 2HP4A 4OIIL 4XTRC 3LKQA 3PDGA 5D2NE 2PR4H 1QVOA 2RB8A 3BPCB 3PDDA 5B38B 5BVPH 5D7LD 4Y19E 1EGJL 3C6SA 3S5LG 1IJ9A 3GRWH 4R3SA 3RTQB 5BMFH 3U9PH 5C08B 1NKRA 4LP5A 4GRWF 4H0GA 4HH9B 4MB4A 3QUXC 3MZGB 4MD5A 3MNZB 2WWKT 4H0HB 5ITFA 3S36X 1JPFA 3E1F1 1PX3A 1B0WA 5E8OB 4E42A 3ZTNL 4G9FE 1R0AL 1XIWA 4XP6H 3WCYA 4HKZA 4LCYA 4PS4H 4DCQB 5DS8B 1RZGA 4LSVH 2J88H 1JPGA 5E2TH 1OSZB 4LSRH 3RIFF 2B0SL 4PRIE 4NQCD 2HLFD 1F4HA 3MUGA 4ZUTA 5L8LB 4F33A 1TVBB 1VB9A 3RWEB 1JZ5A 1L7TL 3BUTA 9CGTA 3HCVA 4DGYH 2Y5TB 4IOIA 3VU2A 3ZE0E 5F93C 3EO0B 2YUWA 5A2KH 5DGRA 1RUML 2DQJL 4QT5B 5E6IA 2L4OA 1U8IA 4JHZA 4KI5E 1DQQB 4PGDB 3QWRA 4N8CL 2NX5E 4CNIB 1IVLA 4X6EA 3HC3H 2XA8H 4HS6A 4XP1H 1R5VB 4X7TB 3CUPB 1S7UA 4LLWB 2AVGA 4XBEL 1TCRB 1HILA 1M05A 1S7VB 2H1PH 3GSQB 1GC1H 3QI9D 4NNYB 2D0GA 1HE7A 3UMTA 4MDIA 4YX2L 4IRJC 2CRZA 2GT9B 5I8CA 3OKNA 4J3SA 2QLVB 2JIXB 1C5DA 1IGJA 4C83B 2R2EB 3GM0A 1EAJA 2H2PD 3I02A 4PGBB 3IT8D 4MCZB 2F53D 1J87A 3CFIC 3QIUC 4LSTL 1HKLH 2I5YH 1KPRA 1NCCL 2CDGB 5I71C 2R4RH 1MIMH 1T2XA 5I1EH 3ZE0F 4I8DA 4Y4HC 3MJ9H 5L88L 4WI8A 3EFDL 4EKXA 2XKUA 2FWOB 4Y2DA 1SYSB 2OR8A 4JDZA 1FZKA 2HFFB 3BWAA 2ICWA 4X5LA 3OKOA 1E27A 2GK0B 4K3DH 3AY4C 1OB1A 4NKIH 1MHPH 4F57H 4L8BA 3VFSA 4JREC 3VXUD 5D6DA 1LE5B 3O9WC 4H25B 4HSQA 3HNSL 4K3EL 1BJ8A 4HFWA 3GBNH 2DTMH 2CKBB 2XZAH 4QWWD 4DAGH 4RRPA 1GOHA 1E4XI 4Y4FA 5HJ3A 3C5ZD 3ULSA 1QA9B 3SJVA 3MLUL 1FFOB 4PJAB 1UKQA 5T5FL 3RA7H 2BDNH 3UTSB 4JM2F 2AK1H 4K8RC 3ZYZA 3ETBF 1NGYB 3F7PC 3HR5A 3QUZA 2GFBB 5T3ZH 2NY0C 2VDOH 4J3VA 5F9JA 2JB6B 1IGTA 5F1NA 4GBXC 1G7MB 1G7QB 4EIGB 5JO5A 2EDOA 1TNNA 2Q76A 2VDML 3C08H 3TA3B 4LSPH 1IL1B 1FRGL 1MIEH 5BRZB 4JRYE 2W91A 4YC2B 3S37X 3I3BA 4YZFE 5I1AA 2I27N 3KYKL 3IJSA 1JV5A 5D70L 1QLRB 2EE9A 1DVFC 3V5HA 1AE6H 3D87B 3BT2L 4K7PL 4AH2A 1DANU 3BSZL 1HOCB 1G84A 3N85H 3W0WA 2B2XH 5BS0A 1S7WB 2ESVA 1PBYA 1KNOB 2DYPA 1Z9OA 4OF3A 4YEEA 3BZ4B 4P9HH 4ZQKA 1CE6B 4XWOC 1RIUH 4S2SA 5B39B 1UACH 2IC2A 4UIMA 5GS0L 5KAQG 4L8DA 2EE3A 1KB5L 1NC4B 5C92A 3VI4E 2LV4A 4BQCA 3UP1A 2B1AH 3EIFA 5EBLA 4JZJA 5F7DB 1E4KC 3HE7D 4MDJA 3WEXA 3QIWA 4POZD 4KZDH 3K1KC 4BFBD 4IRZH 3UCRA 1A64A 3PWJB 5J56B 3CFCL 2BVQA 5LCVL 5J1AA 2XYCA 3PP4H 4YHYB 5E8DL 3TIEB 5J06A 4QOKB 2DQEH 4G3YL 2W0FA 2FATH 3SDXE 4RFNC 5D1QB 2QHRL 3LRHA 3D3VB 4RGOL 4ZXBC 3BRGC 4NRYB 4WFHD 5CGYC 3QNXB 2HT3D 2DICA 4JFXA 4L9LB 4Q6IC 1FBIL 2J2ZA 1TIUA 5EOQL 1VHPA 3NZHH 4ISVA 1YEDB 5BV7H 4EOWH 3JV5A 4YZFF 5IW6A 3FO0L 3F7VA 2DBLL 1QPXA 4DZBA 2QSTA 2RBLA 2ED7A 2OTUB 4JN2B 4PJ5B 2BC4B 4IHOB 3T8XA 4HLZH 1KCVL 3VXSA 3VXME 3T0WA 5KVMC 2DQDL 1T2QL 4EJ1C 4MNGB 1HIMH 1V8HA 3IAGC 3EOTL 2IPUG 3RL1A 3L5XH 2EYSA 5D5MB 1N0LA 1P4LA 5EIQA 4X0KB 1DL7H 3L3KA 1MI5B 4BQ9A 5DHVH 1J8HE 3VI4F 5IKCB 3VFRA 1UGNA 2ZUQC 3X13B 4OT1L 3MV9A 1DLHA 4HIHA 5IG7A 5JORA 4Q9QL 5J11B 3MUHL 2A1WL 3RU8L 3NTCH 1SM3H 1EIBA 3M1BB 5EU6A 5FB8B 3WN5B 3B8SA 1UXWA 6FABL 1BHGA 2AJUH 2NY1C 5D2LE 3P9LA 5DRWB 3VXPA 5C86A 4X5XB 3KYNB 2ZUVA 4XGZA 2RGSA 3WXVL 1RIHH 4KKAD 4XPHH 3ZL4H 2J4WL 5EB9A 3MACH 5CHNB 5FUOH 4EUPG 1MFNA 4RCAA 4DKDC 5HDQH 3FQUA 5JHLL 2NR6D 5FOBB 3WDHA 3OF6A 5IFJB 2R0LH 2FD6H 4LOUC 4P5KA 1DEEB 1MFDL 1J0ZA 4HWZA 4CL7A 1QSEE 3L5WA 5JOFB 2WBWB 4UAOB 2VLJA 1NQBA 3HMXA 4HJGA 3VWJB 5C0BD 4L4TB 2DQIH 3WS3A 3EYQC 5CUSH 5E08H 3ISWA 3QFDA 2MQ3A 1JWMB 5DUMH 4PJFE 2UYLA 2MKLC 4PRHB 2EZ0C 4BQ6A 1FZMA 3QDGA 1NJ9A 2IBZX 3PWPD 3C2AL 2AEQL 3QDMD 2A6IB 3JV0A 2HN7B 5TF1H 1I3RB 2HMID 3DMMC 2N1KA 5L2KA 2KKQA 5ILTH 4NQDD 5D2LF 4HUVB 1IAOA 3QEUA 1OAZL 3GGWB 1LGVA 1H3TA 3CDCA 4QTHB 3B2UD 3G04A 4N9GA 1P7QD 5I8OL 4M8QB 3DV6B 2APVA 4RQQB 1G9NC 3VFTB 1QSFA 4G6AD 5FV1L 3IFLL 2UUDH 3N9GH 4CMMA 1I1CA 1NCWL 1B0RA 3LQZB 4L3EA 1ZLWH 3OAUH 5GS0D 5HPMB 1KENL 2YBRA 3DTXB 4L4VD 3CPLA 3I50H 5DJAA 5JIKA 2J3SA 1FNSH 3QRGL 5J6HA 1Q0XL 2FJGB 2ICWI 3FB7A 1QQDA 4HK0B 4WIQA 4FFYH 3TT3L 4I9WD 3X3GL 5KS9A 1YECH 3CZJA 5E6ZA 3MBED 2YD1A 1Q0YH 5A40E 2NXZD 2XY1A 3BQUD 5B4MC 1Z3GH 3EOBB 1YYLL 4PRPA 3ZDYE 5J6GA 4YHKL 2HLFC 2AEPL 2VISB 1QKZH 5JUEL 4WEBH 1VGEL 2YK1L 2OYPA 4KV5F 2RIKA 1U6AH 2PXYD 3B5GA 5CMAA 1ADQA 1INQB 3PWVA 4YXLH 2NW2A 2B39A 4YHIA 1G6RA 1A1OB 1XF5B 3EJYD 4YLQT 1E6OL 2CR3A 5IEKB 1SJHA 5HI4D 2HTKD 4X4YA 3UTQB 5J8OA 3DVIA 2BNRE 2NX5D 1AC0A 5D7IA 2PYFB 1WFOA 3NA4A 3KDMB 4D3CL 5T3XH 1F97A 1MH5B 1LE9B 2X4SA 1QBLL 3QCUL 5JIHA 3TH2T 1OGAA 2VC2L 1DQJB 3R06B 3GIZL 2ENYA 3HG1A 3BP7A 3SKJL 3ZKSD 4AL8L 3QPXL 4WNQA 1ZA6A 4TTGA 1F2XK 4NZRL 4QNPE 5ID1B 4MSWB 4M62L 3CH1B 1KV3A 3UC0H 1AFVH 4PY8I 3WE6B 4NJAH 3P4NA 4WWKB 5EG6C 2P42B 4HULB 3L3HA 4GW5B 4QGTA 5BV7B 3GJEB 1AQKL 2FH8A 3VFVB 3PL6C 4HQQL 4U6YB 3CNKA 3B6SA 2VDKH 4OM0L 4UV7H 4XHQA 1T66C 1NFDA 4FTVB 2H2PC 5HYSG 5JLZB 5IHUH 3LN5A 5C0ND 4D9LH 1IFHL 3ZDYF 2X4TB 4MNQA 1X4XA 2CLVA 3GJFB 3I6KA 3RWDA 4NM4L 5KZCB 4KKLC 5GSRB 4Z7WB 3KPLA 1DBBH 1H5BA 3JV6A 3O2DA 4U1KB 1YMME 1BZ9B 5EO9B 4XNZB 2CJUL 4R96A 2BHZA 3U46A 4I5BA 1CG9A 4H5SA 1FDLH 3K2UL 4WEUD 4PJXE 3SGDH 4HDIA 3OR6A 1JF1A 1PSKH 4MHHI 3SKOB 1RU9L 1PAMA 3VH8A 2J8UE 1AGDB 3NA9H 1T1WB 3QJHA 2DBJA 3G5ZA 5HDOA 4NUGH 1T7WA 1ZXQA 4UBDD 4YXKL 4AM0B 2V2TB 2BY2A 3B3IB 5J89A 2DLFH 1MRDH 3C60A 1I4FA 1MLBB 1OY3B 4KK6C 1VESA 3QZWB 5AG8A 3W5MA 1D5ZA 3RWHB 3WNMA 1JUFA 3A67H 1HHGB 5IB4A 4K7FA 1FG2A 3RHWF 1R3IL 3NH7H 3SDAB 1A02N 4PJCF 2AEIT 2YUXA 5TH2A 1K8IA 3UTSE 1A7OL 5FK9A 1PLGH 3ARXA 3B2VH 3GSWA 3OSKA 3H3PL 1J5OH 2OTWA 3B8YA 5DJZA 4Z5RA 1FIGH 2E27L 2CMRH 3RZWA 1UWGH 4PJIB 1Z9LA 1A7NH 4JANB 4JKKA 2YPKB 3DSFH 4Q97A 2XQBL 5DC0A 3QEHA 3ARDD 2CIKA 3L5HA 4Q2ZA 4XVUD 4XBGB 5FYLH 4Z8FH 1LK3L 5BRZE 4PJXF 1IC4H 4HUMB 3GSXA 1NCTA 5I1CL 4NC2B 5IBTL 1FL3A 1YC8A 2XV6B 3RWGA 5ESQA 4O51B 5E5MB 5IHBA 2J8UF 3BP5A 1H8NA 1BBJA 3PGFH 3V0WL 4OZHB 5DJYB 2X4NA 1T21A 3WFEL 4QF1A 5B3NA 4KTDH 1JYNA 1KC5H 3CSBA 1TPXB 1KJVA 4PG9B 3L3JA 4AEHL 4JY5H 1MJJB 5EC1A 3S35L 1NCDH 4JFFD 5FM5M 2OSLB 1F6AB 4PRDA 4G8IB 1OL0A 2XWBA 2D7NA 2X9YA 2DRUA 4CU7A 3V8OA 5SWZA 4OF8A 5E2UH 4HJ0D 3QH3B 1B3JA 2PO6B 3GDBA 3L6FA 1ZVHA 2VR4A 3WHE0 1AP2B 3D6GA 4PP2A 3BMWA 4XNMA 3IDJA 1ZEAL 1LO4L 3D18A 1XZ0A 4Q0XL 3ULUF 1H0DA 1JPTH 1MVUA 1CBVL 4JO2H 4QOKE 5F7MC 5IMKB 4F37F 4ETQA 5ALCL 3D3VE 4Y7MA 4N8VB 1NLBL 1BVZA 4HUUA 3ZYJA 4MVBD 1MCNA 4RBPH 1ZAGA 4N0UE 3H2WA 3QPQD 5K33A 4GRLB 2YC1B 2Q7NA 2X2YA 4QXUL 4RGMC 8CGTA 4PV8A 3TC9A 4PTUA 4HJJH 1JGEA 4OLUL 1R24B 3S4SA 4QRTB 3ARFC 4PJ5E 3UO1L 4LLVB 4J12A 1IGCH 3ZKXC 3QO1A 3G6JB 4MNGE 1DZBA 3HI5L 4ODUB 4UUJB 2VXTH 3TO4B 1GOFA 2ZSWA 4NT6B 2DM2A 4PGCB 4YQXL 5HHOD 2AJYH 1MI5E 3RBGA 3B5TA 3SPVB 1BPVA 3ZHLA 1CDJA 4IRSA 3TZVD 3Q6GH 3BFOA 5B22A 4P2OB 5IUSA 5E2WL 5FA3B 5HGDA 1UB5B 4HFUH 5KOVC 1AR1D 5CINH 3VWKA 3ARBA 1EV2E 2Y6SD 3MLZH 2B4CC 4KUCF 3BEVB 1TZIB 5DEGA 3LEXB 2B5IB 3QFJA 4ZFGL 1Q9WB 1S7TB 5AYUH 3F58L 3O6KL 4PJHB 3CAFA 2BCKB 4KKAC 2DD8H 3MGOA 2FJFB 1U8JB 1SEBA 2CK0H 1NPUA 1TPXC 2A6JA 4QO1A 4NRZB 5D72H 4D8PA 1HH9B 2DLEA 3O3BB 4ODHL 4MZ3A 5E8NB 5TDOB 1CGSH 1I75A 4DOHB 3PQYA 5H2BB 2I9TB 5HYQA 3QXDA 5I9QC 5EULV 3BH9A 3SGDI 1FVCA 1BIHA 1YPZA 1BF2A 2Y4SA 4L4TE 1LHZA 5K9OA 2EDTA 1NMBL 1L9MA 3ULVD 1ZS8A 3LMJL 1SJEA 2MPAL 2APTA 1TJGL 3EDKA 4NSKA 3HFML 1DQDH 1I1AB 5I2IA 4XNUL 3VA2C 5T1KA 4LAJH 4OUUA 4N0FB 1A21A 4UB0H 2A77H 5BZDB 2CKBL 1RULH 2Z92A 2VXQL 4K3JL 1F8TH 5K9KA 1MQKL 3INUL 3D2UD 2P8LB 2XZCL 5C0IA 1KT2A 2QJDA 4NP4L 1UADC 5ITBH 4XCCL 4OFDA 5DK3A 2IH3B 1OTSD 3DSNA 3E6HA 4RWHA 3MRKA 4LKCA 4PRBA 2Z4QA 4CN1A 3UAJD 5GS2H 3QCTH 5F3HA 2AI0L 1NC2B 3S5LA 2DQHL 3RTQD 3VXOB 5C08D 4ONFL 3VFNA 4PJBA 4M3KB 1FNLA 4CGTA 4GS7B 2A6KA 4QRRE 1CZ8H 1IT9L 3WUZA 2AJXL 3QG7L 5DJCB 1XFPA 3IDMA 1A6VH 1EAPB 3FMGL 1JGLL 3FQXA 1JN6B 5L6YH 2OJEB 2LVCA 1QNZH 4NZTH 2BNQA 3RNKA 4NWTL 5CZKA 3SCMC 5KSBB 4P2RD 1P9MC 1KJMA 3UBXA 5HHQA 3FB5B 4DN3L 1DJSA 4YIQB 4HEPG 4BM7A 5CD3A 1KTDA 2DJSA 2Z31C 4YPJA 4S1RL 4Z0XB 3LS5L 3O8XC 3WS6C 4ZUUA 4GG6B 1KLGB 3WHXA 5CEYA 1U8PA 2ZWLT 2QR0B 4I18A 2ORBH 1SQ2N 2NXZC 1FO0B 3GRWL 2ITDB 5BMFL 5K9QI 3P4MB 4H20H 4BK4A 4J3UA 4XWGH 4B50A 3TBSA 3K81A 1ACYH 2D9QB 4OLVH 3RY6A 5TDPA 3RZCB 3TIDB 5I1HH 1D5XB 2VN7A 1I9JH 1PKQA 1KPUB 1MCJA 4R2GB 2AJ3A 2ADIB 3GMPA 1KB9J 3VGFA 4P23A 1NLDH 5D96B 5DJ6A 4XP6L 4OSUH 5GRUL 5I8KL 5F89A 1FE8L 4WUUB 4MJ6A 5IV2B 3TYFB 4FXLA 4N5UA 1O5DT 1RJLB 1LMKA 1QOKA 3UTPE 1I3VA 3RI5F 2Q8AL 1ONQB 2EDEA 1Q72H 5CEXA 4DWHA 1U8LA 4E41D 3AS1A 4DGYL 1QD0A 4RMQA 1GZQA 2DI9A 2JIXD 4WI4A 4PJEA 3QNYA 2X4QB 4FTVE 1PX4A 3O4LA 4LCIH 3TO2B 3G9VA 2XZQL 1RUQH 1YNLL 5DFWH 1QBMH 2BSSA 3HC3L 2G9HB 3HE6B 2P8MA 3D69B 4XP1L 2AXFA 5ICXA 3WBDA 2H1PL 1EBAA 1M6OB 4CVUA 1LEKA 1X5IA 1D5BB 1X44A 3BO8A 3U9UB 3H9HB 4FQQB 4AQOA 1CXLA 4KK9C 1G1CA 3BKML 3WJLC 1U8QA 1NCAH 2KZWA 5E2VH 3LIZH 5IJVA 5J9PB 2R9HC 3AREC 4KWUA 3R8QA 4CMHB 2H45A 5ACZA 3MRJB 3T0EB 1OOAA 1Q9KB 3KLSA 4JGJA 3CCHB 4U49A 2A6DA 4YR6A 4GAJL 3IU3A 1BQLH 4OLEA 1HKLL 2I5YL 2ZOKB 1MCEA 4KJPD 1U3HB 4JM4H 5ENWB 5FHAL 3REWA 4RMSA 4TNWF 3UTSD 1IKNC 5IR1A 3BP4B 5EO1B 5I1GH 4JDVA 1U3YA 3MJ9L 1T1YB 1F58H 2KZ1B 3BESR 1A6WH 1XF1A 5EUOB 1T80A 2IBZY 2IFFH 2W0PA 4K3DL 15C8H 5DHYB 4NKIL 1MHPL 4Z95L 5E1AB 4LKXA 3IJHB 3TA3D 2FX9L 3GMLA 4G9FA 3KR3H 1HQRB 3WLWC 4I3RL 1S78D 5BRZD 5I74B 1I8LA 2A73A 5I18H 3MFFB 2DTML 4TQEH 4XPBL 5FYKU 2XZAL 3Q6FB 3K2MC 2YMXL 4JPVL 3WKMH 1EUUA 3V6ZB 4JKPL 4LRIA 2BDNL 4LLMA 1LWRA 5IBUB 1SVZA 2FECL 4NCDA 2WW8A 4GG8A 1IQDB 1ZT1A 3G08A 5E56A 3SKUD 3H9SB 1X5HA 1M71A 1NC4D 4GW4A 3STZA 4OLXH 5KVGL 4HJ0C 4UT6L 3LEVL 4GUPB 5EU3B 5CLWA 2BSRA 3C08L 3NIDE 1YDPB 3SE9L 4MA7H 1MIEL 2MHAB 4JFDD 4NPYB 1FL6A 1KBGH 4OIBA 5ESAB 5CILH 2IEPA 3RWIB 4U1HB 5BVJA 1MF2L 1FFPB 3MX0A 3FFDA 2HVJB 1HZHL 1GGCH 1MJ7H 4R4NC 3NPSB 5D1QD 2VLLA 3C5SB 1KGCD 2BVPA 4P49A 1LILA 5GGTH 3KPQA 3MA7B 1YUHA 3MFGB 4MVBC 4WCYH 1YA5A 5IFHL 1A1NB 1JI2A 5EBMB 4BH7A 1IGYB 4HG4J 4IIQB 4G43A 4JM2A 2HFEB 4Y4KC 3M07A 3CGTA 3T2PA 3L5IA 1HCVA 2VITA 1LP9F 1UACL 4PJ5D 1NKOA 5IM7B 5MENB 2WIMA 1D5IH 4P4KA 3U30B 4QCIA 4KFZC 4C56A 2B1AL 1UM4L 5MEQA 4Y5XC 3N1GC 1JWSA 1N5AA 4U1SB 1ZLVK 4KZDL 4IRZL 2G60H 5GRJH 1O7SA 4H1LG 2UUDK 2GTZB 3PP4L 4ZAKA 2CD0A 2NW3B 1AKJB 2DQEL 5T3XE 3FAXA 3U48A 1ZLWK 5DD1H 2X4UA 5L9DH 1I85A 4R90H 3TZVC 4GW1A 1RZ8B 2V5MA 3JTTA 3RGVA 1KIPB 1YJDH 3KYMA 2IPTH 3F7RA 5TFSL 4LGPB 5HY9A 5A2FA 5BV7L 1EO5A 3MV8A 2V9QA 5FM5O 1AIFA 4YHZL 3L7EB 4MJID 4IMLA 1F3JA 2EO1A 2IAMD 5FGRA 4EUPA 4NBYB 3C6LC 3DIFB 2PW1A 3FHAA 4U0RB 1IM9A 5K59E 3SGEI 3RDTA 1KCRL 3LZFL 1YQ2A 1C08B 4RSVA 4DOHE 4OZFA 1FL5A 5I6XC 5BJTB 1LNUA 5DYOB 1G9MC 3FO1A 2HTLC 3QUML 1DL7L 1X4ZA 5JOPD 4UZGA 4Y88A 3QIBA 4BSVB 1EMTL 3SGJC 4KRPB 3UTTA 3VWJD 4ODXB 1T1XB 2R1YB 1RZ7H 1S7SA 2JCCE 3B43A 2VOTA 3NAAH 3TNNB 1CLZH 4TVSa 2V7HB 3NTCL 5KSAB 1RJYA 5E4EB 4JY6A 4JRYA 2FB4H 2AJUL 4GAGL 4U1GC 4XNXL 4HUXB 1CT8B 1IGIH 1ND0A 4W70A 5FDYA 4PRHD 1EFQA 3CFKA 1T83C 5KSVA 4NZJA 2X42A 3QQ4B 3ILQC 4XPHL 3ZL4L 5FUOL 2CPCA 1BWWA 4C58B 1KJ2A 1I7ZB 4KDTC 1VFUA 3ARQA 2VDRH 1EHAA 4OI8A 3MRLB 1AGBB 3BH8A 4HXBL 4YDJB 3PWLB 2R0LL 2AAVA 2WSKA 4M93B 2FD6L 3LKNB 3VGGA 1BQUA 1KFAL 4ZOEA 1OTSC 3KPSE 1W72H 2GIYA 3ARGA 2C1OA 3FONA 1X4YA 4WFGE 3IXAB 4GOSA 5CS7A 1KG0A 5K59F 4G8GB 3SQBA 3P30L 1UENA 4AT6A 1YY9D 2NY3B 3NZ8B 2R1WB 4EI5A 2DQIL 1PZ5B 3C9NB 2C3VA 5CUSL 5E08L 4XRCB 5T3ZD 5EC2A 1VEPA 2W9EH 2P8PB 4UT7H 2F54B 3SE3C 1ZHKB 2V17H 3O6MH 3M17A 4GSDL 2FL5A 5HGBB 2JCCF 3BPOB 2UWEE 2EDFA 3HS0B 5DMKA 4L9DA 5IFAH 2DOCA 5TF1L 3OX8B 3D25A 4A6YA 3DX9B 4PJGB 1S5HB 3RUGB 3C2SA 1CD8A 5I1DA 1ZGLB 1CIUA 3CXDL 2WAHA 4P2CG 1ETZA 3EOYG 3OQ3B 4ZFFB 5KANG 3WFCL 5F6IC 4KVNH 2OL3A 2H8PB 4WWID 5ABDE 1FIEA 2AKRA 1FSKB 1ZLUH 5HGHA 3N9GL 5C0RL 4OCLC 3QUXA 5KVFL 5C6PB 3OAUL 1UVQB 3IRPX 1I1YB 3JWDH 2RCSH 4R0LC 1J8HA 2AABH 4HWBA 1FNSL 5JHDA 5IB5B 5GRVK 4WUUE 1U8HA 1F5WA 3FOMB 5KSAC 1MAMH 3VRIB 5IWLC 5ACMA 3GMQB 2OZ4A 3NFPA 1YYML 5D2LA 3WUWA 2UWEF 1CLCA 2ATPB 3PGCB 3VDAA 4JB9H 1Z3GL 1BEYL 4I2XB 1V3LA 1QKZL 5HHVL 4OFYA 4WEBL 4GLRI 3DYPA 3PABB 2NXYB 3JWOH 4LSUH 5DSCB 1FNFA 1N0XH 3GMMB 5HYSA 3GBMH 3BJLA 1BREA 4M43H 4JZNA 4M61B 3K8KA 4RDQF 1W0VA 2JJWA 3CMOH 1SYVB 1AD9A 12E8H 1WTLA 2YR3A 4M7ZB 5KZCD 5DMJB 1FCGA 2FH6A 3IF1B 4FZ8L 3RGHA 4Z7VE 2BXZA 5T3XL 4TOYH 1HI6A 4TTDD 4IDJH 4M9OA 3BDBA 3K3QA 5I17B 1G9EA 4OB5H 3AU1A 5D7KD 4HWUA 4WY7H 5GS1B 1ORSA 2Y25A 5F7WC 4FZEL 4FQXA 3THML 1UYWH 5HHME 4PJDB 3HUJF 4OCRL 3CK0H 3UC0L 4HCRA 4IRJA 4L1HA 5DGQA 2CGRH 3HC0B 1FVEB 4NJAL 5BQ7A 5F1SA 4M1GH 4WHDA 1XF2B 4YFLF 5GGVL 3UTOA 5H35A 1JWUB 2VDKL 2Y23A 5EZIH 3T0EE 4WW2B 5LKNA 4HKBB 2GJZA 3EO1A 5JNYB 5GJSH 5IHUL 4D9LL 5FGBC 5FKAB 2FSEA 1AGFB 1JHTA 3QIUA 4WFED 5EA0L 1P7HL 1FC2D 1ZA3A 1YEFL 3SDAD 4RGNC 1OGTB 5JPNB 4KJPC 2F74B 4YEFA 1K5NA 2W60A 2X9XA 1FDLL 3CFJB 3QXAA 5CP7B 5SV3A 1BZQK 4HXAL 1WBXA 2VAAB 4NKOA 2LTQC 2FLBT 3LKQB 1V7NH 1QVOB 1WQVT 4Z7VF 4MYWB 5CZXC 1E6JL 3NPZB 3AY4A 5IEHA 5D1ZC 3C6SB 4JLRA 4YHMH 1FH5L 4R3SB 1MCPH 1BBDH 2FCBA 1U58A 2NTFB 4LCWE 3STLA 4PV9A 2DLFL 2GQHA 2EDLA 2VXUH 1YEKH 2HT4C 4JHAL 4ZO7A 5DJ2A 5I8EA 4JHWL 3A67L 1NEZG 5ITFB 1TZGH 1JPFB 1MWAA 1OWWA 1AXSA 3UROR 3AMKA 4FNLH 4E42B 4PBXA 5JMOC 1BJMA 3SO3C 3X14A 4HKZB 3S98A 1D6EA 4JFYA 4NHCH 5HD8D 4QTIL 2CMRL 1A6PA 1J0KA 1RZGB 2C3XA 3C5JA 1JPGB 3ARWA 2PO6D 4GBXA 4LFHG 1T0NA 2BNRA 2BOCA 3MUGB 4G6ML 4ZUTB 4XCNA 4F33B 1E28A 1EO8L 3LCYA 3AM8C 4KY1L 4IOIB 3T65A 1KTLA 3ALWA 4F7MA 3GHEH 1NDGA 1MY5A 2C4FU 2RAMA 3FN3A 5C0JA 3MBXH 1U8IB 3MOAL 3FT3A 3PGFL 4ODVL 5DK0A 4HHAA 1KYOK 1MEXH 1MCRA 2YD5A 4FP8L 2XN9E 4KTDL 1FO0L 4HS6B 4PJCA 4X6BB 4NN6C 5HVGB 4JY5L 1S7UB 1DBJH 4GRLD 1NCDL 3G6DH 4PJ9C 1IGFH 4F7PB 1HILB 5GPRA 1M05B 2YHGA 2FHCA 3RPKA 1W0WA 3EAKA 4NQSA 4CN6A 4MDIB 3LKRA 5E2UL 1RV6X 5MENE 4JCLA 4LRNL 1NBQA 3UPRB 4PLKD 4O4YH 4U1MA 3DRTA 1JNJA 5I8CB 1GJIA 1TFHA 4HT1H 3OKNB 1YMMA 2Q8BL 1E4KA 1S7XA 1UWXH 3NFNB 2N56A 1CFVH 3A6CH 1T22A 5CBEA 4R8WH 3TO4D 3BD4A 1C5DB 1Y0LB 1IGJB 2VIRA 4M6OH 4ELMB 5L2JB 5DD5L 3CVHA 4JO2L 3I02B 1BP3B 3I3DA 2MCPL 4PJ8C 3OZ9H 4PUBH 5C09A 4HBCL 5ISZE 3VD9A 4O2EA 2PTVA 5T3XD 5JPMA 1KPRB 4U1LA 3B9EA 4ZXBA 3BKCH 2GK2A 2VDNL 4P2OD 4D2NA 1J10A 4NO2A 4P48A 4Q6IA 3NGBC 5E8EA 1TVDA 5DZLA 1FLRL 1JPSL 1GC1C 1QUNA 1A0QH 1AGCA 5B3JE 2ITCA 1YNKH 4HJJL 1C5BH 3IDYB 1QP1A 2DWDA 4Y2DB 1FVDA 4JDZB 1FZKB 3E8UH 3BWAB 5HHXL 4FQHA 2IAMC 3ESUF 1E27B 3AC0A 3T3ME 1T03H 4HS3B 5F7YC 2FHFA 1OB1B 3WLBA 5FCUL 1OD9A 3OHXA 2PNDA 4L8BB 3VFSB 1XIWC 4HIIB 4EN3D 3OMZA 2VXTL 1S3KL 3FFCE 2H2SD 1AI1H 1BQSA 2XXMB 2AJYL 3G6AA 3AROA 4Z6AT 4G6FB 4FA8A 5CBAA 3FQTA 1GPOH 4M7LL 1ZGLM 3Q6GL 4Y4FB 5HJ3B 3ZTJG 2BRRH 1XR8B 4HFUL 5A16A 4EI6A 5GS3A 3ULSB 5CINL 5IQ7H 5CEZE 3SJVB 1TZHA 5F7UA 1P7KA 1AO7A 4DEPC 1YY8A 4UINL 1CK0H 1I1AD 2VDPH 1HYSD 2QSQA 2Q3AA 1BQHA 3QUZB 5E6IC 4CN4A 5EZOH 5F9JB 2DD8L 1IGTB 2E9BA 4LPTA 4QRPB 5F1NB 3D5OF 3EHBD 4Z7UF 2EYTA 5FYKE 4JQVA 1F2QA 2H32H 5JO5B 5HYJA 3MMEB 1CCZA 1MCFA 2Q76B 5B3JF 4WUKH 1RK0B 2FRGP 4V2BA 4BJLA 3VI3E 1CICB 3VA6A 5AD0A 5I1AB 3IJSB 4JN1L 4S1QH 1JV5B 4LLDB 3T3MF 1R3JA 3V5HB 4PG2C 3RX7A 2DM3A 4YE4H 4AH2B 2C1PB 1TCMA 2R4SH 3OAYK 4G9DA 1EA9C 2N7BA 3W0WB 4MLIA 3IS1X 5BS0B 2ESVB 3X12A 1I7RA 3LEYL 2DYPB 1DQDL 1JGUL 2X4OA 4MQSB 1BLNA 4OBRA 4ZQKB 2NNAA 1ADQH 2ERJB 2W38A 4S2SB 4UB0L 4FQ1H 1G6RH 5C6TL 5FYLD 4L8DB 4N0UA 5EBLB 3HMWH 4JZJB 1CDGA 5ITBL 3ZLQC 5IBLC 2RJMA 4MDJB 3WEXB 3TF7C 3QIWB 2EC9T 2XTJB 3TM6A 1DN2A 5CJBA 1OAKL 2BVQB 1HCFX 5J1AB 1KCUL 1VACA 3BRDA 4AIZA 2FGZA 3MLVL 2OQJA 4RGNE 5SX5K 3P2TA 1IAIL 3BHBA 1V3KA 4P3CH 2W0FB 5B38G 4ERSH 3R0MA 5D7LA 3U83A 3IKCA 4LL9A 4BZ2L 4AQ1B 5I1LB 2XG5A 4MA1B 4JFXB 3R1GH 1CZ8L 4ISVB 3RZCD 3VI3F 1NUDA 3W39A 5IW6B 1GZPB 5L6YL 4R2GD 4N90E 2P48B 3VGEA 4XMKH 4NZTL 3F7VB 3KPPA 3PHQB 4DZBB 5J7CC 1WT5C 3MRMA 2W07A 3QHFH 3VFGH 1KSRA 4O00A 3T8XB 4XP9H 3VXSB 4KDWA 4MS8C 4QYOA 5F7LB 4KJQD 3L1OL 4X4XA 1B88A 4NQEB 3RL1B 4J1UA 4PTTA 1A7RH 3W9EA 2ORBL 1P4LB 4BK5A 5K9JH 1ITBB 3OKDA 5CD5C 1TJIH 3L3KB 4I2XE 2A9MH 3IKKA 4H20L 2AXHA 2ZG3A 4KDVA 3VFRB 4XWGL 3MV9B 1XGPA 4HIHB 5IG7B 2BFVL 5JORB 2FBOJ 1ACYL 1HINH 5GIRA 4V2CB 5EU6B 3VFPA 4TVPE 5I1HL 2YSSB 1I9JL 4TN9A 1UXWB 3A0OA 5TE7L 1JTPA 3ZKQD 4DJMA 4XGZB 3HE6D 4MQTB 1HWHB 3U7WH 1LEIA 4QRSA 4NQVB 5GGSA 3FQUB 5I1KL 2ZUWA 1KCKA 1QRNA 2W9LA 1DE4A 5LGHH 5F7HA 3QI9A 4HWZB 4P5KB 4DGIH 2RFXA 1Y6MR 3VD5A 1RFDH 2DKMA 1A3QA 1XF3B 5DJXA 2VLJB 4HJGB 5JMRA 4FXKA 5IROA 1S7RB 1EK3A 4HZLA 5MI0B 5HSFA 1JZ7A 1X3DA 3JV4A 3PL6A 2ARJA 4HV8B 1JTTA 2X89A 4K3GA 2IMMA 3T0ED 1L6XA 3WS3B 4LCIL 1RUQL 2XTJC 3NACH 2L7JA 1N8ZB 2FX7L 2Y36L 2Z8RA 2UYLB 4Y8AA 3GSRB 2AK4D 4KGJA 5FGSA 1PJ9A 1FZMB 3QDGB 3I3EA 3RKDD 5KVDH 1NJ9B 3FZUD 1HEZA 4IEFB 2EDQA 2FEDC 2R0KH 5HDLA 3VRLE 2E7BA 4K71B 4LVNB 2R2CA 4FMFA 4XC3H 4L8SA 1J05A 4OZIF 5CEZL 2VQTA 2EKSA 1IAOB 1R5IA 1SY6L 2QEJA 2CDFA 1GCFA 2AV7A 4N9GB 1NCAL 2HRPH 5E2VL 2GSIA 2QQKH 1CDCA 4HKJA 1OWRM 1QSFB 3V5DA 4JG1H 4U0QB 1RQ5A 4CMMB 4UI2A 5FYKL 1B0RB 4ZYKA 2CLRA 1RMFL 1Q9LA 1BQLL 1DLFL 3QXVA 4L3EB 1M7IB 2DDQH 2ZKHH 4YAQA 5IIEA 2YBRB 1YN7B 5FKPA 2H32B 3QCVL 4QXGH 3CPLB 3MJ8A 5DJAB 3C5ZA 3MJ7A 5J6HB 3G5VB 5I1GL 3FB7B 1QQDB 2AQ1A 4OJFH 5EBGA 3H9SD 5GS2D 1A6WL 2L0DA 5AEAA 2OK0H 3NCMA 3NIGF 5AAMA 4PRPB 5CLTA 1V7MH 5C1MB 5J6GB 2VQ1A 3KR3L 4BKLB 4LCUA 3IDIA 4GT7A 3OGCA 4MAUH 1MRCH 2P46B 5CMAB 3PWVB 4UOW0 3KG5A 4TQEL 2NW2B 4YHIB 1G6RB 1K6QL 1MCDA 3SKMA 1SJHB 1YEHL 2IPUK 3WKML 4X4YB 5IB3B 4R4FL 2X7LA 1I8KB 3TH4T 5D7IB 5I76A 2ZNXA 4AMKL 3RQ3A 4BQ8A 2HH0H 1FORL 3OG6B 2NY6C 3WJJC 3RJDA 3MCLH 4HAGA 1H3VA 1RJZA 2X1OA 4BFEA 1N59A 3G9AB 3HG1B 3VW3H 3BP7B 4WNQB 4X6FB 1ZA6B 4Q7DA 5MEND 5F72S 4DN4L 4YPGA 4OLXL 4HF5H 4ZFZA 2D7QA 8FABA 3P4NB 1VFBA 3L3HB 1D9KC 4LLUA 4XPFH 2LU7A 2UY7A 4G7VL 1KBGL 3LKSB 3LN9A 4LARH 4R97C 3F8UB 5CILL 2ED8A 1LO2H 1ZV5A 4H1LA 4OIIH 1MLCB 5DRXA 1NFDB 5DO2C 4ZFOL 1GGCL 1KOAA 3LB6C 3LN5B 3I6KB 5GGTL 4M6AA 3RWDB 1I7TA 1EGJH 1FNAA 3BN9C 3KPLB 1H5BB 3JV6B 2VL5A 4D0BA 3DUUA 1UT9A 4R96B 4YBQD 4I5BB 2E9JA 4H5SB 5DT1H 1J8KA 1FGNH 3PG2A 4DTGL 2NY5C 4HDIB 4TVPL 3ARFA 5CJOH 4ZTOH 1JF1B 1J0YA 3MRPB 1JF5A 4JRXE 5TQ2L 2VE6A 2BZDA 3HNTL 3G5ZB 1XGUA 1Z5LA 5LXGH 2D31A 5MEOB 1KIRA 2G60L 4EN3C 1ZLUK 4LLQA 4YBHA 3C60B 1I4FB 3S88H 3TBWA 5TGBA 5C2UB 3CJJA 2IQAB 1D5ZB 3MLYL 4KRPD 1JUFB 1FJ1B 1KEGH 4UDUB 1DANT 4KQ3H 5TH2B 1L7TH 1WIOA 3VJ6A 4JDTH 1ZK9A 3H3KA 1BIIA 3GSWB 4FOMA 2H6PA 5E99L 1J9CT 2OTWB 2J6EL 4Z5RB 1RUMH 1T89C 4J3WA 1N5YL 1LP9A 3TYGH 1BD2D 4ZSOE 2EDBA 1SJXA 3MRDA 3QEHB 2CIKB 4Q2ZB 3KPRD 4KROB 1YZZA 5J3HD 3GSXB 3MRBA 1FL3B 1XGTA 3RWGB 5ESQB 4NHUA 2V9RA 4G8GD 1BBJB 5ALBH 1RZ7L 4JFEB 2NY3D 5D93B 3GMOA 1P6AB 1T21B 3KPOA 5CJQH 3HKFA 1EFXD 5C0BA 2FBJL 4QF1B 3PP3K 5JZ7D 4HX1A 1KJVB 4IOFD 3L3JB 2FB4L 3LQAC 5EC1B 4ORGA 5HI3C 4WRLA 5MERA 2F54D 2XWBB 4LPCA 1FQ9C 5FO8B 4XMLH 1P1ZA 1L0QA 2EEAA 4UILL 5SWZB 1NCCH 5KBNC 3L6FB 1U3ZA 3VG9C 3PWPA 1NGXA 3UYRH 3QDMA 4PP2B 4XNMB 3IDJB 3LPGA 4OGYL 3D18B 4PP1C 2R2BA 4WI3A 1XZ0B 3V0AC 2J7LA 2XTJE 5L88H 1P2CA 1H0DB 2VZSA 4NQDA 3TN0D 5DWUH 2F15A 4I0PD 1Q1JL 4LHQB 2I9LA 4MA3A 4ETQB 3NCEB 1M7XA 1LD9A 4HUUB 3GIVA 2NY2C 5GJTH 4GKNA 2W9EL 3KXFB 3S3JA 4WI5A 4GFTB 1OTUD 3O6ML 4PV8B 4PTUB 5C71A 1FYTE 1JGEB 3S4SB 2E7LC 5IFAL 1JP5A 4L4VA 4NFCA 4LVOC 5EDXA 3QO1B 4X4MA 3MGAA 2Z31A 2AJVH 2Z35A 3MLUH 3H7LA 3WS6A 4WO4C 2ZSWB 1PY4A 3MBEA 1T4KA 1CXIA 3PGDA 4D9RD 4P46B 3U0WH 3BQUA 1JHKL 2QHLA 4IRSB 2CK2A 3MV9E 5HGDB 2NXYD 4NZDA 3VXQA 1OF2B 2VDMH 4AEEA 5EU6E 3VWKB 2JJTA 1S9VB 1FRGH 5DEGB 3KYOA 4BELD 1HSBA 1OTTD 3JWDL 3O3EA 2RCSL 4GMSH 1B6UA 2Y7QA 3QFJB 1ZTXH 4TRPL 3KYKH 4ONGL 3MO1A 3BT2H 4K7PH 2JCCA 4RZCA 3GKZA 3MGOB 1LK2A 4BUGA 3HI1A 3BSZH 1SEBB 1MAML 4FQCL 3V0VA 2VXVH 2V2WA 4D8PB 2R1XA 4HG4K 3HAEH 5IF0A 1II4E 4WI9A 3K8LA 5HYQB 2ZSVB 2PKDA 4PJIF 3QXDB 5HVHB 1FVCB 2VLJE 1NBYB 5C0GB 4XP4L 1NFKA 1KB5H 3JTSA 4NRXA 4KK8D 4GAYB 1OARL 5K9OB 2YPLE 5FUCE 1ZS8B 1SJEB 4O2FA 3TBYA 1N0XL 4RFEA 4M43L 5I2IB 3CX2A 3KPSA 3C09C 3TGXA 3CFCH 5T1KB 1YEJL 4NN5B 3DX6A 4OUUB 2APWA 2YXMA 3QDGE 4HLZG 4G3YH 4MGXA 1WZ1L 4IDJL 4RGOH 2YD6A 1R3HA 2Z92B 3OGOE 1FNGA 5I19H 3RKDC 4JO4H 5K9KB 1BFTA 4OQTA 2VZ3A 5C0IB 5EOQH 3WXWL 5L2KE 1T0MA 2X70A 1UWXK 5F44A 3E6HB 3FO0H 3MRKB 3OR7A 4LKCB 1G7HA 4PRBB 2DBLH 3CXHK 3SQOH 2CGRL 1OAUH 3GK8L 3WJLA 5F3HB 3QULA 4X9HA 2UWEA 4M1GL 3EYFA 1F4WH 3S5LB 4OGXH 5EWIH 4ODSL 2P24A 1KCVH 3VFNB 4PJBB 3AREA 2DQDH 1T2QH 5EZIL 3RVUC 1WITA 3EJZC 2AW2A 2AP2A 5GJSL 2A74A 4ODWA 4JVWA 4L3EE 4MHHG 3L3GA 5DJ0A 3IDMB 3AS0A 1NEZA 3FQXB 3QZWG 5C0AD 1CFQB 2ZUUA 1UXSA 4KQ4L 2BNQB 3RNKB 5DI8A 1L0YA 1U9KA 3P0YL 4IRSC 5TJWK 1OAQL 3PXHA 3L95A 3MV7A 1DBMH 1KJMB 1IKNA 4L3CA 3UBXB 4BZYA 4OT1H 5HHQB 4PJ7E 4YK4B 5CD3B 2A1WH 1KTDB 3BPNC 3ARBC 5KS9E 3RU8H 4ZUUB 4MAYD 2GKIA 5H37H 3WHXB 5CEYB 1U8PB 3T1FA 4I18B 4U1JB 3WXVH 2DWEA 3HUJA 4PRPE 4BSWA 3RVVC 4YHML 4F80A 1MCPL 1GXEA 1BBDL 2COQA 5JHLH 3MRIA 4OFPA 3TBSB 3I85A 1MFCL 3SE4C 2VXUL 5F9DC 5TDPB 7FABL 1MJUH 1PKQB 1RK1A 2AJ3B 1TZGL 3QWRD 5BW7C 3GMPB 1ES0B 1CTOA 4FNLL 4P23B 4NO5B 4DK6A 2J12B 4P5MB 1NL0H 5CSZA 5DJ6B 2VN4A 4XH2A 3QXWA 1OGAE 4MJ6B 1N4XL 2WBJD 2GY7B 5F6HJ 5J4MA 5SWQB 2WWMD 2FR4A 4PJ7F 5CEXB 3FCTA 1U8LB 4QRQA 1N7ML 3C2AH 2AEQH 5CSBA 1D3CA 3T2QA 1GZQB 2DQUH 4M6NH 3V2AR 3CC5A 2KH2B 5D4QA 3L3OA 1BMGA 3QNYB 1NFDE 4BFGA 3O4LB 4GRWB 4OZFH 5JXED 4V1DE 4MNQE 5ADPL 1KIQA 2BSSB 3O3DA 3O81A 4TPRL 1I7UB 2AXFB 5ICXB 1AQDA 1DBJL 4P2QD 4Y16C 3IFLH 4ZNEA 2VLKE 1NCWH 3LDBC 4LIQE 2D0FA 3ARRA 4Y4KA 3TJEH 1LEKB 1MFEL 5CWSA 3MYZA 4J3TA 4K9EC 3DUSA 4Y2DD 1DCLA 3BO8B 1KENH 4JEGB 3S97C 1U8QB 3B9KD 1J0IA 4HT1L 2HFGH 3QRGH 3BP6A 4Y5XA 5IJVB 5KANI 1CFVL 4R8WL 5FA4B 1QLFA 2R23A 5EIVA 1BF8A 5E9DE 4DVBA 4Q58C 3X3GH 5ACZB 2MKWA 3LPWA 4XC1L 3OZ9L 4G6FD 1I8IB 2A6DB 3K4AA 4YR6B 4OGAD 5HHOA 3IU3B 2HJFA 4BZ1L 4Y4FD 2YZ1A 1YYLH 3TZVA 2E6QA 3DVGA 4Y19B 3REWB 2AEPH 3SJVD 5FO7A 5JUEH 3HMXL 5IR1B 1VGEH 3CD4A 2YK1H 3HAEB 2OR9H 3PJSA 1A0QL 1YNKL 3S96A 1P69B 2IFGA 1C5BL 4M9PA 1E6OH 4OLYH 5A2JH 3BXNA 4JPWL 1KB5B 2P5WE 4QRPD 3U7AA 3O2VL 2YKLL 1MAJA 2QBWA 4D3CH 4LKXB 3GMLB 3P4LA 4G9FB 3QCUH 1A9EA 4L29A 2V7NA 4JPIA 3RX8A 5ANME 3TFKD 2WINA 1UM6H 1CFTA 2VC2H 4YHNA 1CICD 3L3IA 5J3HC 3GIZH 1MFAL 1KPVA 1PDKA 2W9DL 2VLMD 3SKJH 1GPOL 4AL8H 4S1DC 4NZRH 4P2YA 2DKUA 3SGJA 4NCC1 4M62H 1GH7A 4MD0A 5HTSA 3UZVB 1OAYH 2CXKA 2WUCL 1C12B 3BYTA 4YDKL 5MEPA 1RURL 3AAZA 4KHTH 4RAVA 2P7TA 3BN3B 3IETA 2XQYK 3W0WD 5BS0D 4LLMB 2ESVD 1AQKH 1MHCA 1DFBL 2OL3H 3BKYL 2DYPD 3W9DA 1EH9A 4PGJA 2VDPL 4GG8B 4K94C 1P84J 4IOFC 5DTFB 1VKXA 2EC8A 1OP9A 1ZT1B 4KVCH 3G08B 1T83A 4XAKE 5EZOL 1M71B 3GEWB 2NY5L 2LVEA 5C07A 2XKSA 4GW4B 3STZB 4KDTA 3VFUA 4AYFA 1B9ZA 1NGPL 3S8WA 1KCSH 2BSRB 3IS0X 2WLYA 3D2UA 4PBVC 4PIRF 4WUKL 4HWBH 2CJUH 1MPAH 4U1IA 1FL6B 2DQTH 2JELL 2VLRD 1K3IA 4GQPH 2VDLH 3TN0C 4ALAH 4Y5YC 5BVJB 1CF8H 4I0PC 1LO5A 3BOVA 3FFDB 1CD1A 1MJ8H 2VLLB 4YE4L 2BVPB 3KPQB 1YUHB 4RA3A 3O0RL 1PG7H 1F90L 1TVHA 4G43B 4JM2B 1HDMA 2C9AA 3MNZA 1VENA 3SE3A 3NABL 1ADQL 3QQ9D 5FV2A 4XZUA 1OTUC 1G6RL 5ISZA 2DF3A 4KMLB 2VITB 1TITA 1QFWL 2X4PB 1MCBA 1RIVL 3QUYC 4MQXD 4P2RA 4P4KB 3VXSD 2GTWA 4QCIB 4C56B 5E8OA 3OKLB 3PHOA 4KKCD 4EBQH 4Z7UA 1U91A 1JWSB 4GXVH 1N5AB 4NQED 3H3PH 4DCQA 4TUKL 5A2IH 4KMQA 2EECA 3F6LA 5GZNC 1IQWH 4OD1H 1QSVA 5C0CA 4ZAKB 2E27H 4LHUA 1CFSA 1Z0NA 5FYJE 1O0VA 4M7LT 5JW5A 3RVWC 3RWEA 4HCRH 3MV9D 4EDWL 4GW1B 2MOVA 3JTTB 3RGVB 4WHYG 1PEZA 3KYMB 4MNHA 5HY9B 4MJ5A 2OJZL 5EU6D 4BYHA 2PYEE 4HK3J 1I8LC 3MV8B 3VD4A 3LQAL 4XMKL 1AIFB 4L4JA 4R0LA 3OAZH 4IMLB 1DQQA 1F3JB 1CLOH 3Q3GA 3IU4L 3P73A 4EUPB 3VFGL 4XP9L 3FO2A 4P59H 3K4ZA 1IM9B 3WFEH 4PLOB 2P5EE 4X7TA 3DLQR 4NZUL 4MZ2A 3RDTB 2IQ9L 1UJTA 3O2DL 1TCRA 3OF6D 3O6FC 4AEHH 5IWLA 3BZEA 3S35H 1SY6A 1S7VA 4OZFB 3PQYE 1F6LL 1FL5B 5FOJA 4YDLB 1A7RL 1LNUB 2N7AA 3FO1B 5JXAH 5K9JL 4LIQL 3LS4L 4KK5C 1YPZE 3MR9B 3O3AA 2A9ML 3NMEA 5D7JD 3QIBB 3D85A 1CQKA 3O4OB 2GT9A 3UTTB 1CR9L 1S7SB 1FZJA 3ZSSA 1OAXL 5HGGS 4O02L 3RVXC 4E41A 1BM3H 1C1EH 1OP5K 1LO4H 1RJYB 4Q0XH 4JY6B 4JRYB 5HVFB 4PGBA 4F7CB 2PF6A 1ND0B 4RIRA 4EVNB 5KSVB 2X1PA 2WBKA 5DUPH 3HHRB 1VA9A 5ALCH 4RX4D 1NLBH 3U7WL 3O2WH 4YFDB 1KJ2B 4P3WA 1A7PL 4JFPA 1TQCB 3BH8B 5LGHL 1WV7T 4NNPL 4DGIL 2FWOA 4G5ZH 2E6PA 3ARGB 3FONB 2HFFA 4OLUH 3HZKA 3U7YH 3UO1H 3EDJA 1KG0B 1P4IH 2IF7A 1QSFD 1IC7L 4AT6B 1T5WA 3FQRA 4EI5B 4ELKB 2GCYA 1AHWC 2C3VB 3RIAF 2VWEC 3VXNA 1AH1A 3F7QA 3NACL 5EC2B 2EXWD 4L3ED 1YPZF 2PW2A 4YQXH 5FGBA 1HQ4A 2X44D 3RY4A 2BNQE 3M17B 1WZKA 2FL5B 2OMBA 5DMKB 3QDJD 4DQOH 4EQ2A 3VD3A 2GJJA 2CUIA 5E2WH 5DVNA 3D25B 4XC3L 3ZKNC 4EQ3A 2OX5A 2HT2D 4MAYC 4F3FB 3PDOA 5I1DB 1XGYH 3CZFA 3TWCL 3U0TA 1CIDA 4X7FC 3F58H 4BFIA 2JB6A 3MCKA 1N2RA 2QQKL 1ETZB 5D1ZA 3WNLA 5EU5A 2IG2L 2OL3B 1G7QA 1K8DA 2AKRB 4APQD 4DUWA 4JG1L 3VXMB 5HGHB 3TA3A 4I0KA 3H3BC 5ACLA 3I6GB 4M3JA 3QUXB 2AGJL 1GSMA 3MLXL 1GAFL 2DDQL 3PV7A 3QIBC 3CVHH 3IAQA 1WVZA 2OI9C 1J8HB 4JG0H 4M1CD 3U82B 1NMBH 2KQMA 1I9RL 1S7WA 2EDYA 2ICEA 2XWJA 1U8HB 2ID5A 2MPAH 1IEBA 2D03L 3MRRA 2VNCA 3HG1D 4JGMA 4XBPA 4OZIA 2WBJC 3S36L 3QDHA 5D2LB 3WUWB 3OKKA 1UB6A 1V7ML 4TSCH 2VXQH 4C57C 2QADC 1T5XA 2BHUA 3AM8A 3INUH 4LCCC 2H9GA 1MRCL 3AFLA 1F3RB 4PJEE 4WFFD 3GMRA 4NP4H 2KDGA 3O4LE 4JFDA 4QRUA 4GRWE 4XCCH 3GZKA 1CL7L 1SEQL 5HYSB 1U42A 3O11A 4JZNB 1W0VB 5GGQL 3TIEA 2FIKB 1AD9B 5HI5C 1RZFL 4AIOA 2AI0H 4P57A 5LQBH 5MHSD 4ONFH 2DI7A 4PJ9A 4ORZC 3AU1B 2EE2A 1ORSB 3ARUA 3QG7H 1JF6A 3FMGH 2Y5EA 1JGLH 2QQNH 1JZ4A 3L7FA 4YHPA 4IRJB 4NWTH 3QAZC 3B9KC 4XPFL 4I48A 3DO7B 3DURA 4LMQE 4DN3H 2CDEA 4OD3L 4UDTA 5H35B 5SV4A 4LARL 4QHNA 4U1NA 3C60D 2GJZB 3SEPA 3EO1B 4NC1E 4PJ8A 3MLSL 4UQ3A 1I9IL 1HK6A 2FSEB 3QIUB 1JHTB 4I1NB 3WL9A 1ZA3B 1HHHA 5I71B 3GSUB 5CCKL 3X13A 3BVNA 5KTEL 4P4RB 4PJEF 1K5NB 2W60B 2K3TA 3TT1L 3M1BA 4Y4HB 5GZOC 5DT1L 4QXWA 3QXAB 1FGNL 1WBXB 4NKOB 5EO0A 2OBGA 4OKVA 5DRWA 5CJOL 4ZTOL 5HXMA 4MJIA 3KYNA 3V7MA 1BECA 1QFUH 2IAMA 2EIBA 2YUVA 5CHNA 3ORJA 3Q5TA 1EPFA 1OT1A 5IEHB 1ZOXA 4NQTA 5FO9A 4JLRB 5LXGL 2JE8A 4KROD 4JREB 1U58B 2GJ6D 5GRUH 5I8KH 1FE8H 3U0PA 3O9WB 4PV9B 1H8OA 2XNAA 3S88L 1DEEA 3KJ6H 4RWYH 3DXAA 5DJ2B 4UNVA 5I8EB 5JOFA 4NNXA 3WIHA 4JFED 2Q8AH 1A5FL 4JKWA 1KEGL 4KQ3L 5DC9B 5IVZA 1AXSB 4JDTL 1G9NH 3T09A 3VFOA 1JK8A 3O6LH 3X14B 3C8KA 4YDIH 3ZKMD 1D6EB 3PXJA 2EIDA 1HSAA 1CXKA 2Q20A 4JFYB 1E0OB 2XZQH 2NY0B 3C5JB 1YNLH 2VXSL 1WUNT 3FTGA 2D4DA 5SWZD 5DEFA 4JE4B 4GBXB 1T0NB 2BNRB 3TYGL 2BOCB 3KS0J 4XCNB 1E28B 2HN7A 3T77A 2JK5B 3BISA 3E2HC 3RWJA 5ICYA 3F65A 3T65B 1KTLB 5BZWB 3I75A 2E5EA 4FQXC 2UZIL 5C0JB 3RL2A 2M26A 1DVFB 3H9YA 4M8QA 5ALBL 1B4RA 3FT3B 5DK0B 2X1WL 3BKMH 4PG2A 1XH3A 4HHAB 3ES6B 2Q6WA 5CJQL 1MCLA 2YD2A 4PJCB 1RHHA 4ZPTA 5BXFA 5EN2A 2O61A 1DUYA 3S37L 3QXUA 3KXFD 4X8JA 3VFWB 4GAJH 4NQSB 1JCKA 4XMLL 3LKRB 4YBLC 5T33L 3QISA 4C56E 1XF4A 3FT4A 4LEXL 4MA8H 1QLEL 2ZCKL 1AXTH 3DRTB 5FHAH 3UYRL 4PY7A 5C70A 3IRZA 5LBSL 1JNNH 4MXQD 3KLDA 1YMMB 4KKCC 5CBEB 1XR9A 2Q3ZA 4LGSB 5DWUL 4PJXB 5KAQF 4N1HB 4P46D 3CVHB 5C09B 4O2EB 1A7QH 1ROWA 1BFSA 1IM3A 4RFNB 4U1LB 4JRXA 4ZXBB 1A8JH 2J8UB 4KC3B 4Z95H 1JNLH 1U0QA 2W1NA 1F11B 4NO2B 4Q6IB 2FX9H 5E8EB 3VWKD 2XOTA 5GJTL 1INEL 4I3RH 1T04A 3MV8E 2V6HA 1AGCB 2ITCB 3QFJD 4JCMA 5IEKA 4NKDA 1GGTA 4NO0D 4XPBH 4I13B 2Q86A 2DWDB 3DYMA 4UNUA 1FVDB 3SY0A 2YMXH 1WT5A 3RWCA 1JMZA 5JW3H 4JPVH 4FQHB 2BK8A 4JKPH 3TNMB 2AJVL 5JOEA 3WLBB 2VKWA 3E6FA 3BUYA 3OHXB 3EYVA 4Y5VC 3Q5OA 1DQJA 4NM8L 4YH6A 3U0WL 3G6AB 4MSWA 1A9BA 1FV1A 3FQTB 3UTTE 5D7JC 2ZUQB 3BD5A 5KVGH 1ZT7A 3KNBB 4UT6H 3LEVH 4ZSOA 5A16B 3GJEA 3W11C 3DX7B 4EI6B 3SE9H 1P7KB 5T1LA 1YY8B 4X7CC 3ROLA