1BJ8A

Third n-terminal domain of gp130, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
b'MDKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP130
publication title The signal transducer gp130: solution structure of the carboxy-terminal domain of the cytokine receptor homology region.
pubmed rcsb
source organism Homo sapiens
molecule tags Receptor
total genus 20
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bj8A00
1BHGA 2A77L 3BW9A 4HEME 1HNFA 2VIRA 4UAOC 3D2UD 4GMSL 4U7KA 1HKFA 4LKCB 4WV1C 1IAKB 1VFUA 2WBJB 3VMNA 5GPRA 1RUPH 1Y18B 1SVZA 1SQ2N 3DECA 1IBGL 1V3JA 5TPWH 4PLNC 1S7UB 5I0ZA 1Q0YH 2Z4QB 4NYLA 1NGQL 3RDTB 3L3HA 1C1EH 4OCXH 2F74A 2MCG1 1ZT4B 4LPUA 5DJ0B 2BY1A 3H3KA 1A2YA 4HQQL 1KFAH 3P9WB 5CS7A 3IDXL 3QDJA 1DTUA 1DBBL 2R4SL 1RZJH 4L8SA 5EH1A 2IMMA 2AK1H 3E6HB 4LHUD 5FEBA 2V7HB 1SYSA 1IC1A 3BKCH 1LEGB 2EXWD 4JANB 1A7OL 4RAHA 4Z95H 5B3JE 3HZVA 4HLZG 2A6JA 1DEEA 4IRJC 15C8H 1J18A 2XTLA 2HKFH 5HI5C 4XMKL 2HT2C 1X5AA 2XXMB 5T33H 5D70H 4LKCA 5FGBA 1IAKA 4WUUB 2WBJA 4DWHA 1JPST 2ZUSA 4DK3A 2AK4E 1Y18A 5I66B 3ULUE 1FNSL 3ULVF 2VDNL 3A6BH 5B39B 1S7UA 1WJ3A 2B7DT 1NAMH 2ED7A 3RDTA 2Z4QA 3BYTA 4V2CB 4K2UL 1ZT4A 2IFFH 5DJ0A 3TT1H 5HDQL 2PYFB 3GM8A 3TYFB 1V3KA 3C5JB 5HI4C 4EOWH 2HH0H 2W38A 1GPOH 3E6HA 3WJLC 2J4WL 4Y4HB 4GT7A 4XWGL 3B2VH 2V7HA 4WGWB 1F90L 1LEGA 5GHWH 4JANA 1TITA 3ZTJH 1A64A 3KPRE 5INDB 5I71B 1FCCA 4P9HC 1KN2H 3SGJC 3DNKA 4F9PA 1Q9WB 2C1OB 4GQPH 5JPNB 1K3ZA 5CINL 4WUUA 5DHVB 2E3VA 4LIQL 2Q8AH 3RY6A 1JMXA 3FN9A 5C0DB 4J6RH 1EHLH 5I66A 1QR4A 3I02B 1UWXK 5B39A 3ARPA 2FX7L 2FLRT 4JHWL 2PYFA 3TYFA 3QO1B 3C5JA 3MZGB 3MJ9H 5LVEA 4R97C 3DIFB 3ZHKA 2MHAB 4ZPVB 4H8WL 4Y4HA 3UCRA 5FAAA 1ADQH 4QHNB 4O5LH 2R2EB 3DX8B 1FSKB 5INDA 4K9EL 3VH8B 4LK4A 1M4KA 4PRNB 3S88H 1F58L 2B39A 5HYEA 1T6WA 5IVOA 5BQ7B 5JPNA 1Q9WA 1YNKH 2C1OA 5DVOA 3X3FL 3QXVA 3PV6B 4XMLL 5J57B 2KUTA 2FR4B 3TZVB 2DQCH 3HNSH 4P5TD 5E5UB 1HWHB 4MHHI 3MGTB 5C0DA 4IIQB 1PG7H 3TM6A 3I02A 3K8KA 1IGCH 4PRIB 1AC0A 4OTXH 1UGNA 2AJVL 4KHXH 3L5XH 4YNYB 4KROD 1CDIA 4FFWD 3QO1A 5C09E 4Q6IB 3DO7B 1T03L 3SJVD 1G1YA 2C5DC 3DIFA 3MLUL 2MHAA 4ZPVA 2E9JA 5FYKE 4JZJC 1NUFA 1UACH 5JQ6H 1CDYA 4PJXF 4QHNA 4FNLL 4DGVH 2R2EA 2ZKHH 3B9KB 3A67H 5EBMB 4JQVC 5F96H 4F58H 2H26B 3DX8A 4MCYB 3VH8A 1UKQA 4PRNA 1QLEL 3RVUC 3T04D 2J2ZA 5BQ7A 5E2TH 3PV6A 3VWKD 4MQXD 3IT8D 2FR4A 4HGWB 3TZVA 4HWEH 3MGTA 4Q7DA 1NGPL 4OB5H 4IIQA 5ID1B 3RWJB 1KACB 3GMLB 3RPIB 5L2KE 1JFQH 2J6EL 2PNDA 1YEEL 4PD4K 4PRIA 3IS0X 4NKOB 4YNYA 5KJRH 1Q0XL 2OQJB 4UB0H 4OT1L 4Q6IA 3DO7A 5FYLH 1AH1A 3IFNL 2OMBA 4PRPE 4MLIA 1NC2D 4R90L 1Z6JT 2VN7A 1F8TH 3H3PL 3VGAC 1JI1A 5JW3H 5HGAB 5HGBB 1U8NB 3WKMH 5JA8B 5EBMA 4G5ZH 3RUGE 1FQ9C 2OTWB 5FV1L 2H26A 3OXSB 5EUOB 4MCYA 3PGCB 2VDKH 1MCCA 4QTIL 3PIQB 4Z7UE 5DFTA 1SJHB 3GBML 3LN4B 1QSFB 4N0CD 3VFNB 2NW2B 4HGWA 2YN3A 1RK0B 3R8QA 2NX5D 4CMHC 2R1WB 4DAGL 5ID1A 5DQDL 5F9OL 3RWJA 3VXMD 3JV6B 5KZCD 3GMLA 2DQHH 3HTLX 4JRYE 3RPIA 5A2KH 3GGWB 2P43B 4WFFE 4NQVB 3L3DB 3K3QA 4NKOA 2NQCA 4QKXB 1E6JH 1QYGL 4DKEH 1OAXL 2OQJA 3QEUB 4Y4FD 4Q0XL 5JOPD 3EAKA 1CR9L 3V4VH 3TIEB 4PG9B 2ESVD 5HGAA 5HGBA 1JL8A 1S9VB 3E2HB 1U8NA 4RWHA 1FLRH 4KMLB 1MRDH 4APQD 1YDPB 4XP9L 3MXWL 5IM7B 4D2NA 2OTWA 4Q58C 3OXSA 5DRNB 5EUOA 3VFGL 1GYAA 1KUMA 2DM3A 1RUKL 2OXHA 3L3KB 3PGCA 2FWOB 3PIQA 5IMKB 5BJTB 1TVDA 2NCMA 5B39G 5AG8A 1VENA 3H9SE 3BPLC 4OFPA 4W4NA 1SJHA 1MFDH 3LN4A 1QSFA 3VFNA 2FGWL 2NW2A 1RK0A 1CE1H 4Y4KD 2ZJSH 2R1WA 4QRSB 2X41A 5DJAB 4XC3H 2FECL 3MJ6A 3JV6A 4Y16B 4KJYB 3GGWA 2Q3ZA 4NQVA 4XPTL 3C09C 1CVSC 4QWWD 5CZXD 3B83A 3FQNB 3ALWA 3QEUA 4OLZL 2BY3A 4XAWH 4LBEB 4G9FD 1ZLUK 3TIEA 3KHQA 1CXLA 4PG9A 1NEZB 1OP9A 2E27H 2P5EE 1S9VA 3MLYL 1YDPA 5D2LF 4OD2B 3D25B 5IKCB 5IM7A 3T0BA 3LEVL 3MSPA 5DRNA 2B2XL 3L3KA 3KYKL 2FWOA 5IMKA 5BJTA 4LQ1A 3IGAB 1LO3H 5L6YH 4QRSA 1WWBX 5DJAA 5IVZB 3DV6B 1R0AH 1P7HL 4L4TE 4PJEF 2XXCB 3QI9C 4Y16A 4KJYA 4M6MH 1TETL 2DN7A 5GIRB 1J1XH 1KPVB 2BNQB 3L7EB 1FHGA 4P2QE 4JGMA 5AWNH 4OZHF 2LU3A 2YZ1A 5FKAB 3SDCD 1P4LB 5HDBF 3FQNA 1K5NB 2AP2A 1BD2E 3MJ7B 4JFFB 4MGXA 4LBEA 3RTQB 4LGRB 3VH8G 1YEHL 1CDBA 2A9ML 5DVMA 5F3BB 3BOVA 1UM5L 5BV7L 1NEZA 4M1DH 1P1ZB 2DJUA 5ECJE 4OD2A 3D25A 2HT3D 5IKCA 1SBSL 1YEFL 1OOAA 3O11B 5IBUB 2V9TA 4TNVK 1MJUL 1MVFA 3T0DA 4GG6B 4K8RD 4U1NB 3IGAA 4RDQG 1AXSB 1MJ7H 3PGFL 2R2BB 5IVZA 2PTUA 3DV6A 3HC3L 4GW4B 4RMUA 1JK8B 4ZUTB 3ULUC 4ELMB 3QIWB 5JW4N 3QDMD 4OSUL 5DHYB 5GIRA 1PEWA 1KPVA 1H9VA 2BNQA 3L7EA 1V7MH 3LB6D 5FO9B 1NMBH 2FIKB 1YYMH 1J0JA 2F19L 5FKAA 1CICC 1P4LA 2BRQA 2MJWA 3WIHA 3FMGH 4Q74A 1K5NA 3MJ7A 3DSFL 4MZ3A 5EB9A 3VXOB 5JXEC 4JFFA 4JQXA 3RTQA 4P46D 1IE5A 3CDFA 5F3BA 3MJGX 1JZ2A 3RY4A 3FN3A 3DVGB 1P1ZA 4ZTPL 3IDNB 5DJ2B 4N9OB 3R0NA 2IFGA 1I85A 1A9EB 3O11A 2DBLH 3LQAC 1YECL 5T3ZL 1NAMB 1TPXC 3BKYH 4GH7B 1P4IH 1UYWL 2ATKB 3MLTB 4XXCC 4GG6A 3LN5B 3ARQA 2MWCA 4U1NA 2ICWI 1AXSA 3FO2B 1NL0L 1QFUL 2R2BA 4GRLB 5I30L 4U1HB 3F6IA 4HCRH 4GW4A 4MYWB 4RX4A 1JK8A 4ZUTA 4ELMA 4YPJA 1WIUA 1YMMD 3QIWA 4DKFH 3G6DH 5I8CB 5DHYA 1BECA 7CGTA 5BS0D 2MCPH 5FO9A 5T5NG 5F7YC 2FIKA 1YPZE 3ZKND 3ZYOA 3HNTL 4U1KB 1OW0A 3S4SB 3A6CH 3NH7L 3VXOA 2WBKA 4E41D 3NFNB 3QIUB 1D7FA 5EC1B 2B4CC 5IHUH 1OB1B 3DVGA 1AGFB 1NBQA 2X10A 3UPAA 5F8QC 3IDNA 5DJ2A 3LD8C 5D72L 3BAEL 3VXRD 2D0HA 1NANI 5FYKU 1A9EA 2NY0C 4GSDH 1NAMA 1T2QH 5CGYD 3MLTA 2ATKA 1KEGL 3G6JE 1MI5D 5HI3C 4CN6A 3LN5A 5E1AB 5E00B 3BQUD 1XF2B 3WUZA 3FO2A 3HPLB 3LSOB 3UTPE 1S7QB 3LKOB 4GRLA 2P8LB 4U1HA 1F6AB 4NZTL 1J1OH 4MD4A 3SGEH 1RZFL 4K7PY 3LQMA 1ACYH 1B9ZA 5I8CA 3S34L 4GXVH 4W70A 1TTUA 3MC0A 3BD4A 3ZKMD 3TGXA 4TNVF 4U1KA 3S4SA 3SCMB 2C3GA 1A3RL 1GIGH 2DKUA 2GIYA 2CO6B 3NFNA 3U7YL 1LGVA 3QIUA 4NQDB 2WLZA 1VFBB 1M7IB 4M7ZC 4OBSA 4S1QH 5EC1A 5J11C 1OB1A 3C5ZC 1AGFA 3QXDB 4FQHB 2YK1L 4QXUL 4ACPA 1XF1A 1W2KT 3DV4B 4XPGH 1G9NH 5E1AA 5E00A 3HE7D 1XF2A 5F9WB 3MV9D 3HPLA 3LSOA 3DHMA 2HLAB 1AY1H 1S7QA 3LKOA 4JPIB 5IOPB 5JOEA 2P8LA 3MJ9A 4NOFA 1F6AA 3IAPA 4U6YB 1IMHC 5BO1H 4JPVL 4HK3J 4I3GA 4NNXB 2GUOB 4UT7L 1N6QH 1ADQA 1XCQB 4YHZH 1NEZG 4IS6B 3L3OB 3SCMA 3VXUD 2K7QA 3JV4B 1GZPB 3WKNA 4NQDA 3ESVF 1VFBA 1M7IA 5GJSH 3UBXB 2BMKB 3T0AA 2DMBA 4TVPD 3H3BC 3QXDA 5FDWB 4FQHA 4JY5H 3TFKC 5DZOA 4YHYC 2W0LA 4Y5VB 5SWSE 1HYSC 4XVTH 1PBYA 4K55A 4D9QD 3DV4A 2FIRT 1UB6B 1P6AB 4BA8A 3ZZ1A 1A14H 3N85L 2GT9B 2HLAA 5IOPA 2AGJL 4JPIA 3FZUC 4TULL 5I1LB 1G9MC 1KB5H 4U6YA 3DXAD 2X70B 4PJ8C 4NNXA 2GUOA 5KOMC 2A0LD 4XVSH 1D9KC 2Q8BH 1XCQA 1ZANH 1GRWA 3UEZA 4IS6A 3L3OA 3O3AB 1J8HB 5CZKA 4HWBH 4G43B 3TN0D 2CRZA 4O9HH 5JQHC 3C8DA 1U3JA 3JV4A 1GZPA 5E2VL 4HX1B 2VC2L 5GS2D 3UBXA 3HRZB 2BMKA 1NH6A 3PDGA 3JWOL 3LPWA 3OAUH 5FDWA 1R3KB 2A6DB 4DN3H 4WCYH 4PJIF 4Y5VA 3O2DA 4H0IA 1U3HB 4P23B 5DVLA 2VNCA 4XPFH 2VDLL 4A2LA 1DQLH 5TE6H 1UB6A 4OGAC 2VLJB 2HA1A 1E4XL 35C8H 3WXVL 1HCVA 1OAQL 3B4NA 2GT9A 4PRBB 5EBGA 4WW2F 5I1LA 4NWTH 3BE1H 4FG6C 5DMYA 4R9HA 1KCLA 2X70A 2F5BH 4HMEA 3QG7H 4C57C 2CDEB 3IRZA 4X5LA 3VG9B 2QQLL 4MX7B 4JDVB 5JIHA 3O3AA 1J8HA 2VDOH 5BRZB 1RU9L 3KPSE 4G43A 4UT9L 1IM9D 4U3CA 4YDIH 1MSPA 1OTSC 5A40E 1BQLH 4HX1A 1RVFL 3GHBL 3BHBB 4UDTB 2X6MA 5D7JB 3HRZA 3SDYH 5K9OB 1QNZH 4R8WL 4TQEH 4CRPA 1R3KA 1J8KA 2CMRL 1VHPA 1YZZA 3O9WC 3D2UB 1FL3B 3U4BL 4P5MB 4GOSA 3DETC 4P59L 4JG1L 4JO2L 1U3HA 3UDWA 4P23A 4MWFB 2UZIL 1O7SA 4TSCH 2VLJA 3QZWB 1S9WB 2HKHL 2NXYD 3PF2A 3ZTJG 1ERNA 4PRBA 1F00I 5F44A 4JO3L 2ATPB 1JPGB 2XKNB 4K8RH 3S4SG 4N5ED 5I9QC 4HFWB 25C8L 2CDEA 1Z9SA 1GGCL 2D3VA 4MX7A 4RA3A 4JDVA 3BD5A 2VH5H 4LHUB 5BRZA 1MCDA 3N06B 4WEBH 3ZT6A 1FCGA 1AXTH 5HHOE 1R3HB 4HC1L 5M94B 4YHLH 4JQIL 3RWHB 2FZ3B 3BHBA 3MV11 4UDTA 5D7JA 4HFUL 3HR6A 5K9OA 5FXCH 2ZCKL 1UWEH 3QEHB 2LTQC 3T0EE 4FMKA 2K1MA 1S7WB 1ZLSH 3D2UA 3T3ME 1AHWB 1FL3A 4P5MA 4IHOB 2OR9L 5CLTA 1A5FL 1FRGH 4RMTA 1I9JL 4MWFA 5EOQH 3WD5L 2HJKB 3QZWA 1S9WA 1NSNL 1YYLL 2ICEB 5CJOH 5KSUB 1AD0B 3OKOB 2UVEA 2NY2D 1R5VB 3N0PB 1VEMA 3DROB 1WIPA 1JPGA 2ATPA 2X4QB 2XKNA 3GK8H 3QFDB 4JVWA 4WU5B 4Y19E 5DI8B 2RIKA 3HNVH 5J9PB 1JHLL 4HFWA 1S78C 5TF1H 1A1NB 4JJHA 5HYIA 4KKBD 5FA4B 4NHCH 1CWVA 4Z7WE 2B1HL 2C3WA 2XA8H 1RUAH 5K9QG 4UMGA 4B0MM 4HIHB 2QJDA 3LEYL 4KDTC 1R3HA 1MRFL 4M1CD 4YWGH 2MOVA 5DSCB 1YC7A 1MCEA 4DGYH 4LCYB 3VU2A 1DQMH 5ILTL 3RWHA 2FZ3A 3SDAA 1P7QD 1EERB 3QEHA 1KIRB 1F4XL 3C2AL 3U0WL 3QJHB 3H9ZA 1S7WA 1AHWA 3PQYD 4IHOA 3OQ3B 3V4UH 2X09A 1VA9A 4GW5B 4HUKB 2BX5A 2HJKA 2ICEA 1OWRM 3N1MC 3F58H 4HJJH 1FZOB 1WC7B 2JELL 2YD9A 3MOAL 1AD0A 3OKOA 4KWUA 5E6IC 5KSUA 3BT2H 2NY3D 2HAZA 4M3KB 3HZKB 1T04B 3MRKB 1R5VA 3K4ZA 3O4OC 1HQRB 2ZG1A 3TWCH 3BO8B 3DROA 2X4QA 3QFDA 1JRHL 4WU5A 5DI8A 5J9PA 2YPVL 4FQIL 1A1NA 5JHDE 1LO4L 5FA4A 1MJ8L 2BHUA 3UBXG 1S9XB 1F3JB 4HPYL 4PJGB 4RGMB 2JKXA 1FE8H 4R2GC 3ET9F 1U2CA 2WUBH 5EA0L 3AM8A 1FFOB 4HIHA 1OP5K 3LY6A 2OBGA 2P1YA 4M1GH 4MB3A 5DSCA 4LCYA 2WUCH 3RVXC 3QQ9C 1EV2E 2MQCA 1KIRA 1PEZA 3KPNB 3LZFL 4AMKH 3R1GH 3QJHA 4EBQH 5D5MB 5MHSD 2WM0A 3IU4H 2SEBB 4ZQKB 2HYMA 5HJ3B 4P5TB 4GW5A 5E70A 3JTTB 4RIRB 1FZOA 1WC7A 3JWDL 4Y2DD 3NIFF 3HZKA 1T04A 3MRKA 4MMXC 3KS0J 1HQRA 1FAIL 3BO8A 4KROB 2VN4A 5DYOB 4OZIE 4XI5D 3RNKB 3I75B 2PCPB 3SJVB 2G60L 4HULB 1S9XA 1F3JA 4PJGA 4FABH 3FO0L 4AJ0A 4AEHH 3TBSB 3NCBB 1EGJA 4DVBB 1FFOA 4MA7H 2WAHA 5F72S 4G8IB 3VXTB 5GGVH 4HPOH 4GMTH 4Y1AD 3QEGH 3KPNA 1KT2B 3ILQC 1UZ6E 1X44A 4HCRA 5D5MA 3KJ6L 3TV3H 1INEH 3VWKB 5FHAL 2SEBA 4ZQKA 4TVPH 5IG7B 1TZIB 5HJ3A 3WNOA 4NQCE 2DL2A 1K6QH 4P5TA 1XMWA 3QDJE 3L3GB 4Z0BL 3JTTA 2CIIB 4RIRA 4KZEL 4OZGF 3JVGA 2ZPKH 2P49B 5CD5D 1X4XA 1IAOB 3E8UH 5FYJL 5DYOA 3ZT7A 3SKOB 4LCCB 2NW3B 3BMWA 3I75A 3RNKA 2PCPA 4UNVA 4G7VL 3NAAL 4GS7C 3SJVA 5FM5O 4MJIB 3IKCB 3VFSB 1ZEAH 2UVFA 4FQ2L 1NC2B 4LDEB 3TBSA 2O5YH 4LHJB 3P11H 5KVFL 4DVBA 2R8SL 1A8JH 1JGLH 3U48A 4G8IA 3KJ4B 2Z8VC 1NAKL 2CXKA 2GTWB 4PJBB 3VXTA 4ZFOL 1OCWH 5K9KB 4ONGL 3CFJB 5C0RL 3QZWG 4TSBH 4YBQD 3TA3C 1KT2A 1MWAH 2AXGB 5CGTA 2IAND 1OPGL 2Z91B 5CEZE 5GS2H 4ZS7L 3VWKA 3C60C 3T4YB 5IG7A 1N64H 1TZIA 3G9VA 2NX5B 5JTWA 3L3GA 1MPAH 1L4IA 3P4NB 2CIIA 4V2BA 1DBJH 5KZCB 3VXMB 3FQTB 1DLHB 2FH8A 3QUYD 5H2BB 3PXJA 5C1MB 4PLOB 2G2RB 4LHUG 1NFDB 1IAOA 2CUHA 2LFGA 1E4KA 4G6KL 1A3LH 1NANH 4M7LH 4OM0L 3SKOA 4LCCA 5DR5L 2NW3A 4Y4FB 2CH8A 4ZOCA 4K94L 12E8H 4MJIA 3IKCA 3VFSA 1ETZB 1NC2A 1UXSB 2R39A 5CZVH 3U30B 2ESVB 2FJHB 4UILL 4WUUE 4APQB 5T1DL 1JHTB 2GTWA 4L3CB 3BPNC 5I1HL 4PJBA 4BZ2L 1JGUH 2EDTA 2V9RA 4WWKD 5K9KA 3CFJA 1IJ9A 3WSQH 2R0KL 2R56L 4N68A 4X6FB 1GC1C 2AXGA 5CKGA 5DT1L 3KHOA 3O3EB 1Y6NR 2Z91A 1G7PB 1KB5B 2IBBA 3QPQD 1FL6B 3T4YA 4Y4KB 5A2FA 4U33A 2NX5A 3BRGC 3P4NA 2JJWA 3VXMA 3BKML 1DLHA 3FQTA 4X7SL 3O4LE 5H2BA 3U7AA 2HRPH 2G2RA 1NFDA 4GMSH 4Y2OA 1C5CL 4YBLC 1JYNA 3ZE0E 4DQOL 3K8LA 4Y4FA 1TZHB 2HLFC 1HINL 3SQBA 1ETZA 1IBGH 4G9FB 5EIQA 1KJ3L 2FCBA 1UXSA 2ESVA 2FJHA 1NGQH 5GRUH 2AXHA 3PL6C 3JBG7 5ADPH 5FGCB 4APQA 1JHTA 4L3CA 1KGCE 1NMCC 5JR1L 5DURB 1CXKA 1G1CA 1HI6B 2R4SH 3UC0H 2KQMA 4NT6B 4X6FA 4K3GA 3O3EA 1G7PA 1KB5A 2VZ1A 1FL6A 2CK0H 1BGXL 4Y4KA 1NCCH 1FP5A 2FEEI 1CK0L 1PGRB 4YFLF 5L0QB 1PQZB 3GSVB 4N8PA 3HCVB 4XMKH 4HWBA 3O2WH 1CTNA 1NKRA 2QQNH 4CU7A 2QQKL 5FK9B 4QNPF 3SDCB 1HQ4B 1WT5A 3VRLE 4QHKI 2KDGA 3WFCL 1TZHA 1FNSH 3WN5B 2EYTB 4NZRH 4G9FA 2DQGH 1A7NL 2VDNH 1T80A 4M6OH 4K2UH 3NZ8B 3OSKA 1XGQB 5EU6D 3E3QC 3CFEB 1HI6A 4I4WB 3QUMH 2K7PA 4NT6A 3T0EC 1X3DA 4PRIE 1BZ9B 5T1LD 5I1IL 2EDEA 4LU5L 1F90H 1KTRL 3K80A 5E8EB 4RFOL 3DRQB 5E4EC 1PQZA 3GSVA 5SWZD 1JPSL 2I27N 3HCVA 2X40A 3QDMB 1XGUB 4C54A 3AS0A 2H2SD 3K2UL 3ALXA 5FK9A 3LKSB 4POUB 4LIQH 3SDCA 1HQ4A 5EWIH 4E42B 3OZ9L 3WN5A 2EYTA 2AI0L 4P46B 4F7PB 4FFZL 5C70A 2FX7H 3BESR 3O8XC 4ODTH 5IGXL 3RVWC 3NZ8A 3VXPB 4KJPC 4JHWH 1XGQA 3CFEA 1A21A 4J3WA 4I4WA 5FUZL 5I1GL 1CFNB 1ITCA 1BZ9A 3OJVC 1I1RA 5I2IB 5DZNA 3SDXF 5T3ZD 1WFNA 2Q1EA 2NYYD 4MNQD 5E8EA 3AS1A 3DRQA 3LRSB 4P9HL 3PG2A 3RUGF 1YMMB 1F5WA 2BNUB 2NY1D 2EDWA 3QDMA 1XGUA 4JM4L 5DUML 1QBLL 5DRZB 5BS0B 4LLAA 4XMLH 5HHXL 4M5YL 3LKSA 4Z7UF 4HJ0D 1U8MB 5DRXB 1EO5A 2XQYG 4R4BB 3ILPB 5EUOE 4E42A 1NQBA 3PP3H 2WIMA 3U82B 4E41B 1FNAA 3V5HB 4EN3D 4P46A 1CIUA 4F7PA 4X83A 1VKXB 1Z0NA 5FCUL 2X4SB 5L9DH 2AJVH 4D8PB 1I1AD 4EDWL 5JZ7C 3VXPA 2WWMC 3NMEA 1PDKA 5LG1A 1DANU 2QSQA 2Z92B 3VXRB 1T03H 1FNLA 4GRWH 1UXWB 1CFNA 2CSPA 3MNWB 3WFHB 3A0OA 3UTSD 3TBYB 3BQUB 5I2IA 3EZJB 3Q0HA 5I15L 2DICA 5SWQB 1JBJA 4OLWL 2VLRD 3B5GA 4LSRL 1BOYA 3LRSA 4PJCE 3MQIA 4CADB 1YMMA 2BNUA 2XTJD 1MNUH 4MQTB 4XNYH 4OLVH 5DRZA 3RWCB 5BS0A 3JSSA 2YSSB 4NP4L 5E4IA 4U7MA 3OWEA 1U8MA 4PP2B 5DRXA 4R4BA 2V7NB 3ILPA 4NM8L 3GSWB 4N9GB 4E41A 3V5HA 1VKXA 1YEEH 2X4SA 4KKCD 4WHDA 3QNXB 4U31A 4D8PA 3WIFB 3N9GH 4I0PD 3WNPA 1BMGA 4EIGB 5I1AB 3MRRB 4LRIA 1LEKB 2W9LA 2Z92A 5C3TA 3VXRA 1UXWA 4K7PX 4CN1A 3IFNH 2EH7L 5IMOB 1QRND 3EW3B 4R90H 3H3PH 3MNWA 3WFHA 3IDJB 3TBYA 5I1DB 3BQUA 3LS5L 3HE7B 4X7TB 3IJSB 3MV9B 5SWQA 5A3ID 1Q9KB 3B2UC 4Y0GA 3N1GC 2E7LA 3GIVB 2CKBH 4CADA 4L8SC 4PJDB 4YC2B 4QTIH 1LO2H 1TENA 3RWCA 1YEGL 4MAUL 1WGOA 3Q1SH 2YSSA 2G5RA 4PP2A 2V7NA 5C08B 2VLLB 2ARWA 3GSWA 4DAGH 3VXUB 2JJSA 4N9GA 1RJZB 5DQDH 1DQDH 5C0BD 2A1WH 4HH8A 3QNXA 2M2DA 4PR5B 3WIFA 1QYGH 4UTBL 5I1AA 2ED9A 3MRRA 4M4PA 1BQSA 1LEKA 4Q0XH 2VLKD 3LKNB 4HK0B 1CR9H 5IMOA 2J5LC 4JG0L 2BNQE 3IDJA 1U8IB 5I1CH 3DURB 5I1DA 4X7TA 3HE7A 4PY8J 3IJSA 1Q1JH 3MV9A 3P73B 1B3JA 4XP9H 2J8UB 5I1KL 1Q9KA 4N1CA 3GIVA 4JFFE 2VAJA 3DXAB 4PJDA 1E27B 2ICWB 1RUKH 4KAQH 2HVJB 1EPFA 5KS9E 2X89A 4UNUA 4LARL 2PXYC 1HHIB 2EZ0D 4KI5E 2YC1B 3TN0B 5C08A 2VLLA 3RQ3A 3RAJH 1RJZA 4GAJH 5DVKA 1MWAB 1DBML 3TO4C 2GJ6D 4YGAB 4GG6E 4PR5A 3I9GH 2PN5A 1NCWH 3VDBA 4KI1A 3RY6C 1DLFH 4NM4H 4ELME 4M48L 2X1WL 3LKNA 4HK0A 4JB9L 1EHAA 5LQBH 3RZCD 1U8IA 4RGND 3D87B 3MLYH 3DURA 1AP2B 1RZKL 1IGMH 3Q6GL 5IV2B 3P73A 2J8UA 1CXEA 3LEVH 2FB4H 2B2XH 3DXAA 4XRCB 1E27A 1PKQB 2ICWA 4MSWB 3KYKH 4HUMB 5CILL 2HVJA 4Y4HC 3BDBA 4D9LL 3IDYB 2YMXL 1HHIA 1UENA 1C16B 2YC1A 2CRIA 4NQUA 3TN0A 2J3SA 3IDMB 1IM9B 2W9EH 5I71C 5A2LH 1MWAA 1XIWC 3NN8B 5L7XH 4XCFL 3ARVA 2PO6D 1KBGL 2GYSA 1MVUB 3NFSH 1FIEA 3U36B 5JXAL 2A6KB 2NR6D 3MBED 1OM3L 1UQSB 3RPKA 1T66C 1WUNT 1YEHH 2EEBA 1NGYB 1GOFA 5B4MD 1UM5H 1EHNA 5D1QC 4H20H 1BIHA 1AP2A 4H1LH 4X5WB 4H25B 5DJ8B 5IV2A 4DZ8B 2NXYB 4MA8L 3D0LB 3FJTA 1YEFH 2CDGB 4XRCA 1MJUH 1PKQA 4MSWA 3HN3A 4F57H 1TQCC 2VAAA 4NNPH 4G6JH 3ARDD 3PGFH 4NO3B 3G6JF 1C16A 4XP4L 3BFOA 3IDMA 4HMDA 3HC3H 1FSKC 1IM9A 3WEXB 3G04B 2CKNA 5MEQB 3NN8A 2GITB 4GAGL 3MODH 4OSUH 3MGOB 5L8LB 2YXFA 3LKPB 1JF1B 1H5BC 1F3RB 2V6HA 2F19H 2D03L 1MVUA 2RBLA 2NPLX 4F15B 5E8OB 1JZ7A 3U36A 2A6KA 4JM2F 3DSFH 4LQFH 3O2VL 1UQSA 4FHBD 4OIIH 1NGYA 1HHKB 2AJZB 1UCBH 3UJJL 4MVBD 4X5WA 4H25A 5DJ8A 3O3BB 4DZ8A 4IOFD 2NY2B 3NCYP 3D0LA 2CDGA 3NCJL 1EX0A 1II4E 1K2DB 2GK0B 4NQDE 5T3ZH 4UUJB 5E8DL 4YK4B 1UYWH 4XNZB 3CCHB 4YHML 3FKUS 2KPNA 1NL0H 4NO3A 2QR0B 4ZFZB 4ENED 3QUMB 2ICCA 4RAUB 3WEXA 3HUJB 3G04A 3ULUL 5MEQA 3AS2A 4JRWA 3MO1B 1KCVL 1D3CA 4OV5B 2GITA 2XZCL 1P7QB 4X6CB 4I3SL 3MGOA 4PJIB 3LKPA 1GL4B 3QP3A 2JLLA 1JF1A 4Z78B 1H3TA 1N59B 5E8OA 3PQYB 2X4OB 2VABB 4YDKH 5M7QA 5D6CB 1VADB 3ARBB 1HHKA 2AJZA 1CGTA 4LCIL 2VXSL 4ZOBA 3O3BA 3MBXL 1L0XA 2NY3B 4OUOA 3U4EB 3EJZC 3TLRA 3KLHC 5D72H 2XWBB 4ZOEA 1K2DA 2GK0A 3LQAL 3VG0H 4UUJA 2EKSB 1JJUA 4LSVL 2VLMD 1B90A 1NUNB 1PZUB 3CCHA 1A6UL 3ABZA 4GKNB 2DKSA 2ZP0T 4NZDA 2QR0A 3HC4L 3T8XB 4QRRE 2X1PA 4ZFZA 3QUMA 3QUZD 4RAUA 4NZTH 3HUJA 4KKLD 1ROWA 2N1KA 1RZFH 3MO1A 3S34H 4OV5A 1P7QA 4X6CA 4PJIA 3MRIB 1EJOH 3D39D 4YFDB 1F13A 4Z78A 3P40A 2WP3O 1WCBB 2Y9RT 1N59A 3PQYA 2X4OA 2VABA 3TJEL 4X6BB 3C2SA 2BC4B 5D6CA 1VADA 3ARBA 1Z3GL 4LSTH 3O6MH 4IEFB 5ALCL 3RVTC 4Y2DB 2CO7B 3U4EA 1MCSA 4WTXA 1OAUL 2XWBA 3MLXH 4WW1B 4JFPB 2YK1H 3V8OA 4QXUH 5I8EB 1MHHB 2EKSA 1T22B 5I16B 5TDOB 2W59A 1BJMA 1TNNA 2A2QT 4GKNA 5IR1B 3T8XA 4GRWB 5AZEH 1CBVH 2XKUA 5IESL 4NPYB 1KIQB 4JFOB 1IAIL 4ZSOB 2VLJE 2H6PB 1CLOL 2AV1B 3MRIA 4Y1AB 1CFVH 3HB3C 2P47B 2BVUA 3F6LA 4PYHA 1BIIB 1CD1B 1WCBA 3PWUB 5GRZA 5KVDH 3V7AG 2EE3A 4X6BA 5EOCH 2BC4A 1FNFA 2W07A 5FYKL 3I2CL 1CLZL 4DGIL 1ORSB 4UU9B 4K3JH 4Y2DA 5L88H 5BRZE 1PX3A 4WW1A 4JFPA 2YPLD 2IAMD 5I8EA 1MHHA 1T22A 5I16A 5TDOA 3X14B 3HG1E 4PJ7B 4CVWA 5IVXE 5ADOH 1MY7A 2ENYA 2AJYL 4WY7L 2F5AH 5HD8D 4BFIB 2BHYA 2DLEA 5E2WL 5IR1A 2AGJH 4WO4D 4TULH 4U6VL 1MEXH 3I85A 4P9ML 4NPYA 1CFQB 1KIQA 3EDKA 3GEWB 4JFOA 6FABL 4ZSOA 5CSGA 1I8KB 2H6PA 2AV1A 2X9YA 1PYWB 3EYQC 4Y1AA 4XVJH 4J2XA 1IZKA 1G0XA 3MYJB 2MTPA 3CLEL 1BIIA 2HWZL 5MEPB 1CD1A 5A43C 3PWUA 2CKBB 3MA9L 4FFVC 2W9DH 4XC1L 3IFPB 2C4FU 2VC2H 1SEBB 1ORSA 5BZDB 3JWOH 4UU9A 3QUYB 1S8DB 4X4XB 3S96B 1QFOA 4PJAB 1OSPH 1BX2B 1NUDA 2Z8SA 5HVHC 4GQ9L 4NUJB 4L5FL 5CSBA 3T2OA 3T3MF 3QIBD 2WIIB 3IS1X 3X14A 4PJ7A 5EFIB 1IC7L 5F7NC 2QLVB 5LXGL 2XZAH 4BFIA 1J11A 4XZUB 1OAQH 4KQ4L 1N26A 4MJ4A 4KI5C 4A6YL 4WHTB 3OR7B 2AEQL 2H32H 4I9WE 3W2DL 1YA5A 1CFQA 2HFTA 4FQJL 4WWKB 4OLYL 3P0YL 1I8KA 1PYWA 2QQLH 3MYJA 5F7HA 3CLFL 4QTHB 1IQWH 1RU9H 5DVNA 5MEPA 4UT9H 2CKBA 1OAKL 1VCAA 4FP8L 2X4TB 2JB5H 3QIWC 3IFPA 3DARA 5GISL 1BQUA 2C4FT 2P44B 1RVFH 1SEBA 3GHBH 1ZLWH 5KTEL 3L9RB 5SX5K 1RMFH 3S35X 5BZDA 4R8WH 4LRNL 3QUYA 1S8DA 4X4XA 3S96A 4PJAA 4YX2H 2CMRH 3EHBC 1BX2A 4LNRB 4XNMB 4NUJA 3JUZA 4JO2H 5E08L 2BDNH 2WIIA 5EFIA 3TVMC 1GCFA 2FEDD 4Z8FL 3SDDB 1PSKH 4AL8L 4FTVB 3KR3H 1KC5L 4WHTA 3OR7A 2WWKO 1EMTL 5D1ZC 4W81A 1U0QA 3SBWC 5E5RB 4JGJA 3P0VL 25C8H 4HXAL 4WWKA 5FFLA 1GGCH 1BPVA 3NCEB 5I18L 1JNLL 2FD6L 2DQDH 4D0BB 3RRQA 4J23A 4QTHA 2R9HD 2X4TA 1CXIA 4G3YH 4M6AA 4F8QA 4OCRL 3D48R 4UV7H 4JQIH 3C87A 3L9RA 4PJGE 5CGMA 1UWXH 4YE4H 4KMTL 5EU7C 4Q2ZB 4M3JA 7FABL 4NGHL 4UINH 3LDBB 3I3EA 1P4BL 4LNRA 4XNMA 1AXIB 1A5FH 2EICA 4K9EC 3IU3B 3WD5H 4NIKB 4JKPL 4QF1B 3QNZB 1NSNH 4NFCA 3CNKA 3SDDA 1IVLA 3QHZH 4NWUH 4PGEB 5D5ME 4FTVA 4QGTA 1FH5H 2JJTC 3O81A 2N4IA 4QYOB 5ESAB 5AUMB 5CIPH 5EU6B 1XGTB 2XPGB 2IPTL 1YQ2A 3FL7A 4H1LB 4OZIF 4LEXH 1TMCB 3BP6B 4D0BA 1I3VA 1VACB 2VOTA 5T1LB 5ACZB 1U41A 4RMRA 4AK1A 2R0LL 4JN1L 1MRFH 3EYSL 3AFLA 1C7TA 5ILTH 4MDIB 5IEHB 1DUZB 2V5MA 3VFWB 5SWZB 4Q2ZA 3QFJD 3C2AH 4IRJD 2Z9TA 5HI5D 1UZ6F 4P2OB 2X4PB 2HT2D 3V0VB 2VUYA 3IU3A 4WI4A 3U9PL 4QF1A 3QNZA 2NMSA 5IFHH 3GSQB 2VZOA 1DL7H 1LILA 4PGEA 4HS8L 3SEPA 3ULVE 4QYOA 5ESAA 4XAKE 5AUMA 1F4WH 4WI5A 4FQIH 3KYAA 5EU6A 1T0MB 1M7XA 1GOHA 1XGTA 3LAFA 2XPGA 1WBYB 1LO4H 4H1LA 1MJ8H 2R69H 3BP6A 3CFIC 4L9DA 5HI4D 1I7RB 1VACA 3PWPD 4Q9QL 5T1LA 5DC4B 5ACZA 5GS0L 1RUQL 4WFGD 1MCIA 4MNQB 2E7BA 4MDIA 4MJIE 5IEHA 1DUZA 4IRZL 3VFWA 1A0QL 4XTRC 5SWZA 2NY1B 4UTAL 4YDLB 3LZFH 2VZVA 4KZDL 5EO0B 5LWYL 4P2OA 2X4PA 3U2SB 1YY9D 3GHEH 5EZIL 1MUJB 3V0VA 1P9MA 1J12A 3WMSA 2EDYA 5FF6B 4EN3B 5J13B 3JWDH 3I3BA 3GSQA 1MREL 4OKVB 5EZLB 4Y5VC 1FAIH 1I1AB 3GBLA 5ICYB 5HPMB 5GGTH 2NX5E 3PWLB 4QXGH 4XBPB 1T0MA 1YMHB 1WBYA 3VXME 3O0RH 4OCMC 1PLGL 3MV01 4PJFF 5DTFB 5IB2B 1I7RA 4I18C 3UTSB 4NZUL 4RRPA 1TQBB 3MMEB 2BSRB 3PNWB 2VLRB 4MNQA 4Q9CA 4XWOC 5JOPE 3O6FB 3T0WA 2XTJB 4OGYH 43C9B 1T7VA 4HT1L 3JTSB 2RHEA 2F15A 3KJ6H 5EO0A 5D4QA 3KXFE 5FHAH 3U2SA 3FHQA 4YHOL 2VXUH 1BP3B 1MUJA 1IRAY 1UEYA 3K4DA 5GSRB 1KOAA 4EN3A 5FF6A 3REVB 4KZEH 4JFDE 3MFGB 4OLXL 4WEMB 4OKVA 5EZLA 1ZS8B 1P84K 5A1AA 3G5XB 4UBDC 1I1AA 4WFHE 5ICYA 4I0PB 5HPMA 3PWLA 1U3HC 1RIHL 4P23C 1FFNB 4XBPA 5E5MB 4X4MA 1YMHA 2JE8A 3ZE0F 3NAAH 3MRCB 3TYGH 5CKAA 5I1EL 3RA7L 3M45A 3W11C 1QRNB 5DTFA 5IB2A 2DAVA 5ABDE 5KVFH 4DOHE 3UTSA 5A2IH 2R8SH 2I9TB 5TJWK 1NAKH 2DWDB 3MMEA 4OQTA 2BSRA 3PNWA 2VLRA 3K81A 1OD7A 3SPVB 4ONGH 5C0RH 1IGTB 3O6FA 4OF0A 4G9FE 3VG9C 1RPQA 1CTOA 5GGRY 1FZMB 1AQDB 4QT5B 1CGSH 43C9A 3TBVB 3JTSA 4L3ED 3IYLW 4X80L 3EYOB 1IEHA 5FGCE 4F9LC 4HLJA 5HDOA 1E6OL 3L1OH 3RVUD 5IWLA 1SMAA 5GSRA 1ZLUH 5C0BB 5E9DD 4LMQE 3REVA 2NY7L 1WV7T 3P4MB 4I3RL 3K8MA 1ZS8A 1ZHNB 3UJTH 3G5XA 4I0PA 4G6KH 5ICXB 3RJQB 1FFNA 5E5MA 4EZMA 3HI6L 1W72H 5DR5H 3MRCA 1D5XB 2APXA 2EXYC 2VLKB 3V5DB 1A4KB 1QRNA 1EEYB 3FT3B 4JJ5B 4LPVA 3GSNL 3CZFB 2AJXL 1KN4L 5KN5B 2I9TA 3X13B 1RQ5A 1MLCB 2DWDA 5I1HH 3FAWA 4G6FD 4BZ2H 4ONFH 3SPVA 2F8XC 1IGTA 2BRRH 2R0KH 1EBAA 3P9MB 1FZMA 1AQDA 4X7FC 4QT5A 2RFXB 5CUSL 5BV7C 3TBVA 3VFUB 2VZUA 3MLSL 1M7DB 2EDKA 5DJDB 3VXSD 3EYOA 3WV0A 2ZNWA 4Z7NE 5HVFB 4RDQF 4ALAL 2R29H 3WIIL 3SDAC 4JVPA 4GAYB 3OB0K 4H1LG 4KTYA 3UTTD 4BYHA 2GJ6B 3P4MA 2D7NA 1ZHNA 4Y5YC 1C5CH 4F37K 4MMZC 4ODWB 1CFSB 3EDFA 5ICXA 2H1PL 4UZGA 3WYRA 1D5XA 1SJVA 1HINH 2VLKA 3PJSB 4MA3B 4TYUA 2Y5EA 1A4KA 4HWUA 1D6VL 1KJ3H 5DMJB 1EEYA 3QDME 5C92A 3FT3A 5DEZA 4JJ5A 3RZCB 4OCYL 3SN6N 4RGNB 3CZFA 5KN5A 3X13A 4XX1G 1AO7D 1MLCA 3BZEB 3A6OA 3WHE1 1WWCA 3P9MA 3CFBB 2RFXA 4WTWA 3VFUA 1M7DA 3AM8C 5DJDA 1I9EA 3FRPA 3H8NA 2H32B 4X9HA 1L6ZA 1WITA 1A3QA 3LHPL 4HWZB 3EFDL 1CGYA 2YUWA 1I9RL 4FFYL 4GAYA 3D9AL 1JE6A 1Y0LB 2ERJB 2EH8L 2GJ6A 4M7KL 4WEUD 1N4XL 2P5WD 2QQKH 4QRPD 2C26A 2PO6B 4ODWA 1CFSA 2C3XA 1JZ6A 4RRPG 5T5NF 4C56D 2OL3L 2DJSA 3SKJH 5EO9B 3WFCH 1F4HA 3MBEB 3PJSA 4MA3A 4DW2H 5EUOF 3IXTB 3RZCA 2OZ4L 1WAAA 3CX5J 3QQ4B 2ZSWB 4NQED 3BZEA 4OCNC 1U8LB 4PJ5D 1UWGH 4HLZH 4E41E 3QG6B 1JGEB 4N0RA 3CFBA 2QSCL 5CFHA 1CD9B 1ULVA 4M5ZL 4ZUWB 1KXVC 2H32A 4NKDB 3WE6B 4R26H 4LU5H 4OKDA 5AAMA 3ARDB 3MGAA 4HWZA 4XP5H 5IBLD 2NZIA 4RFOH 3VXRE 1RJLB 1QKZL 1ND0B 1T7ZA 1KJ2H 1Y0LA 4ZOAA 1JPSH 4HV8B 2BVPB 2W1NA 1DQTA 2PO6A 4LAJH 3WNLA 5EO9A 2GKIA 4RMVA 3MBEA 4OZHE 4WUKL 4DKDC 5HVWA 3IXTA 4FFZH 1UJ3B 3CVHH 1XGRB 3ELAT 4Y5XB 1MF2H 5IW1B 5CD3B 4FRWA 5BZWB 1DVFC 3QQ4A 2ZSWA 5DC0A 1U8LA 3I6LD 3TH3T 2D4DA 3QG6A 1JGEA 4F37F 4EUPH 1AI1H 4BJLA 4ZUWA 5CIPB 4D3CL 3WE6A 1MLBB 4NKDA 4ZNCD 5KVGL 5LJYH 3GO1L 3ARDA 2AXFB 3BMVA 3M8OH 1O7VA 1RJLA 1QPPA 1ND0A 3FFDB 4M9OA 4P9HH 1OGAB 3EYUL 2E6PA 4HV8A 2BVPA 2NY6C 4I0KA 4JM4H 4LF3B 1QBLH 3ULUD 3VWKC 3ULVC 5HHXH 4JDTL 3MRDB 2JCCB 3WJJC 1RURH 2XN9E 2Y36L 4U1GB 4PJDE 1IT9L 2HJFB 3RI5K 1CICD 4Y5XA 1XGRA 5IW1A 5CD3A 1NCNA 5BZWA 1U93B 5JXED 3P30L 4HJGB 4EDWH 5F6HJ 2C9AA 5C08E 3UO1L 4S10A 1EDQA 3CXDH 2AQ3A 2YZ8A 3S3PA 2NY4C 4TVPE 5CIPA 5J1SC 3CH8A 1MLBA 1AFVH 1INDL 4LPXA 5I15H 2AXFA 1JN6B 1A7BA 2WNGA 3QUZB 5TFSH 4FA8A 3FFDA 2Y1VA 1OGAA 3FFCE 5IW6B 4D9QE 2CD0A 1N2RB 4LF3A 4Y7MA 3SQOL 4ZD3H 1GOGA 2KH2B 4NP4H 3MRDA 2JCCA 4S1RL 4NN5B 1J0IA 1U91B 4TVSa 1LE5B 5F9AC 2HJFA 5BOPA 5DD1H 1X5HA 2RCSL 4LSUL 5IJKC 3WLWD 1JYXA 4JFXB 1U93A 4XNUH 4HJGA 3FRPG 3T0XA 5F70A 5DF0A 4YR6B 4DZBB 5KW9L 3BDXA 1VGEL 4KRLB 5CJ8A 4U2ZA 2EH7H 5FDYA 1YNLH 2E9WA 1AQKH 5FHBL 3U30C 4ELMF 3EUUA 5HGHB 1FVDB 3NBNA 2NY0D 3LS5H 4IJ3B 4LOUC 4P3CL 3BRDA 1JN6A 1HZHH 3QUZA 1OAYL 5HI3D 3IDIB 4C58B 2RB8A 5JO5B 3RU8H 5IW6A 1CYGA 1X5XA 1N2RA 4MAUH 4ZO7A 4PGBB 1X5KA 3QWRD 3ZE1F 3V7AE 1B0GB 4PG2A 4G7YH 1U91A 3GNML 1MQ8A 1CE6B 1H8NA 1PKQE 1LE5A 2NTFB 5I6XB 3HAEH 4KK5D 2VKXA 3T2PA 4JFXA 2VL5B 2YHGA 4UTBH 4N0FB 1NMAH 1WT5C 2B0SL 3HMXH 5FYKD 2VDML 4YR6A 4DZBA 4B50A 3C5ZD 1CZ8L 1FC1A 2OLDA 5HPOA 2IAMB 2L0DA 1JWSB 4GJTB 4JG0H 1S7VB 5ENWB 1XEDA 2YRPA 1FVDA 5HGHA 2BOCB 5GGTA 3QCUL 3U9UB 1TLKA 1MELA 1FLTX 2XV6B 5I1KH 3RI5F 4WO4B 4LPWA 2VO5A 3IDIA 5JO5A 5GGSB 5TQ2L 2BY2A 4L9LB 3BX7C 3Q3GB 1LWRA 4ZFOB 4PGBA 4RFNB 2E7CA 4JGUA 5AYUL 2Y6SC 1B0GA 3W9DB 3LS4H 1CE6A 5L0QC 3S37X 1NDMB 2NTFA 3GMNB 5C0ND 2Q86B 1QFWL 4DFHA 2VL5A 4N0FA 4PS4L 2EDNA 3KGRA 4TUOB 4K71C 4YUEL 2MPAH 4M48H 2IAMA 1UADC 3QIBB 1JWSA 3TFKD 5J3HC 3CZJA 3C6LD 1S7VA 1J0ZA 5ENWA 3S5LG 5KG9B 4NBZB 4OM1L 1HYSD 1MAJA 4KXZH 5CEZL 3U9UA 4FQXC 1L7IL 1W72B 1BFSA 4ODVH 4LP5A 3Q6FB 4WO4A 1HN1A 4POZC 4HGKC 1ED3B 4LLWA 5CILH 5GGSA 3FB8A 3FZUD 4L9LA 3MV8E 1YEJH 3WL9B 3Q3GA 5IFAH 2YMXH 4ZFOA 4PJ8D 4JRYD 5DQJB 1BAFL 3MUZ1 4WFFD 1D9KD 3W9DA 1NDMA 3GMNA 2Q86A 4R7NB 2E9BA 4XCFH 2QSVA 4I2XB 1KBGH 2C1PB 5C0JB 1AD9B 3DUSB 2IBZY 5ELIA 4TUOA 3VI4E 4FXLA 3HUJE 4M61B 2VDPL 5JXAH 1GH7A 1OAZL 1OM3H 1G7HB 4L4VE 2XQBH 2VTFA 4ZDHB 5KG9A 4PJIE 1HIMH 2Y06H 4O58L 5F89B 3GMQB 5EIIB 1W72A 4MA8H 3Q6FA 4OGAD 3PQYE 4HS6B 4R4FL 3VCLB 2F53B 1TCRB 1ED3A 4OLEA 4F80A 2FBJH 5AZ2H 2I5YH 3WL9A 4FG6D 2I24N 3D85D 4MXWL 4O02H 1XGYH 2YD6A 5DQJA 4XP4H 5D2NB 3FB7B 3VGDA 4BZ1H 4R7NA 4MNGB 5F7FA 3H7LA 2VKWA 2MSPA 3DLQR 2YS4A 4J8RB 1QP1A 1RFDL 3EIFA 4IM8A 4I2XA 2C1PA 5C0JA 2D03H 1AD9A 3N1QC 4H5SB 5FUOL 1RIVH 4M9PA 4M61A 2P5ED 3BD3A 3RL2B 4KPHL 3LIZH 1G7HA 3B5TA 5CAYB 5BVJB 4UAOB 2B8OT 3O9WD 4ZDHA 5D6DA 4XVUC 2MKWA 5F89A 5ACMA 3CK0H 3GMQA 5EIIA 3SKUD 5MHSE 4DJMA 5E56A 1MRCL 4HS6A 1DR9A 3VCLA 3NCJH 4K3EH 2F53A 1TCRA 1X4YA 5E8DH 1LDPL 4ODXB 5FGRA 3C08L 4L4TD 4YHMH 3R06B 5D2NA 1ONQB 1OLLA 5E99L 5JIKA 3FONB 3ULUH 1W0VB 3FB7A 2R1XB 3HI5L 3MR9B 5DA4A 3AB0C 2QV2A 4S1DC 4ZNEA 3MACL 4MNGA 2XZCH 1MFBH 3BEWB 4QGYA 4J8RA 3EJJX 3MREB 3QFJB 3SGKA 1XZ0B 4H5SA 4IRJB 5EORH 1V5JA 4JHAL 4PB0L 3QRGL 4OQ1A 1KJ2B 2JJSC 4NKIL 4JEGB 3RL2A 2ZOLB 2ITDB 1KEML 4P4KC 1JTPA 1LHZA 4ODHL 1C5DB 2XFXB 5BVJA 1C5BL 1IGYB 1GGUA 4PFEA 3THMH 2VXSH 4IMLB 3MBXH 4L8DB 3OPZH 3EO9L 4BSJA 2ADFL 3N1PC 2H3NB 3V4PL 2OJEB 3UJIL 4EQ3A 3INUL 5FB8B 3CVHB 3LQAH 4HG4K 4ZO9A 2VQ1B 4ODXA 1X4ZA 4JPKL 2J7LA 5HSFA 4XPBH 1A6UH 1JYWA 5KSAD 2XI9A 3R06A 1KSRA 3PWPB 1ONQA 2OI9C 2PYEE 3FONA 1W0VA 2RQ8A 2R1XA 3MR9A 1XGPB 4EUPB 3AVEA 4JFZH 4S0TD 5F7EL 5D71L 3BEWA 4QXTB 3L3IB 1KLGB 3S36L 3MREA 3QFJA 3CJJA 1NCUA 5EUKB 1XZ0A 2OP4L 4IRJA 5GGQL 1KJ2A 3TJEH 4YPGB 2ZOLA 4JRXB 1YJDL 1GHFH 2ITDA 3BZ4B 4YXLL 3H42H 4X9IA 1C5DA 2XFXA 1Z3GH 4AG4H 1IGYA 4G8GD 4YAQB 4XCCL 2B4CH 4LLMB 2Z31C 5ALCH 2FX8L 4IMLA 4PD4J 4L8DA 4TRPL 1CG9B 1J0YA 1BZQK 1OAUH 2H3NA 3VFTB 2OJEA 5E6ID 5FB8A 3LRHA 3CVHA 3ZSSA 2DQEH 4LSQL 4XHJC 2VQ1A 1VB9A 3C9NB 4CGTA 3PWPA 2DMCA 1S7TB 5F6IB 3V79C 1YNTB 1H8SA 5DC9B 4EI5C 3T77B 2XZQH 1FNHA 1XGPA 4R2GD 4EUPA 4K94C 3WJLA 3EOBB 3NOIA 1CLOH 5LGHH 3PDDA 4QXTA 3L3IA 1KLGA 1J88A 2B20A 1BJ8A 5FIEA 3RVXD 5EUKA 3QQ9D 1T0NB 3IDUA 1OF2B 3CIQA 3SE9L 4YPGA 5JORB 4JRXA 2AJUH 3BZ4A 1F6FB 1MAMH 1QO3B 3I2CH 2R4RL 4YAQA 1RI8A 4NCC2 3L5WB 4LASL 4DGIH 2EDHA 4LLMA 3MLRH 1OQXA 4C4KT 1CG9A 3VFTA 1NCAH 2HMIC 3TP4A 5ANMB 2CJUL 3NIFE 5IJVB 2LV4A 1KYOK 3UTPD 4BELD 3ARUA 2DQUL 2YD5A 4CL7A 3SY0B 3C9NA 3D3VB 3MFFB 4RFEB 5E2WH 2IG2L 2DWEA 1S7TA 5ALBH 1YNTA 5TE4L 1RZ7L 1D6EB 3T77A 1VPOL 4P9MH 4JZJB 2YRLA 3TBWB 4K07A 6FABH 1CIDA 3IDYC 3EOBA 1NBVL 4NRYB 4PP1C 4X8JB 4YHIB 3LH2H 2H9GB 3CLEH 4FTVE 2HTLC 1T0NA 1OF2A 3MLWL 5JORA 3ILQD 4XC1H 4OCWH 1N5YH 1QO3A 4KK9C 3L5WA 5E9DB 3OJDB 5B8CB 4PJGF 4G6ML 4HAGA 3B43A 3LMJH 3HAEB 4GQ9H 5ANMA 5I1JL 4L5FH 5IJVA 3DVFA 1DE4B 3SY0A 1J5OL 3KLAB 4ODBD 3OAYH 3D3VA 3IAQA 3MFFA 4RFEA 4BK5A 3NVQA 4A6YH 4N0UE 4WHYH 1OP3H 1G9MH 9CGTA 1D6EA 2AEQH 3W2DH 1CFTB 5D5MF 4G6FB 4JZJA 4G80B 5JDSB 1ZHKB 3TBWA 4ERSL 4OLYH 4Z7OF 4UDUB 4NRYA 1BF8A 4X8JA 4YHIA 3F7RA 4JQVA 2H9GA 5KSBB 3CLFH 3ZDZE 3VXSB 2WQ8A 1FO0B 1OAKH 4M02A 3ARYA 3TA3D 4PV9B 5EU6E 1NPUA 4DVRL 5GRJL 3BYYA 1DBAL 2DD8H 3C60D 5SWSD 1IC4L 3UXFA 3UTTB 5E9DA 3OJDA 4LRNH 5B8CA 4CMHB 2F58L 1WZ1L 1X5LA 1J0KA 2HFEB 1S5IL 3QXAB 4PJFB 3HAEA 3SGEI 1DE4A 2EDOA 3FRUB 1WFTA 3KLAA 4NRZB 2PR4H 1RUPL 3HMXA 1I75A 2UZYB 4XX1E 1AO7B 1EMTH 1CFTA 2V5YA 1Q0YL 4G80A 5JDSA 1ZHKA 3P0VH 1C1EL 1SY6L 4HXAH 4KKBC 3V7MA 4XNZC 4UDUA 4TUJB 5DGQA 5DWUH 3UX9B 3MCG1 1U42A 3EDJA 5FOBB 5KSBA 1LD9B 3RJDA 3HMWL 3S98A 3VXSA 1T0PB 1FO0A 2CGRL 3R4DA 4PV9A 2FSEB 5C7XH 1XF5B 4OD3L 1TJGH 2YD3A 2CRMA 4Z95L 3UTTA 3LOWA 4KMTH 1BWMA 1JUFB 15C8L 1ES0B 5HYJB 2P5WB 3AUVA 2HKFL 4QRPB 4D0CB 2Y23A 7FABH 1CN4A 4JO1L 4WJ5B 2HFEA 3QXAA 4PJFA 2PKDA 4J3TA 4MNQE 4C56B 4EUPG 3ARBC 3UZVB 4WW2C 1P5UA 3FRUA 4P3DB 4PJBF 4XNXL 3C09B 5D70L 5DMGC 5T33L 4YHKL 4NRZA 4H88H 3X17A 2NY3C 1BVLB 1QSEE 3F8UB 2QKIB 2HLFD 3SE3C 1JV5B 5J8OA 1AO7A 4NQEB 3MRBB 5HGGS 1L0QA 1NAML 3GMOB 4WI6A 3VWJC 4AENB 2DIAA 4PJ5B 3KPSD 3PL6D 4TUJA 2IFFL 3TT1L 1CGUA 3MUGB 4PY8I 2GTZB 5FOBA 1Y6MR 2AQ2A 1LD9A 4WI7A 4EOWL 3W9EB 3C5SB 1B2WH 5I76B 1GPOL 1FFRA 3K4AA 3S8WA 4MA1B 1HE7A 2FSEA 1NFDF 3MV7E 3BEVB 1XF5A 3BP5B 3G6AB 1X9QA 3V6OC 5GHWL 2BVYA 1UJTA 1JUFA 1L7TL 1MQKH 2BFVH 3UTSE 1ES0A 3TT3H 5HYJA 2P5WA 4QRPA 1KN2L 4D0CA 1TDQA 4WJ5A 5MP6H 4F7MB 1ZWIB 2VLRE 2G75B 4C56A 4MLSA 2VL4A 3U9PH 1MCPL 4P3DA 4JKLA 2W65B 5D1XD 4QNPE 3QPXH 3KS0H 1BVLA 3C8HA 4J6RL 1EHLL 2QKIA 5DHVA 1JV5A 3TJHC 2HVKB 3QDHA 4L1DA 5DD3L 4NQEA 4XI5C 3MRBA 3GMOA 3P4LA 4P57B 4AENA 4PJ5A 5JA9A 1F4YH 5HHOD 3MUGA 2GTZA 3VRJB 4XHQA 3TPUB 4G42B 3W9EA 4Q9QH 3C5SA 5I76A 4MDJB 1OSZB 3NPSB 3T0ED 3BEVA 2APVA 3BP5A 3ETBF 5E24E 1ADQL 3G6AA 4IRZH 5FUCE 5CJQH 1A0QH 1QRNE 4UTAH 4HHAB 1T1WB 2E7MA 3PXHA 1OHQA 4KZDH 3ZKXC 4K3DL 3GIZH 4F7MA 3MJ8B 1ZWIA 2G75A 8CGTA 5EZIH 5IK3B 3QHFH 4NC0B 1OT1A 2DQCL 3HNSL 1QBMH 2W65A 1G6VK 2KKQA 1CICB 2HTKC 5DLML 1NCDL 2WZPD 1VGKB 1PG7L 3MUJA 3CGTA 3HA0A 4C4KO 2BJMH 1CL7I 2HVKA 4YHNB 3FN0L 4OTXL 4P57A 5IT2L 3L5XL 2VZSA 3O8XD 4JCMA 3RWEB 3RVWD 2VXTL 4N1HB 4KJPD 4MCZB 3VRJA 3TPUA 4G42A 2DM2A 4NZUH 1KCSL 1JCKA 5TQ0H 4MDJA 1OSZA 5I75B 2DQTH 1TPXB 4GKSB 5TE7L 5JQ6L 3HAEG 3ZHLA 2VLKE 3SDXE 2IF7A 3A67L 5HHME 4HHAA 1T1WA 3DYMA 3AAZB 4HT1H 3B9KA 5DRWB 4MS8C 2HFGL 3MJ8A 2X5PA 3J7HA 2IPUG 5IK3A 1IC5H 1Q94B 4Z7NF 3PWNB 4S1SL 1A7QH 3T09A 4HWEL 1A4JB 1CICA 4V1DD 3EO0B 5JHDD 1VGKA 4ETQB 3O2DL 4YHNA 1MFAH 5IHZB 5CP3A 1RIHH 4B53A 1RUMH 5E7BA 3RWEA 4JR9L 5JZ7D 3DX6B 4UB0L 2GJ6E 2WWMD 3LD8B 4MCZA 5JPMB 5D7SH 3B9EA 5I73B 3HE6D 5IROC 2NY0B 4OD1L 4GKSA 4W6YB 4WWKC 4XXCA 1AKJD 1FORH 3BJLA 3WKML 1CU4L 4K23L 1YN6B 1BOGB 4G5ZL 2VMFA 2F8VA 4ELKB 1ZT7B 3AAZA 1RZKC 1UA6H 5DRWA 2PW2B 1BBDL 1E6OH 5ISZE 4HIXL 1F4AA 3MLVH 1QA9B 1Q94A 3PWNA 5DO2C 5C71A 2GFBB 3SO5A 1A4JA 2D7TL 4TOYL 2IALB 2NY7H 3PP4L 4I3RH 4CBPA 3EO0A 1A6WL 5D7IF 4ETQA 3GJFK 2DQHL 3LCYA 4CJ0A 5IHZA 2VB5A 1EO8L 4M7ZB 4U49A 2NXZC 3HI6H 4NFDA 5J11B 4NQXB 1CLYH 1N7ML 3CDYA 3C5ZB 3BSZH 3SDDC 2NY5H 3DX6A 4N8CH 3L3DA 5JPMA 3GSNH 4E5XB 1UFUA 2AJXH 4KJWC 1HXYB 2YWZA 4Y8DC 4K7PH 4C55A 1YN6A 3QB7C 1BOGA 3CMOH 4NQCD 4ELKA 1ZT7A 3B2UD 3JZ7A 2Q7NA 1MCKA 2PW2A 4HKXB 3QWRA 4JZOB 4TPRL 3WIIH 1QA9A 1MFDL 3T0VA 4PTTB 4JPWH 1NCBH 2BK8A 2DI7A 2GFBA 2ZJSL 4DEPB 1EFXD 2B5IC 2IALA 4OFIA 5BCAA 3BP4B 3TNNB 4XCNB 4NQXA 2FJFB 1NCTA 4HKBB 4PGJA 1PX4A 3C5ZA 3MNVB 3MCLH 3O6LH 1D6VH 4YHYB 3C6LB 4E5XA 5A2JH 1HXYA 3NZHL 1G0YR 4OI8A 3RHWK 3S3JA 2E27L 3QEQE 4JFEE 5D7LD 5CEZD 1P7KB 3UYRH 5B38B 1YEKH 3OR6B 1GC1H 3ARGC 4A6YB 4XT1C 4FS0A 4PJ9C 4HKXA 4PJ8B 3LPFA 4JZOA 3BN9C 1I9RH 5AD0B 2EDJA 4PTTA 2KBGA 2PXYD 1ZXQA 2BP3A 1R0AL 4LFHD 1A7PH 4WGVB 3ZLQC 4Q9RL 4P2OC 3TO4D 4QEGA 1I7ZB 3AS3A 3BP4A 4KVNH 3TNNA 2C7UB 4XCNA 1J1XL 2L4OA 3S37L 2FJFA 4HKBA 1OGAE 5AWNL 3MNVA 3B8YA 3O3UN 5MI0B 3C6LA 4PJDF 2OZ4H 4WI3A 1IGFH 4KTEL 2BHZA 2JCCE 1RULH 3MRQB 4OCSH 4ZS6C 4M1DL 1P7KA 4FQCH 5B38A 5D93B 1HDMB 3OR6A 1FJ1B 2BCKB 1VFOA 4A6YA 1I7UB 4M5ZH 4NO2B 3D85B 3OAZH 3VGFA 1MCQA 4PJ8A 2IBZX 3O4LD 4XPHL 4Y4HD 3VXQB 5AD0A 1MJ7L 4M7JL 4ORGB 5IF0B 5F9JB 2B1AH 3S6CA 4NQTA 4U4BA 1I7ZA 1N6VA 4NN6B 2C7UA 1XIWD 4ZFGL 3TH4T 1V7ML 3WXWH 2P5EB 4LDLB 2J8UF 4UQ2B 4D94A 3GUTB 1ZOXA 1KPUB 4WUKH 3BPCB 4G6AC 3FMGL 1L6XA 3O9WB 4AYFA 4NJ9L 4ZG1A 4Z77B 1T2JA 3MRQA 1T66D 1U8QB 5BW7A 3PHOB 5C0CD 4LHQB 3F7YB 5D1QD 3AC0A 1HDMA 1FJ1A 3K2MC 4WFEE 1U8HB 2BCKA 3T1WA 1EGJL 2QBWA 1I7UA 3GMRB 5E8PB 4NO2A 1EHXA 2FYYB 4L4TB 1UH2A 3D85A 2DBLL 5I9QB 1IARB 3BKYL 1P4IL 2F54E 1MCWM 3VXQA 4X8XA 3NGBC 3O6FC 4RAVB 5JW4Q 2EDLA 4ORGA 3EYUH 4OJFL 5IF0A 3CVIL 5F9JA 1RV6X 1DDHB 4HCRL 4LLDB 3RHWF 4KK8C 4BSVB 1YEIH 1AR1D 1A1MB 1HHHB 3HI1B 4JDTH 4DKFL 3G6DL 5CJXA 1Q9OB 3V2AR 2MCPL 2P5EA 1T1YB 4UQ2A 3LEXB 4G8FB 4B7IA 1HHGB 3GUTA 1RHHB 1KPUA 3BPCA 4KKCC 5J0BA 3A6CL 3O9WA 3V95A 4MJ2A 4WI2A 3P30H 5CWSB 4Z77A 4KTDL 4J4PC 1U8QA 4OF7A 3PHOA 5IMLB 3F7YA 5FUCC 1BBJB 4RISL 1U8HA 3F5WB 1IKFH 3GMRA 5E8PA 2FYYA 4L4TA 4GSDL 1Z9OA 1KIPB 3NIGE 4RCAA 5AAWA 4CDGC 5KSAB 2HRLA 4HWNA 3OL2A 5GZOD 4RAVA 4KVCL 3GKWH 1DDHA 4LLDA 4KHTH 5IMMB 4BSVA 2EE2A 1J1OL 3SQOH 1FBIH 1A1MA 3ULVL 1HHHA 3HI1A 2FO4B 1GAFH 1Q9OA 4S1RH 4CJ1A 4Y88A 1P6FA 1T1YA 2AABL 3VA6A 3LEXA 4G8FA 1HHGA 2QADD 1RHHA 2X9WA 4LSUH 1EK3A 4WDIB 4G8GB 3BZDA 1GGBH 1QACA 1DSFH 5CWSA 3IETB 2GSIB 4PGCB 4S1QL 2EDQA 1X5IA 5IMLA 3ESUF 5KW9H 5E6IB 1BBJA 2ED8A 3KLHD 2V5RA 3F5WA 1I3GL 1ZLVH 5FHBH 2EKJA 1QOKA 3VE0B 3WHXB 3PP3K 5B21A 2FGZA 1KIPA 4ZTOH 5KSAA 4L3AA 3H7BB 2AKRB 4XPGL 5C0AE 1OAYH 4R2GB 4HUXB 1I1FB 1X5ZA 5IMMA 4I77L 4KDTA 5DGRA 5BO1L 3X11B 4URTB 2FO4A 1D5IL 5EZOH 2WBWB 1QLFB 3T08A 1FZJB 1NEUA 5B38G 2EDXA 4WDIA 4G8GA 1H3PL 4WHYG 4J3SA 3IETA 2GSIA 4PGCA 1T83A 3AMLA 3NACL 3QULB 4IMKA 2JTDA 4X6DF 2IPKB 4M8VA 5KVEL 4Z7QE 5E6IA 1ZVSB 3RVTD 1CZ8H 3VI4F 2ICES 3HUJF 4R4NC 4BUGA 3VE0A 2ARJQ 3QCUH 4XVTL 4HF5H 4I2XE 4BQ6A 3E6FB 4X6CF 3H7BA 2AKRA 2YWYA 3DGCR 2RGSA 2XYCA 3SE4C 2VXQL 2EYSB 3DMMD 1A14L 5D96C 1F11B 1ZVYA 4HUXA 4OZFH 1MOEA 1I1FA 2QSTA 2JF1A 4MXQC 1KB5L 1TTGA 5IIEB 4DFIA 2X05A 3X11A 2BSSB 3MROB 1NLBL 1S7XB 1QVOB 3GRWL 4XVSL 3H2WA 4HH9B 1I8IB 3HB3D 1QLFA 4F2MB 1FZJA 2F53E 2ERJC 3RIAK 3V52H 4O9HL 4HUNB 1A6VH 3QULA 1CL7H 5D2NE 2IPKA 1W8NA 4DN4H 3DO3A 4KFZC 3G5YB 1ZVSA 3KAAA 4DN3L 4WCYL 5INCB 4OM1H 4U1SB 1FGVL 1N0LA 3VD7A 1ZE3C 2A6DA 3E6FA 1L7IH 4XPFL 1J9CT 5H37H 2EYSA 2CRYA 2I25N 1CS6A 1ZGLB 4NC1E 1F11A 1R5WB 3GSNB 4NWTL 5IIEA 3DJ9A 3BGFB 2BSSA 2F5BL 3MROA 3DHJA 1S7XA 3ARDC 3QG7L 4S2SB 1BVZA 1QVOA 5B22A 2JIXD 1C08B 1T2XA 3OG4B 3EYQD 4HH9A 1JWMB 1I8IA 4H0GA 3TA3B 4F2MA 3B8SA 2N7BA 4R96B 5C0FB 4FZ8H 4FFVD 4LPCA 5JHLL 3C60B 5SWSB 4LAQH 4YDIL 3SGDI 1HHJB 3SDYL 3EDDA 2WQRA 4YXKL 3G5YA 4TQEL 4GRWF 3CH1B 3BZFB 4Y5XC 2VDQL 5D7KE 3RVVC 5F71A 4DCQB 5INCA 4U1SA 2AQ1A 3QFJE 3RBGA 4TSCL 4R4FH 1NLDL 1A47A 1ZGLA 5SV4A 3UTOA 1R5WA 3GSNA 4KI5D 2APFA 2YUXA 3GBNL 4N5UA 2V17H 1GSMA 3BPNB 3FTGB 5I74C 4S2SA 5JW5B 1TJHL 4ENEC 3ZE2F 1C08A 4P2CG 3QUXC 4KY1L 2I07B 4RMWA 1JWMA 3TA3A 4NN7C 5SX4I 2VH5L 4FZEH 4WEBL 4R96A 5F88B 5C0FA 1MHCB 4RX4D 1AXTL 2W0PA 3C60A 5SWSA 1JYVA 4PJ7F 4LHUA 1GJIA 1RFDH 4YHLL 1HHJA 3PWPE 5FUOH 4U1GC 5GS0C 1UWEL 1ZK9A 4WFGE 3I6KB 4OFVA 4KPHH 4Z5RB 3CH1A 3BZFA 2OM5A 4IBLT 1ZLSL 2WINB 1R24B 4WIQA 3S35H 4DCQA 4Y89A 3EHBD 4YBLB 1U6AH 2CQVA 4FOMA 2JK5B 1FRGL 3DYOA 5EOQL 2DRUA 3TVMD 5CJOL 3RIAF 1MRCH 5JIIA 3GMPB 1H8OA 4JRXE 1T89C 4ZPTB 3BP7B 3KPSB 3PL6B 3WDHA 3GK8L 3HNVL 1KLFA 5D1ZD 3FTGA 1NMCB 3X3GL 4M43L 5JW5A 3O41B 5HYFA 4NHCL 5E99H 2I07A 4PJAF 1AJ7H 3MACH 5F88A 3MRMB 1MHCA 4YWGL 1FYTD 4DGYL 2LE9A 1DQML 2BXZA 2EIDA 4NN5C 4PG2C 4PB0H 3QRGH 3I6KA 5LKNA 4Z5RA 3O6KL 2EO1A 1R24A 2WINA 4AEFA 5EPMB 4OF6A 3VA2C 5D1XB 2JK5A 2DLTA 1MCFA 3HR5B 3EO9H 4YEFA 5F7WC 1H3GA 2ADFH 4HJJL 3WNMA 4S11A 3QCTH 3GMPA 4HEPG 2FECI 3EOYG 4J3XA 3INUH 4ZPTA 2YKLL 2OZ4A 3BP7A 1M1SA 3KPSA 3PL6A 3ROLB 5HHOB 1B4JH 4H26B 4IJ3C 5DFWH 2R0WL 1JF6A 3O41A 1URLA 3OHXB 2Y07H 1LK3H 2PTVA 1FE8L 1ODAA 4OLUH 5ANME 3T0EB 1T5XB 1K8IB 2WUBL 4KRPC 4XH2B 4MAYD 3CX2A 3HFML 5F7EH 4W4OA 3MRMA 3CC5B 5D71H 4M1GL 3D3VE 4FQQB 1TJIL 1CXFA 4JM2C 1KV3A 2IGFH 4WNQB 2WUCL 2OP4H 1DFBH 1X5YA 5E4EB 2A74B 1N3NB 3B6SB 4AMKL 2D2OA 1HOCB 4IRSC 1SBBA 3IU4L 5EPMA 3W0WD 1VSCA 5D1XA 1KCRH 2FX8H 4NQDD 1PKOA 3ARED 3HR5A 4TNWK 2UUDH 3DI3B 5DEFB 1LO5B 1M71B 1WFOA 1LO0H 4R0LB 3O8XB 4IDLA 4RA0C 3ROLA 1ZA6B 4LKXB 5E9DE 5HHOA 1T7WA 1UM4H 4H26A 1IFHH 4JREC 4TN9A 3GI8L 4NO5B 1MCBA 3OHXA 3VW3H 4AEHL 4F7TB 3T0EA 1T5XA 5DFVD 1K8IA 4CKVX 2EE6A 4XH2A 1JGVH 3CC5A 2DDQH 1SJXA 1MFNA 2O5XH 4FQQA 2VSCA 4WNQA 4OGXL 4U05A 5GGVL 3EZ8A 4GMTL 2HT4C 1BFTA 3RWDB 4X0KB 3QEGL 4LVNB 2A74A 4XTRD 5EC2B 3SE9H 1N3NA 5BVPH 3B6SA 3L5HA 3ZDZF 1HOCA 5DDHB 1SYVB 3TV3L 2DQIH 2R4RH 2DLFL 5T5FL 2ILLA 4TVPL 3VDCA 4V1DB 1G7MB 5KSBE 2CLZB 1Z2KA 5JHDB 3H0TB 2DL9A 2OR7A 3UMTA 5DEFA 1LO5A 1M71A 3GSXB 1KIUA 2ZPKL 1E0OB 5T3XE 3BDYL 3KPQB 4QRRD 1BEYL 3O8XA 2DQUH 4HBCL 4R0LA 1ZA6A 4LKXA 4CVZB 1U58B 3MUY1 2IG2H 3HE6B 4NO5A 3BGMB 1HCFX 1ZEAL 5TE4H 3TC9A 1IM3B 4PJFE 4F7TA 2HN7B 3P11L 2AJSH 1AKJB 3HC0B 3OB0H 3I50H 1INQB 3F62A 4FQLH 3C8KB 1NBVH 4NQSB 1OCWL 3WFEL 2O5ZH 3U6RB 3IRPX 5C0IB 4XWOD 3RWDA 4X0KA 3BPOC 5EC2A 3MLWH 5FV2A 1MWAL 1UB5B 2BNRD 5DDHA 1SYVA 3TPKA 5J4MA 2AEWA 4KKAC 4V1DA 1G7MA 3RGVD 1MPAL 2CLZA 5BXFB 5JHDA 3H0TA 3RKDC 3GSXA 4G6MH 2N7AA 2R1YB 1MCHA 5ITBH 3KPQA 3KG5A 4UBDD 4JDZB 3TNMB 4CVZA 2A77H 3ARSA 1A3LL 1I9IL 1U58A 1U3HD 3ARFD 4HD9A 4M7LL 4P23D 5F6HI 2L7UA 3QUKB 5HYJE 2P5WE 3HE6A 12E8L 3BGMA 1IM3A 4HZAA 3W11D 3EJYC 4XP6L 2HN7A 1UH3A 1AKJA 1NC4D 5AG9A 3V6ZB 3HC0A 2C3HA 5IEKB 1INQA 1MIEL 1RAMA 3C8KA 4TNWF 4NQSA 3RFZC 1BJ1J 1JGDB 1JGUL 5F7KC 4NQCB 3GSOB 3U6RA 4NRXB 3P0GB 2Y72A 5C0IA 1MCRA 1TCMA 4NQEE 5DD5L 4OZFB 4HQQH 1UB5A 5F21B 3IDXH 4YEEA 1DBBH 1DBAH 1FVCB 4OIBA 4UOW0 1J0HA 3IJHB 1EFXB 4XCEB 4QY8B 5BXFA 3HG1D 1WZ1H 1A7OH 1S5IH 2R1YA 2HRPL 4NC1C 1CF8L 4JDZA 3KDMB 3TNMA 3ARZA 3QUKA 1XH3B 1MCOL 1JZ3A 2EXYD 2DLIA 2JJVA 1H3VA 2J5LB 5GRUL 1SY6H 2ZUQC 3V6ZA 5D7LB 5ADPL 5IFJB 5IEKA 1JGDA 4ODUB 4NQCA 3GSOA 4NRXA 3MRLB 4L29B 3HMWH 1FVEB 1HKLL 2XT1B 4KC3B 4QOKD 5HDQH 3UC0L 2CGRH 4OZFA 4U0RC 1WLHA 4KJQC 1KTDB 3I6LE 4J3UA 2CR6A 4OD3H 5GXBB 1FVCA 2CK0L 1W0YT 2K3TA 2PXYB 4PJHF 4PLJC 5A16B 3W81A 2IJ0C 2J4WH 3IJHA 1EFXA 1NCCL 3ZT5A 4YXHL 4XWGH 4XCEA 2E7HA 4QY8A 2LU7A 3SDAD 5DJZB 3TO4B 4JO1H 4RGOL 4CDHA 3ZDYE 3LVEA 3O2WL 2ZZUT 2QQNL 1F3DJ 4ODSL 4XNXH 3KDMA 3ZDXE 4DUVA 4YHKH 4I9WD 1KB9K 3B3IB 1DJSA 5CINH 1ZLWK 1XH3A 4NZRL 3VRIB 1GVIA 2DQGL 5F93C 4J12A 3WUWB 1JTTA 1P2CB 3QXUA 3IVKB 4M6OL 5D7LA 5IFJA 2YXMA 4M93B 4ODUA 1UVQB 2YPKB 5GZNC 1SMOA 2BVOB 3MRLA 4L29A 1MIML 3V8CA 5E03A 4BQCA 3QUML 1FVEA 4NFBA 1T20B 3O4LB 3OGOE 1KTDA 2O26U 2D7MA 3CU1A 5D7IB 4H8WH 2PXYA 5A16A 1RIUL 1L7TH 3G08B 4KV5E 5DJZA 3TO4A 5E1HB 1YY9C 1XIWB 4K9EH 1KG0B 4KUCD 1MCPH 1F58H 3NA9L 2FBOJ 2YBRB 5EWIL 1L9NA 3B3IA 3X3FH 5DD3H 1AGBB 3VRIA 3WUWA 1P2CA 1NGWB 5EOTB 3WFZA 5ICZB 5C0CB 4ODTL 3IVKA 2ZUTA 4R6UA 5D1QB 3V0WL 4LSPL 3DVNB 1UVQA 2YPKA 2BVOA 1QSFE 5F6IC 2P4AB 1T20A 3O4LA 3STZB 3MLUH 4BKLB 1TQCB 5D7IA 3QAZC 1E4XI 1MI5B 1XR8B 3SGDH 3FQUB 5HYQB 3G08A 4FNLH 2AERT 4X9BA 1PY4A 4ZAKD 4O2CB 4K3DH 1XIWA 1WAAF 2IWGA 1KG0A 3OJMB 4C59B 4ZO6A 1H5BB 1QLEH 4OIAA 5E6ZA 2YBRA 5DLMH 2GY5A 1NCDH 1H3XA 3T3PE 1AGBA 5C0GB 3FN0H 1R3LB 1NGPH 1NGWA 5EOTA 5L9DL 5ICZA 5C0CA 1M05B 5IT2H 1Q72L 5D1QA 1DVFD 2J6EH 3GSRB 2VXTH 1EFQA 1YQVL 4LVOC 3ZL4L 3DVNA 4PB9L 4XMPL 1WBZB 5IHBA 1KCSH 1Q0XH 2PUQT 3QDGD 1KPRB 4OT1H 1DANT 5TE7H 3JUYA 5SX4H 2D4FA 3STZA 4BKLA 2QQQA 4LMQI 1JVKA 1MI5A 1VESA 1XR8A 3FQUA 5HYQA 5DZLA 4O2CA 2HFGH 1MNUL 4XNYL 2NY6D 4OLVL 1A6PA 4S1SH 1ZTXL 3ULVD 1H5BA 4XAKD 2QADB 5B8CC 1RD6A 2WP3T 3GBMH 5IQ7L 4N0YL 3O2DH 1KNOB 4Z9KB 5C0GA 2ZUXA 1R3LA 4OZFG 1M05A 3U7WL 5F9OH 2EDDA 3N9GL 4JR9H 2Q3AA 3GSRA 4ZFFB 1CCZA 1JPTL 2P46B 1K8DB 1WBZA 5FGBC 2WBJC 4MJID 1C12B 1OAXH 1KPRA 4OD1H 2P8MB 5DK2B 3WNKA 5E7FA 2NY4D 4UOJA 2OXGA 3IJYB 3FOMB 1CU4H 4JZNB 4K23H 3RDTC 4Q97A 2IMNA 2R23B 5CCKL 1RJYB 2CKBL 3ZHDA 5MEND 3MXWH 3W5MA 1DEDA 1BBDH 1EXUB 1LO2L 4HIXH 3VFGH 3Q1SL 4YZFE 4WI8A 4BFBD 2IQAB 2D7TH 4BM7A 4TOYH 3PP4H 4GBXD 5LAXB 2FGWH 2GCYB 1A6WH 2WV3A 5H37G 1DQDL 2VYRE 2A1WL 1KNOA 4HXBL 2R2CA 1EO8H 2VERN 3U83A 3VXUA 1Q38A 1N7MH 5K93A 5DMIL 4ZFFA 3NCYS 4F9PC 2YD7A 5GGUB 1K8DA 4NUGL 4XPTH 4LFHG 2J88L 4KU1A 1C12A 4PJCB 4HUWB 2P8MA 1DP0A 5DK2A 5I1CL 1D5BB 4OLZH 2Q7YB 1J1PL 3IJYA 3DMMB 1Q1JL 2JCCF 3FOMA 1FG2B 3KXFD 4JZNA 4LOUD 5IB1B 2R23A 1J87A 1RJYA 1MHEB 3CSGA 5D8JL 4KAQL 4ZXBD 1JRHI 1EXUA 2H2PC 4JFDD 5EU5B 3CXHK 3WUWG 1CDGA 1FDLL 4P5KB 4TPRH 3SHSA 4WFHD 1NUGA 1IEBB 1JNHB 2IQAA 3ZE1E 2E9IA 3KLDA 5TDNB 5LAXA 3RAJL 2GCYA 3PABB 4GAJL 1KXQE 2XY2A 3I9GL 2FJGB 1NCWL 4ONOA 2ZCLL 5DHXB 1TETH 3QT2A 4XGZB 1DLFL 2WK2A 5C07D 4NM4L 5GGUA 3SOBL 4PJCA 4XB7A 1K3IA 3VGHA 4RBPH 3NZHH 4QXWA 4F8TA 4HUWA 5LQBL 1YUHB 3QCVL 1B6UA 1D5BA 2Q7YA 1IGML 4X9GA 3DMMA 1FG2A 2A9MH 1AGEB 5IB1A 3O45B 5BV7H 3NIDF 5DURD 4BQ8A 2FB4L 2D31B 1MHEA 1JP5A 5IBLC 4MA1C 1MCJA 5EU5A 1SBSH 4P5KA 5DK3A 2JIXB 5L2JB 3M07A 1IEBA 4R3SB 1JNHA 2Y6SD 3FB6B 3MOBL 5TDNA 1VFAB 2W9EL 4AEIL 4Q9RH 2DOCA 3PABA 2Q76B 1JZ5A 5L7XL 4U2YA 4M6NL 2FJGA 3S37H 4D9RE 3NFSL 4XGZA 4QHMB 1ZKAA 1L0YA 3TZVC 5HVHB 4JO4L 2NZ9C 4KTEH 1FV1B 4XBEL 5FECB 4IIQC 1YUHA 5J3HD 2X9XA 4H20L 5KS9B 4FQXD 1AGEA 3O45A 3EGSB 3REWB 4POZD 4M00A 2D31A 2BERA 4ZTPH 4Q6IC 3NPSC 2WWKT 4I13B 4XPHH 1HYRC 2JIXA 5L2JA 4F57L 3NIGF 2R0ZL 3T65B 1YECH 4NNPL 4G6JL 4HDIB 4M7JH 4R3SA 4U6HB 2XNAB 1XT5A 3FB6A 4X6DB 1VFAA 3IB4A 3B9KC 1QFUH 2Q76A 3EDEA 5I30H 5JUEL 4UV4L 1TVHB 4XBGB 3MODL 3W82A 4ZFGH 4JFQB 2DQFB 3UYOD 3K1DA 4QHMA 3CFCL 1PJ9A 4LLYB 1RHFA 3OXRB 2P8PB 3MTRA 4NJ9H 4LQFL 4AIOA 4OIIL 2XG4A 4KKNA 1FV1A 3HNTH 5FECA 3NH7H 3TVMB 1SJEB 1UCBL 5KS9A 1XR9B 1YJDC 4YDVB 1AR2A 4P2RD 5KAQG 5K9JL 5H35B 4GKOA 4G8GE 1EGJH 3EGSA 3TEUA 3REWA 3HHRB 5C3LD 1I3UA 5D1ZB 3RY5A 5I75C 3BAEH 2QHRL 4LSSL 1SY6A 2APWA 3T65A 4HDIA 4U6HA 2XNAA 4OJFH 1EVUA 1KEGH 3CVIH 4OUUB 5F1NB 4X6DA 1EEUA 3VGBA 1B4RA 4NC2B 1FYTB 4MD4B 4DKAA 5E0QA 3FO1B 1IQDB 4CN4A 1TVHA 4XBGA 3OKMB 1I3RB 1U8OB 2M26A 4JFQA 2DQFA 1QG3A 1B6DA 4RWYL 1WICA 4LLYA 3WLWC 3OXRA 2CK2A 2P8PA