2Y6TE

Molecular recognition of chymotrypsin by the serine protease inhibitor ecotin from yersinia pestis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
141
structure length
141
Chain Sequence
QQQPLEKIAPYPQAEKGMSRQVIFLEPQKDESRFKVELLIGKTLNVDCNRHMLGGNLETRTLSGWGFDYLVMDKISQPASTMMACPEDSKPQVKFVTANLGDAAMQRYNSRLPIVVYVPQGVEVKYRIWEAGEDIRSAQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords CHYMOTRYPSINOGEN A
publication title Molecular Recognition of Chymotrypsin by the Serine Protease Inhibitor Ecotin from Yersinia Pestis.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
total genus 16
structure length 141
sequence length 141
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y6tE00
1SLVA 1P0SE 1FI8C 1XX9C 1EZSA 4NIYE 1XXDC 2Y6TE 1N8OE 1ECYA 1EZUA 1AZZC 1ID5I 1SLUA 1IFGA 1XXFC 1ECZA 1SLXA 4IW4C 1SLWA
chains in the Genus database with same CATH superfamily
3NQIA 3AUVA 3D3VD 4L4JA 1HDMA 2HH0L 4GI9A 1OSZA 4JQXC 4F3FB 2VB5A 4HFWB 3NA9H 1TVHA 1ZPLA 1U8OB 4C47A 1JGEB 3RGBA 1L7TH 2C7FA 4WFGE 2I5YH 1IQWH 3MNVA 3V9CA 1BZ7A 5FUOH 3RILA 4APQD 3DK0A 2XWTA 3LV3B 1U42A 2B1HL 4HUCA 1WUNT 8FABB 3ARSA 5F93C 4P4RA 1QNZL 1TJXA 3T2QA 3IF1A 2WSDA 1U8CB 2D7OA 3EO9L 2ZUSA 4F8LA 4CBZA 2C26A 2X2JA 1PQZB 1RK1B 4LFHD 3NCBB 4BRJA 4X9HA 4PGEA 4JDTL 1LO3H 4LE8A 4ZI8A 4D9RD 2VAAA 1WK0A 4GLRH 4KO7A 3MRMB 3F62A 3AS2A 3PNWA 4MS6A 2PO6D 3LXBA 4KO5A 1N2RB 3HRZB 1JZEA 4AENB 3HG1A 5JORB 1KGCD 2A73A 4I87A 2O5ZL 3QGVA 3TBSB 4TNVK 3WFHA 2R56H 4L4TD 1NCIA 2FH6A 3GLEA 1KCSH 4LK4A 3LZPA 5B39B 5E56A 3HE6B 5INDB 3D08A 1ASOA 4YC2C 5E00B 3OKOA 5E70A 2NYYD 4JRLA 4KKCC 2F74A 5T1KA 5L4FA 4V11A 1Q0EA 1RIHL 1TZIA 4K9JA 3FTVA 1BECA 4BH7A 5HVFB 4TL4A 1YEIL 3UH8A 1QR1B 1A7NH 2CIIB 3CK0L 4FXGA 1AD0B 4ZXBD 3U82B 3O81A 2LFEA 1MVFA 3KWWA 3D39D 1S7RA 5D5MA 1K4CA 2AJVH 4HUXA 3QUYA 5MHSD 2MCG1 5JDSB 1OSPH 5CJXA 1E3ZA 2EXWD 4YGVA 2OYKA 2YPKA 4AIOA 1YEWA 3FSVA 1W9XA 1ZTXL 4KHTL 3L4WA 3RWHA 2E75C 4HQQH 5EF1A 3CUPB 5J1AB 4ODXB 5SWQA 2X4OA 3QJQB 2R2CA 2YGQA 5BO0D 2GC7C 1S9YB 4RIRA 2VR9A 5BJTB 2XKSA 3CIQA 2AC0A 3BW9A 1A6UH 3KPSE 3W5NA 3EUDA 4YDIL 2NNFA 3ZTNL 2GBAA 2X89A 4HWZA 4IIQC 3VXME 1GGTA 2K9UA 3FDWA 4YWGH 5L2KB 5JHAA 4OGQC 3CZGA 3AU0A 3QJHA 4XTRD 1PG7X 4GRWH 3LKOA 4NT6B 3SCMD 5F89A 2NY1D 5FW8A 5I71B 3UPAA 5C3LD 2WSPA 3NZHH 4KY1H 5ACZB 4ODWB 2QR0B 4L8BA 1JK8B 2X9ZA 3D3VE 1A4AA 1WUZA 3HB3B 4Z3EA 4DF9A 1S78D 4WIQA 4DZBA 1X6LA 7PCYA 2COVD 2IPKB 3RZCB 1AR1B 3WMSA 3P4LA 5ADPH 5I1EL 2IVFC 5DMKA 3MN8A 3FS9A 5FO8B 3BT2H 3VFWA 5MP6L 1H8NA 4ZAKB 4ABQA 3WENA 3A4EA 4YDZA 2JKIS 1GGBL 4P3CH 3OC8A 3K5RA 1MFBH 4RX4D 4JHVA 4KKAD 3GSWA 1CTMA 5DFAA 2R27A 4AYMC 3EDKA 3N50A 1TEGA 4MQTB 1T80A 1H5BC 1YN6B 4AM0B 4HJJL 5ID0B 4E2OA 3VXUA 4PJ7B 3WO4C 1D7CA 4YE0A 4D9RE 1SNRA 3G6DL 4NP9A 4NRYA 5HPOA 1FAIH 1OAQL 2VDMH 2WP3T 3IBOA 2F7QA 3WV0A 4EQ2A 1DUYB 3DYMA 1E6JL 4IRSD 1KGCE 3MUZ1 2C1OB 3H0TB 1NCAL 4I0PD 3BISA 4N4YB 4L4TE 4N8PA 2YGPA 3L3GA 2OBGA 2KDYA 3QQ3A 1UQSA 2EVJA 4M93C 3IAQA 1P7HL 5J89A 5DT1H 3ARDA 2OMTA 1T5WA 3FOLB 4CADA 3FOMA 2I7OA 4FNUA 1SN5A 4OCYL 1DEDA 3ZRCC 3NSCA 4ZUSA 4EIUA 1GYWA 2VISA 1WBYB 4AGPA 4JJHA 2DS4A 4NERA 2LLNA 5E1QA 4YSAA 5D96C 3R1GH 3WTXA 3U7YH 3D39E 2MTAA 1N7ML 1DQDL 4HK0A 1WWWX 4W9IC 5MHSE 4IOSA 4AZUA 1QAWA 2DQFA 1N5AB 2Y4SA 4UDUB 2FJGB 3N5AA 3DSFL 5TPWL 5I0WA 1JZ8A 5C08B 4QRFA 4GY4A 4QAMB 2FE0A 3S2CA 3TEUA 3INUL 2ZQKA 3QXAA 1OLZA 2IXQB 1WISA 1YY8B 3MNWA 4H8QA 1UM5L 4HIJA 2ZWKA 2IH1B 3DXAB 5BUPA 3EO9H 4M9PA 3SE4C 2X12A 5ERWB 2BSSB 3EOYG 4Q97A 4GG6F 1MQKH 4OT1L 5I0XA 4NKOA 4DP9X 3GMLA 4MA3A 1TTCA 4JDTH 5CP3A 3N40P 3JZ7A 1XQ4A 4N20A 2ICWI 3APMA 4PJCE 1FDLL 3P3SA 4UMSA 1TQSA 1NTDA 2O5ZH 3DO7B 4YS4A 3FUMA 3OMZA 1BD2B 4ZS7L 2B8OT 5ICZA 1T20B 3Q06A 4XNQB 3P3UA 4OZ4B 1N9PA 1EANA 3OZLA 4FNLL 2ZNXA 1IM9A 2WUCL 1KIUA 5CR1A 1R3JA 3GSQB 5HYSG 3BRFA 2ZUQC 5IP4A 2Y2WA 1ZVSB 5FM5M 1JIBA 1RIHH 2Y7OA 1PSKH 2F54B 5J3HD 4I1NB 4C8XA 1NBVL 5DD3L 3E8UL 1OQOA 5EU4B 3DX9B 3CK0H 3C5ZB 1ZVHA 1D5RA 1EGJL 5I0VA 4PJ8B 3CDFA 3D3VA 1EAPA 4RETB 1J86A 3CLFL 3EFOA 3SPJA 1BHGA 3VFUA 1LMKA 3LPFA 4DKDC 1HNGA 3BIKB 4NQXB 5JUEL 3V6OC 4PJEF 3RRQA 3DGGA 3MV8B 5BXFB 1LWJA 1ZTXH 3TBYB 1RFDL 1W6WA 2NY7L 4DVRL 5I66B 4LDCA 4HBQA 2E9GA 4APQA 4J28A 1XD0A 3X1FA 1MCRA 3QG7L 2YD1A 1A9BA 4N85A 1JE6A 2VE6A 5FWRA 1CE1L 1G7LB 5AWNL 1D9KC 4LVOC 1B0RA 1F0LA 2VDPL 1BXUA 2O5YL 4B60A 5IEKB 4F8TA 4ISVA 1QO3B 4G7YL 4N5EC 4W9LC 3GRBA 1KJ2H 3CXDH 4XMKL 3OLDA 4OQTA 5FGCE 4LP4A 4JM2C 2PO6A 4LSTL 2ICEC 5DK0B 4FXTA 3RGVC 2BVQA 4WTZA 4IHOB 3ETBJ 2A9NH 3STZB 1JGLL 1LL1A 3ZHFA 3ZO9A 3TVMA 1U8MB 4CU6A 1MW0A 4X80L 3GRGA 1UT1A 3KPRA 4JFFB 4AJ0A 1YUHB 5C0ND 1PVHA 3QZOA 1B2YA 2VXTL 1H5BA 2AV7A 5I1EH 5F7BA 2AJXL 2OMNA 2VRAA 5MP6H 1OD7A 4YSPA 5ENWB 3SB3A 4R7DB 2P7TA 3B7SA 4OV5B 1DEEA 3M1BB 3PWLB 3RJOA 2N1TE 2AJSH 3BGFC 3L95B 4DK3A 2FNBA 2VIRA 1ZHBA 2GQHA 1I82A 3K8MA 2Z8WC 1QRNB 7PAZA 4HJJH 4EEEA 1ZHLA 4WW1B 4GRLC 4G9DA 4GFTB 3QAZB 2UWEE 3D39A 4M5SA 5IHZB 1B0IA 3GEFA 1NBCA 1OAQH 4YOKA 3SE9L 2DL2A 3UPRA 2H2SD 2WK2A 1PL3A 3IETB 1JDAA 4QTHB 3ZL4L 1UATA 3WXVL 5L9DL 3WDIA 2OULB 3KHQA 1KV7A 3QEHA 4HIEB 5I5MA 1OSEA 4PJDA 5FEBA 1NCAH 1SXAA 3WS3A 2IH9A 3OSKA 3SSGA 3NSFA 1D5XB 2X7LA 1HILB 1HIML 3T2NL 3VFVB 2VLJB 1YPZB 1R3HB 3JVGC 3Q05A 2G75A 1ZT7B 2D2CC 1OD9A 1ZLDA 4M1DL 4R90L 5EC2A 4GUCA 2FJUB 4PB0L 4RSYA 1X5XA 4EI5D 1KELL 2ITFA 1I1YA 1WE5A 4WSKA 2ZWNA 1WG3A 4DP2X 1MXDA 5C0AD 4OCYH 3ZK0A 5ADOL 1UUNA 5FA4A 2RQ8A 3T8MA 3QA3B 3F58L 3MROB 3Q8EA 3SCMA 2LU3A 5AUMA 1TG8A 3C6LD 5HJ3A 1WA1X 5JXED 2BOLA 4O2FA 2BNUA 2OMVB 5FDWB 5IJVA 3N44F 5EULV 1N7MH 3BWUC 3WY1A 4Z18A 1X5JA 1IQDA 1DQDH 2AQ1A 2XTLA 4AYDC 2YBRB 3OHXC 4X6BB 2A74B 2Q76A 5J12B 3H9SA 3SE4A 2ZOLB 4PCSA 5GISL 4E9QA 1AHKA 5INCB 1TVBA 3DSFH 5TPWH 3PHQB 3MLZL 1Y7VA 1VADB 1S7XB 1K5NA 3INUH 3S8FB 1ZXQA 2P26A 1XTMA 2J56A 2J21A 2P5WD 2Z91B 3GJFB 4WW2F 2VH5L 3GUTB 5CJQL 3PWVA 4TSAL 5BVJB 4N8VA 2CJ3A 35C8L 1T5KA 1SJHB 2J7LA 2ADIA 1KLFB 3MRNB 3QUKA 4HV8A 4J6RL 3T4YB 3JV5A 2MNUA 4HZLA 4BXSV 1Z0MA 3NCFB 3GEWB 4UU9A 4HJGA 1BVNT 3LKQA 1KDIA 1QMUA 2BXYA 3FQYA 5KBDA 1QKZH 3FYIB 1PJ9A 3H4HA 3QDGD 3K8LA 2AQPA 2PWFA 1S5HB 1ITBB 3E6FA 4QHMA 4AC2A 4ZS7H 5BW7C 1WBZB 2EYSA 3AREC 2AABL 4FULA 4LASL 2AAVA 1QR4A 2P42B 3B6SB 5J9PA 2G9KA 4FNLH 1AGDB 2V8MA 3NIFB 2J8HA 4W9KC 4B7IA 3NCYS 3VW3L 4E9VA 4H7VA 4JRYD 3TPUA 3QIUD 3UGUA 4KWUA 1KXVC 5LBSL 4WI9A 3MUJA 1ETA1 3NIGF 4Z7QE 3O4OB 2IAMC 3L7EA 1BXXA 3H3BC 3HS0A 4JGNA 5HYSB 1NBVH 3NJMA 2CAKA 5DD3H 3E8UH 3MJGX 3LXUX 1YAIA 2CCLA 3BMVA 2UXGA 3BZ5A 4OKDA 3II3A 3PWJB 4S1DC 4XX5A 2R0LL 2IH3B 4OI9A 5F0LB 4WSGA 4F2ME 2MCPL 2YD4A 3X13A 3MRIB 3MRLB 3E2HC 3U9UA 1KXHA 2VCOA 2IIJA 4I0CC 5D6CB 1G7IB 3IKCB 2HVJB 4FQJL 3TH2T 2E4FA 4J2XA 3VRJA 3CJJA 3GSVA 5DUML 1GSMA 1WWBX 2YZ1A 1BZOA 3CDGB 3QG7H 4MAYD 2LTQC 4X5PA 5D1ZB 2ICEA 1RCYA 1TPXC 5I26A 1CE1H 5LHDA 2MHAA 5AWNH 5C0AE 2VDPH 3FK3A 5EO0A 2O5YH 1SFDA 3LIZH 4LU5L 5TE6L 4OZHB 5I18L 2UWEA 2G5BA 1P7QA 1ETJA 4G7YH 1ULVA 4NQTA 4WEBH 4QHUB 3I2CL 3T2LA 4XMKH 4UTBA 1PCSA 5EZOL 2XZAL 1EX0A 4GYBA 1TJHL 4GP8B 3V6ZB 1U8NB 3TO2A 3GI9H 4FXLA 1QD0A 1GOHA 1VFBB 1R9FA 4HWBL 2DTSA 1GY1A 4KO6A 1GC1H 1T3FB 2NY6D 2RJMA 2W88A 4EUPG 3HCVB 4XBEL 4JY4A 2YRPA 3T08A 4JFPA 3RUGE 5B22A 5AD0B 2VXTH 4OU3A 4JFQB 4YHIA 3DUUB 2MQ3A 2AJXH 2XT1B 3DX6A 4GRLA 3S88L 4GXUN 4Z7NB 4RMRA 5KVDE 3L5IA 2P5WE 1S3RA 4P2RB 3BUIA 5JIKA 4HP5A 5F9JB 4B53A 3O3BB 4XZ4A 2ESVD 3OXSA 4PU2A 2ORBL 3H7LA 3TFKC 1DVQA 3TT3L 5IUCA 1Q9KB 3MMEB 3OG4B 3S8WA 1Y0LA 3GHPA 4Y4KA 3B9VA 3VMNA 1U58B 2KT6A 2Y1ZA 2HMIC 2EIBA 1F18A 3RG1C 4HXAL 3FZUD 3SE9H 3ZL4H 1LP9A 4TNEA 1I8UA 3WHE0 3QDGE 1EEYA 2MRYA 3GMPA 1T7ZA 2ADGB 3BCFA 5ICXA 5E8PA 1TUPA 5ABZA 3UTSD 4GSXA 3PABA 5CGMA 1TIUA 3U79A 3BAIA 1F8TL 4P9HL 5B38G 2R15A 3QI9B 1PMYA 4I77H 4R90H 4M1DH 2E7LC 3QH3B 3EYUL 4YBQD 3UMTA 2DH2A 1I7RB 3QRGL 2GJZA 4IHBA 4NQCE 4PB0H 3PWUA 4JRYE 3QPXL 1ECZA 4JY6A 1OAZL 3TT1L 5IW6B 2FIRT 3RWGB 4YSTA 3FFOA 4P5TA 4TSCL 3V5DB 3FB5A 4NNXA 3RGHA 3F58H 2BOBB 4NP4L 4WUUD 1JFQL 3BLPX 4OGAD 5DMGC 4PVBA 25C8L 4OY9A 4LVNB 2AXFA 5CEXB 4J3WA 3HR6A 1ZT4A 5GGTA 4PJIE 4XAWL 5GS2D 1F41A 1XGPB 4N2BA 3ETBF 1E7VA 1MXGA 1VFAB 4HWUA 4QHLB 4DVBB 1UWGL 1NA8A 4X9FA 4MXVF 4RMUA 3U4EB 4PCKA 1BFVL 2EEFA 3F05A 3MLZH 4GIPD 2MKWA 4OD2B 5CD5C 1SHXA 3VXSD 3EKCA 5KG9A 2JKXA 1PZSA 2VR3A 4FZEL 4A2GA 4L8CA 1EO5A 2JJVA 5LLIC 1JPEA 3SGEI 2VH5H 5CJQH 3I02A 3Q2VA 4XMXA 1CLOL 35C8H 4UBDC 3M7OA 4MVBD 4HJSA 3MV9B 4LCCB 4GI6A 4YDJB 3QZBA 4J6RH 4RMSA 2O1AA 2WWKT 4F2MA 3UL4A 3LKRA 4PPTA 2PTTB 1ET8A 2YD8A 2ZSVB 4AG4H 2XXGA 1A7BA 2FD6L 1GGUA 1RLWA 2G3ZA 4CVXB 5A7EA 2X28A 4JHUA 3EJZC 4C59B 3CE1A 4TNVF 1E28A 1RXLA 2ZUWA 5FCSH 1EZLA 1F3JA 3P73A 5ESQB 5CCJA 2AABH 4LASH 5D4HA 4B5EA 2HFGH 4MNQD 1J8HD 4OCSL 1MVUA 3TBVA 2CM6A 4F9PC 3VW3H 2XVBA 2CDEB 3V9FA 3ULVF 2ROXA 3BVWA 5LBSH 4XZUA 2PP8A 1M3IA 1CDGA 1H15B 1A7OL 2ESVE 4I3SL 2M8XA 4X8JA 3C6LA 5I75B 5JXEA 1NBYA 4NO2A 2ZX8A 2WTRA 1L5GB 3NBNA 4FC3E 5EZJA 2R0LH 3CFKA 3BZFB 2CLVB 2MCPH 5J5EA 2YS4A 1U3YA 4Z7WA 2VC2L 3CBRA 3GKZA 1MJ7L 1MN4A 4ZX5A 5GSRB 3KW8A 4FN0A 1JN6B 4X98A 5SWZB 5EEUA 5LCVL 3K4DA 1LM8V 2X6UA 1AXTH 2JCCF 4YPGA 4QRSA 3UTSE 4FQJH 1E3XA 3MRCB 4PBVC 5DUMH 3RURA 5HGBA 3MRJB 3PRZA 1MNUL 3BPLC 5GJSL 3OD3A 1UB5B 1AHWC 2HRPL 5IJBC 4PVNA 2XWXA 1BFOB 3ROOB 1NUNB 4H8PA 3MJ9A 1P6AB 1IGYB 2OLDA 2VC2B 1I3UA 4ZPTB 1K2DA 1JK9B 3WLBB 1DQJA 3P11L 5I18H 2ENQA 3J8F7 5IHBA 4OI7A 5D1QC 3I2CH 4WUUE 2BVPB 4NZJA 5EZOH 2XZAH 1FFPA 3P4MA 3FQTB 1RZIB 1TJHH 3V5HB 5JHLA 1NPJA 3OXRA 3FFCE 4KKNA 2KL6A 1NC2A 2KERA 2WWOA 4BQ8A 2IBBA 2OMZB 1ZLUH 4XGZA 3CSTA 4F92B 2X4NA 2X3AA 4KK6D 4XBEH 3QJVB 3LH2L 2XN9B 1YEDB 4G72B 1V27A 3L4TA 3L3OB 4NQCA 3WIFA 1UADC 4JRYA 4EUPB 4V33A 3VXSE 5FF6A 3S88H 3EFDL 2E47A 2HTLD 3LNDA 3SDDD 5I15L 1GS8A 4MX7B 3UERA 4GO8A 1CXIA 2I07B 3FT3B 4PLNC 2ORBH 2CJUH 2H2PD 3QHZL 1YECL 3L5WB 4G8FB 3MRKA 1NANI 3U1SL 3T0EC 4HXAH 3T0DA 3NH7L 1PIFA 3UYPA 4Z3TA 4NQDD 4MA8L 4PV9B 3REWB 3HPLB 2DTML 3QUZA 4J3SA 4U1MA 2AJUL 2EDNA 4FJ6A 5DUPL 3UTTA 5BZWA 4UM8B 3EJJX 3TCTA 3NZ8A 4P9HH 2ATPB 3BEVA 4PY8J 3JV4B 4MNQE 1J8HE 3TJHC 4OAWB 2HTKD 2JIXD 1R3LB 3QRGH 3AG3B 4KAQL 1MREL 5E4EB 5LBVA 3T6XA 5K9OA 3QPXH 1BOGA 5ECJE 5B38B 1OAZH 3TT1H 1BBJB 3A6OA 5IMMB 3VD3A 2XX1A 5FYJD 3LIUA 3HI1B 4TSCH 1OTSC 1NH6A 1QQDB 3L16A 5E1AB 1XGUB 3P9MB 2NY3B 2HG5B 2WZAA 2X2YA 4NP4H 1MW1A 4A68A 3Q8AA 1A65A 2CNZA 1XD1A 3QK0A 1TVDA 5DHVH 25C8H 3WNLA 3VUAA 4Y19B 2Q2LA 3LNFA 5HHVL 1GC1C 3VWJD 3OC5A 2XVGA 1WVZA 2DBJA 3NCYP 1UWGH 5KN5B 2N4IA 3PUUA 4P0DA 4P49A 3HUJE 3BRDA 4ALAH 1BFVH 1ZD6A 2CO6A 4LRNH 4HEPG 3CXHK 2EP6A 3GRWA 4W4NA 4KXDA 4FZEH 4BM7A 3VWKD 3SY0A 4OJYA 1BJ1H 3TNMA 1FHGA 2ESVA 4FQPA 4NQQA 1M1XA 4Q7DA 1CFMA 1CLOH 1O9WA 1T0NB 1U91B 3CFEB 1P2CB 1VGEH 2N56A 3MCYA 1T7XA 5I0ZA 4HMDA 1MJUH 4MB5A 5C07E 3FCBA 3N55A 5KVFE 1CDHA 1A1OB 2B1AL 2FD6H 2EXTA 1UA6H 3MRHB 1EHAA 4F9PA 4DO5A 5IJDC 3NCEB 2CRYA 1HH9B 3WJJC 1WIUA 2OXGB 5ID1B 3MCG1 3KYKL 2WLHA 4L1LA 3KH4A 3LPGA 5ITBL 1KCUH 3ARWA 1ZGLP 2VOTA 1OP4A 3NRPA 4DPBX 3EW3B 4N2GA 3PG2A 4HHGA 2WO4A 4OCSH 3VRLF 4DAGL 1KXTA 2NXZB 3HN5A 5SX4I 3MFFA 5C0FB 3P40A 5DRNA 5BRZB 1NCJA 2YUVA 3TBWB 1B9ZA 2CDFA 1A7OH 4FQHB 3C09C 3TA3D 4AJVA 4ZX6A 3IXTB 3HIZA 2BNRD 3WGUB 3U36A 4G8GD 4GSRA 5DMYA 4S1RL 4GBXD 3RVXD 2QKIA 5F7DB 3FFCA 3VI4B 2VZSA 1P9MA 2W0FA 4MDRA 5SV4A 1BP3B 5ID0A 1VZHA 4HKZA 4NQDE 5ANMA 3CX5J 3PV6A 4TTGA 2J1XA 3M8OH 4X4MA 3TBTB 1UUSA 5LCVH 1TQBB 5IBLC 3O9WC 1EVUA 1U6AL 3IK2A 3P9LB 4JN2B 4MSWA 4QRRB 2Q6WB 3RWJB 3W11D 2DLHA 3CH1B 3VXSA 4M43L 2YAOA 1GS6X 3T3ME 1XAKA 4XPFH 3CC5B 1MNUH 5GJSH 4JKPH 2HRPH 2BO0A 1F6LL 2C3GA 3BP6A 1YNLL 5JO5A 3CFQA 5IHHA 4TNGA 2HN7A 1XFPA 4KQ4L 4AW7A 5FYJE 4FEMA 4O02L 1S9VB 5AKSA 1XCWA 1CICC 1MUJB 2QELA 3NZSA 4I2XB 2HPTA 2W60A 1AO7B 4KUZH 5AW6B 3BVUA 3PLYA 3GJEB 4L3CA 1BPLB 3PJLA 3LEXA 5CSBA 3QQ4A 3FSWA 4OF0A 3ZE0F 1A4JB 1FNAA 4UQIM 3TM6A 4R3SB 5KAQG 5IMOB 1WDAA 1A22B 4JZNA 5GRUH 4POYA 3B9DA 5FM5O 3A6CL 5I74B 3ESOA 4N0FA 3HZVA 1HXMB 2QGDA 1J8HA 3LH2H 3MVSA 4GLRI 1XL4A 3SKMA 1ACZA 2AEPL 1ODUA 5DA4A 4PS4L 2ZUVA 3MBED 4H8WH 4IJTA 2EACA 2XXCB 3BQUB 3P3YA 2IF7A 4ELMF 5MEND 3OTTA 4DN3L 3V10A 1VERA 2DBLH 5I15H 4ZMZA 3C2AL 1EHLL 4KC3B 1XCTA 3SKOB 2OMWA 4GUPB 4F7PB 1OLLA 4LHUG 1FBIL 4JDVA 3ZKNC 3CVHH 4L0PB 3G6JF 4R8WL 3WO3B 3QHZH 1YECH 4P4KB 1LQBC 2B16A 5J11B 2GEQA 4LP8A 2A6KA 4X6DF 3GJFK 2IOOA 1AS6A 1DE4B 2MQGA 3U1SH 2MOVA 3MLRL 1OGAB 4KNQA 3FF7A 3GNMH 1CDBA 3NH7H 1JXKA 3Q6FB 5DJ6A 3IS1X 3OKKA 4MA8H 4FI8A 4X4XA 3D69B 1NAKL 2R7EA 2Q8BL 3RB5A 1CYWA 4GG6A 1YO4A 3HUJA 1ZLWK 1PS3A 2AJUH 2FWLB 5C2BL 5DUPH 3K0YA 4OBRA 2NCEA 3SDYH 3K72A 4FXKB 3RP1A 4NQVA 2CE6A 3HLAB 1G1CA 4WW2C 3RKDC 4Q2ZB 2EDFA 4BZ1A 1DBKH 3NACL 5DWUL 5AW8B 1GTFA 4P2OD 1MREH 2C5DC 4WNSA 4RISL 3VDCA 1U9KA 1UWXK 4NN5C 2IC2A 1SPDA 2RH0A 2NZ9C 5C07A 3SDAD 2BNRE 1NUDA 3U83A 4XWOD 2UUDH 4G8GE 1S9XB 3BE1L 4AQZA 2W80C 1U8QB 1HCYA 3ECVA 3U7WL 3RYMA 3KPPA 4MKTA 4TMPA 5EC1B 3SKJL 3U6RA 3CH8A 3T3PE 3T77A 4HIHA 4BK5C 1I9RL 4RAVA 3C87A 5HHVH 5LGJA 3GBEA 4L3EB 4QRPD 1DQVA 2ZT9C 4LOFA 4FHKA 4KMQA 1KTBA 4N6RA 2W9EL 3FN0L 3EYVB 1KCLA 4N0CC 5KBMA 5BCAA 1J5IA 1WD9A 4LF3A 2O5XL 3QQ9D 2VLKB 3SDDA 2WHVA 1NGZB 3KDMA 4X7EC 5FWQA 1MHHA 4F20A 3NAAL 2D7MA 5DZJA 5CJ8A 3QJOA 5G55A 4OZGF 3SYCA 2B3RA 3GKWL 3UACA 5DEGA 3N43F 5DJ2A 5ES4B 4Y4HB 5DDHA 1HSAB 1K8IB 3P30H 3ZDXE 2K6WA 3ARBC 4NQDA 3B7YA 3T65B 1SY6L 4OFDA 3KWVA 2BY0A 4DHLA 2WVTA 3MV11 2FCBA 3QORD 3KPQA 4HUWB 3BZ4A 4YDVB 4XNYL 2YAPA 3QRLA 1KIRA 4YNYA 3KYKH 5AQ0A 4PJAE 5ITBH 5EZLB 2ZYRA 3QBTB 5DFVD 1B90A 1JPFA 4DAGH 4F57L 1THCA 4MHHI 4QXWA 1XIWA 1CTOA 3P4NA 2Y06L 3DX8B 1F5WA 3IMWA 1X5ZA 5A2BA 3E0GA 1AZRA 1HQ4B 4LCWB 4ELDA 3CVIL 4ADGA 3CSYB 4HUVA 3IU3A 2FX7H 5A3IC 2YA0A 4GW1A 3FFDA 2Q7AA 4S1RH 3FUEA 3CC1A 2FUQA 3WAJA 4AZ8B 2M83A 4M48L 3TZVC 3FT1A 4PJ5B 1IM3D 3RTQD 4EZJA 4JFOA 4IDLA 4JREC 3V0DA 3E1ZA 2XOTA 1QBLH 3M17B 3VCLB 1Q1JL 1U6AH 3GXUB 4IGBD 4ALAC 4NENA 4AKOA 4OZIB 2D3VA 4KKLD 5BUAA 4GKSA 4WKZA 4DPAX 3K71A 1BMWA 2WXGA 3H2WA 2CJTA 4RGND 4XC1L 5E5LA 1T66C 3U6XS 5JLZB 3ZIMA 3F7YB 4XXDB 5CEZL 3MRDB 3DPBB 2A38A 3MJ7A 4MNGB 2VN5A 4MMZB 4O02H 3DRTB 4XHJC 2FJHA 3HR5B 4GEIA 5L4IA 1DSWA 5CN3A 3QZMA 5LVEA 2GJ6A 3A3YB 4LGSB 5CNHA 1NDMA 4B9CA 4Z7OE 2CK2A 2XYCA 3WHXB 3RWIB 2CIKB 4U1JA 3T1FA 2EIKB 2EKSA 5IJCC 5JNYA 1QG3A 1FN4B 5KSAD 1C5CH 1KIQA 4WO4A 4QJ3B 4B50A 4Y5VB 4JO8A 3CXHJ 3GXIA 4NUPA 2AEPH 2OAAA 3HTLX 2EC8A 4U6TA 3HPJB 4PS4H 2IBZY 3SZKC 5K1JA 2E27L 4XBGA 4KK9C 2MH4A 3K4AA 4DN3H 1EFXA 1XGQB 3VXPA 3AWEA 4X83A 5BZDB 1R0AL 1G1OA 4OF8A 1EHLH 3TA3A 2IGLA 4NZ8A 3LOWA 2Q8AH 2BNRA 3N42F 4XX1G 2IGFL 4R8WH 3D0LA 4LPYA 1BX2A 3ZE1B 2NY2C 4XP9L 3VJ6B 4PJGE 3V4PA 4GB9A 3WFDL 3MLRH 1IAOA 1T03L 3HN3A 4WW2A 3D18A 2J6EA 3WE1A 4A7UA 4XCCL 1NAKH 2Q8BH 5FV1L 3LQAH 4P2QE 4WHTA 4R83A 3I6GB 4KKRA 5LB1A 4AIZA 5KYUB 5TJWK 1N6QL 4QNPE 3FQWB 1ORQA 1BDYA 3LSOB 4NC1E 4LLYB 3UC2A 2Z4QB 4UANA 3UAJC 4B3EA 4DFIA 1RHFA 5DWUH 3NACH 3EH1A 2E76C 2PPCA 3GS4A 4LQFH 4F9LC 5J13B 3KPOA 1RZQA 3GTTA 4RISH 5TD4A 1JGUL 1PDKB 4LSUL 3ZZ1A 4DEPC 4ZW3A 4JFYA 4JKLA 4A6YA 5HDQL 2QHLA 3QJZA 2EABA 2VN7A 1EWHA 4FQLL 4JO3L 5HPMB 2VMJA 2ZX5A 4HSCX 4LCUB 1XBRA 4X99B 4IBLT 1U92B 3AQXA 1C5DA 1L9SA 3BE1H 4I88A 5FLVA 4R7VA 4Q74A 3U7WH 1HJCA 4J4PC 4KKCD 5IB3B 3KXFD 2DOCA 3CFIC 3PDOB 1FCGA 4KO9A 1XR9B 1CO1A 1NCBL 4HJTA 2GHZA 1I9RH 1U3HD 3JTSB 1J0JA 4NHUA 5DSCB 1U8HA 4RLDA 2WVUA 4GW4A 4AXWB 4OTXL 1JNHA 2VM9A 3ZXAC 4GKZA 4Y5YA 3OR6B 2W9EH 2WTPA 3FN0H 4WFHD 5HHPB 2JKSA 2O5XH 5GRZA 5L4JA 1XMEB 4TVPD 4H8WC 2OX5A 3PFQA 1WGVA 1MFNA 1NGYB 1TU2A 4NZFA 4WWOA 1Z9SA 2B5IC 5E6IB 2Y24A 4RGNE 3VQLA 3R0NA 3NAAH 1RU9H 3DRQB 2CO7B 2ATAA 3PPSA 5TQ0H 2ICCA 4UDTB 1BQHA 1CGVA 2O30A 1OO2A 2L4OA 2WUBL 3GKWH 1CB4A 3L3KB 2OMXB 3EBGA 4UTAL 2EUWA 5IB5B 5LNGA 3CSPA 1SY6H 1VFOA 4U3HA 5K9QG 1MI5A 5C9JB 5EFIB 2H6UA 3BO8B 5J1AA 4Y16B 3AY4C 5T1LD 3EJYD 4ONHB 4XNYH 4EOWL 3LJ3A 1X9UA 3UBXG 3QS3A 4JNXA 3FQ2A 1WA2X 1WZKA 3O3EB 2J2ZB 5L8LB 2XBTA 1IBBA 3DV6A 3CPUA 4WCYL 4IU3B 5I9QC 4DP6X 1R47A 2OJEB 5FGRA 3V4VB 5G2NA 4PRPA 4AT6B 3IJYA 3S98A 3GPSA 5DLLA 2O93L 5TDOA 1DCLA 3O8XC 4YHNA 1LEKA 3TZVA 4R96A 4U33A 2FRGP 3SDAA 5B8CA 3CVIH 3AM8C 3EF4A 4BXVA 2NRDA 3G04B 1CCZA 2Q7YA 3AVEA 3WKYA 3RVVD 2QTEA 1M7IA 4Z95L 4JN1L 4PS8A 2W65A 1E9OA 5HVGB 3MODL 5FW6A 4AEIL 4P3DB 4ODSH 4XPTH 4PJ7F 4J1UA 3U0TB 1IEBA 3IJEB 1Q1JH 1TCMA 4B7LA 3B56A 3GK8L 3HZ3A 4CJ1A 1TZOA 5F7KC 1H19A 1KLGA 1A3QA 4OLYL 2ADJA 5TQ2L 2K8QA 3WD5H 3UZVB 4RA0C 1C08A 3BPNB 3HBPA 4IBSA 4JUSA 5CEZH 2DIBA 1M6OB 2XDHA 2HAZA 4I48A 2WNKA 4ZZKA 3WUWG 1XGRB 2LT9A 1XH0A 2QSVA 1DBML 4PJGA 3JUZA 3T8XB 3CFBA 4J3OF 3O11A 2OW6A 1G9EA 1MF2H 4P2QA 4N0UB 3CHPA 3TF4A 1KENL 3DSNB 2E59A 1BAFL 1E42A 5EO1A 1HCVA 2X42A 1SDAB 3A4AA 1NGWB 1IIKA 2X4RA 2XWBB 2MNJB 1BJ8A 4WFHE 3U1PA 3UTPD 3P4OA 1CJYA 4I0KA 1T7VA 2XN1A 4JJOA 4TVPE 1WZLA 2E27H 5T1MB 5IB2B 1HL9A 1IGMH 2VSMB 1Z1WA 5CGBA 4IJ3B 2CG9X 2DWYA 3BAWA 3NFNA 4LFHG 3BN9D 2UY7A 5C0JB 1OP3H 5CEYA 3TBCA 3WTVA 3O41A 1M2OA 4K3DH 4P23B 4APXB 4QR7A 4XP9H 1Z9NA 3PHOB 3FB6B 3KLDA 1KG0A 1UZGA 3WFDH 2WLIA 1T1YA 4FQQB 2WXKA 1T03H 3QFDB 3NSDA 4ADIA 3IDUA 4HIIB 3D2UA 4PHZA 2VDQB 1IC0A 4XCCH 1JF1B 3TFBA 1OE1A 1IUZA 4ZQTA 1PEZA 5F3FA 4HAKA 3GZQA 4HLJA 1G6RA 3S3BB 2G5RA 4G59C 2K7PA 1KTDA 4OF7A 4WV1A 3UTZB 4I3RL 1UOWA 2CHNA 2AGJL 3LKNA 4DFHA 3MJ8A 3FU3A 2R4SH 4G43A 5T33L 4X6FA 5GRJL 2YGOA 3SO5A 3SBWC 5D1XD 5CWSA 3UDWA 1JGUH 4LSUH 3MRPB 3APFA 1SQ2N 4FQLH 5CLZA 1TZAA 3BKMH 1B6UA 4F7MB 4BH8B 1F4YH 4YHLH 4TLTA 3Q5TA 3D1MC 4PUBL 1YC7A 3AQYA 2K3HA 1EJ6A 1VRSA 1S9KC 4F7CB 2ARWA 5D9SA 3PP3H 5F0PB 2OYPA 5BZXA 3DX7B 4RMVA 3RFRA 5EDSA 1KTLA 4O2EA 2Z93B 4JG5A 3EYFA 4IEFA 1NCBH 4MXWL 4DNLA 4X5WA 5E9NA 2J8OA 1EXUB 3LB6D 3S4SG 3REVB 5F1OB 4OTXH 4LDOB 2JKTM 4FTVD 1Z7JA 3QFJD 1I1FA 4PGDA 5AOMA 5F1KC 4PGZA 5BUGA 2Y0SA 1NFIA 3FHEA 1GHFL 2M1KA 3MRRA 3OJMB 5CP7B 1C8QA 1GVIA 4ZFGL 3S7GA 3PWPB 4WI8A 1EJOH 3C2SA 4LLDB 3Q8CA 2EIEA 3UO8B 1JS4A 1QABA 4FFWC 5DLMH 7FABL 4ZD3L 1VCAA 2WUBH 4IRJC 3EDDA 2YZ8A 1NBQA 3C08L 3FAXA 1I1AA 2JI3A 3OAZK 1SJVA 3U0PB 5KYWA 4L8SB 1EZSA 3SDCC 2ZXEB 4UTAH 5H4ZA 3RDTB 1KPUB 4H1LA 2BP8B 4NCDA 2ZOUA 2JKRM 1D9KD 4RQQB 4MXQD 4HH8A 3TC9A 3ZZLA 4AVHA 2A6JB 3BDYL 5ANHA 1RZGB 3ARGB 3LQAC 4M7JL 4K5LA 1MHCA 3G5XA 4G71B 5HGHA 1TMQA 1ECYA 4MZRA 4JM2D 5IVZA 1LK3L 5C0DA 3RGVD 3TBBA 3EGSA 2X41A 4P9ML 4HAGA 3UBXB 3UTPE 3ZOAA 3H4FA 4U3CA 1INQA 1UVQA 4NQSB 3K6FA 3PU7A 4TN9A 4QRTB 4NQUA 3PS6A 1AG0A 3D48R 3TN0B 1OF2A 1YMHA 2VO5A 4JRXD 5BV7C 4NN6C 2JELL 4Z95H 4JN1H 4ZUTB 4WWKC 3MGAA 3RWDA 2H0FA 2WXIA 4ZYKB 3ZKMD 4BKLB 4WVRA 3MODH 5C0RL 2PR9A 3WN5C 5E9AA 5E9DB 1CPUA 2ZP8A 1X9LA 4A7QA 1XAUA 2FSEB 3K91A 5DEJA 5KYXA 4X5QA 1UASA 4Y4FC 3GK8H 4EZLA 1QFPA 2O6CA 3NP3A 5I76B 2N1KA 1BF8A 4IQHA 5IK3A 4P57A 3F12A 1RJLB 3OAWA 4ZOCA 3LZLA 5D1XE 2FQGA 2OQJB 2ADYA 2DKMA 2EDRA 1J5CA 1QLEB 4PRIA 4M5ZL 3L7FB 1DBMH 1FZJB 4FNSA 5FKAA 3VXMB 2WINA 3IVKB 4UM9D 2HT3C 1HJBC 1GL4B 3TGXA 3WUWB 1ZT1A 1GYVA 1C12B 4LAQL 3CN2A 5D71H 1KIPA 2NMSA 4V1DA 5C0IB 3HE7C 2DWTA 3HAEA 1RJZB 2KLSA 1QVOA 1D2OA 4RFOL 1V3MA 4FTVE 3W1ZA 3O2DA 3QFJE 4PREA 1NWOA 2BY1A 3D8MA 1PZCA 1LO5B 5TF0A 2UVFA 1I85C 1MG3C 2E6JA 4U7KA 3U30C 2VUKA 2BSEA 4LSVL 5C9KA 2ARJA 1E9PB 1NMCB 2JXMA 1CFSB 2X6CA 5HP5A 3QIWC 3V6OE 3MA7A 5KYUA 4LL1A 5FC9A 1A3LL 1JWMB 2AK1L 2GSGA 4N28A 1G7JA 3BH8A 1I8KA 1X4YA 4ZQKB 3VXTB 4DQAA 3AFLA 3HZMA 2FATH 1NPUA 1TETL 3S5LG 1EUTA 3OL2A 3SGKC 5JHDB 2YC1A 4G5AA 3DBXB 4R97C 3EJUA 2QADB 4L9DA 1VB9A 1J0IA 3SBWA 2C3VB 1G5AA 4N1CA 4UQ3A 5TE7L 1Q4NX 1IFGA 4K94L 5L0QC 4L4TB 3VRIA 5JPNC 3VQ1C 3VFPB 4L48A 2AGJH 5IEHA 4P2YA 4PIBA 5T33H 1JUFB 2P45B 5GRJH 1PZBA 1OIOA 5BZZA 1EEQA 2CGZA 1RI8A 4XO4A 3TV3L 3OKMB 5F88B 3VFMB 1M05B 4JZOA 2YR3A 1BQ5A 4JRXE 1FNEB 4AIEA 1XGTB 3L3DB 5AKTA 4G6KH 2V4LA 2KS0A 4ZXBB 1A3RL 1R24B 2IAMD 1DJHA 1U8IA 3CFMA 3D85B 3IJHA 1YEGH 4MXWH 3HC2A 3IDGB 5DQ9A 3TS8A 1AFVL 1YEHL 2KI6A 4E42A 5E1IA 3EDJA 4BSWB 1RL1A 2B59A 4DGVL 1U95B 3IDJB 4S1DD 1J87A 4U3SB 1WO2A 3DHUA 1JZ6A 4AQAB 5KBLA 3S4SB 3BWZA 4NUJA 4PWIA 1A9VA 1R5WA 4KTDL 2X4TA 3UTQA 2X4PA 1GHFH 1FUNA 4ZTPL 2EEBA 3CCHB 3DVNB 3NFPA 5DUBA 4ZFGH 2HFFA 4MMXB 4F27A 2PLTA 1I7TB 2DI8A 7FABH 4ZD3H 3Q0HA 4AYBA 5JQ6L 5DURB 3C08H 1YYML 5I17A 3ESNA 2A3TA 4TQEL 1ZJAA 5DC4B 3QWQB 3CNKA 2DDQL 5GGRA 2NY1B 1ZSDB 4OZHF 3JWNC 3C60C 2OXHB 4PJCB 4O58L 4TLSA 4M7JH 4YUEL 4CW1A 4HCFA 3VSUA 1A02N 4MD4A 5LGHL 4EQ3A 4GRWE 1SVBA 1S9WB 1INDH 1EDHA 1LK3H 1QFWH 1CLYL 3ECQA 4OZFA 4UYPA 1X7SA 1KWKA 3MXWL 4P9MH 4FS0A 1G1KA 1Q90A 2EE6A 3ATDA 2ZCHL 4PJHB 5D1XA 3WL9A 2VL5A 1WAAE 4FLOA 3QNZB 2CMRL 2QVIA 5A16A 4JHWH 3HFML 3WLWC 4HLZG 1A6TA 2Y25A 3LD8B 1T7YA 4Z7NF 5I5JA 2AEWA 3FQXA 1ILSA 3VD5A 5GGUB 3HZKA 3DECA 4A7GA 1DVZA 4HD5A 4JDEA 5A1AA 3OQ3B 3TFKD 4ZO8A 3SYPA 4N1HB 1QLFA 4PY7B 4XNDA 4FTVA 4E41D 2F19H 3QFJA 4IRSB 1JDCA 4GIOA 5GPRA 5KJRH 2HMID 2P47B 4X6DA 4D9QD 2NNCA 5IHUL 4I0PB 2L04A 4OCWL 4PTUA 1J8KA 4QKXB 2DQHL 3B37A 1T22B 1EDQA 3H55A 4NZDA 2VLRE 4L4VD 4Y5XB 4JZJC 5CJ5A 4NWUH 4AUYA 5GS0L 3LDBB 1JV2A 1H3TA 1J5DA 2ZXAA 2DB8A 3O6LH 2H1XA 4I89A 5L2KD 5F7UA 1ACYL 2OSLA 4PLJC 4M5ZH 4KDTA 5JR1L 1ZHNB 4Q6IB 4U2ZA 1Z3GL 5ACMA 3ZQ9A 4OW6A 3ESPA 4IMKC 3QUMA 1SOQA 5ITFA 5FGCB 2YAHA 3GSXB 4A67A 2JVUA 2B39A 1BYNA 1HHHB 3O45A 4ATTA 1I85A 4LAQH 4S0HA 3QJFB 2F58L 4GAAA 2OI9B 3RZCD 1UC6A 1KTRL 3AXLA 5TH2B 3QIWA 3EOBB 3QHFL 4KRNA 5DMGD 1I1CA 2VLLA 4I4WB 2GI7A 5J1SC 1JYXA 1IFRA 1QSFA 4M6MH 1I8MB 2NQCA 3WFEL 3ZBMA 5AAMA 1RZFL 4Z5RB 5J7CC 3F00A 4ZMWA 3S96B 1DSYA 3C8KB 3C5JA 2W0PA 4RZCB 1AP2B 2ITDA 4PGBA 3CZKA 3PP3K 3IFOA 4N2OA 1GW0A 2QDWA 4Z76B 3QXTA 3UYOD 4NIKB 2PMZA 4G42A 3RPIB 1MCOH 1A8ZA 5EUOE 1J1PL 3HMXA 1TETH 1U8PB 3MBWA 4QYOB 2DWXA 1ZVNA 4OZGA 4TSBH 4LCYB 3ISWA 5FUZL 2E56A 5DJXB 5IROC 3IGUA 3MFGB 1JJUA 4N8UA 2ICES 2BIMA 5TE7H 4K94H 3ZIYA 5BOPA 1IGJB 1SN0A 2FUTA 4OF5A 5GGSB 2C9AA 2XJLA 5IBUG 1FL3A 1VLXA 4YZFF 2OW7A 1P5UA 4JFZL 3RI5F 1KJVA 3CN0A 3PJNA 4JVWA 5F72S 4YK4B 4DEUA 3EJZD 4H4NA 3ATBA 1IGIL 4OGYL 1QI5A 2ERJB 2V2WA 1ERNA 2WAQA 3VYPA 1KCVL 2OJ1A 4LNVA 5DK2A 2HWZL 4UM9A 3IB4A 4U1LB 3PPEA 2NR6A 3LEYH 4IU2B 2WQAA 1CFNB 2W9DL 3DOSB 4YL4A 1UXSB 5D8JL 4Z7AA 5KSUB 3PGCA 2F7OA 4ETQB 5C86A 3NJFA 4U4IA 1SM3L 1AE6L 1FZKB 1P5VA 2R2HA 1XF1A 2CJSA 1HAUA 4TLKA 3BYYA 1JCVA 1H6TA 4XN1A 1J18A 1KACB 1NJ9B 2AKRA 1AFVH 1YEHH 2KKQA 3HC4L 3ULSA 2JI2A 3KH3A 4E41E 2Y5QA 4HC1L 4XBPB 2Y6SC 3RIAF 4HG4K 2WZPA 5F1IB 1O6SB 2YMOA 4XCFL 3TNNA 4FQIL 3VH8B 1RULH 2H26A 1TJIL 5E8NB 1WAAA 4GKNB 2H0JA 4KTDH 3DXAD 1OE2A 1CIDA 3DROA 1DVFB 1X5YA 5SX5H 4YHKH 3SJVD 1HFUA 2BNQD 5GS1A 1LEGA 5TFSH 1CBVL 2A0LC 5AVWB 4XNAA 5IR1B 5L2KE 1ZTXE 3ZQWA 1S2EA 1KYFA 3QXWA 3DV4A 5JQ6H 2OCFD 1YYMH 4FL4B 1PF3A 2WWMC 4LLVA 1U8KB 4S10A 3WJLA 3E9TA 3FBKA 2DDQH 1TZGL 2ED7A 2ODHA 4PRAB 1KEGH 2AXJA 4OFYD 1MFEL 1IJNA 1BD2D 1JP5A 3MZGB 1WT5C 2ZF9A 1AGBA 3N6YA 3VI3F 4YUEH 4X9YA 4G8IA 1KGYE 3EZ8A 3MTRA 5D1QD 3EH2A 1KYDA 3FTGA 5LGHH 3AU1A 2VLRA 5B4MC 1CLYH 3IDXL 2XCMC 3GHEL 5IZ7A 5JA9A 3MXWH 4DP5X 4LEXL 1BZEA 3KGTA 3L3HA 1KMGA 1LD9B 2ZCHH 5F6IC 5DVOA 5I1AB 3LZRA 3B2DC 1CZ8L 1W15A 1L9QA 3S3PA 1CXHA 4Z7QB 4LPCA 3ARFA 4J3OC 5FECA 2FR4B 5JW5A 4GAFB 1GZPA 4J8RB 4PJ8D 3SGJC 4OIFA 1S6NA 3WNOA 2GCYB 1WEJL 4MCYB 4F3FA 3RWEB 4HFWA 3IFLL 4HJ1A 3ILPB 1U8OA 2GBTA 5DRZB 1P4LB 3MV8D 5CBEB 1JGEA 4JZJA 3GPEA 2V3DA 4M5YL 1I53A 2F53D 5F6HJ 4F7EA 2LAAA 4Y8DC 4F8QA 2R23A 1AC0A 3LV3A 2IWFA 8FABA 1S3KL 3FT4B 2Y07H 3T0VA 5LKNA 4OCWH 1WJ3A 2C7UB 1QYGH 1U8CA 2DQHH 3DX0A 5IQ9B 5DI8B 4G9FB 1DJWA 1RK1A 4DOHE 1BF5A 5GS0H 1QBML 1XH3B 4JMXA 4N2EA 5DZLA 1EHXA 1UD3A 4EI5B 2JB6B 3KJ4B 1ACYH 3NDZE 3CLWA 3MRMA 5C0AB 2GK0B 2CKBL 4C83B 5JR1H 3VU2A 1N2RA 4FQXC 3HRZA 5ALBH 1Z3GH 3EBAA 3TJHD 4AENA 2VQ1B 5B3JF 5JORA 1H6EA 3TBSA 1TLKA 1PY0A 5AVQB 2CO3A 3QWRA 1MY5A 1ZV5A 4CA4A 5B39A 5INDA 3HE6A 3CZNA 2RAMA 3CFJB 1Q1PA 1FC2D 5FGBA 3GBML 2NSMA 1R3IL 5E00A 2GI0A 2JTDA 2WKOF 3L9EA 5C08E 3OBAA 1MCIA 3GBLA 2B0SH 3QHFH 1IC5L 2C9QA 2WXHA 1X5GA 2CLZB 2CKBB 3DYOA 2XZQH 5C7XL 1K3IA 2ZP0T 3B2PA 1DL7H 4Q9CA 3RUGB 4GFXA 4PR5A 1PLGL 4R84A 3FW6A 3DXAE 2Q2EB 3D12B 2YKLL 2CIIA 3VM7A 4XB3A 3WFEH 1QR1A 3SJVE 1YA5A 5I8EB 1AD0A 2E46A 1KV3A 1TTBA 1RZFH 1N4XH 3L9BA 3WEXA 3V55A 3PAVA 5F96L 2F5AL 3GSRA 3WY4A 4ICXA 3ZDZB 2I60L 1XB8A 3LN5A 5JDSA 1D7FA 2EIZB 4PJFB 1L9NA 1FJ1B 1J1PH 1KGJA 4FKKA 4OQ1A 4E9XA 1JF5A 3CUPA 3IFPB 4I85A 1PFOA 4ODXA 1BD2E 2P8PB 1H9VA 2WLMA 3AWFA 5I1IH 3A47A 2WBJC 2YD7A 3QJUB 3VSVA 5GRXG 3QDGB 5FUZH 1S9YA 5D1QE 5BJTA 4OLXL 4M7LH 4BZ2L 5EU5B 5B1BB 5IFJB 1QACA 4MNHB 1DJIA 2PCPA 1YAZA 3L45A 4OJCA 1BZDA 3EHBC 1V5JA 4JFZH 2FEJA 3D06A 3L4CA 3MTXA 3UFIA 5EMYA 2FBJL 1IGIH 3MUY1 5FAAA 1WH0A 3IDIB 5IBUB 5AB1A 1NAMH 2X9YA 3IJSB 4FLHA 3QIUB 3MXVL 4NT6A 2UYLB 1A14L 4Y9EA 2VLMD 2FDBP 1KCVH 1T1WB 5ACZA 3TL5A 4ODWA 2QR0A 1NIEA 2VSCA 3H6AA 4PBWD 4HKBB 1UXWB 1JK8A 1H3UA 2W9DH 2VR5A 2F8VA 2NY0C 5IWLA 1SM3H 1BVZA 2VDNL 4UNVA 4EVNB 2IPKA 3RZCA 4Y9CA 1G1YA 5DD6B 5F3BB 3MV8E 1RIUL 1Q94B 5E5MA 5FO8A 3HC4H 2GSIB 4HJIA 4ZAKA 2F53E 1GKEA 1SLXA 1YJDL 4X7FC 4IBYA 2QGCA 3U48A 4XCFH 2X70B 3CFUA 4FQIH 1TJIH 2BSCA 2UVEA 3Q43A 3MKKA 1LDPL 3SD5A 1P1ZB 1HK6A 4RFEB 1WBXB 4AM0A 1YN6A 2XU9A 2CBTA 3K1KC 5EG6C 5A6MA 2W91A 3HNVL 2PYED 4MAYB 4PJ7A 3K0WA 4PVMA 1CBVH 3AACA 3O9WD 1XXDC 2J43A 5FLUA 3RY6A 1GSKA 4D3CL 5ETUB 2ZWLT 4I13B 3FMGL 3UZEA 1CE6B 1DUYA 1GIGH 2EE3A 4ODBD 1ZLEA 4GXVL 2C1OA 1JPTL 3H0TA 2YPVL 3BDXA 1TZGH 3QAZC 3UAAA 3UGXA 3DI3B 6FABL 1X5IA 4QTIL 1HE8A 2HKFL 1CICD 4W6YB 2LU5A 5F1SA 1OT1A 4KQ0A 3FOLA 4P46C 4P99A 2E7HA 2Z92B 4XP1L 4U1GC 1FIGL 3VQ2C 3GHEH 2UX6A 4LEXH 2BY3A 3SE3C 5HHQB 4BINA 4M7LT 1RUKH 5EB9A 1WBYA 3UG4A 4NUQA 1NM9A 1JYNA 1QRNE 1CZ8H 2N59A 3RVTC 3B9KC 2PCFB 1RZPA 4YVNA 1KBWA 3WDHA 4RFNB 1DJSA 1T83C 2YD6A 3BUPA 1LWRA 4KV5E 1IX2A 5ICUA 3B9AA 1WEJH 4NFDA 3TO4B 3BVTA 1N5AA 1FFNB 3IFLH 4UDUA 2FJGA 4BUGA 2HJFB 3U2SB 4XCEB 4WAFA 4GEJA 4WI7A 5C08A 4G6AC 3EXJA 3HZYB 4GAYB 2XPZA 5BRPA 4JCMA 4M5YH 1YPZE 1YY8A 1UHVA 1RUQL 1S3KH 5I8KL 1B6DA 2P46B 4K5NA 1FFTB 4BUHA 4EO5A 4GQ9L 2IH1A 4AITA 3DXAA 3UTSB 3V0EA 2I27N 5ERWA 1NIBA 2BSSA 4OH2A 4PBDA 4HULB 1QBMH 4LSPL 1TF4A 4EIBA 2CA4A 2FHFA 2GAZB 1EXHA 2J3SA 3EOAB 4TNWK 1FA4A 4EKJA 3ZY7A 2VLME 4NDMB 2CKBH 3L54A 3RKDD 3I75A 2FBRA 1NKGA 3G6AB 1BQRA 1QFHA 2NDGA 1EK3A 4ENEC 3ARZA 1HSBA 2BOCB 4WUUB 1BD2A 2I24N 4FG6D 1T20A 5IUSA 1N70A 1PFCA 4OZ4A 5D2NC 2VGLM 1JNNL 1O7VA 3GBMH 1R3IH 2NZ9D 3NQKA 4QGYA 2KHAA 3GSQA 1IC5H 3WS6C 4UQ2B 3ZGIA 5C7XH 3QIBB 1ZVSA 3HG3A 1OGPA 2F54A 1Q0YL 4XP4L 2WNGA 1KULA 5I73B 4FG4A 5EU4A 4URKA 1FZMB 3DX9A 4MS8D 2PYEE 3C5ZA 2UV3A 4OFKA 3W39B 1FSKC 4S1QL 2K70A 3BWAB 4PJ8A 1YNKL 4XAKD 3ARYA 4CKVX 5F96H 2F5AH 2NPLX 5H4YA 2CBPA 2AQ3A 2I60H 1Z32X 1ZSHA 3R18A 3ZMNA 1JV5B 3BIKA 1KTJA 1CXEA 3GC3A 4NQXA 5BXFA 1NCGA 4LLWB 3TBYA 5I66A 1AGEB 3QUXC 4MJ6B 2ZKMX 5KYYB 2NW3B 3NSJA 1EGJA 2DI7A 4OLXH 3QQNA 4WFFD 5D70L 4BZ2H 3NIFE 1J1XL 3QUHA 1G7LA 3Q1SL 4UQ9A 4DO4A 4KTEL 1IC1A 5IEKA 1T0MB 2Y72A 4MNQB 2V5MA 3BAEL 1QO3A 1YQ2A 5FO9B 5GS0C 1ORSB 2FBJH 3F01A 5FYKL 1QTPA 3MXVH 1A14H 2ZXWB 4G8EB 3IGKA 3L9RB 2HLFC 4IHOA 1Y1DA 4UNUA 3STZA 1NDTA 5EPMA 3DBSA 2GHWB 3GMMB 2P5PA 5IF0B 1U8MA 1WICA 3QB7C 1BGXL 4JFFA 2VDNH 3UIYA 1DFBL 3GMOB 5F7FA 9CGTA 1YUHA 2OP4L 3UG5A 4X7DC 1RIUH 1ZK5A 4XT1C 1OOWA 3GSNL 1BZ8A 1OTUC 1GGCL 2WQ8A 5A3ID 3KPLB 2XWJB 5D4IA 5MEOB 1GJUA 5ENWA 4R7DA 1PX3A 4BD4A 2J12B 2YXVA 2DLTA 3AT9A 1PX4A 1YJDH 4OV5A 3ZTJH 3M1BA 3IN2A 3UYRL 2M26A 3M1OA 3L95A 2O61A 1LDPH 3K8KA 3WJMB 5F7HA 3IFNH 1QRNA 2J8UF 5T5FA 1YEKH 1SVZA 1PIGA 1QASA 2GBUA 5F7WC 3MV9D 3HNVH 4N26A 4WW1A 3B8SA 2BHUA 1E7UA 1UD5A 5IHZA 3IKKA 1Z0NA 4M1GL 4JL2A 1LO2L 5FYKU 2HZHA 4LNRB 4D3CH 1EV2E 2D31B 3IETA 4G2AA 4QTHA 3WNMA 1JZ7A 2WXLA 5HHMB 1YQVH 1AQHA 2VDLH 3FMGH 5T3ZL 1AZBA 3DJSA 3FO0L 4HIEA 4G80B 5DCCA 2L7EA 5EBLB 1SYSB 2VZUA 2YPVH 1OHQA 2ZNWA 3RVUD 4W1TA 4XOBA 1J0HA 1HILA 5K9KB 4PRDB 2VLJA 6FABH 1R3HA 5FFLA 3PHSA 1H3PH 1SOSA 1ZT7A 2HKFH 4QTIH 3V7MA 3VMOA 2R9HC 1A7RL 3AT0A 3P02A 1ROCA 5JOPD 3K2KA 3SGDH 4B27A 2LVCA 2AEIT 4XP1H 4Z7NE 2X2UA 2ZPKL 1Z9PA 2V3EA 1WFNA 4NNPL 3MOAL 3QA3A 3MROA 2FZ3B 2IWEA 3BIAX 2Z31C 5KAQF 4LIQL 4HOXA 3ABZA 1S7VB 4IKKA 1BQHG 1T4WA 2OMVA 1ASPA 3FTXA 4KRPC 5FDWA 3QWOB 4XAKE 1M56B 1J05B 4BZYA 3PQYD 4KK9D 4B9KC 3NT0A 4F24A 2YBRA 2NQ3A 4FJYA 4X6BA 4P04A 1TR7A 2A74A 4DN4L 4AQ1C 2PPDA 1IGTB 2ZOLA 1SJMA 5INCA 3BKYL 3CAFA 3PHQA 1G0YR 2ICWB 5IB4B 4NHCH 4J3BA 1L4IA 1S7XA 3HVNA 4FADA 3T09A 2CDGB 1N8OE 2Z91A 2N0KA 3GJFA 5I8KH 3GUTA 1CR9L 3GGWB 4JFUA 4GQ9H 2BIQA 2ITCB 3QDMB 1QZNA 4M8QB 1JHKL 1OB0A 2Y23A 5F7LB 5BVJA 1SJHA 4X7SL 4FTDA 5I6NA 2F08A 1NUGA 4L0YA 1KLFA 1U2CA 3MRNA 4LSPH 3T4YA 2ZONA 4XMLH 1IKFL 3O0RL 2JIXB 2ZWYA 4OCNC 2XPGB 4RDBA 2R4RL 4WI0A 4I9WD 4LMQI 3UAJD 4PBXA 3WS6A 2EE9A 1S5HA 1UCTA 5AW1B 2CKNA 4R0LB 3QXDB 1VEPA 4BIKA 3V4LA 1EXGA 2WJ5A 4AK2A 5C8JB 5IB1B 1G5GA 1F90L 3B6SA 4IRZH 1FORL 4TTDD 1JNNH 1IZKA 1AGDA 4ETYA 2WP3O 3IGFA 3RL2B 3CMOH 3VB8A 3VWJB 4RCAA 4W6XB 4LCIL 2VZOA 4GQQA 3QISA 2IAND 3ZTCC 2D7TH 4YGAB 1IE4A 1Q0YH 5ABAA 5HYSA 4XP4H 2WO2B 3MV9E 2IMMA 5FV2A 4JRWA 5DJZB 5A6LA 4PRBA 3VWKB 3PWJA 4KITB 3QFGA 4S1QH 3VGFA 3VMPA 4XVTL 5IMLB 4HA1A 3FSOA 4XMUA 3MRIA 4JRFA 3MRLA 5KOVC 1ANUA 1CFQB 1VZGA 2BIHA 4Y2NA 4NM8L 5CIPB 5I6LA 4NRXB 1XR8A 4MCZB 5D6CA 1KB5L 1G7IA 2GEEA 1IEAB 4MB4A 3IKCA 2HVJA 5C0EB 3ES6B 5KS9F 3CWGA 3E3QC 1W72L 3DK2A 3U9PL 1YUKB 3CDGA 1MCWW 1CT8B 2YOCA 4J23A 4DW2L 4NOBA 5D1ZA 4HFUL 5D70H 4F37F 1J1XH 3P0VL 4HX1A 5JOPE 3Q1SH 5J8OA 4Z6AT 2FEDC 2K1MA 3FTZA 4OZHA 1E5ZA 1KB5B 4BUQA 3L2MA 3DETC 4QHUA 1NEUA 2NY3D 5FYKH 3LNIA 4IDJL 1A25A 1GGIL 3NP4A 3V6ZA 1U8NA 2PXYB 3KPNB 2BRRL 1BMZA 1T3FA 3PQYE 4Y19D 3S5YA 3RPKA 4G8GB 4GBXB 1BGXH 1J0ZA 1MRDL 1DFBH 3O8XD 1IMHC 4FYSA 4Y2OB 2OP4H 3NMEA 1G7PB 1EUUA 2E6PA 3TLRA 5AD0A 4JFQA 3T3PB 3GSNH 3DUUA 1QEWB 1GGCH 4KH9A 1DVYA 1YN7B 3WE6B 4HT1L 3FCGA 4P2RA 1FO0A 4HWBA 3UYRH 3O3BA 3SOBL 1TTUA 2A6IB 1Q9KA 4FYQA 1L3NA 1GS7A 3L3OC 3U1QA 1D5MB 4M4RB 4AY0A 1U58A 3MUGB 2AANA 5DUJA 5K9JL 5E5RB 1KB9K 4KI5C 1LO2H 1EZVY 1TSHA 1C16B 2RFXB 2NNAB 4Q0XL 1BXAA 1JXGA 5T3ZH 4BFJA 1UKQA 2BP3A 1FVDB 2ADGA 3EJRA 1T1ZB 5IMKB 4NB7A 5EU3B 3CSBA 2WYIA 2ZXGA 4LXFA 3QI9A 3QH3A 1H6UA 1M7XA 4L5FL 2MJWA 5CN2A 1I7RA 5A7BA 5I8CA 1NLDL 1A7RH 3HG4A 1ZS2A 2NXZD 1SEBB 5C0CD 1D5ZB 2FLMA 4PJAB 2IANE 5IW6A 5JMRA 2ZPKH 3RWGA 5L6YL 4NNPH 1KYOJ 1ZLVH 3V5DA 3MOAH 5B7MA 3MBEB 5HGDB 1RJYB 1IILE 2BOBA 3IDNB 3O6FD 5IV2B 5MENB 1B4LA 2Y1YA 3SKUD 4FP8H 4XVSH 2X0WA 5CEXA 1MRCL 5DXWA 1HHGB 3FULA 3Q13A 1WTLA 1XGPA 4G11A 3IE4A 3D51A 2EIMB 4AQ8C 1IL1B 1VFAA 4U4BA 2BDNL 1UWEL 4QHLA 4DN4H 4Y2DC 1DUZB 2NY4C 1G7QB 2DYSB 1V3KA 5D72L 3V0JA 3ULUF 1QHPA 3U4EA 3BKYH 3K4ZA 4ODHL 1YZZA 1YEFL 4LOEA 4OD2A 4PJ6A 3U2IA 5AZ2H 4WI2A 3QC6X 3QXVA 2IADA 3IXAB 4HKJB 1YJDC 1YSOA 1CR9H 2DH3A 4JBSA 4G7VL 5HJGA 1A66A 3L1EA 3L1OL 1ZVYA 3MV9A 4LCCA 4OF3A 4X7SH 4YDJA 3VFSA 3IWUA 4M1CC 2VDKB 5D4JA 3UG3A 1Z5LB 3HFFA 5DJYB 4HXBL 3OLEA 3CHSA 3VGDA 5D7IB 3HLKA 2R4RH 2PTTA 4KMTL 3N85H 3I50H 2ZSVA 1UOLA 4WEUD 4CVXA 1MIML 5EF3A 3HJEA 2LR4A 4Y19E 2W81C 4XI5C 5ESQA 4GAGL 4Z7OB 2IBZX 4WNQB 1I7ZB 43CAB 3HNSL 1F90H 1AZVA 3MNZB 1FORH 4L8DB 3FCTB 1LNUB 3K6IA 4W9DC 2CDEA 4LCIH 3BQUD 4QRPB 1AXIB 2IV9A 5CIPH 2G0KA 2Y36H 3HW7A 1I3VA 1H15A 1K5WA 5FX3A 2C1PB 3IPFA 1WAEA 2ZXBA 4JQVA 4X6EB 4HH9A 2B9BA 2FH8A 4I18C 2XNAB 4JO2H 3OKEA 4XVTH 2CLVA 2F1EA 3RA7H 1QFWI 1OGAD 1TCRB 4BBWA 2V17L 4NXSA 5BRQA 5GSRA 1FFOA 4X7TB 1JN6A 5SWZA 3U7AA 2V2TB 3MRGB 1KB5H 1QTYT 2Z3FA 1SYVB 4YDLB 1UJ3B 3MRCA 1S7UB 4QXGL 3R0MA 1W72H 1RZJC 4IRJD 2Z4TA 3RWHB 3QORB 5CJOL 3MRJA 3UZQB 2D2OA 1UB5A 4HFUH 3SDCD 3SKNB 1BFOA 3P0VH 4OCRH 4KKPA 5C0CE 1IGYA 4ZPTA 1LO0H 1JK9A 1SHWA 5EORL 1OF0A 3WLBA 2FL5B 4ADJA 2IPUK 5H37H 4MJID 4UT9H 1MCPL 2BVPA 2EUXA 2GG1A 1GGIH 3FQTA 1RZIA 3H85A 3V5HA 2F9BT 3VI4E 4YXKL 2BRRH 1V55B 3WKPA 3W3BA 2OMZA 1HN1A 1W91A 3Q6GL 1MRDH 2VKXA 4L3ED 2XN9A 1YEDA 5I1GL 2A4CA 1MFVA 4PJXB 3L3OA 4KK5C 4MASA 2G9HB 3W0WB 1IM3B 4EUPA 3RTQB 2ZG3A 4OIIL 5TDNB 2DD8L 5F2FA 4MX7A 4HT1H 5DMJB 1AD9B 3DVIA 5AVSB 5BPPA 2WB1A 2I07A 4OJAA 3FF8A 3FT3A 1L0PA 3SOBH 1F3DJ 4DK5A 1QEXA 3H56A 4O2CA 2AV1B 4PGCB 3L5WA 4QHNB 2BJML 5AKRA 4G8FA 4RBPK 2X3CA 2BWQA 4Y4HD 2BS9A 4NZTL 1FNSL 3WIIH 4L1BA 4Y4FD 4XCYB 4OLEA 4Q0XH 5IHLB 1V3LA 4NRYB 1ITCA 3HPLA 4PV9A 3REWA 2IDQA 2HJLB 3BVVA 4ZG1A 3S37H 2Z7UA 4N87A 2IQ9L 4UM8A 3RNKB 2ATPA 15C8L 5D7JC 3JV4A 2YEZB 4OAWA 3ZDWA 4L5FH 3QQ3B 1NCCL 1NLDH 1R3LA 5D7LD 4CSTA 5B38A 2NXYB 1QPXA 1BBJA 5IMMA 3L6FB 2EVHA 5L6YH 3IAPA 2EEXA 3HI1A 4WEEA 2OM5A 5E1AA 2DM3A 4LCWD 1XGUA 2V9UA 3P9MA 1JPSL 2HG5A 3FTYA 1SDDA 4KDWA 3HE7D 5D55A 4W70A 1QI3A 2WKOA 5IG7B 4Z0XB 4PI0A 1U8JB 4JKMA 2DAVA 2PWGA 4DGIL 4Y19A 1OGAE 2DQMA 3S48A 4FCHA 3IWVA 4R4FL 4AYSA 1WP6A 3VFTB 1UWEH 5EN3A 4M7ZC 3NEOA 3RVWC 4HK0B 5DFWH 1E67A 2NT0A 4J7RA 1F58L 1JMXA 4U6XB 1YEFH 1W80A 3OPZL 1QA9B 3F7VB 4HPYL 4N2FA 1RMFL 2WMPB 4L9LC 2Z9TA 1N10A 2JQAA 2KPNA 2H3KA 3DX4A 1TTAA 2H45A 4OZFG 2PF6A 3FQNB 1Q9WA 3FTWA 4L1SA 1T0NA 3CFEA 3L1OH 1U91A 2QZ5A 3F6LA 4NWTL 1P2CA 5I30L 1OARH 4LVHC 4ZDHB 1IBYA 1MFAL 3CFCL 1HWGB 4HXBH 4TNWF 1OCZB 3FO2B 2CQVA 1Q9OB 4KMTH 4UOW1 4D7PA 1W8OA 4PJ9C 1PZ2A 2Z1KA 1MIMH 4BGLA 4R2GC 4YC2B 4A7VA 1HH9A 4M62H 4B0MM 2OXGA 5ID1A 4J5VA 1CI3M 2WOBA 1BQSA 2VL4A 5CEZD 5IIEB 4GAGH 4L3EE 2CU9A 4R9HA 3HNSH 5AB9A 2QEJA 1X9RA 3KXFB 4YFLF 3KLLA 1IZJA 2VUOA 4UUJB 1U3HB 1A2YB 1YEJL 4AQEB 4DCQB 1L0QA 4NO3B 5C0FA 2VLKE 5JYLA 2KQNA 5BRZA 3ZKXC 3TBWA 5HJBA 4EDXB 1MIEL 2EO9A 4MA7L 5FPIA 1ZANH 4FQHA 4H0LC 3IXTA 4QOKB 3BESR 4RSVA 5F7DA 3ZW3A 3VI4A 1DBAL 3PUCA 4X42A 4LBEB 3A5VA 1XB3A 1REIA 1JZFA 3J7HA 2V17H 4M61B 5T3XL 4KJPC 2R69L 4NI6A 3TBTA 1QLRB 4UAOC 3W9EB 3F5WB 3BD4A 2Q6WA 3RWJA 3P9LA 2E8ZA 4JN2A 3WIHL 2NW2A 4NEHB 4QRRA 4QXGH 4IIQB 3L4VA 3FCUB 5CJOH 5GZOA 4HUUB 4RNRB 4HBCL 1QFUL 3EO0B 3ZU8A 1RVFL 3LHPL 5LG6A 3FUDA 4QXVA 2NX5D 1FGNL 4PJCF 1A9BB 1WV7T 3RLSA 4OI8A 3BQVA 1FP5A 1S9VA 1MUJA 4LCWE 4I2XA 5AAWA 1AO7A 2VMCA 1MCPH 3DJTA 4M02A 5JQIB 5ICYB 4IKLA 2ADFL 1UXMA 3GJEA 4CRPA 1XMWA 43C9B 2VW6A 4YXKH 4FQ1L 4R3SA 5IMOA 1S7WB 4ZBJA 4ZMLA 4PRHD 4ANUA 4DKEL 5F3HB 3FTSA 4KVPA 5EOCJ 3K6SB 3Q6GH 1HXMA 1CD1B 2VDRB 1W0VB 2DQIL 1B4JL 5G5DB 2DMGA 4FFZL 5E7FA 4Z0BL 2ISDA 1ZY9A 3L9YA 4YSDA 2XN0A 1RY7B 4OIIH 1HYRC 1F1DA 4KJWD 3T0WA 4OZIE 3WO4B 3OKDA 3SKOA 4GUPA 4RGOL 1BQLH 4NPYB 4F7PA 2ZXCA 4Y89A 1GZQA 4P4KA 1F45A 2YD5A 2BJMH 1DJGA 4WQOA 1DE4A 3JQOB 4XB8A 5D2LB 5D93C 2JFCA 4NZTH 3L4YA 3ZDYB 2OYLA 2X4SB 3VM5A 2A4ZA 3Q6FA 5SV3A 3BZDA 3NEXA 3D69A 1MJ8L 3VTAA 1WHPA 2CRIA 3QHTC 4Y9GA 3PL6C 2YN5A 4M93B 4Y16D 4JKWA 32C2B 1K6QH 1URIA 2WN3A 2IQ9H 5CEZE 3J07A 4ENZA 4PJDB 4XPHL 5TK2A 1UM6L 1GGYA 2Y6TE 4FXKA 4PLJD 3WS3B 15C8H 3HLAA 4URTB 1GOGA 4Q2ZA 2EDBA 4U49A 2FO1A 3N1GC 2DPKA 3QNFA 4HU2A 4N9OB 3AXHA 3CZJA 1DZBA 1E8YA 5D96B 2YN3A 3RFZC 3WEMA 1AQ8A 3TCLB 1Z2KA 4GJTB 2G3MA 1OPGH 4PG9A 1JPSH 5FA4B 1S9XA 2H32B 2K6ZA 1U8QA 3ILQC 4XPAL 4PHXA 3ZE1E 4LP5A 1GR7A 4AUJA 5EC1A 3OAUH 4DGIH 3OV6A 1QBAA 4XMZA 4TOYL 5HDBB 2WQWA 5JW4N 2ETWA 2V7NB 4R4FH 1GYCA 4L3EA 4BV1A 5DHEA 2APSA 1XWVA 2KZWA 2XZZA 2WQRA 3EZJB 5DRWB 4HJEA 4A2DA 3T8VA 4WU5B 1F58H 1K8DB 3D05A 3EYVA 2Q76B 3ZT5A 4DQOL 2R1XB 4O4YH 3OPZH 4HPYH 2VLKA 5CP3H 2DWDA 3EJSA 1NGZA 2R83A 2UWEF 3P1VA 5SWSD 3QCTH 3WXWL 3V8OA 3QCVH 4HEPA 3MACL 3U0WL 2XICA 4EN3C 3VD1A 4YSQA 3STBA 4B9GA 4B95C 2WVVB 4DUWA 5I30H 1YYLL 4Y4HA 4N8VB 1MFAH 2FNWA 1HSAA 1K8IA 3CFCH 5IROD 1HC1A 5EOTB 1ZEAH 1IBGL 3T65A 5DVLA 2J25A 4HKXB 5BQ7B 3OKNB 1CL7L 4HUWA 1FCCA 2CWRA 3PWNB 4YDVA 1AYOA 4PW3A 3PXJA 4F15C 2BIIA 2B9AA 2KYIA 2ZUQB 5EZLA 3NA9L 1UEYA 3GFUA 4W4OA 2OSWA 1JNJA 4CC4A 3L17A 5CHNB 2UZYB 3DX8A 4X0KB 3DNKA 5DEZA 5BO1L 5IOPB 1I9IL 1IQWL 1Z9OA 4LPTA 5FUOL 1HQ4A 4M3JA 1DFXA 1MIEH 4MA7H 3UBHA 4AGLA 2FWOB 5H35B 3CSYA 4HEMA 3AXIA 4XVUC 3GHBL 2G2PA 3QR1A 3V0IA 5IESL 3ISRA 4P23D 5GIRB 2Y6SD 1E5UI 3MLYL 1DBJL 1DBAH 3RPBA 2J5WA 4AZ8A 4YAQB 2FSDA 1LO3L 4HS3B 2CBOA 3SBRA 2Z0BA 4PJ5A 4FNRA 4HISA 1JPST 5T3XH 3IYLW 4NAMA 3X13B 3U4AA 2AERT 2P80A 3U9UB 3VCLA 3M17A 2DJMA 2A0LD 3WIHH 1OZTG 3JVFC 1R4XA 4YSOA 4HZAA 4K5OA 1D9KB 4LVOB 5CMAB 1R1CA 4OZIA 2R56L 1YY9C 2DJ4A 2BH0A 4UTBL 4OQTH 3QNYB 4ZOEA 5B7FA 1O5DT 4HBCH 1QFUH 1SLUA 1VHPA 4LLAA 4MBRA 4Q58C 5GRVL 3LHPH 5JLZA 3F7YA 4XXDA 5CGYC 3MRDA 1P0SE 2Y7MA 3DPBA 3V5KB 4JM2B 4MNGA 2ICEB 2ZE0A 3RGVB 4MMZA 5ESAB 3DRTA 2X87A 1L6XA 2NT1A 3HR5A 2CUHA 2ADFH 4NAQA 3WHXA 4X9BA 5B4MD 3RWIA 4ICWA 2CIKA 1CXFA 4I9XA 1SBBA 1YEEH 1FN4A 4JRXB 1JZGA 4WGWB 4EIGB 1PGRB 4DKEH 1TQVA 4Z7QF 2EXYD 1TYEB 2AJVL 2DQIH 1B4JH 1VEMA 4K3GA 4Y5VA 1OSPL 1D7DA 3FO9B 1ZHKB 3BGFB 1F4XL 3HPJA 4Z0BH 3WEOA 2EINB 4FXGC 4JFPB 4GNKB 2YRZA 3P3RA 4MZIA 4NLAA 5SWSE 5BZDA 4GRLB 4JGJA 1JPGB 2LHAA 4ZMPA 4LOUC 2YSTA 3MI6A 3AITA 4MJHA 4PLKC 4RGOH 3PWPD 3QUYC 3KR3L 1ND0B 2J1ZA 1BW8A 1A6UL 4UV7L 5DD0H 3H1ZA 3VJ6A 3K7UA 5E6UB 1T0PB 2R0WL 4YWGL 3M88A 5KBPA 1KLUB 3V52L 5AYTA 3RDTD 4AX3A 2Q10A 2HFTA 3AB0C 3ZUNC 5DEFB 3PNRB 1MEXL 3IU4L 1NZRA 3OB0H 3I6GA 3ULUC 3NZHL 4GW5B 5JIPA 2X1WL 3KM1A 4WSJA 1SJEB 4XO5A 3MLTB 3U4KA 1BQKA 4XPHH 3LSOA 4LLYA 1UM6H 2Z4QA 5ICXB 1E2WA 4FQXD 3UMNA 1PYWB 4B9ZA 4FI6A 5JW3L 2F61A 1B88A 1LYQA 5ADPL 1OOAA 3GB7B 4GRWB 4HGKC 2GJZB 1PDKA 3BT2L 4YE4L 2A1WL 2KDGA 4ZFFB 4P3CL 1HEHC 3QJRB 4WLCA 4LCUA 3FPYA 3TN0D 4AVJA 1U92A 1M9WA 3QPQD 3OHXB 4XPAH 2G3XA 5CINL 5KANI 3VFOB 5HI4C 3RUGF 5IB3A 2VN3A 2GVYA 3PDOA 4GS7B 1XR9A 4LRIA 4TOYH 3JTSA 1FAIL 3RHWF 2RCSL 5E9DD 2Y1VA 3MV7B 3QJSB 4AXWA 1E4WL 4G6FD 7CGTA 4CU7A 4G8AC 3OWRA 3OR6A 1G7HB 2L7QA 3SPVB 2XV6B 5HHPA 2CLRB 3S35H 3ARUA 2Y22A 5DJCB 1ZRUA 3ZE2B 2VO8A 5CD3A 4IK7A 1FE8H 4AV5A 2QPSA 4PJFF 3GUFA 1NGYA 5E6IA 1G0XA 2KMWA 1LEIB 3WXWH 1GW6A 3DRQA 1WC7B 2CO7A 5KG9B 4YL9A 5DT1L 4UDTA 3MACH 3TH3T 4BSVB 3U0WH 2VDMB 2DQTH 3NSYA 1I31A 5KS9A 3VX1A 3L3KA 2WBJD 2WO3B 3DKHA 4Y7OC 3SODB 2OMXA 1OPOA 4I7ZC 1Q72L 4NZRH 5IB5A 3E7JA 5AW0B 5C9JA 2DQDL 3AREB 1I8IB 5EFIA 3BO8A 4KXAA 2YUWA 3ARDC 4Y16A 1CL7H 1AGFB 3DJRA 3R1GL 1YNTB 4ONHA 3C6SB 3VGGA 3N0PB 4LEBA 2J2ZA 4Y9FA 1F2XK 4XP6L 4BDVB 5L7XL 4IU3A 2IAMB 1NKRA 2CUAA 2HRHA 1TJMA 1XGYL 2OJEA 3IMRA 4QCIB 4RDQG 3V4VA 3VYNA 4Y1TA 4AT6A 4U2YA 4DO6A 1YCSA 2VITB 5BO1H 4WU7A 2ICWJ 2YKKA 2NY0D 4HJ0C 3TBVB 4DP8X 5BNXD 1I9IH 5EZPA 1BQUA 1T7WA 4PJIF 3WEBA 3PWPE 4YVUA 1XF5B 3QEQD 5JPMB 3G04A 2XKUA 3GHBH 3E2HB 5KSVB 1UD8A 4UT6L 5IESH 5F1NB 2VJ0A 1O6VA 1MQKL 5ECGA 3MLYH 1DBJH 4CMHC 4ZMOA 4MQ7B 3SGDI 3ZUCA 2MQCA 2OR8A 2AAAA 2CBQA 4P3DA 1VIWA 3FQRB 5JHDD 2AJ3B 1V3JA 3DHJA 3MJ9L 3IJEA 3U0TA 1NOLA 2QADD 2LTQB 4NRZB 4NJAH 5EUOB 1TPXB 2X1OA 4EDWH 2WZ5A 2EUZA 4I5BB 4UTBH 3UZVA 4AYGA 5AVZB 1A4KB 5FFOA 4FDWA 1ZV9A 5JHLL 3PFUA 4K73A 4PH8A 2YD3A 1M6OA 2CD0A 3DTUB 5E94B 3HMWH 3ZYJA 1B9KA 3C6EA 1XGRA 3PGDB 1OT4A 2CCVA 1MZYA 1TKWA 3BPOC 4N0YH 3T8XA 1K2DB 1NCDL 2QGEA 3GF8A 2XFXA 1UJTA 2X4UB 4BHUI 1PSKL 2VRKA 1QOKA 5H94B 2APWA 1X4XA 4HLEA 3ENEA 1KNOB 2ITEA 4GAJL 4LSRL 4N0UA 3EH3B 3M6DA 5KW9L 3DSNA 1XF2A 3ZKSD 3I6KA 3D85D 1CLCA 1VCBC 1NCNA 5E9DE 4DH2A 1VFMA 2WIIB 4JPIB 4CJ0A 4NGHH 3SQBB 3B9KD 4EI6B 1NGWA 3AJ7A 2XWBA 3AQDA 3L48A 4FQCL 4YMPA 1F4XH 1IRAY 1RZKH 2ATKB 2WBKA 2R8SL 4JPVL 2FQDA 2VMEA 5E7BA 5IB2A 2NYKA 2X38A 5T1MA 3G5ZB 2W8CA 4E41B 2P5EB 2W5PA 3ME0B 5D7KD 1IGCL 3PDGA 5F7YC 2L3BA 5C0JA 2GSMB 4RRPM 3KR3H 2H6OA 3GMNB 4UV7H 1HH6B 3PAZA 5E4AA 2XWRA 4LKXB 4APXA 1ADQA 5DURD 4L4VB 3PHOA 4X6CB 3FB6A 3B8YA 1G43A 4IBQA 3WTYA 4NQED 4I1RA 2G60L 1NMCC 2R0WH 4APQC 4FQQA 3FB7B 3H7BB 4MRBA 3SDXE 3QFDA 1KJ2L 3CXDL 4HIIA 3V52H 2YRLA 3PJSB 1JF1A 2EH7L 3BJLA 2ZKXA 1MEXH 3IU4H 3MZTA 5A2FA 2A9NL 3Q2WA 5CJBA 1HESA 3MOQA 2XIDA 3UX9B 2JF1A 4PVLA 2YFNA 4GMSH 5AL8A 3UTZA 1RP8A 2IFFL 5J06A 1IBZA 4V2BA 3SE8L 4LEOB 5F7EL 5JW3H 4OLWL 2PO6C 1QFWM 4X9IA 1KJ2B 3KVDD 5GGTH 1MG2C 1WITA 3MRPA 4YE4H 2A1WH 3ZQXA 1KT2B 3S36L 3TVMC 4AK1A 4F7MA 4BH8A 2AJSL 2YJQA 1JXDA 3DLQR 4M3HA 3K81A 5CINH 4F7CA 4BKSC 3IDYB 3GS0A 5KVMC 3CVCA 3DX7A 5CKGA 2Z93A 3P0YL 3G5YB 1HXYB 2NYYC 4K3JL 2XVLA 1MSPA 2RCSH 4TPRL 1EXUA 3D0VB 5JHDE 3REVA 4PD4J 1RIVL 1E4WH 2O72A 1PX8A 4P5MB 1FH2A 4G3YL 1FYHB 3QDJB 3VG9C 3HNTH 5KBKA 3RAJL 1BJMA 2D4FA 3FT0A 3PWPA 3FRUB 3LRGA 1CDCA 2VNCA 5J57B 2EXWC 1J10A 2CHWA 3EGDA 4DOHB 1KBVA 1EEUA 2X10A 1Q72H 3U0PA 2PP9A 4L8SA 4M6AA 1DVXA 1KPUA 1O9ZA 2BP8A 5DYFA 4TF4A 4RQQA 4KVCL 3CN1A 2DQDH 2APFA 4BCYA 3KL0A 2A6JA 4AC4A 1RZGA 2YQGA 1XGZA 2WXMA 3ARGA 4LPXA 4N90D 1WGOA 5GS0D 4CUCA 4DZ8B 4XTRC 4XP6H 1DCEA 3FT9A 5L7XH 3KDPB 2ZCKH 3GSUB 4JJ5B 1P7BA 2QQKL 3SCMC 3UBXA 1XGYH 2Y5TB 1U2YA 3EYOB 5JOFB 3LXCA 2AXHA 4QRTA 3B2MA 5D7KE 3B34A 3VD9A 1S78C 2BMKB 5B1JA 4UILL 4C56B 1K85A 4W9ZA 1TFHA 5TE4L 2BSTB 3LYRA 4UT6H 3T2PA 4ZUTA 4JKKA 4UZGA 1QTSA 5MEPB 4C57C 3SJVB 2J20A 3HUJF 4FQ2L 5I2IB 2BNQB 4WEMB 4NQEE 4ZYKA 2X6VA 1HE7A 4BKLA 3FU0A 1INEL 4LKCB 5A2CA 5KVDH 3LZNA 4BE5A 4M8UA 3I84A 4B97A 2AZAA 2FSEA 1M4KA 2A99A 3MJ9H 1TDQA 3BPLB 1MDTA 2XJKA 1AHWB 4N86A 5EIQA 1OK8A 1QKZL 3KS0H 3NIDB 2AXWA 4G5ZL 4RMQA 3U2JA 5K39B 5I76A 4K3HA 2VAJA 4DP7X 2WQXA 4MYPA 1I3RB 2SEBB 1A1MB 3BPCB 2DI9A