2Y6TE

Molecular recognition of chymotrypsin by the serine protease inhibitor ecotin from yersinia pestis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
141
structure length
141
Chain Sequence
QQQPLEKIAPYPQAEKGMSRQVIFLEPQKDESRFKVELLIGKTLNVDCNRHMLGGNLETRTLSGWGFDYLVMDKISQPASTMMACPEDSKPQVKFVTANLGDAAMQRYNSRLPIVVYVPQGVEVKYRIWEAGEDIRSAQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSINOGEN A
publication title Molecular Recognition of Chymotrypsin by the Serine Protease Inhibitor Ecotin from Yersinia Pestis.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Hydrolase/inhibitor
total genus 16
structure length 141
sequence length 141
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y6tE00
1XX9C 1SLXA 4NIYE 1FI8C 1AZZC 1ECZA 1IFGA 1EZUA 1EZSA 1N8OE 1ID5I 1SLVA 2Y6TE 1ECYA 1XXFC 4IW4C 1XXDC 1SLWA 1SLUA 1P0SE
chains in the Genus database with same CATH superfamily
1XCTA 2V7HB 2Y6SC 1WZAA 2HZHA 2J2ZA 3ARFD 5SWSD 3QZBA 5JMRA 5IJDC 4NQCE 3IFNH 6PCYA 3IMBA 4PG2A 4PAZA 2VDQB 1VFMA 1AFVL 1NC2B 2WXPA 4P06A 5AW1B 3SPIA 4E9WA 5B8CA 5E2VH 5TE4H 1OAJA 1BVLA 2R0LH 3UYPA 4Z7OF 4DNLA 1IGML 1ZA3B 4F57H 3VFRA 2NW2B 4MJIB 1WZKA 1LO0L 4AX3A 4ESKA 3C8DA 1PFOA 2BY2A 5TFSH 3HNSL 3K46A 1X5AA 4PWFA 2A9MH 4O2CB 3RVXD 3H9SD 3KPSB 3IDYC 1FUNA 1REIA 4GKZB 1YEGL 2ZAHA 1YQVL 5D6DC 5AOKA 4CMMB 1SDYA 4CBZA 2FBRA 4GQRA 1BM7A 2BINA 1YC8A 5TF1L 3WS6C 3B2UC 2XLLA 2FJSA 2VCOA 3EOYG 3NPZB 4C4UA 3APNA 2PCFB 1ZS8A 4XBGB 2BVQA 4UU9B 5DMGD 3TBSB 3DETD 2BC4A 3SCMD 2Q2EB 2Q76B 5HHME 4GSQA 3BRDA 1VEOA 3D69A 4P2QA 2ZCHH 1IGMH 2N0KA 1GH7A 3TA3D 2OJEB 3RG1C 3QJFB 2BVPB 4L3EA 1E30A 2EYTB 5B3NA 4U3CA 4Z7QE 1SXZA 4QYOB 4EO5A 1CG9B 3W57A 5C2BL 1TVBB 1O7DE 4C83B 3CN1A 3E6HA 5T1MB 3TZVB 2VXUL 4ZSOB 1SUHA 1O6VA 3KYMA 1P5UA 4NUQA 3VRIA 5HVGB 2HJFA 2WP3O 1U93A 1LP9F 3L48A 3BH4A 5FOJA 1TQCC 2BVOB 2OA9A 3BPLB 5TF1H 2B3RA 5ANMB 4ZBJA 3WHE1 1AZZC 3HW7A 3UTTA 1BEYH 4XCEA 2CIIA 4BUQA 1OM3L 1G7HA 1X5HA 4TM9A 5SWSE 1J88A 1IO4C 4NQCA 2X2HA 3BUYB 5D4JA 5CSBA 2QGCA 1XDTT 1FH5L 3DV6A 4FHJA 1M2VB 1AKJD 4NM8L 3UZEC 4AVJA 1IJ9A 2YPLE 3GSVB 1BQUA 4N26A 4XBMA 3TJHD 3IM1A 1BQKA 4L8SA 4LNRA 1J8HB 5ANHA 4NN7B 4PJDF 5C2BH 2R69L 5DYOB 1OKEA 3U0TB 3BVTA 2VXUH 4B9CA 1ML0A 4WGWB 4X8XA 1WBXB 1SY6L 1QX1A 2CO2A 4IBZA 2AXHA 1MW2A 5MEND 4NWUL 3OGCA 3LS4H 4JE0A 4HDIA 1T6VN 3BE1H 2DICA 4ZFOA 2OBGA 2NZIA 4AH2A 1RV6X 5AAWA 1B3JA 2YOCA 1QHQA 2DIBA 3OKOB 1R6VA 4E9RA 4JPQA 4K3HA 1U8HB 1LTXA 5JPMA 4OT1H 3MRQB 1BMWA 1QD0A 3IDNB 3IDXL 4IBWA 4FQHB 1J1XL 3OHMB 2D2OA 5I1GL 2C8NA 5JHBA 3QE5A 4JR9L 1FH5H 3QG6A 3LV3A 4WJKB 4UYPA 1E28B 2VR6A 3RJQB 2WXIA 4YDIL 5C9KA 1BFSA 1KTDA 2L7QA 2WXKA 2R69H 3NIGE 3OG6B 1GAFL 5EN2B 4BZYA 4OZFB 3P0GB 4Z7UB 4G8GB 2P8LA 4LDLB 1SY6H 4ZMNA 2COVD 3E9TA 3ISWA 1BVOA 3OM3B 2ZKHL 1R5IA 1M1SA 1UZ6E 4NWUH 5EOTB 4PRNA 1FGNL 1HEZB 3ZTJH 4KKZA 2Y7LA 1XSKA 4PI2A 4HS3A 2Y2YA 4LEBA 3E1ZA 3FQ2A 1BVKA 3WFCL 5HYJB 4M43L 1F58L 3TPKA 3IJ9A 3WDIA 4W1TA 1KF9B 3Q2LA 2DQEL 5E8DH 3K5SA 2Y07L 1HE8A 1GOFA 4URKA 3AU0A 1G9NL 3G04A 4YHIA 4NQVB 5D72L 3WKPA 2C9PA 4JZNA 2CJ3A 2PW2B 4PG9B 4BWUA 3ZDZF 2ZX8A 5HYQB 5J57B 4R7XA 1SHXA 1NAKL 3JSSA 4TXVB 2YPKB 3D2UA 5IBUG 2GBAA 4NSKA 1CFQB 3HZVA 4YDIH 4POZC 3CQFA 5ACMA 2ZUQC 2C3GA 2A38A 4OUUA 5E8PA 4UQEA 3FN0H 5CJ8A 3AUVA 4NO2A 4HF5L 2VQTA 3GLZA 4U6TA 3NJJA 1JGDB 2YPLA 4FNLH 3VE0B 1AR1C 2HFEB 2ZKHH 4S1DD 5CEXB 4UTBA 1XGQB 2MRYA 4Z8FL 1FGNH 1Z9SB 2ADJB 4Q6IB 5A7BA 2ATKA 5I8CB 3HUJF 1AO7A 3MGOA 4QRRA 2W92A 3Q06A 3WFCH 5GJSH 1F58H 2DN7A 5MERA 2FJGB 1MRCL 2JQZA 2Y07H 4B0MB 4JM2D 4KHXL 1G9NH 5MENE 5D72H 2FT8A 2CDGB 5IVXA 5DC2A 1R75A 1I3UA 2VZ3A 3L81A 3SO5A 3T4AA 3WN5B 1FZMA 1T2JA 4MSWB 1NAKH 3QUXC 2CUMA 2FZ3B 3J07A 1U8IB 4Y5XA 2DBLL 1DUYB 3SDYL 5C0JA 4JFDE 2E7LA 1GPOL 2JKJA 5J9PB 4W9CC 4NAQA 2CO6B 3BFWA 5EF2A 3RPBA 3V0DA 4Z8FH 3JTSA 1OQOA 4ZO8A 5FF6B 5F7FA 2NCMA 4AOFA 1DQQB 2Z35B 4U1GC 3AGVA 1UOWA 4ZTOL 1EO8L 1M3JA 2AVFA 2O26U 1S8DA 1N18A 1MRCH 3L3OA 4XVOA 5DHDA 1JNLL 3DJSA 4PRBA 1NM9A 2D2CC 3QQNA 1KCWA 4NI3A 1V8HA 4R7LA 4KHXH 4F7KA 1FIGL 4Z18A 2WKOF 5F2FA 4JFEB 3II1A 3RFZC 1I7TB 3D9AL 4OUOA 4QDGA 2D31A 4OQ1A 4ZFZB 2H1LM 4OF8A 5KG9A 1VZHA 2G75B 1EZSA 2DTML 4PG2C 2GUOB 2VDPL 1M7DB 5C08D 4Y4FC 3PREA 3WN6A 1U6AL 3AXLB 1IT9L 1GPOH 5B8CC 4EZKA 5F1IA 2C3VA 1MREH 2WMPA 4WTQA 1OM9A 1FAKT 2Y7SA 3LQZB 1GYAA 3CVHL 5E6IB 5DHEA 2NR6C 1FN4B 1SJXA 3EF7A 1NEZA 4PLKD 3ZBMA 3HBZA 3KYKL 4ZTOH 1W15A 2HLFC 2J20A 3ABZA 4E5XB 1AGFA 5C0IA 5J89A 4NZJA 3HOGA 4LLMA 4QUOA 4FJZA 4GBXD 3WS3B 3U4KA 2F1EA 1S7WB 1G94A 4I5BB 1FIGH 1EAOA 1QSZA 3V6ZA 3G5ZA 4MD4B 1S9KC 1WVZA 2NY2D 5JIKA 1U21A 5FFLA 5CLXA 4MAYD 1BIIB 2CBPA 4LAQL 3DSNB 3FH7A 3QWOA 1ETZA 4Z7VE 2LU5A 1BD2D 3QDJB 5L8JB 2DTMH 3DX8B 2VDPH 1A8JH 4Y9BA 5IQOA 2J1XA 4NC1E 4WUUD 3KH4A 1U6AH 2AQSA 1YEFL 3MYZA 1ZXKA 4FF9A 4M8QB 4OCLC 1TO4A 4MXVF 2YLHA 1PY0A 1TYJA 1WFTA 2BLFA 1YJDL 3CVHH 4N8CL 5CM1A 3T65B 1ZS2A 3FT3B 5SV3A 3TVMA 1KCKA 4UQ9A 2K4AA 4W9DC 2CO1A 2YSSA 4JFDA 3BZEA 3HN3A 2YRBA 2E6QA 3KYKH 4XMZA 1XF5A 2VDRB 4U4IA 3QJXA 4X6CF 2ILLA 1A6WL 5DDHA 3RGVA 4F9LA 2IAMD 1P5UC 4X4KA 4DUVA 3E1F1 4E41B 3QIWA 3VFNB 2DMBA 1NLDL 5IIEB 4LAQH 2BNQD 4L3AA 1RI8A 4PS4L 1KPUB 3BH8A 2GUYA 3F7PC 2EDQA 4KKCC 1QSFE 4MA3A 4Y4HB 4DP6X 1WTGT 2XKNA 4J2QA 5DZLA 5MEOA 1CD9B 2QHLA 2VR3A 5JW4R 1F97A 1LD9A 3MKGA 4HPOL 4YAQA 1D2PA 4MS6A 4KJYB 3IMWA 1FF5A 5C08E 3V4VB 4ELME 1XT5A 1J11A 2R0KL 5EB9A 1VSCA 4X4ME 4L8SC 2X10A 4PJEF 1IE5A 4KUCF 4L1SA 3MLRL 4YZFF 1A6WH 2VLKB 3L8QA 5A16B 5E08L 4U1JA 4IS6B 1A6AA 2Y7NA 5IOPB 2DM3A 2CLRA 2MQ3A 2DYSB 1EGJA 3O3BA 2WXNA 1Q4NX 1SOQA 4GYBA 3MV7D 3QZLA 4PGCB 4GKNA 4PS4H 5KWYC 3RUGE 4GQ9L 4CSPA 5L4FA 4XOEA 1E7UA 4R2GC 2EAEA 3EGSA 5TGBA 3V0VB 5AAWC 2AJUL 1Y6MR 4P3CL 2R1YA 3EDJA 4PD4J 5ETUA 5JPMC 4JDEB 4WNQA 1ZLVH 1PF3A 1BD2E 1J0ZA 2A6KB 2FH8A 3BOVA 1YNTA 5CCGE 4HPOH 2VDPB 4IMLB 4U1KA 2EVGA 4YIQA 1MCEA 2DD8L 2D9CA 1N12A 1AANA 3UJJL 1EHAA 4ADGA 1KBKA 1OE3A 3C5ZD 3FOLA 3V0AC 1BQ5A 5D71L 5AVSB 3TYFB 4L1LA 3MLRH 5FHAH 1ZHBA 5E08H 3V6OE 2NY3B 2D3LA 4B9ZA 3U4AA 3U0PA 2BW4A 4PR5B 5I0DA 2PYEA 5LBVA 4LCCB 1B4RA 4IIQB 3DMMB 1O7DC 3KAAA 4PP1C 4GQ9H 5GS0L 4FAAB 4PVLA 1TCRB 3IXTB 4AKQA 3VXME 3I75B 2IXQB 4WKZB 4P4RA 3K6DA 2BNQE 3H2QA 4LLDB 1QSFA 4HXAH 4D0DA 4KRMB 3BO8A 2WXMA 5BCAA 4HCRL 2VLRA 4AK1A 4DKEL 3WU1A 1TVHB 2FX7L 3UJJH 5I1KL 3K4ZA 3CTTA 4NRZB 2DQFB 1JGEA 3KLKA 3VDBA 1T7VA 3ILQC 1OOAA 3VGBA 3ARPA 5EBGA 4ELMA 3L7EB 1FNAA 4FABL 2ZWSA 4LFHD 3HBPA 3JYBA 4J5VA 1O9VA 3FFCD 2BVYA 1EA9C 3IE9A 4OB5H 4OH2A 1ZLWK 3KL3A 3P9WB 1CFTB 2XUWA 3CXDL 4F33A 3SOTA 1XL6A 2JVUA 3S9DB 1MCJA 4JANB 4QJ3B 2YQBA 5E7BA 4Y2DB 5DJ2A 5HHXL 3HJ0A 5JDSA 5F3FA 5JUEL 5H4ZA 5A2JH 4Q2ZB 4GBXA 2BNRD 2HWZL 1ZEAL 4GRLA 3OKLB 4HLEA 1QBLL 4WFHE 1NIEA 4KKBC 4HCRH 2Q8AL 3RVXC 1Y7VA 4JUTA 5I1KH 4N1EA 4Y5XC 3GEWB 1HKLL 5L2KD 3GZQA 3FHEA 2E7LC 3F7YB 2JKNA 3CQPA 4IJTA 5DEFB 4FABH 2IBZX 4AWJC 5DMGC 3IKCB 3TTSA 4OD1L 2Y4SA 3T0BA 1E2VA 1YNKL 2NTFB 1IUZA 3EH5B 4R4FL 4FYSA 1HILA 3KMDA 3PABB 2NXZD 3CXDH 5HJBA 3T4YB 4OVVA 3ZE0F 4JO4L 4JL1A 4OFDA 3MO1B 3DVNB 3NG5A 3UC2A 2ICWA 4RRPA 5I66B 5LGHL 2NNXA 5HHXH 2DH3A 4K71B 4OCYL 4OZFG 2D3NA 5ICUA 2HWZH 4TSAH 1ZEAH 4IOSA 1QBLH 4X4YA 2VMDA 4J6IA 2Q8AH 3BT0A 3VXMA 2JNZA 2VJ8A 3FYIB 4QT5B 4TVPD 3X11B 5KANI 3MVSA 3IMRA 3M8OH 1MI5A 3RI5K 5D7LB 3BVNA 4OR1A 3VG9B 4Z3TA 3KZ8A 1T0OA 3D39B 3OMNB 2F8IA 2WKGA 1KB9K 3T3MF 1YPZF 5A7EA 3UGEA 3GLEA 2I26N 3ZXAC 1R5VA 1IM3A 1P69B 5HVHC 1JD7A 1QR1B 1KLGA 2CHNA 1AVAA 3CHSA 2Z1PA 2X9ZA 1IM9B 1NGWB 4N8VB 4DPCX 5LNEA 2A2QT 4X8GA 3IVKA 2DZEA 3LX9A 1OB1A 3FFCE 3MRMB 1F3JA 3NIDE 4OCYH 4XPBL 2DW5A 3LQAC 5AYTA 3U6RA 5JIPA 3VD7A 2KKQA 3OG4B 1KTJA 3OAYH 4NWTL 4Q7DA 4AM0A 5G4MA 2V2WB 5EF0A 4XC3H 1U8NA 5EO0B 2YS4A 3BAJA 1OSZB 2P24A 2VUKA 1CYXA 1ZT4A 4WI0B 1G4MA 2GBVA 3JWOL 3U46A 3D50A 2EADA 4LO9A 1YYML 5INDA 1YYLL 1SEQL 4L3CB 1AP2A 4U1SA 3K2UL 3TVMC 5SX4I 5I1CL 1VGKB 1VRSA 1R1CA 1F4WL 4LHJB 4X5WA 2BSRA 2XU9A 4XP1L 1XF2A 1JGIA 2EDFA 4IRJA 1Y1DA 2FCBA 3KCWA 5FO8A 2KPNA 1QFHA 2GJ6B 4F27A 3UPRA 2G0KA 3RGVC 1Z9LA 4F9LC 5E1GA 5T1KD 1V7ML 5F9JA 1CXFA 3D1MC 4OLVL 2R0WH 1OTSC 2ZXCA 2Z31B 3LMJL 4ORGB 4OJEH 1N68A 4HKBB 2AABL 2Y6TE 1CXLA 3GZOA 5F21B 1CT8B 2ZSVB 1DUZB 3PJNA 1XSJA 3ARTA 4M9PA 5AL8A 3UAJD 1ILUA 1P7BA 3JWOH 1G7LB 4PJBB 2PW1B 3COOA 2P5WB 1YYMH 3DI3B 1SEQH 2UXTA 3MC0A 3Q9QA 4TYUA 1OTTC 5SX4H 5JQHC 1R34A 3K2UH 3BPOC 4NERA 4NN6C 3WI9A 3OKKA 4AT6A 4DQOL 4HFWA 3WNLA 3NJNA 3GSUA 2AEWA 2NUPB 3RY4A 3EFOB 3RIFF 3V6BR 2BHUA 1PLCA 1RCYA 4W9FC 5C07D 4LKCA 2WQAA 3VM7A 2A73A 4AEHL 1XEUA 3HS8A 3ULSA 4AQZA 1ZRUA 3GIVA 5FLVA 3P0VL 4OLVH 4CSSA 2WSPA 4G9FD 3V6FB 2XPYA 1J5DA 4UT6H 3ZTDC 1AGBA 2AABH 4TTDD 4GG6B 1QO3B 3MRKA 3BMVA 1T89C 2FWUA 2H6PA 4WVRA 3ELQA 4G1EA 5T8IA 2F1BA 1A02N 3EYQC 3ZGHA 2XQ0A 3MOBL 1M56B 3TJPA 2FWOB 2ORBL 3EO0A 3MTRA 1ZDQA 5FV1L 2APTA 4NC1C 3ZT7A 2IOIA 4DQOH 3MOQA 1RLWA 4XHQA 1MLCB 4O5LL 1GYVA 2VXQA 4A6YA 3WO3B 5F6IB 2XWBA 5DJ8A 3BZFB 4G1MB 4JGUA 3Q01A 2A6IB 3V9CA 4FG4A 1UM5L 4A66A 3IJ8A 3TIEA 3SY0A 1RK1B 4LCYA 4TSBH 3VFPA 3P0VH 1W16A 3KLQA 3F7RA 4S10A 4QRPB 5EC2A 2EIZA 5IB5A 2QFRA 3ZZLA 4XTRD 1NDMA 1JI1A 1MXGA 5D1QA 3UBGA 3V10A 4ZJ9A 4PSPA 5IMLB 4HBCL 4KTDL 2XTJD 2EEXA 4NZUL 1YDPB 3QAZB 1L9OA 3PNWB 3V52L 1U42A 4FG2A 3MOBH 1NQBA 5I6LA 3L1FA 2NYYD 2ORBH 3QJVB 3OAZH 4K7PY 1HT6A 4KH9A 2GFBB 4X8CA 1RUAL 3SDCD 4PJGA 3LZNA 4O5LH 1JZ6A 3VXOA 1HHIB 3GTTA 3ETSA 3H8NA 4YSTA 2QV2A 4QRQA 1UM5H 4Y5VA 4PJCB 4U1IA 1YEDA 1H6FA 1OGTB 2X2IA 4PJ8A 2GY5A 5JZ7C 4IRSD 4HJEA 5IOKA 1CFNB 3VD4A 3FB8A 2H3KA 1BPLB 2XHNA 1NEPA 3KLDA 3DIFA 3NJLA 3MRDB 2YKKA 2IV9A 4HBCH 4KTDH 1VADA 4PLKC 1D5XB 1E2WA 3V52H 2G4EA 4G9FE 1ZLUK 2K8MA 5BRPA 4Q9CA 3F12A 3L5XH 3S36X 4MB1A 4UTAH 4GBXC 3X12A 2OP4L 3NCJL 4UQBA 4XXCA 2WKLA 2OR7A 2B16A 4GRLC 5KTEH 1OT1A 1Z66A 4JM0A 4H0LC 1QUNB 2ZXQA 1N5AA 1T1ZB 2VW4A 4L1TA 4YHOH 4FDWA 3KYAA 1IEAA 1FZOB 4PJFE 1VFAA 1XMEB 1I1AA 4I87A 5EUOE 1WAAA 3O6ML 2O5NA 2Q2LA 4KROB 2FLMA 2KBGA 2V3FA 1PBYA 4PJXF 4PBXA 4X5LA 5CP7B 2HTKD 4PJAA 5JYMA 2C7UB 3D30A 5I1EL 1T20A 4WRLA 3KXFB 2HXAA 5CGYD 3AADB 3CFKB 5AAPA 4QF1A 3ZL1A 4WV1B 1E4JA 2H41A 2R29A 5FM5M 1KGJA 1CTMA 2LU7A 3V6OC 5IWLA 4U0RC 5A43C 4BZ1A 2PXYA 1OGSA 1UWGL 5HDRA 1ZSDB 4B27A 5FM4A 4H7VA 4JCWA 2OULB 4JQIA 3WCYA 3OB8A 1NDGA 4MB4A 4BFNA 2W94A 2ZXEB 1GS7A 1NCOA 1XH3A 3BC9A 5F71A 4DQAA 3FUIA 4BK5A 4JDTL 4FXGB 4P0DA 4UZSA 5FGCE 1A2YB 2FSDA 2IAND 1U4FA 5AAMC 1J5OL 5E00B 3V5HA 4HD9A 4HV8B 4G7YL 1XB3A 2FIKA 5F97E 4HMCA 2OXGA 1TZ8A 3GB7A 5MI0C 1CQKA 1UKQA 1KV3A 3A4DA 2EDLA 4A38A 3NFSL 5EO9A 3HKZA 3OHXA 2QPEB 2FEDC 5ESAB 2YXFA 1AIZA 1MSPA 2LAAA 4NGHH 2KQMA 4Y1TA 2YAMA 4MRBA 4HC1A 1T0MB 1Y1UA 2JK5A 2A4EA 3ESPA 4P07A 5HHOB 3BN9C 1IAKB 4H1LH 2QEJA 3WNNA 4EIBA 2WXGA 5BV7C 3DURB 1TFHA 4HJJL 4LDEB 4H5SB 4TNVF 4JDTH 1KELH 1ZGLP 3MNDA 4ZMQA 4PEEA 1S7TA 5LAXB 2B7DT 4JFWA 5D9SA 5J1AB 3KDMA 3VXUB 1K6QL 3QORA 2PN5A 1KB9J 4Z78B 1XZWA 3RVUD 2ZICA 4M7ZB 1KGWA 4D0BB 1LDPL 3FU7A 4ZTEA 3CBKB 3KPLB 5EUOA 1DJIA 4I7ZC 4X5XA 3T6QC 2QVMA 1ONQA 4WI4A 1IBBA 4R83A 4LSQL 2H9GB 2VMJA 4GXVL 2HT4C 3C5ZC 1FP5A 5DI8A 3LN5A 1OP9A 4KTYA 4L1DA 2JKRM 2IPUK 4HJJH 1PD1A 4PWKA 1MVUA 1JDAA 1A7BA 2UX7A 3QNZB 3KHOA 1U9KA 1U8OB 4HZ1A 2AQPA 1N26A 3BKCH 2XX1A 4OCSL 5D1ZI 3VD5A 4EI6B 2HKFL 2PLTA 4NFCA 5J7CC 2XV2A 1EJ6A 1KYDA 4MNGE 1TTUA 1AG0A 1EIBA 4X99B 4KKRA 4ZPTA 4AIZB 5IB2A 2QDVA 3ECQA 2YMTA 1FVCA 4HWBL 4LL4A 4HLJA 2RQ8A 3L9BA 5GGSB 4DP9X 3MYJA 4J3VA 2WXOA 5GISH 3ZRSA 2P43B 5LDUA 1J8HD 3HPLA 1F1GA 1BVNT 1EERB 2YLKA 3L3HB 4G11A 4GAGL 3E8UL 3FQUB 4ZZKA 3UH8A 5IV2B 3T8VA 4MJIE 4BKTC 5C0AB 1DVUA 3B5TA 4QGYA 4UB0H 4X6EA 4GXVH 2VZOA 4LBEA 2F15A 3GDBA 4CW1B 3D25A 1ETJA 1PZ5A 4XH2B 1H8NA 4FNPA 3DDFA 2CMRH 5ITBL 1QBAA 1YEJL 4GSUA 2HKFH 2A74B 2A83B 2WM0A 3UPCA 2LFGA 5CGTA 3QZNA 4RMTA 4H1LB 3HFFA 1M57B 1NBVL 1DJGA 3AAZA 3I6KB 2R1WA 3MACH 4JPWL 1F4XH 5E8NA 2F7OA 4HWBH 3EYSH 4N8VG 3C6LA 4UI2A 4WU5B 5EG6C 3CAFA 3QWQB 4YFDB 1UOKA 4YSOA 3W11D 4DVBA 2ITCA 3NP3A 2AJZA 2J8UB 4Y4KA 3VWKB 1HFUA 1J0HA 2DEXX 1J12A 4AVIA 1LO4L 2Z9TA 1D5MA 2R2EA 2W65B 4GAGH 2FJFA 2DQ6A 1QLEL 5DSCB 3ABLB 3QJHB 2YAPA 5IK3A 1DBBL 5E8EA 3FN3A 4IDJL 2YD6A 1J7VR 4IGBD 1CD0A 2PCPA 2FVNA 1GSKA 3ZDXB 2MCAA 5C0DB 4ZSOE 2P9RA 1L9MA 2KLTA 1KMGA 2BRRH 1YEJH 2BZ7A 2FYYA 5D1QC 5ESQA 4AC2A 3WEXB 5FK9A 2IGFL 5DR5H 4WO4A 3NK3A 4NO3B 1XCQB 4G8IA 3X14B 4JPWH 4LEEA 4O2FA 1CL7I 3RA7L 5ANME 1P1VA 4D3CH 1QNIA 1N7ML 3V79C 5D7EA 2V7HA 1BJ1J 5EEVA 1F56A 1SVZA 1IQDB 1K4CB 3ECVA 2A5UA 1ZIAA 1LO4H 1GHFL 1SDDB 2DLTA 1QLEH 1FV1B 12E8L 1WWBX 1NC2A 1PG7L 5DJYA 1DBBH 2KC0A 3S37X 3VTMA 2ZX9A 1A0QL 1CTNA 2EECA 4QRTA 4YC2B 1J0KA 3L3IB 1J8HE 1ZA3A 1II4E 2F8VA 3EIFA 4PV9B 4APQD 2NW2A 4MJIA 2AK4D 2A4CA 2BSBA 1W2KT 2CRMA 2IGFH 5T1LB 1KZYA 5DD5L 2JCWA 1CL7H 3PPSA 1BAFH 2JV6A 4JRXA 2AJSL 3AXHA 5D1ZB 2PPFA 3RA7H 2YD7A 2JB5L 2XNAB 3KPSA 4OD2B 4DT2A 3ARYA 1E4WL 1EXUB 2APWA 4GKZA 2CBOA 5D4IA 2R51A 2F19L 3GMOB 1Q72H 1LGVA 1QPXA 2VUOA 1GHFH 2AEIT 3OC5A 4Y19D 3NACL 4JHWH 3D34A 3DX6B 12E8H 5IREA 4XBGA 4F5CE 4UU9A 1I1AC 5HHPB 4WCYL 3QFDB 3TBSA 4YHLL 1A0QH 1ZGLB 2Q76A 4CGUB 3L2NA 1G9MC 1JZIA 3UP6A 2HJKB 2OJEA 3S96B 4Z7UE 2VIRB 3MCKB 4QO1A 2WOBA 4XO8A 2BVPA 1ZAGA 2EYTA 2Y1ZA 3OJMB 5KBKA 3EAKA 4JKPH 5GGQL 3E38A 4QYOA 1SJEB 5IWLC 1CG9A 3IYLW 3GUFA 1TVBA 5DD5H 4JFED 3TZVA 5T1MA 4ZSOA 3AACA 1UGKA 3MFGB 4FP8L 5TDNB 1TNNA 3GGWA 2TAAA 3S8FB 1XIWB 3GXMA 4E0RB 2F19H 1FI8C 2BVOA 4BK5C 1BQSA 5LN8A 5IT2L 4RMRA 3KGTA 2BCKA 2HMID 5M94B 4FFWC 5ANMA 2HCZX 4HUVB 3TH4T 1F45A 3HHRB 3QH3B 2KZ1B 4DPRA 1LHZA 4YHLH 3O41B 2KI6A 4GW4B 2DBJA 4IRZA 1ILSA 1MFBL 4KQ4H 2D0HA 2N1TE 4JFSA 4KJPD 1ECYA 4JG9A 1HXKA 5IBTL 2PCYA 1VDGA 2EKSB 4IBLT 4N90E 3BUYA 3QB7C 5FCUL 4LSUH 2VDML 3PLYA 2A1WL 1H6UA 1M2VA 3V0GA 5IFHL 1VZGA 3CH1B 3GSVA 3OSKA 1BXAA 3OHXC 3LY6A 1U8QB 3VGEA 2RJMA 5DYOA 3U0TA 3D06A 2P80A 1YEIL 4FP8H 3MJ8B 4ZNEE 1WBXA 2OMVB 3OPUA 2NZ9C 1G87A 2E7CA 3ZOAA 1ZV5A 3BSZL 3QDJD 3EJUA 1SHMA 1IARB 1CF8L 5DF0A 4JO5A 3RX7A 2OI9B 1DTUA 2PKDA 3WNIA 3QDGD 1MCDA 4FKEA 2DQTL 4XMLH 2UVFA 4TTDC 1MFBH 1M05B 3OKOA 3WIHA 1E8YA 1U8HA 5IBTH 2DQDL 4WWKD 1NIBA 1T2QH 2Y23A 3MRQA 1JTPA 3KCPB 3IEAA 3R0NA 5JO5B 3N3EA 4FQHA 4Y19E 1NOFA 2VDMH 3T0XA 1HZHL 2YKLL 4F5CA 5B3SB 2BSED 2A1WH 5IFHH 1JCVA 1E28A 4HUUB 5EN2A 2ZXWB 1UC6A 4D8PB 4OZFA 5KBDA 1MFMA 4Z7UA 4LCWD 5KJRL 4G8GA 1JXDA 4N22A 1YEIH 3S3BB 3SJVB 1BJ8A 3VXNB 2YO3A 5BPPA 4HHGA 4QNPF 3BSZH 5F3HB 4JNXA 4FTVD 5EOTA 3VWJD 1HEZA 4X0KB 1CR9L 3EJZD 5F7EL 4JFEE 2JKLA 1NSNL 4N0UB 5HYJA 5IBLC 4Q58C 1R46A 1QSEB 3DBSA 3L6FB 3RPIB 4U31A 3SPVB 4FJ6A 2B5IC 2AAAA 3W39B 2PW2A 1SXCA 4D7BA 4P5TD 3AG2B 3BVWA 5I26A 3QJRB 5HYQA 1SYVB 4KK9C 2YKLH 2YPKA 1MCPH 3ZE2E 3BAEL 1CFQA 4MQXC 3MROB 4ZYKB 5I6NA 3KM1A 4EQ3A 1INEL 5E1AB 4JFZH 1LLAA 1PX8A 2IWEA 4JX0A 4OIFA 5F9WC 4JFTA 1GJUA 2ENSA 4B3VA 1JGDA 1KN2H 4X6DB 3VE0A 3LNFA 5CEXA 5CEZL 3BUIA 1XGQA 2DQUH 1JPTL 4OF0A 1LNUB 4JDZB 1Z9SA 2ADJA 1CR9H 1P1ZB 3Q2CA 4Q6IA 4FEIA 1NSNH 1CGVA 4PBVC 2FJGA 4TF4A 3CDGB 2I60H 2R2HB 3EH4B 3DYPA 3QDJE 4LIQL 4NJ9L 2VM3A 4G80B 2CDGA 3MNWB 5CBEB 1GS8A 4FQCL 3WIHL 3OKEB 4MSWA 1NA8A 1TO5A 2GTZB 3QDGE 4G42B 4Y4KC 3PAZA 3QJQB 3WELA 2FZ3A 3BAEH 1U8IA 3O9WB 1RPUA 1DUYA 1INEH 2NY3D 1E3XA 1HSBB 5J9PA 1EO5A 2ENQA 2N01B 3DMMD 1ADQA 4TNWF 5G4OA 5CEZH 3H42L 1TQBC 1JPTH 4FQ2L 4JRYD 5ECJE 2NDFA 5CJXA 4YVNA 1S5HB 1FSKB 5FF6A 3WNOA 1XQ4A 3OXRA 4H44C 4E41E 2Z35A 4Q14A 3BW9B 4PJ5D 3QEHB 5IROD 2DWEB 2CM6A 2KS0A 2KDGA 4HJGB 4RBPK 3CFBB 4NJ9H 3HZMA 4FTVE 2RH0A 1FGVH 1F6FB 2CWRA 2G3MA 3FQWB 4FQCH 1C12B 1ZT1B 4AZ8B 3RWFA 3BLBA 3B2XA 4XN8A 1I7TA 1FYTB 3P4LA 3JV4B 4M6ML 4ZFZA 1G43A 2UUDK 1OSYA 1O9ZA 5EZIH 4ACTA 2G75A 3WMQA 3LNEA 3HFML 1OZUA 2GUOA 3MFFB 1FVDB 2PO6B 2Y1VA 1N6QH 2WINB 3KLHC 4JO8A 2ZOTA 3PUCA 5L0QB 2WWNA 2ZXBA 3LQZA 2E3VA 5E6IA 1PS3A 4RZKA 2NT1A 2PP7A 1FN4A 1DJZA 3DBXA 3HE7B 6CGTA 3CCHB 2Y3AA 2FSEB 3QHZL 4OM1L 3B8YA 4U33A 4WU7A 1ZV2A 3CFJB 4E5XA 4Q6KA 3O6LL 3F58L 3TP4A 1QEXA 1I3GH 2VW6A 3WS3A 3IJEB 1ZHNB 2A9DA 1S7WA 2YGPA 1ED3B 4I5BA 2OAAA 4MMXA 2DJSA 2ZUSA 4MD4A 4ONFL 2OL3L 3H53A 1BIIA 4M6MH 2IFFL 5FWQA 1Z7JA 3DSNA 5BQDA 4F2EA 2VLLB 3FCUB 3LZQA 3BP4A 2L0DA 3DVFA 2E56A 3HFMH 5K1JA 1CXKA 1FFTB 3CSBA 4M29A 5LGKA 4A2HA 5BUAA 3OX8A 1D7BA 1YG9A 3CHPA 1I7RB 1J9CT 4M8QA 3T0ED 1I8KA 1OGAD 4WY7L 5EA0L 4G43B 3IFOB 1UVQB 4OIIH 3SODB 8PAZA 2VR9A 1JHTB 3FT3A 1HU8A 4BQCA 3QHZH 4OM1H 4RFNB 2QADB 1UJTA 1EX0A 1EVUA 3O6LH 1QA9A 3F58H 4FLQA 3SDDD 1RZJL 2XIBA 4PB0L 3IDMB 1KC5H 3TZVC 5FKAB 4ONFH 3PV7A 3ZE1E 4E41A 2E47A 3VFNA 1A4JB 5IIEA 4PJ5E 2IFFH 3ATFA 4WO0A 1TTAA 2J5WA 2OSLB 5A3IC 1JDCA 2LU4A 1KPUA 4L4VA 3D8MA 3BPLC 4XN2A 4Y4HA 5GS2H 2YMOA 3MJGX 3TEZA 3RYMA 1JWSB 1FNSL 5EA0H 4XODA 2W9DH 3ERXA 3MRIB 4KK5D 2QQLL 1Z9NA 2XZZA 4KJYA 3V4VA 3GMLB 4Z7NB 3RBSA 3ULVH 4WK4B 5FXCH 1JZEA 1R3LB 1T2XA 1KFAH 1JXKA 4NN7C 1RZJH 3RWGB 3ORJA 1KBGL 2XACC 4ZMVA 5ACZB 2QLVB 4PB0H 2N4IA 2VLKA 4M5ZH 5A16A 2XZCL 5GS0D 5K69A 3RURA 4HXBL 4P04A 4ZUSB 2OR9H 4X83A 3MLVH 5IOPA 5I1HL 3BAIA 3BGMB 4AGOA 3ARQA 3L9EA 4RMWA 4FRWA 4K2UL 4BUGA 2LU3A 2C26A 1ZSHA 4WHCA 3U7YH 2N7AA 3FTYA 4PGCA 1BAWA 1NC4A 2V9UA 2DLGA 2HRHA 4BCYA 4M93B 1U36A 3SYOA 3S48A 2YD2A 3QWRD 1WFUA 4AL8L 3QQXA 1BWWA 1WE5A 1FAIL 1FNSH 4TL5A 4JDEA 2A6KA 3AS0A 4LLYB 5ALCL 5IMKB 1JGUH 3Q8BA 4B9GA 4IMLA 4ETQA 2H0FA 4R7DB 3W11C 6PAZA 5L8LB 1KBPA 3P02A 4OZIF 4QLRA 1N0LB 5SWZB 3HC4H 1ROWA 4PU2A 4EZJA 3NQKA 4F20A 4L8CB 1KBGH 3TYFA 1KWKA 1A4KB 4E42A 4GAAA 2XZCH 5DQ9B 3TO2B 2Z31D 4HXBH 4Z1PA 4AE0A 2OKMA 2WIIB 3MPCA 1QWUA 4PR5A 3UXFA 4Z7OB 4LCCA 5DK2B 4K2UH 4IIQA 4UOQA 1SOSA 3EOAA 3SHSA 3O11B 5JW4M 3F7QA 4PUBH 3VRJB 1JTTA 3IETB 4KQ0A 1TCRA 2JCCE 3IXTA 1I9JH 3MRHA 1O9WA 2IXQA 1HINL 1HHHB 4WKZA 4AL8H 1J5HA 1RFDL 2IMNA 1FAIH 4NNXB 5T5FL 3RHWF 3ZGIA 5I2IB 1SFHA 4WFFE 5LO7A 5ALCH 4JAMB 3BXNB 1TSRA 3K2MC 1FNFA 1V7NL 4I85A 1E43A 4OLXL 2EXWD 3D39E 1TVHA 4NRZA 5HGHB 2DQFA 4OIAA 1G7PB 3UC0L 2OYKA 4HOWA 3Q5OA 1HH9B 1UWEH 1CFMA 5JW5B 4Q9QH 5GRUL 3A47A 5J4MA 1SZNA 4K23L 4KO5A 2YBRB 3BUPA 5CKAA 3GO1L 3PGDA 1WFOA 4Q6IC 5D4QA 1CDIA 4R7VA 1CFTA 2HT3C 5F9AC 2B9BA 3VFUB 5IB4B 2B0SL 2UWEF 2VR4A 3LB6D 3F3HA 5FA4B 3VVWA 3K91A 2F68X 1DBAH 4JANA 5DLML 2Y5QA 1BX2B 4Y2DA 2JI1A 1RFDH 5T5FH 3GXUB 1W72H 2VUYA 1UH4A 4Z6AT 2X6UA 4Q2ZA 4N6RB 3OKLA 3WN5C 2AS5M 2VZ1A 1QAWA 1V7NH 2BOBB 1FNGB 2GIMA 2QTEA 3P1VA 4FLRA 4Y8AA 3KPMA 3QXDB 5HYFA 4Y7MA 1FO0L 3MLXL 2BXYA 3UC0H 2WJ5A 4Z7WF 1PAZA 4KRPB 1G4RA 3C09B 1IILE 3F7YA 3KPQB 5HGDB 5FO7B 5DEFA 3WFEL 1PAMA 3GBNH 5GRUH 2CGRL 3WY4A 2NDGA 2XJLA 3C60D 2GJ6E 4DKFH 3GO1H 2NTFA 1EFXD 4K55A 5CJXC 4Q6YA 5IHWA 4M02A 3A24A 1PDKA 3FB7B 1YMHB 3FQTB 3GEFA 3P73A 4N4YB 3VSTA 5A2IH 5KSAB 5KVGL 3MO1A 3DVNA 4Z0XB 2FK9A 1OCZB 3AWGA 5I66A 4NKDB 1TJHL 4BUHA 3B7TA 5IEKB 3EH2A 4NO0B 3QI9A 1QTYT 1JTOA 3FONA 3ZDWA 1XF3B 3VI3B 1GXEA 3DPDA 4HH8A 4D9QD 2P28B 2XDHA 3QUKB 4NRXB 4PJ7A 3AT0A 2P5WE 3EOTL 4FG0A 4QT5A 3X11A 4G6MH 3CHRA 2X88A 3IDIB 1A6TB 1E5YA 1UACL 2HMIC 3VW3L 5D7LA 5F7AA 4LVNB 2VYRE 3ZKQD 4HS6A 2HX8A 4EF3A 3R18A 4HU2A 1QR4A 4LCVA 4RZCB 3WFEH 5IW3A 2VQ4A 3ZU8A 3D39A 4XCCL 2CGRH 4JO1L 5I8KH 5IQ7L 5LNGA 2QVIA 5BMFH 4OJFL 5CILL 5E6IC 4PS8A 3R4RA 3MDJA 1FC1A 4F8PA 1HNYA 2X6AA 3LRGA 3CNKA 3OJDB 4HIJB 5JHLA 2CLZB 2ESVB 3OLIA 1IM9A 1NGWA 3DO4A 3HG3A 4N8VA 4J3BA 4GG6E 1TJHH 3BGAA 3IJSB 3CFCL 3MRMA 5KYYA 2H5UA 2VLJB 4TOYL 3ULUF 1DR9A 4EI0A 2I32A 1U91B 4PLOB 2V2WA 4J2XA 1G6RA 2NY6D 2CM5A 2ICES 4XO3A 1JK8B 3EOTH 3CD4A 5EO0A 1W72B 1OSZA 1UACH 3QS2A 3VW3H 2XJKA 2EZ0C 2J6EH 4ZS7H 2VW7A 4WI0A 3GTNA 4Y16D 1XXDC 3F2LA 1MVFA 3ZJAA 3HC0B 4NJAL 4XCCH 4JO1H 5IQ7H 4EZLA 5ADPL 4L3CA 4YFLI 1JWMB 5CILH 4Y9FA 3ZDZB 2BY3A 1XWVA 3MGAA 2Z7ZA 2FD6L 3QXTA 2ZQKA 5LVEA 4QRPE 4K9JA 3C75A 1C16B 1X5ZA 4P2RB 1PW3A 2GJ6A 1AC0A 3ZIMA 3B9EA 3CFCH 1GCFA 2F9BT 3B3BA 4PB9L 3OB0K 1A21A 1OCCB 3EBIA 1CGUA 4ORGA 4HKBA 5H37H 5E9DD 1KG0B 4CC1A 3R0MA 4Z5RB 3GS4A 1VB9A 1WUNT 1CT8A 3FB6B 1DUZA 4Y4HC 1FCCA 4PY8J 5KVDH 3TTYA 1SMDA 2FB4L 4WW1B 3ML9A 3FFDB 3WXVL 5F9DC 1EDHA 1G7LA 4PJBA 2PW1A 3BX7C 3O2WL 3WEOA 2P5WA 5DUML 1FNEB 1LEGB 5ADPH 2BRQA 3PDDA 1J05B 1Z5YD 5CD5D 4M7JL 1NJ9B 4P5TC 4H8QA 4PJCE 5GXBB 2NUPA 2FD6H 3G3LA 3EFOA 3L9RB 4NBYB 4RMUA 4MCNA 2ITEA 5IJKA 3UIYA 4E68A 4YDJB 3KGUA 4KNTA 3UMNA 4BFFA 2P8MB 3QR0A 4PB9H 3HZ3A 1CBJA 3RY6A 4WJ5A 3V6FA 3PHAA 3NJXA 3WKML 3H2WA 4RAHA 1QO3A 2YARA 4TQPA 1IU1A 4AKOA 1YY8B 3RWHB 4F9PA 2B3IA 1FL6B 3AM8C 3NJKA 3NN8B 3BDXA 1M7IB 2YD3A 3ZIYA 3O2WH 2K1MA 4RDQG 3H7LA 5DUMH 5HPOA 2A99A 3R7QA 2FWOA 3ARDD 3AY4A 4ZAKD 3IXAB 3B1TA 3DPBA 1MLCA 4YWGL 3HBGA 1P6AB 4G1MA 3KXFE 3RVWD 2A6IA 4BH8B 5I1DB 2V8LA 4M56A 2IDTA 4U6YB 1OCOB 4MDJB 2QQNL 3KGSA 1RK1A 1IC0A 1RZGB 1Q8MA 2NY3C 1QP1A 3O4LB 1AOHA 1MRFH 3LH2L 3N42F 1IEBB 2OK0H 4ZUVB 4QTFA 4ZMTA 1AI1L 4QRPA 3IU3B 3WG7B 4LCCC 3CFIC 4AIEA 4QTHB 4IIQC 3DMMC 4MXWL 1L6XA 2JJWA 2TSBA 4RETB 5IMLA 2FEJA 5I30L 4AGQA 1YDPA 3PNWA 1EEYB 1E0OB 3CBJB 3PL6B 1CZ8L 5DWUL 1F18A 1S9VB 2QVFB 4K7FB 3DUSB 3FUDA 3DGGB 2HJLB 1XZ0B 4UOW1 2Q86B 3BQVA 2ICWJ 2WZ5A 2FT7A 3QEGL 5ICYB 1IFRA 2GFBA 2IBZY 3T08A 1BGXL 2XWTB 3UJIL 4KI5D 3X1GA 1X6NA 1TEFA 2Y72A 5FGBC 5C0AD 4DGWC 5DRWB 3AMKA 4HLZH 1HHIA 4LOFA 4YWGH 4N2EA 4OLUL 3OZ9L 1MVYA 3D3VD 1WWCA 4HJTA 4QYAA 2QQNH 3C9NB 4PJCA 4RGMB 1OCWL 4Y2OB 1NANI 4R26L 3LH2H 1NL0H 4OZHB 1AQDB 1AI1H 1CFNA 4B5ZA 1OF2B 4IBYA 5DVKA 1T80A 3RJOA 2VXVH 1PQZB 4ODTH 1H3WM 1KCVH 3SDAB 1D5XA 1J1PH 2EDWA 2OS7A 2XBDA 4MZ2A 4Y2DC 1CZ8H 2NSMA 5DWUH 3FMGL 4UT6A 5KYNA 1C9SA 3TOPA 1NFIA 5IJVB 3VXUE 3CBRA 1QUNA 3Q6GH 1T1ZA 1CE1L 3KS0H 4KKAD 3UJIH 1MJ7L 3TEXA 2CKBA 3QCVL 4PI0A 4OKVB 1PL3A 2DQJL 1FZOA 1A64A 4LSVL 1TNMA 3H0TB 1U8KB 4RESB 3D51A 4CVWA 4OLUH 3VXQA 3OZ9H 4YQXH 1E40A 4LVHB 1NANH 1C5BH 3WD5H 1EUUA 2YA2A 5H35B 3BHBA 1EZUA 3GQFA 5HY9B 3KXFA 4UBDD 3CFKA 4X98B 5D7JB 4WTWA 1BMGA 4EPSA 3UTPD 2X3AA 2YIHA 4IW4C 4I9WE 4TNGA 4LBAA 3US9A 5IJCC 2FQEA 2VH5L 4NOBA 4B9JA 2SEBB 1ZSDA 2OMWA 5DUBA 1RULL 2CCWA 3FMGH 3NUKA 4J28A 4HG4K 4K71C 5LXGL 2Z65C 3O8XD 3INUL 1A3ZA 4OV5A 1JPSL 2EE6A 1PEZA 2VQ1B 4Z9KB 1OAXL 1CE1H 4FXGA 5AZ2H 1MJ7H 2L7EA 3QCVH 2EIKB 1A2YA 3APMA 1HOCA 1TQVA 2Y3NA 3O0LA 4LSVH 5E00A 1BQLH 4HV8A 5EEXA 2C9RA 3LEXA 4XPTL 3VJ6A 3HIZA 5BO0D 3VG9C 4P9HC 4WW2A 1X5LA 4F7MB 1QWNA 3QPQC 3EDFA 5C0AE 4P2CG 3CZKA 3R19A 4WNJA 3FT2B 3QUYB 2BIIA 4ISVA 5LN4A 3U4BL 3TO4D 4HAFA 5ESAA 3WDJA 3GIZL 2VH5H 4S1RH 1RULH 5HHOA 3GSNL 1JZ5A 1CDJA 3V4LA 4BBWA 3INUH 3DURA 1JPSH 2F5BL 3H54A 4H5SA 4AY0A 2V5MA 5L2JB 4JUSA 4R9HA 1JPGB 2D7PA 2DWYA 4A2FA 3VH8B 4DZBB 4ZXBB 2AZUA 5J12B 4M61B 2J8UE 2JELH 4UTAA 2EVFA 3GBLA 3RWCB 3VXUA 4XPTH 1J5IA 1URIA 3K4DA 2ZD0A 4Z78A 1WS8A 3AB0B 4D0BA 3E3QC 1UB6B 3G5XB 2Y69B 4F7EB 2NNAA 4EIUA 3U4BH 3P4NB 4ZUTA 1RZQA 4AE1A 3QO0B 5AOMA 3P4MB 3S7GA 2WZPD 2ZZUT 2QKIA 2VSKB 4GS7B 1XIWD 2BK8A 3GSNH 3FQ4A 1RAMA 4P2AA 1DQVA 4LLQB 2F5BH 3OKMB 4YBQD 1WTLA 3QNZA 1BZOA 1NWOA 1ZY9A 3N50A 2ZOUA 1U8OA 2Z31C 1QLRB 3ECUA 4UDTB 3RDTD 3V7AE 1L6ZA 2QGBA 4EI6A 1OAYH 4PGEB 4NQTA 2YN5A 4JO3H 4PGDB 4X99A 2F53B 1NZRA 4AIZA 4HSCX 2R56L 1CB4A 1G1CA 4XMWA 5I0WA 2OMXA 5GGSA 2CBQA 3V9EA 4L9LB 2OSYA 2J12B 2X1PA 3WGUB 3DX2A 1LO2L 4M4RB 3FQNB 3RPKA 2FL5A 3ETTA 1QZ1A 4Y2NA 2R9HC 3L3HA 1HAUA 1CGXA 3ZYZA 2NZ1A 3FQUA 1HN1A 2Y2TA 5IV2A 2WK2A 1RJCA 2EXWC 4XI5D 3ZHNA 1U3YA 1AQKL 3VD0A 2P7TB 4DWHA 1DO5A 2QR0A 3MV01 3KEDA 3I74A 4FXLA 5DC4B 4GIAA 4CW1A 4XH2A 1EXHA 4P9ML 3RY6C 3IGAB 1INQB 2DEYX 3UJTH 1HZLA 5KZCB 3LD8C 2A83A 2A74A 2VZTA 1Z2KA 5I24A 3S8WA 4H1LA 3WJMB 5GQBA 5CIPH 4FX5A 2RFXB 4AQ8A 4F9PC 2V5RA 2BOLA 2H2PC 2R56H 2FX8L 2Z34A 3I6KA 2NUTA 5GZOD 4WU5A 5HI5D 1F90H 3IJHB 3ROOB 4G6FB 3MV8B 1LO2H 1B0IA 4TTGA 2J8UA 1ASQA 4XX5A 3VWKA 2ZKYA 5KOMC 5M7QA 3P2DA 2VDLB 2W65A 2WVVB 2XETA 4M48L 3H56A 5F6IC 1YAZA 1EXGA 4IMKA 1EBAA 3QJHA 5DSCA 3UPAA 4UT9L 4WHDA 5FLUA 1AQKH 2FRGP 4KITB 1P5VA 3QFGA 2W38A 2BZCA 2ODIA 4OQTA 3LVEA 1URZA 1VFBB 4LDCA 4P9MH 3B9VA 5C0DA 5ICZA 2GJJA 5GHWH 1QSED 4JZJB 3V0JA 4XXWA 4DPBX 1LILA 3GSNB 3WEXA 3VYPA 2MMXA 3DX3A 4NO3A 3X14A 3QAZC 4NZFA 5TE6L 2OW6A 4YNYB 5TF0A 1Q0YL 1NPUA 5BRZB 5I1LB 2C9AA 3JWNH 2P26A 1NCDL 3ARVA 3TBCA 2J55A 4AUJA 1TKWA 4ZX3A 2BM3A 2O61B 1IQDA 1K4CA 2J8OA 2AJ3B 4W68A 4J23A 1SDDA 4DW2L 4RFOL 3D85B 1UFGA 3HN8A 1DFBL 1WICA 2DTSA 3PGCB 1PLAA 2ADGB 4U6HB 4WIQA 1CYWA 1HEHC 3DXAD 4UT9H 1IC4L 5DHXB 1MJUL 3FQ1A 2Q7YB 4BZ2L 2VDOL 3L3IA 3C2AH 3FO2B 4MB3A 2D4DA 1CICB 4WFGE 5AW4B 3VMPA 3NJVA 4J3OG 4PV9A 2WNGA 4QTIH 1N0XH 5DHYA 2YUZA 4FQXD 4P4KD 3H4FA 2X4RB 5T1LA 2FJHA 2GI7A 5MEPB 5LBSL 1L9NA 3X3FL 4XHJD 3NSFA 5D1ZA 5TE6H 2QVTA 4N2BA 3Q6FB 2EYSB 1Q0YH 2NY0B 2XNAA 4NENB 4G6KL 2AI0L 2AQRA 4OD2A 1NCDH 5IVOA 5C7ZA 1EXUA 1RIUL 2LT9A 4ODWB 4I4WB 2J57A 4YSAA 4LAJH 1HJBC 1E90A 3BSHA 3O9WD 3GMOA 3EKCA 5CIPB 2XBZA 2EKJA 2NRDA 1IAOB 5K9OB 4DW2H 4RFOH 1U58B 3VYOA 3T6ZA 5CMAB 1DFBH 3WLWD 5SWQB 4GINA 1ZGLA 3QFDA 4R5VA 3ZN6A 2FHCA 1MJUH 2CCVA 2NTSP 3DJ9A 4UAOB 4HA1A 1AJ7H 2JH2A 4KROC 1JUFB 1CI3M 2HJKA 5K9QI 2IDUA 1YHPA 3S96A 3UEZA 1BF8A 2VIRA 1CC3A 5C97A 3MCKA 3R8BB 4R4BB 5AZEH 3GJFH 5I71B 4WV1C 1G1OA 1GC1L 3ASOB 1DJSA 1SJEA 4Z77B 1V55B 1QW9A 4L1HA 5HHQB 5DD6B 4N0UE 2UZIL 1T3FA 5TDNA 4KZ0A 1QSEE 4G6KH 3EBHA 4R6UA 4DGUA 3KLAB 4RAVB 2CBMA 5CINH 3UO8B 2Z91B 3S34L 4OCNC 1FJ1B 3QSKB 3ZDYF 4U05A 5G4NA 1M6UA 4FXGC 4LL9A 2DY2A 3QEQB 1OAUH 5I8OL 3ML8A 4HUVA 1WZLA 2YAOA 3QH3A 3CUPB 5CR8A 4AMWA 3O41A 4GW4A 3LCYA 5AVRB 1UYWL 3VMNA 4AYSA 4Z7QF 2EKSA 4QCIB 3QYNA 2E9GA 4UT7L 3WY3A 4ENZA 5BVPL 4UINL 1GYWA 3HHSB 4LCIH 4H2AA 4ZOAA 5E0FA 4K5MA 4GW1B 2ITDB 4NYLB 4X9YA 3CH1A 1A65A 3ECBB 4X6DE 3VQLA 2Y7QA 5E94B 2IDSA 1S7QB 1U8QA 3HG1D 5IVZB 3TBWB 2NY1D 5CFHA 5IHBA 1ZTMA 4PCSA 3U2SB 3GK8L 2UZIH 3MJ8A 2OMVA 2F58L 1MCRA 2D7OA 3S34H 2WWMC 4AG4H 3NIFB 5I8OH 1OAZH 3P3YA 5IFJB 5AW3B 2AMGA 4R4ND 1JI2A 1M05A 4PWEA 4XO4A 1UYWH 4X7SL 4O00A 1N4XL 4A7GA 3KCPA 1ZANL 5JO5A 4UT7H 1A3LL 1BQRA 4B96A 4UF7C 3CGTA 4LEXL 4M7ZC 5BVPH 3WGVB 4HJIA 1RU9L 1G9EA 3T71A 4ETYA 5CCJA 4HPYL 5CEZD 3BKJH 4OCRL 4HUUA 3PY9A 3EJPA 4KMTL 4XN7A 3HR5B 3ARED 2ZOOA 4RIRB 4D8PA 1MG3C 3V5DB 2CR0A 5IVXF 5CSGA 3SJVA 1JWUB 3GJFB 3VXNA 4F7TB 2VR5A 3RVWC 3PWPD 3ZTCC 1UG9A 5F3HA 2E7BA 3LPGA 3MLYL 5CN1A 2ARWA 4X0KA 3S36L 1FWXA 4V1DB 2HP4A 4N0UA 4Q9BA 1AOZA 2NX5B 1IKOP 3WYRA 1FYTE 3MUGA 3RPIA 4P23B 3HR6A 3SPVA 3HE6D 5JXEA 3TV3H 1OCRB 3TN0B 1XF1A 4YSDA 5D2NA 3FL7A 2CA4A 3A21A 4X7SH 1MFEL 4HUXA 3W39A 2FEEL 2KH2B 4WTZA 1ZANH 1A66A 3EH3B 3LKRB 2FEEI 3NIGF 4M3HA 1A3LH 1SYVA 4B5EA 5CD3B 4LEXH 2ZTBA 4MNQD 4PGBB 1CLYL 3L3GB 3PP3K 4UV4L 4PJ9D 1T6WA 4ZUUB 2RBLA 3MROA 4OCRH 4G8EB 1GW0A 5B1JA 5EOQL 4AKPA 4ZYKA 4I13B 3GRWH 1X5FA 3QHFL 5E1AA 1T7XA 5LG6A 3X3GH 3MGTB 3LKOB 2XT1B 4JPVL 4GAYB 2PABA 4LT7A 5E6RB 2DQMA 3BIAX 1BDYA 4NUMA 4X6DA 3MLYH 2J1KA 3KGRA 4JDZA 4DEPB 3S36H 3ZQWA 2P42B 3HG1E 1JYVA 4NBZB 1ITBB 3L1EA 5DEZA 2DRUA 4M03A 2A74C 5DZAA 1NCNA 1YSOA 3HNTL 3PP4H 5AVWB 3VTAA 4KUZL 2R2HA 2OJ1A 4HGWB 4RDBA 3C6EA 4AQ8C 1FE8L 3UYRL 4JFHE 3NZUA 3MBWB 3T2QA 4HGKC 5D7KD 2AGJL 5CBEA 1MFNA 3B9KD 1UQSB 1Z3GL 1TXKA 3OKEA 2RCSL 4I0PD 4G2AA 2GTZA 1LWRA 4G42A 5SWZD 2CJUH 1CLYH 1CXHA 3PJSB 3VWKC 3KPRD 4UV4H 4W4OA 4QHLB 1ADWA 5CP3A 3IF1B 1SXNA 3O9WA 5EOQH 4NUGL 5KYXB 4IMKC 4KKAC 4YS4A 3VH8G 1GGBL 4HKJB 3V0WL 4JFYB 1QASA 8FABB 1DVFD 4ALAC 4YVUA 4DP8X 5B39B 5CEZE 1YVLA 3TESA 1UWXK 3FCSA 4NQQA 3GSRB 1S5HA 4R90H 2P8PB 4H0GA 3MLSL 4XXWC 1WZ1H 2YZ8A 3BW9A 4R2GB 3QEHA 3K71B 3Q05A 2DWEA 2Z3FA 3HNTH 4ONHB 4UBDC 4HJGA 4KUZH 5ENWA 1VAHA 1FE8H 3CFBA 3UYRH 4DOHB 3DO7A 3VXPB 5GS2D 4M3KB 4L0ZA 2QPDB 2AGJH 1KGYE 3FQWA 1ZT1A 4AZ8A 2ED8A 2MOQA 4KRNA 4DUXA 3I2CL 1FYTA 1F2QA 2E6PA 1D9KB 3KVDD 4N2CA 4F2FA 1WP6A 2JQAA 2JIXD 5HHMB 2V3DA 4HPHA 3MFFA 4HAGA 1FVDA 2PO6A 3QC5X 4NUGH 4UANA 1IKFH 2WINA 5F7LB 4HEPG 4ZMYA 5F7KC 4U1MB 3WHE0 4Z7NE 3FRUA 1C5DB 4YC2C 3V0WH 2FGZA 4HIPA 4XE5B 1G7IB 3N44F 4Y7OC 4BD4A 1IQWH 2H6OA 5DJZB 2OV0A 5D8JL 3BZDA 5DJXB 3HE7A 1ZVHA 5EFIB 2FSEA 1Z6JT 3FAWA 4PBWD 4NOFA 1A3RL 3CFJA 5HTSA 1KY7A 4FQLL 4V2CB 5IP4A 3CVIL 1H19A 2TRHA 3IJEA 2WLHA 1ED3A 5EBMB 4S1SL 5D1ZC 5D55A 1MCFA 4AYDC 3P9MB 4G6JL 1QRND 5FEBA 3P9LA 1WGOA 3MRNB 2VLLA 4GI6A 3T0AA 1MCWW 2CDEA 5GZNA 3ARFB 2ETWA 2X4TB 1JP5A 4V2BA 5IHHA 3DRTB 5D7KE 1AMYA 3UACA 4NQED 5DJCB 4TSCH 3ZKNC 1BA9A 4CSTA 3MRRB 2K45A 1I7RA 3CQQA 4EDXB 1KXQE 5SWZE 4G5AA 1S9WA 4G43A 3IFOA 1UVQA 2Q7NA 2GC4C 1JHTA 2ID5A 4KHTL 4LE8A 3RZCD 4FTDA 4TUJB 1A3RH 1JHKH 5F0LB 4ZODA 4Z7OE 1UJ3B 5ISZB 3MX0B 4BELD 2E74C 5GJTH 4X0NA 1DJWA 3QPKA 3IDMA 5AW5B 4JFFB 1YNTF 1WEJH 4BXVA 4G6JH 3KWVA 1A4JA 1XIWC 3C5JA 3H9SB 2EVHA 3AG3B 2AVGA 5DS8B 1HOEA 3RQ3A 1GZHA 5GS3A 5BRQA 2AEOA 5T3ZL 1ET8A 2OTUB 4RA0C 1MG2C 1A9VA 4HJ0C 2B59B 4G6AD 4HIHB 1DEDA 1MHCA 1V54B 5KJ4A 4NC2B 1JWSA 2X89A 1X3DA 4FNQA 1IEHA 5H2BB 5CHNB 2X1WL 3SCMB 1NICA 5HI4D 2WBKA 4EBQL 4HD5A 3MRIA 1J18A 1IFGA 2E86A 3IDGB 3JZ7A 1ET5A 2P3YA 4UQAA 4KHTH 3GMLA 3TA3B 4IKLA 2A3TA 4YLQT 3ULVE 3ZPDA 1R3LA 3W37A 1EPFA 4F37F 4L5FH 1E6JL 3RWGA 1MFUA 3ZT5A 5JIQA 2JTDA 5HD8D 4DN3H 5ACZA 2M1KA 2VLJD 5AVQB 3C8HA 4HQQH 3FTZA 3MV9B 2YQGA 2ZAIA 4XI5C 4ZUSA 5IY5B 1U3HB 3BGMA 3K2KA 3GSWA 4JPSA 4J3UA 2VZVA 1MDAA 1UFUA 2UXVA 5HDBF 3RWEA 5T3ZH 2OI9C 4RWYH 4UILL 1NLBL 4MMYB 3LRHA 4ELMF 1LP9E 1T66D 2R0ZL 5B7MA 4DAGL 3F84A 3S37L 4UM9D 4RFEB 4M7KL 3B5GA 5JHMA 5KSBB 4AEEA 1IBYA 4LLYA 4B41A 4EBQH 1EZVX 5IMKA 3HCVB 5HI5C 1XB8A 4PJIB 3DX9B 5IM7B 4CVZB 3MLZH 3L4ZA 4P2RD 5DT1L 1N0LA 1KXQA 4W4NA 1T4WA 1NMBH 5I23A 4HETA 1A4KA 1I8IA 1CDGA 1L6PA 2PTVA 5DQ9A 3TO2A 4ENEC 4MQ7B 4HW6A 4XN5A 2FH6A 3CXHJ 3I9GH 5DK2A 4AW4A 2P47B 5MENB 3NSCA 3O11A 4I0KA 1XF4A 3LIZA 2ZWZA 3VI3E 3O3EA 3BUTA 1MNNA 5H8DA 5I15H 4UILH 1OTUC 1NLBH 4NQXA 1HEJC 2XZQL 1HHHA 4ZFFB 5JXEC 4HIQA 3NSXA 2R0ZH 1NKRA 4NNXA 4DAGH 3RL1B 3EFDH 2XVKA 4JAMA 3BXNA 1EJOH 3QUMA 2RIKA 4GO8A 4D0CB 1U3NA 3DARA 3VGDA 4XB8A 5DT1H 5HGHA 4RX4D 2NNFA 5B1JC 1G7PA 2VC2L 4XB3A 3RWJB 5KBPA 2QFPA 1KDIA 4ES9A 5TPWL 2APVA 3F6IA 1TQSA 1HH9A 4IIZA 5LDSA 4YDMA 4TKWA 4P57B 5JW5A 4Y88A 2ESVE 3QJTB 4ZW3A 1T4KB 2ZSWB 4I8DA 2YBRA 3F7KA 4M1GH 1MIML 1A7OL 4JK0D 1OHQA 2VN3A 1N6UA 5E7FA 5C0CD 2VLJE 2YAFA 5AD0A 3VFUA 5IB4A 3ARBA 5JHDD 4QGTA 5FA4A 4WI5A 1IJNA 2XZQH 4OZ4B 1BX2A 4W6YB 4Q4EA 3EJJX 2BDNL 5DVPA 1ULVA 1K8IA 1J10A 4HBQA 4PN6A 4N6RA 1EAPB 4AEIH 4YFEA 1KIRB 1FNGA 1HE7A 3FTUA 3QXDA 4W4OC 2P45B 2Y06L 1UUSA 3TPUB 3O9WC 4BFOA 3ZDZE 4QY8B 2ARJB 5TPWH 4DN4L 1NCCL 1L9RA 3WKQA 3GTVA 3V0HA 3KPQA 5HGDA 2F54D 5FO7A 3U0WH 5CZXD 3P3RA 2WXQA 2CUAA 2I24N 3OLDA 4EUPB 1AZBA 4GMTL 4P2RE 4KXBA 1MIMH 1A7OH 1KENL 5C0ND 3B9DA 3V2AR 1ODAA 1FSKC 1SHSA 3FB7A 1OT4A 1KB5B 1SRDA 1YMHA 3FQTA 1ODUA 5KSAA 3DECA 4K8RC 4X8JB 3OAUL 4JN1H 4R0LB 3T3PF 1TZOA 1ES0B 3DVGB 4Z0XA 3RX5A 3VUAA 1BF5A 3RP1A 5FYKL 4NKDA 4JS7A 2BDNH 3WEMA 5IEKA 3LIZL 4NO0A 1WFIA 1E9OA 4Z7VB 4J8RB 4OGAC 1J8RA 5C2UB 2TRYA 4EI5B 4JM2B 3M45A 3VI3A 1XGUB 3B9AA 3GKZA 4JFOB 5C7XL 3GMRB 3QUKA 4NRXA 2FO4B 2CJTA 5F89A 2LLNA 4QKXB 4CVUA 3UO1L 2Y06H 5EH1A 4XRCB 3IDIA 1A6TA 1IFHH 2PO6C 3EUDA 1WAEA 3VSUA 4DN4H 1NCCH 2UZPA 1HKFA 4RZCA 4BKLB 5L0QC 1PJWA 1T0NB 3AC0A 4LSSL 1PZ3A 4CN1A 5GPRA 3LZFL 3HE7C 1CU4L 4G9DB 4QAMB 1YECL 3SDAD 2BERA 4HIJA 1ZD6A 2AJVL 4G71B 2FX9L 2ESVA 4NXKA 2MOGA 4RGOL 2EO1A 4D94A 5FYKH 1DE4A 3D4YA 3IJSA 4UOZA 3U6XA 3CFDB 4KXCA 2Y2WA 4J6RL 4BA0A 5GRYA 1LK2B 2NY1C 2VLJA 1PLBA 2BFVH 4U7SA 5C7XH 2CIKB 5KVFH 1U91A 1EFQA 4ABUA 4XXDB 1JK8A 1CWVA 4YSPA 2VDNB 1KPRB 5GZNC 4N2FA 1W72A 1XR8B 5JXAL 1G7MB 3QNYB 5AG9A 3TS8A 3AS3A 5DURD 1ZA6B 4FQQB 5T3XL 2XV0A 5C08B 5JTWA 3HC0A 5DVMA 3CWGA 2OMYB 4Q52A 4WGVB 4LSSH 2OTWB 1TQWA 5IFAL 1JWMA 3LZFH 3BKML 4JJOA 1CU4H 3RAJH 5GGRB 4RFNC 2VERN 4N20A 2EXYC 3O4LE 1D7CA 2QADC 4JPKL 2A9NL 2AJVH 4Q0XL 4L8BB 2FX9H 2NPLX 4KUCD 2AERT 4RGOH 1C16A 3P54A 4NZTH 1NBZB 4P2RA 1KGCD 3IT8D 2WYTA 4XPGL 2LV4A 4FJYA 1KEGH 4FN0A 4XVJL 3OMZA 4WFED 5B22A 3RIAF 3RUGB 1HHGB 4JFXA 2V2XB 2BSTB 3PWJB 4U1NB 3WSQH 5B38G 2NY2B 3VQMA 4MAYB 1UT2A 5B39G 5T33L 5IQMA 4BV1A 4Z5RA 1GZHC 3FB6A 5TJWK 1RVFL 1BD2B 5HHNB 5JXAH 5DFVC 4YDVB 4AGPA 1OSEA 1B2WL 2O5ZL 4F58L 5KVDE 2BFGA 3LKSB 3FFDA 4K7PX 3TH2T 1YAIA 2F5AL 4MHHI 4WUUB 1LEGA 5CJBA 2YEVB 1I8MB 2WSDA 2EDTA 1J05A 3BKMH 3H6JA 4P5KB 2VITB 4N0CC 4S0TD 4MA7L 5FUCE 1NJ9A 2WQRA 4HKZB 3GM0A 1FG9C 2BHFA 3BUDA 1GR7A 4JPKH 2A9NH 4MXVE 4OZHE 4Q0XH 4RMVA 2X28A 3L9RA 5HJ3B 5JYLA 4YDJA 4RX4A 5IMMB 5E8OB 3OD3A 4HK0B 4XPGH 2FQFA 5FC9A 4C47A 4PH8A 2Q87A 4H26B 4Z3IA 2P8MA 4H13C 1TMQA 1XGPB 3L4YA 3HLAB 1A3QA 3UGXA 3UBXI 2IAMB 3JTTB 3KL5A 4HX1B 1ZLDA 3K3QA 4PJGF 1OWRM 1DQKA 4ZXBD 1X5JA 5T33H 4I1NB 3MJ9A 4HSQA 2BNQB 1A5FL 1RVFH 1YY8A 4WHTB 4M93C 1MDTA 4F58H 4R84A 1NPNA 3NN8A 4WEMB 4YK4B 3ZO0A 4Y5YB 3IAQA 3AW5A 5KJ7E 5KS9B 3A6BL 3H9HA 4KQ3L 2ZIDA 1TYEB 3DHMA 4MD0B 4I3RL 2J6EA 1HTYA 3IXAA 1U8LB 3V4PB 3SE3C 3SKJH 2MPAL 1OE2A 1KJ2L 1A9EB 4S0HA 1CD8A 3QG7L 2YEQA 1JZDC 5I1DA 1E50A 1JN6B 4U6YA 1U8MB 4MDJA 4XPFL 1RZGA 2P48B 2YGNA 3O4LA 5I5RA 4PYHA 2FWSA 1LM8V 3DDGA 1IEBA 4RSYA 4U1LB 4ZUVA 1MHHB 4AYID 3IU3A 2D8KA 1SLUA 4QTHA 2ALWA 1IAIL 1DVQA 4W9EC 1OP3K 5IF0B 4XNDA 1IAII 4MBOA 4F8LA 1A5FH 2YQ2A 2J7LA 3UROR 3MV7B 1WAAF 1AACA 3X17A 1EEYA 1JPEA 3PL6A 4E9YA 3NDYE 1S9VA 3B34A 3FU6A 1HL9A 4K7FA 4PJAF 1RZKC 3FF7A 1R33A 3DGGA 1XZ0A 2CO7B 4YHKL 2Q86A 3D52A 3A6BH 5J6GB 5ICYA 3QDMD 4I3RH 3RIFK 2EDHA 1BYNA 3NPSB 2XWTA 3D18B 4UMGA 4AUUA 4PGJA 1D6EB 2MPAH 4G5ZL 4KNSA 5DRWA 3IFLH 1KJ2H 3QG7H 1XGTB 3GSOB 3EADA 5F7DB 3ROLB 3AQXA 4M1DL 4NP4L 3AQZA 4PM1A 1GL4B 2XBTA 3C9NA 4NPJA 1QKZL 1ZKAA 3ULVC 5KZCD 1USQA 4OZHA 3QR2A 1AQDA 2I5YL 3QVAA 3JWDH 4LGPB 3QFJD 1AR2A 1IAIH 1OF2A 4KPHL 4UQ2A 3FRPB 3SKMB 3TNMB 2C5DC 2HVBA 4M00A 5IQ9B 3I6LD 1TSHA 3D6GA 4J8QA 4JB9L 4FG6D 1PQZA 3LEVL 4ZW6A 3SDAA 4LHUD 3NOIA 2W9LA 4FFYL 1A7QL 3AMLA 4KKQA 3ESOA 4WGKA 4BFKA 1QUPA 3EW3B 3IGKA 2GQHA 3O2DH 2D7QA 1WH0A 3DUUB 5IJVA 4KBPA 2YC1A 1PVHA 4CNIB 1ZT7B 4ODVH 3VD9A 4OCWH 5LXVA 3QIBB 4X7DC 4G5ZH 4W70A 2GTWB 4OKVA 5DEGB 3H0TA 1U8KA 3IBEA 3TU6A 1LEIB 2PWEA 5C0RL 1PY9A 4M1DH 4KRPC 5F7UA 4NP4H 1NGQL 3C09C 3BKYL 1BVZA 5H35A 4N87A 1QKZH 4YHYB 2F61A 3BP6B 3LZLA 2I5YH 1FC2D 2W0FB 3TT1H 4FCAA 4NQDD 1WBZB 4KPHH 1NBQA 4J3XA 3ARGA 3HEIB 5D7JA 3B2DC 3NIDB 2A0LD 2HFTA 5EC1B 5KSAC 3NEXA 2E7HA 3UBXB 4AZUA 2SEBA 5FYKU 4CBPA 1FZJB 1A6VL 1XEDA 4EN3B 5GS1B 1YMMD 3TBYB 1K85A 2F53E 1QNZL 3FTXA 4M5TA 5EUOF 1NAML 5I8EB 4XPAL 2BNRB 1UENA 3IJ7A 5JW3L 4BHUI 1SUJA 3NRFA 4KAQL 4YXKL 3BEWB 3BESR 3H9ZA 1MXDA 4LVNC 5C0RH 5KYWB 3VRLE 1N6VA 1A6PA 1NGQH 5ALBL 4WWOA 4JY6B 4AYFB 2H4EA 3BKYH 3I9AA 5L2KB 5EULV 1A4AA 2VMCA 3D0VB 1MWAA 2VB5A 2ATAA 2KDYA 3MV11 2DQHL 1WV7T 1WHOA 3CXFA 4OSUL 3V55A 4Y9GA 3SO3B 3PIQB 4JW3A 4OFYD 3S5LB 3FT2A 3QUYA 1GGIL 4PY7B 1UB5B 2ZPKL 2NXZB 3JV0A 2F8XC 1FFQA 2AJXL 1A1NB 4QEGA 3QFJE 3W3BA 5HD8C 3CVDA 2WO2B 3S88H 5EF3A 4DK3A 5F7BA 1BXVA 1ZLWH 1NAMH 3I6LE 3SE9H 1JIBA 1SJVA 4A2GA 5L2JA 5JW3H 4PRDB 3CLFL 1HHKB 4YXKH 3VH8A 1QRKA 4DZBA 3ULUL 3OLEA 4M61A 2YPVL 5GRWA 3RWCA 4CAGA 1HHJB 5ALBH 3EO1A 4F8TA 2JB6B 5EEWA 1TLMA 4OSUH 1UB6A 5FM8A 3G5XA 1AGEB 2ZF8A 2NLJB 4HOXA 2IFGA 4GRMB 4HZLB 5DA0B 1R3JB 3P4NA 3HNVL 2ZPKH 3P2TA 2UY6B 3P4MA 3RB7A 2AJXH 4YPGB 3FU3A 4L4TD 2A4ZA 2O6PA 1NGPH 2X4UB 5EDSA 4H8UA 1SVBA 1ZHLB 3OKMA 4LLQA 5IG7B 4XWOC 4UDTA 4EUPG 3EYFB 3UTZA 2YHGA 3NH7H 1FLRL 4PGEA 5BRZE 3CLFH 4DP7X 3ULUH 2F53A 4DP2X 4PTUB 1KCLA 2YR3A 1B2YA 4WZ9A 3QJZA 2FQGA 4K94C 3ME0B 4CU6A 2E5EA 1ZLEA 2GVYA 2JTYA 3FQNA 3UCRA 1UCBH 4PW3A 3QULA 1V10A 2PWFA 5IHZB 5F9OL 4N68A 2KZBA 4CDHA 3HNVH 4B7IA 3ATDA 4HVBA 4Z7WB 2O5YL 4TNVK 3OF6D 2P7TA 1VIWA 3HVDA 4QXGL 4QRBA 3FHAA 3JUYA 3IGAA 4TRPL 1INQA 4U3SB 5EIIB 5T1KB 2X41A 5TQ0H 3HMXL 2WQUA 1UTDA 2WLNA 3F5WB 3CC5B 5L7XL 2XOTA 5F6HI 2ADYA 4XR8C 4N5EC 2RFXA 3TCLB 4Q9RL 1HWWA 2XWDA 1HVXA 2IQ9L 1NAMB 3VSQA 1B0GB 3HPJB 4FQPA 4WK2B 1P84J 3A4FA 1MCLA 3IJHA 3PU7A 4P2OD 3X1BA 4ANKA 3ROOA 4A55A 3MV8A 1L0PA 4A2LA 2Y7MA 4XCFL 4ANUA 3GI9L 1UKTA 2Q6WA 4GUPB 4TLTA 2WVVA 1B0WA 5F9OH 3W9EB 2XPZA 4WEUD 4EDWH 1XHHA 1FFPB 5BS0D 3B7YA 1Y07A 5DZVA 3I50L 4KZCA 4JFVA 4BCZA 2WYZA 3BYTA 5BNXD 5C07B 2XWCA 4V1DD 1VFBA 4QXGH 3R1GL 2EE0A 3CN3A 3F6JA 4TRPH 1TJIL 2WXRA 1Y18B 4JBSA 2ZCZA 4JZJA 3CX5J 2E6JA 4L4TE 4JCLA 4KK6D 1NGXB 3CDZA 1VA9A 5JPNB 1DQLL 3OMAB 3QEQE 3PL6C 3S35H 1KACB 4NKIH 4I2XB 5BRZA 3W82A 3MLWH 5I1LA 2EYRB 4NHCL 5J1TC 3JWNE 1S6NA 4DEWA 1SLWA 2O61A 3Q9PA 2YMXH 1OQXA 4XCFH 5D5MB 2AJ3A 3GI9H 3KBPA 4L05A 4UQCA 4JE4B 3D85A 1UD2A 1YN6B 5J13B 4NIYE 3PGCA 2ADGA 2AEQL 3I50H 3CFTA 5FOBB 4GQZA 2Q7YA 3PWVA 1TZIB 5FUCC 4OI8A 1DQIA 3EYOB 4RGMC 3FO2A 3UTSA 1CICA 5E4EB 4KNUA 2GJZB 3HZYA 4JFUA 1RUKH 4QXTA 4BSWB 4CKVX 2QQKL 4JPIB 5GGTA 3AG4B 3EXJA 1LO5B 1RMFH 5F7WC 3TFKD 2L4OA 2X4RA 1KGIA 2V5TA 1DQLH 4MMZB 4O02B 1OWWA 4XP4L 3SDAC 4O2EB 4KKNA 4YHMH 4ZD3L 1A9BB 1FNHA 1TPXB 2XTJB 1F5WA 3H3KA 3Q6FA 2EYSA 1U92B 4RRPG 5EU6D 4U7MA 5FGCB 4NENA 1JGLH 3ETBJ 3MA9L 4ODWA 4I4WA 5F8RC 1L5GB 1Q1JL 5DHVB 1MCCA 5F88A 3H6AA 2QZQA 1IAOA 3US0A 3TJEL 5K9OA 3B4NA 1U58A 5F7YC 4C4BA 3SDCB 5CMAA 4HT1L 5TH2B 2CGZA 5SWQA 4KO6A 5D6CA 4LLVB 2AEQH 2UZYA 3OPZL 4LMQI 3TWCL 3WEAA 3WJJA 4Z3JA 4AGNA 1JFHA 4XVTH 1N64L 2JJSC 3I9IA 4LVHC 4WI6A 4AXWB 6TAAA 2FJUB 4ZUWB 5E5MB 1JUFA 2XI9A 4UNIA 3SD5A 4LVEA 1T5XB 5DTFB 2GK0B 1YQ2A 5EV7A 2QQKH 3OXSB 3C12A 4K3DL 1XX9C 4IRSB 4PV8B 4R4BA 4XOAA 2K7PA 5D7JC 2WTPA 2GIXA 1U8JB 5AUMB 2ZJSH 4DEUA 3GC3A 3RIKA 4Z77A 4XP4H 1T7ZA 5HHQA 4V1DE 4ZD3H 5DD6A 1EHNA 3WTVA 4P46D 4KVNL 3KLAA 4RAVA 2WB1A 3MA9H 1R24B 2Z91A 3QUXA 1Q1JH 1FJ1A 3M46A 1DBJL 4PVMA 2VWEE 4JLRA 4OU3A 1KXHA 3GZKA 3QEQA 3TJEH 1S9YA 2AQTA 3JQOB 4XVUC 3BZ5A 3CN2A 3ECWA 4U1HB 1PU0A 1D5RA 3CUPA 1JPST 4HKXB 4IU3B 4Z7UF 4D9RD 1JYWA 3OPZH 1PGRB 3DI2B 2PPCA 5JQIB 1N64H 2XWRA 4QCIA 2CK0L 4UZUA 4JHAL 1UXWB 3HHSA 4GW1A 2ITDA 3NJGA 4NYLA 5KSUB 3ECBA 3QUYC 5J3HC 4PJXE 1F86A 1TZGL 2QJDA 4ZRGA 5E94A 4DK5A 1S7QA 4M4PA 1CF1A 4ZFGH 4XMKL 5IVZA 4XNZB 2XXFA 4M6NL 3RL2B 4MD5B 4GJTB 3U2SA 2P49B 4GRWB 5I74B 1O6SB 5DUJA 5EWIH 4C4KO 4X7EC 5LAPA 4KVNH 4MNGB 3IGLA 2I25N 3H7BB 1KJVA 3BT2H 3L08A 1DBJH 1A7NH 3PAVA 2C34A 5CLTA 4W6XB 2ZX5A 4O51B 4WWPA 5CCKL 3NA4A 4Y4FA 2ZOKB 4FFZL 5EU6E 4ZXBC 2GG1A 5J12C 1ZLUH 4ATWA 5IFJA 1USZA 2IANB 1UXLA 1C1EH 1OPGH 1N2RB 2WNKA 2QSQA 2WUBH 1MW1A 4W93A 5D1XD 2NR6A 3AB0C 1BBDL 1NCIA 2Y36L 1U30A 3B7UX 3W0WB 4L9DA 4UNUA 2IOOA 4DVRH 1TYRA 4C59B 1TR7A 5ISZD 1I8UA 4TQHA 3EJCA 2CG9X 1TZGH 3P77A 2RR3A 35C8L 3HR5A 5E4OA 4XMKH 4JFFD 4RIRA 1VF5C 3Q2VA 1W80A 2LFEA 4G3YL 3V5DA 1RZPA 5DMIL 3GBML 4GS7C 1RZ8B 1JWUA 1GSMA 1TENA 3GJFA 4ANWA 4MB5A 4F7TA 4NT6B 3MRGB 4DOHE 2BVUA 4V1DA 2B14A 1R3HB 5CCKH 2B2XL 2XFGB 2NX5A 1RZIB 1AFVH 4LFHG 3DTXB 5LCVL 4FFZH 5AVVB 2VDKL 4JQXC 4P23A 5EO1B 1CFVL 1AHMA 4HEME 1Z0MA 3TN0A 2ICEB 3GKWL 1MAKA 5FUZL 2HN7B 1BZ7B 4B6ZA 4L9LC 1BBDH 3N1GC 3PXHA 3W81A 3MXVL 1T1XB 4PGBA 2QBWA 2GABA 1F8TL 2W60B 3L3GA 1LO0H 1F4HA 4D9RE 2J4WL 4ZUUA 4G8EA 2J5LB 4DK6A 1Q9KB 35C8H 3MV9D 4OGQC 5I6MA 5D4HA 3WLBA 3DO3A 3O4OB 3QUGA 3T77B 2ZNWA 3HNSH 4ADJA 4G3YH 1U3HD 2B1HL 3MGTA 3LKOA 2AANA 4CKQA 3CFNA 4GAYA 1DVYA 2VL5B 1YEGH 1S7RB 1YQVH 3D7PA 3HB3B 3VB9A 2APXA 3GMPB 1MJ8L 4XNXL 5EU7E 4BFIB 5C3TA 2B2XH 2IDQA 4MDIB 3S4SB 4KZEL 4TQIA 2D03L 3EG9B 5CZRA 3S5LG 1RK0B 3E80A 1CXIA 4HGWA 4FYTA 1I8LC 4LU5L 3GKWH 4N28A 5KYUB 2X9YA 2D7TL 4NC0B 1R19A 5FUZH 3SE4A 4PD4K 5F70A 4GUQA 1UQSA 1UGNA 2AV1B 2ZP0T 1PZUB 5C6WH 4LGSB 1KULA 3L54A 1WIOA 1C5CL 3TF7C 2OW7A 1GY2A 1F8TH 3PJSA 3LEYL 2YBGA 3AITA 3INOA 1CDUA 3CK0L 3IF1A 5T5NG 5JIMA 2Z93B 1ZTXL 1JFQL 2EEDA 5KYXA 5LB1A 1WS7A 2B1HH 4HKJA 2E46A 4JKMA 5HSFA 5B38A 1B4TA 8FABA 4N2HA 1DANU 1FFRA 1YN7A 4XX1E 5F93C 5B39A 5ISZE 1ECZA 5FYJL 4QHNB 3L4WA 3GSRA 4XNXH 2P8PA 4JFFE 4JZJC 1H3GA 4KZEH 1CFSB 2YGVA 2D03H 4MZIA 3K71A 3CG8A 3H9SE 4ONHA 3E2HB 1MH5B 2PUQT 1G6VK 2VJ0A 2A0LC 1OM3H 1E27B 4D8OA 3VXPA 4WK0B 3QBTB 2D7TH 2F7IA 2L7JA 2V0AA 1NINA 5KUKA 1PIFA 2E9BA 3N85L 3TFBA 1D9KA 1P4IL 3IPEA 4NM8H 3L5JA 3OKYA 2DQCL 3LEYH 2B20A 2DLHA 3WAJA 1TJGL 3CK0H 4GEJA 1OE1A 4L8DB 3HG2A 2R59A 4X4XB 3L5IA 1ZTXH 1JFQH 4U1MA 4I3GA 5HDQL 2ENPA 4PP2B 1AIFA 1B6UA 3J27A 5JOPD 4QXVA 1ACXA 4K9EL 1H3VA 2FATL 1KNOB 1AD9A 4OF5A 1CICC 5DJZA 5FYJH 5DJXA 4IGBB 3ZHLA 2XKUA 1IGIL 5EFIA 3MV9E 4YBLB 3VX0A 5C70A 4Q89A 2K70A 5AQ0A 1WFMA 5EBMA 3HAEH 5T3ZD 3L1GA 3P69A 4MJ6B 4PMEA 2NY0C 3IDXH 3P9MA 5F0PB 4LP5A 1J1XH 2KMWA 3O6FD 5I1GH 4NRYA 2AITA 4JR9H 1P4IH 1Z9OA 3MRNA 3I6GA 2DQCH 3BQUD 3D08A 2OFQA 3M1BB 2XQYG 4PRID 5KSBE 1TJGH 1DQML 3ARFA 5SWSA 5EIIG 2X4TA 1R0AL 1YNLL 2BP8A 1GAFH 1I3VA 3DRTA 3W5MA 5GRVK 4TNWK 5DJCA 5HDQH 3WJJC 1C08B 4PJIE 3MRRA 3TNNB 4EDXA 4UAOC 1R4XA 4K9EH 1BZ9B 4L48A 4LLUB 4NCDA 3VTTA 4MYPA 4YGVB 4I18B 3CSYB 4OKDA 4DTGL 3ZLQC 1IGIH 3S2CA 2X2UA 3VFWA 4KJQD 4APQB 4M43H 4TUJA 5I71C 4JG1L 2AK4B 3FB5B 2W91A 2DQEH 1VLXA 4FMKA 5CJQL 3MX0A 3WFBL 2YQ3A 5DZNA 4EI5D 5EORL 3POHA 4ZFOL 4Z23A 2QMKA 5KOVC 1GY1A 1WF5A 4GIPD 3MRLB 3DHUA 3H9SA 2J2ZB 3U36A 1UEMA 5HXMA 5DS8A 1J8SA 1DQMH 1FVEB 2OTUA 3US1A 1R0AH 2XWEA 1YNLH 2Z8RA 2B59A 4HIHA 3BAYA 4Y19B 1PZAA 5DRZA 3JWNC 1DL7L 3ABKB 4GSDL 3FFOA 2X4QB 4XCNB 4HF5H 4OCXL 4KRLB 1BVLB 1JBJA 1ET7A 2EDEA