2Y6TE

Molecular recognition of chymotrypsin by the serine protease inhibitor ecotin from yersinia pestis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
141
structure length
141
Chain Sequence
b'QQQPLEKIAPYPQAEKGMSRQVIFLEPQKDESRFKVELLIGKTLNVDCNRHMLGGNLETRTLSGWGFDYLVMDKISQPASTMMACPEDSKPQVKFVTANLGDAAMQRYNSRLPIVVYVPQGVEVKYRIWEAGEDIRSAQVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSINOGEN A
molecule tags Hydrolase/inhibitor
source organism Yersinia pseudotuberculosis
publication title Molecular Recognition of Chymotrypsin by the Serine Protease Inhibitor Ecotin from Yersinia Pestis.
pubmed doi rcsb
total genus 16
structure length 141
sequence length 141
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y6tE00
1ECZA 1P0SE 1FI8C 1ID5I 1EZSA 1N8OE 4IW4C 1IFGA 1SLWA 1SLVA 1AZZC 1XX9C 1XXDC 1XXFC 1ECYA 1SLXA 1SLUA 2Y6TE 1EZUA 4NIYE
chains in the Genus database with same CATH superfamily
2AEQH 3MRNA 4J4PA 2DBLL 4E0RA 4MJID 5E6IA 3PWUA 1WVZA 5IOPA 1OV8A 1JS4A 2GYSA 2VLRE 5T3ZD 5JPMB 1DVQA 1QI3A 4R9HA 3B7YA 2Z4QA 3VXOA 5BMFL 3H54A 1TJXA 2AQRA 4NZTL 1TYEB 5T1JA 2WJ5A 2QPDB 3ERXA 4W6WB 2X88A 1U2HA 2XBDA 3UOAB 3QPQD 2VC2H 4KNUA 4F2MA 3C5SA 1RZFL 1MCNA 5LB1A 3UPAA 4OV5A 2EIZA 2A74A 3BISA 5HYJE 5I0YA 5F9OH 4B5ZA 2JI1A 4E9VA 1WLHA 3MCLL 4U1IB 1A25A 4MKMA 4NEHB 2P5WE 1E6OL 2YFOA 4R4BA 2VUOA 1RLWA 4IRJC 5TDPB 1NJ9A 2VM4A 5E8EB 1FVEB 2YN5A 2YUVA 3CMGA 3P0VL 3UJTL 3GSOA 3GBNL 4GIPD 2W07B 3UJIL 3LH9A 3BZ5A 1ZSHA 4ZOEA 3FZUC 2B59B 2Y1AA 4G5ZH 1INQA 4AZ8A 1IV8A 1U33A 4BUHA 4CL7A 4I3RH 4AI7A 5BQ7B 3VRIA 2FWUA 1QZ1A 1RUQH 3ARUA 1EJ8A 4IHOB 4N0YH 1F86A 3WGVB 4A2FA 3HC3L 5I1GL 1TTFA 3ALPA 4BZ2L 3MXVH 3UP6A 2V33A 2UVEA 1D6VL 2F68X 2PCYA 5DJ0A 5FUCE 4G8EA 2WXGA 3ZHDA 1FO0B 2EVFA 5F1SA 4WWKA 3BVWA 2YKKA 1P5VA 1TVBA 4OVVA 1FYTB 2B39A 2HRHA 4WUKL 3TCXA 3EGDA 4IBSA 4YL4A 5C0AA 4AKPA 3GSVB 2FBJH 3S37L 4JKMA 2VDOH 4EI5A 4LIQH 1ZXKA 2EH8H 2G3ZA 3OXRB 5FPIA 1AHKA 1AACA 1DVFC 1S9VA 3CFCL 4KHTH 3VI4A 3NAAL 4ELMA 4CC0A 1YYCA 5G5DA 2YHGA 1JL8A 4WW1A 5KYUA 2R2HA 3RWEA 3OG6B 1FG9C 3SBRA 4AT6A 1T1ZB 1Y1UA 1E4KC 1F1AA 5EU4A 3S4SG 1CYGA 1L3NA 3RX5A 4Z3HA 1KIPB 4RAUB 3RFZB 1EHLL 1HTYA 4Y5VC 4K5MA 1CDGA 1CCZA 2JCWA 4U2YA 4XMVA 4Z95H 3TH3T 4U1GC 2XFXB 1HFUA 4RA0C 4MJJA 1OY3B 5GRXG 5EIIA 1LO0H 1XZ0A 2WO4A 4LSUH 1JXJA 4NN6B 5C0CA 1T2QH 2YPLB 2HCZX 1JPEA 4FLSA 1DBAL 3RVXC 3R4RA 1FZKA 5E8DL 2NY4D 2ITCA 1HNYA 2GK0A 3CZFA 1DVFD 3KPQB 3MRKA 3PIQA 4AH2A 4DEUA 3EKCA 2CHDA 3KPRD 2YQ2A 2GK0B 4QTHA 4P23C 5F7AA 4R3SB 3K5RA 4DZ8B 3WIHA 2AXFA 1U8HB 2A9DA 5D55A 2XTJD 4PQXA 1MI5E 1SN5A 1KBKA 4Z0XB 3H4HA 2CR0A 3T3PE 4R4NC 2ZNWA 3CFEB 1GIGL 3OZ9L 4R3SA 4N8PA 1UJ3C 4HZLA 3FT9A 4Y1SA 1OSPL 2R0WH 3JV6B 1C08B 2XKNB 2YPLD 3UG5A 1ZV9A 3KCPA 3KPQA 1ZMYA 1ZLDA 5DFAA 1SDYA 2BSSA 4C56A 2DDQH 3C6EA 3Q0HA 1CICC 3VFNB 2FECL 4LKXB 4Y9GA 4LGPB 3GHPA 1LHZA 3RI5F 5EN2A 2XC8A 5CP7A 5GGQH 4FFVD 5H94B 2ZF9A 2BHUA 4R6UA 4DP4X 2Q5BA 2WMPB 1JD9A 1ZGLM 2VR5A 3QUKB 3ULVF 3QDGD 3ZKNC 4E2OA 4U4BA 4KK6C 2BVUA 2B2XH 1MG3C 1WFOA 2GKIA 1N5AA 4PJ8C 2K70A 1R3JB 4YSSA 1E28A 3FN3A 1J9TA 1CFNB 2AQ1A 5FYLE 5I5JA 3ARWA 4M1GL 3JWOL 5B8CC 4KROD 4QHMB 5BOZG 4JW3A 3X3GH 4ZTEA 5DUPL 3O2WL 1GTFA 3NJJA 3F62A 2WCPA 3ROOB 2HG0A 4FFVC 4QDGA 3VXNA 3POCA 1OTTD 1EWHA 4KVCH 1AMXA 3TIDB 3MKGA 1Z6JT 1UXSA 4XO9A 2XU9A 5EU3A 1OAZL 3DK0A 3MGTA 3KPOB 2NRDA 4QJ5B 1F4HA 2NY0C 2JB5H 5ETUB 1X5ZA 4N2NA 3S8GB 4M4RB 2FLBT 2GTZB 3M07A 4JS7A 1A14L 3KPOA 4XNUL 5EEWA 2VL4A 3QAZB 2A0LD 2ZWSA 3B6SB 1JGDA 4G8FA 1JCKA 4U0QB 5EUOE 3OLGA 3RKDC 4FQLH 3F5WA 2BNQB 1CZ8L 2J21A 5DHVH 3GSNH 3SDDA 5KVMC 5JIMA 4FNPA 4YS4A 2XSKA 4BFKA 1M4KA 3PDDA 1EZVY 4P5TA 4ZTPH 5C6TL 5E8EA 1UWYA 3O2DH 1BQ5A 1PG7H 4Y1AB 4XMKH 1ZANH 3T2NL 3FCBA 2ZUSA 4LDCA 4JY6B 2FE0A 1C1EH 3OF6A 4C4KO 3GPSA 1BD2D 32C2A 2YJQA 2N3JA 1VACA 3C8HA 43CAB 3QORB 4PVLA 5ESQB 1WYJA 4XNYL 3W0WB 32C2B 1RMFH 4CVUA 4YHNA 5KSBF 3TTYA 2OMNA 5J3HC 3JTTA 4PJ7E 3MRMB 4HIHA 4FNSA 3A6BH 4MASA 1RJCA 4X7SL 1J88A 2BWDA 4DP5X 2EABA 5EFIB 3BQUC 5E6UB 3LX9A 1KPRB 2GEEA 4LNRB 4APQB 3PWNA 4U6XB 3FAWA 4KRLB 2P43B 1OE2A 1XGYL 3TZVB 2ZUVA 1I8IA 4PVNA 1W0WA 2YSSA 4ZODA 2R23B 3KYAA 1F11A 1D7FA 2ZXAA 4R4FL 4LAJH 4O5LL 4GRWH 3WUZA 5I18H 3K6DA 2Y36H 3MCKB 2QVIA 5DFTA 1ZXQA 2WIIB 3ZK0A 3K6IA 4ELDA 2Y7QA 5DFWH 5HI4C 4N22A 3UZEA 1WA2X 1L9RA 2CM6A 2ZCKL 3BP6B 2AQTA 3L7FA 2D31B 1QBAA 3L1EA 5CJOL 4CU6A 1BBJA 4ZUTA 3LS5L 3V4VH 3TO2A 1JGIA 2I5YL 3EYVA 3T2QA 3RGVC 2EC8A 1JXFA 1KYUA 2W60B 2EYTA 3EGXB 3V0VA 3SYPA 4KTYA 1QNIA 4DIXA 1LP9A 5GZOD 3PABB 5I1EL 3MTXA 3MO1B 1F4WH 4MVBC 4UZGA 1U95B 2W80C 4KRPD 1FDLH 2OYLA 2EH7L 3S5YA 1EDHA 2ETWA 3EH3B 1S8DA 2K78A 2V37A 3KLSA 4ZI8A 5TE4H 3F12B 4ZUWA 3OPZH 5ADPH 3H7BB 2FBRA 3AACA 5E0QA 2D3LA 2XYBA 4H88L 3QQ3B 3MRDB 1KCVH 3BP7A 1ZK5A 3CH1A 3NPZB 5KOVC 4DF9A 3E0GA 5LXGL 1PLAA 3HI1B 1JWMB 1NEZA 1TKWB 1Y0LA 4YDKL 2D2CC 5FF6B 1IAIL 1UOWA 4PRPE 5EC2A 2PLTA 4ACPA 3X17A 1F02I 3N1QC 3FJTA 4KMTH 1JK9A 3AG1B 1XMWA 2FIKA 5DZLA 2QQLH 2R0LL 2YRLA 4HCIA 4UCFA 5D7HA 5FA3B 5L4FA 4JEGB 1BYNA 5EF3A 1JPST 1CFVL 2J20A 3JV4A 3QDMD 3W38A 4B7LA 4E9XA 5FLVA 3UMTA 3OKLB 4K9EH 3DYPA 2R1WA 3LHPL 4PCTA 2HN7A 4MZ3A 1IT9L 3FO9A 1EGJA 4HXAH 1OT4A 1N4XL 3FFCA 2TAAA 2G2RA 1E0OB 1MFCH 2DD8H 2R7EB 5IK3B 4HHGA 5AOKA 3MHZA 1YN6A 4YWGH 5TF1L 3W39A 5AOJA 2NY0B 1EJOL 4O51B 1VEOA 2X4TB 1YEIL 1JZJA 1EVTC 3OKNB 4M61B 2O4EA 4QTIH 1E9OA 3HLAB 1BFSA 3CK0L 4CADA 5KANI 2LAGB 1FO0L 1QEWB 2RFXA 2VABA 2X40A 3QI9C 1FH2A 3QJFA 4NQED 3FUKA 2XWEA 2ZZUT 1OLZA 1O6TA 2FZ3A 3QUML 4QAWA 4X7CC 4NC2B 4X98A 4LVNC 4WNJA 1IZKA 5TFSL 4OFQA 2DOCA 3T0WA 3O6FB 4S10A 1DQIA 2IPUK 5B1CA 5IMMB 4P46A 1TIUA 2A74B 3FRPG 3L3GA 2ZP9A 3QE5A 5HVGB 4XCFH 5AZ2L 1E8WA 3PP3H 3QQDA 3S6CA 3ZMNA 3MLWH 5BPPA 4U3XA 2LOEA 4I0KA 2IADA 3CLWA 3LN4A 4QRRA 4G3YH 1R0AH 3W57A 5E7FA 1OTUC 5B39B 4LHUB 1DJHA 2XV2A 2O6PA 4GRLA 3MLUL 4HKJA 5AB2A 1AD9A 2XZAH 1ESOA 5SWZA 3BT2H 3IXTB 2P3YA 1AGFB 1A6ZB 3IYLW 4ENEC 3C5JA 1OZTG 4KBPA 1LTXA 4Z7NE 1PCSA 3KWUA 5E9DE 4GMTL 2WWKT 2X4PA 4IIQB 3F64A 3GI8H 3B3IA 4GEJA 1HWHB 2BFGA 4P59L 1ADQH 3TFKC 1TQSA 5GISL 1U8MB 3GBMH 4WEBH 4JG5A 4FD0A 1W15A 2XVGA 4MDRA 3VFSB 2IPKB 2OM5A 2GJ6B 5F7NC 2Q8AH 1RD6A 2YD5A 5G4NA 1Q4NX 2VLKD 3QAQA 1T7YA 5H4ZA 1RLBA 5FYJU 4X4YB 2Q10A 4MXVE 1BQRA 4QR7A 1T1YA 1JHTB 3BDXA 5FHAH 2XACC 4YZFE 3RWFB 5CMAB 4ES9A 1ZPLA 4OU3A 3I3BA 1AHWC 2WKGA 4KKAD 1JHTA 3F8UB 3DKHA 5AG9A 4AE1A 2P5PA 4XMZA 3EYQC 2VQ1B 1IGTA 4YHKH 4JFHD 4IU3B 5CN2A 5C7XH 1I7UA 4JHZA 2YD9A 4RGOH 1AANA 4NN6C 4RX4D 4DGVH 1TYRA 4MS6A 1U92B 2VDPL 5B38B 1IGYB 1CFTA 2OMVA 1WWAX 5C0ND 1O7DE 4NIKB 3WTSA 2NY5H 3HMWH 3RRQA 1AZVA 2VERN 4YC2C 1RCYA 1LEGB 4XOBA 3FQUA 4YHYC 1A02N 5I8CA 1HHJB 2Y5QA 1J8HD 2G9KA 2HJKA 3N40P 3QDJD 2G75B 3NFPA 4PMEA 2VMJA 5DMJB 1YLBB 3ARDD 1N0XH 3FTUA 3WL9A 5E08H 1NDGA 1JF6A 2WOYA 4G9DB 4MMXA 1J0JA 1J1PH 2QGCA 3R1GH 2AEPH 2HZHA 3EYQD 1IKFL 2ZUWA 1HXMB 4KXZH 3C6SB 2J2ZA 4XMLL 3QWNA 3S34H 2QVKA 3DUSA 2I69A 1SYVA 1OGTA 3RFRA 1AR1B 3ULUH 2BVQB 1Q9KB 4ZMZA 2FO4B 1PZ3A 3P2DA 2F54B 1A3LH 4Z7VF 3NSXA 2GSMB 3KYNA 4YDJB 1U8QA 5CJ5A 4WW2A 5CIPB 3BVTA 4TULL 4XR8C 4KKBD 3WO4C 4BXVA 2BWQA 4Y16D 2IGFH 2ZXDA 4UB0L 3WTXA 2DJSA 4B95C 4XPGH 5BVJA 1WCQA 2VO5A 3SDCB 5EEXA 3MOAH 1PJ9A 3Q5OA 3LN5A 3MLTA 4XO4A 1F3DJ 3NFNB 4H13C 4B5EA 2J7LA 4UM9A 4NQDE 3EHBB 3GRWL 1JYVA 1QFWM 2A4EA 2ATKA 2NY5C 2VH5L 2YXVA 4V2CB 2WNGA 3QEHB 2CO3A 5EO1A 3WNOA 1I3UA 2GJ6E 1HIMH 1QRND 3PWJB 2B1OA 4QRUB 1YSOA 4OFKA 2R69A 7PCYA 1XAKA 4Y9BA 4G2AA 3VI3A 4X6FB 5F9JB 5J1SC 1UJ3A 4K5PA 2FNBA 4O2FB 2Z4TA 4LF3A 5MERA 1Z5YD 2ZPKL 4AUYA 1LM8V 1NGXB 1CD1A 5TQ2H 1XIWD 1SOSA 3HB3D 2WTRB 4KXZI 4YQXL 1AS6A 5DJ0B 2KZKA 4Y4HC 2ZNXA 1TSHA 4NB7A 2XOTA 3ZU8A 1BLNB 4I2XB 1JZ7A 1UA3A 4YN3A 3MQIA 4YLQT 3WY4A 4AZ8B 1OQXA 3MCG1 5DU7A 1C16A 4ABWA 2P80A 4HS3B 1P4BL 4HLJA 5FO8B 4FL4C 3F7YB 3T4AC 1F3DH 3UBXB 2DQFB 4LBEA 1JPGA 2YAHA 1KJVA 3D85A 1IM9B 5E4EB 1ZT1A 5LBGA 3VI3F 3IN0A 3BPLB 2MIZA 5DFVD 3K4ZA 3T1FB 1NDMB 3I6SA 1R24B 4KJYA 3I3DA 3BAYA 3KPTA 3OLDA 2DJMA 4GG8B 3DTXA 3NFSH 4NJAH 2EE0A 2Y5TA 5CCJA 1AO7A 1U8MA 5F1NB 5BO1L 4HK3N 4GQRA 2B3IA 4JQXC 3V0WH 3CFBA 2ZKYA 1HE7A 1UADC 2NYZA 2Y5TB 4N8CL 4XXDA 3PL6A 3QRGL 4L4VE 3SN6N 4HJGB 4XODA 1NCUA 1P4LB 2JIXB 3FUNA 3ZL4H 1AMYA 1ZS2A 2F54E 2MRYA 1EO7A 4QXTA 5T1KA 3EJCA 3MNZA 5MENA 2X6AA 1ETB1 1P53A 5HDRA 1KLGA 3V6OE 3QZPA 3DV4B 4X7FC 2YUWA 3SGDI 4YHOH 1NQBA 3RKDD 3WNJA 5AW1B 1FN4A 2GJRA 2NDFA 4J23A 4R7DA 2E7LC 1A6TA 1I9JH 2YC1B 4NPYB 4R90H 5ERWA 1Y6NR 5JHLA 1X9UA 3AQDA 4TVUA 5FO7B 1LEGA 4K07A 1KJ2H 1IGJB 4LP8A 4U6XA 4XNMA 5HGHB 5D1QE 4X8XA 2DMKA 1MIML 1KFAH 3SDDC 1KTCA 1NUGA 4QRPE 2ICWA 2WGNB 3RX8A 1T0MA 1G5GA 3HHMA 3ULUC 2UX6A 4X6DB 4X4MA 3VD9A 2CIKB 3UCRA 2H6OA 2UXGA 2YEQA 4KO7A 2DI7A 2XG4B 4BEIA 5I8OL 2JKSA 5I1DA 4Z95L 5K39B 4PRBA 2WZPD 4BINA 3DOSA 3NCWA 3BP4B 4FQXB 5D7LA 5JXAL 3LY6A 1F58H 4FG6D 4D9RD 1T2QL 3ARGC 1E5YA 4PJFF 3HZ3A 3HI6L 3GMPA 2IWFA 2Q1EA 3JQOB 7FABH 2XZCL 3SGJA 1TQCB 2C8NA 3JYCA 3HRZB 1L7TH 4K15A 2XBZA 1RIVH 1CTOA 1JV2A 2GIYA 1A7RL 1WHPA 1NMCC 5BV7C 4WNQB 2V17H 3F83A 4FULA 2ZX5A 5EC1A 1FC2D 5K39A 1F5WA 4FNQA 1JV2B 4LOEA 4X5WB 3WIFA 1IZJA 5ISZD 2R4RL 4UILL 1UH3A 3F7VA 5C0JA 2R2CA 4AG4L 1A9EA 3LKQB 1UCTA 1Z9LA 2PCFA 5E4AA 3F6LA 3MRPA 1HINL 2QQNH 1KV3A 1U91B 3UZEC 1S9XA 3RX7A 2H6PA 4D0DB 2C3VA 2EZ0C 2IAMC 1U93A 3HB3B 1K8IB 4TS6A 3BUYB 3F7QA 1S7WA 3WEBA 4RISH 5CZXD 1QTSA 3RJOA 1YMMA 1FC1A 1AXTH 3O0RH 5D4HA 1YY8B 5GGQL 3WIFB 5FA4B 4MRCA 2EDWA 4G42B 2QGEA 3ZXAC 4HV8B 3WKMH 2WSPA 4AVIA 35C8L 4YVNA 1RUPL 2YEZB 3FB6B 2DWDB 3A47A 3KS0J 1BECA 2ZYSA 3R4DA 4MHHG 4HG4J 1G6VK 1CE1H 1MWOA 3W9EB 4BYHA 4OVUA 2Z8WC 1LJMA 4NP9A 4ZO7A 1D9KB 1G7IB 1X7QA 2JKTM 3EHBC 3HC4H 2MQCA 1MFDH 4OD3H 4PJ5D 4JAMB 2IH9A 2ICEA 2RTTA 3ARBB 3TIDA 2SEBB 3LTVA 1DVXA 1BLIA 5A2JH 3SDCD 5G55A 2YXFA 4UZSA 4TUUA 3DX7B 2YGQA 2KYIA 2MWCA 5I1AB 1SF5A 1WAAE 1L9SA 3H7LA 3ZN6A 4Y1AE 2I9TB 4O02H 4JFXA 3FCGA 3HC0A 4PTTB 2AI0L 4AT6B 1VEPA 5L2KA 5IREA 4KRMB 1QEXA 1SXBA 2BNQE 2F54D 1PGRB 3DV6B 2IG2L 2Y6SD 4Y2DB 3WTYA 1QLEB 5E6RB 3OWEA 4AK1A 3MKKA 4FYRA 3K72B 3N1MC 1FVCB 3PXLA 4M7JL 4N6RA 5I5IA 3FQWA 4MQSB 2CJ3A 2NXYD 4Z7OF 1ND0A 1UWGH 3L95B 1XCXA 3SQRA 3WKYA 1GY1A 3S2AA 3GK8L 4RWYL 2EEDA 3FO1A 4Y8DC 4DK6A 5ICYA 2HLFC 2E6QA 3IETB 1ZANL 1NLDL 4PD4J 4K3HA 1P7KB 5JR1L 1KZQA 1V54B 2HLAA 4YE4H 1QW8A 1ROCA 1CF8H 1Y7VA 4HPYH 4N2KA 3LXAA 4B9JA 2GG1A 1HHKB 1I85A 1N2RB 3FTXA 3DXAE 4X6CA 5E1IA 3C5ZC 2H8PA 2DN7A 3DX2A 3ABGA 1CK0H 3BKYL 3JVGC 3S37X 1E27A 2PW2A 4FTVB 1CFTB 4UI2A 5AOIA 3VCLB 3MRRB 3F6IA 4TQEH 4ZDHB 4I1RA 3ZDXE 15C8L 2R1YA 3UTPD 1DZ0A 4G43B 5FECA 1NC4A 4H25B 2CQVA 2VR7A 5F1KC 1MRDL 4PW3A 4QT5A 3TO2B 3S36H 3K2UH 1KMGA 5FECB 3QHFL 2ZWLT 3L1OH 3UYPB 3U9UB 1FWXA 2VAAA 4GRLC 2VDOB 3WL9B 1U58A 2HH0L 2H8PB 5I0VA 4MJ5A 3P9MA 4Q7DA 3LKSA 3OGOE 5ADOH 2YIHA 1CIDA 2OZ4H 3O9WD 4XVSL 5I28A 1DQTA 3GIZL 1J7VR 3SQOL 1DBBH 3WELA 4BCXA 3PE9A 4Q58C 3B7TA 3D39B 4LLUB 1IM3A 3OKDA 3T3PB 3TBSA 2JCCE 1ILSA 5HGBB 1AR1D 2BDNH 4XX5A 2HT4C 3NJFA 2WBJC 2VSMB 3MV9A 4P23B 2Y06H 3MNVA 3I2CH 4BWTA 2E7MA 4G6FB 2KQNA 4B53A 2ZOTA 1NFDB 1A6PA 4QCIB 1I7TA 3LEVH 4ZO9A 3FQYA 1ZGLA 3MREA 1IM3B 1NICA 4JG0L 4PLKD 4PRAA 2JJSC 2H47C 5DLML 3ZDYB 4NRZB 4HWEH 3UYRH 3F12A 1IJ9A 2QSTA 4ZUWB 4GBXD 3E8UH 1TSRA 4NUJB 1XGQA 3QJTB 1HSBA 4Z7WB 2QQKL 3NZ8A 4NDMA 2FWOA 4PS4L 3VU1A 5I0WA 4ZOCA 5H37H 4AXWA 3EBGA 4ZPVB 1KULA 1Q0XL 1QSEA 5LBSL 1B0WA 4XNXH 5CUSL 4QHLA 2HP4A 3I9AA 1P5UC 3T0VA 1UACH 1CDHA 4KMLB 4AVJA 5KVFL 2CRMA 4KHXL 2XWZA 4GQQA 1AKJA 4ANUA 4E0RB 2X05A 5DUMH 4WWID 1OQOA 1RK7A 5D9SB 1KTKE 2YUXA 4ESKA 1HJCA 2VDLB 1Q1JL 4UOW1 4RGMB 2Q3XA 3KPPB 3S35H 1ZA6A 1IT9H 1NUNB 2V7HB 3C2AL 1UGNA 3B9KC 3LB6C 1ZLSH 2C9SA 2ITFA 3HMXA 4PVBA 4HLEA 4UIMB 4P46B 1FGNH 2VXQL 3V4PB 4HWNA 2WQUA 3TT3L 3QDMB 4F58H 4XOAA 2JV6A 1RZFH 2Z64C 1NGZB 1R4XA 1D9KA 1X7QB 3AGWA 4WAFA 2PR4L 3OBAA 3UTZB 2PWDA 4H8PA 1WEJH 4ZFFA 4H8QA 1BOGA 3QCTL 2WAHA 5CZRA 2I07A 4FG0A 4N86A 3ZE2E 1N8ZB 4ZX6A 1KLFA 4E9TA 5EZPA 4S1SH 4XCCL 1CU4H 1KJMB 2C1OA 3KYKH 1MUJA 1NAMH 2FT6A 1U8PA 5EPMA 3H9SB 3TV3L 1HJBC 2FX8L 3ZTNL 1TJHH 3O11A 4AL8C 1AY1H 3MRBB 1J9QA 3A3YB 2JXMA 4M1DL 2J55A 4FQCH 4XWGH 5D71L 1VLXA 1J18A 1SOXA 2QPFA 1BJ1H 1R5IB 3RAJL 2A9BA 4KXAA 1AD9B 4PGCB 3HC3H 1DJSA 1DDHB 1CD0A 3DV6A 1D6VH 1UEMA 2A6KA 3WIHH 4BSWB 3QIUA 2C7FA 2I60H 3BJLA 3LZFL 2BIHA 2PCPA 4NFCA 5ICXB 3B5TA 5IEKA 5HXMA 3U1SL 1U3HA 2DEYX 3IN2A 3KCWA 4NHUB 4AW7A 4HF5H 5ALBL 1S46A 1OCRB 4L8DA 3ESNA 1PLBA 2M8XA 3OKKB 1UEYA 4H44C 3O3BB 4OD2B 4GMSH 3S3BB 5CM1A 4WKXA 5JOFB 3UYOD 5JPMC 3NBNA 4Y4HA 3UTTB 2NUPB 4LRIA 3D1MC 5DK2A 1JXDA 5FHBL 4NI3A 5F88B 3L3IB 1CL7I 4F2EA 2K9FB 1J12A 3HI1A 3MXWL 5CEYB 4WHTB 3LHAA 1JTTA 5E2UH 3KBFA 2TSAA 4A67A 1H6EA 2G60L 5CLXA 1U8CA 5AZEH 5I75C 2X6CA 4KMQA 3SKMA 2DWEB 5DHXB 3HBZA 3UZQA 5I1DB 2XPGA 5IB3A 4PJCB 3BUDA 1DVUA 4JUSA 4ZZFA 4LSPH 4K5LA 1FAIL 5FHAL 3QS3A 4JG1L 4OV6F 1F11B 5LNDA 2FEDC 5AFAA 2Z3FA 3VQLA 3BQUB 3RVTD 3CSPA 1GMIA 3WNKA 1GJIA 3NCXA 3CHXA 1RZKC 1V55B 2OJZH 4HIJA 3EW3B 4DHLA 4ZG1A 4YHKL 3HG1E 5IHUH 1PZ5B 2UXVA 1CFBA 1K5NB 1S9WB 1V3MA 1XBDA 3N6YA 4JFYA 1JPFB 2WSDA 4MD5B 3QCVL 3OKOA 4GQZA 3H56A 3VXUA 3VE0A 3BWUF 3HE6C 3V6OC 2FECI 1XMEB 1FG2A 2V9UA 2W65A 3L3JB 3VD7A 4CNIA 4EXPX 3STLB 3HMWL 3OLEA 4MCNA 5HHMB 2WC7A 1FL3B 5JMRA 2CUAA 1KJ3L 2EICA 1G4MA 2ARJQ 3TNMA 5IQ9B 1JZ5A 3HE7C 3QFJB 4WLCA 4ZMYA 3QNXB 2APVA 4HKXA 4PSRA 1OM3L 5K59E 3U0WL 4FYSA 4YFEA 1M7DA 1OSPH 1X9QA 3TH2T 2KLSA 3CVIL 3WEXB 3H7BA 3HG2A 4XNBA 3ZT5A 1FNSH 5DR5L 4ZD3L 3QA3B 4XZ4A 2D7PA 4QI3A 1HHGA 1WICA 2AANA 2NOYA 4PUBH 1RHHA 4XCEA 4HS8H 3RPIA 4IHOA 3ZZ1A 4JREB 3DC0A 5KBPA 1A0QH 1Y07A 1A3LL 1VF5C 3ATDA 4GW1A 5LGJB 5B4MD 3QULB 3D51A 3C6LB 3PHOA 4TQIA 4F15C 4C57C 1JZ8A 2YBRA 4JFQA 3N0PB 2WTRA 3BCFA 3IFPB 2VLME 4HALA 4IEFA 3GLZA 4X9GA 2OS7A 4XPGL 3T0AA 5E8PA 3L7EB 4PJDB 1WD9A 3HZYA 3ZDXF 4HCRA 2DTSA 4FFYA 4L8SB 3P30H 2IQAB 3V5DA 4IKIA 3MJ8A 4GYBA 5DURD 3LH2H 4FS0A 4MAZA 4U6HA 5I6KA 4PH8A 3JWOH 4BKSC 1UWEH 4V1DB 3VD2A 4QWWC 2R8SL 4PJ7F 2ICWI 4L8BB 4PJCF 2F53E 3VXPB 2OI9B 1XHHA 2VH5H 3I74A 2WBXA 4EMZA 1MUJB 1IAII 3EAKA 5CO1A 1DBMH 5EBWA 1YEFH 3EH4B 3VXOB 3MV8B 3TM6A 2AJYL 2BERA 3RBGA 4ZW7A 3D87B 4PY8J 1U2YA 3MRGA 3S88H 1R5IA 3MGTB 3JVFC 4TVPL 3FQWB 5IFAH 4P2AA 2Y6TE 2XYCA 5DS8A 3L54A 3TYFA 1ZDSA 3POHA 4BH7A 1ITBB 1OAJA 4PN6A 1OE1A 2MTAA 4J3TA 5AQ0A 3TL5A 3U6RA 4Z78A 4UWQB 1K9TA 4TVPE 2IAMA 3IAQA 2PO6B 3O4OC 4XP4L 3LEXA 1J5OL 1QSFA 2SODB 1P84K 4WWKB 2B0SH 3WNPA 1C5DA 1RH8A 3V0HA 3HZVB 4L3ED 4JFFA 1MHPL 2XTJB 2WWMD 4P5TB 3CFJA 1VFUA 2YGPA 1XZWA 3ZLQC 3GM0A 5ID1A 3EUDA 3AJ7A 5CXPA 4XH2A 4OTXH 3RWDB 1PAZA 5AVUB 4ABQA 2BZDA 1LE5A 2DIAA 1HWGB 2OTPA 4BH8B 3DX0A 4L48A 3CVCA 4OZ4B 4LK4A 2OK0L 5A2LH 5BZXA 3GDCA 4PV8B 3OJDB 5JW4Q 1FBIL 4ZBJA 4N0UB 4GAAA 1N18A 1MF2L 4NUQA 3LZQA 4QY8B 2XXGA 4Z3JA 2AJ3A 5IHZA 3MA7B 4UINL 1FNHA 1R3HB 1INDH 5CN1A 1Q9LA 1U0QA 3ZL4L 4HHAB 4KROB 3V9EA 2XWJA 2CAKA 2VLKE 4U05A 2FHFA 5C0CB 2VISA 3UTPE 3V6ZB 3GSQA 5I17A 4FMKA 3GBDA 3JTBA 4I3RL 4Y19D 1CLOH 4AM0A 3KXFD 4NN7C 3QJOA 4OJYA 4XO3A 2WTOA 1YMHA 1OL0A 5DJXB 3WMQA 2NXYC 4H2CA 4QYOA 3FQNB 4YDVA 1LEIA 2AEWA 4CN4A 2J44A 5L2JB 5KSAD 3FQXB 2VUKA 2DQMA 3HAEB 4X2UA 1JCVA 5E8OA 1BQHG 4PG2A 4DW2L 4C56B 25C8H 1GA2A 1JMZA 3BFQG 4AIOA 1XQ4A 2BX5A 1T3FA 1SLWA 5FEBA 4S2SA 5IW6B 1MCKA 2A9AA 4NC1C 5F7DA 5DEGA 2EH8L 3OLIA 3UTSB 5T1MA 4RFOH 1IE5A 2EDEA 4Z0XA 2FQEA 1SDDB 2J56A 1XO8A 3QA3A 2YD1A 1W2KT 3FRUA 4PJ8D 4JFDB 5I26A 1SY6L 1VESA 5LXVA 3VH8G 4PJAE 3QT2A 3SOBL 3VUAA 3EZ8A 2ESVD 2AEIT 1AGEA 3U2IA 1GGTA 3LKOB 3BHBB 1R3JA 4H20H 2A7BA 4LDEB 5F7BA 4U1LB 3HA0A 5GS0D 2WYTA 1DSWA 1FFPB 1OTSD 4LSUL 5DEGB 5FYKL 4XHJD 2FWLB 2HTKC 2WBWB 3VFMA 1DBAH 2EP6A 1V27A 2BO0A 4IRJB 4OUOA 1S4IA 5BZWB 4LRNL 1FLRH 3Q5YA 1RSFA 1JI1A 4CJ1A 4JPVH 2OULB 4KZDH 3HRPA 3DRTA 4L1HA 3ZGIA 1BQSA 2LV4A 5GRJL 1QAWA 1RFDH 1ZHLB 5HGDA 1C5CH 4LOUD 4NZRL 3GMOB 1WDAA 3E3QC 2BC4B 1BEYH 4UQEA 5AVQB 5I15L 1QEWA 3NCBB 5I30L 4JL1A 4M6OH 2ZUTA 1TUPA 5EEYA 5CIPH 3AW5A 5GS0L 3AAZB 2DW5A 1GIGH 3D06A 3NESA 3OZ9H 2Q8BH 4FQ2H 3QULA 1BIHA 4K71C 5GS0C 1MIEL 4RISL 3KHQA 3VM5A 1GHFH 2QFPA 4XN7A 4MJIB 1KGJA 3T0BA 5IK3A 4ILDA 1ORQB 4WHDA 5JZ7C 1IEAB 1UWXH 3FT0A 4FQQB 4QXTB 1NUDA 1J0YA 1C5BL 1J48A 1RJZB 5HHNB 4J3UA 4XZUA 3QJXA 4ELMB 5C9KA 3OKNA 4M61A 1MFUA 1O6SA 1CE1L 4Q9BA 3NRQA 1YNKL 4WEMB 3NGBC 2DMHA 1AXSA 4W81A 3MJ7A 5IMLB 2RR3A 1OP4A 5JHDD 2TSBA 3VNZA 2AHIA 3VGGA 1OWRM 2QADB 4IRSC 3QZWB 2A6DA 3MJ7B 3KGRA 4A39A 4Q52A 5IMLA 3KJ6H 1JF5A 1G0YR 1A6AA 4I88A 5IKCA 1UKTA 2YD4A 2YRZA 1DN0B 3IGKA 3O4OB 3DARA 3PLYA 1U8KB 5IJKA 3EYFB 3I9PA 4ZTOL 4DQOH 2VN3A 2MOGA 5E5UB 1EXGA 1SF3A 3T0ED 4YLCA 3A4EA 4G7SB 2CHXA 4YNYB 2UZIH 1B0GA 5DRXB 2R29L 5DC4B 3M88A 4NO3A 4Z78B 1CL7L 4IDJL 4JE4B 2DKSA 3TURA 2DQIH 1IGIH 1ND0B 2A83B 2J8HA 4MA7H 1HILB 2C9VA 3LRKA 1DVYA 1HAWA 5HYQB 1L9OA 2LE9A 4ZXBC 2OMYB 4MAYA 4N3TA 1F6AB 2OR8A 4Z7UE 5GGRA 4EJ1C 2O1AA 1T0NB 5D96C 3K80A 2XQYK 1HL9A 1MLCA 1Z9MA 2AMUA 1R34A 4NNXB 3MRDA 2JJWA 3TT1H 4M8VA 2DWEA 3EJZC 3ATEA 3QUZB 4CBPA 1A14H 4L05A 1YPZB 2ZJSL 3DA0A 2Y1ZA 3BT0A 5E99L 1RZ8A 2X1OA 4P3DB 1MCBA 2MFNA 4JVPA 5HHVL 3TYGH 1KELH 2EVIA 3BP6A 3L7FB 4PJ9D 4QGYA 3WUWG 1IC4L 3C75A 4MYWB 2VDPB 3B83A 5I6PA 1SUJA 1UVQB 3NSCA 3MOBH 4ZMPA 2DJ4A 5HI3D 3IMRA 1KTLB 3O8XD 5SX5K 1JZ4A 2XFGB 1KEGH 2YD8A 2HN7B 1WE5A 4HK0B 2X2IA 1W16A 3E6FB 2I25N 4TUKH 4NZ8A 2I85A 4JM2B 3QBTB 5I16B 1EFXD 2B1HH 1I8UA 2RCSH 3BGAA 4UQDA 2QPEB 3QNZA 3MCKA 4LCYA 1R19A 1JGEA 5EU5B 2X87A 2OCFD 3CU7A 4PV9B 1KJ2B 4RVBA 5E5RB 1R3IH 2H26B 5LGKA 2XRAL 4AMXA 3RY4A 1B6UA 3B1UA 1JWUA 5KYYA 3QUYC 1N0XL 3BE1L 1XGYH 1U6AH 8FABB 2KDGA 2XTSA 2H0JA 4OAWA 3MSPA 1MOEA 4M5ZL 4M6NH 4LU5H 4Y5XC 4MNQA 1QSFE 3F6JA 4XMLH 1T1XA 3NVQA 3K2IA 4U1HB 1HOCA 3LSOA 4AITA 4Z77B 4JGUA 4M5YH 4JRXE 1SGKA 4EVNB 1QG3A 4OBSA 5AVWB 5GZNA 5ICZA 4NUGH 2BY3A 1KNOB 3IVKB 5J6HB 3LRLA 4XP6H 5EOTB 3VFTB 2OMXA 2A1WH 3AB0C 3WDIA 1EQWA 5LQBH 4QRPD 4U1NB 2HTLC 1OM9A 1SQ2N 3HVDA 3QJFB 3ESPA 5K1VA 5CD3B 4NXKA 1UWXK 5CEZL 3R8BB 5KYNA 4UT6A 3SDAC 3LZOA 4LCCA 4LCIL 2HPOA 2P7TA 2QBWA 4E9QA 1RUML 3GRBA 2NTFA 3PXHA 3S36X 4C54A 5KS9B 1BFOB 4JO8A 1UM4H 4JZJC 3QPXL 1R3LA 5AUMA 2X0VA 3AXLA 2NX5B 3IU3B 1FV1A 1YN7A 3KXFE 3L3OB 5IB4B 1AZNA 2BHYA 4U1MA 2PTUA 2GJ6A 3JV5A 2YPVL 3BLKA 4EDXA 4WUUD 5F0LB 2OMUB 1AOZA 1WP6A 2R0KL 2VITB 1HS6A 1T20A 2IH1A 1J05A 1AR2A 3BWAB 3O2DA 3Q2LA 4U4IA 5HDBB 2OSLA 1MG2C 5SV4A 1JUFB 3J27A 2DQFA 1G0DA 3EGSA 4KQ3L 2HTLD 1A6AB 5LN4A 4APQA 3KYOA 1XIWB 3L6FB 4JRXD 4JHWL 4H5SB 4YR6A 3AWEA 5IESL 3B2MA 1A9BA 2Q20A 1GC1L 4WU7B 5K69A 5CFHA 3GXFA 3MI6A 3QHZH 5F1NA 5H8DA 3P3SA 3S35L 4BQBA 4HMDA 3HG3A 3IKCB 1CD9B 4YPGB 3ECWA 4LLAA 3ALWA 1F97A 3MPCA 4L9LC 4IJTA 3UDWA 3MV8A 5HJ3A 5JPNC 1P4BH 3QC6X 3QSKB 1A6UL 1MREH 4ALAL 3TEYA 3OMNB 2CIIA 1WEJL 4X6BA 2NXZC 4QHKJ 3WFDH 1MFCL 4JRXB 1NOAA 1CI5A 2BIPA 2G0KA 3VFRA 5ESAA 1U8JA 3C60B 3IF1A 4M8QB 3KYKL 2HPTA 2AJUH 4BUGA 3NABH 4DETA 3E9TA 1AZUA 3MCLH 4Q6YA 4XVTH 2GHWB 3V6FB 4QHPA 2X70A 4WSJA 5JNYA 2PYEA 3I9GH 3D4GA 5CEZE 2F8IA 3BVVA 4BXSV 3FHAA 3BW9A 3X14B 2J2ZB 5K9QI 5D4IA 2WLZA 3BZEB 2EDFA 1QSVA 1WTLA 2CALA 2Y23A 4QGTA 4S1RL 1OPGL 4AENB 4FG4A 3AS1A 3G3LA 4JFED 4JHBA 5AKVA 1U58B 2BCKA 2CG9X 3CZNA 1OARH 1V10A 2X4UA 4OBRA 3V6FA 4W9KC 2AW2A 4NAMA 1M2OA 3QW9A 1CD8A 1SVCP 3B5HA 5D1XC 4HDIA 2CA3A 3LN5B 2IDTA 2VO8A 3MLTB 3REWA 4BJLA 3T08A 1QQDB 3QDJB 4ZAKA 3TVMD 3WJMB 4BRVA 4PP1D 2XA3A 3G6DH 4XBGB 1H8NA 2BNUB 1AGCB 3APMA 4R26H 5KUMA 4Q6IB 5IQ9A 4B9IA 4UNVA 1W0YT 2WQAA 1CFQA 4RRPG 2DQJH 2EUZA 5IQMA 4X99A 5IWLA 3NIFF 2ZXGA 1LK3L 4L1LA 1CFSB 2BIOA 4P59H 4MJHA 2ZQKA 2AQNA 3GBML 4X99B 3MNWA 4A7GF 4OCNC 3W9DA 1IEBB 1EAOA 3HAEA 2F15A 3ZL1A 4BQ6A 1D5IH 4FEIA 1OO2A 2BNUA 3BVXA 5GXBB 4X5LA 1OKEA 3N50A 4WW2C 1C8PA 3X1BA 3MRNB 3PAZA 4UAHA 1QWHA 3N1GC 3MZTA 3IFNH 5DJ2A 3U4KA 2Z91A 4XCYA 2QHRL 5FB8A 5IJVB 3TBCA 4PRDB 1RPQA 4ZJ9A 1MEXL 4MX7A 3OB0K 4WUUE 3LPWA 4JPIB 3KYNB 4YDJA 1UB5A 2V5SA 4ORZC 3HI5H 3NJXA 5ITFB 1J8SA 1AJ7L 1G9MH 2BOLA 3MV7D 2VDPH 5D8JL 5IR1A 2HG5A 2WYZA 2R4SH 4OLEA 4XXWA 3WXVH 2YPKA 2Y0SA 5EIIG 3BI9X 5SWSB 1DANU 3IFPA 4MBRA 3U0WH 1FZJB 4H0LC 4KOBA 1FZOB 4NQSB 1YJDL 2MCPH 4K7PH 1DSFH 3BH8B 3FN0L 4U1IA 4NZFA 4L1SA 4NQCD 3SPIA 3VGDA 4DZBB 4K2UL 4N90E 4PRID 4PCSA 4P04A 3OMAB 4EVNA 5CKAA 3DUUA 4Z7VA 5CLYA 2R0WL 3N5AA 1IAKB 5D7KD 1BWWA 5DVMA 4F2MB 1HHGB 5KN5B 1RPUA 5D2NE 2W07A 1A0QL 1L4IA 2J1KA 1YEHH 4LSRL 1OPOA 4PG9B 4HA1A 3N06B 1CFNA 5LAXA 3S34L 3MBED 2GY5A 1UG9A 2YEZA 1REIA 2PWGA 3W1ZA 1ZV5A 5KYUB 2PO6A 2EIZB 1TJIH 1TF4A 4TF4A 2DQ6A 4DFIA 5DVNA 1A6TB 3W2DL 2NXZB 4G83A 3LKPB 1KXQA 4NQEB 1TVDA 1NPJA 5DS8B 4Y9CA 3TN0A 3T4AA 4P99A 1F1GA 5CJXA 3PJSA 1MHEA 3BVNA 5TPWH 3K3QA 4KK9C 5DZJA 3RVVC 3OKYA 4JY6A 3QNYB 3U25A 1KCWA 4KTEL 5JQIB 5DF0A 4UQ2A 4JQVC 1RURL 2Y7SA 1G7QA 2NSQA 4IOIA 4X50A 3BOVA 1FO0A 2EXYC 1TMCB 2XI9A 1MHCA 3ZTCC 3ROLB 2X42A 3WHXB 3X3GL 4KGLA 3PL6B 5LNEA 3MUHL 3F58L 3LPOA 5EBMA 2EINB 3LEXB 2WVTA 5DT1H 2HJFA 4GFXA 5IROC 4UQIM 1AI1L 1IAMA 3IJEB 4WUUB 3PWPA 4NBYB 3FUHA 1HQRA 4NYLB 4JFPA 5GJTH 4D9LH 1A4BA 1CT8A 1OAZH 2L4OA 3NSYA 4WWNA 2A73A 4M7JH 4EZKA 1RZJC 2VNCA 1NC2A 2GVYA 1IM9A 3I9IA 5CLTA 5T1DH 1CDBA 3IXTA 1KC5L 3O3DA 3FUFA 4MD5A 3DX3A 5IVXE 4JDEA 4XNUH 4FFWD 1WITA 4NNPL 3UZVB 1J5CA 1V7MH 2W8CA 3V52H 1NC4B 5AEAA 2JKRM 4WFFE 4W9ZA 3FH7A 2WP3T 1NCWH 3WFCL 2ZCLL 2A2QT 1IX2A 3TIEA 4OZFA 1CZ8H 2BW4A 3BEVB 3ZDZF 1QLEH 3OX8A 3VNYA 3BQVA 2A5UA 1YY9D 4WTQA 3GJEB 4NJ9L 5GRYA 4R7DB 4PJGE 1ZOXA 5F3BA 3BEVA 3SYQA 3NP3A 1NFDF 4LLDA 2J1XA 1DO6A 4KI1A 5DTFB 3TBYA 1IE4A 1WSST 5EU7C 1KLGB 3PJNA 3ZE1B 1F3RB 3NIFB 5DJ6A 1KYOJ 1A8JH 2PKDA 4M02A 3C60D 4YZWA 1ADWA 3G6JF 2WJ7A 3GT6A 2GCYB 4KI5C 1XGPA 3K6NA 4I1NB 5IHBA 4PWEA 4AJYV 3K2UL 5FA4A 3N1FC 5KANG 5C07D 3DXAA 3WFHB 4I0CC 3D52A 1T66D 1BYPA 3VG9B 2OR9L 1KCSH 4UNTA 2NUTA 4AUUA 4JBSA 1NCBH 4LLYA 4BWWA 3SGJC 3VTAA 1SLVA 3PQYD 4QOKA 3T6WA 3US9A 1OAXL 5ADOL 1IGML 4LDLB 4JGNA 3L4VA 3TA3A 2EUVA 1BD2E 2UY6B 1FCCA 1QX1A 2ENPA 3IJ7A 3TTSA 2DI8A 3UTSD 4Y9EA 4K4KA 5TH2B 1DBBL 3ZO9A 5IQ7L 5GZNC 1XD0A 2GJZB 4ODVH 1KY7A 3G5YA 1DEEA 2J8OA 4UMSA 5AOMA 4MNGB 2OMTA 4JM2D 3TZVD 2XG5A 3E6HB 3QH3A 5H35B 2J73A 3EO0A 2BDNL 4NM4L 1G0XA 4DZ8A 3SDAA 5D6DC 1ZE3H 2O61B 2B4CL 4F7TA 1RUAL 1ZA3B 1A7OL 3C6SA 3BD5A 3FF8A 3LEYL 3MLYL 4YBHA 4NKDB 3SGKC 5IOKA 3QXVA 1NAKL 3NH7H 2PWFA 4LCCB 4JZJA 2C9UA 4UTAA 1MELA 1KDIA 1NL0L 4I0PD 5C9JA 4QHLB 4OFVA 3GEFA 3ARPA 2BSTB 3FB8B 2IANB 4TOYL 4YBQC 2DWYA 3IMBA 4HCRL 4R5VA 1E5BA 2P8MB 1TJMA 3GMQA 5CZKA 4ONFL 3UC2A 1OW0A 1W72A 3MRQA 4EZMA 1SQMA 1Z5HA 1BVKB 2XX1A 4JZOA 2B1AL 5FYKH 2XNAB 5G2NA 5JXAH 3VD1A 2J4WL 4JKKA 5IB5B 4W70A 1JGLH 4LSSL 4OGZA 2BC4A 3O6KL 1NGWA 4LRNH 2G5RA 4UM9B 1IBZA 1OAYH 2W0PA 3S8WA 3VQ1C 4LEEA 3U6XS 2WXKA 4MDJA 2BSTA 4AYGA 4Q9CA 3L9RA 2GSGB 3IMSA 5GRJH 2AAVA 5I5RA 3OR6B 2GI0A 2F53B 5E6IC 5BO0D 2JIXA 5KVFH 3DX9A 1XL4A 2Z7WA 4GKZA 2WLHA 4Y1AA 2IH8A 5JOEA 1LYQA 1BZQK 1WA0X 5CU5A 5E4OA 2D0FA 4HLZG 2RIKA 1CMOA 3K6OA 3K8MA 1A6WH 1IEHA 2HVKB 1D5XB 2Q8BL 1YMME 5IHHA 3QS2A 3VSTA 3RNKA 4OLUH 3MROB 2H1PL 2BVOA 4Z0BH 4NP4H 5CD5D 3V7AE 4AV4A 4BSVB 3LIZL 3O6MH 4FQJH 3IDYB 2HWZL 1AZZC 4NKOB 3O4LD 1TZGH 2N1TE 4FERA 3B5GA 1H5BC 2DD8L 4KTDL 3G9VA 3B3IB 4N25A 1A4AA 4WI4A 2B77A 2A6DB 4YSDA 3TO4C 3OJVC 3WJLA 1PW3A 3EBIA 1TTGA 3FCSA 2BIIA 3X11A 1QVOA 1THAA 2YAEA 4TKWA 3RVXD 2EIDA 3B6SA 3SIKA 4K23L 3ILQC 1AXSB 3O8XB 2VLJA 4JKLA 5ESQA 2EIBA 3Q8EA 4QXGH 4DERA 4GUPA 3VRJA 4P4KC 4Y2OA 1NCNA 3KJ6L 3BAIA 2VUYA 2N7SA 4P3DA 2EJ1A 3G5ZA 5TE6H 4Q14A 1UKSA 5KEZA 1MFDL 4PJ9B 2EC9U 1PKQA 2FR4A 2C7UA 2ZICA 2DLTA 5F71A 4POYA 4W9GC 4OGQC 4C8XA 1KTRL 1XFPA 4L5FL 4XCFL 5AZ2H 3LKNA 4HOMA 3V95A 5KYWB 2VLJB 1CICA 1VGEH 1ZTXL 2ZYIA 4AGQA 4EUPG 5I1JH 1GAFL 1IGIL 3MYJB 3D69B 4Z7QF 1NWOA 5AAMC 5JIDA 3V5HA 3GLDA 3C6LD 3S7GA 2F74B 4LO9A 3R7QA 4H8HA 1RZ7H 4OKDA 2VDNL 3ASNB 4X4YA 2Z35B 5D7JB 3BZ4B 3CLEL 3HHSB 4P4KD 5E00B 4QY8A 3OWRA 1KGCD 5B1BB 1FJ1B 4CC4C 2BNRB 4NC0B 5AOZA 1G7MA 2VDRB 1I1FA 1S5IL 4G43A 1LE9B 1GOFA 3DRQB 2FBOJ 3Q05A 1JXKA 4QOKE 4EUPH 4N2HA 2DLHA 3NK4A 3Q8AA 3CDGB 3EJQA 1YEDA 2XTJC 2JQMA 2L0DA 1DVFB 3HEIB 4Y4FB 3ZX1A 3C5ZD 4NQUA 5DD1H 3QIBA 1FGVL 1HI6A 2Q7YA 3ZMRA 2GJZA 3N41B 3VI4E 4R83A 7CGTA 3VH8B 2WUBH 1BMZA 4WFFD 1NLDH 2PPCA 2D8KA 3LS4H 2BSEA 1ZS8B 1DYZA 1OGAE 2BNRA 5C0AE 4CMHB 1EMTH 3BP5A 5D7KE 5IVOA 5I1CH 3FH8A 3EOYG 3LZLA 4XXWC 3WG7B 1FFNB 4NFDA 4K7FB 4M03A 1AZRA 1NFDA 5C09B 1OSZA 2YN3A 4MA1B 4JKNA 4YSPA 1WQVT 4XNQA 3OTTA 2LFGA 1T80A 4P23A 1UFUA 5CINH 1RZIA 2HFEB 3VU2A 4E9LA 1N19A 5MEPB 5JYLA 4IOFD 4DGYL 3IEAA 3O3EA 1MPAH 3TBSB 3QIWA 3C08L 5KZCD 4TTGA 5IVXA 4AYDC 4OCSL 2VLLB 5AVVB 3J2PA 1RI8A 2ZE0A 2ZUUA 2BH0A 1KCUL 1NCTA 1T22A 4G1MB 4OM0L 3TJEL 1UYWL 5I1LA 4BFOA 1F13A 1UA7A 3WGUB 2V0AA 1XGTA 4XPAH 1CS6A 1F8TH 4WTZG 1KXQE 3KS0H 2BHFA 5EF1A 1GGUA 2H0PA 2X89D 2QQQA 4PS8A 1BM7A 3K2KA 4MTMA 5HHOD 3IDMB 4QHNA 1E43A 2EO1A 1RERA 1SM3H 3CZGA 4PGEB 2MPAH 1ETA1 1UOVA 1N59B 4ANVA 4GW5A 3UO1L 2F6AA 4DUVA 1LO4L 2JVUA 5IBUB 3GM8A 1RK0A 4JX0A 4Q8BA 2A1WL 3WFZA 2VXUH 1I1AA 3WY1A 5EUOF 5L8JB 4H1LH 1P9MC 2OMXB 4CAGA 2X4TA 1A9VA 1JZHA 1X6NA 5F6HI 2BVOB 4ZS7H 4MJIE 5K59F 3GIVA 1GMEA 4FZEH 2QVMA 2OYPA 4UB0H 3LH2L 3NIDE 4TLKA 2YQGA 4N3UA 1T1YB 3RTQA 3KWWA 3UBGA 1KUMA 2PCXA 1OGSA 3FMGH 1EO5A 4JM4L 2Y25A 3C5JB 1EAJA 2L04A 5IROA 1DVTA 2F53A 4LCUB 4EZJA 1CVSC 5JZ7D 5DI8B 3V79C 3QQNA 2BSRB 4HKJB 1YN7B 3L3OA 4G8AC 2DM4A 1ID2A 1YNLH 2KKQA 2WO2B 4GUCA 1FL5A 3QORA 1CVRA 4QNPF 4U7KA 2I7SA 3T2PA 5TF0A 3RPBA 5FDYA 4UT9A 2V8MA 1JHKH 2YS4A 3GSVA 1DFXA 3OSVA 5A2KH 5MHSD 1TYJA 3VGAC 4KNSA 3BD3A 3QIUC 3RILA 3CQQA 3FT2B 2F5BH 3H9HB 4QD2E 3F7RA 2I07B 3BQUD 4ZFGH 1PZ5A 2O6CA 4HKZB 4NO0D 4OD1L 5KVFE 1C12A 1MFBL 5C0EA 1M2VB 2IADB 3S97C 5CSZA 4GKLA 1MHPH 3II3A 5J1AA 3RIKA 3C2AH 2B9AA 5GJSL 4GAFB 3OB0H 5JOFA 5I9QB 3PWVA 3HG1A 4U3HA 4PS3A 4OT1H 1HQRB 4EZLA 3BO8B 5DRWB 3Q44A 3K8LA 2Z31D 2R59A 2R2BA 2YA2A 4L1TA 4TV3A 3PWVB 3WN5B 3QCTH 3GXMA 4M8RA 2DM2A 4U33A 4ODSH 1BAFL 4ZW6A 1RZPA 1G6RH 1QRKA 2GB2A 2YOCA 5GHWH 3WN5A 4YDIL 3APDA 2MTPA 3QUZA 3UAJC 1TJHL 3PGFH 3BPCB 5MHSE 3N41F 4EIUA 1XSJA 5BUGA 4JQVA 3TXAA 1AFVL 1EEYA 4PGBA 3VFUA 3JV0A 4UDTB 2YC1A 3I75B 3AS2A 5ELIA 1AYOA 3FPXA 3BGMB 3SE4C 3U79A 3L5WB 1BIIB 4OGYH 4ODHL 3GLAA 5AW0B 4N68A 1NZRA 2WLNA 1NFIB 1EJ6A 1SLXA 4G6KH 4LHJB 2EE9A 5E2WL 2Z31B 2XUWA 4FI6A 1SXZA 3OZKA 3KPRE 4TL4A 5HI3C 4YXHH 3CD4A 4FFWC 3P73B 4CW1A 5FYKD 3H9SD 4KKCD 4FNLH 4FXKC 4Z7AA 5IOPB 3RZCA 2WLMA 3SGKA 4MJ4A 4Z3FA 3SY6A 2XG4A 4ERSL 4W4NA 1AG6A 3F7VB 3W82A 3WFHA 3D39D 1UURA 4HOWA 2E5EA 3ZDYF 4YK4B 3WAKA 4F8QA 2BFVH 3FQUB 1PFCA 3T0XA 3EH2A 3ESVF 1NMBH 1YY9C 4XI5D 2AABL 2NZ9D 2A77L 2QSCH 2O6EA 2OV0A 3HZKA 4IJ3B 4DEPB 5JOPE 43C9B 3BH8A 3H2PA 3MJ9A 1OW0C 2DWSA 5E2UL 1VGKA 2D7OA 4O02A 3P4MA 1CQYA 1NGZA 2GT9A 2NCMA 1A7NH 3JWNH 5EH1A 1NGQH 2JJUA 2AV7A 3O3AB 4Q0XL 4JCLA 3SJVE 2AQPA 4PLJD 3BSZH 2YBRB 5TGBB 1UB5B 4HT1L 3GS7A 3LDBB 3ROOA 4F7CB 2P8LA 1CLZH 4XCEB 3RPIB 1M57B 3HNTL 3UTTD 5JA8B 1I1AB 5FB8B 1IAIM 4Q9RL 4OLYL 1E4XL 4J2XA 3HFML 3U2SA 5F9DC 2M2DA 3FYIB 4G1MA 3QCVH 3BRGC 2HFFB 5IFHL 1SEBA 5E6YA 2R4SL 2E4TA 3WXVL 4O2FA 4YDLC 2CDGB 2ZYHA 2E7HA 3MV8E 2CO6B 1C5CL 3SCMB 4YPJA 1M53A 2EACA 3D0LA 4MJ6A 5CJQH 3QNYA 4J5VA 1SDAB 4ZSOB 3QWRA 2PYFA 4Y9FA 2BP8A 5IBTH 3FT1A 2DH2A 3AUWB 2XICA 2C3XA 2PCPB 4DN4L 3I02B 4WENB 3TO4A 3JWDL 3SKUD 5D6CA 1RK0B 3KEHA 4DKFH 1YEGL 1KWKA 5FOBA 5HHOB 1IGCH 1A1NA 1X6LA 3QXWA 2ZSVA 4XT1C 4ZOBA 5E56A 4RGNE 5FO8A 3GSNA 4XBPA 4EN3A 3RA7L 4WHYG 1WG3A 1C5BH 1S9VB 4UAOC 1TLKA 1XF4B 2OBGA 3KLAB 1AXTL 1GS7A 1DVSA 3SY0B 3E2HC 2NY6B 4WO4D 1LEKA 1O0VA 1CF1A 2BP8B 2NY2B 4DP2X 3FTGB 1JZEA 3KYMB 1PG7W 5EO0A 5C0BD 3QQXA 1TPXB 3V4UL 2BOBA 4XO5A 1ZSDB 5CP3A 1DLHB 1P5VB 3B2UC 2NY1D 3MVSA 4I9WD 4LOFA 4Z6AT 2X1XR 4S1DD 4ONGH 2ZWKA 4P46C 1QHOA 2YMTA 3GKWH 3BMWA 3P30L 3N91A 3CFDA 2K6YA 3ARBD 1JV5A 2P8PB 2WV3A 4OIAA 4PJ6A 4X9BA 5IEHA 5INDB 2IQ9H 2FATL 1KBVA 4L3CA 4ZMXA 3DPBB 4ACTA 2IV9A 2NUPA 3VWJB 3CFEA 3QJZA 4NQVB 3CN0A 3L5JA 5F3HB 3V9CA 3IBOA 5LGHH 4FFZA 3ARDC 4WO4C 1FRGL 1P69B 1ETZA 5J12B 1MHHA 3A22A 4X80H 1WFNA 1U8LA 1FAKT 1H0DB 3MR9A 1KXVA 1D6EA 5TQ0H 3H3PL 3LKOA 2XY1A 5CD5C 4FZ8H 3EG9B 4J3VA 1JBJA 2VKXA 2YAQA 1RUKH 2OMVB 3VYPA 2Y22A 1U4FA 4WU5A 2GUOB 3KGUA 2YPLA 1BZDA 5AVYB 5CLWA 3T8XB 1M6OA 2IF7A 4GBXB 5KVGE 3OXRA 1BXXA 2ZUQC 2H9GB 1P1ZA 2VMDA 4JFOA 3WEOA 4CMHC 3B2VL 1UT9A 4FP8L 5CSGA 1G7PA 2ESVE 2IAAC 1LP9E 3U30B 5ISZB 5L0QC 3HHSA 4TXVB 4Y89A 1JP5A 1CF8L 1UC6A 4XP9L 5IJCC 4K94H 2XN9A 5E1AA 2EDMA 4N9GA 4NOFA 1CBJA 1QSZA 4AE0A 3VDAA 3NCJH 1A7PH 2RAMA 2QR0B 3ZUNC 3PABA 4G80B 4Y1TA 4ECNA 2VZ3A 4LSTL 5F7DB 1YEEL 2G5UA 1LDPH 4LKXA 4AQ1C 5D7JC 5BVPH 1MCWW 4PRNA 2AQ3A 4CVXA 1PDKB 4GINA 1INDL 2YLHA 2H32B 4XNDA 3DMMA 2NTSP 5CFAA 3WSQL 1DQJB 2MPVA 5AZUA 1A7QL 4LU5L 4PJ7A 1UOKA 4YMPA 1OF2A 2R7EA 2XCMC 3PNWB 2ERJC 3VXNB 5K5YA 3EDEA 1SRDA 3RKPA 3W5NA 4MNGA 1Z0MA 2E6PA 3MRQB 4GOSA 4PRDA 1ZT4A 3RWCB 3FQRB 1GYVA 2UX7A 2X4QB 3DSFL 4GY4A 1EERB 3ECBB 4MB1A 2IANA 3L3HA 1CXLA 3P3UA 5E0FA 1PZUB 1QLFA 3OQ3B 1NAKH 3ARVA 3NH7L 4KQ0A 2P5EA 4J3BA 4B9CA 3QDAA 4MKTA 1YEKH 5FUZL 2ID5A 4JZOB 3UAFA 4TUJB 1R5VA 1CURA 5D6CB 1L9MA 4O4YL 4UT9H 4WJ5A 1NCDH 2FJUB 4H1LG 3NACL 1KGXA 3G5VA 3QDME 4RQQB 1DHKA 5C3IA 5HD8C 3S9DB 2R56H 1BAGA 1T03H 1PSKH 4OJAA 1TZ8A 3P40A 3LEVL 4NOBA 5I73C 5F89A 4FNTA 1UKQA 4H20L 3LQAH 2NY7L 2GFBB 2ZXWB 3V8OA 2JKNA 3O6KH 1MN4A 5AOLA 2VDLH 2YPVH 1K2DA 5IFJB 4BQ9A 2EADA 3ME0A 4JPQA 3CSFA 3MBEC 3H1ZA 3GMRB 3TU6A 1NBCA 2HFGL 3QIWC 5EBLB 5F97E 3QG6B 3V4PH 5A2CA 4QHUB 1BREA 3BKMH 4TM9A 3ZHFA 1JYWA 1XF1A 3HC2A 3MDJA 3REVA 1BVZA 3EJZD 4CU7A 3O9WB 5T3ZH 2GTZA 3KLLA 2CLZA 3EYVB 4A2EA 3SYOA 2YO3A 2ZWNA 2ADYA 1E5UI 1BJ8A 3RUGF 5EZJB 3D3VD 2VR9A 2V3DA 5D7SH 2LLNA 1ASQA 1PY0A 4FDWA 4OIIH 2YA1A 4DFHA 5L9DH 3CZFB 4LHUA 2YXMA 2XA8L 5AVSB 4FHKA 1A6UH 4J8QA 4ZXBA 4OZHE 2WQXA 3MRRA 4WFHE 2VN6A 1KEML 2EO9A 2QGDA 5AYUL 1MVUB 1DLHA 2WXNA 2NYYC 2ZF8A 5HHPA 3OX8B 1AP2A 4X8JA 5KYWA 2ENJA 5B7FA 1I8IB 1IJNA 1ZJAA 2LLGA 4YSCA 1CXFA 1T2JA 1VFAB 2X7LA 4PJXB 4OSUL 4AMKH 4Q9QH 2F8VA 4M93C 4YNYA 2H4EA 1M71B 2JSFA 4HIIA 1ES0B 3RTQC 1CPUA 2CKBH 3RWGB 5IJBC 3D39E 4U2ZA 3EHBD 1AY1L 1A1OB 5F1OB 1IAOB 4FQCL 5FA3A 3FZUD 5CJBA 4ZUSB 2EIKB 4M7KH 1AZCA 3D3VB 1VZIA 3R0NA 5F72S 2O61A 1WK0A 5AW3B 1O7SA 1MXGA 4RZCB 4RNRB 5DUPH 2LVEA 5EC2B 2NW3A 2Q3ZA 3KWTA 4HGWA 1ZT7B 3ORJA 4HYTB 3QEQB 1U91A 4WJKB 4Y16B 1M71A 3TEZA 1ULVA 3SQBA 4OM1H 4F8NA 5C7ZA 1UM6L 4W6XB 1O6VA 1OXYA 2OTWB 2WCGA 1HH6B 3T4YB 3G6DL 4N0CC 3UL4A 4AQOA 4RRPA 5CZVL 1ACCA 2NQDA 4WGVB 3VB9A 1D5MA 5ALBH 4RGND 4PRHB 3QNXA 1X3DA 4FTVE 4PJHE 3ZRFC 4ZW5A 4LCYB 2V5TA 4GAJH 2CJUH 3ARGB 1WS7A 2O5ZL 3DXAB 5FOJA 5E8NB 1NANH 2N4IA 3MAWA 4CILA 1KYOK 1S9YA 1MCSA 4L29B 1I7ZB 1UCBH 1TVHA 4EI0A 3SBWC 2OJEA 1QABA 3KGSA 3VD3A 3MRLA 3H2WA 2PXYA 2HG5B 1MCHA 4HXBL 2WUBL 4XN5A 4MMXB 5DMKA 3T2NH 1AO7E 1PJWA 3RGVD 1KELL 1SJVA 3LJ3A 2V8LA 1QA9A 1J0KA 5F96H 4DO6A 2ADIB 1ZIAA 5KTEL 1QNZL 3FC8A 1Y6MR 4LLVB 1W72L 1YUHA 3DUUB 4Z7VB 3CZSA 3F5WB 2F7OA 4BZ1A 1NBYB 4GQPH 5CBEA 3PGDB 2WGXA 4JO4L 5DK0A 3QCUL 4TUKL 3RDTD 3VI3B 4P49A 4G7VL 2VSKB 2KPWA 5MEPA 3EXLA 4BDVB 1ZHKB 4ODUA 1Q8MA 3GO1L 2NDGA 4A2GA 1Z9SB 4FKHA 4G82A 1CGWA 1V7NH 5HYJA 1N0LB 4X6CF 3X11B 3ZRCC 4AXWB 2YA0A 1KGYE 2Q76B 1T6BX 3MBEB 5DJCA 4BZ2A 3KL3A 4DOHB 2WSKA 2WXFA 2KC0A 4K2UH 3H6JA 4MWFA 4O5LH 1E6JH 1FYTA 3FULA 5C3TA 2CWRA 3CXDL 4F80A 4GS7B 5EEUA 1QLFB 5C6PB 2FX7H 1S2EA 1A4JA 4PCKA 2IV8A 2FSEA 3MZGB 5FYLL 1KJVB 5K9OB 5ANME 4DOHE 3FONB 3RDTC 3S98A 2P5WA 3BKCL 4MLIA 3FU0A 3D09A 4EI5C 1UH2A 2WUCL 4OLZH 2F5AH 3FB5A 3MLVH 5C0GB 2X4UB 1J5IA 4NKIL 3ZOAA 1NPNA 4JO2L 4JRYD 3WIIH 1PX8A 3W11D 4QRTA 5ICUA 1TJIL 5DD6B 3PP4L 3W2DH 1SHSA 4FL4B 4DN3L 3DX4A 4XP6L 3VI3E 2UY7A 2ICEC 4FQXD 1X5XA 1BG1A 1FVEA 2WIMA 4ZT1A 5E00A 4CMMA 5DZAA 2GY7B 4N9OB 2ZIDA 2CO7A 5F44A 3ZE1F 1AGBB 1BF2A 3MMEA 4Z7VE 3OVUB 5EDSA 4YHYB 2X0UA 1G7LB 2IBBA 3DURA 3FO2A 1RUMH 4MQ7B 4ZFFB 2MEJB 4UMGA 1UWEL 4RX4A 2LGNA 1H8SA 2BM3A 3QUHA 3DNKA 4YDKH 4JVUA 1F4XH 1MVYA 2X4OB 1OD9A 5FGRA 3VFPB 1R5WA 1TEGA 2Z92B 3HS9A 1OTTC 3WS6A 1A5FH 5IG7B 1MCDA 1HAUA 3RFZA 3DX1A 2X6VA 1FL5B 1U8HA 1Q9LB 1AKPA 2GUOA 3VMPA 2EDLA 4K5OA 2AEQL 5BS0D 2X3CA 1L9TA 4ELMF 4KU1A 4X83A 2TRYA 3QDJA 4OJCA 1MJ8L 2P8PA 1JVKA 2HRGA 1JPSL 3MUY1 4OD1H 4LP5A 4HAKA 3HPJB 1H9DA 4F57L 3VWJD 4N6QA 4NNPH 4XVOA 3QHZL 2XIDA 3AC0A 5IVNA 4XVJL 3VYOA 4B3EA 1NUFA 2CBMA 4EN3C 2R51A 3BX7C 2DQEL 2WVSA 1MFEL 4NC1E 4KJPD 4XP1H 3Q9QA 5CP7B 3T3MF 2J72A 2DF3A 3JXAA 4PGZA 4XNAA 5IMKB 2FH8A 1HHIB 2NY1B 4AQ1B 2EXTA 1CGUA 3F84A 4NJ9H 5FDWB 2LABA 5FYJD 3M1BB 1XCWA 4MZRA 5E6SB 4A7UA 3DWTA 2VXVH 4HDIB 1B88A 3RY5A 4AQ1A 1UB6B 1G9NC 2Z35A 5D7JA 2FQFA 3HG5A 5D1QB 2BMKA 2NY6D 2VLMD 2YD2A 1MCWM 1CXHA 4HEPA 4JZNB 5GHWL 4KQ4H 4RNRA 4ANKA 4G9DA 4UTAL 2GC7C 1NBZB 1ML0A 2EAEA 3VXMD 5C08A 1AFVH 3IGAB 4PLOB 4X4ZA 3ELQA 2H32H 2X10A 2Y1VA 3DTUB 1RJYA 1YG9A 5E8OB 1NCBL 3H6AA 1BM3H 2OMZB 4GXVL 4UINH 5B8CA 5F93C 4BKTC 4L4TE 2VJXA 1Z9OA 5L88L 5CEXA 1INEH 4GBXC 5I0DA 3VXQA 4L9DA 3ZKSD 4EDXB 4YGVB 5GS1B 3QO1B 3B9KD 5H4YA 2G75A 3LB6D 3NFPB 3O3UN 3TLRA 3C5SB 5KOMC 4DGWC 4MXVF 4P9HC 5T5NF 1UXWA 3MJGX 3BUIA 4L4VB 2F1EA 1OF0A 2QMJA 4WUKH 1XIWA 3L6FA 2MCMA 3EFOB 4D7PA 5DEFA 3JTSB 1QHQA 2D73A 3X1GA 1E50A 1NMBL 3WHE1 3VWKD 1QPKA 4FHJA 1IFHH 3R06B 2X3BA 4S0HA 1A7OH 4PYGA 3L08A 1K4DB 3DMMB 1XF2A 2UUDH 1WGVA 4HJ0D 4A68A 1L0YA 2CR6A 1E65A 1MJJB 2DM3A 1SUHA 3DROA 3FL7A 4XPTL 3HZVA 3RIFF 2VDKL 1UASA 5ITBL 1IVLA 4GW1B 3GINA 2WKOF 5ICZB 5SWZE 2OMWB 1CLCA 1Z9PA 2JJSA 2Y4SA 2VXTL 4Q0XH 1T1WB 4ONHB 3CDCA 4IBQA 2AV7B 4MCZB 4X7TA 1EAQA 2X4PB 3D07A 1YY8A 4HT1H 4G7RB 4XPHH 5ESAB 3TBBA 1LO0L 1X5FA 3ILEA 3L4CA 3L1FA 2NX5D 1K2DB 3B1TA 4FE9A 3VGAB 4BSWA 1TCRA 1EA9C 5KYXB 2FJHB 1UATA 1Z66A 4JFXB 4LSSH 4XPBL 1U8IA 3IFNL 4AQEA 5JPMA 4GRWB 2QHRH 4HUWA 4XMTA 2JKWA 4UAOB 3K4DA 2X5PA 3EOAB 4E9YA 4KZEL 5T1KD 4OZHF 1JZGA 4BH7B 1YDPA 4QRFA 2Z8VC 5DUJA 1DUZB 3NCCB 2EYSA 3QWOA 4F7PB 1IBHA 1TJGL 3FUJA 1S3RA 1E8YA 1A6WL 4WK2B 4DN4H 3LQAC 3IS1X 5DD5L 2ICWJ 1U30A 1EXUB 2AP2A 3SKMB 1MDAA 4XXCC 1TXKA 1WBXB 2G0LA 4S11A 1OP9A 2GTQA 1YC8A 2HWZH 1E9QB 3HC0B 3ZQ9A 1B3IA 3WJMA 1QSEE 2QV4A 3BXNA 3TBWB 3AGVA 1AP2B 1MIEH 1KT2B 1GJUA 1VIWA 5E5MB 1YDPB 3AREB 4WI8A 5C8JA 4J8RB 3ULUL 1CN4A 2OQJA 4HPOL 5FW8A 3BDYL 1PEWA 1ZVSA 1HEHC 4OZ4A 4P0DA 1OCWH 5B4MC 1O5DT 3P02A 1KGUA 4S1QL 3HE6A 7TAAA 3VDCA 5C8JB 4HW6A 1LO3H 1WWCA 3B43A 3WAJA 2OMBA 3FCTB 3AMLA 5DMGC 2N0MA 1EHKB 4DEPC 2C3WA 3B3BA 2Z1KA 3FXIC 5IQNA 5C70A 3CIQA 3IGFA 1KPUB 1UT2A 1C12B 2NYKA 5FKAA 4JFFB 1XGUA 1E5CA 1CGYA 1UVQA 3APCA 4MNQE 3L4ZA 2MQ0A 4M6ML 5GRWA 5GQBA 3IJEA 2GPZA 1GGBH 3EO9H 5JNYB 3MRMA 1ZT7A 1KGCE 1YC7A 3QFJA 4GPVA 1JFQL 2WLIB 3RWHB 1KGWA 3N85L 5I5MA 3VGHA 3GRWH 1JZ6A 5BW7A 1KG0B 2TRHA 1SYSB 3GYRA 1BQLL 3HR5A 3QDGB 5B21A 1FFOB 3P11H 2C3HA 1U3HC 2E47A 4XN9A 2GCYA 2A9CA 4D0DA 1EK3A 5ISZA 3SODB 2WNXA 5FCUH 5BZZA 5DD0L 5JXED 2A9NL 4JN2B 4M3JA 1WAEA 3QUXB 2EO7A 4F8TA 3SBWA 1TENA 1C7SA 4MA7L 1HNFA 4AEHH 4B6ZA 1XH0A 4IOSD 4XTRC 1IIIA 1P7QD 3TPUB 4D9LL 4PWIA 2GBVA 3FBKA 3VX0A 2X4NB 1HL5A 4XPFL 1GZPA 2Z93B 4LFHD 3I75A 3PUCA 5D1ZD 1XWVA 3VXQB 1CFMA 3ZQXA 5DRZB 4ETYA 3P3TA 2ZX9A 5MI0B 1HOEA 2DICA 3AFLA 3R7RA 1V7ML 3V52L 5GRZA 2F0CA 4BZ1L 2YAOA 3GSWA 3DDFA 3AM8A 4LSQH 3NK3A 5GGTA 4NZTH 4DESA 2A6JA 3S3DB 3K1KC 5ETUA 2FGWH 2CDFB 4LLVA 1FIGH 4NM8H 4J4PC 2HXAA 3OC8A 4KKCC 4PRPD 3TV8A 3OKMA 5I73B 1LGVA 2AXFB 4EPSA 4X6CE 1JGDB 3MOBL 4WWOA 5C0RL 3HLKA 5IW1B 4U1SA 1NEZG 1S3KL 3EO0B 4EI6B 1NCAL 2Z9TA 4CRPA 3D2TA 1HNGA 1UXMA 5EA0H 3AAZA 1QKZL 2W59A 4NXSA 3QZBA 3MLXL 1L9NA 4GW5B 1A2YB 3T77B 4APXB 1DN0A 5DLLA 1NIBA 1DE4B 4MMZB 1I7TB 4UQ2B 3WMSA 4G5ZL 1ZPUA 4Q4IA 1PQZA 4PB9H 5EO0B 5AB1A 3UIYA 3BWSA 2BP3A 4OH2A 4AEEA 4DCQA 2XDHA 1O75A 4UU9B 1A7QH 2E46A 1JFHA 3ESMA 1UD2A 5I18L 3LIUA 2HRPL 5DCCA 1WH0A 4U7MA 3NZHL 4I9XA 5HDLA 3B34A 3IETA 5C0AD 3NA9L 4XMWA 2YZ8A 4OF6A 1JNHA 5HVHB 3X3FH 2FB4L 3UO1H 2VR3A 3H0TA 1FP5A 2QADC 4YPGA 1WAAA 4IKKA 1R9FA 3B8YA 1CICB 4AJWA 3K72A 1SEQH 3OMIB 4XE0A 3MRBA 5FKPA 2VW6A 3QZWA 3LEYH 3MLYH 3NACH 3WLWD 3U4EA 2V7HA 1IFGA 1FDLL 1QBML 2E27L 4QRQA 3U0PB 3MA7A 1VPOH 5FW6A 2YBGA 4FOMA 4I3SL 2I9LA 5TE4L 5EZOL 4PGDB 1T21B 5FWRA 4YIQA 3IDJB 4ETQA 1AHWA 1I82A 4WKZB 4XN2A 1MFAH 2ILLA 1FZMB 3MA9H 4IS6A 3SJVB 1KZYA 1DVFA 1VERA 3BSHA 5DD6A 5JIPA 3QARA 4PG2C 2XV0A 5ISZE 1OCZB 2ZCHL 2ESVB 1N12A 3LVEA 4QAMB 4AQ8A 3KMDA 1FPTL 1JN6A 4MA3B 1OAYL 2R0KH 3ZRSA 4LVOB 2VMFA 4UILH 1OP3H 4L5FE 2J5LB 5D1XE 1MI5A 2W81C 1L7IH 2ADGA 3DURB 3ZSSA 3QGVA 3FYEB 3F85A 4XMPL 1E9PB 5FV1L 1P2CA 5IESH 2QQNL 4I89A 1IGJA 4OFYA 4IGBC 5T1MB 4IU3A 3K71A 1UZGA 4WEUD 1XB3A 3LQZA 4C56D 1CGSL 1YEDB 5J56B 4LZKA 4W9EC 5DJDA 5K9JL 3LQZB 2XX0A 3CSYA 3WKML 4BWUA 1MREL 5EN2B 3U7YH 3VB8A 4IU2A 2E7CA 3W0WD 3KL5A 2LVCA 2R9HC 3LKQA 4R8WL 2APWA 4YEFA 5C09D 3KPSE 2P47B 2H3KA 1F6LL 3GSXA 4HBCH 3E80A 2FJFA 1FH5H 5CWSB 4PWHA 4XVTL 4HZAA 5LDUA 4HZLB 3MFGB 2V9TA 4NGHL 5J11B 4GBXA 1JNNH 1HE8A 5DMIH 2VMCA 1KBGH 3BPCA 4Y16C 5GS3A 3P69A 5ILTL 4W9FC 3GJFK 1FNLA 2QSVA 2XETA 1ZWIB 3ARFA 5INCA 3E6FA 2W9DH 1Q9KA 4FGMA 4M7ZB 1FSKB 4OI8A 4NCDA 1F4YH 1I1FB 2HVBA 1LE9A 4Y4FD 1OT1A 4MSWA 4DK5A 4M1GH 3AWGA 1ODAA 4KK8C 1TQBB 5HYSG 1UM5L 4IMKA 4DP0X 3W9EA 4L5FH 1BZ7B 4OQTA 1CIUA 2R9HD 3FT4B 3OR7A 2DJUA 2XY2A 3RYMA 4I18C 3I50L 3KLDA 5ITFA 5I1JL 1J1XL 4OW6A 2HTKD 4PJ7B 5ECJE 5IF0B 4QTFA 4G6AD 4GMTH 2ZXCA 2NY4B 2ZT9C 4OZIF 3ZVVA 2X9WA 1XH3B 3MUGA 5LN8A 1FCGA 3GI9H 2C3GA 2P46B 4N2AA 1BZEA 1PZAA 3G6JB 2EYRA 4DVBA 4Z23A 5MENE 2EUWA 3KHOA 3OC5A 4NQCE 4RWYH 4PRNB 1XTLA 4GG6F 2EVJA 2IBZX 5HDQH 5IB5A 1OSYA 1N6UA 5HJ3B 4FQLL 3M8OL 2BWIA 1G4RA 1ET7A 5KJ7E 1A7NL 5IJKC 1R17A 4MMYA 1SY6A 3WTUA 3IDXL 4P48A 4P2RE 4XMXA 1P7BA 2A9MH 1JYXA 1N0LA 3GEWB 1QA9B 3MBWB 2PYFB 2HLEB 1FLTX 2G5BB 3BD4A 4F33A 4FG6C 4H5SA 1QHPA 4X9IA 4CSSA 4Z7QB 3O8XC 3QXDB 5D2LE 1FL6A 1D2OA 2KMWA 4OCLC 1WO2A 1E4XH 5I1CL 1KDJA 2DQDL 4UQ3B 1J05B 1PIFA 3AG3B 4WW2F 2H3NA 2XNAA 3V6BR 2IFFL 3JUYA 1LO2H 2MHAA 3U0PA 3I85A 2J6EH 3CQFA 4XXCA 5FYJH 3Q9PA 4DO4A 5GGVL 1H3WM 1HEJC 3WKPA 3QIUD 5PCYA 1M7IA 3CFTA 2X12A 2VRQA 3D0LB 5D8JH 2DYPA 2ZAIA 4OKVA 1E4XI 3NQIA 1NDMA 4G8GE 1I3RB 4GKSB 3F2LA 3WJJA 3VWKC 1CG9A 1DTUA 4FQIH 5AKSA 4DTGH 5BRZE 3PHSA 2HX7A 4K7PL 5C07B 6FABH 1DSFL 1E3ZA 3ARED 1HXKA 2BP0A 1CUOA 3SJVD 3BPNB 5FOBB 1BGXL 4NYLA 1ACZA 2FEEI 1ZVSB 2AERT 2E9IA 3KPRB 2H2PC 2D7TL 4DKTA 1HU8A 3IPEA 3CVHL 5FWQA 3P4OA 3WIIL 4BFBD 1PLCA 2RQ8A 3KLKA 1LP9F 1HHHA 4LQFL 1BF8A 1TT6A 2AMGA 4PJCA 2QKIB 4TULH 4NERA 4YHIA 5MEOA 4FYQA 5FYLD 3R19A 2DYSB 2IGFL 5EWIH 5GGRY 3KR3L 3UAJD 4Z76B 1A6VL 3LVTA 1IMHC 3VXRE 4E36A 1UT1A 5MEOB 2AJ3B 2B16A 2UV3A 4F1ZA 5IHZB 1MY5A 3ECUA 1SJMA 5GSVA 3GJEA 3QUYA 4HUMB 1U4EA 5LDSA 1QMUA 1HKLH 4GUPB 2QGBA 2D0GA 1PS3A 4MQTB 1CT8B 3UH8A 3ARGA 1TG8A 4PJBA 4YBLB 2A0LC 3DHUA 5C0AB 4ZUVB 1S7SB 1OCOB 3IJHA 4HBQA 4EE2A 1ET5A 1M1SA 2Y2WA 1L6XA 5IJDC 5J13B 3D18B 4XO8A 5LXGH 3P4NA 4Q56A 1Q0XH 1AIFA 3AVEA 5LBSH 5CUSH 2CM5A 4HUXA 1EHAA 5IIEA 1G7HB 2IPKA 4J3OD 4NX0A 2CCLA 4MHHI 3ULSB 4WW2B 4F57H 4QOKB 3UGEA 4TVSa 3CUPA 5GJTL 3AM8C 1Q1JH 1LWJA 3ZKMC 1CFVH 2E9GA 2Y7NA 4F37K 5L0QB 1OGTB 5HVHC 3L5IA 3X13B 4H8WL 4UM8A 4CBZA 2EXSA 1KTJA 2Y1YA 1SBSH 2HFFA 4FP8H 2J88H 4N1CA 2VCOA 3BESR 3BGFB 1RQ5A 1VFOA 5BRQA 4UOZA 4CVXB 1XH2A 4PJFA 4Y4KB 1N4XH 1QOKA 2IFGA 2J57A 4QRSB 1JDCA 5LCVA 1UD8A 4IK6A 4XC3L 1TEFA 2YJLA 1PLGH 3MCYA 3MV01 3F7PC 1JZ2A 3M17B 3PNRB 2AK4A 2VDQB 3FRPB 5F7LB 4K0OA 4UBDC 1DSYA 2UWEB 1X7SA 4N9GB 1T22B 3CK0H 4AK2A 1QACA 5LWYH 5JHBA 3RI5K 1FO0H 3NIDB 1WZ1L 4LSTH 4IRZL 4XB7A 2FT8A 4OZFG 1FYTE 4X98B 2G3MA 5JIHA 2OX5B 2NSXA 2EDYA 2Z4QB 2ZOKB 4UTBH 4CC1A 3PGFL 2RGSA 1RJYB 2XWTB 3CDZB 4QRUA 5TFSH 2AJXH 3BFOA 1T5WA 1Z5LA 1FNFA 2W92A 1I3GL 1U8NA 3L16A 1YHPA 2O5XL 4JQIH 4MRBA 4B7IA 3NIGB 4GRLD 3VAEA 4AGPA 2RJMA 4R7NB 2WOBA 3HUJF 3IMUA 5M7QA 5EU6D 3Q43A 3U1SH 5E2WH 1IGMH 3S5LA 4J2QA 2AXGB 3B9EA 3E7JA 4G6JH 1FZOA 1S7RA 1TTRA 4NQSA 4GO8A 4KV5E 3T8MA 2DKMA 1FIEA 4OGAC 3RJDA 4LARH 3DSFH 3EJSA 4G7YL 5DDHB 2Y9RT 1JK8A 1RJZA 3AADB 2ZOOA 3VFVA 1KFAL 1X4ZA 1QFPA 3QR0A 2VERA 3G08A 4JFFD 2J8UE 4IK7A 4J4PD 3S37H 2CJTA 3AMKA 1LQSR 3LMJL 3U9PH 2AABH 2QSCL 1I8KB 5HYJB 2BRRL 4E41E 2F1AA 4L0ZA 4GG8A 4WEBL 3STZA 3PDGA 2Y3AA 4P2RA 4U0RC 4WJ5B 2R56L 3O11B 4OJEH 3DI3B 6CGTA 2GSGA 1VEMA 3TBWA 1U41A 3FKUS 4B41A 1S7TA 3LKRB 1HL8A 3P0GB 2GBAA 4L4VD 3RWJA 1BXUA 4WDIA 1IEAA 5DGQA 2VOTA 3X1FA 3VTMA 5FGBC 3CFKB 3MLPA 1P1ZB 4PBDA 3H9ZA 1JN6B 4F5CA 5DWPA 3THMH 3JT0A 3ZGHA 4YHLL 3DIVA 1HILA 2HFGH 2X38A 1GCYA 3L4YA 5KSVA 3W11C 3HFMH 4IGBA 1GC1C 2CGZA 2VAAB 3NT0A 3ATFA 3L2LA 3MOQA 4EN3B 1TJGH 2R4RH 1CDUA 3KPSA 5IWLC 3RWJB 4JNXA 5I74C 4HCFA 3EG9A 1KTDB 2EYTB 3EGXA 4AJVA 2CPCA 4EQ3A 2Z0UA 2VL5B 4ORGB 2PN5A 5T1KB 3CVHB 3ARDA 2FJGA 3PAUA 4JFEB 3DOIA 4JDEB 3VXMB 3ZIYA 3T65B 4F92B 3TC9A 1U8KA 4PJEE 5JDJA 2QTEA 5D7SL 1KXVC 5IBTL 5L9DL 3QZMA 1SDDA 1ZSDA 2LHAA 5L4IA 2OW7A 2WIIA 1E5ZA 3RIAF 3O0RL 1KBPA 4FQHB 1F90H 1YEGH 1HSAA 5DMYA 5T5FH 1O9VA