4TSAL

Structure of a lysozyme fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
210
Chain Sequence
VLTQPPSVSGAPGQRVSISCTGRSSNIGAGYDVHWYQQLPGKAPKLLIYGNTNRPSGVPVRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHSYSCQVTHEGSTVEKTVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Structure of a lysozyme FAb complex
rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 39
structure length 210
sequence length 212
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tsaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tsaL01
5INCB 1FPTL 5F1OB 3ARBC 4JFZL 2Q76B 4OLYH 2MKLC 2V7HA 4BUHA 4R4FH 3QO1B 1IGIL 4O02L 1WWAX 1GIGH 3BKYH 3QDHA 3TV3H 3BPCB 1JGLH 4PRAA 1HKLL 1QR1A 2LTQC 1IILE 4HS8H 1EEYA 5CHNB 4AH2B 3IVKA 1P4LA 5HYQA 2GIYA 1NFKA 1RHFA 3F7PC 4KHXL 4U1SA 3AU1A 1IGMH 1DUZA 5I1AB 2EDTA 3BW9B 4POZC 4I0PD 4BZ1L 2K7QA 3P9LA 1ZWIA 4Z7UA 4YNYB 1KN4L 4KTYA 1VENA 4LSUH 3QSKB 4MJIA 4X6CF 2C3VB 1NC2A 4N9OB 4H0HB 1IGJB 3D2UA 3R4DA 3OKMA 2I25N 4H0IA 3O3EA 5EUOF 4RGOH 1I1FB 1DQTA 2CR3A 1UVQA 1MI5E 2G5BA 2YPLD 1PG7H 1QR4A 4JG0L 5I1LA 1ZOXA 1I7RB 3SGEI 2VERN 3SKNA 3VJ6B 4WHCA 3BKMH 2IQAB 4XNUH 5D7JC 1AO7E 5DQ9A 4L8CB 4P48A 5HDLA 3ZE0E 2FX9L 2A6JB 4BKLB 1R0AH 1IEAA 2GFBA 4XPAL 5FUZH 1JF5A 5JW4Q 2CDGA 2HFEB 1NKRA 3RY5A 4PRBA 2Z31A 1YMHB 3RTQC 3FFDB 3SDAD 3V4UL 1CZ8H 4N0RA 3RWFA 1A0QL 1FYTE 2IQ9H 3OR7B 1ZTXH 5IB2A 5GHWL 1OOAA 5HVHB 3QUKB 1Q8MA 4HC1L 4HD9A 3P4MA 1WZ1L 2Y36H 1GZQB 5F9OH 2JE8A 2CKBH 2N7AA 4N0YH 5IMLB 4G6AC 1AJ7H 3C2SA 4L5FL 1DQLL 3IDGB 4H5SB 1WVZA 3O8XB 1MUJA 1HEZB 4KJQD 5FHBH 3UP1A 3OSKA 5F72S 3VXUD 2HKHH 3KR3L 2H2SD 5EN2B 4PB0H 3L5JA 2O61B 3IU4L 5AWNL 1BJMA 3CVHB 2K9UA 1OB1B 1FZMB 2NYYC 2D7QA 4R3SB 3B6SB 3ZYJA 3P4NB 3Q5OA 3QXDB 3IFNL 4PJDB 1E4XH 4LCCB 5D1XA 5AZEL 2VISB 5IF0A 2KZ1B 3BHBA 1J12A 2GJJA 1A1NA 5L88L 5IB5B 1OM3L 3VU2A 1FL3B 5ERWB 3SE8L 1I7UA 2D31B 4LSDA 1LK3H 4Y5VC 5IJVB 4XWOC 3LPGA 5SWZD 2V5SA 4TNWK 1PQZA 4XHQA 4ZUVB 4Z8FH 4OFIA 2X6MA 4X6BA 3S5LA 5K9KA 3FRUA 4HS3A 4ACPA 3MV7A 5ALCH 4EUPG 1LO5B 4K94C 1FL6A 4WTZG 3QQ9C 4MDIB 4GG6F 2W60A 3PWVA 2X41A 4YXHH 4WHYG 4YFEA 5DZNA 4K7PL 5DJAA 1UT9A 1OAQH 5IIEA 1FNSL 2EYSA 1G6RA 2EH7L 1AR1D 2VDOL 2F53D 2VITB 3BGFB 1MI5A 2Z92B 2XZAL 3HAEH 3MRDA 1MCWW 4X80H 1QHOA 3OBAA 4B41A 3K46A 4LKCB 4ONHB 4NRXA 4P2RD 2VLLB 4I3SL 3S3JA 2H8PA 1NBQA 3SE9H 1F3DJ 4KDWA 4Q9BA 3BO8A 43C9B 4N8VG 3R1GL 3BEWA 4NBYB 2FX8L 3GK8H 5ILTH 5HHNA 1NL0H 3MJ7B 5SWSE 2R4RL 2NY3C 5JW3H 3V8OA 1DL7L 3IKCB 3CH1A 1FYTA 1XCTA 2C4FU 2I07B 1JPGB 2VKWA 3UXFA 4K9EC 3PV6B 5A2JH 1DUYB 1ZAGA 5F8RC 1MPAH 4JVWA 2W0PA 3KPPB 1OCWH 1J8HB 3BEVA 2COQA 4U6TA 2OXGA 3HE6A 3ZHLA 5HI5C 4ZO8A 4KK9D 3O2DA 4O4YL 3VGGA 5CJBA 4H0GA 1T4KA 4OFVA 5JHDD 1D5XB 1H5BC 4MS8D 5AAMA 4FFWC 5KS9B 3U30C 4EI5A 1Y6NR 4GAGL 2HFFA 1G1YA 1F90L 1TJIH 5J6HB 1IAMA 1YMME 5T5FH 3UDWC 5KVDL 1AD0B 1IM9D 4G3YL 8FABB 4OF8A 3DX7B 4LVNB 5FO8B 3MA9L 3HZKA 5FK9A 1R3LA 3QCUH 3G6DH 4RQQB 1KT2A 5KSVA 3RWDA 1UJ3C 4ELMF 3IAQA 4U1JA 4DZBB 3QG6B 4PJBE 3UBXG 1BP3B 4PD4J 1FSKB 3MV01 1CXLA 1XF3B 3EDKA 2P8PA 3CZFA 3ES6A 1MCWM 4LHUA 4UU9B 1WTGT 5FECA 3TESA 1TVHA 4DZ8B 8CGTA 5FFLA 4OCXH 1J8KA 3OG4B 4G9FA 2X4QA 3VRJA 5C0GB 2J6EL 1RUAL 4PJFA 1IEBB 5IESH 5C2BL 1O5DT 2BNRD 1I8IA 4F57H 4LVHB 5IG7B 5I15L 5DD1H 1HXMA 2X5PA 1Q72H 5GSVB 5ADPL 3HC3H 2ZZUT 3RUGE 1CLYL 3V0AC 2YD4A 3VFUB 4WI2A 1LGVA 4S10A 2VL5B 2IFGA 4XHJC 4LQFH 4OCRL 2BOCB 4H1LG 1NAMH 4NZRH 5E8DH 2P48B 5J3HC 1BQHA 3KXFE 3TN0B 2IH1A 2MCG1 1M7IA 4PS4L 5F70A 2AK4D 5SWSA 1ZK9A 1IFHH 1ZANL 3BP4B 4P23D 1MFAL 3GSNH 1D5IL 3VE0B 3V52H 4DGYL 4QLRA 4LSTL 1CK0L 2ADGB 2B4CH 4TUJA 4XVJH 2D4DA 3S98A 4OV5A 2W65B 4JGMA 4NUJB 1MFEL 3WIFB 3TVMD 5ICYA 3FT2A 3RNQB 5MP6H 1S7TB 2OJEA 5LBSH 3LKOA 1MRCH 1XGUA 4GSDL 4LAQL 3K8MA 4Q9RL 5JLZB 2C3GA 4B50A 3QUXC 3F8UB 3LKPB 5KVFH 1EHLH 4M7JL 1KLUA 4YHNB 4XVUD 5I66A 3O3BB 1NC4B 1JHTA 4MAUL 3U48A 4XCEA 4JFYB 4J12A 4PJ5B 5IVNA 5DDHB 2DAVA 3DX9A 5HGAA 4JFHD 1QFHA 3QUML 3UTZA 4OSUL 5GIRA 4OZIF 4I77L 3H9YA 2CIIB 3E8UH 5IMMA 5E2VH 3DYOA 3TJEL 5L7XH 2PN5A 4Z7VF 4E9LA 1RMFL 5D5MB 3O2WL 3JV6A 3B3IA 2EICA 3L3HA 4KDVA 4QRSB 5BS0E 3S36X 3GSOA 3HI6H 1AGBB 3S35X 5H35A 1WWWX 2AJYL 1J0ZA 3DVNB 2J8UE 3Q6FA 4KKCD 3SDCD 5JPNB 5L2KD 2EYTA 5FCUH 1UG9A 1R3JB 4PJ7F 5INDA 4JO4H 3QIBB 3UEZA 2NQCA 5FM5O 4H88L 2E7HA 1PLGL 4HUUA 5DGQA 3RGVB 1JPSL 3H2WA 4XBPA 2DIAA 5L6YL 4Y16A 3G5ZA 3P40A 4U31A 1JF6A 1YDPA 2GHWB 1QSFB 3WNOA 4PTTA 3EO0A 1YNTB 3RUGA 2B0SH 4R8WH 2JJUA 2QSCH 3PP4H 3MV8A 1QSZA 4EI6B 3RL1A 1N5YH 2DQCH 4G7VL 2UV3A 4ISVA 2YK1H 5F21B 2YEZB 1DN0B 1Q0XH 3KXFA 2IF7A 1HI6B 3LS5L 3Q0HA 4R4NC 3OAYK 4HKZA 1AKJB 1FDLL 2OR7A 2XTJE 2FR4A 3ZDZE 1ZVSA 2MWCA 4C59B 3FQRB 4GRWB 3SCMB 2EDDA 1HKFA 4OF0A 3S88L 4L29B 1IAIM 3UPCA 1D6EA 1ZGLA 1W72A 5GGQL 1KIRA 3LOWA 1R5WA 3C8KB 4XVTH 5IOPA 1F3JA 4LLMB 4K3JH 4R96A 4KU1A 3U2SB 3O3UN 4CDGC 1YEIL 2JJTC 4NO0A 3AXLB 2CDFB 1V3MA 2MNUA 2R2BB 1MHHA 3NIGE 5EZIH 5DFTA 3DV6B 4QRPE 1Q9KB 5IQ7L 4BYHA 3VH8A 2FJGB 1U8IA 2DLHA 2IANB 4ZODA 2VLJD 3RWGB 1A7QL 5MENB 4RCAA 4M6MH 4YHPB 5EU3A 1NDGB 1X5FA 1WIOA 2APFA 1QKZL 1FLRH 3T77B 1BZ7A 3MLSH 2DMKA 4GUPA 3QHFL 3NCBB 3OWEA 4RMVA 4F7EB 2R2CA 1RIVL 3KLAA 4JO1L 4EDXB 1DQJA 4X6FA 3KYMA 4UDTB 3MRNB 1MJ8H 5DEGA 4X4MA 5K9JH 2EEBA 3PHQB 3O45B 1WBXA 3BPOB 1LE5B 4OKVB 4MQ7A 2J8UA 1I3GL 1WCQA 2NNAA 1AGEA 3KVQA 3MJGX 2F54B 4JG1L 1G7QA 4M1DH 3AB0B 4WDIB 4IRSD 4HZAA 2DLEA 4TN9A 2Q6WB 4JM2C 5BJTA 4JFXB 1ONQB 3E0GA 4QHLA 4MJ6A 4XNZB 1H3PL 5KVMC 2C3XA 4LRIA 1CGSL 2N56A 3FT4A 3ULUD 3SQOL 2EDXA 1A6AB 3RVUC 1HH6B 2QQNH 5GS1A 4LPVA 5F7MC 4KK5C 1NFIA 2CK0H 4ZAKA 3ECBB 3V6FA 2IPTL 4B0MM 5CEXB 4JQIH 1KACB 5IMKA 2E7LA 3MACH 3MLXH 3KPOA 3SO5A 2B1AL 1FCCA 4GKNB 1HYSC 2D0GA 4UINL 4NOBA 5ABDE 4MCZA 2DD8L 1NCCH 5D7SH 4M1CD 3V5DA 1CFSA 3QI9C 1MHEB 3CMOH 4NKDB 5C8JB 4L8BB 4NHUB 4H8WC 2R4SL 4QGYA 1E4KA 4GRLA 4HCRA 3MV9E 1HILB 4OF3A 1GAFH 1P7QB 4FXGB 3PWPE 4WV1A 12E8H 1UA6H 2QQLL 3D39B 3F7RA 5AZ2L 2KL6A 1T80A 4WI8A 3S35L 1D5MB 4DKFH 3ULUF 2VLRA 3U83A 5E24E 4GW4A 4NZUH 3KLSA 3Q3GB 1DQMH 3WN5C 5DMIL 5CZVH 4ZDHB 4KTEH 4XXDA 1A3RH 3BWAB 3BYTA 5DR5H 4Z7OF 3O6FA 3EYUL 3E2HB 4O58L 5M95B 1SM3H 5EWIL 1GC1C 1BD2E 1QSVA 5EU6E 4IOFC 4HGWB 2WWKO 2ICWB 2X70A 4OKDA 2BNQE 1J1PH 3DHMA 4CVZB 4DCQA 1CFNB 2W38A 5C7XH 1UWXK 3ZTNL 2ESVD 3M17A 2Z91A 2PCPB 4HHAB 5BZDA 4I4WA 1QP1A 4XMLL 4GXVH 4V1DD 5TQ0H 1GZPB 3VW3H 2C4FT 4I3RL 4LMQE 5FF6B 1U3YA 1F6FB 2AI0L 5TE7H 5ITBL 4QOKB 2R9HC 3GGWB 5GGVY 3OKLB 4HS6A 5GRJL 3STLB 4ZNEE 5HYSB 4PLJD 1U8OB 5EIIA 2MTPA 3KDMB 1N7ML 3RKDC 2JIXD 1U8JA 2NY6D 3FO2B 1KB5H 1A7PL 3N1QC 3IDXH 2NY4D 5JW5B 5J6GA 1Q0YL 3KWWB 2YKLL 3CPLA 3RDTB 2XZQH 3S36H 1JZ7A 4YDLB 3JVGA 3P4OA 5E8EA 5IJKC 3ARBB 4HT1H 1INDL 3QDGA 2CRIA 5FUCC 2R0LH 3VXRE 5DJ6A 2CLRA 4OFYA 2LTQB 3PWPA 1CS6A 1I7ZB 4L4TA 5T3XH 1MFCH 2X2YA 5HI4C 2EZ0D 1MNUH 3HR5A 1LDSA 3T1FB 4HZLB 4MWFA 4YDIH 4HF5H 2NLJB 2YD6A 4LDEB 5DHYA 1JGVH 3ARDC 4LCIH 3PQYB 1RIHL 4GW1A 2HKFL 1JF1B 3CNKA 2VN4A 4YO0B 2ICWI 2H32B 2YZ1A 5D72H 3TWCH 3MX0A 4PGEB 4PGBA 1D9KC 5DHVH 2GUOB 4FQLH 3NCYP 3FFCD 5EU6A 3W0WE 2K3TA 4PV8A 1O7VA 1F58H 2OJZH 2CRYA 2QJDA 4P99A 2CSPA 2V5TA 3BI9X 4X9BA 3VI4E 2APBA 2EECA 3UX9B 5CZXD 1HHKB 3M1BA 5C0IA 4C4KO 3I2CL 4OM1H 4L4JA 3ZL4L 1W0WB 3HNSL 4OBSA 4DK3A 1RHHB 4D3CH 5F9WC 1TQCC 1AGCA 3U1SL 4UDUA 4KI5E 3CXDL 4OLEA 4KTDL 4MHHI 4ZNEA 1NANH 5D7JB 4FTVE 1CGVA 1VPOL 3GM0A 3MNZA 5TJWK 4LK4A 5EZOH 1HDMB 1JTOA 2J5LC 3QR2A 4XXCA 1BQUA 4KC3B 3HS0A 1L0YA 3DXAE 3RTQB 1MY5A 4F8QA 4HUNB 1DLFH 3I6LE 4D8PB 4DN3H 4GG6B 2PYED 3BVNB 2IH3A 4XPHL 4Y5YC 1T83C 3TA3D 3L3OB 3QFJE 5D1ZC 4KGLA 5FYKU 5EPMA 2A77H 3U7YH 2HLFD 4EXPX 4Z7WB 4IJ3C 1QLRA 4YWGL 2PW2B 2BJML 4JPIA 4MXWH 4JRYE 3ZT5A 3OXRA 5HXMA 1MVUA 2FX7L 3MBXH 1OTSC 1F2QA 3VXRA 5ESAA 1G7LA 5A40E 2ICCA 3BDYH 1FNEB 3BDXA 1U41A 4R26H 3QULA 4YGVA 5FCSH 2JB5L 1DBBL 1DP0A 1G7PB 2YD3A 5DI8A 3HI1B 3REWB 3ZMRA 4HEME 5IFHL 3Q6GL 1CG9A 3OF6A 4TUOA 1EDQA 3ZYIA 1ADQA 1CDHA 2UZYB 3PXHA 1OAKH 1JUFB 5IM7A 2EH8H 3ARRA 5EA0H 4ONOA 3S97C 1MCQA 1XMWA 3C8HA 3AS2A 5CLTA 5CCKH 4Y5VB 4YX2L 4Z78A 1TZGL 1T2XA 3DRTB 4F15C 1J05A 2WIIA 2OZ4A 5BV7H 1KIUA 4ZXBB 5CJOH 4PRID 1W0VA 4ODBD 4ZUSB 2ZUYA 5EU4A 1FO0H 1NJ9B 1S5IL 3DI3B 1PZ5A 4ZS6C 2PTUA 4GAFB 3W0WA 4D0DA 1RVFL 4L9LC 3MO1B 3C60A 4HJ0C 1OD9A 4P4KC 4RDQG 2W92A 1RZJL 3VD7A 2AEIT 2GTZB 3VI3F 1FVDA 3WEXB 1QFWL 2XQBL 2GAZB 4GXUM 5ETUB 3MGTA 2OYPA 5I1CL 1CF8H 2BVQA 5CGMA 1P4BL 3IU3B 1C16A 3CU1A 5AEAA 2VZ3A 5DUPL 4EN3D 4P59L 3U0TB 5TGBB 5D7LE 2VDMH 3IDJB 2H2PC 3UYPA 4ELKA 1KG0B 2JELL 1QLEL 1A7RL 2ZKHH 3DX8B 4P3CH 1AC0A 2XKNA 4RAVA 5GS2D 1L4IA 2EE6A 5D6DC 4ELMB 3OKYA 2NY3B 3DXAA 4L4VB 3R0NA 2VLKE 3FQTA 4U49A 2LV4A 1PKQB 1L6ZA 3WUZA 3SO3B 5LKNA 2VIRA 3L9RA 2UVEA 4G8EB 4NQEB 1GHFH 2CRZA 3QFJA 1PZUB 1FG2B 1ORSB 4NQCE 1KPUB 1NFDF 1XH3B 3HC0A 1MCJA 5FYJD 1J1OH 4MNHA 4TOYH 3D9AH 4JRYA 1A2YA 3JV4B 4UTBL 4Y0GA 1BJ8A 3CD4A 3D3VE 1T6VN 5CUSH 4G5ZH 4MAYD 7CGTA 3JTTA 4G8GB 1RQ5A 5IHZA 4QRUA 5C07D 3KLDA 2OBGA 1QNZH 4RMUA 3QQ3B 3VCLA 2BHUA 4G6MH 1MELA 1GC1L 4W81A 2F5BH 1RUML 2R2HB 4XP4L 5DMJB 3SE4C 1XR9A 1F8TH 3TT3L 5IGXL 3P0GB 4JREB 4X83A 4RZCB 3ZKMC 4ZTPL 1IT9H 4ZTOL 1YEHH 4GBXA 3H9SE 5C0CD 3EYOA 3SQBA 5D2NE 4JFED 4FMFA 4HPYL 3TGXA 1QBLH 3VDCA 1CR9L 1R5VB 1NDMA 3ARED 3V5HB 2HVJA 3B4NA 5E2TL 3C5ZC 3MUZ1 3QUYC 1DSFL 1U93B 2KQNA 2G60H 3FN0L 5FA4B 2DBLH 4JFDB 5DA4A 3V5KA 2EEDA 3QEQE 3I02A 2BVPB 5J1AA 4JJ5A 1LMKA 3NMEA 1ZVHA 1YUHB 1W8NA 4FQCH 1PEWA 4LSVH 4P46C 3AUVA 3DETC 3MXWH 4X9GA 3EOAB 3O6LL 5KOMC 4O5LH 1ZGLM 3WNNA 3ILQC 3LIZL 1EFXB 4JPKL 2YUWA 3L1OL 3O11A 3EOTL 1K2DA 4FQ2L 1FE8L 2AKRA 3IXTB 5KG9A 2NR6C 4JPVH 4LNRA 1MJUL 2Y07H 1I4FB 3V6OE 4CMMB 4F9LC 1MAKA 4EQ3A 3U9UB 5HYSG 2VLKA 1RULL 5D1QC 5TDOB 2FWOA 1HHHB 3T0BA 1ZKAA 3RWEA 3R0MA 1FVEA 4NQCA 2NW3A 3OKEB 2AEQH 4OT1H 3RGHA 2DQFA 3HTLX 5F3BA 2DJUA 3C9NB 2EE2A 4H20H 3GJFK 3BH9A 3AS0A 3OKDA 3SGKA 3GJFA 2I5YL 3D3VA 3LY6A 3QUXB 4N1EA 1BFTA 3T3PF 1J7VR 1TVBB 4KWUA 2EE9A 3NBNA 4TUKL 5CMAB 4OQTA 1HHIB 4PJ8A 1IAOB 3BZ4A 3GUTA 5EBLA 4LLUA 5DJ2A 1F11A 1BF2A 5CS7A 5JW4N 2BVUA 3I6GA 2AQ1A 2ED9A 1DEEA 4OLXL 4OLYL 3FB6A 4PJHB 2CK2A 4KHTL 3MOBH 2FO1A 2FIKB 5E2JA 4JKPL 2QQKL 4ZO6A 3WIHL 2GK0B 5GZND 1YA5A 3L5XL 4XGZA 1YY8B 2X89D 4FN0A 3QEQA 4F7PA 2VC2L 2AXGA 3MYJB 3RWCB 1KCUH 3V2AR 1I3UA 4MVBC 5B22A 2VSDA 1LEKB 5DC0A 2P5WD 3LQMA 3HB3D 5T5NF 1G0YR 5HGBB 4ZNCD 1CDUA 1FFPB 5L8LB 3OKNB 3NFNA 2OLDA 3I9GH 1KJMB 1N0XH 3TP4A 3VMPA 3QH3A 4LLVA 4O9HL 3QJHB 35C8L 1VACA 3MRLA 3V6OA 2VDKL 5I18H 2VXSH 3VXME 3IJSA 4NKOA 3ZE1E 4U2YA 4PGCA 3QWOA 2AXJA 4KROC 3HG1D 5EZJA 3UTTB 1BWMA 4OCSH 2CQVA 3VFMB 3RU8L 2ENSA 1TTGA 1B2WH 5INCA 3BRDA 2Q76A 3UJTH 2FJHA 3VWJC 3WJLA 4FFYH 1J0IA 2DL9A 4RBPH 3QO0B 1FBIH 5MEQB 4MSWB 1F4XH 3BPCA 2BRRL 5C09E 1S9YB 5E6ZA 1LEGB 4PJDE 4OJFH 5CHNA 2A9MH 4YE4L 3IFOB 1JV5B 1CZ8L 4AH2A 5SX5K 3E6HB 5CIPB 2Y36L 3LMJL 3RNKB 4HIIB 5IBTH 2BSRB 5FV2A 5I1AA 2ZSVB 1QEWB 3T0EC 4MJID 3NCYS 4G7YL 2GT9B 3UYOD 1NC2D 1GGBL 1MH5B 2HKHL 5L9DL 3EGSB 2C3VA 3FQWB 2HAZA 3D2UD 1R5IB 1MIML 2H6PB 3FMGL 1IGJA 1YNKL 4UQ2B 1NMBH 4YIQB 5JA9A 2R0WH 4S0SD 5E8OB 1I1FA 1A3LH 4PJCF 2R0KH 3AMKA 5EOQH 1I7RA 3VJ6A 4Z8FL 1NEZG 1SY6H 2BFVH 2A1WH 4M5YH 2DM7A 1FC2D 2IQAA 4HWBA 4AEIH 3EFFB 4XTRD 4L8CA 3P0YL 4RGND 2Z31D 2EC9U 2A6JA 1UCBH 4BKLA 2JKXA 1Z0MA 4DQOL 5BMFL 5LCVL 4JPWL 2HFEA 4Z7UF 1RY7B 3N1GC 1YMHA 3BP5B 5D96C 4S0TD 1ZGLP 1CU4L 3FO0L 2YBRB 1LO2L 3OR7A 1HXYB 1RZIB 4KZEH 3QUKA 4GAJH 4HSQA 3HZYB 3GI9H 2DLTA 1GZQA 4LSSH 5DGRA 4XNYL 3PHOB 5IMLA 1J8HE 4DN4H 3BJ91 2BDNH 3IDGA 4H5SA 3T0AA 2QSTA 2DQHH 3W5MA 3C08L 1HEZA 4AIXA 3BIKA 4R90H 1Q38A 5EN2A 5D1XD 3WN5B 1NL0L 1A3QA 2O61A 4P3DB 4XNXH 3CVHA 1OB1A 1FZMA 1UWEH 4R3SA 3HC4H 3B6SA 3P4NA 3QXDA 3BYYA 4PJDA 5IV2B 4LCCA 2VISA 4NN7B 3ZKNC 3AAZB 1G0XA 5IB5A 1C08B 3EJZD 3K8KA 1FL3A 3DV4B 3DWTA 5ERWA 2GY5A 4Q58C 5KANG 2D31A 3TO4C 5IJVA 4YHZH 5GS2H 1RJCA 3AFLA 3SGDI 3MV7D 1LWRA 1M71A 1OCWL 4H25B 4XBEL 5D7IF 4DVBB 1KEGL 2XWBB 3DUSB 1LO5A 4HWEH 4MDIA 3W81A 1CGUA 5I1KH 1PDKA 3MLPA 4KQ3L 4P2OC 5EO9B 4BJLA 3TM6A 1E4WL 1FIGL 5EOCJ 1L7IL 1NGWB 1MI5D 1X5YA 2OXHA 3O81A 4LPUA 3ISWA 4WUUB 2NY0B 3ZDYE 3RQ3A 2VITA 4Q6YA 4ODSH 4HGMA 4WWID 3RZCA 2GW5A 2R29H 3V8CA 4LKCA 3WO3B 4FQJL 4ONHA 3X3FL 2FCBA 2D7PA 2HTLC 3CFCL 2VLLA 3HA0A 3UJIL 3WFHB 43C9A 4MNGB 4YXKL 2ZP0T 4IEFB 3EYSL 5DUMH 1I3RB 1U0QA 3MJ7A 3W9EB 5CEYB 1FYTD 1I7TB 2A6IB 1OAUH 2C3HA 1H15A 3IKCA 5A2IH 1IAIL 3EFDH 3CDGB 1K3ZA 1JPGA 4F57L 3GNML 1IGCL 1WISA 5T3ZE 3PJSB 3PV6A 4X8JB 1L9NA 1DUYA 1JTTA 3GHBL 3B9VA 3HE6D 4PRHB 3O6KH 2WSKA 1KCLA 3KPPA 1J8HA 3NFSH 1SYSB 3L3DB 5I1GH 5FB8B 3A67L 3TBSB 1NAML 4LLDA 4WEBH 1T0NB 1ZSDA 4EI5D 5DYOB 1XF4B 1G84A 1D5XA 3ARDB 3STZB 5KS9A 5JO5B 1NAKH 2VLME 4UT7L 1OSPH 2RFXB 1UWGL 4HUKB 5J6HA 4HIHB 4PJIB 1AD0A 4RAHA 8FABA 3D69B 3DX7A 1D9KB 4M7LT 5FO8A 2R1YB 1DZBA 4RQQA 3NCEB 2CPCA 3T2NL 3WS3B 4GLRH 3VFNB 5J06A 3BE1L 1X5ZA 4JN1H 3QG6A 4YK4C 4DZBA 5KVFL 4LOUD 3MV11 1VFMA 4M5ZL 4E0RA 2YA0A 4LHUD 4KKLC 3VFPB 1WUNT 2AJXH 1XF3A 4G9FD 1SJHB 4UU9A 1T22B 4DZ8A 3MRMB 1WZMA 3E1F1 4TNVK 5F9WB 2M2DA 1TQCB 1MAMH 3CU7A 2VDPL 2ZCLL 5C0GA 5IKCB 4GAYB 4BQ9A 1IEBA 5CSZB 3ZKSD 1MCNA 1ZXQA 3QCTL 5IG7A 2WBJC 3HMWH 2HFGH 1YQVH 1QSFE 5GSVA 2J5LB 5DFVC 3VFUA 2UWEB 2Q87A 3U4BL 4ODVL 2VL5A 3S7GA 3T4AB 4N0UB 1EEZB 1I1YB 4XRCB 4MMXC 2APXA 2EE3A 5SWSD 3DNKA 4ZO7A 1I8LC 4Y5YB 3TF7C 1KXVC 4JANB 1F13A 5I1EH 4GRWE 3BP4A 5ID0B 4IJ3B 3CAFA 3VE0A 2ADGA 5JZ7D 1FG9C 5HGHB 2BZDA 2DTML 3SPVB 3GMMB 2ORBL 4P23C 5BVJB 4WGVB 2W65A 4FQIH 4APQC 4NUJA 3WIFA 4PJFF 1S7TA 2HLAB 3PP4L 4FP8L 2I24N 1V7NH 2WUBH 3MRJB 2FEDC 5TE6H 5JLZA 4PG9B 4Y19B 3LKPA 1Q0XL 4YHNA 3O3BA 1NC4A 1UJTA 3FRPA 1RU9H 5DT1H 2IANE 1UZ6F 5MENE 4PJ5A 5DDHA 1S7RB 5L0QC 1U92B 4MJ4A 4JGUA 2WMPA 4F15B 2D7MA 5BVPL 4EOWL 5GRUL 3TNNB 2PXYA 5DLML 3QQ4B 1OTUC 3ZO0A 1KEMH 5D5MA 4OIBA 4QRSA 1C5CL 2VAAB 4Z7QF 4L9LB 1H3UA 1AGBA 1F3DH 2V17H 4Z0BH 4P4KB 1DQQB 3F65A 3DVNA 5F96L 3PNWB 4O2EB 5JPNA 2F54E 4MNQB 1SJEB 6FABL 1ZMYA 3KPNB 3RI5K 3QDJB 1R3JA 4F7MA 2CKBB 3MUJA 1T89A 4I2XB 3QIBA 3ARFC 4M6ML 4KKCC 3SDCC 4O2CB 1FLRL 1WF5A 4Y16D 3RGVA 1CDJA 3MRPA 1BLNB 2JJSA 1MFDH 1HHJB 1YYLH 2WK2A 4POYA 3PIQB 3OR6B 2QHRL 2R15A 4JZOB 2Y06L 3MV8D 5CJQL 1QSFA 1YNTA 5FKAB 3VA6A 1VGKA 2VDQL 3RVTD 3MMEB 1R3IL 3KXFD 4EI6A 4C57C 1BVKB 5B21A 5EORL 4XI5C 2YEZA 1DN0A 1T7YA 2G9HB 1HI6A 1B0GA 5BV7C 3H42L 3FQRA 4RFOL 2PF6A 2XPGB 2P46B 3SCMA 3VGFA 4KMTL 2B1HL 2DLGA 3UC0L 4L29A 1OGAE 1LE9B 2QQNL 4JFOB 5IHUH 3A6OA 4IDJH 3C8KA 5JXEC 2DOCA 4OTXH 1U91A 4NO0D 4LLMA 4OUUB 3MCLL 3U2SA 4J4PD 4OGXL 1QOKA 4XP6L 4F9PC 3AXLA 2CDFA 2AJVH 2OR8A 4HC1A 2R2BA 3NGBB 4ZD3H 1EO8H 3HAEB 4BH8B 3DV6A 1EZVX 1Q9KA 4NOFA 2FJGA 2IANA 5C6TH 3RWGA 5MENA 1NDGA 1AI1H 3T77A 5D7SL 1B4JL 1J86A 5C0NC 3GI8L 5IFAH 1TJHH 4OLWH 2F5AH 1CL7L 2X9YA 3GBMH 3K1DA 2F9BT 4NM8H 3KLHC 2AJSL 4EDXA 3DI2B 3ROOB 3VMNA 5LGJB 5LXGH 4UDTA 1LDPH 4AZ8A 3MRNA 3HLAB 2EKSB 4RMSA 12E8L 2AS5M 2AJUL 1UYWH 4YDKL 3PHQA 1BQLH 4R9HA 3BESR 3O45A 3KNBB 1LE5A 1GOFA 4OKVA 3L5HA 2MPAL 3P11H 5DWUL 4ETYA 3TIEB 4KRPD 2F54A 2EC9T 3OAZK 1G9MH 1QVOB 4WDIA 5IB3B 3F6LA 4DK6A 2EDKA 3HNVH 1ONQA 4P46B 5GISH 4GT7A 3C5SB 1E4XI 1L0XA 3FOMB 4X4ZA 4HMEA 2ICEB 5SV4A 4KJYB 4R0LB 4ZAKD 5E2UH 4CVUA 2J8OA 3GKWH 2B39A 1HH6A 4HH9B 4QOKE 5CILH 1SM3L 3ECBA 1C7SA 2CO7B 4P0DA 3LS4H 5CEXA 5EO1B 5B38G 5FYKL 2RHEA 2FBJH 3O2DL 1NGYB 4XCNB 2CGRH 2DQEH 4ODUB 1FNHA 5IBUB 2XTJD 3H3PL 3MJ9L 4JRXA 3T4YB 4X6CE 3NN8B 4UV4L 4GKNA 2OTWB 1ZT1B 5DD0L 2I60L 1BEYH 1MCKA 2X05A 2NXYD 3GSUA 3SDYH 3EO9H 3O4LB 4MA1C 1MHEA 5EUOE 4GRLD 1P1ZB 4NKDA 4U1HB 1ZHBB 5C8JA 4L8BA 4NHUA 5EBWB 4M1CC 1HILA 3IF1B 1P7QA 4FXGA 5JMOC 2VLRD 3D39A 4NRYB 5C6WH 1D5MA 4UIMB 1HWHB 3WHXB 5MEOB 2UYLB 4KY1H 3Q3GA 4B7IA 3C2AH 1MEXH 1HIMH 1H8OA 3ARWA 3PQYE 3EYVB 4XAKE 3PGFL 4ZDHA 3MLVL 1NAMB 4ERSL 4KKAD 3OJDA 3O6FD 3NABL 5LQBL 3EJYC 3BWAA 3A6CH 1YNLL 1A14L 1CT8B 2R0LL 2Z8RA 3PGCB 1K4DB 1XGYL 3MGAA 2Q3AA 1NBVL 4NGHH 1N3NB 1G7IB 2X4OB 3GSNB 4HKJB 4ODHL 2O93L 1U36A 3TCXA 5T3XL 2F58H 4QXGH 4HGWA 2J88H 1YY9D 3WSQH 2NXZD 3C87A 2C26A 4WO4B 2ICWA 2V2XB 1MNUL 4HEPG 2IPKB 5T33L 1CFNA 2R69H 1JGVL 4LCIL 4F80A 4XWGH 2PCPA 1AR2A 2VUOA 1E28B 3NIGF 4HHAA 1N59B 5F7NC 1GZPA 5D4QA 1X5XA 2VABB 5FYLL 5HHOA 1D6VH 5FF6A 5LGHH 3GGWA 3OKLA 4L8DA 3STLA 5HYSA 1VDGA 2V2TB 1U8OA 5HHQB 5FGBA 1A1OB 3LPWA 2IBGA 3RVXD 3FO2A 4PLJC 3B9DA 7FABH 4KROB 3KWWA 1A7OH 1U8QB 3PXJA 4GG6E 4AENB 4XT1C 3SE3A 3RDTA 1FGNH 1JFQH 1LO3H 3QDGD 1KBGH 4YFLI 3SJVB 4IRZL 2ZUVA 4A6YL 4RA3A 3ARBA 2W9EL 3VWJB 4OFYD 1J5OL 2DRUA 3PWPD 3G6AB 4L4TD 4PJCB 1T66D 4HK0B 5EZOL 4LKXB 1I7ZA 3FO9B 5E03A 3WMSA 4N5UA 2FLBT 1JGUH 4UB0L 3X3GH 2LU7A 5K9QG 4X7FC 4HLZG 3EO1B 2NLJA 4X4XB 5SWZE 2E7MA 2E6QA 2X4PB 1M4KA 3IS0X 2I26N 1CE6B 4BFIB 1VB9A 3U7YL 3IB4A 4ZOBA 1JF1A 1SVZA 4DAGL 4NJAL 3MRHB 3NAAL 5ELIA 3H9HB 1C1EL 4YO0A 5E0QA 3T0EB 1X6NA 2M26A 2DTSA 5CP7B 5EU6D 1RZ7L 4PGEA 3KPMB 2GUOA 3IGAB 3B2UC 4S1QL 4QHUB 4KZDL 4KK6C 4M7LL 4NCC2 4PJEA 5JNYB 1N64H 1BBJA 1SEQL 1H3XA 1HHKA 4Y4FC 1W0WA 1NH6A 1HYRC 3D6GA 1RHHA 3QJFB 1L0QA 1WAAA 5CZXC 4C56B 5AYUH 1D3CA 1Y18B 3QRGL 1SMOA 3IFLH 5BV7L 1J0HA 2DI8A 1CFVL 4R2GC 5D7JA 1S78D 3ULVF 3ULSB 4OM0H 3V6ZB 1BGXH 2XA8L 1BAFH 1HDMA 5IB2B 5E6YA 5IVXB 3OXSB 5I9QC 4Z7NE 2BXYA 5D7IB 4S1DD 4ELME 4L4VE 3RTQA 1ZEAL 3UZEA 3VGAC 1PKQE 4D8PA 4GG6A 3BVNA 1G6VK 3L3OA 4PY8J 1PKOA 3LDBC 5JOEA 4LAJH 4Z7WA 2E27H 4KJPD 2PW2A 1TLKA 1SVCP 1IZJA 3V7MA 3JWOC 4XCYB 3VXRD 1MJ7H 5JQ6L 1S7VB 3B9KC 1NCAH 3TA3C 2FGZA 2VDML 2P43B 5JHDE 3SY0B 3IKKA 5DJXA 4EEEA 2ZKHL 4UT9L 3OF6D 4LBEB 1FNEA 3O3DB 4G8GE 1IQWL 1G7PA 3REWA 3HI1A 2LVCA 3VGEA 3WFZA 1E6JH 1JMZA 4U6VL 1JUFA 3GZKA 2DLFH 4IM8A 1WWBX 5TE4L 4B7LA 4N8CH 2W9LA 4Y5VA 5I74C 3TO4B 1RFDH 3KAAA 4CU6A 3DRTA 3KJ6L 3W0WD 3VFGL 5CUSL 3C60D 3OAYH 4G5ZL 4I8DA 1FZOB 1A7NL 1NJ9A 5EU7E 3BKCH 1DBKH 3MO1A 1QNZL 4KXZI 4P2OB 2XN9B 2ED7A 4G6ML 4JFDE 4K2UH 1QYGH 1FH5H 1OL0A 1D5ZB 2ZCKL 1W72H 5IFJB 3LZFH 2BNRE 1P2CB 2GTZA 1A1MA 1G7JB 2BC4B 3WEXA 1MY7A 2GAZA 5LWYH 1XCQB 5F88B 3GFUA 1IT9L 4OD1H 3IU3A 2GCYB 5F6HI 4KI5D 4YHML 3MRKB 2Q20A 5J1TC 4OZIE 5D70L 3QZWB 4FTVD 1INEL 5EBGA 3U0TA 5TGBA 3EZJB 3IDJA 1BM3L 3KGRA 4HCRL 4P2QB 4Z7VE 1KG0A 3MLUL 2P49B 3RRQA 5D93C 3VRLF 4EN3C 3DX8A 4NUGL 5H94B 3DXAD 5BW7C 2NY1C 1FRGH 2DBLL 2P5EB 1MCHA 2R0ZL 2YD7A 3VFSA 3I6LD 4U1IB 1YYMH 4ELMA 4L4VA 3QFJD 4U7KA 3ZDXF 1PKQA 1JZ4A 4GH7B 1VGEL 1HHGB 1S9XB 4G8EA 4NQEA 4XNQB 4JRYD 1FG2A 1ORSA 3RIAF 1EMTL 1KPUA 5B4MC 4ZQKB 5IBUG 1RI8A 1XH3A 4RRPG 2ATPB 1HINL 4MA7L 3JV4A 1SJVA 5FM8A 2XKUA 3Q1SL 2CDEB 4XX1G 4KI5F 4LCUB 4G8GA 1LILA 1RK0B 1M7DA 1DDHB 3QQ3A 3KPRB 5ACLA 1KELH 3ARGC 5JUEH 2EDYA 4NO2B 1NGZB 3W2DH 2R2HA 5T5NG 4AK1A 1TITA 5DQDH 3RWDB 4ZPVB 3UDWA 1KC5L 4RZCA 4OGYH 1PSKL 4ETQB 5IEHB 4B5EA 2Z8SA 4AEHH 3CLEH 5L2KE 5CWSB 5CD5C 4PJHE 4OLZH 4WFHD 1R5VA 2HA1A 3BUYB 4K23L 4YK4B 3V5HA 1EGJA 1FP5A 4PJFB 3HI5L 4YHKH 1U93A 4YHOL 5FA4A 4JFDA 4DUXA 1HZHL 1TETL 1HQ4B 4GMTH 2HH0H 1BJ1J 2BVPA 4XZUB 5E99L 5IP4A 5C08B 3B8YA 4NQTA 1YUHA 4N1HB 1YJDL 5GRZA 2WBJB 2V6HA 2YWZA 3EOAA 3G5VB 5JOFB 4LP5A 1VFBA 1EFXA 2Y4SA 4CU7A 1H8NA 3MOBL 3UYRH 3VXSB 1GGCL 3WUWB 2OK0H 3IXTA 5K9OB 4TULH 2UZIL 4HUVB 1QSEB 2VLKD 5J8OA 2AEPL 1UH4A 4CMMA 3W11C 3U9UA 4X7SL 5DHVB 5TDOA 4KUZH 1HHHA 2OJEB 4NQCD 2HRLA 4OZFH 3HE7B 1XGUB 4MZ2A 2BY0A 3UTTE 3BOVA 4IIQC 3ULVL 1XAUA 4OLUL 4KPHL 4P23B 3OKEA 4APQB 1ZLSL 5JXAH 1DBAH 2O5ZH 1UXWB 4K07A 4QTHB 4OQ1A 1IKFH 3C9NA 3D3VD 5GGRA 4N5ED 4I1NB 4WVRA 1UWXH 2VLJE 3QUXA 3WDIA 3W39B 2Q7NA 1TVBA 4AJ0A 1K4CB 4PJ8D 4A6YB 1J18A 3K4ZA 1F6LL 1WWCA 5CMAA 3D85D 3B3IB 1HHIA 4MCYB 5F93C 5L0QB 1IAOA 4NKMA 3HMXA 3PWNB 5IK3B 5DMGD 1CXIA 5DJDB 1DVFC 3FQUB 5HHPB 1S9VB 3QWRA 5E5MB 3UJTL 1DEDA 4FFYL 1ES0A 5DVOA 2JTDA 1XZ0B 4PJHA 1KENH 2Y7QB 4HIEB 2FIKA 3OB8A 3QA3B 4HFUH 4JY5H 3THMH 2GK0A 1YY8A 3QEQD 1HSBB 3ARFB 4M61B 1FVCB 4XP5H 1YDPB 5ICZB 1U2CA 2A9ML 2HYMA 3MYJA 3RWCA 4JQXA 3MA7B 1PY9A 4MGXA 5F7KC 1LEKA 1D7FA 1U8HB 1FAIL 4LASL 1QFUH 2PO6B 4HAFA 1E6OL 5HGBA 2GSGB 1PVHA 1FFPA 3OKNA 1NGQL 3I50H 4NHCH 1KJMA 3PP3K 5KVGH 4RNRA 2VYRE 2JB6B 4KV5F 2YD1A 3E6FB 5DS8B 5GGSB 3JWOL 2KZWA 4DGVH 4K7FB 1T1XB 3DPBA 5L2JB 5I30H 1ZGLB 3FL7A 5HD8D 3QJHA 5I76B 1M1SA 5FA3B 5BV7B 5IOPB 3Q2CA 4UIKH 5KTEL 1NPUA 2VXTL 3RY4A 4LARL 4P3WA 2DLIA 3QXWA 5DEZA 3W9DB 5FUOL 1EH9A 3QG7H 3UTTA 1A3LL 3FN3A 3VFMA 5KZCB 5EOQL 3MLRH 4WU7B 2BRQA 4UOJA 5C9JB 4FZ8H 1SJXA 3B8SA 2A1WL 4M5YL 2YRLA 2JJTA 3OV6A 4FS0A 5GRXG 2C5DC 2CJUH 4LSQL 1H0DB 1UH2A 3QO0A 4GUPB 4NWTH 1NANI 5MEQA 4MSWA 4N9GB 5T1KB 3S37L 1NLDH 5B8CC 1S9YA 4DVRL 1JNJA 4XAWH 1LEGA 1XGPB 15C8H 4FZEL 4P9HH 4O00A 4FFZH 3IFOA 1JV5A 1UACL 3E6HA 5CIPA 1MREL 1NCWH 1S7XB 1MCDA 4GAJL 5IBLD 2VJXA 2FIRT 3UJJH 1BQSA 3RNKA 4LSSL 4HIIA 4AMKH 4LU5H 2DJSA 1P4IH 3FAXA 2NY2B 1QFOA 4XC3H 1DCLA 2ESVE 2ZSVA 3MUGB 2IBBA 2IEPA 1QEWA 4MDJB 5ALBL 3VG0L 4E41B 1XF2B 2GT9A 2YZ8A 1MH5A 3EGSA 3TBVB 1U6AL 1N6QL 3QDMB 3L3KB 5GS1B 1NFIB 4HFWB 3U36B 3FQWA 3V6FB 2IAMC 3IDIB 2DQIH 2H6PA 1UXSB 4UQ2A 4NO5A 1MF2H 4YIQA 4WUUE 5F1IA 5E8OA 2D03H 4ZFGL 3QXAB 3UMTA 1ADQH 4YHZL 2DQJL 3F58H 2JCCB 5GS0D 4GKZB 1A7BA 4WWKB 2WZPD 4D0CA 4WW1B 3CSPA 3V5DB 1RJLA 1DFBL 2O5YH 4LCWB 5D6CB 1NCBL 5SWQB 1QG3A 4MNGE 3WKML 5I1KL 3GO1L 4NZJA 3QZWG 5TDNB 1JTPA 1WGOA 1MFBH 1Z3GL 2OZ4H 4M62H 3ZKQD 1CGTA 1IC4L 3BP5A 3O0RL 3KPQB 4WHDA 4RGNC 2Q8AL 5KVEL 5C0BB 4MB4A 3OPZL 1WBYB 2YBRA 4MA1B 1YC8A 5L8JB 1OARL 1HXYA 1RZIA 3IDNB 4I3GA 3HZYA 3FOLB 4YJZL 4UBDC 3LQAL 4K7PY 2YWYA 2X42A 2ZOLB 3PHOA 1G9MC 3O8XD 1REIA 3MLWL 3B5HA 1ZA6B 2WNGA 4P5MB 1ZLVK 4D9QE 3WN5A 1M7XA 2ZCHH 5DUML 2GJZB 3BDBA 1GGIH 4DGIL 5IV2A 2HVKB 3FQXB 1OAUL 4M4PA 4DUVA 2DB8A 4JM4H 3AAZA 2YPKA 3FFCE 1JWMB 2ZPKH 3GMOB 5DO2D 1C08A 4PJIE 5CINH 3DV4A 3U0PB 1JNLH 1N0LA 3ZE1F 2IJ0C 3M17B 3CSBA 1CBVL 1JZ6A 3P0VL 3NIDE 4I4WB 4M7KH 3BMVA 4EVNB 4W6WB 4DVBA 4WEBL 2XWBA 3DUSA 1TIUA 4ORZC 1IGYB 3CK0H 5EO9A 1NCTA 2UVFA 4PBXA 3B5GA 4HXBL 2UUDH 4RFEA 1XIWB 1NGWA 3PDOB 5F97E 3UTSB 4WUUA 1YN7B 5F7EL 4OI8A 3K81A 4PJDF 3GBNH 1NBYB 4V1DB 3IDYC 5J6GB 2J4WH 4NZTH 4DTGH 4JHAL 3CPLB 1XF1A 1DTUA 2FLRT 4N0UE 3ZSSA 3JWDH 4EUPH 3WFHA 2DKUA 4MD0B 2Q8BL 1KJ2A 4OIIH 4MNGA 5I8KL 1TCRB 1A9EB 3CFKB 3N9GL 4U1MB 1I3RA 4PIRF 3W9EA 4J2XA 1ORQB 4W70A 5CEYA 1I7TA 2A6IA 3D18A 4WHYH 5IJKA 3VI3E 3RPKA 5ESVB 2YD5A 3CDGA 3BPNB 1JHLH 4OCMC 1RUQH 4OD2B 1F6AB 1F4WH 4X8JA 1J8HD 5FDWB 4PG2C 4PRHA 1B90A 5D71H 3B9EA 3L3DA 3ZSTA 4DFHA 5FB8A 2MQ3A 3TBSA 3IJYA 5EFIB 2ITDB 3TC9A 3WFBH 4Y19E 1T0NA 4BQ6A 4NPYB 5DYOA 2O5XH 1XF4A 3O9WB 3ARDA 1GH7A 3LHPH 3STZA 2G5RA 4YLQT 5JO5A 1RIUH 2RFXA 4PRIE 3MBEC 2JJVA 4M02A 3NCMA 4HIHA 1KSRA 2OQJB 2Z0BA 3CVIL 4GRMB 4PJIA 3JV0A 3D69A 1D9KA 2E7CA 1J87A 4LLYA 5FIEA 1UQSB 2R1YA 1NFDE 3X11B 1K5NB 1MRFH 2ZUQC 1SMAA 3FHAA 1KCRH 4U33A 1S3KH 1I9RH 3WS3A 2WUBL 4Y8AA 1GYAA 5TE6L 5E08L 5IEKB 3UROR 1U8PB 2LAAA 3QDJE 5MI0B 3PF2A 4MA8L 2A6DB 3VFPA 4Y4FB 3DGCR 2DDQL 3EUUA 3T08A 1SJHA 3MNZB 1T22A 4LOUC 3MRMA 3UZQA 2A0LC 4K3EL 3MGOB 2K7PA 5KS9F 4JRWA 5IKCA 2MCPL 3AM8C 4GAYA 2DQDH 4R2GB 4S1RH 5CSZA 1FYHB 1B0RB 4OQTH 4WCYL 4QEGA 4JDVB 5BZWB 2VKXA 2NY7L 4HPOH 2YPVH 2AABH 2CKNA 3FZUD 2UWEA 5I9QB 3B2VL 4JO3L 5DEFB 3TN0D 1T2QH 4N0UA 1EEZA 1I1YA 1WT5C 4XRCA 3D48R 3VRIB 3BZFB 2P4AB 3TT1H 4JDTL 4Y5YA 1T83A 2QKIB 4UT6H 2FATH 5D1ZA 2DM4A 1IGFH 3MRQB 4JANA 5KJRH 3LDBB 3K2UL 4YXLL 4P9ML 5ID0A 4XPTH 1KF9B 2B2XH 1EAJA 3B9KB 3DSFH 3HPLB 2D0FA 4S1SH 3TA3B 3WXVL 1CLOH 2NMSA 5HGHA 1CE1H 3TYFB 4PUBH 3GMMA 3SPVA 3CFJB 3AY4C 3TYGL 3UTOA 5J56B 1FORL 5BVJA 4G8IB 3ALXA 4I48B 3MCKB 1IMHC 1CFTB 1FLTX 4PB9L 4KVCH 4TNVF 2HLAA 5GGTH 1P69B 3QHZL 3MRJA 1NC4D 1KJVB 4H1LH 2MSPA 5HYFA 2DQTH 4PG9A 4WW2C 4PJ5D 4Y19A 3HUJB 4YQXH 2VLMD 3VH8G 3RVWD 3ARVA 5EOCH 3RZWA 1KCSL 4JFEE 5I74B 3ZE2F 4L9DA 1S7RA 1U92A 2YXMA 3HZMA 1QBML 3TNNA 3HNTH 1RAMA 3QQ4A 3NTCH 1J0YA 3RWIB 4C83B 3RBGA 1H9VA 2GY7B 2VAAA 4L9LA 3QIUB 4P4KA 1DQQA 1MWAH 5I8OH 3QIBD 3PNWA 4ZD3L 3S3SA 4O2EA 2AV7B 1EO8L 3T3PE 4MNQA 1IKNC 1M05B 1SJEA 3KPNA 3QDJA 1U3ZA 3OHXB 2CKBA 4I2XA 3SOBH 2R56H 3RGVD 2P8MA 4M1GL 1QHPA 4O2CA 4OD3L 1W0YT 2DQUH 1LHZA 1AI1L 32C2B 1Z9MA 2RIKA 3C09C 5H37G 1BLNA 2F5AL 1I9IH 1HHJA 3QEUB 1QSFD 5ACMA 1EHAA 2RAMA 3MRCB 1IC5H 2BMKB 3OR6A 3BSZL 4I0KA 1HH9A 5D93B 4YDJA 1WK0A 4ZUWB 1IQDB 1KCKA 2WQRA 3MNVB 5FKAA 2NY1B 4Y2DC 1BQLL 3BAEH 3MMEA 3KPSB 3ZYOA 4WFEE 5D5MF 4LEOB 5D6DA 5SX5H 1BVKA 1AKJD 2C3WA 1OTTD 4BFBD 1G9ML 2FD6L 1UM6L 1TNNA 2G9HA 4QRRB 4KKBD 3SCMD 2CO6B 5IVZA 1AXTH 5A43C 5JDJA 1EERB 3PL6B 2XPGA 4XX1E 2OP4H 5C0RL 5I73C 2IBZY 4K55A 5CJXC 3JSSA 2IFFL 2QADC 1LE9A 3QXVA 5IW1B 5JTWA 3DJ9A 3GRWL 5CILL 4KAQL 1NMAH 4OUUA 2ZUUA 5IQ9B 3WIIH 4ZG1A 4PJAB 3ARGB 5K93A 4HBCL 3WFEL 4PRPB 4GBXB 2IAND 4JR9H 3SE4A 5MEND 3HAEA 4BH8A 2YUXA 4BSWA 4J4PC 3UTPD 1ZT7B 4GQ9L 2BVEA 1UEMA 2A74B 5I71B 1GGTA 4RMQA 5IW6B 1AP2B 2M8XA 5GS0H 2EIZB 1K8DB 5MEPB 2Z35B 3H7BB 3J7HA 4Q9CA 1LP9F 3ROOA 5J1AB 5LGJA 2C7UB 5JW4R 3N1MC 5CGYD 1MCIA 3HLAA 5GJSH 5T1LB 2EKSA 3VD9A 1EIBA 4ODWB 2F54D 4W4OC 3GMNB 1EHNA 1KTDB 3KNBA 1PBYA 3TIEA 4Q2ZB 5HPMB 1QVOA 4NN6C 2XKSA 5IB3A 1HIML 3RA7H 2OL3H 4P46A 1CIUA 4KRPC 3C5SA 3ARPA 3NCJL 3FOMA 3HFML 1T2JA 2M1KA 4FXLA 4KJYA 3CUPB 4R0LA 2RQ8A 2VXQL 1R6VA 3CVHH 4OGZA 4HH9A 2R23B 5JOPD 3HR6A 1JCKA 3VG9C 3AGVA 1VESA 3I3DA 1OT1A 2VOTA 3P30L 5D8JH 1VEMA 4F9LA 1NGYA 2WINB 4XCNA 1CDIA 4XNMB 4ODUA 2DQFB 5KW9H 4RRPA 5HY9B 1VEOA 3NZHH 4YGAB 3Q5TA 3T4YA 4Y5XC 2HJFA 3NN8A 3OKDB 4IIQB 3WO4C 2OTWA 5TQ2H 1ZT1A 1OGAD 4PV9B 3BD3A 2FBOJ 3SJVE 1EJOL 3O4LA 1D6VL 4L3CB 4FA8A 4UILH 1KJ3H 1P7QD 1NLBH 1ZHBA 3JWNC 4U1HA 1P53A 1YEKH 2VAJA 4YEEA 4TPRH 5DMKB 5EBWA 4UTAL 4PJCE 4KDTC 1JZ8A 2EXYC 3IF1A 1J88A 4GRLC 2DYPB 3N85L 4PRDB 3OB0K 2G75B 4NRYA 4UIMA 3KS0J 3INUL 4TRPH 4W6YB 5MEOA 3LEVL 3V4PH 1BFVH 2UYLA 4K8RC 2QEJA 3TBWB 1DVFB 5F3HB 1H8SA 4WUKL 1FGNL 3EYVA 5JHLL 2WP3T 3GIZH 1QRNB 1NAMA 3MODL 1CT8A 3PGCA 1K4DA 2AXGB 4CJ0A 1TDQA 1G7IA 4GMSL 1ZLUK 1E4JA 2X4OA 3GSNA 4HKJA 4KVNH 4NBZB 2OX5A 1RJZB 4HXAH 4DFIA 2AXFB 3VFRB 5DSCA 2V2XA 4QTIH 3ELAT 1KIQB 2IPKA 4XCCL 3TLRA 3U9PH 1YY9C 3I84A 1BVZA 2VL4A 4TSBH 3BZDA 2A38A 3QEGL 1AY1H 1L7TH 1S5HB 1E28A 3RAJH 1N59A 1B6DA 4C56E 5I19H 4QOKD 2VABA 4AM0B 2VR5A 1RZKL 1KN2H 1PJ9A 2E5EA 5JR1L 4K7PX 3DO3A 1TNMA 1ITBB 1QBBA 4MJ5B 4TSCH 3QHTC 4Y4KC 1Q1JH 2V2TA 3NH7H 5HHQA 3VGBA 4F58L 4X9IA 1A1OA 5TFSL 3LB6C 5D7IE 3DUHA 3ZHKA 4F3FB 5F1SA 4WY7L 4Z77B 3RDTD 1RPQA 4RMTA 2FJHB 1U8QA 3DX6B 5DK0A 3F5WB 4AENA 4TQEH 1WJ3A 1WV7T 3LH2H 1CXFA 1MRDL 3SJVA 1DBMH 2IG2H 3VWJA 5FGRA 3C6LB 1NCDH 5FHAL 4KK8D 4AG4L 3G6AA 1G9NH 2ADFL 5TH2B 4PJCA 4HK0A 1A6WL 5B8CB 1OP5K 4LKXA 3IETB 2NY5H 3FO9A 5I1JH 4QRQB 5KSAB 1T66C 3CSYB 4TVPD 2Q3ZA 4FHBD 3WNMA 2GK2A 3PQYD 3EO1A 4XP9L 4X4XA 4EQ2A 4XAKD 1ZHKB 4ONFL 2ERJB 2X4PA 3IRZA 1XF5B 3MV7E 1CE6A 4QHKJ 4QKXB 4BFIA 1EO5A 1LO4L 4POZD 2VDRH 3QCVH 4RWYL 4NP4L 3MRHA 3H9HA 2P44B 1BBDL 1U2HA 3T0EA 5CP7A 2A9NL 2XRAH 1TJGL 4WI9A 3KPMA 1ZHNB 3HHRB 3IGAA 5DQJB 4RGMC 4QHUA 2AGJH 2FEEI 2XN9E 4LSRH 4NKIL 4XCFH 4D9RE 2IAMB 5DRXB 5EB9A 1HSAB 5T3ZH 5JNYA 1VADB 2LU3A 4HKBB 5B3JF 2F8XC 1OP3H 3LRHA 4R4BA 3QPXH 2MKWA 4M43H 3QJFA 1K6QH 4C56A 5DF0A 5D7JD 4CADB 1Y18A 4PP2B 1FPTH 4P2QE 3P9WB 4OGAC 4Z6AT 2I27N 3ULSA 1CQYA 3V6ZA 1IGIH 4O02H 1FFQA 3EOBA 3RTQD 5IVXA 3OXSA 3U7AA 1HKLH 2X9XA 4K2UL 1F2XK 5D7IA 4ESKA 1S78C 1YEJL 4UI2A 2QHLA 4QF1B 3T8XB 3GHEL 5BCAA 5FYKE 4S1DC 4NFCA 4PJEF 4G6AD 4LEXL 3WS6C 2GI7A 3BIKB 4BZ2L 1OHQA 4KHXH 2F74B 4XCYA 1S7VA 2VQUA 3L3JB 2VXUL 2VR4A 5DZLA 3SY0A 1WAAF 3K4DA 3LKQB 4BZ1H 4LBEA 3QRFM 3O3DA 1KN4H 1OAXH 1KFAL 4X9FA 3VA2C 5AAWA 3GSQB 3GSRB 3KPRE 4LDLB 1CICB 5AG8A 1M71B 4DW2L 2AEWA 3X14A 3TO4A 5DHXB 4ZXBD 1A02N 1TFHA 2V5YA 2CD0A 4JG0H 1S9WB 2LABA 3MJ8B 25C8L 4JB9H 3QQ9D 4Z7WF 1RUKL 4G9FE 4GRWH 1FZOA 4PJFE 3PWUB 3M8OL 2FX9H 4LL9A 4P2OA 2XN9A 1ULVA 2OI9C 1KELL 4XPAH 4XB7A 4YUEL 5C9KA 1D5ZA 3RZCB 4D0BB 5IFJA 1P2CA 2DQGH 1G7JA 1OLLA 5DQDL 5C0DB 2BC4A 5C08E 1UZ6E 3DRQB 5T3XE 4YDVB 1XCQA 5F88A 3T0WA 4OGYL 1ZV5A 4NDMB 2E9WA 3IDYB 5GHWH 2GCYA 1NCUA 3MRKA 4HC1H 4PRNB 5TF1L 1WZ1H 2PTTB 2UZXB 3QZWA 4G6KH 1JWUB 3VXSE 4P2QA 3PWJB 3RVVC 4L5FH 2F8OA 5DD3L 1H15B 1AO7B 1OPGH 3GB7B 4Z7QE 4YHKL 5H94A 4L4VD 4PTUB 3TZVC 5FYLE 2H1PL 3KR3H 2P5EA 5DJYB 2W9DL 3IU4H 5AWNH 4U1IA 4YZFF 1MCPH 2HH0L 1CD1B 4LF3B 4MB5A 4NQED 2VSCA 4N90D 3IFNH 1U3HC 4FABL 1T1ZB 5AZEH 2RCSH 3T3ME 1HHGA 1S9XA 4WEUD 4LLDB 2FO4B 2L0DA 4XNQA 1OM3H 5L88H 4AT6B 1EVUA 1ZSDB 5E94A 3SE8H 1JNHB 4K8RL 4NRZB 4ZQKA 1I8MA 1RZFL 1P84K 3MJ9A 1C5DB 5HI5D 5TDPB 2ATPA 4NM4H 1DQDH 1GGUA 3UYRL 1H3TA 5EC2B 4G8GD 4FFWD 3BGMA 3BUTA 4K3HA 4DKEL 5C6PB 2CDEA 4LCUA 3O6ML 1RK0A 3LQZB 4DUWA 1DDHA 3KPRA 3F62A 4NO2A 1NGZA 1I9JL 2OR9L 3MBEB 5CP3H 2XY1A 2CLVB 4ZPVA 4K7PH 4Z7NF 4YEFA 4G9DB 1FNSH 2XNAB 1DE4A 1YECL 2EH7H 3HZVA 2VDOH 2FJFA 2DI9A 5JXAL 4E0RB 4YC2B 4ETQA 4DJMA 5IEHA 2ZUQB 3QXUA 5GZOD 5CWSA 5E4EC 2AK1H 3FB5B 3BUYA 1HCFX 4JFDD 2UY7A 4I3SH 4DKDC 3IDMA 3LKSB 4Q97A 4GOSA 3BKJL 1MCOL 5EIVA 3OMZA 1Y6MR 3VWKC 3R1GH 2NPLX 2FX8H 5BXFB 3RFZC 3BP7B 4NC2B 3B5TA 1B88A 1HQ4A 4XZUA 4JAMB 3MV8E 2R4RH 5C08A 3ZZ1A 3MLTB 1DL7H 2X4SB 2HTKC 1U8LB 5IW3A 2WBJA 1EFXD 1JK8B 1RURL 2AAVA 3G5VA 2IBZX 5JOFA 4XHJD 5J3HD 1EXUB 4Y4HB 3VXSA 3WUWA 1GVIA 1HQRB 3BD5A 5K9OA 3D25B 3QDAA 4O4YH 1I8LA 4GS7C 4HUVA 3S34L 1QSEA 1UENA 4J3TA 3TBYA 5HDQL 4IRJC 4TVPL 3KYOB 1RZ8B 4GAGH 5DHVA 3WV0A 4RISL 1KTKE 1F90H 2F19H 3TIDB 3HE7A 2BY2A 5KVDH 1I9EA 4P23A 5F71A 2XIDA 1T5WB 4PFEA 4G3YH 4APQA 3STBA 4MQTB 3MA9H 1UXWA 4QTHA 3V6BR 3CH8A 4AQOA 5GJTL 4HIXL 3QUXD 1N6VA 2HWZL 4TYUA 2VE6B 4M6NL 3SDDB 4PREB 4WW2B 1T0PB 3W39A 5I8CB 5E1HB 1K4CA 5HHXL 4CW1B 4A6YA 2PXYB 4UV7L 3A6BL 4N5EC 4P2CG 4XMKL 4MCYA 4X4ME 1IC7L 4PJ8C 3PWNA 2ARJB 1C8PA 5IK3A 5DJDA 1YMMB 3QWRD 1YPZF 3FQUA 5J89A 2J6EH 1RUAH 5HHPA 5C2BH 3MLRL 4F7MB 3WNKA 1GJIA 1S9VA 5E5MA 2MOVA 5I15H 5ADPH 2CUIA 4EIGB 2HRPL 1CLYH 3IAPA 3NACL 1XZ0A 3GKZA 2Y7QA 5D2NC 1IAKB 4HIEA 3QA3A 4ODTL 4AIOA 1QA9B 5MHSE 3MRPB 3SKUD 4OCRH 3BN9C 2ZUXA 4PJBB 3QDME 1HSBA 3ARFA 4M61A 1FVCA 2FGWL 3BISA 5ICZA 3WLWC 1A4KB 4PS4H 5C86A 1VGKB 1ZANH 3MR9B 1MFAH 3MA7A 1D5IH 4XC1L 4UQ3B 4DGYH 1U8HA 1UB6B 4LSTH 1KPVB 1CK0H 2PO6A 4MA3B 3FB8B 2GSGA 2JCCE 3WBDA 1X7QB 1B0GB 4Y2DB 1MFEH 1LP9B 3G5XB 1X5JA 4DEPC 1QACA 4R4ND 4L8SC 2JB6A 1L6XA 3E6FA 4GSDH 4LAQH 4LCWE 5DS8A 5GGSA 4Q9RH 4YPGB 4RFNC 3PDDA 4K7FA 3TPUA 1T1XA 5L2JA 5I76A 4PJHF 4M7JH 1S7QB 5FA3A 2H32H 3QUZC 4MAUH 1OT2A 3V7AG 2BY3A 1U91B 2Y9RT 3UTTD 4MQSB 3CLFL 1UB5B 1A6UH 4OUOA 5I73B 5C0BE 3W9DA 1LEIB 1P84J 2MQCA 2QADB 4U0RC 3QUMH 4AIZB 3OQ3B 2VLRE 4OSUH 2D03L 5GGUB 3VD5A 1EUUA 1U3JA 5JXEA 3TJEH 1AHWC 2C1PB 4M00A 4WU7A 1RMFH 5C9JA 4FQQB 3O2WH 4X7CC 1VFUA 4F9PA 3CXHK 4K94L 3BN3B 1NUGA 1H0DA 1KLFA 4N9GA 5T1KA 2AJYH 3LD8C 1MHPL 1B6UA 1XGRB 1BJ1H 2WAHA 2WM0A 4LRNL 5BRZB 3DLQR 1XGPA 1AE6L 2Y6SC 4HJJL 4H88H 4MX7B 3LN5B 1S7XA 1JPSH 4DOHB 2D7NA 5L6YH 4PGJA 5T1MB 2FHFA 3GSVB 5BS0B 3MUGA 4MDJA 4TVSa 3EYFB 3W5NA 4E41A 1XF2A 3KYKH 2YN5A 2ZG3A 2OMNA 4G7VH 3TBVA 5C0AB 3QDMA 2ZCHL 3L3KA 4KH2A 5E5RB 4HFWA 4YHLL 4O51B 3LS5H 3U36A 4JZJC 2BVTA 1FDLH 1X5LA 1VFOA 3IDIA 3MQIA 3RVUD 2HT4C 1UXSA 3BFOA 4KK5D 2HT3D 3T65A 3WFCL 4POUB 4JM4L 3OZ9L 4K9EL 5CINL 3UTSE 5ID1B 1BX2B 1EEQA 4JRXB 3QXAA 2PTVA 5L8KB 2DM2A 4N0CC 3VG9B 1YEFH 2JCCA 4GKZA 3BQUC 4BK4A 5C3TA 4WWKA 2XTLA 1I1AC 1F3RB 4WW1A 3SGJC 3JZ7A 3W82A 5FO9B 3GSUB 1YEIH 5DURB 3OL2A 4PJXF 4LCWA 5D6CA 5SWQA 3QDGE 4Y5XB 4OCWL 2C1OA 3CK0L 5IQ7H 3WO4B 3WD5L 4JVUA 5TDNA 3RIFF 3MXVH 2YMXL 4YH6A 1A7QH 3KPQA 4HIJB 4L4TE 4LPTA 5C0BA 1QKZH 1WBYA 2XZZA 4JM2F 1VCAA 3GBNL 4UOW1 3IDNA 1XGTB 1AFVL 2YN3A 5IROC 3FOLA 1RIVH 4JO1H 2GEEA 4DTGL 1FAKT 2ZOLA 4X7DC 3EDJA 2A83B 3PDGA 5IT2L 3FAWA 1NSNL 5EBMA 1ZA6A 1EGJL 5GRYA 4S11A 4WGWB 3ULVE 3QIWC 3OJDB 4Q6IC 4P5MA 3TO2B 3DMMC 4YBQC 3PUCA 3O8XC 4JG1H 3FB7B 4QRPB 1GPOL 1AGDB 2GJZA 1GXEA 2OMBA 5LVEA 2HVKA 3FQXA 2DL2A 1H3PH 2W07A 3GMOA 1J1XH 1JWMA 4BH7B 1JHLL 1MCSA 4IOFD 4NWUL 3U0PA 3SQOH 1I3VA 3DTXB 1X5HA 4P2YA 5DO2C 2IPTH 5J57B 2E9BA 2P8LB 1T1YB 4OZFB 4XMPL 4X98B 2NW2B 1D5BB 3WHE1 3QWQB 4E42B 4EVNA 4LIQL 4FQHA 5HHOB 4XPFL 4HMCA 1IGYA 2B1AH 4XPGL 4L8DB 2ADJB 1A8JH 5I1HH 1WFUA 4WUUD 2NY0D 3KJ4C 1XIWA 5HVGB 2DD8H 1YQ2A 3PDOA 3B43A 2XQYG 1EEUA 4EBQL 1CDGA 3UTSA 2YD2A 1YN7A 2WUCL 2WWKT 3RKDD 1MFNA 3SKJL 2X4UB 1NBYA 4ZOCA 4Y4KB 4V1DA 1I85C 3BGFC 1HE7A 1MRFL 1NUDA 1S3KL 5H8DA 2X1PA 4TSAH 3S35H 4OLVL 1KB9K 2I9LB 2ZG2A 2CMRL 1PY4A 4MD0A 2VRAA 1KYOK 4IMLB 4HUMB 5A3IC 1TCRA 2JIXA 5FKPB 2DI7A 1A9EA 3CFKA 1MLBB 3HMXL 4U1MA 2R2EA 5DMIH 3ARUA 1ORQA 4I13B 2BVYA 1PGRB 5ESVA 2DQDL 4QGTA 4PRHD 4G6JL 5EULV 5DD6B 5J7CC 3CXHJ 4OD2A 1F6AA 5DRZB 5FDWA 3EYUH 3BGAA 2BX5A 3GMLB 3MV9B 4HQQL 5EWIH 4MXQD 3V0WL 4D9QD 3ARDD 5EFIA 2ITDA 1T7WA 3RBSA 3LEYL 3HUJE 3VRLE 4NPYA 1Q9OB 3FRPG 5DK3A 3DOSA 3O9WA 4JHWL 1JPTL 3L6FA 3ZTNH 5E6IC 4HKXB 4JLRB 4NSKB 2RJMA 5HYJB 4GXUN 3ZDXE 1D9KD 1BHGA 5BO1L 2B2XL 2OQJA 4XMLH 4Z95L 1IBGL 4GRMA 5C92A 5JIKA 5ITFB 5HDBF 1CE1L 4PJEB 2AI0H 1BBJB 1UQSA 5E2WL 3X11A 5ITBH 1K5NA 4LVNC 5GRJH 2AJ3B 4YAQB 2V5RA 5GGTL 1BD2B 4Q0XH 1N7MH 3MZTA 4BQCA 4R7DB 3L3IB 3EDDA 2BNQB 2BHZA 5IEKA 4NT6B 4YQXL 3TCLA 1U8PA 2Y5EA 3FCTB 1A7PH 3CJJA 5EOCL 5CJ5A 2A6KB 1Q0YH 1TZIB 2A6DA 4Y4FA 2YUZA 2YKLH 2X4TB 4WFFE 4X4YB 2QBWA 1GRWA 4FNLL 4OCYH 1BFOB 2GKIA 3SDXF 1PX4A 1A5FL 3MGOA 3RWHB 4ALAL 4Q7DA 5CGTA 2BK8A 1INDH 4JEGB 1B0RA 5ADOL 4JDVA 3MNWA 5BZWA 4PJIF 1EA9C 1MQKL 4NC1C 4BA8A 3G9VA 4HV8B 3KPSE 1OAYL 4M3KB 4C4KT 5DEFA 2P42B 3VRIA 3BZFA 3EYQC 3FZUC 1EPFA 1FL5B 4QRRE 2R56L 3NIDF 2QKIA 5DJXB 2VO5A 3TN0C 3MRQA 4KQ4H 5T1DL 1OTSD 4FQ1L 5ISZB 1RIHH 3LRSA 2P24A 2YA1A 2HKFH 4X9HA 3TA3A 3B9KA 3HPLA 3TYFA 3CFJA 2VZOA 4G8IA 1LNUA 2PR4L 4I48A 3MCKA 3TPKA 1CFTA 4Y19D 4PJAE 4ZS7H 4MJ2A 4PRPE 3CX5K 1KJVA 1MCRA 3HUJA 2UWEF 3NZ8B 4NCC1 4WJ5B 4HX1B 4J6RL 1SY6A 5CSGA 4P5TC 3ZL4H 3MYZA 3HNSH 2VDNL 4WFHE 3H9ZA 3MRBB 3RVWC 4D9LL 3PP3H 1A6VL 3RIAK 5JQHC 1VSCA 3T2QA 4ZS6D 3U1SH 1S7WA 2IALB 3SKMB 3CXDH 1A1MB 4HJ0D 3RWIA 4C83A 3FN9A 1VPOH 4HWZB 4LGRB 3QIUA 4MNQD 2J2ZA 3QDJD 3G08B 5FEBA 4MZ3A 2AV7A 1M05A 2LFGA 4ZOAA 3JTSB 1Q94A 3OHXA 4OI7A 3I85A 2OSLB 2QTEA 4LMQI 2WWMC 4HWNA 4LLWB 4XPHH 4AL8L 5JIPA 1EVTC 32C2A 2DM3A 4XVSL 2J1KA 4H8WL 4YWGH 3VFSB 3QEUA 2BJMH 2CH8A 3MRCA 2BMKA 2FX7H 1S7SB 3X13B 4A2MA 4EN3A 3CC5B 4HGKC 4ZUWA 1IQDA 4RMRA 3MNVA 5BW7A 1KYOJ 2EEAA 3TZVB 3DSNA 4P4RB 2BCKB 2E8ZA 5CIPH 3KPSA 1HK6A 1DBBH 4LEOA 5KOVC 3Q6GH 4NQDB 1U3HB 1KXTB 4JVPA 4QRRA 2OL3L 4Z5RB 43CAB 5HSFA 5E9DB 1UM4L 4WNQB 3PL6A 1H5BB 4YX2H 1GSMA 4XPBL 4ZUTB 3U30B 1M7DB 5C70A 2ZUSA 4CMHC 5F9DC 1KTRL 1TZGH 4X6DB 5IW1A 3ULUH 1IL1B 5HPOA 1X44A 4CAGA 4E5XB 1X9QA 5IQ9A 1S5IH 4PJAA 1PG7X 3ARGA 4KV5E 4PRPA 4CNIB 3ZKMD 5C0EB 4QXUL 2VDLL 1RZJH 3DIFB 5CEZL 1UJ3B 5C07A 4QHMB 4Y1AB 1ZT7A 4X5XB 2A74A 1QFWH 2XQBH 5IW6A 1AP2A 5I1CH 2EIZA 4ZFOL 1QRNE 1K8DA 4EUPB 1P4BH 3VXNB 2HJKB 5MEPA 2Z35A 1OLZA 3H7BA 5ENWA 1N4XL 2GTWB 4CBPA 5E4EB 1CLZL 3UO1L 2MFNA 3GBLA 4P59H 1QQDB 3RJDA 1F4HA 2C7UA 3MLZL 4XP1L 4ZMAT 3EHBC 2JELH 5T1LA 3JV5A 1MVFA 1P7KB 4LSPL 1A7RH 3CX2A 4EDWH 4ODWA 3VWKB 2EO1A 3GMNA 1KTDA 1KJ2L 4X6EB 4P49A 3V4PL 2ZUTA 4Q2ZA 4OZGB 1VFBB 5HPMA 5KN5B 4P46D 1UM5L 3DETD 3NIFF 3S4SB 1TZHB 5JIHA 3AB0C 5KSBB 4PJ9C 1VEPA 2QL1A 1RJYB 3GIZL 2ZJSL 5E8PB 1C5BL 3CUPA 4N8VB 1WFTA 1ZLVH 1XEDA 1YPZB 2NR6D 5DTFB 3V4VL 1MLCB 3KPLB 2R23A 2V7NB 2IADB 5D7LB 1JI1A 4WFED 3I6KB 4PPTA 4GS7B 4G6FB 3WFDH 4YR6B 2P47B 4MHHG 4QTIL 1N5AB 2WINA 5FOJA 1YEGL 4XNMA 4IRJB 3QP3A 5HY9A 5GGRB 1MCLA 1GC1H 1JWSB 1RUMH 1JJUA 4XP4H 1AY1L 1P9MC 4IIQA 4NNPH 4NFBA 3VFTB 3O4LD 3TT3H 5IGXH 4R7NB 2YC1B 1LO0L 5IMOB 4PV9A 3GJEB 1P7HL 4ZTPH 1I8KB 1F4YL 4ZTOH 3MUHL 2N4IA 4OCLC 1ACYL 4Q9QL 1RD6A 4L3CA 3NA9L 4NKMB 5DMKA 2XXMB 5CFHA 3CX5J 1ETZB 3MLYL 1UH3A 2DYPA 4PRDA 2G75A 5E2TH 4RMWA 1DSFH 3QYCA 4I9WE 5A2LH 5F7UA 2KPNA 2XWTB 4LVOC 4ENEC 1ES0B 2H26B 1BZ9B 4R4FL 2FECI 4LPXA 3TBWA 1FFRA 1DVFA 5F3HA 3AROA 3LH2L 3BKYL 1GIGL 3TV3L 4JFQB 1JGLL 4D94A 1EZVY 1QRNA 2V2WB 1T3FB 3UBXB 4PY7B 2B4CC 4N68A 3H9SB 3O6LH 4FQXC 4HS8L 4JHBA 5D2NB 3VGDA 3LIZH 1LK2B 4JE4B 3VFVB 3L1OH 4WO4D 3EOTH 3O3AB 4K3DH 1WCBB 3VXQB 3LCYA 3LN9A 1FE8H 4U1LB 1II4E 1RJZA 2HMIC 2AXFA 4PGDA 1FN4B 1MJUH 4L1DA 3VFRA 4MVBD 1IGML 4V2BA 4YFLF 1KIQA 5GQBA 5I6XC 1N8ZB 2AW2A 1RULH 1CYGA 4RNRB 1UEYA 1S5HA 4Y2OA 1DBJH 4H1LB 4LSUL 4PP1C 2WQ8A 4AM0A 5AUMB 3NPZB 3V7AE 4DEPB 2PYFB 4L8SB 1VA9A 2AV1B 4MJ5A 3KG5A 4WIQA 3OTTA 4RFNB 2I5YH 4RGOL 5E00B 1AQKH 3T0VA 4XCFL 4KROD 1PG7L 3QUZB 4LLAA 4FG6D 4M3JA 4ZSOB 5T3ZL 4F3FA 4Z77A 5JDSB 4U0RB 3DX6A 3BKML 4XNUL 3F5WA 3SJVD 4M43L 3VWJD 1FZKB 1MWAB 3SE3C 3RDTC 3LKRB 1AHWB 3CMGA 3MRFB 1R0AL 1EBAA 5FUZL 2EKJA 5D7KE 3HG1A 5DJ8B 3C6LA 1T04B 4OLXH 2BNUB 3QB7C 4J3UA 5GGSY 5TH2A 4R97C 4KHTH 3LD8B 2IQ9L 1OF2B 1ZTXL 4JKPH 4U6XB 2SEBB 5B8CA 3IETA 4J3OC 2QQKH 3ZTJG 3MFFB 3WIHH 2B5IC 5FGSA 3TH4T 1OY3B 4KK8C 2O26U 3L5XH 2NX5B 4M9OA 5CLWA 2L4OA 4QRQA 5F9OL 5KSAA 3CSYA 5B3NA 2CKBL 4TTDD 4N0YL 4PJXB 1WIPA 3E3QC 3UBXI 1AJ7L 2VC2H 4IOIB 1ZHKA 1BZQK 2XG5A 4L3EB 1XF5A 2FSEB 5JORB 5FHBL 3F7VA 3T0ED 4PB0L 1U8MB 4JN2B 4JM2B 5FAAA 4I0PC 4YFDB 2H9GB 3G6JB 1E4XL 4GQPH 5LAXB 4NO5B 1ZHNA 4PYHA 2G2RB 4X0KB 5FM4A 5DQJA 3JXAA 1Z2KA 5F1IB 4BZYA 1OAXL 4U05A 1LK3L 2JK5B 4O9HH 2IAMA 35C8H 4JZJB 5DRXA 3WE6B 1HSAA 2VDKH 4HLZH 3UCRA 3ILPB 1QRKA 1VADA 4PD4K 4D0CB 4HKBA 3UTQB 3M45A 4C56D 1RJLB 5ALCL 3V0VB 1R24B 1Z9SA 2BOBB 4NQUA 3BQUB 3J8F7 3RU8H 4CADA 4YXHL 1I1AB 4JB9L 4PP2A 4LCYB 4P5KB 3LPFA 4LDOB 1OAQL 3QI9B 3KS0H 3VMOA 2HG5B 2BRRH 1WITA 3SDAC 1UGNA 4X80L 3VXMB 4QF1A 3TBTB 2DQGL 4CVXB 4YE4H 3BJLA 3T8XA 1EFQA 3SE9L 1JZ3A 4JO2H 2DIBA 3GK8L 5ILTL 3LMJH 5KS9E 2F74A 4G6KL 3L3JA 3CDCA 2NTFB 2OL3B 4KJQC 5J9PB 3QIWB 4Q6IB 5JW3L 3BZEB 2H2SC 1OQXA 3DMMB 3WCYA 3LKQA 2OM5A 1OPGL 2YPKB 3VFOB 4G7YH 1GGBH 1WQVT 4PYGA 5L9DH 5C09B 3ZKND 3GSQA 3GSRA 4OAWB 2F15A 2QR0B 1MCPL 3GRWA 1CICA 3MREA 1MPAL 5IVXF 3TO4D 1ED3B 1MIMH 2RCSL 3FMGH 1J11A 1YNKH 3H7LA 1Q9LB 1Q9WB 3H0TB 4MD5B 4U1NA 4NM4L 1DQDL 1S9WA 4HLJA 3TH3T 3MJ8A 4U4BA 5FYJH 4RFEB 1TJIL 4OF5A 3A0OA 4ZXBC 4P2OD 1Z5LA 2XN9D 4LP4A 4ZFOB 5T5FL 4D9RD 1XT5A 3P0YH 3PWUA 4EXKA 3U46B 4DQOH 3QCUL 3G6DL 5BMFH 5LCVH 4D0BA 3KJ4B 4JPWH 1OP9A 1AR1C 5C0DA 4QNPE 1CU4H 3DRQA 3FO0H 3C6SB 4YDVA 5FXCH 1LO2H 1JGDB 1QZ1A 4NDMA 3ZE2E 2HTLD 1CTNA 1KJ2B 4PRNA 2PTTA 1LD9B 4P2QD 1PFCA 3BXNB 2AK1L 1JWUA 3S4SG 5MERA 4XNYH 3WLBA 3D18B 1JRHH 3PWJA 4JFFB 4OCXL 2AQ3A 2P5ED 1AO7A 3GB7A 5IESL 3C08H 4PTUA 1H3GA 2R39A 5DJYA 5DD1L 2P7TB 1Q72L 4EKXA 3BX7C 1AGFB 1CXEA 3HC3L 3ZHDA 1CD1A 4LF3A 1X4ZA 5FYKD 4M48H 1XGQB 1IRAY 1T1ZA 3SBWC 3ARTA 3NA4A 4LQFL 3IJYB 4NZRL 3MOAH 5E8DL 3SO3C 2FO4A 3GMQA 4JFPB 4U3CA 4AT6A 1FNGB 4WHTB 1JNHA 4NRZA 3SDXB 4PG2A 1C5DA 5TDPA 2BHYA 4PJ5E 4WFGD 1IFHL 4KK9C 2E6PA 3GSNL 5EC2A 1T7ZA 3V52L 4XBEH 3KPRD 4MS8C 2B4CL 1KNOB 2I9TB 4XVJL 1KEGH 1MJJB 3LQZA 5E6IB 4LLYB 5D5ME 1CGXA 2IPUG 4KQ3H 3FKUS 4GKOA 3JUZA 3MBEA 5MP6L 1E4WH 1IGTA 2X09A 1FIGH 5LBSL 2CLVA 2F19L 1PX3A 1MRCL 1L7IH 4CGTA 1NUFA 4G9DA 2XNAA 1KXQE 1PYWB 1EHLL 4JREC 3TJHD 3ME0A 2YS4A 2YHGA 2R1WB 1IVLA 4U6YB 4KKLD 4FQJH 3X3FH 2XQYK 3FB5A 3CFCH 3N06B 1LVEA 3LKSA 2CLZB 2XOTA 5GZOC 3E8UL 5L7XL 5E2VL 5DRWB 4WI6A 3UJIH 5IR1B 1I1RA 5EU7C 4YXKH 5BXFA 3BP7A 5CKGA 5C08D 3EYSH 1EUTA 1URLA 2KH2B 5T3XD 2VXVH 3HI6L 2VNCA 4G43B 1RUPH 4JAMA 1JMXA 2WBJD 3OAUH 1JYXA 3AM8A 5E1AB 2KBGA 5DFVD 3MLTA 3UPAA 3MUY1 2X4SA 1IAIH 4C54A 5IWLC 3MPCA 5FCUL 1U8LA 1JK8A 3OB0H 3GNMH 1IGCH 4JO4L 3VXSD 5H2BB 4M03A 4F7CB 3GHBH 5D1ZB 1LP9E 1EXUA 3AVEA 4Y4HA 3SN6N 5CD3A 1WT5A 4RX4A 4Q74A 1HQRA 5FYLD 1QSED 5GGVH 3A67H 3D25A 3QAZC 4LGPB 4JZNB 5IUSA 2BP3A 2NCMA 4HAGA 2GJ6B 2APTA 4F2MB 3HE7D 2YSSB 5FYJU 3KYOA 2B0SL 4R8WL 5EU5B 1RZ8A 2QSCL 4UT7H 1UWGH 3TIDA 2Z93B 4APQD 1ZLUH 1N5YL 2DQCL 3AY4A 2YK1L 2VWEC 3TVMC 1T5WA 2FEDD 3LN4B 3MRRB 3UTPE 5F7YC 2VE6A 3T2NH 3IJHB 4XVUC 3HKFA 3HZMB 4PREA 4YBHA 2A2QT 4WW2A 3SDDA 2VZSA 5HJ3B 3BE1H 5I8CA 4CW1A 5DC9B 4M5ZH 5BRZE 1ZLWK 4P5TB 4XVTL 4K3JL 1M6OB 5CZKA 1A6UL 3D0LA 1OTUD 3HN3A 4HH8A 2ARJA 1RZGB 2VZTA 1YMMA 5EZIL 4DOHE 2VDPH 2ZCLH 2FL5B 1SBSH 1CWVA 3QCTH 3T3MF 2P8MB 1TPXC 5DJCB 4CN6A 1WEJH 1U8KB 1IAKA 3MLSL 3U4BH 4ODVH 1IE5A 3EBAA 4QHNB 1QA9A 1CDYA 3ARFD 1IKNA 9CGTA 5JPMB 4NNXB 4PJBA 3DUUB 5C0AE 4F7TB 4WU5B 2ZG1A 1HH9B 1MJ8L 1A4KA 4YDJB 4FXKB 4MQXD 5K9JL 5JOPE 2PO6D 1FIEA 3MR9A 3D5OF 4UQ3A 5DVMA 2LVEA 2WLYA 1UB6A 4JQXC 4LPYA 1KPVA 3U6RB 4JRXE 1OP5H 4MA3A 4M1DL 2DTMH 4FFVD 3FB8A 2PW1B 1J10A 2ORBH 1X7QA 2FZ3A 4PJGB 3CFEB 4Y2DA 3ARXA 1LP9A 4XI5D 4QT5B 3G5XA 5IVZB 2V9TA 4FP8H 3OJMB 3KYKL 3GMRB 3NVQA 4YPGA 2CK0L 1S7QA 3G5YB 4JQIL 1UB5A 1T03H 3DURB 3D39E 5CJXA 1LEIA 2W0KA 3EIFA 4CMHB 3MACL 5JXED 3MLXL 5KZCD 2IMMA 4QRTB 4CKVX 4AIZA 1T5XB 4Z76B 5D9SB 5GGUA 4OIAA 5BVPH 4KMLB 4EOWH 5GRUH 4BSWB 5DLMH 1YEFL 1JGEB 1YEEH 2C1PA 1FJ1B 4FQQA 5T1KD 3TNMB 1C5CH 4KXZH 1NCCL 1ZHLB 3SKOA