4TSAL

Structure of a lysozyme fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
210
Chain Sequence
VLTQPPSVSGAPGQRVSISCTGRSSNIGAGYDVHWYQQLPGKAPKLLIYGNTNRPSGVPVRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHSYSCQVTHEGSTVEKTVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords Lysozyme C
publication title Structure of a lysozyme FAb complex
rcsb
source organism Homo sapiens
total genus 39
structure length 210
sequence length 212
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tsaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tsaL01
2H32A 4R26L 2DQGH 2Y36H 1CZ8L 1ZT7A 1BD2E 3LKPB 2IANB 4HH9A 4JKMA 5AYUL 3TFKD 4CVZB 1MAJA 3PJSA 5IOPA 4NRYB 3VGEA 4YPJA 5CEZH 1OGAB 4FQXD 3RIAK 3RWIA 1T21A 1R24B 2FO4A 1DQJA 4HPOL 1VFMA 3HCVA 2CLZB 1RAMA 3C5JA 4ODXB 5SV3A 3U4AA 4NKMA 3MXWH 4PRIE 3H9SB 2D7QA 3QDGD 4NNXA 4G6FB 4Y19B 5I1LA 2Y6SD 4LGSB 1PDKA 1JWUB 2M1KA 5DQDL 3MLXL 1NC2D 3KLHD 1UH3A 3ZT6A 5EC1A 3TT3L 2PTUA 4IRSC 5DJ8A 2CDFB 35C8L 4XCFL 5EUOF 1DFBL 4XVTL 4X4ME 1NFDF 2HRPL 4WTZG 4PRNB 3Q5YA 5DD3H 4Z76B 3H9YA 1R5WA 1X6NA 3UAJC 1J8HA 1FVDA 2FWOA 3GDBA 4WGWB 5EU5A 2NY0C 5GJTL 4G8GE 2F5BH 4F8TA 5BOPA 4QNPF 3REVA 4AQOA 1GRWA 2X4UB 3UJTH 2Y23A 4S1SL 4PJDB 4POUB 1QFWL 2DL2A 4IM8A 3ZZ1A 3SPVA 4UQ3A 5HHME 3AUVA 2BY2A 1FNGB 1S7UA 3X3GH 4CMHC 4ZD3H 4MJ5B 1U3HD 3T77B 4ZUVB 4XPHL 3BQUB 3U4EA 4JANA 4MCZB 3UYRL 4CBPA 1TIUA 3PWPB 5IB3A 3DMMA 3QI9B 3QEHB 2D9QB 5FKAA 1WFUA 4YJZL 2R8SH 5KG9B 3H8NA 3TNNB 1RJZB 3QDME 4ZUWA 5EU6D 5L88L 1BVLB 5J1AB 5BOZG 2XNAB 4CJ0A 3FRUB 4UIKL 3IETA 4LRNH 4QRRE 2NY6D 2C3GA 5I0DA 1ZXQA 3OKMA 1OTSD 3ORJA 3TBVA 1NMAH 3S3JA 1AO7E 1KUMA 2DQUL 5EO1B 4EI6A 3MV01 1B2WL 2IPTL 3VGGA 3VFOA 4TQEH 3E8UH 1CD9B 2Z91B 4EZMA 1F2XK 1JNNH 1QG3A 5F96L 3G6DH 3VD9A 5ENWB 3QUML 3SQBA 1MI5D 1S7VB 1B0RA 5EWIL 1I4FA 4ZSOB 2WWKO 5I16A 1ND0A 2AGJH 2UYLB 3V8OA 4ERSH 4JB9H 1OSPH 1K8IA 3TH4T 3DPBA 3RVVC 3MV9B 2R1YA 5E2WL 4ONFH 5ESAA 4OQTL 1MHEB 3M45A 4Y88A 5FF6A 4KK9D 5CP3H 3VXTA 1K2DB 2XACC 5L2KB 3QDGE 4YX2H 3T0XA 1VERA 3UBXA 1DEEA 2HT4D 1HH6A 3QDHA 4K55A 4FQIL 1N6VA 3QPXH 1PY9A 1ZHBA 2PXYA 4KU1A 2OTUB 2J7LA 2L7UA 1CICB 4D9QD 4NO0B 5M95B 2UWEE 1H15B 3FFDB 1OAZL 1I1RA 3CZFB 4GSDL 4L8DB 5JW3L 1UACL 5EN2A 3RAJH 2CR3A 3BESR 1JZ7A 4JFQB 2X09A 3PGFH 1QLFB 4LSRL 4O2FB 4QRPA 1UWEH 5I73C 4ZMAT 4NIKB 1DTUA 3BKCH 4OSUL 3SBWC 5DD5L 2OL3B 2ZUSA 5FYLE 4PGJA 4PJ8D 2Z93A 4BFGA 4DW2H 5ANME 1NDMA 1U93B 1R5IA 4PRBB 1RUPL 3DXAD 4FMFA 4WNQB 1FL5B 1WC7A 4XXCA 1AGBA 5KVFH 2P8PA 1IKFL 2WQRA 4MJIB 5D7LD 4M1GL 5EU3A 4UUJB 4XPBL 5GRZA 2YA0A 3OGOE 1KLFA 2JKXA 3M07A 1QSEE 1XCQB 5EU6E 1MFBH 1U36A 4FG6C 4ZXBC 1A6TB 3L3OB 4M9PA 4P3CL 2OZ4A 4LPXA 4NDMB 1AGDB 3SDXE 1CL7L 2IFGA 1F5WA 3O6KL 4AT6A 3S5LB 3X14A 3BQUC 4LCUB 1LO4H 2ZSVA 4NN6B 4L4TB 5FK9B 1T20A 1FFPA 1A4KA 1PKOA 4C4KO 1F8TL 5SWSD 4HWEH 1DANU 4AEIH 3CSBA 4WO4B 3PIQA 3N06B 4KTDH 4Q9BA 5L9DL 3WXWH 3B5HA 4Y4KA 1AGFA 5LAXB 5DK2B 3UXFA 2R69H 2D03H 5DRXA 5DWUH 3BSZL 2Y5TA 4EUPB 4LL9A 3HHRB 2NY4B 5BZWB 1KLGB 1OAYH 1S7XA 3GJFA 1BEYL 3B9KA 1NBYB 1A7NH 3BISA 1P6AB 4NQCD 1HXYB 2ICWA 3HNTH 3SE4A 4GXUN 4EQ2A 2D0FA 3AMKA 4P2QB 2VR5A 5C3TA 4L29A 3QYCA 1UB6B 2VC2H 4Y2DB 3TZVB 1XIWB 1MELA 1WIPA 4TVPD 2PW1B 4P4RA 2V9QA 2G2RB 5E8DL 3MRGA 4Y8AA 3C5ZB 4NCC1 1CF8L 3GRWH 5GS1A 4AL8H 4CVXA 4E5XB 4IRJB 3BDYH 3PE9A 3VMOA 2RIKA 5I6XC 1MRFL 1HEZA 3FT3A 1JWMB 4WUKL 2H9GA 1V5JA 4D9QE 4M6MH 3X17A 5I2IB 3KYAA 5GS0C 1GOFA 2VL5B 3WN5A 3VFPA 3PNWA 2ITCA 3V0AC 3IU4L 1LDPL 2NX5B 3UZEA 3MX0A 4YHZL 5C07D 4WUUA 4BSWA 3QUXD 1T2QL 1EHLL 4CDGC 4BK5A 2C5DC 5MEOB 5F7FA 3MJGX 5HYJB 3KYMA 2HLFC 2X6MA 1F11A 2BZDA 2PO6B 5GGSB 4BFIB 2F53D 4WJ5B 3G04A 4FXLA 4Q74A 4XNMA 5E8OB 4PYGA 1N0XH 5F89B 3DXAE 5ADPL 5IHUL 2EDEA 5HDLA 5GS2D 5C2BH 1T4KA 4QOKB 4TVPH 2MCG1 1G9EA 5I9QC 2G9HB 5ICXB 1IC7L 5F72S 1JN6A 3BUYA 3K4ZA 3B6SB 5C0BB 1DR9A 4N1HB 3EYSH 1NKOA 2EYSB 4FFVC 3LSOA 1FFOB 1WWAX 5E2UH 2NY1B 1YEGL 4C54A 2QSQA 1NL0H 5CJQH 3ZTNH 3B2UC 4I13B 1RZKL 4WENB 4FFWC 4XBEL 4YC2C 1NUDA 4DN3L 3ARBD 4JO4H 1E27B 3U9PL 5IBLD 4OZFA 5SWSE 3PXHA 1DDHA 2SEBB 2X4SB 1EXUB 4M5ZH 4K94L 5HPOA 4X6DF 5HI4C 1ZHKB 3VFNB 4POZC 4N5ED 4Z7UF 4U7SA 4OCXL 4GAYB 3FCTA 4MWFA 1EAJA 4A2MA 1JGUL 7FABL 4XCNB 5ID1B 3KPRB 4NP4L 3T2QA 1N64L 2WIIA 5J57B 4PJXB 2A6DB 5K9QG 4QRQA 3RVWC 4ZYKB 1MHHB 2BXYA 3ARGB 3SJVD 4MYWB 5KVEL 3DVGB 4Q6YA 4NQCE 3T2NH 1FAIH 5GS2H 2BVOA 4GS7B 2V5RA 3BJ91 4WO4C 2O5YH 3TYGH 4MS8C 3ISWA 3ZE2F 3V7AE 4TVPE 3CVIL 3DV6B 2HT3D 4JREC 4A6YA 4F7TB 3HRZB 5I1DA 1MLCA 3A67H 1UH2A 2PNDA 3EJYD 3EOBB 3RQ3A 1T1ZA 4X6BA 5EB9A 4J8RB 1FNAA 2V2WA 3CSPA 4PJ5B 3VXUA 4G6MH 5E8PB 2EDDA 1ACZA 2XZAL 5TDNB 5IB5A 2HLAA 3VFRA 4Y2DC 4XRCB 1J10A 1FBIH 1GGUA 1XIWC 3MJ8A 1VPOL 1B9ZA 3ARXA 3GBML 4QT5B 1OD7A 3C5ZC 5C07E 2HT2D 1GGIL 1D6VH 4U6XA 1TZGL 4IRJC 1C08A 2J4WH 1J7VR 1F58L 4KVNL 3QFDB 3UJJL 1VADA 3GO1H 3KGRA 4I77L 3T3MF 3D2UA 2C3HA 4Z18A 1R0AL 2PR4H 4I5BB 3KHOA 5HHOB 2AJYL 5KSUB 2F53E 4J4PD 1IQWH 2WINA 4RA3A 3LRGA 3STZB 1X5GA 4MD4B 1WZ1H 5F7NC 3WBDA 1YEKH 3S5LG 3F6LA 1HYSD 5I18H 3Q6GL 3TP4A 3WDIA 3O6FD 1I1FA 3H6JA 5I8CA 2J3SA 4MNGE 1T83C 2KH2B 4PJGA 3L3HA 3CDFA 3MCKA 1OT2A 3IRZA 2QQNL 4HFUH 2PO6C 2VR4A 3MMEB 1U6AH 1AP2A 4PS4L 1A6VH 4EUPG 4OZGE 3TIDA 1CFBA 3MLWL 1YY9D 4JY6A 4WWKA 4LAQL 1H8OA 1MHPH 3IJHA 4O58H 4Z0XB 4NJ9L 4DTGL 4ELMB 3FB7A 3IDIB 2JIXA 3JWDH 2ZUVA 4NCDA 1N2RA 1KOAA 1A9BA 5J6GB 3IFNH 3O0RL 4PJCA 3PV6B 4L9LA 3WS6A 2I9TB 3VMPA 4X99A 3BIBX 3G6JA 3GSRA 1F3JA 5EU7C 3KJ4B 3BH9B 5I1GH 3LS4L 2BNRB 4KJWC 1GCFA 4LLUA 3HMXH 5C0AA 1U8IA 3SJVE 1O7SA 2DMCA 4KAQL 3F7VB 4PJFF 4EIGB 2WK2A 5SX4I 1XF5A 3WUWB 5JZ7D 3VI4F 5EZLB 4P2YA 1MFEH 1U8QB 2CJUL 1PD6A 2QADB 3E6FB 4Y5YB 1J12A 1D5IL 1IM3A 1BJ8A 4M00A 4GQ9H 1MCRA 2QQKL 3H9HB 4TSCL 1GJIA 1I3GH 4LVEA 5HY9B 3R06A 2X4NA 3LD8C 1SY6A 3G9AB 5D1QA 1FZOB 4XHJD 2ZG1A 4GS7C 4WEBL 4F57H 2E9BA 3DRQB 3NIDF 2NTFB 1BFVH 4L4VB 1KCSH 4NO3A 4XVJL 5DEZA 3BIKB 4J3UA 3AGVA 3DJ9A 3JV5A 3QNZB 3V9FA 4NC2B 3HRPA 3OXSB 1XGRB 3L1OL 4M7KL 4WI8A 5GGVY 3BP4B 4PRAB 4RCAA 3MJ6A 1HH9B 3JBG7 4HS3B 1S7WA 3OJMB 1U95A 1FYTA 4RIRB 2XTJD 4WTXA 2X4QA 1YY8A 2NY5C 4I0PD 3GMOB 1TZHA 4R4FH 3LKSA 3OWEA 4N90E 4QYOA 1KJMB 3JTTA 2WBWB 4PB0H 3EGSB 3C60B 3EOAA 5F1SA 4MJ6A 5E1AA 3DVFA 3HI1A 5HHQA 4LCWD 2A74B 2CDEB 4YE4L 3QZWB 2HKHL 3EOTH 4HUXA 4PGEB 5HHNB 4GFTB 5IVZA 5LKNA 2VMFA 3IU3B 1BJ1H 4KUCF 4Q9CA 2YRZA 4NBXB 4HUVA 5HYSA 2YKLH 1G6RH 5J8OA 4FFZL 3C6LA 1IT9H 3MJ7A 3MYJA 2ZKHL 3FONB 5FGBA 3HN3A 3V5HA 5GRWA 3ECBB 3RVTC 5L0QC 1IEBA 4MQ7A 1RULH 1VEMA 5DMJB 3K8LA 3IFLL 1I9RH 2H45A 5DJ0B 5JUEL 3ZYIA 5IHLB 1NCDL 2F54D 4LLDB 5ESQB 1CR9H 4JQXA 2FNBA 1XF2B 1YDPA 4KHXL 1BZ7A 2EH8H 2P24A 3O3UN 4HHAB 5IW6A 4DKFH 2A77L 4WI4A 4PBWD 1K6QH 5DEGA 1MJUL 2EICA 4J6RH 4FXKB 2EZ0C 2YHGA 3V4UL 3C2SA 2YWZA 1WT5C 1INQA 2DTML 2CGRL 3ZKXC 4MX7A 2EKSA 3L95B 4RAUB 4Y16C 4LNRA 1GAFL 1IILE 1H0DA 4RQQB 4XXDA 4L8CB 3MA9H 2GJ6B 3RI5K 4FQCL 2MFNA 2OQJB 1CU4L 1N26A 2VXQL 2Z35B 4H88H 5CIPH 1JGDB 4QRSB 1BQLL 3RRQA 5JORB 3SE8L 3NA4A 4J23A 3D25A 3TEUA 3HUJB 1XFPA 1VB9A 4R97B 5F7WC 4HS8L 5CS7A 4KTEL 3OPZL 2YUWA 3QEUB 3DO3A 3EYOA 2B4CL 1MCCA 4M8VA 5T3XL 3QHFL 2XT1B 4NZTH 4EI5A 4M9OA 4JJHA 3ULSA 3WIIL 2QADC 4Y5YC 3CUPA 5DD0H 3QT2A 3QNXB 1HKLH 1GHFL 3FO9A 4PGCA 1YEIH 3MGTA 3DETC 4KKAC 2IMNA 5DUMH 3CXHK 4NZDA 3HC3L 5I1HH 1OAUL 4I2XA 2Y25A 1MCPH 1VFBB 3L3DB 1B4JH 2GQHA 4WV1A 1T5XB 3HE7B 3QNYA 4HMDA 1LEIA 5TE7L 1FO0L 2X89A 2X4OA 5JHDB 2HFFA 4B7IA 2M8XA 2BDNH 4LCWE 3LQAL 3RTQC 3QIUA 4LGRB 4UI2A 4A2LA 4P4KC 3EAKA 4N0UA 2JCCF 1YMMB 4Q0XL 4WWID 2VSCA 3SQOL 5D7KD 2DKSA 1WZKA 1M7DA 4NQEB 2GYSA 1T3FB 2I07A 4KJQC 4JFOB 4AEHL 1NDGB 3NGBB 5IMKB 2VJXA 2E7HA 2ZP0T 2H1PH 3I75A 2DAVA 5ETUA 2R39A 3WUWG 2UWEF 4KZEL 4LCCB 1BQHB 4NQDD 4WVRA 1YEJH 2XV6B 1S78D 1V3MA 1TJIL 5I1AB 2D9CA 5FHAL 2F54E 1R6VA 1W72L 4FZ8L 1EUUA 3B5TA 4MD0B 3RA7H 5JW4M 1TZIB 2DQGL 2Y36L 3OJDA 4OBSA 2FB4H 2H3NA 4Z5RA 1EAPB 5EORH 2DF3A 1HNFA 3DBXA 3QUMB 2P4AB 5CEZL 1K85A 4HG4K 4HF5H 5K9OB 3IAPA 3L3JB 3BPNC 5GRVK 1RMFH 4K8RH 2GK0A 3S9DB 2YC1A 4KFZC 1CG9A 2B20A 4DKAA 5F7DB 4KKCD 3QXAA 4JDVA 4JQVC 4WFFD 1ND0B 2C7UB 3MXWL 2OS7A 2UV3A 2RCSH 3OTTA 2VLRB 5DF0A 5FOJA 2HMIC 2ZOKB 2AXFA 2HVKA 5E95B 4OB5H 4UBDD 3BYTA 3CFJA 2CKBH 5MEQA 5JW4R 2HYMA 4Z7QE 1KTLA 1DBMH 5EUOB 3L6FA 4XCYA 2Q86A 4YQXH 3VW3H 2BSRA 4ZUTB 1BLNA 3CX5K 1NFDB 3SDXF 5J89A 4KKLD 4LEOB 1F3RB 5DD3L 4M4RA 2B5IB 3O3DA 3Q6FA 1A9EA 2F5BL 4URTB 3QZWG 3V0WH 3SGEH 2JELH 3UJTL 5A2FA 5DMGD 4LDLB 5MERA 1UWGH 4RFNB 3DX6A 2IH3A 5E6IA 4U1NA 5K9KB 1M71B 4X5XB 3X3GL 4ZD3L 4CNIB 4F9LC 2A9NH 4QRPB 3PL6B 4XCEB 1A4JB 2R0LH 1W0WA 3QO1B 3P4LA 2FYYA 3BW9B 5I76B 3UPRB 3PGCB 3RKDD 3MLUH 5IWLC 1NSNH 5DHYA 2R8SL 3O11A 1U8NA 3F65A 4PJCE 4C83B 3BKMH 1T89C 4HPYH 1SVZA 8FABA 3MRJA 1K8DA 5FO7B 4LRNL 4JHBA 2AABH 1EVUA 5DGRA 3G5XB 4JJ5A 3FO0H 1NMAL 2FSEB 1MCIA 2WWMC 3GMLA 4EN3B 3WIFB 3P11H 1Q9OA 4TQEL 1QR1A 3E8UL 1CK0H 2BNQD 1LMKA 1Q0XH 4G8IA 1JNNL 2FZ3A 5EFIA 1HOCA 5I8OH 2BNUB 4H1LB 3G6DL 1RJLB 1PVHA 3JXAA 4L3EA 1Y0LB 2GJJA 3HG1B 1KPVA 1S9YA 4HUMB 3OGCB 1PX4A 3I2CH 2AGJL 1X44A 3K1DA 4PREA 5F7LB 5DMYA 3IDYC 4R4NC 4ZFZA 1BQUA 4ERSL 4JB9L 1OSPL 2D7TH 3EDJA 4K23H 3O2VH 4DK6A 4ONFL 1IAKA 2A0LD 4K7FB 3RVXC 2GTZA 3X11B 3JV0A 1RZGB 5HGDA 3TPUA 1MJ8H 1TVDA 4YX2L 5AZEH 2ICWB 1BVKA 3QPXL 2W9DH 1BF8A 3NBNA 4DVBA 4TUOB 1JWSA 3RWCB 2IAMD 1FYTE 2J5LC 4KJYA 5F7KC 4L8SB 2QEJA 5C92A 4P2RB 1I8IB 3NIFE 3BGMA 1B0GA 2VISB 2XOTA 1YNTB 4QXUH 3VRJA 2ADGB 1QEWB 3X12B 4LLYB 3RAJL 5CGYC 5GZND 1UGNA 1ZA3B 4APQD 4BJLA 3TO2A 4R0LC 4R9HA 5CCKH 3I6GA 3PGFL 4RDQG 1H8NA 5CKAA 1UWEL 2QQQA 3BKCL 3PQYA 4JLRA 2EDTA 4DW2L 2XKNB 1CTOA 4PJIA 2Q76A 2N7AA 1NCUA 3GSWA 2VIRA 3IVKA 1MCHA 2E6QA 3B83A 3TJHD 1P9MA 2B5IC 3EDFA 5KVFL 1X7QA 2R2CA 3FO1B 2DWDA 4ZTPH 4YXHH 1BQHG 4B53A 5HJ3B 1XAUA 5L7XH 2BC4B 5IM7A 5T5FH 4U3XA 4RFNC 4PP2A 1MFBL 4GKNB 4CU7A 2W60B 1IL1B 4DCQA 5CEXA 3X13A 3GMNB 1RZJH 1UH4A 2CDGA 3DO7A 3PWVB 1HI6A 1AD9B 5C1MB 2E27H 2JB6A 3UDWA 3VFWB 1FIGH 2BCKA 2NXZD 3OJ2C 3IDGA 3ZSSA 4NRXA 3FFCB 1LO4L 3MRCB 3OKDB 1W0YT 4PRPB 5DZLA 4HWEL 4JFEB 4AEIL 1M05A 5A2IH 4KTDL 3WXWL 1WIUA 4HLZH 4DEPB 2C3XA 4OUUB 4YZFE 1T6VN 4K7PX 1T22B 2DI8A 2R69L 3OXRB 2D03L 3GSUB 5DWUL 2E7MA 1E28A 3OKLB 5KSAD 3S4SB 3T4YA 4Z7NE 4LNVA 4ZAKD 1OAYL 4X0KB 2BHUA 3TCLB 2R2EB 1A7NL 5BS0D 4OAWB 4HULB 2MNUA 4LIQH 3SY0B 1U8OB 1RD6A 3HNTL 2B1HH 2VC2L 1EEZB 5CINH 5MEPB 5TF0A 5EPMB 4DZ8B 3WJLC 2XQBH 1FZKB 4YBHA 1Y18B 3GRWL 2NY7H 4AL8L 3SDAB 3RJQB 4U6YA 3RI5F 3BDYL 2ITDA 2ADIB 2GTWA 2ATKB 3ZKQD 3VWKA 1YMHA 4ODWA 1CT8A 2VL4A 4M6ML 1MCQA 4YBQD 3NIGF 5K9QI 4OZGF 3W5MA 1QFHA 1DZBA 3MRRA 2VLKB 1NAMH 2DLEA 4JFPA 5HVHB 1DLHA 4MNQA 4F2MA 1TNNA 1M7IA 1N3NB 3FTGA 4WW2A 1QKZH 1ES0A 3SDDC 1I3RA 1QVOA 4GW4A 1G6VK 3HKFA 4HMEA 4IRSD 2VOTA 3SKOB 2AJZA 4XAWH 4WW1A 4HD9A 3ELAT 2QQLH 3G5ZA 4KQ3H 2GFBB 4YNYB 3QEQD 2CO7B 1N0XL 3UAJD 2R2HB 2FBJH 1NBVH 5C2BL 2BSED 2NY0D 5FDWA 4TVPL 4JY5H 3WFCH 3IJSB 3TM6A 5EBMA 3B5GA 3REWA 2IEPA 3HLAA 1TTGA 5DA0B 3EYSL 32C2B 4H1LG 3TA3B 5E2UL 5F1NA 2B39A 4UT6H 3CAFA 5TDPB 5IB1A 1NL0L 3UTSB 1KGCE 4WI3A 1DJSA 5CJQL 1I8MB 3ZTNL 2FJFA 4LF3A 5JQHC 1FNEA 1OWRM 5KJRH 1RZIA 4GRLB 4XNZC 2MHAA 4FTVB 1BF2A 3MZGB 3MV11 3MUY1 4JO4L 1JIBA 1CLZH 2EXYD 2GT9B 4M5ZL 4X6DB 2EDBA 3RWDA 3NPSC 4BKLA 5CSZB 4Z7UB 1S9VB 1JGEA 1F00I 3BUTA 3JV4A 5C0CA 4NN7B 3D85A 1MJ7H 4W70A 1H5BC 1QRND 4YGVB 3KDMA 3RHWK 3LZFH 3WS3A 5GGSY 4O2CB 3L7EA 4IJ3B 4ONHB 3OKEB 3DUUB 5DJXA 4D0CA 3LB6D 5BS0E 2ZJSH 1U8HA 4ORGA 3T2NL 5LQBH 1FAIL 1RUAH 3L3KB 2BVPA 1GZQB 1YJDC 2O5YL 3TYGL 2HTLC 4TSBH 5ACMA 2KUTA 2BX5A 5DYOA 3MV8D 4AEEA 3SDCB 2ARJA 4Y5XB 4RISH 4JGJA 4U33A 1TCRA 1A2YB 5DS8A 3RNKB 3A67L 3CFDA 4UT9H 2R0WH 3VCLB 1S9WA 2LFGA 5TGBB 1MAKA 4G6ML 3MBEB 4RGNB 1BOGA 2JLLA 2UUDH 2XFXA 4V1DA 4ZO9A 3WYRA 5C0EA 3AXLB 4R2GC 5FYKU 4P46D 1FBIL 1LE9B 4NKOA 4ZOAA 3O8XA 3IXAB 4XPGH 1P7QA 4BZ1H 4TRPH 2AJUH 4WU5B 6CGTA 2CLRB 3TWCH 1D6VL 4L3CB 2X4RB 2J4WL 2FIKB 4FXGB 3GO1L 5C9JA 4YDLB 3MRPB 2R56H 1KJ2A 4OFYD 1W0VA 3ARFA 2PR4L 4M4PA 4CMMA 5HD8C 4Z7OE 2Z31C 5JOPD 1IQWL 2AQ3A 4PJHA 3FB6A 3IXTB 3RWEA 3IF1B 3D9AH 1WZ1L 3U0TA 4GRMA 3RBGA 1YEKL 5JDSA 5DVNA 5I18L 2DQFB 1F90H 4X8JB 3BDBA 3WNLA 4U2ZA 4JEGB 3WFHA 2X40A 4KDTC 4HKXA 3WD5H 1JPFA 3MV7A 4U1MA 5J3HC 2YWYA 4HFUL 4G80B 3EOAB 2BVUA 4PV8B 1QSVA 2HWZH 1U6AL 5JIIA 3F5WB 1A6VL 2LVCA 3S4SG 4BH7A 1UXSB 3AREB 3VDCA 5A16A 4PJ9B 1MHPL 4O58L 3CPLA 5ESVB 1WCQA 2DD8H 4JPWH 1QSFD 3QRGH 4Q9QH 4UINH 4KRPB 3JWDL 4LK4A 3I3BA 1V8HA 1FDLH 1X4ZA 3W9EA 2BSSB 3IFNL 5CILH 1J8KA 4B5EA 3WJJA 3O4LA 1MSPA 1WBXB 4PFEA 1UM4H 1AR2A 4FG6D 4JGMA 5DRZA 4ZXBD 5ITFB 1T1WA 3U9UA 3TA3C 3ZT5A 2ZCHH 1QRNE 4S0TD 5I1GL 1XGYH 1U92B 3C87A 5GRVL 3HMXL 3U2SA 1VDGA 4YHIB 1FC2D 1PLGH 1KIUA 3OR7A 5ACZB 2EC9U 4PJFB 1MH5A 2OR7A 3DV4A 4OZIA 2E8YA 3IKKA 5D93B 4CGTA 3MRDB 5F9WB 3MV8E 1KELH 3Q1SH 5SWZB 3QIBB 1MFEL 3EKCA 1G7LA 3MRKB 4MDIA 5J13C 4GQ9L 1YPZA 5DT1H 3RY5A 3I84A 1N8ZB 1I3GL 4P5MA 1I3VA 4IJ3C 1Q9LA 1AKJA 5A2JH 3T65B 1J0HA 1MWAA 5JTWA 1ZGLB 1NUNB 4XCCH 3QPQC 4GXUM 3O3BA 2V7NB 4F57L 4HWZB 4EDXA 1ZT1B 1X5KA 3FQXA 1QHOA 2UZXB 1BFVL 1II4E 1KCSL 2VZUA 2AV1A 5C09B 4M93B 1IGTB 3MA7A 4PJIE 4NRZA 4Y5XC 2PTVA 4JN2A 3AY4A 4X6CF 4C55A 1HSAB 3Q5OA 2WBJB 3HZVB 1J0YA 1K5NA 3WE6A 4IMKC 4JO3H 1A3RH 1L6ZA 1RIHH 3D39D 2VWEE 3MZTA 2M26A 2OJEA 1KT2B 3J8F7 5IVXF 3RL2A 1X6LA 4F3FB 5GS0D 3MBEC 4R4FL 1T2XA 5C6WH 3N85H 5HHVH 2DQEH 4PJBE 5FCUH 3HNSH 1BD2B 1UJ3C 4PB0L 2GKIA 2LE9A 5GGUB 2I24N 1I8LA 1JJUA 3DWTA 3EOTL 2GY7B 5CKGA 1FO0B 4G9DA 4Z7WA 4X9IA 3MUGA 1VKXA 3T1FB 2YKLL 1G6RL 1IT9L 3ILPB 3RPIB 2GUOB 3CDGA 3BI9X 2IPUK 1ADQH 1QSFE 3GSVB 3D0VB 5CMAA 5DRNA 1F4HA 1RULL 3MCG1 2J8HA 5ICZB 3QCTH 4XBPA 4XB8A 1I9RL 3IT8D 5TFSH 1DUZA 1NGXB 1S5IH 1SHMA 2VKXA 1QTYT 1KIPA 4D8PA 3DVIA 2I25N 1CR9L 1D9KA 5GS0H 1E4XI 3BRFA 1PFCA 3DRTB 3AREC 2F19H 2EH8L 4PJ9C 1G9MC 4DKFL 4FFWD 3VFSB 3C8KA 3HI6H 1CFSA 4QLRA 2QTEA 4KRPC 1W72B 1K6QL 4LLMA 4J6RL 4UV4H 4MDJB 1QO3A 4WRLA 5HHMB 4CADB 4YFEA 1TNMA 5FOBB 5BXFB 2WLZA 4BFEA 3T0EA 1ORQB 3PHQB 4PGBB 4BH8B 4I4WB 3MA9L 5DMKA 2ZPKH 5JA9A 4FS0A 5E8EB 1HCFX 43CAA 1DVFC 4Y2OA 4M48H 4F7PB 4MA7H 4H88L 5IEHB 3U0WH 1BJMA 3QDMB 3PGDB 4OLYH 4E41D 4KI1A 5CP7A 4OGZA 2VE6B 3MRHA 4MS8D 2ENYA 5D93C 2YPLD 4QRRB 5IVXA 3VGFA 5F9WC 2NY3C 3LQZA 5D9SB 3U36B 1R3HA 4J12A 3DARA 2D3VA 4NZTL 1A1OA 3NH7H 1G9NC 2UUDK 2ZSWA 4OD2A 3UTPE 1AO7B 2MQ0A 4R90H 2K9UA 5A2KH 4FQHA 4GG8A 5DD0L 5B39B 4NM4H 1S7QB 1HKLL 3D39E 3MR9B 1YEIL 5E4IA 3QH3B 3QUZC 5DUML 2D7OA 5I1HL 4HW6A 1MVUA 3O9WC 2C4XA 1MCPL 2JTDA 5JO5B 3S36X 3T8XA 2FGZA 4R6UA 5IROC 5BRZD 1B4JL 4YHYC 1XZ0A 5HDBE 4NQVA 3AFLA 2WBJC 4FQXB 2BDNL 1JK8A 5F6IC 3EYQC 3QULB 5C0IB 2IADA 2JCCB 4YHPA 4IOIA 5D71H 4Y4HA 1JUFA 2XYCA 3HI5H 1H8SA 3QDGB 3TVMA 3TYFA 5I66A 3P73A 2N4IA 4IHOB 5C0CE 5IT2H 3TBWB 4JFFA 5CWSA 3QJHB 5T1LA 1NC2B 1P2CB 3O41B 5GISH 1NGWA 2H1PL 4RFEA 4KGLA 1BQSA 3BEWB 5D5ME 2UWEB 4MVBC 1A6AA 5KS9A 3NIFF 2R1XA 1YEJL 3MJ9A 4R96B 3S35H 2Q87A 2D7PA 3C8HA 4AENB 3ZKNC 4U1LA 1VFAA 4QXTA 5IBUB 3RA7L 2GJZA 2BRRH 3VE0A 3H42H 1RZ8B 3EO0B 2GSIA 3AB0C 3O3EB 2E7LC 5DC4B 2FB4L 3GSOA 4HUNB 4FZEH 5EORL 3BH8A 3RBSA 5KSBF 4POYA 2VDOH 1JPGA 4P9MH 2FZ3B 4HF5L 4QHNB 1RMFL 4K8RL 1AXSB 3C6SB 4L3EB 1U3HB 1HQ4B 3DOSA 1KCKA 4OJFH 5KAQF 2RCSL 1RK0B 1X5ZA 5KVDH 2VDPH 3RWHA 4ETQA 4OB5L 4PJ7F 5DEFB 1DQQB 3MBXH 2CKBL 2VO5A 1ROWA 3AMLA 4XH2B 3UO1H 5IIEB 1DBML 4K7PH 1J11A 2NW2A 4YQXL 3QFJA 4Y4FC 4U31A 3VW3L 1G7HA 4NYLB 3SDXB 2APFA 2NY6B 3LKQB 4NHUB 1F6AB 5I17B 3F12A 1HHJA 5DJZB 2WNGA 1KB5H 1M1SA 4JG0H 3QXDA 1ZHLA 3V0WL 2V5YA 4XMLH 2JELL 4LKCA 4NUJA 1FVCB 1KB9J 4P5TD 4V2CB 5DQ9B 1UWGL 2E3VA 4YZFF 1RZ7H 1X5FA 1CXEA 3AS1A 3V5KA 3MV7E 5C08A 2C4FU 1MI5B 1F4AA 4E42B 5BRZE 5TF1H 2A9NL 3C08H 4Z7NF 3PWUB 2R0LL 5F88A 1Q94A 4JFXB 5I71B 3P30H 5IB2B 1R3KB 4LPUA 5I1CH 1OSZB 4BQ6A 5D96B 1L0YA 1UT9A 2DJUA 1J05B 4QHMA 3MLUL 1NSNL 4OKVA 4R7NB 3V52H 3SGDI 3WHXB 3BKML 4HPYL 4ZNEE 2XWBB 2FH6A 2QHRH 2BRQA 3JV6B 3DTXB 2IG2H 3UTZA 1IGYA 1G7QB 1YEHH 1JNJA 2E9JA 1HXMB 3LDBB 2JJSA 5T33H 5E00A 2AK4D 2AABL 1JYVA 1V3JA 2YUXA 3FO0L 4FQXC 4XNXH 5INDA 1I9JH 3DGCR 3P11L 1NFKA 1CK0L 1Q0XL 1I7UA 2XN9D 3MFGB 1ZLSH 5ILTH 1QLRB 5I8OL 2CD0A 3MLYH 5DZNA 5FFLA 5EU4B 4HWBH 2O61B 3VXRA 5JW5B 1FCGA 1P4LB 1J18A 4P9HH 3KLHC 3I2CL 2BJMH 5DJYB 3TNMA 4MXQC 3RVTD 3BMWA 4PJ7A 4KWUA 3ES6B 5HVFB 2D7TL 4K71C 2EC8A 4K23L 3O2VL 4GBXA 3DXAB 3IDNA 5HI5D 1H3XA 2NY5H 3FQTB 1PBYA 1MJ8L 3LEVH 1N59B 1W8NA 2ESVD 4PG9B 5D7LB 1XGPB 5AZEL 2IQAB 5B39G 2RAMA 4FHBD 1RSFA 4BQCA 2W9DL 1IC5H 5D7IE 3QB7C 3FL7A 4FMKA 3RUGA 2EZ0D 4KRNA 3ZHLA 5IR1B 4UAOB 4U1IB 4QXUL 4LSVH 2Q7YB 5F7MC 2GW5A 4LVOB 1ZWIA 1LP9F 2FIRT 3I6KB 5CBEB 2G5RA 3N1MC 5JIHA 1I9IH 5FYJE 5CCKL 5SWSB 1QFWM 2V7HB 2DQJH 1UB5B 5DJDA 5GZOD 5IB4B 5MENA 4Z7WE 4UDUB 5BVJB 5DJ2A 4ZDHB 2NY6C 3JSSA 4MCYA 4QCIA 2R1WA 2XA3A 4NQCB 4OLWH 1NAKH 2HJKA 5IESH 4ZTPL 4YXHL 4JRYD 5T3ZD 3E6HA 5AD0B 1MFCH 4NN5B 4HIJA 3DETD 4U49A 5L7XL 4UILH 4CW1B 4R7DA 5T5FL 4PJAF 3QIWD 4N8VA 1KTKE 4EXKA 1XR9A 3QG6B 5B3JF 1IAII 2LU3A 3LKNA 1RZJL 1JF1A 4PJEE 3G5YB 2C9AA 3QXUA 1KSRA 2FECI 2E27L 5I71C 4C56D 1FIGL 1AHWA 1HILA 5KANG 5L8LB 5D96C 4OCRH 3RTQD 2F5AH 4JPKH 4P4KD 1T0MA 2PYED 4HKZA 5FA4A 4WDIB 4PRHD 3D0LA 4LSPH 1EVTC 4RX4A 2P44B 4UNVA 4JDZB 1I8KB 3V6OA 4NGHH 2DIBA 4KK9C 5KSVB 3U4BH 3AS3A 3TBYB 3VG0H 5DUPH 5C07B 1EO5A 4KJQD 1QA9A 1JF6A 3NA9H 3QUXB 5MI0B 3RWJA 1CL7I 2K7QA 3CXDH 4UB0H 3LDBC 4GKSB 4BKLB 5HGHB 4X8XA 1QZ1A 4LIQL 1QBLH 4X7TA 3NOIA 3BPLB 2F53B 3STLA 1XEDA 2B1HL 3I6LE 2X70A 5T3ZH 2XXMB 5BJTB 5CINL 3RGVD 1MFAH 5J11B 3W11C 3ARQA 2IALA 2XQBL 3GMPA 3H7BA 3GJEA 4RRPA 2Q8AH 2NY7L 4JVPA 3U6RB 1FYHB 1E4JA 4YHOH 1XF1A 2DBJA 4JKPH 4WI5A 15C8H 4FQJH 4ZOEA 3UTTA 1PYWB 2VAAB 4PJ8C 3RDTA 1GL4B 1XGQB 3HE6C 2ID5A 4OZGB 3VG9B 4U0RB 4JZNA 1A6PA 12E8H 2G5BA 1NAML 1FNLA 4ODVH 2HMID 4X4XB 1MRCH 1WWBX 5DK0A 3ARBB 4WTZA 2NYYC 4PRDA 2JK5A 3MODH 1QKZL 5L6YH 4IMLA 1EEYA 2V9RA 1IAIM 4HZLA 1I85A 1JV5B 4LDEB 5IFHH 3CSYA 2BVQB 3BD4A 1NUFA 3ILQC 4XAWL 3IKCA 3QDAA 3EJZC 4ZPTA 3VGAB 2QQLL 5AAMA 4KQ3L 5F3BB 1MCLA 4PJAA 2OI9C 1SEBA 5E08H 4XNYH 2HFTA 1ZHNA 3SJVB 2FBJL 4G8FB 4HFWA 3MLTA 1NBVL 4JFFE 3KPNB 3O2DA 4JY5L 1W0VB 3WFCL 1U8MB 3MNZA 4NQXB 5T3ZE 5I30H 5D2NE 4NO2A 2VDMH 2OSLA 3K3QA 4HIEB 1DBAH 1I1AA 3IJYB 5FGCE 3OB0K 4QRUA 3C9NB 4LSTH 5ISZA 1U8JB 4UT6L 3SHSA 2R29H 2WW8A 4PY8J 4QTIH 1YC8A 4J1UA 4C56E 3KNBA 1B4RA 3P4MB 2BVEA 5C0JB 5KJRL 3K2UH 3ZKMC 5IMMB 2YPKB 4XGZA 1KFAH 1CLZL 4NN5C 3DVNA 3LCYA 2QJDA 4IRSA 2ICEB 2LV4A 1E4KC 2VLME 1HHHA 4O51A 2QR0A 1OGTA 1F45A 1MJ7L 1FQ9C 2R2BA 3FT4B 5CGMA 3A6CH 2XPGB 1T1YA 3LZFL 2DM3A 1KLUB 2DS4A 2WWMD 2ZJSL 5LQBL 4RGMB 1RUAL 2XWTB 3PWLA 5CJBA 2YRPA 4PJBF 3BEVA 7CGTA 3RZCD 4M3KB 3FKUS 2WAHA 1KIRB 4TSBL 3QFJE 3VWJD 3ZTJH 3DNKA 4R3SB 4QF1A 5ICYB 3O6FB 4RISL 1OB1A 4Z7VA 3TO4D 3ARZA 4LSSH 5MI0C 4PGDB 3IAQA 4PPTA 5DRWA 4FNLH 4PG2C 1CE6A 5BV7H 5E9DA 4UT9L 2R0WL 4Y1AD 4GG6A 4R4ND 4UOJA 5HGAA 3KLSA 1WBYB 2WUCH 1BZ9A 1ZGLP 3BPLC 3RVXD 4F9PA 5J11C 3K2MC 5C08E 3SCMD 4XPGL 1I3UA 2ZOLA 4BZ1L 3KPMB 4TRPL 2AJUL 5F3HB 3TWCL 2X4TB 1UCBH 3U30B 1A47A 4EJ1C 3SGDH 3VXOA 4X6FA 2YZ8A 4WI9A 3GZKA 4LPWA 2R56L 4G9FD 4YK4B 4JRXD 3A6BH 3OL2A 4LARH 2KZWA 4F7MA 4UT7H 2FR4B 2Z92A 4U0RC 4HQQH 3D9AL 4XZUB 1VEPA 2RB8A 1ZEAH 5CGYD 2Z9TA 4QKXB 4Y5VA 1IZJA 2B7DT 1GVIA 3CLFH 3KPQA 1F90L 5LGJB 2HN7B 3ARBC 2XKSA 3FB5B 4MAUH 4DQOH 4ZO7A 3WD5L 4OLEA 1A6ZB 5CD5C 1IGCH 3HC0B 1HDMB 2DYPA 3NPZB 1YQ2A 4JFDA 3F58H 2WQ8A 3WSQH 4E0RB 1GOHA 1U3JA 5FUZH 4HJJH 1MJJB 2HWZL 5CHNA 1BIHA 5TDOA 1J1PH 5FCSH 5K93A 4JPVH 4H26B 3VXRE 2DD8L 2LQRA 4JPWL 3LKPA 3QRGL 4Q9QL 2IANA 4UINL 4CVZA 1G6RB 3B9EA 4GMTH 4LQ1A 1HNGA 1FDLL 1DE4B 1EPFA 5CILL 3GSNH 2W92A 4NRYA 3QUKB 1OGAA 4BA8A 4LVNB 3IDJB 1UM4L 3KAAA 1X3DA 2VLJD 5IW3A 5CSBA 1R24A 4KGJA 2GCYB 2P5ED 5FM5O 2ZCHL 1XGYL 2CLZA 1CGSH 4ODXA 3H9SA 1YECH 2XTJB 4TYUA 1JPST 3EJYC 5E6ZA 2RHEA 4C58B 1PLGL 2DMBA 4Y19A 4I0PB 5C0NC 3IFPB 4UDTB 1JWUA 3QDJD 2C1OB 3VD5A 1Y6MR 1TQBB 3RUGE 2VXVH 2CDFA 4LRIA 1NGZB 3QUYD 1KELL 3Q1SL 5GSRA 3K7UA 1CFQB 4JZOA 4LCWB 4PRNA 1CFTB 3MACH 3WXVH 4Z76A 5DT1L 2P1YA 4Y1AE 1ZANH 4RGMC 4TSAH 4XCCL 3WIHA 2X4UA 5IJKA 2PN5A 4J4PC 4HCRH 4PJDA 4PUBH 3VFVB 4X7DC 2C26A 4KC3B 5CIPB 1HYSC 1FNGA 4X6CB 5I75B 3LRSB 1GGYA 2X1OA 5D5MF 4MJ5A 5D1ZD 3VXNB 3VXQB 3T77A 4JO3L 3K74B 1A3RL 3S37X 1AH1A 1RIHL 4ZUVA 3BQUA 4MCZA 4JFYB 3B9VA 3R8BB 3R0MA 3PWPA 3S97C 3WDJA 4EQ3A 1IAIH 1ZA6B 2F54B 2Y1VA 3QI9A 4G9FE 3QEHA 1ZAGA 4JRXE 2VH5H 3N85L 4Y4KC 2DQEL 5HHVL 5FCUL 5HBBA 5KG9A 3TNNA 1IKNA 1RJZA 1JHTB 1NPUA 3HNSL 4WFHD 4OLUH 3QQ4B 4UNTA 1F4XH 1BVLA 1UZ8B 1P69B 5J1AA 2XNAA 3FRUA 1YN6B 1XMWA 5A3IC 2YSSB 2BXZA 1EV2E 3S96B 4MAYD 3B9KC 5FUCE 4FFYH 5HVGB 3SDDD 4GH7B 5EO1A 2CO6B 3SE4C 5B38B 4O9HH 4W6YB 2P43B 3HAEH 5GRJH 1QACA 4KMTH 3RY4A 2FHCA 2XRAH 2Z91A 2VQ1B 5DGQA 4HWNA 2ZCLH 5ENWA 5GS1C 1S7VA 2ZUQC 4OFPA 1ADQL 4ZSOA 5JZ7C 5EBLB 3VH8B 2ZUWA 2UYLA 5I66B 3QCTL 5EOQH 3DROB 5CAYB 3BPOC 1SYVB 5TFSL 4HUWB 4OFIA 3WN5C 1S5IL 3MV9A 4N0FB 2YS4A 2E6PA 1WEJH 1MHEA 1P84K 2HJLB 5GS0L 4S11A 3BWUC 5C0FB 1AFVH 4GAGH 2F19L 1K2DA 5L2KA 4NNYA 5C3LD 3CU1A 2QLVB 4OBRA 3HI6L 1H3GA 1DN0B 3L3IB 3IRPX 3L5XH 4UV4L 3QDJE 5F9AC 2OTUA 3LKOB 2WP3T 4KDWA 4M61B 2EE9A 3MUZ1 3UTTE 4ONOA 1U58B 1CICA 4LVNC 4NO0A 1IC4H 2VZ3A 5C70A 1H15A 3FFDA 3CZFA 4O02H 4NHCH 1P1ZB 4L8DA 1XGTB 3DGGB 4WHTB 2ZPKL 3RL1B 3MRMB 4MB5A 5J6HB 4M48L 3U0WL 4MA7L 2VDLH 4QHLB 5CJ8A 3LV3B 3IFOB 2APVA 2VLLB 3G5VB 1A7RH 3PXJA 1QLFA 3GBNH 4I0PC 4IEFB 4JFQA 4OLYL 5DURD 5DQJB 2X1QA 2HTLD 2CKBB 1TQBC 3V6FA 1OAXH 2OL3A 4NQUA 1S8DB 5T1KD 1JMZA 4MZ3A 3F8UB 3NH7L 1U93A 4R90L 5D72H 4PRBA 3OHXB 4WNQA 4NQDB 1FL5A 4WHYH 4NM4L 4YEEA 4OD3H 2P7TB 4BSVB 4MJIA 5F7HA 2P5WD 4LLQB 1BPVA 4UUJA 3GKWH 3U7AA 1KC5H 1IEAB 1XCQA 4KTYA 4WFHE 4FQPA 5I15H 2AXGB 1A6TA 4O00A 3L3OA 1DCLA 4KK5D 4NDMA 3VXSD 3IAGC 1LE5B 1AGDA 4QTHB 3S5LA 3PHSA 4LCUA 4WHCA 2VZOA 2WV3A 4LLAA 4L4TA 3JWNC 5FK9A 4DVRH 1JZ5A 5D71L 3OKOB 5HD8D 3G6AB 3HI5L 4WO4A 2Z31D 4JGUA 1MCOH 1WZLA 5IT2L 1YJDH 3OAUH 2VDKH 5LAXA 5DK2A 5IQ7H 1PZ5B 5D7IF 5GISL 4RWHA 2A83B 4EUPA 1IJ9A 3I02B 5BZWA 1KLGA 1P5VA 4LMQE 3ALXA 5CJ5A 1CQKA 1NBYA 3FJTA 4PTTB 4LHUD 1HXYA 3S35L 5JLZB 4P2QA 3FAXA 1UB6A 4Y2DA 3TZVA 5I1EH 1XIWA 2BRRL 3KXFD 3H42L 2PW1A 2DLIA 1XF3B 3ZE0E 5INDB 2G2RA 3C5ZA 4FZEL 1R5VB 5KSBB 5HHPB 3ZDXF 2E7BA 2VDOL 4P9ML 4E5XA 3MRBB 4IRJA 4GG6E 2RGSA 5AG8A 1JWMA 1ZGLM 4OI8A 5I2IA 5C8JB 1WCBB 1U8PB 2VL5A 4OJFL 5KVDL 5DSCB 2VDPL 4DK3A 1D5XB 1YNKH 3VXPB 2NX5A 3MBXL 5JPMB 3CH1B 4HX1B 1BREA 1FZJB 2CRZA 3N50A 3UO1L 3O3AB 4K7PL 2ED9A 1I1YA 3W9DB 1ZVSB 3ARDD 5MEOA 4E9LA 1B0WA 1ZKAA 5DTFB 4PJEF 3B8SA 5HYJA 2PO6A 4GO6B 5GGSA 3WNMA 4BFIA 2ZWLT 1FG9C 4WJ5A 4G6KH 5E8OA 3STBA 1KB5L 1ZSDB 4JG0L 5F89A 3QCVH 5B8CB 2GI7A 4KJPD 4Z0BH 4QOKA 4XMLL 1QQDB 5B38G 2BNQB 5IP4A 2VTFA 2G9HA 3QPQD 5ICXA 1RZ7L 3BFOA 3L7FB 3WS6C 4BFBD 3TBTB 3BP5B 3Q0HA 1BAFH 3B6SA 5C0BA 5TF1L 4RWYH 4JFDE 3C08L 2EYSA 1J87A 1FFOA 2VQUA 4I18B 4JDTH 3P30L 5GJSH 5I1CL 3TIEB 1A21A 1SJEB 3QP3A 3VH8G 1TVHB 1S78C 5DJ2B 3VFUB 4OZHF 2IANE 1N4XH 2EDYA 1EZVY 1E27A 3V52L 3ARWA 2SEBA 3GIZH 1EXUA 2X4SA 3ZMRA 2R0KH 1G1YA 1FZMB 1OGAE 1ZHKA 3TT1H 3SGKA 3VFNA 1CI5A 1EBPA 2QHRL 2VB5A 4GAYA 2IG2L 1YEHL 2CH8A 4XCNA 5ID1A 4U1GB 3KPRA 5T33L 3TF7C 1KCLA 2Z4QB 4OIAA 4PJXA 2A6DA 3VI3E 4RMRA 4ZYKA 1MHHA 1MQKH 2IAMB 3H9SE 4XNXL 3EFFB 3ARUA 3AM8C 4I48B 2W38A 1MCJA 3ARGA 3CU7A 4LVHC 1NEZB 2C3VB 3MOAH 4Y19E 1EHAA 5CZVH 1I9JL 5D1QC 5D2LE 5D7JD 3VDBA 3EBAA 1ZLSL 4OF0A 4OCWH 5ILTL 1QBBA 4APQB 3MLYL 5K9JH 4HG4J 4UBDC 3KXFE 4HWBL 3B9AA 3ESUF 3DV6A 4P9HL 4F7TA 3HRZA 1QYGH 2BJML 4P23D 2V9TA 2AEWA 3V6BR 5DVLA 2Z0BA 4K07A 1OWWA 3EOBA 1UVQB 4J8RA 3CMOH 4KKLC 4PJ5A 5E8PA 2H6PB 4WU7B 4PJDE 5TDNA 3LH2H 2NY5L 1OF2B 3LEVL 4XRCA 4Z77B 1OW0A 4QT5A 1CQYA 1IC5L 1T80A 3VRIB 1JCKA 2APTA 3FOMB 1F6LL 2J8UF 3E2HB 1ZTXH 1WAAF 3QFDA 4BSJA 3F62A 4NQSB 4KMQA 3MUHL 4LSVL 1CDHA 4I5BA 1AJ7H 5HHOA 2NXZB 5KSUA 1LP9B 2H26B 5GGRB 5FGBC 1I9IL 4UV7H 4YFLF 3STZA 1FL6B 4MD4A 4NCC2 1OM3H 1DVFD 1KV3A 4RFOH 1VGKB 3ULUD 4KUZH 2YEZB 2DQJL 1K3IA 4W4OA 1NAMB 2VDRH 2G5BB 5DJCB 3KWWB 3PDDA 1JI2A 4OZHA 5GHWH 3D3VD 2NY3D 5KSAB 3TH2T 3MMEA 4ZAKB 2VKWA 1QPXA 4JQXC 3SKUD 1EGJA 4YHMH 5BS0B 3V5DB 1DEDA 4OLWL 1SJHB 1NAKL 5IESL 3SKMB 4M8QB 3LN9A 4ZSOE 1MFCL 1HWHB 4ELMA 3IDIA 4HC1H 4UILL 1GZPB 3QUZD 4PJAB 1G9MH 1Y6KR 4RBPH 1KF9B 5J6GA 3ZSTA 3O9WD 4CJ1A 3QQNA 1WT5A 4MHHI 3PV6A 4LLWB 2I9TA 1AXIB 4Y16A 1D5MB 2I5YH 3BH9A 5DVKA 1YN7B 1IMHC 4JR9H 2BNRA 4OCRL 5T1DH 1EMTH 2F5AL 3EYQD 4G42B 4JPKL 4X9FA 3QEGH 5ISZB 2A0LC 4LSPL 1CN4A 2DTSA 3F7VA 4U6HB 4NGHL 3WUWA 5KAQG 5EZLA 3U4BL 3VG0L 1IM9D 1M4KA 5DUPL 3HNVH 3NA9L 1QD0A 4N8CH 3LN5B 3CXDL 1U8QA 1FNSH 4PTUB 4U1GC 4UB0L 2P47B 3CZJA 4GW1A 3E6FA 4Y5YA 4IRSB 2FH8A 2DB8A 1RZJC 1G9NH 2XG4A 3H9HA 3L3GB 4YWGH 3C5SB 1QBLL 5HY9A 1NJ9B 4YDKH 2BOBB 4GKZB 5T3ZL 3QEQB 1FZOA 2J8OA 3QWOB 4PRID 1MFAL 4AM0B 3PP3H 5AZ2H 5GZNC 3ZKND 1SEQH 5IJVB 3DRQA 4ONGH 4APQC 2NY0B 1WAAA 2NTFA 4WY7H 4L4VA 3BIKA 3QNZA 1QBMH 2Q8AL 1MUJB 3OXSA 1XGRA 4OF8A 3BP4A 4HV8B 4LLVB 4PRAA 1HH9A 4YHOL 3QIUC 4HS3A 4I0CC 4UQ2B 2NZIA 4JKPL 15C8L 1P6FA 3HS0B 4FQJL 4JRWA 2PKDA 1G7IB 4RIRA 4MJIE 1CIUA 1WK0A 3SKNB 4HBQA 3GMOA 5DRWB 4ZOCA 12E8L 4G6AD 1KJMA 4ODVL 3Q48A 4CDHA 2D2OA 3IDMB 4G8GD 1MRCL 1XR8B 2OM5A 3IDXH 5ADOH 2QSTA 3MODL 3C60A 3LN4B 4MB3A 2V2XB 2ZCKH 5L6YL 3ULUE 2IPKB 4KI5C 4X6EB 4GRWH 4PV9B 4HIIB 2A74A 5C0DB 2CDEA 4YIQB 3UP1A 3QZWA 5IFHL 3TPKA 4PGEA 4MNHB 4OUOA 4AH2B 5HHNA 2HFEB 3KR3H 5JA8B 1FFNB 1QRNB 1PZUB 1KPUB 4NWUH 3BP7B 2Q20A 1FE8H 1KB9K 3IU3A 5E08L 2A6JB 2VUYA 4XNYL 3PV7A 2FRGP 4XWGH 4N1EA 5E5UB 1AR1D 1G0DA 3NCBB 3Q2CA 3FONA 3I50H 2VQTA 3S3SA 3UMTA 5JOEA 1NEZG 5I30L 4D0BB 1H3UA 2VDML 4H5SB 3MV8B 4YEFA 3RWGB 1BMGA 3ECBA 1DBAL 1HIMH 3WNPA 1RHHA 1KCVH 5DD1H 4LSTL 3NFPB 5F97E 5DJ0A 3BYYA 2R29L 4QTIL 2YD6A 3S37H 4HLZG 4LLDA 3QG7H 5ESQA 5BO1H 3P9WB 2LU4A 1XF2A 3MRIB 3K2UL 2DYPB 4ZFFB 4HHAA 1KFAL 3KYOB 1CGXA 5CHNB 4M6NH 4P46B 2YRLA 4FXKA 2LU7A 5E7BA 1NBZB 4W6XB 5D1XD 4OV5B 4U6TA 3BE1H 4F7CB 3L95A 4RAUA 1T7WA 4G43B 1LQSR 5LG1A 1BIIB 3A6CL 4LSQH 3ZL4H 4RQQA 4L8CA 4ISVB 4GRWE 1EUTA 2ZNWA 5IFAH 3PWJB 1YEEH 1S7SB 2GJ6A 2OQJA 4YBQC 2ERJB 2Z35A 1JP5A 1JGDA 4PJBB 4QRSA 4BQBA 5E6IC 5JORA 4RRPG 2VXTH 2C1PB 3HUJA 1OPGH 3QEUA 4GW5B 4F9LA 3QWQB 3K1KC 4LSSL 5I73B 4FNLL 3FMGH 5BV7L 3BWAB 2YD9A 4MXQD 4JM2D 3UTQB 5FO9B 1MCFA 3QNXA 1PKQE 2WUCL 5GSRB 3MRLB 1X5HA 4JZOB 4UOW0 2Y07H 2Q6WB 2F8OA 1ZVYA 4CAGA 4NKDB 1T89A 3CFBB 4F8QA 1CXHA 1VFBA 5C0BE 2AAVA 1QSFB 3L3DA 1NCBH 1LGVA 1T5XA 3HE7A 1DQMH 1NQBA 4FRWA 4GMSH 2QSCH 1NC4D 5JHDA 1UCBL 2CIIB 4HH8A 1RU9H 5IMOB 1JMXA 5FYLD 1NCNA 4J3XA 4ZXBB 3JUYA 1ONQB 1OQXA 2NQCA 3ROLB 1YMMA 3A6BL 4LARL 1Y6NR 4X9BA 1U8LB 4UT7L 5HVWA 2J12B 1U42A 4HQQL 3KPOB 1L0QA 4Q97A 4UNUA 1ZEAL 4NQEA 1T3FA 2W07A 3QR2A 2IPUG 3B4NA 4JFOA 3CLFL 4ENEC 1NDGA 3KPRE 4MAUL 5IMKA 4PD4K 4HDIB 2EXYC 5K59E 1CTNA 4DQOL 1S7TB 3OF6A 1QSED 3QQ3B 5H35B 4HSQA 1IGCL 4LCCA 4KV5E 3UBXI 1BQHA 3FQRB 2D31B 3GMRB 3WHE0 3F58L 3WSQL 3KG5A 4NZUH 5FUZL 4HJJL 5I1AA 4RBPK 5E94B 1J1PL 3FN9A 4MD0A 1MVFA 4YO0B 4JPVL 3LB6C 1TZIA 4FQQB 1PQZB 4I3RH 3UPAA 3IGAB 4GMTL 5KOVC 1EAPA 3NCMA 3GSNL 4HJ0C 3QUMA 1Q9KB 3T4AB 1IGFH 5K9OA 3L3JA 4TNWF 4M6OH 4PY7B 5FYLH 3NZ8A 5F7DA 2MWCA 3KPSD 4EIZC 1L7TH 1CGSL 2C7UA 3D39B 5I6XB 3DI3B 1MCBA 1YECL 2VLRA 2ZOKA 1FH5H 1EDQA 5GSVB 4R0LA 1T04B 2VDNH 4OQTA 3AAZB 2YPVH 1T5WB 3W81A 1G0XA 2WIMA 4P46C 2VXVL 1PG7H 4XX1G 1UZ6E 3GIVB 4JAMB 5EUOA 1CDUA 1KJVB 4NNYB 2IWGA 4ZUTA 2EYTB 1NFDA 4LEOA 5HHOE 3MACL 3WXVL 4IIQB 1RFDH 2VWEC 4G7YH 1FG2B 3PP3K 3P2TA 1C5BH 1BX2B 4IDJH 1ZANL 2ERJC 4TSAL 5TH2B 3D69B 1ITCA 1C1EH 4HCRL 4PUBL 3NCJH 4J2XA 5C9KA 1SQ2N 3W11D 4IOFC 1AC0A 5K9KA 1OHQA 1M71A 4X5XA 2UVEA 4KH2A 4CNIA 5I9QB 1EFXD 4XCEA 3PL6A 5D5MB 1A4JA 5IBTH 1LEGB 3UDWC 1U41A 4AJ0A 5IQ9B 3B2VH 2DMKA 1I9EA 3QO1A 4Z95H 5C0GB 3V6FB 3BW9A 5I76A 1GOGA 3BN3B 3BOVA 2VR9A 3UPRA 3PGCA 1IAIL 1PW3A 2HRLA 4PLOB 2VH5L 3HE6D 3W0WD 4X98B 3OQ3B 2FECL 5DDHB 3TN0D 5BQ7B 4OLUL 4C83A 2CRYA 3K8KA 1F4XL 4K9EC 1MIEH 1XT5A 2J1KA 4P59H 1JGLH 4YC2B 1G1CA 4ZFOL 1C12B 5LWYH 4OFDA 5FO7A 2NYYD 1BWMA 4D94A 1HHKB 3VXMD 2A38A 4FFYL 3U83A 3G5XA 1DLFH 2FSEA 4FQ2H 1G7PA 2HJFB 4O9HL 3ILQD 5GRJL 4EN3A 4KMTL 2X9YA 3WIFA 1TJHH 3EJZD 5GGTH 1JYWA 1A14H 1QRKA 2XRAL 4MXVE 4JKWA 1LILA 5IEKB 2BNUA 4H1LA 2ZCLL 1RJLA 1CIDA 3PG2A 1Y0LA 1IAMA 4E41B 5DO2C 5HI3C 3HG1A 3RU8H 4BYHA 4XMKH 1FLRH 3VWKC 3OGCA 3HPLB 1WTLA 2YPLB 4XTRD 2HVJB 5EOQL 3BP6A 4JREB 5DA4A 1JTOA 1WEJL 2Z8WC 4MB4A 2YBRB 5F9OH 3KPSE 1ETZB 4K7FA 1BM3H 1C5CH 1NCAH 3X11A 2J6EH 1AFVL 4GAGL 1RZGA 3E3QE 4WW2C 3GUTB 3ZKMD 2EDHA 5JDJA 3QAZB 3L5XL 3U79A 3FT2B 5BRZB 4TUOA 3RWCA 3DIFB 1BFOB 1MNUH 4L8SA 1IC4L 4S10A 5DD6B 5CFHA 4P2RA 1I8IA 4O02L 5SWQB 2VISA 4NHCL 1XGUB 1YNTA 2NXYD 2PCPB 3TBSB 1MY5A 1J8HD 2ADGA 3RX5A 1QEWA 3GGWB 3X12A 4LLYA 1ZA3A 2VDLL 1HKFA 2H32H 2KQNA 4ZPVB 1A7RL 3GBNL 1OOAA 2Q3AA 4OGAC 1YQVH 3L5WB 2X5PA 1OAXL 4X7CC 4BZ2H 4RZCB 1WVZA 2XKNA 3P9LB 1FSKC 3MLSH 4C59B 5D72L 5EUKB 4IIQC 4U05A 1I1YB 5JOFB 3DMMD 4OD3L 2H2SC 1FN4B 3RNQA 3EIFA 3FO1A 5EIIB 1UADC 3GKWL 4L3AA 5HJ3A 1KB5B 5KOMC 2BC4A 1KC5L 3W0WE 4CN4A 3MOQA 5F1KC 1KULA 1LK2B 5FECB 4GKNA 1MEXH 2W60A 5I15L 1IL1A 2XKUA 3U7YH 3GMNA 5DVMA 3PWVA 3ROOB 1AD9A 3VXME 5DI8B 3VFWA 3FFCA 1FPTH 1GGCH 1ZMYA 3RJDA 3MRCA 3D1MC 3OKDA 4PRPA 4DVRL 1TCMA 5JXAH 3BZDA 4LOUD 4JFEA 1Q9WB 4G7VH 4JCLA 1MCOL 1FGNH 3VGHA 3HZKB 4OUUA 1YJDL 3MPCA 3OAUL 2VDKL 3AU1B 2X41A 1T22A 1TJGH 3OXRA 5D7IB 5IQ7L 3GSUA 1E4WH 3OKLA 3S4SA 3BJLA 5GIRB 3QISA 4X0KA 1HN1A 3TCLA 2R2EA 5J7CC 5HYEA 5L2JB 4OAWA 4XC3H 5CD5D 3SY0A 4QGYA 1U8OA 2R23B 2DLGA 2XG5A 2IQ9H 3D48R 1EEZA 3O8XC 1F2QA 5I1EL 5MEPA 1C16B 2EIZB 5EPMA 3IS0X 4LPYA 4DZ8A 3ZHKA 4M02A 1JGVH 4YH6A 1FZKA 1KNOB 3LD8B 1Y18A 4U3HA 1BOYA 4NT6B 4P5TB 4WFGD 5EA0H 2PXYD 5E0QA 3RIAF 4HK0B 3ZDYE 3SDAA 3LOWA 2ADIA 2ATKA 3BD3A 2A73B 1G7JB 4LCYB 1JTTA 1WTGT 2LABA 4JE4B 2YD2A 1J8HE 1INDH 2VLKA 1EJOH 2A1WH 1YNKL 4QRPD 1UQSB 4OCYH 1JFQH 5C0ND 1N3NA 4QHKJ 1JZ4A 5JHDE 2XA8H 3QAZC 3LEXB 2YA2A 3OSKA 1AGCB 4PJEB 5TQ2H 3SKOA 2BVTA 3GMMB 4H8WC 5EG6C 3CJJA 2AK4B 2ICCA 2HP4A 2GFBA 4G6KL 4U3CA 4YNYA 3K80A 2R2HA 3QCVL 2R4RH 1H3WM 4Z0BL 4QRTB 4YPGB 3HFMH 5F1IB 3MOBH 2XN9B 3NN8B 3IJSA 4N90D 3WJJC 5CBAB 3W39B 2CLVB 1MHCB 4H0GA 4JM4H 1BAFL 1OP9A 5JXEA 4RWYL 32C2A 5EIQA 3TA3A 2OP4H 1Z5LB 3GBLA 4JDTL 5GJSL 2XZZA 5LGKA 3CCHB 3TGXA 5J1TC 1MFNA 1F4WH 1OTTD 5TDPA 5L0QB 3UTSA 1FL3B 1I8MA 4OZHB 4XC1H 5L8KB 3SGEI 2A2QT 3VA2C 1N4XL 1X5LA 4GRLA 1CXFA 4FTVA 3P77B 4RAHA 2GT9A 3GIZL 4X6DA 4Y4KD 2R0KL 2ESVB 5CSZA 3TT1L 5ERWB 4Z7UA 1S9VA 1A3LH 1DUYB 5A3ID 2VRAA 3QCUH 4YGVA 3VJ6B 1MQKL 2JJVA 4XPTH 1EEUA 1KTRL 2PYFB 3B9KD 4O2CA 4ONHA 3OKEA 3ZKXB 1KG0B 3DUUA 5H94B 3MOAL 5CZVL 1YEDB 4Y16B 4P57B 2WP3O 5IFJB 3WFEH 3L3KA 1XCTB 2EIDA 4XPAH 4OCWL 2ADJB 1GZQA 5K9JL 5EUOE 4J3TA 1H9VA 4M7ZC 3SDCA 1D5BB 3VU2A 4Y5XA 4J3SA 5IHZB 3B8YA 1A2YA 1QYGL 1ZT4B 4OFKA 2OZ4H 1FNFA 4WFGE 4IMKA 3LPGA 3RNKA 4ZQKB 2R4SH 3VCLA 1VACB 4HKBB 2E7CA 1AE6H 5TGBA 4L8BB 4PBXA 2FJHB 1LO5B 3CMOL 1ZV5A 3MBEA 3MXVH 3OKKB 1T0NB 3LH2L 4GW1B 1K4DB 3GSQB 4F7EB 6FABH 1ZS8B 3AXLA 4XP9H 1URLA 5JIPA 1LE9A 1TQCC 3MGOB 3B9DA 3S7GA 2XY2A 4JRYB 3IXAA 4WUUD 5D2NB 2G75B 1I8LC 4QRPE 3VD4A 2QSVA 2X4PB 4DKEH 3QIWB 4GUPB 4P5TC 4WU5A 2CLRA 4OCNC 2J8UB 4L3CA 2X4RA 4KMLB 1ZTXL 2FIKA 3GJFH 3HZYB 4FXGA 4P9HC 3MRPA 1MAMH 2XZCH 4Y0GA 2AJVH 3RGHA 1AJ7L 4C56B 3OAZH 4DGYH 3DSNA 3IXTA 3IF1A 4UV7L 3RTQB 1OM3L 4P4KB 4RFOL 2PYEB 1CBVH 1D6EB 4PRHB 1KN4H 2DQFA 4KUZL 4U0QB 1BBJB 2VDRL 4OCLC 4UU9B 4X8JA 5E70A 1OVZA 2VABB 2H8PB 2FHBA 5F9JB 2Y06H 3THMH 5GHWL 2A6IB 4M7LT 4P5KB 5IUSA 1LO3H 2ICES 4GRWF 1D9KC 4G80A 4PV8A 4YHML 3F5WA 2G60H 1UXSA 4MJ2A 3AREA 4PJ9A 1R3JB 5J0BA 5ESVA 3H2WA 5EOTB 2FL5B 5DR5H 4DJMA 3HG1E 4HC1L 4P49A 2R15A 1G9ML 3RGVB 2ARWA 2BSSA 3M17B 5C6TH 3KPPB 4TUKH 3T0EC 1WBXA 1W8OA 1YEFH 5GGQH 5ITFA 1AQKH 2I5YL 1A1MB 3ZYJA 1U3ZA 1RJYB 1U92A 3GI8H 4JR9L 5ABDE 3BPNB 1ED3B 1EMTL 1RHHB 4P3WA 5T1DL 3QEGL 4YHIA 1TFHA 4Q6IB 5JMRA 3MFFB 5ACZA 4PJFA 4OV6F 5HI5C 43C9B 3GFUA 5EO0B 3BGAA 4TTGA 3MRDA 3HNVL 4P2RE 5BZDB 5SWZA 4N8CL 5EOCJ 2NLJB 3QIBA 1I7RB 3GB7B 1FNSL 1K4CB 3MRKA 2JJWA 4JHAH 3BD5A 1LO2H 1G9NL 1AI1H 1FFQA 4YWGL 1N8ZA 2W65B 3FZUC 5KN5B 3VXUD 2YR3A 4YDKL 3T65A 1AC6A 1ZGLA 4HK3J 1SVCP 1IARB 3FB8B 4OZFH 2V7NA 4CKVX 5AZ2L 4HWZA 1SEQL 1ZT1A 4ONGL 1UC6A 5JMOC 4WY7L 5C09A 1IGTA 3U46B 4WUUE 1QBML 2BY0A 3MLRH 1HSAA 1UEMA 2WBJA 4OD1H 1RUMH 3HZVA 3OJVC 4S0SD 5GZOC 3H9ZA 4KV5F 5I0ZA 2Y4SA 3D2UD 1KT2A 1UJTA 4Y4HC 5BV7B 2XWJA 1EO7A 4F3FA 4S1DC 2FEDC 1FV1B 1SYSA 4NO5B 4J3VA 1NGPH 1BD2A 4N0YH 1FORH 2LVEA 3IDXL 3EDEA 3RX8A 4HUUB 5ADOL 3VFMB 1UM6H 4MA1C 5D2NC 3G08B 4A6YH 2ZCKL 3GM0A 5GGUA 3QIWC 3NCFB 1Q0YH 2VZTA 3FFCE 1FO0A 3KR3L 4NWUL 3CFEB 3GMQB 4S2SB 2FGWH 1FE8L 4X7EC 3T1FA 4EEEA 2BMKB 3PDOB 3B3IB 4WWKD 4XWGL 4TUJB 3ILPA 3RPIA 3DURB 3I50L 4KROD 2EXWC 2GUOA 2JIXD 3RZCB 3ARYA 1TPXB 3QWRA 1X4YA 3GSVA 4OT1H 4OLVH 3D0VA 3VWJB 3O6MH 3T0AA 1HIML 3GM8A 1KTDB 1EERB 1AGEB 4X4MA 1KCVL 3MRQB 2DKMA 1OP3H 5ICZA 5DD1L 3TO4B 1NGXA 2I9LA 3S37L 2X9XA 2HFGH 3QG7L 5BO1L 1QSZA 3IDYB 4KK8D 4JM2F 1M6OB 5C0AD 1JNHB 4ODTH 5FKPB 1F3DJ 3DRTA 2OYPA 4K3JH 5DK3A 4YXLH 3VFSA 1A6UH 3MRFA 2WANA 2B8OT 4M6NL 1W72A 1FCCA 2EIEA 3RGVC 2O5ZH 3SCMB 3BRGC 4MDJA 4S1QH 4CADA 2KKQA 4Y4FA 1NFIB 3BE1L 3K4AA 1WITA 5FOBA 5TPWH 5BXFA 3GSNB 4LSQL 3ZL4L 1ORQA 2YN3A 3PHQA 4PGBA 4BH8A 1LD9B 4QEGA 4I4WA 5IFAL 4HIHB 1YEEL 4FQLH 2J5LB 5E8EA 4G9FB 1UXWB 1JYXA 4F7PA 4JRXB 5IEHA 5DHVB 3NZ8B 3VXUE 5D1QD 5E99H 4Q6IC 1U8KB 5JHLH 4LPTA 3QDMA 3PGDA 2VXTL 1ZLUK 3QO0B 3LKRB 2VE6A 1OPGL 4R0LB 4QRRA 4DUVA 1QNZH 4G8EB 4QWWD 5D9SA 3U36A 2CUHA 4JHWH 2CXKA 3FMGL 1AO7A 2AXHA 1QFPA 1FYTD 4ZUSB 5KW9H 5B39A 3T08A 5E8NA 2VITB 1S7QA 1TXKA 2YUZA 4WTWA 3V4VH 3MR9A 3CFKB 1AIFB 3QH3A 4MXVF 5EIVA 5DLMH 2DM4A 2Y07L 3QJFB 5IK3B 2WUBH 1F13A 5D6DA 5JO5A 3GJFK 1NCBL 1TVBB 4ODUB 2W9EH 1DQML 4GMSL 2QSCL 4MQSB 1YUHB 2IH1B 1V05A 3JTSB 3Q3GB 3OAZK 2HH0H 1U2HA 4PJGE 4FQXA 4OIIH 4XI5D 1RU9L 4WFED 4AK1A 3QULA 2VXSH 5C0IA 2VLJB 2JCCA 2IC2A 2P5EB 4FTVE 3DYOA 5BV7C 3M1BB 5F1OB 3UX9B 1L9MA 1SY6H 3C6LD 3QDGA 2NNAB 4IHOA 5FHBH 3TBWA 1Z6JT 1CXKA 3O45B 2AJ3B 3QJHA 3QDJB 4OM1H 1NC2A 1P2CA 3O41A 3ARVA 3BKYH 1OCWH 3BEWA 3QUYB 4ZFOB 2UWEA 4GBXC 4U1JB 4R96A 3G6JE 1FRGH 1A0QH 4NZUL 1P4IH 2OXHA 4AENA 1A1NB 3HAEB 5SX5H 1G7PB 1RQ5A 4EKXA 4DFIA 9CGTA 2E9IA 5C0AE 1RZ8A 3EO0A 4I3RL 1KIQB 3MREB 3O3EA 3MGAA 2AVGA 2FATH 3RZCC 1TPXC 4GAJH 4LCIH 2AI0H 4CU6A 4O2EB 1CVSC 3VWJC 4HAFA 4NJAH 4QHNA 1IGFL 4M6OL 2KL6A 1AXSA 3C6SA 5FYLL 1YYMH 1KN2H 3TO4C 5D1ZB 1U3HA 1HQ4A 4HWUA 1L7TL 3LAFA 3ZTJG 2P42B 1RK0A 4H20H 4ZODA 1FH5L 3BP6B 2VDNL 5DEFA 5H37H 2YPVL 1DQQA 3AROA 5CP3A 2F15A 4XH2A 3ARPA 5EU6A 5CEYB 5IIEA 1MPAH 1W2KT 1PG7L 1KBGH 3SCMC 4RMWA 2F8XC 4OCMC 3T3ME 3ARRA 4NYLA 3F7YB 3LKQA 3SDXA 4EI5D 3N9GH 4NHUA 3PWNB 4MAYB 4MD5B 1JZ6A 1F6AA 3FHAA 4I3SH 3TLRA 5I17A 1RFDL 4EXPX 3MYZA 4G7YL 3SDDB 4GT7A 5DJZA 1C5BL 1V3LA 1C7SA 3LIZH 4IDJL 5EZOH 3EO1B 4ODBD 2CSPA 5LVEA 3QHZH 4KPHH 4DOHE 3PABB 1FVCA 1C1EL 4Y89A 3NCJL 5HGBB 5DQ9A 4RSVA 3U7WH 1MI5A 2AQ2A 2J88H 4E42A 2ED8A 4KUCD 3MLPA 2X89D 5IBTL 3PWUA 5FUCC 3B2VL 3UJIH 4JFXA 4Z95L 5IB2A 3ET9F 1R3KA 1OSZA 3QIUD 3MRNB 3JWOC 1CE1H 4WFEE 4U7KA 1J05A 4HBCH 2DDQH 4R7NA 2FJGB 2DL9A 2L4OA 2DOCA 2VDQH 2EE3A 3KPTA 4GKOA 2I60H 4G3YH 1X5YA 4P2CG 3WHXA 3WL9B 4XP4H 4HEME 3U0PB 2XWBA 1MIEL 1JL8A 1JGLL 3JV6A 4P59L 2YD3A 3RNQB 5BCAA 2GK2A 8CGTA 4XNZB 1LNUB 2P8LB 5LWYL 3DTXA 3EYFB 1U2CA 1G7QA 4PLJC 1V7MH 1HXMA 4HXAH 2EE6A 4KI5D 2MQ3A 3VA6A 3NPSB 3OX8B 1DLFL 4FQ2L 2GIYA 3DX9B 2N1KA 2X42A 5ID0B 2EC9T 1H5BB 1TJHL 3H7LA 3IYLW 4PJFE 5GGTL 4Z8FH 1A14L 1UYWH 1KGCD 1Q72H 3VI4E 1ZLWH 3SDYH 2YD8A 1QLRA 1LEKB 5SWZE 5EU4A 1F42A 5DURB 1OP3K 5IW1B 2O61A 5JW5A 1CGUA 3RU8L 3VFTB 1P4LA 1CYGA 4XMKL 1QFOA 1FLRL 2BY1A 5DJYA 5FO8B 5T1KB 3QUYC 2X1PA 4PJ8A 3ES6A 4OTXH 1HSBB 1J1XH 4D2NA 5F9OL 4JFZH 3K46A 2H41A 4ZTOH 3DXAA 1Z2KA 1BM3L 1C5CL 1NCAL 3NIDE 2J6EL 3FQTA 1N59A 4PG9A 5D7LA 5GQBA 1XGPA 2P5WB 1RUKH 2IQAA 1U0QA 4M6AA 4XP5H 2V2TB 4JVWA 3BZ4B 1I85C 5FV1L 2XIDA 1IGJB 3CDCA 4R2GB 1MNUL 3GRWA 3F7QA 5IR1A 4B0MM 1T1XB 1O7VA 2R0ZH 4P0DA 4U1IA 4YHKH 3V8CA 3VXSB 4HT1H 2JF1A 5D1ZC 2Q7YA 5IF0B 1C5DB 3MROB 4R4BB 1CLOH 3I6KA 5CBEA 2Y7QB 1N5YH 4OGXH 5SWSA 2V7HA 3V79C 5FGSA 5EO9B 2Z31B 1DBBH 3WKNA 1I1AC 1YQVL 1EFQA 1FFRA 1UB5A 5EBWB 4I2XE 5E6ID 4ZNCD 3FQNB 4K2UH 1UKSA 5IB4A 5I19H 4BZ2L 5CD3B 4MA3B 4UDUA 5BVJA 3WV0A 1MCDA 2OTPA 4ZDHA 3MLSL 4MAYC 4RAVB 4MMZC 4GAFB 4LHJB 5EZJB 5D2LB 1FP5A 4NQCA 4LHUB 4N0UE 2NY2C 4OZ4B 5AD0A 5F21B 2FO1A 5I8EB 4CW1A 3KXFB 3VMNA 1E4KA 2RFXB 1MEXL 3QG6A 4QHUB 3HAEG 3U7YL 4JN1H 2DI9A 2JJTC 3G5YA 1WUNT 4LBEB 3HZMB 4KI5E 1FPTL 1GGCL 2QKIB 4XBGB 3P4NA 5JXAL 4WDIA 4G7VL 5I1JH 4JDZA 1I8KA 1FGNL 1AXTH 5KSVA 1RK1B 3RKPA 4L3ED 1TJGL 2GSGB 3TBYA 5C07A 1S9XB 1E4WL 4Q2ZB 3QUXA 5CEZE 4ENED 4JG1H 1WJ3A 2LTQC 4PG2A 4S1RH 1P84J 3ARDB 1NMCC 4GKSA 2VERN 5DJ6B 5HGHA 3CFIC 3H0TB 1MCKA 4K7PY 5SX5K 1B88A 4XC3L 2YZ1A 3BXNB 3BT2H 1HE7A 4D0DB 1CFVH 1CD1B 2F53A 4F9PC 2IQ9L 1GIGH 5BJTA 5J13B 5ECJE 5HHXH 4P2OC 1ZK9A 4WGVB 5ALBH 1JGVL 3SOBH 3FHQA 5DFWH 4MNGA 3MNWB 4BQ9A 4FP8H 2D4DA 3OKYA 5EA0L 3U6RA 3SO3B 3MQIA 3MCLH 4NC1E 2RQ8A 4HJ0D 1PYWA 1NCCH 2VAAA 4NPYB 4ZO6A 1XGQA 5CLWA 3SKJH 4OZGA 5FA3B 5C2UB 4M43H 4YDJA 4HZAA 2MMXA 1INDL 4Y5VC 2DKUA 1EJOL 2A1WL 3QSKB 3EHBC 4X4XA 4X5WB 4MA8H 1OY3B 4JFHD 2AEPH 4OCYL 1JFQL 1BBDH 2W59A 3ARBA 3P4OB 4RNRB 2L0DA 2XA8L 3PQYD 5B21A 5IMLB 4WHYG 3FN3A 5TQ2L 1UJ3B 1JV5A 4XNQB 2EYRB 2BVQA 2JCCE 4F33B 4NM8H 4KK5C 1EA9C 5F3BA 1Z0NA 3L9RB 5LGHH 3SJVA 4G8FA 2R4RL 2GITB 2A9MH 4HGWB 5D7JB 5JIKA 3KPNA 3HFML 3MOBL 4N9OB 1U8MA 4NQXA 3QHTC 1YNLH 3DHJA 4HIEA 1RHFA 4JM4L 3IJYA 4IOFD 2OP4L 4P23B 3C9NA 2ZUYA 1D3CA 1KXVC 1U8JA 5LCVH 2PW2B 3S34H 1F4WL 5I1KH 2BOCB 3OAYH 1LO0H 2XZQH 3P4MA 3F7RA 4XC1L 1IFHH 1X5AA 5C0JA 5FIEA 1NLBH 5IMMA 2YPKA 1WBZB 4LRIC 5IG7A 1E6JH 2ICEA 3BHBA 4I8DA 5HDQH 1A3LL 3SE9H 5DUBB 4L3EE 1DQDH 5IHBA 5F7EH 5E2JA 2A6KA 3FT4A 3QCUL 2XPGA 1D5ZB 1N5AB 4XPTL 3V0VB 2UVFA 1ZLWK 3D87B 1KLUA 4N0RA 2P8MB 1U91B 5IJKC 1J0IA 2XWTA 3BKJH 1F02I 3WFEL 4H25B 4XPAL 4J4PA 3HMXA 1KIRA 4XVUD 5F7UA 3AS2A 3NFNB 2VUOA 1DVFB 4R3SA 3D6GA 4C57C 1XH3B 3BVNB 5JR1H 5ICYA 3O6FA 4X4YB 3JUZA 2OZ4L 1KPRB 5DO2D 5HI3D 3DX8A 3ZHDA 4PGDA 4X83A 5HYQB 3VWKD 2F74A 3ARDC 2R4SL 3L5HA 3QI9C 1AE6L 3D3VB 2NY3B 1WBYA 3KYNB 2AEQH 1IKNC 3EFDH 3MXVL 4N9GB 4LKXB 6FABL 4XP9L 3ETBF 4MNQD 2C4FT 1MI5E 4JZJB 2I27N 4KJPC 4HXBH 4XP6H 4LHUG 4JFHE 3VD7A 4K9EH 3QUZB 5DVOA 3KPMA 4DKEL 2VN4A 5EC2B 1EEQA 2YXFA 5F3HA 3O9WB 2X4TA 4X7SH 2F58H 3PQYE 5KZCD 3WUZA 4U7MA 3SO3C 4M7LH 4OFVA 4YHYB 1MAML 2XZCL 2AJVL 3UTPD 5A40E 4DGYL 2FR4A 2DWEB 5F6IB 4XZUA 5B4MD 2FX8H 1CBVL 3T2OA 1KN4L 2Y5EA 2XWJB 5LGJA 2HN7A 2ORBH 3WLBB 3FB5A 4OGAD 2MCPH 3P3YA 1SYSB 4P3DB 5JPNA 3SE3C 5J06A 2Y06L 1IZKA 4HS6B 4DFHA 1IM9B 3V6ZB 1HQRB 3THML 1X4XA 1A6ZA 3WLWD 3HC0A 1NUGA 2DQIH 1HDMA 1LO3L 1XF4B 4GRWB 1U3YA 4NKQB 1BWWA 4E0RA 3GSXB 1MJJA 1T66D 5GS3A 2G60L 5D70H 3BZFB 1G7MB 3O6LH 5D7JC 4H26A 2H2SD 5DR5L 4NNPH 3QA3B 4PRIB 1G6RA 1DE4A 1CICC 3WKMH 3FO2B 5T1MB 5C6TL 4KY1H 4TUKL 5C0CD 3QUKA 5J56B 1H3VA 3D85D 3IDJA 3AB0B 1DL7H 1YEFL 3NTCH 5GGQL 1AQKL 2EDRA 4Z7QF 2AQ1A 4P23C 2GCYA 5C71A 3DX7B 4AIZB 3EZ8A 3GI8L 4MQXC 4RMVA 1PKQB 2GHWB 5D7LE 4TPRH 4I0PA 3CVHB 4X5LA 3IFPA 4UDTA 5D6CB 2I9LB 3JVGC 4N0CC 2C1OA 2CUMA 1WGOA 4G8GB 2AKRB 2XXCB 5E5RB 1NGZA 4KVCH 5EOCH 4M62H 2X10A 4J7RA 3MRFB 1CFQA 4PJGF 1CXLA 4LCWA 3NZHH 1CFTA 5CZXD 4JHAL 1LO2L 4YHNB 4M1CD 1AI1L 3R8QA 4Y4FB 4JVUA 1IGMH 1MLBB 2VXUH 5FXCH 4NSKB 4PYHA 4V1DD 4NWTH 3DHMA 3F7PC 4D9LH 3GEWB 3DUSB 2FEEI 3VFVA 2ADFH 3O8XD 5CIPA 4U1KB 1P7QD 4MNQE 3GHEH 3HR5B 3N1GC 3ULUC 4TTDC 4X6CA 3LRSA 3M8OH 3MLRL 3P9MB 4OD1L 4PJCF 1RUML 3VXNA 3VXQA 1A7BA 1CFNB 4MQTB 4NN6C 3G6JF 1NGYB 2X7LB 3EO9H 4JFYA 3ARFD 3TH3T 2ARJQ 2NZ9C 2EDQA 3CC5B 4BUGA 2F54A 1ZA6A 2C3WA 5FB8B 2M2DA 1NGPL 1JHTA 2W0FA 4N0YL 3RY6C 1FORL 3QQ4A 5E8NB 1FJ1B 1UZ8A 4JZJC 1WICA 1S5HB 1UM6L 4A6YL 1YN6A 3D18B 2NY4C 4FQ1H 1F4YH 2YSSA 3S96A 1Q0YL 1F97A 1L7IH 1VCAA 3BN9D 3MV7D 5F8QC 5D1XB 1A5FH 3UYOD 1CDJA 4YFLI 5B38A 4IDLA 2FGWL 2OTWB 3TZVC 5AUMB 5FGRA 4HIXH 1CLCA 5INCB 1IQDB 3FOLB 2VQ1A 1MCEA 3S3PA 4ZFGH 4DZBB 1A02N 1GPOH 1QHPA 5F7YC 2BSTB 4OT1L 4OLVL 5EBLA 4L5FH 3O6ML 3R1GH 3VH8A 1Q1JH 3O4LD 4J3WA 2CIKB 5HPMB 3OAYK 4HJGB 4YDVB 3DROA 1SYVA 3OKNB 1KJ2H 4HUWA 4N0FA 2HFGL 4OI7A 4U4BA 3IB4A 4JM2B 2HJLA 1TTUA 4TVSa 4ODTL 1F3DH 5C0FA 4K71B 4K3JL 5FM5M 4YXLL 1CDIA 2NW3B 3W5NA 1A6UL 3HC4H 1HHIB 1DN0A 3L3IA 3HPJB 3LPFA 5E24E 2O5ZL 4MMXC 2EEBA 4S1QL 4LQFH 3RWFB 3LKOA 4PBVC 4M61A 1UM5H 1U58A 5IVNA 4RGOH 4EVNB 5TPWL 2YK1H 1X5JA 3RHWF 3NIGE 5E5MB 1JNLH 1NC4B 4IOSD 1P1ZA 4H8WH 1XGTA 1AY1H