4TSAL

Structure of a lysozyme fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
210
Chain Sequence
b'VLTQPPSVSGAPGQRVSISCTGRSSNIGAGYDVHWYQQLPGKAPKLLIYGNTNRPSGVPVRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHSYSCQVTHEGSTVEKTVAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
molecule tags Immune system/hydrolase
source organism Homo sapiens
publication title Structure of a lysozyme FAb complex
rcsb
total genus 39
structure length 210
sequence length 212
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tsaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tsaL01
5JMRA 4HEPG 3O6MH 4PRAB 1XF5A 2WIIB 5HVWA 5DFWH 4OZIB 4PJCA 1PX3A 5MEPB 3QJHA 2B0SL 4PB9L 4L3EA 3QXDB 1FNLA 4LCWA 5LGJA 4FQHA 1XT5A 3KJ6L 5E8OB 1EGJH 4D8PA 4OGXL 4OM1L 4XC3L 5F7WC 5TDPB 3TWCL 4JFXB 1ES0A 3ZYZA 2GSIA 4JY4A 3SKOA 5IEKB 2HTLD 4ZUUA 1NC4D 1RUML 4LLWA 1QSFD 2C1PA 1J8KA 1WZ1H 4HH9B 4M62L 5FM8A 1YMMB 5BRZB 4NRZA 3NPZB 1CT8A 1E6JL 1U8JA 4E41A 2CK0H 3C5ZC 4UUJA 3FZUC 1FN4A 3DX9B 3X17A 1M7IB 2HFGL 4P2RD 5J11C 4F33B 2OZ4L 4A2LA 5HTSA 1IKNA 3HAEG 3T3ME 3H9ZA 4XT1C 1G7PA 2P4AB 1OOAA 3BPLB 3A6CL 4K2UL 3MCLL 1RMFL 2XA8L 3O2VH 1U6AL 2BVQB 4Y19D 4LLQA 3V0AC 4LU5L 2RHEA 4LRNL 3GMNA 1OCWL 4QNPE 2XNAA 3D25B 4OJFH 3RA7H 4FOMA 3QEQA 4UI2A 2DYPA 3A6BL 5I2IB 1CGSH 1EO8L 3IYLW 4XBPB 2Y7QB 1HSBB 3S34H 3HZKA 4Z95L 5DUBB 5CSZA 1ZVYA 3T2NH 3CXDH 3CGTA 4ZQKA 5F3HA 3TJEH 2F5AL 4MWFA 1BZ7B 4CGTA 1S7SB 4K9EC 3OB0H 4MDIA 5DVOA 2DN7A 1BLNB 2HVJB 4JFQB 4K2UH 1M7DB 4JFXA 1T20B 5JPNB 4EDXB 1ZXQA 4P3DB 5IHZA 5GQBA 1WCQA 2DM7A 2FJGA 4LU5H 2DWDB 4BQ9A 1MRCL 2GSGB 3B3IA 1GPOL 5B3JF 1P7KB 4GQ9H 3MJ9L 3PQYB 4BH8B 2J4WL 5J1AB 3HPLB 5JIHA 2QJDA 3DO7A 4K7PX 3O4LE 2DAVA 2XZQH 4WW1A 4X7FC 3FQWA 1INEH 3RPKA 5H35B 5KVFL 1D5ZA 4WFGD 4UT7H 5HHPB 4DGVL 1BVLA 4ZUVB 3QA3B 4P5MA 5FOBB 5MEOA 3QDJE 2OS7A 5D1XC 3ARSA 4TSCH 4WHTB 1E6JH 4K8RL 2OP4L 4POZD 1Y0LA 4RFOH 1A21A 1FH5L 4OV6F 4OCSH 3MA7B 1JHTB 3BESR 3ULVC 2VXSL 2Q76B 1KGCE 3ZT5A 4OZGB 4NN7B 4PJ8D 3HUJA 1BQSA 1SJEA 4Y19B 3H9HB 3QPQC 1UH3A 4Z7WA 3C8HA 4BSWA 3ZE0E 1JTPA 2AP2A 4NN5B 3EOBA 3LKQA 3REVB 4PGCA 4YJZL 3FB8B 3V4VH 2XTJE 3RUGF 1UYWH 1B3JA 1OCWH 3K8KA 2CR3A 5JZ7D 4GW4A 1AC6A 2P47B 4TSCL 4R4BB 3LZFH 5FYKU 4AM0B 1F11B 4QRPE 4KK5D 5DD3H 4CNIA 5T3ZE 4PJ7F 5B38G 4U49A 3FHAA 2X1PA 4Q6YA 5TH2A 1WSST 1H3PH 2VLJD 3MBEA 4OQTL 1A14H 5F8RC 5FM4A 4KDTC 4S1DC 4PGZA 5HHOA 2GJZB 1YPZA 1EAJA 4D0DA 4R9HA 3LDBB 5GS0C 1FYTD 3PGDB 1N64L 4H0HB 1AGCB 5GS3A 4APQC 1XGTB 4AL8H 1FG2B 4LEXH 1JIBA 4F7PB 4Z8FH 2VR4A 2ZUQB 3DRTB 1JN6A 3NIGE 4QHNA 1DBBL 5J11B 4BUGA 3O2DH 2NY5H 3LN4B 4LSRL 4LAJH 1GOHA 4F15B 1TQBC 3L3HA 4WFED 4YUEL 5I1LB 2OK0H 3I6KA 1K8DB 1R24A 5E9DD 3P2TA 5DD5H 5K59E 1NMCB 3QEUB 5BJTB 4M1GH 4JPIA 3V5KA 1U2CA 1FDLL 4DTGH 4OI7A 3OBAA 1YEGH 3UPAA 1U41A 4K8RD 3NGBC 1JF1A 1OTTC 4BZ2H 1A6VL 3MLWH 4Y1AB 5MHSE 1IL1A 3J7HA 1QBMH 1OB1B 1KFAH 1M05B 3P9LA 4P9HH 2EDJA 4FQXD 4HX1A 2MQ3A 2BSSB 2DWEB 4P4RA 3VRLE 1P7QD 1C1EL 1FNSH 4JM2B 4RAUA 3JTSB 3T4YB 1KJ3L 4NO5A 2BSED 4XZUB 5B8CC 5DS8B 3O81A 4G3YL 2QQLH 4G9DB 4HS8H 1RUQL 1IARB 5C0DA 4UV7H 5JW4R 3VFGL 2W9DH 3BOVA 3M17B 4LDLB 2ZUWA 1L7IH 4JFFD 1INQB 2R1XA 2R1YA 4JDZB 2HTLC 4I3RH 3GIVA 4LMQE 3KPLA 5DA0B 4J8RA 3RDTB 3AXLA 1EUTA 4JFEA 4GSDL 1T89A 2E7LC 4XVJH 4XCCH 5HHXL 1WWAX 5F8QC 2O61B 3IJYA 3QCVH 2BRRL 1KBGL 5F6IB 3DXAE 4AIZA 4ZTPH 1YEFH 4WJ5B 2B5IB 5I1AB 5IFJB 4LCWD 1AC0A 5IWLA 2FZ3A 5TE4L 1UCBL 4NO0D 3BEWB 4I3GA 4X5XA 3R06A 4PY7A 3MRNA 3VGEA 4N5UA 4MB5A 2N7BA 3C8KA 5D2LE 1MSPA 4P46D 5JLZB 2PCPB 2XN9B 3KS0H 1W0VB 3E8UH 2NW2A 2VZ3A 4NZDA 5GRJH 4XP6H 3J8F7 1I7TA 1IL1B 4XCEA 1CR9H 2O5YH 2R0ZH 1AD0B 1DTUA 3ES6B 2NXYB 4GAYA 2Z31C 3MBXH 1DEEB 4LCWB 3V95A 3G6JF 4KGLA 5E2VH 5C0CA 3UXFA 1PKQB 2AKRB 4LLMA 4RA3A 4X7DC 3OKOB 2V2WB 3QEUA 2EEAA 3QDGB 3MJ6A 5TE4H 4FQXB 2VKWA 4WHDA 5A1AA 4QY8B 1ULVA 3ULUH 4PV9A 1YDPA 4YBLC 3V8CA 1Z0MA 3BWAB 3GSRB 3MRPB 2XN9D 2CKBB 1YEDB 4UDUA 2DQJL 1ZV5A 2Q20A 2DLFH 2UUDH 1PYWB 4I5BB 5IB5A 5KS9A 3BJ91 1T0MB 3DHJA 1T3FB 1GJIA 1MI5E 2P24A 3M45A 5INDB 3FN9A 4HIIA 3PHQA 4GOSA 4Q6IB 1A1OA 1I4FA 2DI9A 3STBA 3N1FC 3QIUD 4FFVC 3QXDA 2GUOB 5LGJB 4J6RL 4KK5C 4Y2DB 2R2HA 1DFBL 1F97A 3KPNB 4L8DA 3FN3A 5F88A 3ULVL 2YMXH 5E2VL 2CRIA 4MA3B 2IQAA 3WIFA 2DTMH 1Q1JH 5IEKA 1ONQA 4XP5H 1JNLH 3MLXH 2GTZB 4XNQA 4OZFH 5C8JA 3GSOB 2FX7H 3IFNH 3L3DA 2NY0B 4DN3H 3LKOB 2YD7A 4OAWB 1UGNA 5LG1A 4PG2A 1A1NA 1T2QH 2VL5A 2GEEA 4JZJA 2G60L 1OARL 3QEHA 1OGAA 3W2DL 2WQ8A 1MCHA 1AD0A 5GS2H 2R1WA 5T33L 1MHCB 3EO1A 4ZYKB 4ODVL 1QSED 1U92A 5HHMD 4EI6B 5KJRH 1QZ1A 5FHAL 5I16A 1WBXB 3BZEA 1IQDB 2JJVA 2BNRD 3OKLA 4XP6L 5MHSD 1TETH 3LS5L 1DQJA 1R5IA 1F6AB 1Z0NA 4X9IA 4UZGA 2UVEA 1BBJA 4PJ5A 4UQ2A 2YPVL 3DUUA 1RHFA 2DYPB 3JV6A 3RRQA 2Y72A 1K2DA 2LAGB 5IQ7H 1CL7I 1O5DT 3OKKB 4KI5E 1MF2L 3CFCH 3TGXA 2L7UA 4M43L 2Y1VA 3SDYL 4APQA 1LEIB 3EHBC 2D03H 3KJ6H 5KZCD 2MOVA 5F9JA 5F7DA 5TPWH 1A6UL 1D5BA 4EN3C 4OFKA 1CFQB 1D6VH 4WV1C 3ZSTA 2BVPA 2WLYA 4L8DB 5BVPH 3ARGD 4LVHC 4MJ6A 1JZ4A 5E8EB 4J3SA 5J9PB 3O8XA 2YUZA 1JE6A 1MCRA 4UNUA 4JPKH 4AZ8A 4P2YA 3KYMA 1NGPH 5JO5B 2FJGB 2XKUA 4C54A 3QNYA 5EO1B 1R3JB 3O4LB 5DHYA 2FEDC 5IFAL 1S9KC 1QRNB 4WCYH 3C5JB 4NQED 1EEZA 1T1YB 1HXYA 3L5IA 5DJYB 3SJVD 4MX7B 2DQHH 4UNVA 3H7BB 2Y5TB 3G6JE 3I75A 2A1WH 4J1UB 3VGAC 1T0PB 3CH1A 3MCG1 3UJIL 3TPKA 1D9KA 4YHMH 1FO0L 4ELME 3ROLB 3GJFK 5H94A 3BZ4B 2UZXB 1B0GB 5F7HA 3K80A 4MJ5B 5EC2A 2VDML 4JANB 2CK2A 5DRZA 4XNXH 2CUMA 3PV6B 1CN4A 1JPSH 3QR2A 1OARH 4OIAA 2DKMA 5D1QD 3WIHH 1MCQA 1H8OA 1NGPL 5AAWA 1PEWA 2NY3B 4XP1H 2NR6C 3LKPB 3ZL4L 1P7QA 4U4BA 1QQDA 5D1XA 1VHPA 1Z6JT 3FQUA 5E2UH 3N9GH 3V0WH 2LAAA 3NACH 2R69L 1W72L 5FCSH 1G9ML 4LLVA 4PRIA 1AR1C 3OGCA 3QAZC 4PGDB 3U6RA 4P23D 4KUZH 1X5KA 2PW1A 2Y5EA 2VL4A 2EEDA 3BH8A 2CK0L 4RGOH 1VSCA 1YC7A 3TVMA 2BOCA 4LASL 1DUYB 1CT8B 4M7KH 3VFRA 1QPPA 2OTUA 1JNHA 1MI5D 1N59B 4YXLH 5IEHA 3ZYJA 1RUMH 1DUZA 3MLZH 5L88L 4LSUH 5IG7A 4FA8A 4XP1L 2G75B 3JWDH 2FLBT 3HC0B 5F1IA 2FO4B 1YMME 3OTTA 1F42A 4UOJA 3ZYOA 5IKCB 5ACLA 1JYVA 3SGEH 4LEOA 2KL6A 3T8XB 4RBPH 4KZDH 4R2GB 3VFVB 2WWMD 3EOAA 1FFNA 3F7PC 3RA7L 3SDXB 1N0XH 3ARFD 4Y5YA 1A6AA 3S5LA 3HKFA 5C9JB 1S7UA 4YHYC 1A0QL 2VMFA 3EYFA 3WUWB 1HWHB 4G8IB 4JB9H 1NAMH 4RAUB 3SKNB 3X13A 3MGAA 4LAQL 5CUSL 2LVEA 1MREL 5CHNB 4MQ7B 5ADOL 4FZEH 4BKLB 1NFDE 2B4CL 3O3EA 3WHXB 5DEFA 1QSEE 2YXMA 2IBZX 1GC1C 2PTUA 4GUPA 1CXKA 2C9AA 1X5AA 4YFLF 4WHYG 1T2JA 1TZHB 3JUZA 2CLRB 4PG9A 5C0ND 3SBWA 4NFCA 2YPLE 4OUUA 1MVUB 3LIZL 2BNRE 2FIRT 3PG2A 1OTTD 2R8SH 1P6AB 2B20A 5FYKD 2LTQB 3QBTB 3BZ4A 3V52L 1KPUA 1RULH 3IKCA 5SX5H 1JHLL 1NAML 1VERA 3E1F1 5DD3L 1FZMB 5KW9H 2Q3AA 1VGEL 5T5FH 1NC4A 2WANA 2Q8BL 2VOTA 4UIMA 4ZAKB 1REIA 3P77B 5A2JH 2YXFA 2HAZA 5SX4H 1LNUA 1EDQA 4RFOL 2FJFA 2JJTA 1RIUH 1IRAY 3P0VL 3BPLC 4HQQL 3HNSL 3W9EA 4M7LL 2YUVA 1ZGLA 3DX6A 4OJFL 1EEYB 5E95B 2Q76A 1ZT7A 5ICXA 3V6OC 4OZFB 5DI8A 4LSSH 1I9RL 1U3HC 3SKNA 3X13B 4EBQH 5IFJA 3SJVE 3ZDZE 3C9NB 4UILL 5CP3A 5HDBF 1R3LA 2NYYC 4E9LA 1NC2A 2BCKA 1SJHB 3EOBB 3LKQB 5EPMA 5HPMB 1N0XL 4NT6B 5GGUA 1S7RA 3C8KB 5BW7C 5ISZE 3EYUL 4KK6D 2QSQA 1TFHA 2AERT 4PJFE 5D96B 1A6WL 4NSKA 1NL0L 2JCCF 2GY7B 1JK8B 2ICEB 2KKQA 5J1SC 3MRRA 4FQ2H 1GZQB 1I9JL 4U1JB 4Z77A 1BM3H 1H3PL 2NY1B 5CJBA 1UQSA 1N5AA 4JCMA 1SBSL 5ALBL 4CRPA 4OQTH 1HHJB 2H26B 4NDMB 2ZSWA 2I07B 1G9NH 2GT9B 3CFEB 1U3YA 4LGRB 4P5KA 5H37H 3OQ3B 3WXVH 2B8OT 1AGFB 1BOGB 4P59H 2BNQE 2OX5A 1RFDH 4DW2L 4U6HB 1NANI 5KSBB 2YD1A 4F7PA 3EW3B 3S35H 4D9QD 5EB9A 3QG7H 4YEFA 1HHIB 1RJYA 3TN0A 3FQTA 2W38A 3IDJA 4I77H 3V6FA 1OPGL 2MKWA 2I26N 2IH3B 3ILPB 3SQBA 2HKFH 5FIEA 4J3TA 3HPJA 2H3NA 3G6JA 4HS3A 1JI2A 1U93A 2VXSH 3MV7B 5IESH 3KLSA 4NN6B 1U58B 1BQHA 2IAMB 4EKXA 5LAXB 4WI4A 4RWHA 3BYYA 1A6VH 1G0XA 2OK0L 2Q8AH 2A38A 3FZUD 4XRCB 1CD1B 1T1XA 4EVNA 2RQ8A 4S1RL 5CCKL 4AK1A 3U1SL 5C0BD 2EXYD 3CFDB 3LV3A 2P8LB 1XCQB 1N6UA 1IFHH 3HMWL 2DBLL 2JCCA 5IR1A 5F9OH 2IAMD 5IMOB 3RBSA 3QO1B 1MHCA 2X4QA 1TTGA 5IM7A 3TCXA 1IGMH 3F7VB 1JFQL 4HV8B 4WDIB 2MNUA 3SKMA 1UC6A 1ZANH 5C2BL 5F7FA 3T0AA 1OAQH 1MHEB 43CAA 3VFGH 5I0DA 4FQ2L 4IDLA 1SY6L 2R9HC 1OAKL 5EOCH 5KSBA 3G5ZA 4P2CG 1VPOH 2FL5A 1KXVC 4J12A 2DIAA 3S8WA 5IGXH 2F54A 4FXKA 4ZSOA 3R4DA 4U0QB 3UJJL 4X6BA 4GAFB 2DBLH 3UC0L 1DSFL 1JVKA 1FDLH 1FYHB 2ICES 1HHJA 2H26A 3KYKH 2LU4A 2D0HA 4OCRH 4TRPH 4NOFA 1U3JA 4R4FH 4MD0B 3F5WA 1FORH 3CFIC 2VAAA 3BDBA 4CAGA 1Q0XL 5E08L 1OPGH 4HFUL 3TNMA 1IC1A 2IALB 3QUKB 2WNGA 5E94A 1C5BL 5A3IC 5HHPA 4G6JH 1XF2B 3MUY1 2NX5B 5GS1B 4ZUSA 3E8UL 2CQVA 3MV8D 2DLGA 4NC1C 3UAJD 3HNTH 5IB3B 4JN1H 3MO1A 2Y6SC 4JN2B 2A6JA 2A9NH 3QUYD 3AS2A 4PREA 2X7LB 3IFOA 3X3GL 1H5BA 3IDGA 3INUH 1RURL 8FABB 5I75B 3F7VA 1JJUA 4ONFL 3WS6C 2ATKB 3BQUA 1MCSA 5C07B 4MSWB 4PGEB 3VXRE 32C2A 4PLKD 4BSWB 4HCRH 4K3DL 4HPOL 3FT3B 4BH7A 43CAB 5F9WB 1S78C 1A4JB 2NY4C 5HI5D 1A22B 5F72S 1OP3H 3FFDA 3BE1H 4U33A 3KPMB 2ADGB 5IQ7L 1IGML 1AGDA 1MF2H 4TNWK 1JFQH 5KSBF 1MELA 1ZLWK 3HC0A 4RZCB 2W0FA 2UZIL 4YHLL 1BZ9B 3MUJA 4OKDA 2H2SC 4X6BB 3CC5A 3RWFA 1U8MA 1C5DB 2VC2L 3S5LB 1RU9L 3SDCA 5CEXA 2JK5A 4BSVB 4JO1H 4YAQB 2M26A 3HAEB 4MDJB 1AHWA 3KLDA 4WU7A 3ILQC 5IMLA 3KPQA 1PSKL 2FX8H 1XGTA 4QTHB 4YHPB 1J86A 1J8HB 1HCVA 2FO1A 1QHPA 3UC0H 3RGVB 2VE6B 3VXTB 2JJTC 4Z5RB 1X5ZA 1N8ZB 1C16A 1G9NC 5DR5L 1R5VB 1FZOA 1Z3GH 1DQQB 4LNRB 2CGRH 3QUXA 2HLFC 2IPTL 4OZIA 1A7BA 5BV7L 4QRRA 3P11H 2CLRA 3D6GA 4MXVF 3TA3D 4HPYH 1XGYL 3FONB 4KTDL 4YBQC 3V5DA 2R4SL 1ODAA 1H3WM 2NX5D 2R0KH 2JF1A 4HC1A 1P4IH 5D1ZC 1OL0A 3DTXA 4MD0A 3RZWA 1RU9H 2CDFB 3SO3C 3UTTB 4GS7C 3IAPA 4I13B 4OF7A 3NH7L 4MNGA 2E9WA 4H26B 1GH7A 2CKNA 2GI7A 4PJFA 4FQJL 3O6LH 1BIIB 1CDGA 2AQ3A 1V3KA 3JWOL 1WLHA 2JJUA 1QR1A 1RURH 4WI5A 1CD0A 4NO0B 1UB5A 2NZ9C 4IIQC 2IPTH 4LLDA 3VJ6B 4JN2A 4ELKA 4HLJA 5CJQH 5C70A 3O11A 2BK8A 2X7LA 5D7IA 1YJDL 4POUB 1JHKL 3A67H 4L4TB 3DETD 1KPUB 3UPRB 1T2QL 2VABA 4Q9QH 5B21A 3OAYK 2XWJB 1ETZB 1EIBA 4MNQE 3P4MA 1UM5L 5IIEA 1J87A 3A6BH 3OJDB 2NY1D 3VG0L 1RZ7L 2DIJA 4U0RC 4L29A 4KUCD 3IDIA 2VR9A 1G7PB 1PLGH 4HH8A 5CJ8A 4U1KA 5TDPA 5FUOL 4JANA 3QXAB 5CJQL 1CD8A 4JAMB 4MNHA 2D9CA 5D5MB 3RI5K 1J0IA 3NTCL 1OSPH 3E2HB 4UTBL 5IB4A 3MRBB 5HGHA 1XIWA 4NRZB 3QHZL 5D7LD 4XPHH 1LEGB 2RAMA 2HFGH 1TTUA 2OZ4H 1B2WH 4QXGH 3IAQA 4S1SH 3ZE2F 3EDDA 1OAZH 2CIKB 2ZUTA 1YZZA 4Z5RA 3UDWA 2WAHA 5DF0A 3RGVC 2EECA 4GAYB 4PJFF 4LL9A 1KYOJ 2EYRB 1SMOA 2JCCE 5EFIA 1MCBA 3PDOA 3OKDA 2YD5A 5E4IA 1UM6H 4GXUM 4WV1B 5AD0A 3MACH 3KXFA 4PV9B 1S7TA 4OCYH 5DC4B 3QEGH 3O3BB 2NY0C 1WWCA 3O41A 5LAXA 1QG3A 1LEKA 4QWWD 1KCUH 3CXDL 4BH8A 2F74B 1HINL 4JKLA 4L9LA 4WEBH 1MHHB 1QFUH 3MLZL 4HIJB 2HJKA 5DC9B 1A3RH 5FO9A 3MLTB 4X6EA 2X9XA 3RVVD 1AXTH 3G6DH 5JPMB 5DEZA 4RMWA 4F7CB 4C59B 4JFYB 4JRXE 3D85D 1S8DA 3TZVA 1HILA 4KHXH 4XB7A 5KAQG 2UY7A 2DKSA 1HWGB 1MAMH 1M7DA 1RZJL 1XF4A 4QOKA 3HNSH 5AZEH 3QUML 3SGDI 3QIUB 4JZOB 4KQ4H 4ETYA 2L0DA 3MV7A 4QRTA 1JBJA 4Q2ZB 2E7LA 1HI6A 1QEWA 3NIGF 5GS0H 1S7XA 4N9OB 2FEEL 1VFMA 1YN6B 3MUGA 1YNLL 5I1JL 1URLA 5CGMA 4UAOB 4O5LL 4UT7L 4N5ED 1FPTH 4ZPTB 1XZ0A 4L3EE 3L3IB 5I18H 1JGLH 3HG1E 3MJ8A 3O45A 4Y4HB 4L29B 6CGTA 2BMKA 4N8VA 2ZOLA 3K8MA 4MD5B 2YKLH 2XN9A 4M5YL 1KJ2H 3LV3B 3QUZB 1QLFA 2ITDA 2CXGA 2UV3A 1B2WL 4F37F 1BBDH 3V9FA 1UVQB 2ARWA 1JHTA 2Z4QB 1DP0A 4X5WA 3U2SA 2EDEA 4LSPL 2X89A 1J05A 4BZ1L 4E5XA 5CEZE 1A5FH 5D1ZB 1U95A 4W6XB 3TYGL 1G0DA 1G7QB 2JIXB 4L9LB 4H1LA 5FGBA 3MGOA 1WZLA 2BJML 3VA2C 5DJ2A 4KZDL 2F5AH 3MCKB 2XRAH 1N4XL 4G8EB 4LSDA 4S2SB 2B5IC 3E6HA 4ZG1A 1HXMA 2DYPD 2ARJQ 3MLYH 1CICB 1HKFA 1V7NH 3QFDA 3VGBA 3VMPA 2XQYK 3AREB 1RZGB 4L1DA 4XI5D 1KJ2L 3HZYA 5IT2L 2AV1A 2P24B 4FFYL 2HT3C 3SDCC 1MLCB 4LCUA 3VH8G 3C60D 4MNQD 5KVEH 2EH8H 3CK0L 1HDMB 2VZOA 3IDMB 4X98A 2FJHA 2L7JA 2QBWA 1R5WB 4H25B 3SOBL 1X9QA 2FX9H 3RU8H 5L6YL 3VD4A 4YC2C 5E00A 1EH9A 3L6FB 3FAWA 5J6GB 2V17L 4LEXL 2AJUH 4PB0H 3VXUB 3LKNB 5CGYC 4IRZL 1N2RA 1DBBH 3G5YA 4O58L 5IVZB 4Q7DA 3CXHK 3DNKA 3HR6A 4DCQA 5FAAA 1MAKA 3U46B 5E8OA 3T65A 4QRRE 3TFKC 3WXVL 3OJMB 1KLUB 4M6AA 1U8PA 4HWBH 2HFFA 4FHBD 4KKLC 5F9OL 4XC1L 1BD2D 1YNLH 4WTWA 1UVQA 4XHJD 2WINB 4O4YH 2HN7B 1QFWL 1JGLL 1FZJB 3IDGB 1CTNA 5CBEB 1PY4A 1U8IA 5DJ0B 5E4EC 4DQOL 3O6KH 4C56B 2AV7B 3RPIA 5DJXA 3FB5A 3OKMB 5DQ9A 5F21B 1VKXB 3GBNH 2EKJA 4BQCA 4MD5A 3AREA 1JK8A 2ICEA 1FHGA 2XTJC 5DGQA 4LDOB 3FFCE 1ZT4A 3Q5YA 1G6RL 5DS8A 4OBRA 3V5HA 4ELMA 4APQB 1LEIA 1NLBH 1ITBB 1QLRA 3EYSL 4KKCC 3QDHA 2BHUA 2BOBA 4N8VG 5GRVK 5GZOD 2GSGA 1INQA 2R1XB 5F6HI 5IV2B 1RZFH 5DLML 2G75A 4K8RH 2XA3A 4MNQA 2Y36L 3O6KL 3GSVB 4PJEE 3QIBC 5D96C 1N2RB 3PQYE 1I7TB 5J13B 4X8JB 3G5YB 4Y8AA 1BVLB 3BAEL 4Y4FC 3B8SA 5F1SA 1PAMA 1QD0A 5BMFL 3RTQB 1ZVSB 2V5TA 5HVFB 3BIKA 4WI2A 2LU7A 3QIWB 3ECBB 2EDTA 5DURD 1U3HB 4KPHH 5EC1B 1MY7A 2P46B 2QKIB 4KK8D 5ETUA 4K3JH 2F15A 1CWVA 1NLBL 4G9FD 1RUPL 3HE6A 4RQQB 1TLKA 3TBWA 5J13C 1OW0A 4ZOEA 2CDFA 3WNKA 5I76B 5GHWL 2ED9A 2YEZB 1DDHB 1X4ZA 2O5YL 1NEZB 4DK3A 4HD9A 1I9IH 2VQUA 4ZNEE 1ZHNA 1D5ZB 2IFFH 3OG6B 4OCRL 4QXUL 2A6KA 2XWTB 3VRJB 3QUMA 5F7LB 1EO7A 4MXWL 1DEEA 4GG8B 1RZ8A 5IGXL 5CEZD 3JV0A 3PWVB 1OWRM 5CIPH 5E7BA 4HJJH 4ODVH 2XY1A 1DLFL 4LSVH 2VC2H 2EDDA 3EKCA 1A8JH 1ND0B 3G6AB 4IHOB 3L1OH 1RK0A 1J0YA 2DMCA 4YXKH 4I5BA 3DROB 4CUCA 5JUEH 3KNBB 1LO3H 1YUHB 1DUYA 4ODXA 2B1HL 1Q72H 2GJ6A 3C5ZA 4FQPA 1T2XA 4AENA 1M4KA 3QEHB 1RK1B 2P8MA 4XVJL 3VXUE 1OWWA 1KV3A 3DBXB 4NBYB 1JN6B 2YMXL 3TVMC 3BGMA 4X7TB 4O2CA 2EYRA 3FOMB 3ZDXF 1M7XA 1Z5LB 1T80A 5DVKA 4X4XB 1ZANL 3HNTL 1IAII 1NCCL 4H0GA 2F8VA 15C8H 4HWBA 1AR2A 5E5UB 3ALXA 3JZ7A 2EIZB 1A47A 1DLFH 5BVJB 5DMIH 1A6AB 3RTQD 2CRMA 4J4PC 4ORGA 2X4UA 5GGUB 1C1EH 3MA9L 1MFBL 2PR4L 4LLUB 3X14B 2A6IB 4ZFFB 3IFLL 3NH7H 2DQEL 4HCRL 4MLIA 1UM4H 3ZE2E 2B1HH 3BO8B 4PRHA 1D5XA 1OGAB 1SEBB 2W9DL 1L0XA 3BIBX 4PLJC 1TCRA 3B2UC 2V9TA 1JRHI 4U1JA 4EEEA 5KJRL 4RDQF 4ZMAT 4L4VA 5T1LD 3EZ8A 3QQ3B 3O6FB 2AXFB 4IRJD 3SCMB 1JGDA 3ZSSA 3SDCB 3QIWA 1WBXA 3ARBB 4HFUH 2VLMD 3BP6B 5FUZL 2XT1B 2ZWLT 4PY8I 1NBVH 1WFTA 5JO5A 8FABA 2X9YA 3MRIA 4Z7NE 3LKRB 5EZIH 1KBGH 5EU6D 1OGTA 1B0RB 3VWKA 4Z7WE 1F4WH 3GJFB 1RJCA 4X4MA 1UCBH 4PV8A 2VNCA 4HIJA 4NUGL 3ARRA 1MLBB 5GRUL 5GSRA 5TPWL 3GSNA 3B83A 3QIBB 1NPUA 4XNYH 3TBYA 4BQ6A 4N0YL 4L8SC 5GZND 1LK2B 4GW1A 1G9MH 2OTWA 4JPVH 4PUBL 3FTGB 4MQXD 3F12A 3TJHC 1D6EB 3C87A 3WCYA 1QUNA 1B0GA 5EBWA 3D69A 1NSNH 3I50H 3RWFB 5HI3D 5DRNB 4AJ0A 1P9MC 3BEWA 1WC7B 1OSPL 3ARDA 5EU6B 5KSVB 3QDME 3TO4C 1MPAL 4Y8DC 3LKSB 3L7EB 3HMXA 3QUXD 2N1KA 3ZKNC 1F4WL 2VZTA 4OI9A 5EZLB 3QRGL 1KIRB 3C5ZB 3LH2H 4L9DA 2P8LA 5ID0A 2JCCB 4XP4L 3IDNA 4GW5A 4G8EA 3QQ3A 1C12A 1P69B 1Z5LA 4NZJA 3B2VH 5HHOD 1P2CB 1L6ZA 3ET9F 4HKJA 1G7HA 4HXBL 4NWTH 5BO1H 4GG6B 1SHMA 2I9TA 2Z4QA 2BSTA 4I18C 1HQ4B 4FABL 5ID1B 3U0TB 1MPAH 4HJ0D 5JHDD 3ARBD 5IB5B 3KVQA 4CMMB 4CMHC 1QFUL 3ESUF 2Z35A 1KNOA 4H1LB 2VXUL 4QRPD 5TE6H 5JXEA 5DO2D 4C55A 1WT5C 5A2IH 5L8KB 1MLBA 5F97E 3FQWB 4XP5L 2FYYB 2D03L 1H3UA 2XI9A 3Q5OA 5I1IH 1NGZA 1SYSA 1D6VL 3DO3A 4AYFA 1H5BC 1NFKA 1XR8B 2QADC 1DLHB 2FCBA 1ITCA 2MQ0A 1I7UB 4HK3N 5FO8A 2V5YA 1FYTE 1JNHB 1BREA 3MLVH 3BWAA 3N1GC 4P46A 4TUJA 3NTCH 2IAMA 4WY7H 3O6ML 2A77L 4JZNA 3VMOA 4N0YH 4OLZL 1DVFC 5K59F 1JZ8A 3TJEL 4JPVL 5E9DE 4PB9H 5TE6L 4HFWA 1LD9B 3AGVA 3HTLX 2FD6L 5J8OA 1FO0H 5DMGC 2X4TB 3IS1X 4RIRB 1T7XA 2YPVH 1I3RB 4QXTA 4PGBA 2HKHH 1KCUL 2YBRB 5EZJA 3T2OA 3HLAA 4GAGL 4ODBD 4Y2DC 4K8RC 2VJXA 5IR1B 3WYRA 4R7DB 1AXTL 2DD8L 3ARZA 3VG0H 2VISB 1A6UH 2O5ZH 4XCFL 3PWLA 4LPTA 4PJ7E 1Z9LA 3B2VL 2P49B 4HK0A 4FMKA 4F3FB 1K8IB 1E6OH 4WFHE 3LEVH 4QRUA 1MI5A 1I8KA 4LOUC 4WI7A 3EOYG 3JBG7 5J12C 3RTQA 3G08A 1VGEH 5T5FL 1ZHLB 3WSQH 1ES0B 4EN3A 4MB4A 1NDGB 3ULSA 3SKOB 4CNIB 3QQ9D 5I18L 4LP4A 3GMOB 4OGZA 4NFBA 3S96A 2BY1A 3C6SB 1HCFX 3WBDA 4OGXH 2GQHA 3H3BC 1IKFH 1O7SA 2F74A 3P4NB 5FA3A 2BXZA 1FIEA 1GGCH 1I3VA 2LFGA 2R2BB 1UYWL 1B88A 4EI5A 5JW4M 2DDQL 4N8CH 2R15A 4NHUA 3VFTA 3U7YL 5MEPA 1PG7L 4ODHL 2H8PA 4XPTL 2X4TA 1M05A 3P9LB 2KDGA 3TZVB 2EDHA 4XNUL 1FO0B 1OAYH 2ZG1A 3TYGH 2NXZC 5HHQA 2J7LA 1NKRA 5HYSG 2P43B 4ZS6D 5B39A 1N3NA 2DKUA 1MUJA 3CUPA 3O9WD 2W60A 3L3OA 1AFVH 2QQNH 1A3RL 2JE8A 1M6OB 1MCWW 2AABH 1I1YA 4Q2ZA 2EC9T 3ULVD 4DQOH 4LSPH 4OIBA 4MQTB 4TOYH 4I0KA 1O0VA 2XFXA 3O2VL 1PBYA 2IANA 3VWJB 4POZC 3KPLB 1MWAB 4HIEA 1GGCL 1F2XK 5FKPB 3LB6C 4LRNH 3S3PA 4HJGB 1OTUD 4EQ3A 1PEZA 1MLCA 1QR4A 4RIRA 5F89A 2V2XA 2EC8A 4KJPD 3NCYS 4R7NB 1SJXA 1FE8L 1DR9A 4WUKL 1MEXL 2WM0A 4X6CF 2VN7A 1ZA6B 3FL7A 4M1GL 2D9QB 3STLA 3AAZA 1N59A 4O5LH 3KPPB 1GC1L 1SY6A 4O58H 2EH8L 4XHQA 4NC0B 4ZPVB 3LKNA 4H88L 5BS0B 3MOBL 1V3MA 2AW2A 3OJDA 1MQKH 4M3JA 4GBXA 2VSDA 1RZFL 5DLMH 2VLRD 1NMBL 1UWEL 2WBJB 4E5XB 1P7KA 3KPSD 2FX9L 3RU8L 1OAQL 5CUSH 1CZ8H 3P4NA 5FA3B 5IMLB 4PGDA 4ZFOL 5EO0A 5DZNA 5EOTA 2SEBA 2IADA 3MLPA 2J4WH 3CX5J 1F8TL 1RD6A 3K1DA 1I9RH 3GGWB 4BZ1H 4X8XA 2DBJA 4UV7L 4B7LA 3UTQB 1BX2B 4Y16A 3NIFF 4F15C 4UILH 3VGFA 5D7JD 1X7QB 3OKOA 3U1SH 1AIFA 1WCBA 1JGUL 1CFSA 1HSAA 1LHZA 3D85B 4ODUA 1AKJA 2CRZA 1R5WA 4X4YB 1FAIL 1U9KA 3ZKQD 1ZVHA 3HRPA 2JJWA 2NXYC 5DJCA 4P2QD 2IFFL 4UDTB 2NY7H 4PJXA 4PRPA 1TVBA 1JWSB 2NY5L 2X4OB 3GSWB 4KROD 3SE9L 1RIUL 4EUPG 2HFTA 3GJFH 3AAZB 5EOCL 3JWNC 3X3GH 4Y5XA 3SBWC 3BN3B 2HJKB 3FFCB 2Q7YB 3QDAA 3IF1A 4L3EB 5CKAA 3M8OL 4XH2A 1IQWL 2V2TB 1XGRB 1LO3L 2DQCH 4FQHB 4MAYB 4PJAE 3VFUB 2ESVE 4HC1L 4HWNA 4EBQL 5HHOB 5L8LB 3AS0A 4KTEL 4P57A 5ADPL 4H1LH 4HJGA 3PUCA 1FFQA 2J6EH 2H32H 3RDTC 3RWCA 3PHOB 2MSPA 1F3RB 1ORSB 2A6JB 4R97B 1I1AA 2APBA 2VZSA 4YE4L 4YHIB 1H3GA 1A3LH 4JRYE 5D2LB 1KCVL 4PRDB 4JQXA 2QHRH 4EDWL 4MXVE 1YMHB 5EPMB 5E56A 3GBNL 1RSFA 1S5IL 3EIFA 1AQDB 3OAZH 4PJ7A 5DD5L 1JPST 1PSKH 2FX8L 3HCVB 4F9LC 5E1HB 1KTDA 1W0WB 4M7JL 5ADPH 2W0FB 3HN3A 5EO0B 4J6RH 4OD3L 1NUNB 3DX6B 2BRRH 1E4XL 3QUZC 4WWKC 3MXWH 4JFEE 1J1XH 5CMAA 5GGRA 4KU1A 3RVTD 4J3WA 3QCTL 5FFLA 3MROA 4ONGL 3QNXB 2GY5A 1YY9D 2YA2A 1F4XL 1S9YA 1KCVH 4PTUB 3HAEA 4FQQB 4MDJA 1ZGLM 1GAFL 2BFVH 5J12B 4LSQL 5LVEA 1JZ2A 3MCKA 4CU6A 3FB7A 4Z7NF 2OZ4A 2X9WA 4GXVH 4RGND 4HUXA 3WFDL 5EBMA 4XPAL 1DJSA 2VIRB 4G6MH 1BFOA 3CAFA 2AI0H 4XVSL 4Y1AA 1W8OA 4FFZH 5D93B 3MBEC 4TNVF 4GKNA 2VDLH 5HY9A 3H7BA 3IVKB 4OD3H 4F33A 3MRDA 5HD8D 1NBYA 5CGTA 3RKDD 4BQ8A 4ORGB 1WICA 1ZLSH 3SDDC 5E00B 1PKQE 1RY7B 5FECB 4XX1G 4OM0H 1HHKA 3L5HA 3MLSL 5HJ3A 4H26A 1LP9B 4OV5B 1IAOB 4MVBD 2HTKC 1C16B 1N8ZA 3WV0A 4L4VB 4BK5A 3SE8L 2PXYA 1DANU 1U8OA 5BV7H 5CJXA 3DSFL 3SY0A 2EYSB 3KPRB 1C7TA 3IDXH 2P5ED 4YHNB 2BNUB 5F6IC 1DCLA 5HYSB 2E8ZA 4LSVL 3VJ6A 3H8NA 2VDLL 4YO0B 3O45B 3U7WL 2O61A 1OLZA 2FHCA 5E6ID 1S7SA 1XF3A 3HI1B 4JPKL 4MJ5A 4IDJL 2FZ3B 3BD5A 2V2WA 2YPLD 3VXSA 3R06B 3WNMA 4RMUA 1RVFL 3MFFB 4G6AC 1BPVA 3WNLA 1BD2A 1T0NA 4UT9H 3QEQB 3L3GA 4I1NB 3N1QC 1U0QA 3QIWD 4TVPE 2IFGA 1NSNL 2GITA 4AQOA 3TIDA 4WGWB 4XCYA 15C8L 4FXKB 4NQUA 3K4ZA 5GRUH 3WXWL 1EGJL 5DHVH 5IVXE 5CEYB 4M8QA 2CSPA 2DLFL 3O6FA 3GEWB 4ISVA 3P9MB 4UNTA 3R1GL 4GBXC 5I8OH 3GKWL 1HHKB 2BVUA 1U8QB 1HOCA 3MFGB 3VRIA 1CL7H 2DWDA 1KCSH 1PLGL 4LSTH 1Z3GL 3LD8B 5JOPE 5FUOH 3X12B 5L7XL 5HDBE 5F9AC 3RY6A 1CFNA 4BFIA 2IF7A 3MCLH 5IK3A 4CVUA 3T4AB 3QXAA 4QHUA 2E27L 2ZUQC 5LJYH 4L4VD 3PWPE 5IVZA 2EKSB 2HKHL 5F89B 2VLRB 1VCAA 2YPKB 4M93B 3RI5F 3RWDB 3L3JB 3IFPB 3TBSB 4MHHG 3R1GH 3W2DH 5FYLE 3REWA 4ZOAA 2NMSA 5ACMA 3O6LL 3BP7A 3HC3L 3JWOH 1I1FA 1IKNC 1K3ZA 4TPRL 4YDIH 5IFAH 1VB9A 4LHUA 5DHVA 3LKSA 4JFED 5CZXD 1IAIM 4YHKL 4YDLB 1AGDB 1HILB 3SGDH 2BNUA 5J57B 1E6OL 4JKPL 5CAYB 5IHBA 1RIVL 3PIQB 3U9PL 5I1DA 3REVA 5FGCB 4LHUG 5T5NF 4CJ0A 1YC8A 3W9EB 2YKLL 4XWGL 5SWSE 4Y2OA 3UBXB 4JRYA 2C1PB 3THMH 1MREH 3SKUD 3O41B 3C09C 1W72A 1U8JB 2BDNL 4FG6C 1HQRA 3V5HB 3OJ2C 3WJLA 1LE5A 1OTUC 4G80A 1UEMA 4KHXL 4F37K 3QNYB 2VXVL 4HUWA 4XMKL 4X6EB 5JPMA 2Y25A 1D9KD 2P5WA 1RZJH 2EXWD 2B7DT 4LPYA 4LCYA 1J0HA 1QSFA 3EFFB 4D0DB 3CVHA 4OCWL 3G5VB 1EFXB 3GKWH 1BQLL 4KVNL 2EIZA 3JWDC 2O5ZL 3PWUB 1ZKAA 1KCSL 3E6FA 1J10A 1IVLA 2JKXA 4FP8H 5JA8B 3BW9A 3GMQA 1QFPA 3CSYA 2GSIB 4JY4B 4U7MA 3ZE0F 2W0LA 4CDHA 1A7NL 3C08L 5GRXG 1J8HA 4UB0H 2CDEB 2D4FA 4ZSOE 4NN6C 1WTLA 3IF1B 1YY8A 3FQRB 4M5YH 2OR9L 3OKYA 1P84J 3LQAH 2H32B 5DK3A 2RGSA 4NGHL 5F3BB 3QCUL 1KTLA 3QUZA 1IBGL 2Y07H 5JOFA 3MMEA 4UDTA 3FONA 3NCJL 5K9KA 4A6YB 1UWXH 3HZMA 3L3KA 1KIUA 2X4OA 4F9LA 5C0JA 4ONOA 5GIRB 2BY3A 3LEYH 3UBXA 4AH2A 4XPFH 3IFPA 3TBSA 5ICYA 5JW5A 4YHZL 4FTVD 3QI9C 5AUMA 1XIWD 1N4XH 5F1KC 4G7YH 2FGZA 1IGYA 1T1XB 2UVFA 3D0VA 4M1CC 3ARGB 3TYFB 5T3ZL 1FAKT 1U8NB 3DYMA 4GW1B 1G6RA 4L3AA 4X4ME 3QUMH 4LEOB 2IH3A 2VZUA 4LSRH 5D70H 2C4FT 4UOW1 2R2CA 1P4LA 1F8TH 4HHAB 2F53E 4P59L 4FTVB 43C9A 4YHIA 3O3DA 1G7JB 4JQXC 2XV6B 1Y6NR 5DHXB 1ZHLA 4AIZB 4Y4HD 4LLYA 1T20A 5JPNA 5CEZL 4GRMA 2FBOJ 4G7YL 1S9YB 2XWBA 1MHPL 2XZCL 1RZJC 3EYOA 1NLDL 4L4VE 4I77L 5EN2A 3AM8C 1KLFA 3H9SA 3O6FC 3P0VH 4IOIA 1DBAL 3IU3A 4NQDE 4O4YL 5SWZD 2VZ1A 1R3HA 3F7QA 1FVDA 3OG4B 2UWEB 3ARWA 1FNSL 3KHOA 1SM3L 3BUYA 5GRZA 1A7NH 3VXPB 4QRQA 4A6YA 2IH1B 3MJ9H 1F6AA 3PWUA 1UWEH 5JTWA 5C0JB 1FE8H 2DQFA 3BHBA 2XKSA 2IPUG 3CCHB 1SVZA 4KRPD 3OR7A 1T6WA 4AQ1B 2QSCL 3BPNC 2J6EA 1ED3A 1U36A 2VWEE 5CEZH 4PTUA 1JNNL 4TSAL 3V7AG 1DZBA 1YEEL 4HMEA 5GGVH 3EYUH 1IGYB 5C6PB 5JIIA 3LSOA 3U79A 2E7CA 3CDGB 1IC7H 3N0PB 3IXTA 5AG9A 4WO4D 3VDCA 4FQ1L 2WZPD 3MNWA 1F4AA 2FLRT 4ZDHB 4DFIA 3EFDH 4M02A 2APWA 4YFDB 1MCOL 4CDGC 4QT5B 1FLTX 4PR5A 1INDH 3MRFB 3BXNB 4N90D 1DN0B 4MXWH 2Z31B 5HVHB 3QHFL 1FAIH 2PXYC 1T66D 4ZYKA 3BRDA 2JB6B 5SV3A 1EXUB 4R2GD 4OZFA 3STLB 3RZCD 4U1LA 3I6LE 1TXKA 1LGVA 1I7RA 4F7MB 5JHLH 2E9BA 4NCC1 2OR7A 2JJSC 3IGAA 3MPCA 3QG7L 5EU4A 4A6YH 2W91A 4WEUD 4P0DA 3KLHC 5K33A 4OIIH 4HWBL 3OXSB 2NNAB 3H7LA 5HI4C 1FC2D 5E2JA 3ZHLA 5JR1H 2MPAH 1F58H 1RUAH 4XWOC 3M8OH 3MOBH 1A6WH 4MQXC 3TJHD 3CIQA 1NMBH 5IBUG 3JUYA 1C5CL 3PWLB 4QTIH 3ZT6A 1JWUA 1ZS8A 5SWZB 5I2IA 3B5TA 3BUTA 1JWMA 2Z91A 3EYQC 4FFYH 4OQ1A 4YAQA 3FCTA 4D0CA 1AIFB 1BM3L 4Z78B 3O2DA 1YJDC 2HMID 1N7MH 2ICWI 5E9DA 3DRQB 3MRQA 2BMKB 4N8VB 4A6YL 3BKJH 4U1GC 4CN1A 5T1DH 3SO5A 3HI5H 5D6DA 1DQQA 4LNRA 3CU1A 4X4XA 4PJXB 4PRPB 4QRSB 3ROOB 4DJMA 5IVXB 3WJJC 5IW6A 1YEGL 3V4UL 1JGUH 4NC1E 1FGVL 2AK4B 2K7PA 2NY3C 4DEPB 2DTML 4FQ1H 1YYLH 1G7IA 5GGTL 1FCCA 2J1KA 5DMJB 2HFEB 1A3LL 4JREC 1KCKA 4XZUA 3T0ED 4BJLA 3MLXL 4Y16D 1JZ6A 2A6IA 4ZFFA 2PCPA 1AE6L 1JUFB 1SY6H 1TZGH 3DX7B 3RJQB 4NHUB 5D2NA 4AIXA 4U6HA 4NKOB 4Q6IC 4EDWH 2ZPKL 3HUJF 3BP7B 4H5SB 4KKAC 3W81A 3O4LA 1QSFE 1KIPA 1EV2E 3WEXA 4KKAD 3VFUA 1HHIA 4TUKL 1GYAA 2OTPA 1CBVL 4I3SL 3MRFA 5KSAD 1J88A 3GI8H 3VGDA 25C8L 3QQ4B 5I1CL 4PLNC 1BWWA 4QYOA 2AVGA 3KPSB 3U83A 5GXBB 2VITB 3UX9B 5GRVL 2AXGA 5DRXB 4FFZL 4X0KA 5HYJE 4D94A 1BWMA 1SJEB 4LVHB 4Y19A 3VD3A 2EE9A 2HT2D 4NQDD 4MQSB 4NCC2 1AE6H 1GGTA 4Z78A 1JPFB 5JR1L 1YMHA 2EDWA 2J2ZA 4JFDD 4QOKE 1WBZB 3D5OF 2ESVA 4N0UA 1QYGH 4M43H 3JVGA 4I0PD 1FL3B 1IEHA 4KJWD 2VLKB 1TZIA 1WEJL 3TZVC 4NQVA 2R0KL 1UENA 4I9WD 4N0CC 4LKCB 3MXVH 2NY2D 2PTVA 3WD5H 5KTEL 4MWFB 3L95A 4NM4L 1CCZA 1G7IB 3RWEB 3BKJL 4NWTL 5BO1L 3B9EA 3LAFA 2PXYB 4MS8C 3RAJH 3GJFA 4ZXBC 2EYSA 4PJGB 1QRNE 1NDGA 5E7FA 3ULSB 3ARYA 3OKMA 4ZUWA 3EO0B 5IROA 4DGYL 1QNZL 2VXQH 1MCCA 2XG4A 4FQIL 1X5LA 2UYLA 3GNMH 5IB2B 2DQHL 3H9SE 3CFBB 1XF2A 3AREC 4HUVB 3V7MA 4EI5D 1AI1L 1ZT4B 3F12B 1Q9LB 3FQNA 1KTLB 4M6NL 1K8DA 3QAZB 4LSQH 1WIOA 3VFVA 2MHAA 4PREB 3MA9H 1WTGT 2I9TB 1H8SA 3WFDH 2PXYD 3TO2B 2VQTA 4Y4KA 5GGRY 5HHQB 3DUUB 2AI0L 1YPZB 3ZL4H 4I3SH 3GI9H 5CBAA 5DFVC 1CVSC 1J0ZA 4TPRH 2Z35B 3EJZC 5CHNA 4H5SA 4BK4A 4KZEL 4NKMA 4B7IA 3F58H 3QJHB 1W72H 2NX5A 1G1YA 4M8QB 2CKBH 2RIKA 4PJIA 2W07A 4NJAH 5C3LD 5EUKA 4GRLA 2X09A 1A7OH 3L3HB 1ZLUK 4Z7WB 2V5SA 5GZOC 3HNVL 1P1ZA 3NAAH 2X2YA 3MO1B 3T2PA 5D7SL 4U6VH 3MLSH 4HKJB 5BV7B 4K3GA 5FO8B 5SX4I 3FFCA 3IFOB 4XPHL 1XCTB 4F80A 1FNHA 1KPVA 3I2CL 2YC1B 4XGZB 2M1KA 2X1WL 3SE8H 4LVOB 3WDIA 2P44B 5CD5C 2ORBH 4JDTH 1QEWB 3IDXL 1Q0YL 1HEZA 5I8OL 4P57B 2PETA 4K71C 2HVKA 2J5LB 2B1AL 3KYOB 3OZ9L 2VXVH 2CR6A 3L5WB 3MYZA 2W9LA 4JFPB 4ZPVA 4RAHA 5K9OB 3OKNB 4ZPTA 1OGAE 2BSSA 1RV6X 1MRFH 1TJIL 4MAYD 4PJXE 4PRPE 5ESVB 1K2DB 1V3JA 5L7XH 2OI9B 4P2OA 2VLJE 1J1OH 5CJ5A 2DQEH 4NOBA 3DOSA 3HC3H 4U1MB 3VW3L 4XPBH 3EJJX 1R3KB 4ZD3H 5LBSL 3QI9B 3NZHH 5T3XE 4FQIH 2ZKHH 4AT6A 4HCRA 1LILA 2XZAH 3OR7B 3GHEH 3ZLQC 3RL1A 4ACPA 2QQQA 3U9PH 1K4DB 2NPLX 5D1ZA 3AM8A 4WFEE 1U8QA 1BD2E 2OLDA 4L4JA 1H15B 1BJ1H 3HZKB 1JP5A 1RZKC 4F3FA 4NN5C 1NBVL 3RVWD 1FVEA 3PL6C 3ABZA 2J12B 1ZHKB 5CINL 4M1CD 1PZUB 3WFHB 2QQKH 4HUNB 1UACL 2A83A 5D9SA 4BFIB 5I6XC 2DL2A 3P40A 3RY4A 1IM3A 5EA0L 3S37X 5I1EH 4R7DA 4FQXA 4XCFH 3W9DB 5J56B 3DMMA 5HDLA 4LSTL 4NDMA 3HC4L 2A0LD 2C3WA 3PGFL 5DRZB 3NOIA 2QR0A 3Q48A 4RFNB 3REWB 5CBAB 5D6DC 3HNVH 4RMQA 4I9WE 1BQLH 3NPSB 1OD9A 4O51A 2GJJA 3MR9A 1JHKH 4HZAA 3SDAB 2FRGP 4Q6IA 5GISL 3UYOD 5C0DB 1XEDA 5E6IB 1HXMB 2VDMH 4QNPF 3IJHA 3EDJA 4I0PC 4YIQB 3CFKA 3BP4A 4HBCH 1LO4H 3BP6A 1UACH 2Z9TA 1FL5B 1SBBA 1DBKL 1QSZA 3GJEA 2APXA 4XGZA 1HDMA 3LQAL 2V7NB 2P7TB 3NACL 3HE7D 4K94L 4OUOA 3WS6A 2DDQH 1AGBA 1ZS8B 5DK2A 1K4DA 4XRCA 4Q9CA 1IC5L 4AEIH 1EPFA 1MCNA 5JOFB 4UTBH 4G9FE 5DRWA 4ZD3L 3D3VE 4HIXL 3V0VB 2XXMB 4DKFH 2OR9H 2UWEE 3T3PF 3NZHL 4Z76B 1DBAH 1Q38A 2WBJD 3KPNA 3BKMH 3DV4A 3HE7C 4S1SL 5KVEL 5AZEL 1OAZL 1SM3H 3PDOB 4P4KC 3O3AA 3MJ7B 1WT5A 1RHHB 5MENA 5EZOL 2EO9A 1FZMA 3FMGL 3TBVB 3ARDB 4HAFA 5EU6A 2FH6A 4NNYB 5EIIA 3MRJA 2AK4A 1QLRB 4ZO8A 1NCWH 3HMXH 3T0EC 5CBEA 4OAWA 4PD4K 4M93C 1UZ6F 4R3SA 4P9HC 3ZKMC 1LNUB 5D70L 4LRIC 1BJ1J 1I1AC 2E6JA 3BQUD 4GW5B 3CSPA 4LQFH 3BN9C 3EO1B 5I66B 5T3ZH 4X8JA 3G5ZB 2H41A 3K2UL 2EDNA 5I74B 4WEBL 3BP5B 4WGVB 2F19H 5IESL 4OKVB 4D8PB 1JF6A 4H88H 1GPOH 1MQKL 1G6VK 3EJYD 4W4OC 3L3KB 3WUZA 4YHPA 2MMXA 1YEJL 4BZYA 3DI2B 2XWBB 4QRTB 1AP2B 3PDGA 4OLEA 4GBXB 3ZKXB 4G5ZL 2Q86B 3CLFL 1JPTL 1A02N 1FZOB 5HGBA 1T1YA 1A9EA 5L2KB 1BVKB 1NC4B 2YRLA 3KS0J 2ERJC 1NEZA 4FXGB 3RNQA 2BNRB 5AG8A 4QHUB 5CS7A 4JVWA 5GS0L 2EDXA 1JHLH 4XVUD 2Z92A 3LEYL 4N0UB 4OIIL 4ZFOB 5I19H 3QUMB 5IT2H 1TIUA 5B3NA 4MXQD 1FPTL 1F58L 1QLFB 2EYTA 1U8LB 1ED3B 2X10A 4ENEC 3WHE1 5F9WC 3HB3D 1CFTA 3Q3GB 3V6ZA 1HYRC 1Z2KA 3CC5B 5DGRA 2GYSA 3KPSA 4HH9A 2ILLA 1NANH 1FZKB 3NIDF 4NBZB 5I75C 5ACZA 4KKBC 2R0WH 4HK0B 4JVPA 4M7LH 3GM8A 3DX9A 3V79C 1PZ5B 1NMCC 3VXSB 4OZHA 4HAGA 1MIMH 4YPGB 1A4JA 3FMGH 4GLRH 3LRSA 3HHRB 5D8JL 2ATPB 5CP3H 4Y4KC 3NFSL 2BJMH 1K4CA 1INDL 4XX1E 3GSUB 4TRPL 2VABB 3U7YH 3V4UH 2OTUB 1PG7H 4ODHH 1MJ7H 1NGQH 4Z77B 4XPTH 1JZ5A 3LPGA 3M17A 1KEML 3B3IB 2PO6B 1JTTA 4KTEH 2C3HA 5FM5O 3LCYA 1I9JH 3VA6A 4OZ4B 5F1IB 2J6EL 5AYUL 4JLRA 4LLVB 1NDMB 4PRIB 2IPKA 5H35A 5DFVD 1SJVA 1JYXA 5IBUB 4ZUVA 3P4LA 1G6RH 3MRKA 2AJUL 3GI8L 1CXHA 4PB0L 2ZOKA 1UB6A 1KJVA 25C8H 5C0CB 4LCUB 2PO6D 1J7VR 4F57H 3MLWL 1CICD 1KPRB 4MA7L 5CJOL 1Q72L 3QO0B 3QFJA 1MFDH 3ARED 5HGBB 5DJ8B 3ULUD 4YHOH 1W0VA 4BELD 3B5HA 3OKEA 1QSEB 4KROB 4UTAL 2E7MA 1QFWH 3S97C 3QP3A 5C0EB 3ILQD 4GKNB 1YYLL 2CLVB 2JIXD 4WNQB 5E6IC 5C0IB 3SN6N 3HG1A 1WEJH 5GGRB 4MCYA 3L7FA 3RUGA 1KTRL 2WQRA 3BPCA 3D0LB 4P2OB 5DMIL 1VGKB 1JMXA 3D9AL 3BD4A 2DMKA 3R0NA 3WS3A 1ZT1A 3QO1A 2X42A 4NM4H 4N0CD 3QNZA 1L7TH 4F57L 4GH7B 1UM4L 4N1HB 4Z0XB 4OLUL 1BJMA 1RVFH 5I9QC 4JLRB 4PTTA 5E70A 5EO9A 5EZLA 4JZJB 3W11D 1FG2A 2DLTA 4MJ2A 3P11L 2Y36H 2OMBA 4ZUTA 4XTRD 4PD4J 2R4SH 3DPBA 2F54B 4QHKI 4QRSA 2ZP0T 3WXWH 4C58B 3ZTJG 5I16B 3BZEB 4XNMB 2X5PA 2IQAB 4S0SD 4P2RE 1J8HE 3EOAB 1R3LB 4L9LC 1CFBA 5IJKC 5IB4B 1OM3L 2D7QA 5I76A 5T1DL 4NUJA 1NDMA 4PPTA 3RWHB 3WNNA 4XNYL 4HULB 1MHHA 4MQ7A 1GZQA 5KS9E 1F2QA 2H9GB 3UTZA 1FGVH 1N0LA 4WNQA 3LPFA 5GHWH 3RVTC 4WI3A 4E0RA 1G7LB 5F1NB 1U92B 5E0QA 4ZUSB 5E08H 3HR5B 3CX5K 1MCJA 2YSSA 3CFEA 4PJ9C 5I1LA 1IQDA 5C0CE 3RVUD 5DZLA 4L4TE 1DLHA 3N1MC 1IGIL 1X6NA 3EO0A 3QRGH 3C2AL 1KC5H 3LH2L 1FCGA 1XGRA 4ZDHA 1JGEB 1NCAL 3BVNB 1EHXA 4LQ1A 3WLBA 5A2LH 2R9HD 1ZWIA 4PTTB 5DURB 2GKIA 5EO9B 4MMZC 5E6YA 2BVEA 1YA5A 1CXIA 4Y5XC 1RUKL 2GW5A 1XMWA 1PG7W 1S8DB 2FJHB 4NQCD 4HPOH 1OP9A 1RIVH 1VADA 4KUCF 4PP1C 3ROLA 3RDTD 3S35X 4BFBD 4Y5XB 2LVCA 3QHZH 1I7RB 4OLYH 4F7MA 5BRZE 3HZVA 1J18A 4JHWL 4OTXL 3QCTH 5DXWA 3KLHD 1YUHA 4I4WA 3C5JA 4PJ7B 5T33H 4TTDC 2DQUH 4ZFGL 3IB4A 2BSRB 4V1DD 4X80H 5I1IL 4MX7A 5DWUL 4QEGA 2W1NA 3P73B 4Z7OE 4HS3B 4LCIH 3U4EA 3WD5L 5KTEH 2EKSA 1KGCD 1CD9B 1A9BA 1PW3A 1NMAL 1Q0YH 1A7OL 5H94B 3RAJL 5I1AA 1PKQA 4YDJB 4KVNH 1LO0H 1ZTXL 4HIHA 3SDDA 5T5NG 1OAUH 2AV1B 4YXHH 2RFXB 4OLYL 5DYOB 2NXYD 2X4UB 3GMNB 3QDMB 4W68A 1FVCA 5TDOA 4R26H 1ZLSL 4JKPH 4V1DB 2NW2B 2P45B 3DI3B 4JRWA 4X7CC 4OF0A 1GZPB 1CU4H 2Q87A 3KPOA 1K8IA 5T3ZD 2G5BB 5DWUH 1OP3K 4XWGH 2P5EA 2D31B 3W5MA 4G8GD 3UCRA 1QVOA 4DUVA 2VR5A 2NTSP 5E5MB 2ZJSH 5HGDA 1UWGH 1NCAH 1PD6A 4FQJH 5FF6A 4P3WA 1E28A 2HLAA 3O9WC 3QFJD 5DUPL 1LO0L 1ZTXH 3RL1B 1DBKH 3ARVA 5F44A 4G6AD 5D2NB 4MYWB 1DUZB 4Y5VB 1WIUA 1I1AD 1F13A 5E03A 3BGFC 4IOFD 2V5MA 5JORB 3VGHA 3PF2A 3WFHA 4YHNA 5I8CB 5CD3B 4C56A 5INDA 5I30L 1IAKB 2WUCL 2CRYA 3T0EA 2A6DA 5I0ZA 1CS6A 1A1MA 4XNXL 4LP5A 2NW3A 4Q9QL 1LK2A 3OR6A 3WIHA 5C0BE 4LPUA 4EXPX 5GRYA 3K1KC 4FMFA 3Q2CA 2QV2A 1IGCL 5EZOH 1ROWA 4P2QE 4H20L 1DANT 3V7AE 2I60L 4NPYA 5I1GH 4ZFGH 5ESQB 5DUPH 1HYSC 1G7HB 2W60B 3L3OB 4RCAA 5I1EL 1T4KA 2WINA 4K55A 4KMQA 5GJSL 1IKFL 2A77H 4FQLH 2BHZA 4KQ3L 1IAOA 2NY6C 4G42B 1DE4A 1UZ6E 4NCDA 3S6CA 4F7CA 1FZKA 1IBGH 2EDOA 2PO6A 3ZDZF 1I8LC 1WF5A 2HJFA 1XH3A 4HK3J 3DGCR 2AV7A 3RKDC 5C0CD 1FIGL 3GSNH 4PRNB 3VD5A 2KZWA 3WN5B 1B6DA 1EBAA 1I85A 1DN2A 3B9KD 1IM9B 2Z8SA 2F19L 3MRHA 4XBEL 1JYNA 2X70B 3D18A 4QXGL 5IW1A 2VDOL 43C9B 3S3JA 4YDJA 2XZAL 4E41D 4UINH 1QFWI 4RGNC 3KXFE 4URTB 4K9EH 3RX7A 1R5IB 3LEXA 2Z93A 1WCBB 2V17H 1X5FA 5D1QA 4K94H 1DL7L 1P4BH 4NQCE 4MAUL 2K9UA 1OP5K 4JY6A 4HWEL 3M07A 1XF5B 1FL6B 3WLWD 4YFEA 4ODWA 4NO2A 5DJZA 4DN4H 4D2NA 3P0YH 4QRRB 1LO5B 1B6UA 3CMGA 3G04B 1JWSA 3P3YA 2OQJA 1CE6A 2NW3B 3VXMB 3MV9A 1HINH 2HH0L 5M7QA 3F6LA 4OCMC 2ZOKB 4YH6A 3CZJA 3GBLA 2Q6WA 3ECBA 2J8UE 4GO6B 3QHFH 1OW0C 4PRHB 4OFYA 1Y18B 5J4MA 4MD4B 2KBGA 5IWLC 4LHUB 5AWNL 3E6HB 1IC4L 1QR1B 2R0WL 4NNXA 1D9KC 3MRCB 3GIVB 4U31A 3EDEA 1J5OL 3V52H 1T83A 4Q97A 3P0YL 4KI5C 5EOCJ 2XXCB 3X3FL 3VXPA 3O11B 3WFZA 2J8OA 4XPFL 1KPVB 4CADA 1CXLA 4QRPB 1JPTH 5KW9L 5GS1C 4L4TA 3DV4B 5I1JH 4K23H 1IZJA 1YNKH 2CDGA 1EXUA 3O3AB 3B9KA 4NPYB 4DOHB 3VXSE 1MJ7L 5CLWA 4PJEF 4WVRA 1IC5H 4AEIL 3RX8A 3GSNL 3MNZA 1IM9D 1YEJH 1BIIA 5BZWB 5FKAB 1YEHL 4XH2B 3C5SB 4IEFB 2CXKA 3IDYB 5DJ6B 4KROC 5CZXC 3RHWK 4UQ3A 5DD6B 2FO4A 1WWWX 3BAEH 3ARUA 5CSZB 5FGRA 2Y4SA 1UJ3C 3H0TB 4ENED 3U6RB 4NM8H 4XBGA 2J8HA 3SE9H 1MEXH 3QUXC 2JB5H 1CFTB 3MRHB 5IBLC 1ORSA 3VXMA 4NQTA 1NCWL 4O9HL 3HI5L 4Z9KB 2PW2B 4HBQA 5DA4A 5KANG 5FK9B 2XRAL 1RI8A 2LQRA 1Q9LA 2ADIA 3MROB 5ANME 2Z91B 3MLYL 3PE9A 4D9LH 1LVEA 3VMNA 3S96B 1OAYL 3IDMA 4X98B 4HKZA 2NX5E 1LMKA 2DOCA 1I9IL 1UH2A 4NQCB 5J89A 1BFVL 1ZHKA 2AQ2A 3AMLA 4HKXA 4YHOL 1RIHH 3WMSA 5AZ2H 4OQTA 2ADJA 1G9NL 1IM3B 2KQMA 3SE4C 3KXFB 5TDNA 5DJDB 2VZVA 3DUSA 2JB5L 4RNRB 1RFDL 4GRWB 3FQXB 4IRZH 4XAKE 3GKZA 5D6CB 3O2WL 1NCBL 3S35L 4P3CH 4Z6AT 1A3QA 2IG2H 1I7ZA 3UJTL 1L0QA 4LLAA 3X3FH 1WC7A 3AC0A 3HZVB 5IROC 4B5EA 3LKRA 4R0LC 3UTSA 4BSJA 5I19L 1WITA 3DARA 2Y23A 1OF2A 4HIEB 1UXWB 3KXFD 4OUUB 1MHPH 5ERWA 2Q8AL 2OM5A 1ERNA 4LVEA 3MRDB 3RIAK 5L2JB 4GW4B 1F02I 2WBWB 3NFPA 5JOPD 3EGSB 1H5BB 3HE6B 1ZA6A 1GAFH 2BFVL 4NQEE 4X6FB 5HYQB 1R0AH 1Y6MR 5MI0C 3DVIA 4KAQH 3DYPA 4DWHA 1QA9B 2GTWA 4RX4D 5CZVH 3TZVD 4UTAH 2HG5B 1J11A 4P49A 3WE6B 1TQCC 2DQGH 2DF3A 2DJUA 2IALA 4BH7B 1A64A 2BOBB 5DRWB 4XTRC 4MA7H 1GGYA 3IKKA 4JQVA 4O9HH 4AT6B 4BFGA 2QSCH 1U8KB 5E8NA 4WO4A 3VXQB 4PLOB 4MVBC 3NN8A 5FYLD 2FECI 1AJ7L 2FHFA 2VL5B 3G5XB 1A6PA 3P9WB 4YDVA 1VGKA 3FAXA 4RRPA 4L3CA 3TBVA 1TDQA 4HHAA 3BT2L 4QRQB 5GJTH 3EDKA 5GRWA 3HE6D 4KV5E 5C2BH 2AGJL 4OLVL 4QTIL 1FSKB 4P2QA 3WLWC 5TE7H 3M1BA 2RBLA 3UEZA 1V8HA 4OBSA 1WZKA 1JPGA 4RISL 3VCLB 3DROA 4HEME 4GRMB 4XAWL 3WO3B 2HLAB 1VFBA 3MGOB 1IGFH 3C2AH 4QRUB 1NUGA 5F7YC 2A0LC 3RGVA 5L8JB 4RGMC 3L3GB 4OB5H 5MP6H 1JF1B 2CD0A 2QR0B 4OKVA 4JKMA 4X7TA 1XGPA 1AJ7H 3VU2A 5JHLL 3KPOB 8CGTA 1TVHA 2G5BA 4PUBH 4FFWD 2FYYA 1EUUA 1K85A 3X11A 3CVHH 5GJTL 5DMKB 1JCKA 4TNVK 2MHAB 5DEGA 4ALAH 2Q1EA 3T08A 3OR6B 4PJXF 35C8L 2PO6C 2YBRA 5EZJB 1YMMD 3PGCB 3L6FA 3QUZD 1I7UA 5IHLB 4PJIF 5EG6C 6FABH 1ZHBB 2ZPKH 4WW1B 4DAGL 3PDDA 3BX7C 3ELAT 5C08E 1IILE 5IHUH 4YE4H 2XACC 4OTXH 2EDKA 5EO1A 2D7MA 5MERB 5B38A 3QXWA 2VISA 4D9RD 5I8EB 1X5YA 5CWSA 1EEQA 1HI6B 2HMIC 4XP4H 1DE4B 2AXJA 4E41B 5EUOA 1FBIH 3HZYB 1QKZH 4M4PA 4U1NB 3GB7B 3OB0K 5B39G 3W0WB 3U0PA 1U93B 5IP4A 5IMOA 4Y1AE 5BV7C 5FYKH 2M8XA 1A7RH 4L3ED 4Y4HA 3CVHL 1KB5A 4NKQB 2K7QA 4K3DH 5FUCE 1N5YL 1QA9A 2GTWB 4OM0L 3RWDA 35C8H 1T04B 5EC2B 3BE1L 3F65A 2VDQH 4I0PB 2BVTA 4BFEA 2VLKD 3QZWB 4NNYA 4R26L 4K7PL 2V2XB 2UZIH 4LFHG 5CD5D 2C7UB 4PJ8B 3DGGB 3T0VA 4ONGH 2NZIA 2KUTA 1F4XH 4DUWA 3BGAA 3FHQA 4R2GC 1EBPA 3QWOA 4GXVL 4PFEA 3MV8A 3LQMA 4X6DB 2R0LL 3X11B 1UADC 2ORBL 4PJBB 4JAMA 3WFCL 5KSVA 4Y4FD 1S9XB 2XKNA 1CBVH 5IJVB 1FNGB 5ISZB 5EA0H 4XHJC 2R29H 3S98A 3CSYB 3ARFA 3DVNA 3GMLA 4IRJA 3RP1A 1C8PA 3HC4H 3QUKA 3OAZK 3OKNA 3DIFB 1A6ZA 5ID0B 4MD4A 2F53D 4MMXC 1J1OL 5D7JA 1FG9C 2FD6H 1W8NA 3MNVA 3PQYA 3LN4A 3SY0B 2DQUL 5GISH 2E5EA 4I2XE 4LCYB 1AXSB 4HIIB 5HYSA 1CXEA 4BQBA 3A6OA 4GAGH 3B9VA 4Y4FB 4YHYB 4P5TA 5F9DC 5ISZD 1LDPL 2BDNH 4YDLC 4OLWL 3ZKND 4KJQD 3FTGA 4GLRI 3WUWA 4YFLI 5EBWB 2FECL 1ADQA 4UIKL 5ABDE 1MWAH 4M6ML 1HKLH 1Q8MA 3QUYB 4KZEH 2WIIA 5E94B 3WIIL 1ZHNB 1VA9A 3O4OC 1RUKH 1DQMH 5HYEA 5CWSB 2C7UA 3K4DA 4S1DD 1VENA 4ZAKA 3IRPX 2VERN 1V5JA 4MCYB 4PJDE 1N5YH 4JFHE 2HA1A 3SPVA 2BNQD 4IRSB 3VFWB 1A6TB 3FT4A 4HWZA 1JZ7A 4KKLD 2AJSH 2ENYA 4M5ZH 4RGMB 4DGIL 4ZS7H 3DMMB 1MH5B 3K7UA 2J8UF 4P46B 1T1ZA 1KXTB 4MJIA 4D9QE 3U4BL 3C08H 1GCFA 4XMLL 4YNYA 1GRWA 2YEZA 1VFUA 5BRZA 4MAYA 3KPRD 2VLJB 4AM0A 5DUMH 3VXNA 4KRNA 3S88L 2RFXA 2AEWA 1XR9A 4LCIL 5BZDB 2H1PH 3HMXL 1WBZA 4DFHA 5BQ7A 4HLZH 2G2RB 4EI5C 3KPMA 1WISA 4G9FB 5F96H 1HN1A 3C5SA 3RVUC 3MGTB 3IJYB 1MJUL 3OPZH 3D48R 4GG8A 4MNQB 4H20H 1KNOB 4LQFL 3QI9D 4OI8A 1AXSA 3BP4B 3QJFB 5DD1H 3RBGA 3ZTNH 4XP9H 5C08D 2X6MA 3P30L 1ZEAH 2F54D 3GIZL 3VFSA 3D39E 5DI8B 3L3JA 3RGHA 1AGBB 2VH5L 3ARFB 1SYVB 3BQUC 5DK2B 4ZUWB 4MNGB 3BGFB 4G5ZH 3CLFH 1L9NA 1PJ9A 4Y1AD 4R97C 4RX4A 2J88L 3BKML 3OAYH 4B50A 3UMTA 3C6LB 5DHVB 3DX8B 3CDGA 3V0VA 1LDPH 1EX0A 2ZUXA 4JHZA 3HR5A 1QBBA 4NSKB 2BY2A 3MLVL 1FIGH 1NBZA 3OZ9H 4WUKH 1UXWA 2APVA 4YDIL 4XXDA 4M6MH 2EIEA 2X4RB 5ENWB 3BUYB 2GCYA 4P4KD 5BVJA 3UTPE 3WKNA 2MQCA 3AB0B 4EIGB 3WIIH 1I3RA 4QXTB 1MRFL 2YPKA 2NY0D 4C56D 3MRJB 3H42H 5L2JA 5K9JH 4HXAH 3NIDE 1JGEA 3C6SA 2BNQB 4JQVC 5CIPB 4UT6L 3G6DL 1F3JA 1KB9K 3I02A 3VW3H 2XTLA 2P48B 4DVRL 4ODWB 1H3VA 2XIDA 1MAML 4RA0C 3FO1B 3K2UH 2P5WE 4N8PA 1E27B 4G6FD 3AY4C 5ITFA 4PJGE 2OI9C 3WJLC 3MLUL 3LN5A 3PL6D 3U4BH 5EDXA 2DD8H 3TT3H 1QSFB 3EFFA 3HE7B 1CQKA 3MRLB 3F62A 1N3NB 5AAMA 1XCTA 4RWYL 3LMJL 5IMMA 5D8JH 4Y16C 5HJ3B 3DECA 2X70A 5I8KL 4OV5A 12E8H 2QQKL 2C4XA 5C8JB 1KCRL 3VFSB 3AUVA 1U8HA 1LEGA 4C4KO 1HQRB 4NNXB 1CICC 4ZTOL 2B2XL 1NAMA 1JYWA 4DVRH 3P73A 4JRXA 1EK3A 1KEMH 4KRMB 3CNKA 4PRBA 3RWJB 3RZCC 4JO2H 3NABL 3CLEH 3TBYB 5HBBA 1WAAE 5AZ2L 2GIYA 3AS1A 4EIZC 4NUJB 4PJBF 2VIRA 5SV4A 1HZHL 3D69B 3GMMA 1P2CA 5C09E 1W0WA 1CLZH 2FWOB 3EYQD 2EE2A 3ZDYE 3E6FB 4DEPC 5TH2B 5I8KH 2HP4A 2YR3A 2AXFA 3U0TA 2LABA 2HFEA 2Q3ZA 3ARBA 3OAUL 3TH4T 4XNUH 1M6OA 1UWXK 4BKLA 1FFPA 5DO2C 4NZRL 3BMWA 3MRIB 1C08A 3NFSH 4L8CA 5IOPB 2HH0H 3STZA 1OGTB 3V4PL 1CGVA 3H42L 1A7PL 2EE3A 5DC0A 1CFQA 1YECH 3EJZD 1DBJH 4GBXD 5JXAL 3H6JA 3NFNA 5K9KB 4NM8L 4G6FB 4JZOA 2PTTA 4HIXH 4DKFL 1NBYB 4KDWA 1EJ6A 3FB6B 4MAYC 1MCWM 1S9VA 5FHBL 5TGBA 1F3JB 3K4AA 5IQ9A 5C0GB 3T77B 2RB8A 5CD3A 1PX4A 3PV7A 4P23B 5GGQH 4GKSB 5DRNA 4HFWB 4NQXB 3MQIA 5FGBC 1NCNA 3DETC 4K7PY 3AVEA 3GSOA 4YLQT 4EUPA 3HLAB 3SGKA 1LWRA 3MXWL 4LBEB 4C83B 3O0RL 4I48A 2R39A 4KK9D 1UT9A 2QTEA 2Q7YA 5HVHC 3QH3A 1BF8A 1TZGL 1C12B 3FN0L 3FRPG 1S9XA 2XKNB 2EDRA 2EH7H 2Y7QA 1X7QA 5HHOE 1NAMB 3GZKA 3VH8A 4WU7B 1HSAB 3D85A 3EYOB 4K3EL 4L1HA 2HTKD 3MODH 5EUOF 4NT6A 1A7QH 2WW8A 1BZ7A 3VRJA 4C56E 4OZIF 5D1ZD 3PXJA 1JV5A 5LWYH 2VDPL 5JHDE 4IMKA 3U36A 3EYSH 4QT5A 1TZIB 5FYLH 2OL3L 1YEEH 5GGVL 4OD1L 3KAAA 3BPNB 3PABA 4D9LL 1CVRA 4TULL 2J3SA 4QHMA 1MAJA 3WS3B 4LGPB 1U42A 1CDJA 3LQZB 2E9JA 1GHFL 1H9VA 3D25A 4GQPH 3U2SB 2P5WD 4OFPA 2R23B 3ZKMD 3FB6A 3O4OB 4FFWC 5EIVA 4NRYA 4Y5YC 3DTXB 3JSSA 1UEYA 4YDKH 5C71A 5IBTL 2COQA 4EOWH 3HCVA 1K5NA 5E8PA 4S2SA 1I8KB 3KYMB 1DBMH 3D2UA 3DIFA 3FRUB 2V2TA 1KSRA 5KSBE 3STZB 2UYLB 5IB2A 4KPHL 2X4SB 2M2DA 4GMSH 3BP5A 4U1GB 3VD7A 5D7LE 1XGUB 1V7ML 3V6FB 2NY2C 3GSXA 2H2SD 3K46A 4U2ZA 1I85C 4P3CL 5SWQA 1JL8A 1IQWH 4AEHH 4X6CA 2DQCL 4DZBB 1XIWC 4LCCB 1KEGL 1KF9B 3V5DB 1EAPA 4WWKA 2EXWC 4IDJH 4OF8A 3KLAB 2NY6D 4CVXB 5I71B 3QYCA 2NY3D 3DUHA 4ZXBB 1QNZH 2VXQL 5C0RL 4BYHA 3UDWC 2XY2A 3WLBB 1D5XB 3O8XD 4PJFB 1FV1B 2H9GA 3PHQB 3Q6GH 1W2KT 1AI1H 4TUKH 1KLGB 1FO0A 1VACB 3WKMH 2K3TA 4X80L 1K6QH 3RWIA 3RY5A 2OJEA 5MEQA 4ODTH 5I17A 4YQXH 1VADB 1AY1L 3MC0A 5LGHH 4DAGH 4KY1L 4OCXH 5IHUL 4JM4L 3FRPA 3HFML 4NZUH 4F8TA 2FATL 3OL2A 4N0FA 1MI5B 4LGSB 4I18B 2PW1B 2LV4A 4R90L 5KSUA 4JRXD 4ALAL 3SKMB 1N26A 3LD8C 3ULVF 1CGYA 5TJWK 5C0RH 1MHEA 1SYVA 1LE5B 4NJAL 1QYGL 3LQAC 2IJ0C 4PJDF 4XXCA 5ITBH 5ESAB 3IDNB 4KJQC 1IE5A 1CU4L 1QSVA 1Z9OA 5BCAA 4CW1B 2CLZB 1DQLH 4OSUH 4LPWA 2W65B 1T1WB 4XAWH 1ZA3B 3RGVD 1BX2A 4NO2B 1WVZA 5IBTH 4EOWL 1U3ZA 1KIQB 1R24B 4JHWH 3G5VA 1AO7B 5JNYB 2ZJSL 1BIHA 2AEQL 4GG6A 4HKZB 4U6TA 1DBML 5KSAA 5D5MA 2OL3B 4AMKL 2N7AA 3V8OA 1CE1H 4HKXB 1YYML 5KAQF 4YWGH 3BW9B 1HKLL 1V7MH 5GGSA 2HJLB 3QQNA 3PGDA 4OZGF 1GZPA 1X3DA 5TFSL 3GRWA 3GNML 1FRGH 3BKCL 3KDMB 2N4IA 4M03A 4Y89A 3BHBB 1ZVSA 5FUZH 4NO3B 3ULVE 2YRPA 2ZSWB 1MIEL 3RWIB 5L9DL 3VRLF 5I17B 3BPCB 3D0LA 4A2MA 1AHWC 1AO7D 5T1KA 5HI4D 3MRLA 4R0LA 3HZMB 3LSOB 3S36H 4KRPC 3QIWC 2XTJD 1DVFB 4MA1B 4XMLH 5C1MB 4TUJB 3RWEA 4JGUA 4MSWA 4W4NA 3WNOA 1YYMH 4CMMA 3UTTE 1OF2B 3TC9A 3MNVB 3MXVL 2R29L 1WBYB 3OKEB 4YQXL 1EEZB 1WFNA 4JJHA 4LLYB 3F58L 3MNZB 2VDNH 3GSQB 5CINH 3O6FD 2ZUSA 2WV3A 3OB8A 4KK6C 4I0CC 1A1MB 3F8UB 5D7SH 3FOMA 1I9EA 3KPSE 1FNEB 5DQDL 3IU3B 2AJVH 2IEPA 2XPGB 4BUHA 3WDHA 3S37L 4GFTB 2EDBA 1FL5A 1MFAH 1WFOA 5MENB 5ESQA 1K3IA 4OF5A 1WFUA 2DQFB 3GGWA 4UB0L 4U2YA 1TQCB 3E3QE 2B1AH 1YEIL 4W81A 4J8RB 4NWUH 4UIKH 4WU5A 2P8PB 2ICWB 1U95B 3CX2A 1HOCB 5MI0B 1Q94B 3SPVB 3BH9B 1IAKA 4NGHH 2W0PA 3RZCA 4IMLA 1NMAH 3S36X 3IXTB 1G0YR 1LO4L 3BGMB 4ETQA 5JHDA 4X4YA 3BMVA 3QFDB 4X9HA 4HG4J 4JQIL 3D18B 5IW1B 5E99H 1ZA3A 4GRWH 1BLNA 2HVJA 4N9GB 1CL7L 2G9HA 3RUGE 2VLJA 3MBED 4X9FA 4M61B 3RWGB 4YHZH 4YPJA 2CKBL 1EZVY 3PWPB 5TDNB 3VWJD 5K9JL 3LEXB 2VXUH 3P4OB 1M71B 3F6IA 4HUMB 4XBPA 1OY3B 3S88H 4PJIE 1T3FA 5DQJB 1EVUA 3ROOA 5IVXA 4PJ9A 1F90L 4PBVC 5IW6B 2CH8A 3S4SG 4TSBH 4YK4C 5E2TL 3OHXB 5DVMA 4HG4K 4K3HA 4NO3A 4UINL 4P48A 2E7HA 4PJDB 4WWKD 5C9JA 3HE6C 2OJZH 1F3DH 2OTWB 5BS0D 4JQIH 1TJGL 4K9EL 4RMRA 3BXNA 2EYTB 1F5WA 4U7SA 1MUJB 4YHKH 4KMTH 12E8L 1CDIA 2DJ4A 3VXOB 3BVNA 1QLEH 2XZCH 3B8YA 1NLDH 5GS1A 5IQ9B 4XPBL 3SE3A 4U1LB 2VXTL 3H9HA 3H3KA 4JFPA 4LCWE 1H15A 1WZ1L 5C92A 1T83C 2Y6SD 3QIBA 1OP5H 3EOTH 3ETBF 4YO0A 4H0IA 1G9EA 3LVEA 4ETQB 2E9IA 4JO3H 4HBCL 4BM7A 5SWSA 2DQDL 4JFDA 2O5XL 2Y06L 4YDVB 1I8MB 5GPRA 5C0NC 4FQLL 5F7KC 1JPFA 4LIQL 4M48H 2GTZA 2OMNA 4XNQB 5F96L 5FGCE 2DQTL 5IM7B 3B9DA 3OPZL 5T1LA 1X5IA 5H2BA 3MBEB 3TA3B 3BEVA 3U7AA 3BZFB 1AO7E 2XYCA 4X5LA 4IOFC 3TN0C 2AAVA 1MCOH 4LKCA 1CDCA 1GXEA 3BKYH 1NGYA 5EUOE 3ARQA 5E6IA 3RKPA 1T7ZA 1NEZG 5F6HJ 3F7YA 4NKIL 5C0BA 4X9BA 1RQ5A 1E4WL 1A4KB 1BFOB 2DQDH 4TNWF 4QF1B 5JQ6L 4ERSL 4ZFZA 1AQKH 1CXFA 3NABH 4NZTH 3QDMA 1UJ3B 5BZWA 3OXRB 4EUPH 5ID1A 1EAPB 1QACA 4WWKB 2AJXL 3V5KB 4MAUH 4V1DA 4LF3B 2FBJL 1HZHH 3QO0A 4H8WH 3TNNB 2F9BT 4ZAKC 1ZGLP 2B2XH 4OZIE 1J8HD 4WW2B 3FO2A 4G43A 1LD9A 1FVDB 3D3VA 1LP9A 3KWWB 2C5DC 3VI3E 1TENA 1NGZB 1QHOA 1ZSDA 2DMBA 2CLVA 3ZHDA 3NCEB 1G6RB 4NKIH 2JLLA 5SWSB 3HG1B 5IBLD 3GSWA 4YIQA 2P5EE 4NZRH 3IT8D 2ZG3A 3U0PB 4TTGA 3QPXL 3BPOB 1B9ZA 1BFVH 4QYOB 1R0AL 3VDBA 2YD4A 4JG0H 5JIKA 4KAQL 1KPRA 3G6AA 4IHOA 1YEKL 4DVBB 1YECL 3HB3C 4OCSL 3L9RB 4G8GA 3O9WA 4J23A 1HSBA 2NLJA 3FQTB 3UYRH 4HS6B 2Y5TA 4PJGA 5C0EA 4YGVA 3TM6A 1LO2L 1T03H 1MJJB 4AENB 4TQEL 4Z76A 3MV9E 5GS2D 5D7LB 4NRXA 5EU6E 2DB8A 2XICA 2DWEA 4P4RB 2DLHA 1NCBH 2WK2A 3D39B 1HIML 4TUOA 1L9MA 2IG2L 2KPNA 4H8WC 4XCYB 4RZCA 4KI5D 4PJBE 4ZAKD 4PP1D 2MCPL 1ZT1B 3Q1SL 3VFPB 1CZ8L 4JO2L 1T21A 2LE9A 3PWJA 3MRNB 3V6OE 3UBXG 1J05B 2CIIA 2YUWA 1FNGA 3EJYC 2I9LA 3BZFA 3TNNA 4KXZI 4P4KB 1WJ3A 1BVKA 1HK6A 5DJZB 4HUKB 4GKOA 4ERSH 4WIQA 1NGYB 1T6VN 3UYRL 5BRZD 1EFXA 2APFA 2EEBA 4O2FB 3R8QA 1FFNB 4GKZB 4PIRF 2XTJB 3UTZB 1CDYA 2ITCA 1H3TA 3W39A 4U1SB 1IT9H 5C86A 5I1CH 4NNPH 4P99A 3IXAA 4LVOC 4UAOC 5D7KD 3TN0D 1HIMH 1J5OH 3WNPA 4PJ9D 5EORH 5EU5B 4IRJC 1QFWM 2I25N 4M00A 2GFBB 5HSFA 1OT1A 3ZYIA 1JGVL 3QIUC 1A7PH 5E8NB 1II4E 3VWJA 2EH7L 3MRCA 2ENSA 1UXSA 2R2EB 5JXAH 5F7MC 3CVHB