3O2VH

Crystal structure of 1e9 phel89ser/leuh47trp/meth100bphe, an engineered diels-alderase fab with modified specificity and catalytic activity
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTFADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVRAFDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Chimeric antibody Fab 1E9, light chain
publication title Crystal structure of 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe, an engineered Diels-Alderase Fab with modified specificity and catalytic activity
rcsb
source organism Mus musculus, homo sapiens
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o2vH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o2vH02
5D7LE 1HILB 2ZOLB 3AXLA 1BX2A 5C0CA 1G7QA 3SJVA 2K7PA 5JNYA 1BJ8A 4M02A 3O6KL 4ZPTB 4KJQC 2MHAB 1BECA 3EOAA 2O26U 2E7CA 3A6CH 4ODWB 4B50A 1G6RA 5E8EB 4M7KH 5J57B 4Q7DA 5BMFH 1AR1C 1REIA 2ATPA 1TZGH 3LEXA 1MRFH 3STZA 2BVOB 4QNPE 4U0RB 3A6CL 5I1HH 3UYRL 4HJ0D 1T6VN 2XN9E 1KB5H 3ZDYE 4M7KL 4PP2B 1JGDB 5BMFL 4EUPG 3IDXH 5C0BD 1TZGL 3H2WA 1HYRC 1N7ML 3G5VB 5ESQB 1MRFL 4Y5YC 3L1OL 5I1HL 5F9OH 1OAZH 3MLVH 3GO1H 1ED3B 4XPFL 1NFDF 3ULVD 3U7WL 1NC2D 1MLCB 1MCRA 1AD9B 4OCMC 3LKNA 5F9OL 4M7ZC 2EYTB 4KJPC 4ODHH 4X99A 1OAZL 3GO1L 5C8JB 5B38B 1YN6A 3FFDB 2IG2H 5E9DA 1YEJL 5HHMB 1RVFL 5C0CD 1IM9A 3SJVD 3MV8D 4NN5B 2BNRA 3T09A 3KJ4C 1ZEAL 2UYLA 5IOPA 3WFCH 1DBJH 2DYPA 2G5RA 2WLZA 2PF6A 2IG2L 3QUXC 4GRWE 3KHQA 5C1MB 5C2BH 3R06A 3FHAA 4ZS7H 3LRSA 1KFAH 4OF3A 1VSCA 4HKJB 3PP3K 1A1MB 4OCSL 4IRSB 5C2BL 5JQ6L 5CIPH 1DE4B 4PRBA 4ZS7L 2Q8AH 4KXZI 2VDQL 3ET9F 1U8HA 2A74B 3O2VH 5T1LB 5AWNH 3F12B 2G9HB 2R2BA 4QKXB 2VL5A 1C5DA 5K59F 5DHYB 4PRHA 3BP5B 3G6JF 2XY1A 2F8OA 2Q86A 4WENB 2HG5B 3VRJB 3MJ7B 3O2VL 4Z7WF 1AFVH 4LCUA 3QJHA 4Y88A 1PKOA 3KPSB 5T3XD 5E9DD 1IM9D 2F9BT 2BNRD 2C1PA 4UB0H 4Y5VC 1AXIB 1M4KA 4GAYB 2YWYA 1AO7A 3OKNB 3DMMC 2DYPD 2JJTC 2UV3A 1NEZG 3VWKD 3WE6B 3WHXB 4JFXA 5GGQH 1H3GA 4OZFB 1TTUA 4HMCA 4PJIE 3GMMB 1OTSC 5EU6B 3QEQA 4Z9KB 1EFQA 2ARWA 3FONB 5CSZA 3GSVB 1RK1A 5H35B 2VDRL 3LDBC 3V6OE 2FZ3B 4XBPA 1F8TH 5GGQL 4WO4C 4QXWA 5KSBA 1KT2B 1SJXA 1JIBA 3MOQA 4PRIB 1X5LA 1QLRB 3B9DA 2X1QA 3F58L 3KPMB 2DLHA 5JOFB 1F8TL 3V8CA 2ZG3A 3P9WB 4PRHD 3MV9E 5HY9A 4JO2H 3H9SB 4ZTOL 1QSFB 1YEFH 4D9RD 1UB6A 4HWZA 3NABH 4NUGH 1U8KB 5MEOA 2C4FU 2IPTH 5EU4B 4NQCB 4ZFZB 1QA9B 1EUUA 4JKMA 1UZ6E 1YEFL 3T4YB 3Q5YA 1UYWH 3QCTL 4MA8H 2BVYA 4MQXC 5ESVA 4KROC 4FQXA 3WYRA 3HE7B 4OI9A 1AO7D 1G9MH 3RTQC 3ZDXE 4EBQH 1G9NH 1BBJB 4LK4A 5E94B 1UYWL 2B0SL 4MA8L 5TE4H 4OLZH 2I5YH 4F8TA 2EYSB 1BF2A 1PAMA 3QEQD 4OZIF 2DQFA 3DHJA 1U2CA 4YC2C 1G9NL 4ELKB 3S97C 4GRLA 2AEQH 3PWNA 4F9PC 3BP4B 1QFWI 5GQBA 1SVZA 1V3KA 4OLZL 5FK9A 5I1GH 2I5YL 4HK3N 5FB8B 4OZGA 2CMRH 2P1YA 3MNWA 2BHYA 5F1KC 1MPAL 1LDPH 3TYFB 2F74A 2AEQL 1J05B 3BZ4B 4LCIL 3W39A 5I1GL 3F65A 4OF7A 4LSRL 2XFXA 3ES6A 1S7TB 3GSOA 5GGSA 3NBNA 1FO0A 4G8GB 4DVRL 1P7QA 4KUZH 1YEDA 3O3BA 4WUKL 1XR9B 1CR9H 2A38A 4I48A 4ELME 4RDQG 3NFNA 2L4OA 1Q94B 1ZGLM 1S9XB 2VH5L 1WFOA 4HJGB 4FQXD 4P23B 2X4OA 1D6VH 3AC0A 5B3NA 2GY7B 4G80B 3PV7A 1BQHG 1AXSA 3ARBC 1CR9L 4LRNH 4NCDA 2WBKA 4Y16C 4XNZC 2OLDA 1S78C 4Z78A 4MB5A 1LO0H 4O2EA 3RI5K 3C87A 4X6CF 1JGEA 3MR9A 3RPKA 12E8L 1NCCL 4HPOL 1Q9LA 4GRLD 1MFCL 4PGBA 1ZLSH 3QO0B 5F8QC 2VOTA 3ROLA 3D9AH 3CDCA 2R9HD 5DK2A 2DDQL 5F3HA 4O2CB 1LO4H 5C09A 3RNQB 5L0QB 2DM3A 3ZL4H 3SDDB 3LKOA 1IGTB 4YHYB 4HS6A 4MJIE 4RMVA 3V4VH 4JVUA 1LO4L 1AC6A 4GXUN 4WHYH 1HHKA 1P7QD 3C9NB 1DLHB 4DKFH 5A16B 2AK4B 2XOTA 3UPCA 3HCVB 3HAEB 1P4LA 1RY7B 3VFMB 5A2LH 5FA3B 3TF7C 3V4VL 3MBEA 1OQOA 3SGJA 1VFAA 3EJZC 5HYJA 1F3DJ 1MHEA 3RPIA 4OGXH 1IEAA 3HMXA 3JWNC 3WIHH 5DRZB 5AYQA 1IZJA 2YWZA 5C0AA 1J1XH 4GUPB 1MLBB 4YO0A 4NKMA 3RGVD 4PTUB 1XF2B 3O9WB 4BM7A 3AB0B 1SJVA 1FVDA 1LK2B 1Z0NA 3WIHL 4PJXA 4NKOB 4H5SA 5F7FA 5EO1A 2B4CC 4PRPB 1J1XL 3D69A 5F44A 4EXPX 5C09D 3GSWB 4LVNB 4K8RH 4NUJB 2GTWA 5DJAA 4FFVC 3CX2A 4BZ2H 3O4LA 1A5FH 4WU7A 4NWUH 4AT6B 1XFPA 4YDJB 5IHUL 1U8IA 4K07A 2V5RA 1KCVH 4OAWB 4HUUA 4C56A 4HIJB 5TH2B 4ZUSB 2J4WH 2YZ1A 3IETB 4O51A 1J0ZA 1IAIH 1A5FL 4XTRC 5HGDA 2BNUA 2YUVA 3MBED 3CZFB 1KCVL 4U3HA 4F33B 4GT7A 4OFVA 3VXNA 1NFDA 4LLMB 4X4ME 2J4WL 4H0HB 1IL1B 1ZGLA 3W81A 3CU7A 3HG1E 5DQ9B 3O41A 4KJQD 1I9RL 4LPTA 4NN7C 1OAXH 2H32B 5D1XC 3QDJA 1EHAA 3FOMA 4KQ3H 2VIRB 2QQLL 5C0AD 4Z77A 1NEUA 3I6GB 4Q74A 2AXFA 1OAXL 2CLZA 2MKLC 1IAOB 1NCWL 3V5HB 3EIFA 3QIUC 3P4OB 1JZ2A 4ODXB 2FO1A 5SV3A 1I75A 1UH3A 2IQAB 3Q5OA 4JN2A 1IGYB 2DWEB 4X83A 1GAFH 5DZOA 4U7KA 1LE5A 5GRUH 3MXWL 2QADB 2B5IB 2BSRB 3O4LD 1A1OA 4MNQB 3B9EA 4K94C 4C56D 1GAFL 5GRUL 1NUGA 5SX4H 2IH1A 2XPGA 4G43A 1EHLH 3REVA 1KTRL 1TCMA 3L3GA 2W0LA 1MUJB 3UPRA 5C0BE 2FJGA 4F7EA 1U92A 2ESVA 3BO8B 1DQLL 5EA0L 3QDJD 4PY8I 4IMKA 5J3HC 1YY9D 5FM4A 2ZCHH 1UJ3C 4BQCA 2W60B 4RZCA 1IFHH 4GAJH 2R1YA 2V2WB 2A1WH 1BZ7A 1WCBA 4U1NB 2ARJQ 5B39A 2E9BA 2ERJB 5C0CE 3O3DA 1DEEA 3SJVE 2ZCHL 5H94A 5DJXA 1IFHL 4JZOB 2BMKA 5TDOA 3U30C 1JWUA 5C08B 4MA1C 3TWCH 4LGRB 3H9ZA 4D9LH 4D3CH 2JB6B 3N9GH 4NQUA 3OXSB 4HDIB 1NBQA 4LIQE 3D0VA 4F7PB 1EDQA 4OB5H 2C1OA 1WBZB 4F80A 3BD5A 2BERA 3R4DA 3CDGA 5TGBA 3PNWA 4JQXC 4YHMH 4D9LL 1ZGLP 1G84A 4D3CL 3N9GL 5AD0B 4H25A 5F1NB 5L2JB 3UJJL 1UFUA 1EBPA 4QOKA 3VD7A 2FIKB 5I8OH 2D4FA 4OB5L 5FYKU 3W9EA 3BPNB 3B2UD 2VKWA 4PG2C 5GS1C 2ESVD 4YHML 1FFPB 1ZLWK 4V1DB 4XAKD 1QO3B 1UG9A 2O93L 1JI2A 3ZYJA 5BQ7A 35C8L 5I8OL 2NY2C 4R9HA 4NKDB 4MJ6B 3M8OH 3LQAC 3GHEH 3KWWB 3QBTB 4RSVA 2DI8A 1G7LB 4K7PX 2YRLA 2Y4SA 4XVUD 1RURH 3QCVL 3CGTA 4R96A 5T3XE 1YZZA 3MXVH 4G6AD 2NTFA 4LHQB 5E9DE 3M8OL 5JW4Q 3GHEL 2BNRE 3JWOC 3KGRA 4PLKC 3O0RH 4BELD 1NDMB 2WW8A 3GMQA 2NLJB 5SWZD 1CQKA 1NSNH 2FLRT 4QWWD 5JZ7C 2CIKB 1OLLA 3L3JB 3OGCA 5TDPA 3MRKA 1HWHB 2FB4L 3O0RL 2ILLA 5FECB 5DMYA 5I1LB 2QL1A 3BVNA 3CLEH 3QO1A 4LIQL 4U33A 4UDUB 4YR6B 3SDXF 1T22A 5B8CA 4PJGA 4LQ1A 3VD4A 1K5NB 3DUHA 5J9PA 5D71H 2PW1A 3NAAH 1HIMH 1MCCA 4BQ6A 3L9RB 4QHLA 3ARQA 4LMQI 1JUFA 3GMPA 2FEDD 1JPGA 4NNXB 4YX2L 3BMVA 1D5BA 1DDHA 1KNOB 3HB3C 4PRHE 5D71L 2DKSA 3NAAL 1WTGT 4D9RE 1IKNA 2NW3A 2OP4H 1BWMA 2W9DL 3QUMA 3JBG7 1T5WB 1BOGA 3MRMA 4HUWA 4PJBA 5I2IA 1NGQH 5IVXA 1NGPH 4L3EB 2COQA 3MLZH 4RGOL 4AMKL 2OL3B 2BRRL 2RHEA 1RZGB 5FYJD 1KJ2B 3SDCB 5DJDB 1F6FB 4AY0A 4DFHA 1AO7E 2LU7A 4N8VB 2I9TA 3B9KC 3LPFA 4HEPG 3TZVA 4LNRA 1NGPL 3MLZL 4Q2ZB 2PTUA 1PDKA 3T2PA 5DSCB 4HGWB 4RRPA 3TO4C 4QRQB 1ZTXL 2Q1EA 3QHFH 1E4XH 3QEQE 4S10A 4ODSL 5EZLA 3IT8D 3PWJB 3IRZA 4F8QA 1KYOK 3NIDF 5K9KA 1T3FB 3QHTC 2DWDB 5KSBE 3GSQA 3QWRA 1TMCB 3PHQA 1JL8A 2ENYA 5I18L 1QHOA 2CK0H 2R4RH 3DROB 3GSUA 1ZHBB 4GW4A 43CAA 4KI5C 4KPHL 1GJIA 3QUXB 5ECJE 2EO1A 1AD0A 3E3QC 3UBXI 3RWEB 4XPHH 5CKGA 4NP4L 5I9QC 1S7VB 2VLJB 2BNQB 4ERSH 1BQSA 1MVUB 2PW2A 3H0TA 3QRGH 2NYYC 3WIFB 4XPHL 3QZWB 2EXYC 3M45A 4HK3J 3PWUB 1IAII 4G7VL 4OUUA 5IHLB 5KSAA 4GMSL 4JLRA 4ERSL 1OP5K 1YECH 3WXWH 4BUHA 2O5YH 3TZVD 5I1AA 3QRGL 1E6OH 2HKHH 3ARFB 3ESVF 2GK0A 2JELL 3MLRL 4LF3A 4G7YH 3MLYH 5KVDH 4GG6B 1XGUA 5EU7E 3HRZB 1YECL 4MVBD 4LDLB 5DJCA 5EUOB 5DI8B 1E6OL 2HKHL 3AY4C 3RZCB 5ID1B 3QWRD 1PQZA 1A3LH 5GPRA 5KVDL 4J12A 4OZGE 4XXCC 3EJZD 3TCLB 5CBEA 1VFBA 3WFEH 3U7AA 3HZYA 4Z7OF 4Y5VB 5BS0D 2WLYA 2RAMA 3K8KA 3LKQA 1QNZH 3DMMB 3QXTA 1PZ5A 3FQXB 1U3HB 1TZIA 1A3LL 5CEXA 1UWXH 5IBUB 5GIRB 3WFEL 3MA9H 1OSZA 4R0LC 1E4KC 1Y6KR 3L5XL 2IH3B 4HWBH 3CFIC 3TLRA 4FMFA 5D7KD 4ZOAA 3LDBB 1TJIL 1MCDA 3CFCL 4G6KH 3FRUB 3HFML 4WO4B 5F7MC 5SX4I 4B0MM 3HI6H 3MA9L 3RZWA 5IVZB 2VLMD 4NBZB 1YJDH 4TTDC 5ALBH 4URTB 1I1AC 5CZXD 2UZIH 4Y4FC 4MQSB 1B2WH 5FO7B 2R0WL 1AQDA 3VXQA 5DJ6B 2VUOA 2G75B 5LJYH 3QNZB 1S9WB 3IFLL 3HI6L 1U8OB 2NW2B 1U9KA 5ITFA 3OL2A 1B2WL 2FDBP 3RVUC 3QEHA 1EHXA 4YDKL 1MCWW 1FNGB 4XTRD 3MRDB 1U8MB 1IMHC 5CP7A 4LEOB 4P9HC 1T1XB 5C09E 4ZFFB 4WI8A 3DVNB 3RTQB 3QQ9C 2LVEA 2CRMA 2PYEA 3L3KB 5I15L 3ARWA 3L6FA 4L8CA 5ACZB 4FXGA 5EBLA 2XWTB 3P4NB 1R3LB 4YK4C 2VKXA 1FO0L 4JVPA 3Q6FB 2N7BA 3TFKD 5HYJE 3PV6A 3P30L 3N50A 4CVXA 3EYQD 1A7BA 1N6UA 2R2EA 4WW1B 1TPXB 5JIKA 5ALCH 3C5JA 5ETUB 2B39A 3K2UH 4PJDB 2NNAB 1CGWA 3FFCA 4TSAH 5C0AE 3AM8C 2J8UB 3L7EB 1XAUA 3CMOL 5IQ9A 3EDFA 1QVOA 1CE1H 1CDBA 5LBSL 1JRHL 5ALCL 3DETC 1S7UB 3QFJA 3FT2A 2WBJA 3RX8A 2JTDA 3K2UL 4PJXE 4OFYD 1I7ZA 4MQTB 3F7VA 1KJVB 4JPWL 1OGTB 1CE1L 3GUTB 4F3FB 4X6EA 4FNLL 3DV6A 5FYKH 4X8JA 1IQWH 3FRPG 2UWEA 1T0PB 3O4LE 4ZXBC 3RWFA 1EO5A 1RSFA 4C56E 3BAEL 3U4EA 4DUXA 2ADGB 3SCMB 4MCZB 3NCCB 1IQWL 2VABA 3SY0A 1ZWIA 4UT9H 3PXJA 1CGXA 1MJJB 3V5DB 4DN4H 1NFDE 4RMTA 4MNHB 4QHNB 1RZJH 2EE9A 3O2DA 2X89A 3VGHA 5FF6A 4WWKC 1F2XK 4YZFF 3C8KB 1I8IA 1QRNA 4QXUH 5HD8C 3QDJE 2RCSH 1TQBC 4I18B 3T65B 3FFCD 5DEGB 5DA0B 1HILA 2ZOLA 4HUXB 3G5YB 1RHFA 3X12B 3EDKA 4S0TD 2WBJD 2MHAA 4UT6L 1QHPA 4BSVA 4CBPA 4ODWA 5B39G 4RAHA 5E8EA 4PJEF 3MGOA 1MVFA 1OP3K 4HC1A 1SEQH 5EDXA 3HLAB 3WFZA 4YBHA 2Z93B 4U0QB 5JLZB 4C57C 1QG3A 1HHIA 2BVOA 4XPGL 3P9MB 3TA3B 4PP2A 1JGDA 1SEQL 1I85C 3H7BB 1CD1B 3D85A 3F6IA 2WWKT 3G5VA 1E4XI 4JM4H 5ESQA 2ADIB 3HS0B 1OGAA 2HVKB 3MLXH 3U9UA 2YD1A 4YDIH 4M6AA 2CKNA 1ED3A 1U93A 4X7DC 2OBGA 2ESVE 2LTQC 1S9YA 3KNBA 3IDIB 3TNMB 4U6YB 1NPUA 4CU8A 4XAKE 4WTWA 1AD9A 1TTFA 2YD2A 1UZ8B 2CDEB 4E9LA 4YDIL 4DQOH 5C8JA 4Z95L 1FDLH 5B38A 3FFDA 3H7LA 3MRRB 2V7HA 5J13C 4ONHA 1CGSH 3UJTH 5ITBH 3UTOA 5IJVA 4DQOL 4YDVA 4UMGA 1FDLL 3WEXB 4HX1B 3DX6B 1CGSL 3UJTL 5ITBL 2X10A 3KPRA 2V9QA 3CLFH 3B8YA 4HKJA 1IAKB 4NN7B 2IPKB 4IRSA 3ULUC 3EYSL 1DE4A 1CQYA 3DUUB 2OMBA 3D85D 3MRFA 3IVKB 1UM4L 4KK9D 3WN5B 1OGAD 1ETZB 1EUTA 5T1LA 3NPSC 4QOKE 4X0KB 4Y4HC 4TNWK 4PJ7B 2G9HA 5FUCE 5DHYA 3BP5A 4KU1A 3GJFK 4FTVB 5JOPD 3RKDD 3VRJA 5FM5O 3MJ7A 1GSMA 3B9KD 4N68A 5DC9B 3ZDZF 3KPSA 4M03A 3OAZH 4XP1H 5HHMD 1HCFX 3U36A 4DKAA 3PWVA 4D0CB 5CD5C 4LHUB 4GAYA 1TCRB 3OKNA 4X7CC 5SWSB 4EDXB 1V5JA 2ZZUT 3C6SB 4LCYB 4XP1L 3WE6A 3WHXA 3MRHB 1CDGA 3MZGB 1JE6A 4YBQC 1YPZA 4J3UA 4YPGA 3KPRD 5EU6A 4D0DA 2WIMA 1L6XA 4XI5D 3FONA 2X4SB 3GSVA 2LU4A 4D94A 2V2XA 1RK0A 2FZ3A 5DD1L 3PDOB 4IRSD 4YXHH 1TIUA 3FQUB 3G6DH 4JDTL 3REWB 3BUYA 1KT2A 4RRPG 4PRIA 1QLRA 1ZANL 2D0HA 4XX1G 1MAKA 3WKNA 4M1DL 2JJUA 4CN6A 1FJ1B 3MODH 5T1LD 2HRLA 4PJGE 4OSUH 4YXHL 2X4RB 5JOFA 4GMTH 2G60H 5EOTB 3ZT5A 2EXYD 5ICXB 3H9SA 5JDSB 1QSFA 3ZT6A 1FLRH 3MODL 2NY6C 1U8KA 1X4YA 1HI6B 2BCKB 4GMTL 2G60L 3O4OC 1R5VA 2ZUVA 3L3IB 4JFFA 5KOVC 2IBBA 2W0KA 1AP2B 3T4YA 3IFPB 3O3EB 5KANG 5HDQL 1FLRL 3MLSH 3HE7A 2YUXA 5K9JL 4QYOA 5SX5K 3NOIA 5J6GB 4PJBE 5IVXE 5M7QA 5MERB 1BBJA 3Q6GL 1G7IA 5IB4B 5E94A 4RIRB 4FXKB 2R0LH 1S7SB 4Q6IB 3MLSL 3ZHLA 2XQYK 5EU6D 2EYSA 1S8DB 3CVIH 3PP4L 2CUMA 1AHWA 1X5XA 3EAKA 2NY2B 5BZWA 4A2LA 4GRMA 2R0LL 4PRID 4XX1E 3TIEA 2W65A 3CVIL 3V4PL 5IROA 3FO0H 1FL5B 5HYIA 5FYLD 1NAMA 5I75C 1H3UA 1GXEA 1V7MH 3TYFA 4N1HB 1MQKH 3O6LL 3BGMB 1KPVB 2ARJB 2JF1A 1FNEB 5I8CB 1I1AD 1S7TA 3NCMA 2LAGB 2I24N 4G8GA 3O45B 3K1DA 2WQRA 5EBGA 4K7FB 5I1IH 4OF8A 1XR9A 3R8QA 4JFFD 3GK8H 4FFWC 3FMGH 2D9QB 1MCLA 3VXUB 1S9XA 4HJGA 3UO1H 3HE7D 5E5UB 3MJGX 5I1IL 1A22B 1AE6H 3GK8L 4JFPA 2VLKB 3C5ZD 4LSSH 3WDIA 5F7KC 3JWDH 3UO1L 3BDBA 5DFWH 1OM3H 3QUML 2ZJSH 4AEHH 3FN9A 3S36X 1AKJB 3QO0A 2QQNH 3QQ9D 4UU9A 5GRVK 3JWDL 2R2CA 1XF3B 4KJWC 4LSTH 1OM3L 1F58H 3IU3B 4AEHL 3FOLB 4XVJH 1EJ6A 4HWEH 3QYCA 4O2FA 2IWGA 3SDDA 4LSTL 2N7AA 3T4AB 2ICES 4ONGH 1K4DB 2C9AA 2HYMA 5DMJB 3U0PB 4XVJL 1B0RB 5E8NB 5J1SC 1J0HA 5BO1L 1RZFL 1DANU 4LLDB 5A16A 5D8JH 3GKZA 2AK4A 2F5AH 2FYYA 3HCVA 4KTEH 4UNTA 1DUYB 3VFMA 4ONGL 4PP1D 1HHGB 5FA3A 3TO4B 1UXSB 4EI5B 5KN5A 3OKKA 1OHQA 3FQWA 3STLA 2F5AL 1NFIB 3IXTA 1FCGA 2WIIB 4KTEL 2VZ1A 1LP9F 2OJEA 1FPTL 3MSPA 4CW1B 4KK6D 3VGAC 4ZNCD 1JZ3A 4HZLB 3BE1H 2D7MA 2ZUWA 1MLBA 1RZIB 2ICCA 3OSKA 5J4MA 3O9WA 3EOTH 4BKLA 2PO6B 4BH7B 1X5FA 1W2KT 1LK2A 4DZ8B 2PTTA 4NKOA 3BE1L 1D9KA 1T2JA 5I1JH 2V2TB 1XCQB 4ZQKB 4MNGA 5GRZA 2J5LC 3TBWA 3EOTL 4GG6F 4QO1A 2JB5H 3TVMA 4W6XB 4J6RL 5ISZB 4NUJA 5EUOF 5JA9A 4AJ0A 2Y07H 3OX8B 4GBXC 3SDDD 2IANA 5FGSA 5GGRB 4C83B 4YDJA 5ICYB 1RMFH 5DQJB 4OAWA 2N1KA 2VZUA 1R3JB 5TH2A 2HLFC 3IETA 4AENB 1EERB 1QPPA 1VGEH 5HD8D 4X5WB 3RIAF 2PYEE 1KIQB 1FSKB 5LGKA 4J3TA 4FQLL 4F33A 4LLMA 1DCLA 2YOCA 3W2DL 4RISL 1IL1A 3SPVB 3PL6C 4ZOEA 3X3GH 2EO9A 3LN5B 3IJYA 2P8LA 3PQYB 3V5KB 3WFDH 2H32A 1BP3B 2VIRA 2DJSA 5C07B 5IWLA 4P99A 3X14B 2EC9T 4M6NH 1KF9B 2DB8A 1CVRA 3MLTB 5E7FA 2Z8RA 4E41A 4BFBD 3X3GL 2CIIB 3I6LD 1A6VH 3DSNA 2KPNA 4YIQB 3RWDB 3WFDL 2YRPA 5F7LB 1R0AH 4KHXH 1IAOA 3FFCE 4OKVA 3V5HA 3A6OA 1D9KD 3P4OA 4M6NL 2XKNB 4ODXA 1K8IB 3L5WA 5J11B 2IQAA 4X4ZA 1MFBH 3D25B 4R0LB 1IGYA 2DWEA 1A6VL 3TVMD 3QFJE 2Z8WC 3ARGA 3S3JA 3HE6C 3O8XC 4KHXL 3GSRB 2IAND 2CDGA 3ZYOA 4JZNA 1MFBL 2I9LA 4HJJH 3PABB 1FC1A 1HSBA 3TT3H 3T0EA 2UWEE 3EJYC 3DTXB 1NMCB 3QUZC 5F3BB 4IDLA 1OAKH 3FO2B 3BPCB 3D39D 1ONQB 5DS8B 1EFXB 2VN7A 4H1LB 1MUJA 2YBRB 2V5YA 4YDLB 5T3ZH 1YMMB 3BO8A 3LH2H 1T66C 5E56A 2WBWB 4KUCD 3UTPD 1YEKH 4M7LT 3DPBA 2PYFA 4WCYH 4CMMB 2Y72A 1NGWB 4EOWH 5T3ZL 4E41D 1BJMA 4M4RA 1J86A 1FNSH 1QRNE 2V2WA 2LABA 5BRZD 1YEKL 3T1WA 1DUZB 5KJRH 4YNYA 4Z7VA 4WCYL 4XZUB 4Q9RL 4PJDF 5B38G 2J8UF 4JZOA 1FNSL 5C08A 1EH9A 3NCYP 5DR5H 3ARGD 2DBLH 4ZFGH 2JB6A 5E0QA 4YK4B 4KY1H 2ZCLH 3OXSA 2WWMC 3Q1SL 4YFDB 5DD6A 1AI1H 4XHQA 1E6JH 1WBZA 3BIKA 4U6XA 3TO2B 3VXTA 3T0ED 2DBLL 2AABH 3DARA 4O5LH 4DK6A 5AD0A 2ZCLL 3OZ9H 1J1PL 4HS3A 1A4JB 3MJ9H 1KYOJ 2FIKA 1AI1L 4LBEA 2NPLX 4Z76A 5EG6C 2ZUYA 3RX5A 2AABL 2X1XR 4O5LL 1DSFL 3X3FH 3FB7B 1OGAE 4V1DA 4JAMB 1A6WH 1YYMH 3MJ9L 3CVHH 3HC4H 5AAMA 5T1DH 3BXNB 4NKDA 4IDJH 4MJ6A 3I75B 3HNVH 1S7XB 4MD0B 5JOPE 3KWWA 5HI5C 4PJ8C 3K7UA 1G7LA 1A6WL 1YYML 2FLBT 4AZ8A 4BQ8A 4OIIH 4ZXBB 6FABL 3MRGB 3CVHL 3HC4L 3O2DL 1CCZA 2MSPA 3BT2H 5HHME 4IDJL 3HNVL 3RWHB 5MENA 2X40A 1CXFA 1B4RA 1GIGH 1DVFB 4J4PC 5C08D 1NDMA 3GMLA 2NLJA 2NY3C 1A6AB 3BSZL 3A6BH 4IIQB 3KS0J 5F7NC 1GIGL 3L3JA 1A8JH 2AK1H 2Y6SD 3KPRE 4WWKB 3B43A 3VRIB 3VXOB 5JQHC 1QRKA 3G04A 3A6BL 4MXWH 3ZO0A 4UDUA 3TP4A 5KS9F 4YR6A 4NNYA 4AG4H 3WS6C 4HC1L 5LWYL 3IDGB 5E99L 1K5NA 1CICB 5CP3H 2AK1L 3L9RA 2HWZL 3F7YB 4M62H 2YD4A 4MXWL 4YHNB 4V1DD 3KYMB 4LPCA 1G7JB 1LMKA 2YZ8A 4JR9L 2IF7A 4E0RB 1Z3GL 5IFHL 5IT2H 4M62L 1F13A 4TULL 5E2UH 4GQ9L 1GC1H 4LCWB 3KPSE 2JCCB 2FX9H 1T5WA 2RFXB 1M1SA 3E6HB 2OK0H 2E7MA 5MEND 3LMJH 5I8KH 1GVIA 1RZGA 1KJ2A 4NN6C 1KB5B 3SDCA 5DJDA 3U46A 4N8VA 4KI1A 4BYHA 2OK0L 5IJKC 4X4XA 3FKUS 4Q2ZA 2XT1B 2XG4A 3LMJL 5I8KL 5DSCA 4HGWA 2J1KA 3IDYC 2A6KB 5J6HA 1T4KA 2IPUK 1YPZE 2YKLH 3G6AB 5CUSH 5EU6E 3P0YH 1JYNA 3PWJA 4PGEB 2EDEA 1CF8L 5EO0B 4RQQB 4JO1L 1T3FA 2DWDA 4PRIE 1HINH 1YEEH 2YKLL 5CUSL 5BW7A 3A67L 2JKXA 3O3AB 4GOSA 1DL7H 5FYLE 1JHKL 2NY5C 4Y4KC 1ZHBA 3QIWB 4OM0H 3E0GA 4K9EC 5C0ND 1MCBA 3MOBH 1HINL 1YEEL 1J8HA 5T1KB 1QSFE 3RWEA 1DL7L 1G7HB 4LDOB 2NXZD 1S7VA 2VLJA 2BNQA 4GG8B 4OM0L 2J2ZA 2VXTL 5IW6B 2APVA 1DQQB 4JFFE 3WIFA 1MF2H 4KJWD 1QTYT 3QZWA 3PWUA 3PUCA 4J23A 4QXGH 1MNUL 4HUKB 4J3VA 3SDCD 4JDZB 3FT3B 1KTDA 3NPSB 1DZBA 2GUOB 4Y4HB 1CVSC 1MF2L 1OCWH 3ARFA 4OZFH 1OP9A 4M43H 1CBVL 1BM3L 4QXGL 5EZIH 2RIKA 5DMKB 1INDH 4KKAD 5I1KH 1MY5A 1X4XA 1CK0H 5EUOA 2AKRA 4Y19B 4WW2C 1OCWL 3BIAX 3JUZA 3RZCA 5HHVH 1P9MA 1SYVB 5EZIL 5ID1A 1KPRB 1X6NA 1S7WB 4KVNH 1H5BA 3AS3A 3BIBX 3UTQB 2GI7A 1CK0L 4FABL 1KIRB 2P5WB 3I84A 3OR6A 5HHVL 4PS4H 4BFGA 3QH3A 8CGTA 1U3HA 4PJ9C 2ITCB 1FNAA 3CFKB 5ELIA 1MRCL 5GRJL 1J8HD 2MNUA 5GIRA 5L88H 1L0YA 4HAFA 4G8GE 4MA7L 4BUGA 4XVTH 3V8OA 5CCKL 1GCFA 4QRUA 2IH3A 2BNQD 4PS4L 3LY6A 2EXWD 4JRXD 2DICA 3MYZA 3FRUA 1AGEB 5BJTB 4PUBH 5L88L 2MOVA 3RI5F 3I2CH 4EN3B 2ADJB 5FO7A 5TQ2H 2YD5A 1G1YA 1NGZB 5DJ6A 1TNMA 2WP3T 3K8LA 3OB0K 2G75A 5DJZB 3QNZA 3SKOB 1AGFB 1HDMA 1S9WA 1U8OA 4MD4B 5HVFB 2J7LA 1T7WA 5C92A 3I2CL 3H8NA 2A83B 3RUGF 3FL7A 1CDIA 2OR9L 1A0QH 3OXRB 2HLFD 2F54B 2NY6B 1RZKC 3RZCD 4X6BA 3MRDA 2DMKA 3T2NH 1MCOL 3HC0B 4NWTL 5AUMB 3MV7D 4YBLC 4MDJB 1QSVA 1A0QL 1ODAA 4ZFFA 4ISVB 4IBLT 4Y1AB 3DVNA 3PL6D 1T21B 4Q6YA 4CN1A 3RQ3A 1JYVA 3P11H 1U3HD 3KLDA 4TYUA 1JFQH 4MJ4A 1A3QA 3LKPB 3ULVH 4WHCA 1JNNH 2MQCA 2WQ8A 2R0ZH 4NZRH 1EXUB 5ACZA 3ALPA 2XWTA 3LEVH 2AK4E 3P4NA 5DYOB 1IGIH 5HI3D 1R3LA 3B6SB 4F7TB 1JNNL 2H9GB 3C60B 4NZJA 2A9NH 2R0ZL 1OARL 4NZRL 1OAUL 1QBLH 3D18B 1HZHH 5I75B 1ZVSB 1IGIL 4LLUB 1ZT7B 2Y06L 4XP5H 3HE6D 3O8XD 4G8FB 5HHPB 1TQCB 4OQTA 5ETUA 5ESAA 4POZD 2W1NA 2NNAA 3L7EA 1QBLL 5DK3A 1QBBA 3TH2T 2BY3A 4JKPH 2HFGL 5E95B 3I6LE 2R29H 5ERWA 4U4BA 1S7UA 2RGSA 3IXAB 4NZDA 5ADPH 2APFA 3CUPB 3IDNB 1KJVA 4U6HB 2Y23A 4MNGE 1MCWM 3GUTA 2R29L 4F3FA 5L8JB 3OJDB 4XPTL 3MLWH 4WEBH 2Z31C 4GFTB 4ZDHB 3UMTA 4ZFOB 2F58H 3CXDL 4I0PC 2IANE 1R24A 1NCBH 3Q0HA 4KK5C 4FZEH 4XPAH 2VYRE 1D3CA 3THML 5L7XH 4M5YH 3CFDB 2ADGA 3SCMA 5E4EB 4WEBL 3HAEH 3FN0H 4M5ZL 2W91A 5I30H 5CBAB 5IMMA 1S9KC 2OR8A 1D5IH 1V3JA 4PV8B 1Q9KB 3V5DA 5L7XL 4P3WA 4HMDA 4KMLB 5GJSH 1TVHB 3ZKMC 1FBIH 5FHAL 2QJDA 2F53D 1D5IL 4JGUA 4ETQB 4HCRA 1EAPA 4I18A 3T65A 4ZMAT 1CTNA 1ZAGA 2WWMD 5J12C 1YA5A 1FBIL 3BWAB 4E41E 4HUXA 3G5YA 4XBEH 5C0IB 3X12A 2V5SA 4HH9B 3MO1B 3WNNA 4KI5F 5GZOC 2YPVH 4RBPK 1N0LA 3BQUB 3QEUA 3HLAA 5DK0A 2X2YA 3VGAB 2Y5TB 2YPVL 5JLZA 3KYOB 3MACH 1QYGH 3QG6B 4OCRH 3P9MA 3TA3A 3SCMD 1QFHA 3H7BA 3T0EE 5DJ2B 5FGBA 4Z7UB 2LAAA 3N1QC 4IMLB 2P44B 4P59L 2IBGA 2ADIA 3DRTA 3HS0A 2HVKA 1WT5A 4GLRH 2ZNXA 4YHZH 4K7PY 1Q0XH 4K7PH 4CVZB 4PY7B 5KTEH 5F6IB 2AGJH 3RDTC 3IDIA 4QXTB 4U6YA 1JWMB 3RWCA 2NY3D 4L9DA 1UZ8A 4YHZL 2E7LA 4M9PA 3BP6A 3H9HB 4K7PL 3UBXB 1PX4A 1UACL 5D96B 2DF3A 3MRRA 4XC1L 3HZVA 5DEZA 5KOMC 3B3IB 5DLMH 1MFAH 2XZAH 4Z7VE 3O3UN 1YN7B 4JGMA 4HX1A 2MKWA 1FGNL 1MCHA 2DQGH 4FQCH 4QRRD 3QDHA 5C08E 1MCEA 3FO1A 5DC4B 4QHUB 2X4QB 2XZAL 5DJ0A 1EJOH 3WXVL 2IPKA 1OTUC 1EO7A 3VE0A 4Y2OA 5I16A 3TA3D 4FQCL 1TTGA 2A6IB 1YYLH 3WUWB 3DUUA 3NVQA 4NZTL 5K93A 3IVKA 4Q58C 5EWIH 2EZ0D 5IR1B 3WN5A 2XG5A 1KOAA 1DLFL 1ETZA 1CT8B 2DAVA 4HS8L 2QHRH 4PJ7A 4KGJA 4QHKJ 2DQCL 3ALWA 4CN4A 2AJYL 1KBGH 3UC0L 3UAJC 3QPQD 1WAAF 5BZDB 4FTVA 4S1QH 4V1DE 4NCC2 2P24B 2PETA 2QHRL 4HSQA 1Z9LA 2DD8H 4ZUVA 1KBGL 1WZMA 2B2XL 4XXDA 3GRWH 2YPLB 4RFNC 3F7RA 4ZUUB 1N5AA 1PLGH 2Y5EA 1N64H 1GL4B 4LHUA 4L4TB 5FYJU 2E6JA 1IKFH 1TCRA 4HKBB 2DD8L 2X1WL 5SWSA 1FIGL 3SOBL 3SO3C 1JK8B 3C6SA 4LCYA 5MENE 1MSPA 3QT2A 5CMAB 4B53A 4WU5B 3P3YA 1FFNB 1Q9OB 3D2UD 4Y4KD 1IKFL 4ZNEA 5HGAA 4N8VG 2FH6A 4N1EA 4A6YA 4Y2DB 3REWA 5EOCH 4U1GC 3NCYS 5CINH 1JHTB 3KG5A 5TF1H 3Q5TA 1FJ1A 2HJFB 3VU2A 3OHXB 2GT9B 2X4RA 5EOCL 5EOTA 3QFDB 3MV11 3AREA 1YEHH 4WI4A 2QEJA 5TF1L 1J1OL 1MAJA 4G8EB 4TTGA 3IF1B 3U83A 5GISH 1HI6A 4JKWA 1SBSH 3L3IA 4O58L 2EH7H 3TV3H 1U3YA 1AP2A 4G6ML 3JVGA 3O3EA 3VI4E 4PRNB 4R4ND 4WFHD 5J89A 5GISL 2P43B 2Q20A 3QULA 5J6GA 1MH5B 3KAAA 4PGCB 1MHCB 2EH7L 5MERA 5IB4A 4HK0B 3ZTJH 1WCQA 3QZWG 2X1OA 4Q6IA 1S7SA 1BWWA 1P4IH 4XHJD 1S8DA 3GMOA 1OF2B 3KDMA 3P2TA 4DUWA 2MCG1 1CE6B 3BI9X 3B5HA 1J9CT 2B7DT 1FH5H 4P2OC 4LFHD 1P4IL 2JJSA 1FORL 1GGIH 2YHGA 2PR4L 4WJ5B 3RVWC 4LLYA 5T5FL 4R26H 3IKCB 1KPVA 1I8LC 1H8OA 3SE9H 3ARED 4R8WH 4K3DH 5LGJB 2ARJA 1FNEA 3KLAB 5DDHB 1GGIL 5EU5A 1C5BH 1M7DA 1FL6B 3O81A 3O45A 3BJ91 1UCTA 4K7FA 1O5DT 4E42A 4HW6A 1NLDH 2DM4A 2D31B 3SE9L 4R8WL 3B2VH 4K3DL 3QXDA 1J8HE 5HDBF 2EEAA 5CGYC 3VXUA 4IOIB 5F9WC 3WO4C 4MHHG 2VLJE 4XBGB 1HN1A 2BNQE 3VGEA 5A2FA 1NLDL 3G08B 4ZYKB 3B2VL 1I3GH 1WK0A 1I3RB 1P69B 2OL3H 5D1QA 2OSLB 4PPTA 1MJ7H 5F6HJ 2VLKA 1NCUA 5BVPH 4XCYB 1DQJB 1U2HA 4JG0H 2VC2L 3ZKSD 4J8RA 3VD5A 1I3GL 4JHBA 2OL3L 1AKJA 5DD5H 2VZOA 1KJ2L 3BGAA 1F4XH 2WUCH 1XF3A 5D2NC 5FA4B 1IZKA 4PLNC 5EIIB 4I0CC 2XIDA 3LSOA 1SY6A 2XQYG 3IU3A 3FOLA 3MNVB 5FKAB 3SBWA 4EQ3A 1K9TA 5DD5L 3T3MF 1F4XL 4XWOC 3T4AA 5E6ZA 1PYWA 5CD3B 1K4DA 4JO4H 4NN6B 3U0PA 3BKJH 2QV2A 5E8NA 2IFFH 1CIDA 5I8EB 4PB0L 1OPGH 3G5XB 3MUZ1 1DUYA 2DIBA 1HHGA 4EI5A 3QJFA 2AVGA 3K74B 2IFFL 3K46A 5E1AB 1A7NL 1JN6A 2EDXA 2YSSB 4HPYH 4XH2A 1NFIA 4QHMB 2WIIA 5C70A 1FZKA 4CW1A 2W07A 2GHWB 3LB6C 4WFEE 5FXCH 2HLAB 4M1GH 5D1QD 2C3HA 5I73C 4EEEA 1A2YB 4HZLA 4F9LC 2VZSA 1KGCD 3ULUF 4GLRI 7FABH 1RAMA 4HPYL 4TSBH 3S98A 3D1MC 1F3JB 1BFVH 3SEPA 2PO6A 4BH7A 5JO5A 1MCQA 3Q2CA 1NL0H 3WLBB 4DZ8A 2VNCA 2FJHA 1MCIA 5D7JC 1ZLVK 5HHNA 1XCQA 1KLUB 4TSBL 1OT2A 2YK1H 5IEKB 3X11B 5IV2A 3QUYA 3H42H 2HMIC 3OX8A 4ESKA 4FQ1H 3S96B 2C26A 4OCLC 4GKSB 2MPAH 5GGRA 3RIFK 2AQ3A 2MQ3A 5F1OB 4C83A 3S88L 5ICYA 5DQJA 5D7IB 1GPOH 1T7XA 3ZKMD 1A6UH 4P9MH 2AJUH 5HYFA 4NO2B 3CK0L 2ZPKH 4PJ5A 1NKRA 3PWPD 1Y0LB 1QFWM 2BXYA 2I07B 5C6PB 4TVPH 1KIQA 3VFOA 4ZAKD 1A6UL 5E8OB 5FUZH 5JHDD 3SPVA 2ZPKL 1Q72L 2BHZA 1W0WB 4PJHB 5JTWA 4AK1A 4WW2B 1M6OA 3LN5A 4FQQB 3KLSA 4TVPL 3PQYA 3QXAB 1MWAB 3RHWF 1NDGB 4FQJH 5C07A 5LXGL 4M1CC 2R2HB 5C0DA 3X14A 1FVEB 3MLTA 4NPYB 4RMWA 2QR0B 3MV01 4DAGL 2CIIA 4NJ9H 1K2DB 2ICWJ 4PJ9B 4YIQA 1EV2E 4XAWL 4PBWD 4FQJL 2XKNA 4WIQA 2GSIA 4LLVA 3RVTD 1E4KA 1JYWA 2XY2A 4NJ9L 2EDRA 3RY6A 3QUYD 4V2BA 4N5ED 3DX8B 3NA4A 5JIHA 3GSRA 5FCUL 2HKFH 4R90H 1R3HB 1XIWC 4S1DD 3PABA 1PEZA 4D0BB 3PJSA 3DTXA 4PJ5D 2RB8A 2FX8H 1M05B 4RFOL 1ZT1A 3DYMA 1CWVA 1DBKH 4M3JA 5DUMH 4G9FD 4R90L 2Q8BH 3BPCA 1EFXA 4PB9H 2YBRA 2K7QA 1SYSB 1WAAA 4M7LL 1YDPB 1CGYA 3SQBA 1YMMA 2FX8L 3HN3A 1Z9OA 4IHOA 1DBKL 4JANB 5DUML 3PQYD 2WUBH 3CH1B 2FR4A 5HXMA 4YBLB 5FYJH 4PB9L 1EIBA 3HR5A 5C07D 5IB1B 4QRPB 4CMMA 1J5OH 1CFQB 3I3EA 3KHOA 1JZ8A 1VFOA 1NBZB 3C6LC 4C54A 4BZ1H 3RWJB 1DP0A 4YHKH 4WEMB 2WUBL 4XP4H 2P5EB 4HLJA 4KK8D 1DUZA 1OTTC 1WBYB 3V6OC 1FZOB 4XZUA 1J5OL 3VWJC 5IKCA 2VITB 4K23H 1N3NB 4OQTL 5C7XH 3TN0C 3TT1L 4GXVL 3WKMH 4HBCL 4PTTA 2VAJA 4K23L 4KDWA 4KRPD 3VFRB 5I1DA 5TE7H 3FQRB 3WKML 4NT6B 1QR4A 3C08L 5GS0C 5JPNB 4W6WB 1A4JA 3OWEA 4TUKH 2NR6C 3JTTA 3AM8A 5IF0B 3GEWB 4PYHA 2CXGA 1KULA 4PJCB 1YMMD 2VSDA 3FB7A 1C12B 2EIEA 4JAMA 1XH3B 3OJMB 3L5IA 4TUKL 2XZCL 4TPRH 4XNMB 3L3HB 1UM6H 3L7FB 4CU6A 4NQSB 3I75A 1FVCA 4AEIH 1S7XA 4MD0A 4Q0XH 3V9FA 4HFWB 4I0PB 2AV7B 5FUOH 4NKIH 1WWWX 2D7NA 4TPRL 5IEHB 2GJZB 3RWHA 2XQBL 3TYGH 3ILQD 1NC4B 1DVFA 1FE8H 1KELL 2KKQA 3PP3H 1P53A 4P46A 5FUOL 1A6AA 1EMTL 4LHUG 3QEGH 4IIQA 5ACLA 3EYOB 2O5ZL 1FG2B 1QQDA 1FE8L 1QFUL 1T5XA 2JJWA 2HP4A 2PCPB 3VRIA 3VXOA 3QEGL 1B0WA 1OD7A 1UGNA 3KXFD 2FATH 1IEHA 5ICZB 5AAWA 3EFFB 5CWSB 3ARDC 5IB5B 3IDGA 1S3KL 1EEZB 1CICA 3VFSB 3DX7B 4LFHG 1RJYA 3ULSB 3F7YA 1MQ8A 2EDKA 3BKYH 3QNYB 4Z7UF 3EO0B 2FATL 2B4CH 4KMQA 3S6CA 4BZYA 2DQJH 4PJ7E 3PF2A 1IGFH 4UV7H 4E0RA 5JPMB 4NBYB 3SE8L 1GGBH 4JB9L 3WJJC 2XWBA 5E5MB 2HTKC 3VFWA 4G9DB 1OL0A 3GM8A 4LCWA 2JCCA 4W4OC 2HFFB 1KJ3L 4APQA 3BW9B 1GGBL 3S8WA 1DVFD 4P3CH 3IJSB 4WFHE 1C7SA 1KB5A 4P46D 5IQ7H 1IC1A 3TPUA 5SWSE 4U1JA 4FZ8L 1U6AH 2A6KA 1UVQB 3RDTB 3SDYH 4F15C 5CEZH 3WLWC 5IQ7L 4ZNEE 2YN5A 5EO0A 1F4WH 3U7YH 1FL3B 1CICD 3KPNB 2DM2A 4DOHB 3SDYL 3BX7C 5EO9A 1S5HA 3H3PH 2BSTB 1BFOB 1UKTA 1F4WL 3QIWA 1N5YH 3U7YL 1MY7A 3MCKA 5DRWA 1LE9A 3CXHK 5T1KA 4H88L 1I9IH 1VFUA 1G7HA 4QCIA 3U2SA 4PG9B 3BZEB 4JM2B 2H2SC 2HN7B 1G6VK 1N5YL 3IJHB 5EFIB 1TJGH 4K94H 5IW6A 1U58A 4XNUH 5A3ID 1DQQA 4EIGB 4WI5A 1KLGB 4APQD 4TOYH 3M17B 1BVLB 3GKWL 5EC1B 2CK2A 4NJAL 3S36H 1SJHA 3NZHH 4JDZA 1HWGB 5CIPA 1TJGL 4XNUL 3WIIH 2GUOA 1LNUA 5IBTH 2X1PA 3U9PL 1PSKH 4P2QB 2BK8A 4NOBA 4TOYL 2DI7A 2A0LC 4MAYC 4H8WC 1INEH 3S36L 5FV1L 3NZHL 4B7IA 3VA2C 3WIIL 4OM1H 2VQTA 2A9MH 2CGRH 3GHBL 4OI7A 5CILH 5JXEA 1R5WA 1SYVA 1KPRA 1S7WA 2HVJB 1INEL 1OLZA 4U6VL 2IGFH 4RFNB 4F57L 1BZ9B 1T20B 3D6GA 2NTSP 3IFNH 3LKSB 4HULB 1J8KA 4OM1L 2A9ML 4OQ1A 1ZHNB 5CILL 4NRYA 2ITCA 3EOYG 3NFSH 3CFKA 3SO3B 3NZ8A 1UH4A 4TRPH 5ILTH 1F4YL 3P77B 4N0UB 4HV8A 1JZ5A 3WL9B 2FCBA 1LGVA 5C86A 4MQ7B 2G2RA 5D7JD 3VXUE 5BJTA 4TRPL 4U1GB 1VEMA 3E2HC 2XN9D 4RNRA 2B20A 4X7SH 3MYJB 2W9EL 4EN3A 4AEFA 3MRBB 1U8LA 4I77L 1NGZA 3K4ZA 2AJZB 5DJZA 1AGFA 2FHCA 2KQNA 2VLKE 3RU8H 3BKCH 1CD9B 1KGCE 1HXYB 2YPKB 5DWUH 3BN9D 2A83A 2FSEB 1UWXK 4F2MB 5KSUB 1MFNA 4N0FB 5JXED 5SWQB 5HGHB 3RU8L 1AGDB 3EHBD 3LQAH 5T33H 4HJ0C 1ZHLB 4JRYA 5DVOA 1VPOH 4MDJA 3LEYH 2LU3A 3EDDA 1MCPH 2NY0D 2GITA 2C4FT 4Y1AA 1T21A 1A6TB 1T1ZB 4JEGB 3LQAL 3UDWC 3JWOH 3QI9A 1QACA 1VPOL 2H8PB 3OAUH 3LKPA 4N0RA 3LEYL 2W92A 5KAQG 1MCPL 3UP1A 5ID0A 1EXUA 4FQPA 4I8DA 4X7EC 4KV5F 3VFGH 2X09A 4I5BB 4OZHB 3EDEA 3OAUL 2R15A 4P2OB 2H9GA 3C60A 4EN3D 1HXMB 3D18A 4JFQB 4LPUA 1BAFH 3UTSA 4WI3A 1ZVSA 2EDNA 4XNQA 3NIGF 4CAGA 4FXLA 3E1F1 5FGRA 5EU3B 4P5TB 4G8FA 5LCVH 3CCHB 3P0VH 3P4MB 1BVKB 4KDTA 4D8PA 5A43C 4XP9H 4PD4K 3ZYZA 1XT5A 1YC7A 1S9VA 4KI5E 4IJ3B 1Q0YL 5LCVL 1HEZB 3P0VL 4Z5RB 2EYRB 1MELA 4OGAD 3EYVB 4GKOA 1E4WH 4ZO8A 1N26A 1IAIM 3IDNA 1WEJL 2VLLB 2CJUL 4XP9L 4JRYD 1UWGL 5FO9B 2Z35A 3EZ8A 2Z8SA 3UTZB 3TBSA 4RFEA 1CLOH 3OJDA 4Y1AD 1EEUA 4MX7B 2F19L 4JFZH 1E4WL 3KPPB 3CX5K 3I3DA 3QI9D 2VWEE 5A2IH 4M6ML 2Z91B 3UJIH 1H3TA 2BSSB 1CLOL 4NFDA 3ABZA 3C6LD 4JFZL 4PJ5E 1LD9A 1MEXL 5CBAA 1BBDH 1XR8B 3T8XB 3VGDA 4PV8A 3UJIL 3V6FA 1Q9KA 5T5NG 3VWJD 4CU7A 3MUHL 1BLNA 4HQQH 1TVHA 1BJ1H 3UTSD 4H0GA 1UENA 2P49B 2VXVL 1TXKA 4JHAL 1LK3L 3PQYE 4ETQA 4JZJB 1T1YB 3VRLF 4HZAA 5DD0H 4NM4L 5C07E 2DMCA 3S5LB 3VWKC 4HQQL 2XTJD 5F89A 4JKKA 3BWAA 4X6DA 3BUTA 4LEXH 1T1WB 1YNKL 4HH9A 3D3VA 4CADB 3MO1A 1HNFA 1OW0A 1RJZB 5DD0L 3AU1B 1DR9A 2SEBB 1A9BA 2B8OT 2VDLH 2P42B 3LKRB 1SEBA 1QOKA 4M8QB 5D7LB 3BQUA 5C9KA 2AJSH 3T3PE 1K8DB 3GI9H 2W0FB 1URLA 3ME0A 4GW5B 4L8BB 1UM5H 3KPLB 5GGRY 1IILE 1HQ4A 2VDLL 5KG9B 3TJEH 1CXIA 3EYUH 4X80H 3VJ6B 3QG6A 4L8DA 5IMKB 3GI9L 5TPWH 4OV5A 5EPMB 3OPZH 2Q7NA 3MTRA 3VH8B 5IMOB 5D7IF 3WIHA 4Z7UA 4IMLA 3LN4B 4X7TB 3BWUC 5CLWA 1NBYB 4AYFA 1T03L 3EYUL 4X80L 1RULL 4M3KB 4XCFH 2OTUB 4EIZC 1WAAE 1AQKL 4HH8A 4CVZA 2OJZH 2KZWA 4ZTPL 5ABDE 1YMME 5HDOA 3NIFE 4QXTA 5HGGS 3MNZA 4PJHF 4WW2F 4HLZG 1QBMH 4XCFL 1SM3L 5KVEL 1MJUL 3H9HA 3UBXA 4DEPC 1ZHKB 3HC3L 4QRSB 5IW3A 3HUJF 2EIZB 3D3VD 3Q3GA 4YUEL 5EN2B 1QBML 3FB5B 4EDWH 1NKOA 4KZDL 3ARDD 5J1TC 1CLZL 3BQUD 2WINB 4NNPH 4P57A 4IRJD 5M95B 1B0GB 2XKSA 5H37H 2NXYD 2K1MA 4PY8J 4YXKH 4EDWL 4QHUA 1TETL 3PIQB 4LKXB 1EPFA 4QEGA 4XCCH 1G7MA 5GS2H 1VACA 1C5CH 4UTBH 4R2GD 3S35X 1H3WM 2VXUH 2A6IA 5GRYA 5GRWA 4XNXH 3WUWA 5D93B 2DL2A 4GAGH 4JHWL 1ZA6A 5IR1A 2AEIT 4XCCL 1Z5LB 2P8MB 4UTBL 3CIQA 3MLUH 4H1LH 5C6WH 4IM8A 2R23A 5IGXL 4XNXL 2D03H 1PY4A 2AJ3B 4EUPB 1M7IB 4FQXC 5BZDA 5EZOH 4CNIB 2P24A 5EBMA 3T0VA 4KJYB 3RNKB 4K3EH 3MLUL 5IIEA 3EFDH 3LHPH 4P9HH 5F1IB 4K8RD 3F5WA 1S7QA 3VXPA 1IC5H 3QR2A 4LSVH 2YPLA 4ZUUA 5EZOL 3VG0H 5E2WH 5EU7C 4RAUB 4K3EL 3RY4A 3EFDL 3LHPL 4L4TA 4P9HL 2GY5A 2JLLA 4HKBA 1CL7H 3ARPA 4GRLC 1DN2A 1IC5L 1U42A 1JK8A 3CH8A 4X4YB 1OAYH 1DQTA 1A7QH 5CMAA 2ZKHH 5E2WL 5HJ3A 2Y7QB 4F7MB 5K9QI 3B5TA 3QWOB 2VLRB 4Z0XA 2J3SA 5BVJA 4HHAB 1WFNA 1A7QL 4Y2DA 3RFZC 4LKCB 2CLRB 4GH7B 4CRPA 1J88A 1JHTA 3DRQB 1FZMA 2HJFA 3OHXA 5E8PB 4EVNA 5CJBA 4G5ZL 1L9MA 2WSKA 1KCUH 1LQSR 1X5JA 4PBVC 1HYSC 4G8EA 1QFWL 2X4NB 2ZUUA 3RL2B 2H26B 4TNVK 4EXKA 2A0LD 8FABA 4MAYD 3MV9B 1KCUL 4MMZC 2EE2A 4F37F 5FOBB 3FT4B 4IOSD 4LCWE 2JCCE 2DN7A 1A02N 1MH5A 1WITA 3BH8A 4PGCA 4LNVA 5E4IA 2O5XH 43C9A 4HK0A 1ACZA 1WC7B 3GB7A 1NCDH 4HUNB 5FOJA 5C0RL 1VADB 1KTKE 1XGRB 2H3NA 1OF2A 3VFVA 4G42B 2O5XL 4WI7A 1CE6A 1WZ1H 3TBVB 2VL4A 1A7RH 3RWGA 2F8VA 1NCDL 2VE6A 5FGCB 3N1GC 1VKXB 4M93B 1LO3H 1DQMH 4WJ5A 3T3ME 4YGAB 3IKCA 3GIVB 2NX5B 3Q48A 4YQXH 3LPGA 3GMRB 2MCPL 1MAML 3U4BH 3MBEC 1XF5A 5C0FA 5DDHA 3SGJC 1LO3L 2EKSB 4GW1B 4LCCA 1F6LL 4LDEB 4OJFH 1FL6A 1F4AA 4NYLB 4JPKH 4AM0B 1U3ZA 4YQXL 2D31A 3DUSB 3U4BL 5CSBA 3HTLX 5GHWH 1OP5H 4IOIA 3KS0H 3G5ZB 1FN4B 5D1ZD 3CNKA 3VCLA 4HIHA 4XBGA 2C3VB 3CSBA 3G08A 5HHOA 1D6EB 3SDXB 3P40A 5GHWL 2P47B 3WSQH 5CZVH 4YLQT 3U6RB 3I6KA 1DQJA 2H6PB 5DRXB 3SE3A 3OG4B 3L5HA 2AV1B 5CZVL 1KB5L 1U8JB 5FA4A 5JIPA 3O6FB 5HGBB 3IDXL 4I4WB 3BZFB 5FKAA 3MCG1 1C08B 3MLVL 5CD3A 1I1YA 2A6JA 3B83A 1B9ZA 2HFEB 1RU9H 5I8EA 1H3PH 1A3RH 3G5XA 2AXHA 2ZUQC 3DXAB 4ODHL 3O2WH 4XMLH 4NO0B 4DW2H 4MJIB 2ATKB 4F15B 1YY9C 1XCTB 5E1AA 2OXGA 4JM2F 3O2WL 4QHMA 5HHOD 3WFCL 3ULUH 1DBJL 1FGVH 4OZ4B 5DURD 4WHTA 1MI5B 4DW2L 1A2YA 4WWID 1ADQH 4UINH 4ZG1A 1KFAL 2APBA 1FGVL 3WLBA 4PJAA 1NJ9B 1ADQL 1UB5B 2BVQB 2OCFD 4J3OC 4UINL 2Q8AL 2YD6A 1C1EH 5IM7B 3T1FA 1JMXA 2PXYA 5IEKA 3X11A 4FOMA 5AWNL 2FNBA 3S96A 1SQ2N 4GKSA 4JRYE 5GGVH 4KAQH 4P2RA 3S7GA 1KN4H 3ZMRA 3DO7A 4L1HA 1C1EL 5ACMA 3B2UC 3MUGB 1A6PA 2FL5B 3VXSB 1KXQE 4Y1AE 4LVHC 4NO2A 3IFOA 1AFVL 1C16B 1Y0LA 1N2RA 4XRCB 5D7SH 3VG9C 4KAQL 4MJ2A 1KN4L 3BRDA 4IMKC 5E8OA 3GSXB 4J3XA 4UB0L 1RIUH 1W0WA 4BFIA 1FP5A 1S5IH 1HSAA 5FDWA 4FQQA 2A73B 4OLEA 4XVUC 3QXAA 1NDGA 4KRMB 3ZHKA 3VFUA 1ROWA 4G6AC 3ROOB 2NY4C 1FVEA 3UTSE 1KC5H 4NPYA 2QR0A 5MHSE 4MDIB 4RCAA 1VENA 1K2DA 4AIOA 2DRUA 1QLEH 1U36A 3QG7H 5DZNA 5F72S 4L8SB 4QWWC 2XTJE 3UYPA 1KC5L 1R6VA 3KPOB 1RZ7H 2KBGA 2PXYD 2VXSH 5DVMA 3DX8A 4WHYG 4HWBA 4HIEA 2YD8A 4P2RD 2EDYA 4JO2L 1CL7I 1R3HA 2OZ4H 5FUCC 5AYUH 2I27N 3EYFB 2VXSL 4D0BA 3NABL 4NUGL 2YC1B 2IPTL 2FEDC 2ITDA 2VDPH 5I66B 4X6FB 3EO1B 1IRAY 3QXVA 2OZ4L 2XTLA 5DD3H 5HI4D 5AYUL 4GQPH 4PJFE 1D5MA 2D0FA 3UEZA 1G9ML 1J87A 1YQ2A 2VDPL 3QAZB 4EBQL 4OZHF 4JANA 3OKMA 4UDTB 2Z0BA 5TE4L 5A40E 4OFKA 1CFQA 4LMQE 4PRAB 2H1PH 4MB4A 3RWJA 5I76B 2BY0A 2P5EA 4JJ5B 4R4BA 4ZPVA 3ALXA 5E00B 1OP3H 1WBYA 1FZOA 3TBTB 3MCLH 4X6DE 3OR7A 3UBXG 2EDQA 2CMRL 2H1PL 5I74C 4LLQB 3D3VE 3DWTA 1LDPL 1NC2B 1YQVH 2GK2A 1FZJB 4M48H 2CSPA 5FEBA 1BQLH 5B8CC 4U7SA 3W11D 3MCLL 4ODBD 1GGUA 1Y18A 2FRGP 3AXLB 5C0CB 3MV8B 1YQVL 4MXVE 5JNYB 4HAGA 1W0YT 4KUZL 2D2OA 1U0QA 3GSNH 2LFGA 4M48L 4NT6A 1A6ZA 2DL9A 1BQLL 4S1RH 3EOAB 5D5MA 3DGCR 5IF0A 1G6RB 1IGJA 4ZFOL 1D6VL 4Z7UE 3WUWG 4PJCA 2ATPB 3QA3B 4EZMA 4LRNL 4S1RL 5CFHA 4NQEA 4P4KA 1XH3A 1ORQB 4NC0B 1RUMH 2BOBA 4XNMA 1LO0L 3L3HA 4QRTA 1VESA 1LDSA 1N4XH 1LEKB 4UZGA 3CXHJ 1ZLSL 1IQDB 4HFWA 5HPMB 1SVCP 5HYSB 3FHQA 2AV7A 1RUML 3TZVC 1NBVH 1HOCA 2GJZA 3D9AL 4WVRA 2AS5M 1NC4A 5GGTH 4MVBC 2QSVA 1IT9H 3LKNB 3NFPB 1H8SA 3ZL4L 2QKIA 4X99B 1WGOA 1T80A 1YN6B 1FG2A 1IM9B 2NCMA 3B9AA 2BNRB 4OLWH 3VI3F 5D6CA 2PCPA 4DKFL 5IOPB 1HYSD 3MRNB 4NHUA 1MCNA 2DYPB 3EFFA 3MRQB 5CWSA 3GJFH 4OGYH 4OLVH 4Z8FH 3VWKB 3FCTB 1CDUA 4OLWL 1TITA 4R3SA 5CGMA 4LVOC 3LRSB 4Z7QE 3OKDB 2P46B 3QNYA 2FWOA 4NQED 2EDLA 1OOAA 4OGXL 4P4KD 3HPLB 4OLVL 5TQ0H 4PFEA 1E4JA 4QNPF 3ELAT 4NHCH 3K0WA 4PJEB 4M7JH 3ZDYF 4YHOH 5E5MA 5KSAC 4G9DA 5CZXC 3VXRA 3TJHD 4I3RH 5FYKD 4J1UB 2R2BB 4NHCL 2AJVH 1C5DB 4PRHB 2YPLE 5IVNA 3BW9A 4ORGA 3ETBF 3QP3A 3GGWA 2Q86B 3IJSA 4K8RL 1T83A 5K9OB 4L4TE 2ORBH 4LCUB 3QJHB 4BZ2L 4NWUL 2HA1A 5D6DA 1ZSDA 1W72H 1UVQA 5HYJD 3FB6B 2ORBL 3QHZH 5HDLA 3WD5H 1AO7B 1IAIL 4F7CB 3D87B 3KPNA 1KIUA 2NY1D 4GRWF 3QHZL 3UPAA 3QEQB 3WD5L 1WF5A 3ZTNH 5INDA 1FCCA 3BJLA 2OI9B 1JPSH 4XBPB 4KQ3L 1AGCB 2JK5B 3TFKC 3ZTNL 1U91A 3VXRD 4PG9A 4YHIB 3LS4H 3BZEA 4JM2A 3EYQC 5MEPB 2HN7A 5EFIA 1JGLH 5JW5A 2DLGA 4D9QD 2WZPD 5DO2C 1KCLA 1PG7X 1E27A 5DJ8B 1R3KB 4MCYB 5D72H 1PKQB 4LP5A 2XI9A 4HWZB 3OKOA 4BJLA 4P2QA 1KEMH 5HSFA 5KSVB 4JFHD 2OR7A 3PWLB 4H0IA 1RV6X 3G6JA 5ESVB 4ZUTA 1QSEA 4PD4J 5DMIH 4Z7WA 1BEYH 4G6FD 3AAZA 1EHLL 1KEML 1JNJA 2HVJA 1BZ9A 1T20A 5E8DH 4LRIA 3I3BA 2DQFB 4LARH 1NMBH 2X4UA 1JTOA 5F93C 1QPXA 3GFUA 4Y7MA 5FK9B 1UC6A 3V0VA 3CX5J 3DVFA 4U1IB 3MBXH 3OB8A 3WDHA 4LARL 3P77A 4N0UA 4GAJL 2A1WL 4TUJB 1JNHA 2F74B 3WL9A 4LLWA 4LU5H 3AMKA 1ACYH 2OYPA 3ZT7A 2XFXB 3AGVA 5JUEH 3T2OA 3NIGE 3IDJA 5GGSB 3MYJA 3TWCL 4N0CD 5HYEA 1P7QB 5HHOE 5I19H 2WBJC 1G1CA 2AJZA 3DVGB 4I48B 4N5UA 5SV4A 2X4TA 5E6IA 5JUEL 2YPKA 5CJQH 5EOQH 1CZ8H 1UZ6F 2ICEA 2FSEA 2Q76B 5I19L 1OB1A 1QSED 4XP6H 5KSUA 3ZKQD 4BH8B 1RFDH 3DX9B 4BK5A 3GMNA 1M71B 5IHBA 3R8BB 3ZDXF 5CJQL 1CZ8L 3EOBA 1KG0B 3RGVB 3MR9B 5E2VH 4LPYA 3K8MA 2JIXB 4W70A 3NGBC 1A6TA 1Q9LB 1AJ7H 1PY9A 1KV3A 1QEWA 3ROLB 4Z7NE 3BHBB 1S7RA 5DK2B 5E2VL 2NY4D 1JZ7A 5C09B 5F7UA 4OZIA 5C3LD 4U1LA 5B21A 2HT3C 1AJ7L 4OZHA 1RURL 2VUYA 3WNKA 4UQ3B 3LKOB 3MXVL 1ES0B 2ZG1A 3SKMA 3LS5H 5I1EH 1OSPH 1JPFB 2QBWA 1NSNL 2O61A 5EU3A 2BRQA 4P5TA 3CCHA 3P4MA 4NFCA 5F70A 4GO6B 4QOKD 4YAQB 1BVKA 3MBEB 5E6ID 4IOFC 4ELMF 1BGXH 1X5KA 1VFAB 5T1MA 5I1EL 1OSPL 1MHEB 2C3WA 1INQB 1WBXA 3SQOH 4W81A 3RPIB 3CLEL 1JNLH 4Z5RA 4L29B 2EYRA 4PJAE 1P7HL 4Z6AT 1BGXL 4JO3H 3MGTA 5C0AB 1HIML 1QSZA 4YO0B 3SQOL 4HKZB 3UTZA 4TSCH 4P3DA 4UQ2B 1EGJH 1F90H 1JNLL 2F15A 3KPPA 4KK9C 4N90D 5ENWB 4JFOB 4PJXB 4P2RE 2RQ8A 4H5SB 4MZ3A 4MXQC 4JO3L 4R7DB 4QY8A 3KLHD 2Z91A 4KKLC 4TSCL 2IEPA 4X6CA 2NZ9D 3BFOA 2OP4L 2I26N 3RKDC 2GTWB 1X4ZA 3KPQB 4Y5YB 5DJAB 1XR8A 3T8XA 3BP7A 1NGQL 5DHXB 1RZ8B 1NUNB 3DGGA 5EORH 3VFPB 3NA9H 1GH7A 4PGJA 4C56B 4DGIH 2A77H 5IBLD 4P5TD 4X9HA 3ZSTA 4M7ZB 4ZO7A 5EUKA 4JZJA 5EORL 4UIMB 1T1YA 2BNUB 3NA9L 4RDQF 3CPLB 2BVPB 3S5LA 5GZND 2NY5H 3QHFL 1E4XL 1IC4H 4DGIL 1UXWB 2A77L 3BPLC 3KJ4B 3MFGB 1F02I 4K9EH 1U3JA 3D0LA 4CADA 3O41B 4LPVA 4XI5C 4JG1H 1RJZA 4QT5B 2SEBA 1F6AB 3QDJB 4BA8A 4M8QA 4NKQB 1DFBH 4IRSC 2VDKH 3V0AC 5BOPA 1K8DA 3WS3A 2W0FA 3KJ6H 4C55A 2R4RL 2CK0L 4GW5A 1DANT 1W8OA 1FC2D 1MHPH 4NQTA 3KPLA 2AEWA 1YEGH 1LP9B 5KG9A 2CLZB 5DXWA 1DFBL 3VJ6A 2VDKL 5IMKA 3CFBA 3KJ6L 3RVXC 3HKFA 5H8DA 5IMOA 1MHPL 4KKCD 1YEGL 4M8VA 1V7NH 4MSWB 2CUIA 3HZKB 1VERA 4U1MB 2P8PA 3MJ8B 1E28B 1A1OB 2OTUA 5GSRB 1LO2H 3ZE0E 1JBJA 3WXWL 2O5YL 3V6ZA 3GBLA 3OAYK 4JDVB 1MWAH 3U4AA 5C0EB 5DRNA 4JCLA 4G7YL 1J11A 3MLYL 1ZHKA 1LO2L 5CJXA 2DLFH 4F7EB 1FYHB 1U92B 2ESVB 4FMKA 3EUUA 1MWAL 4LASH 4KKBD 2P5EE 3VG9B 4UV4H 1KIPA 3FQTB 1B0GA 2DLFL 1DQDH 2GEEA 4LASL 4XMPH 1EO8H 2B1HH 2R1YB 1QNZL 3LD8C 1BZ7B 1HE7A 3VGBA 3PIQA 4TUOB 4G3YH 1WCBB 2XA3A 1IC7H 5B39B 1ZVHA 1UWEH 5H94B 5DJXB 3WUZA 1N59B 4XMPL 2B1HL 5KSAD 4HWBL 3SE4A 5SWZB 1XF4B 4G6KL 1XGQB 1IC7L 5D5ME 2P8MA 4FHBD 3KYNB 2UUDH 3QPXH 5J7CC 4TQEH 1YJDL 2C1OB 5ALBL 5B3JF 5JORB 3NCBB 4PJCE 2UZIL 1M7IA 1RZKH 3PNWB 2V5MA 3HE7C 4LLAA 4NQEE 4CNIA 4KJYA 4H25B 3NCFB 4F58H 3QPXL 3QIBA 2Q7YA 2W38A 1JHLH 1ZS8B 3C5ZC 1RZKL 2VN4A 4KROB 1PFCA 2Q3AA 4RAUA 1I7TB 2APXA 2CRYA 3EO9H 3VMNA 2VDNH 4LVEA 2G5BB 5FYKE 5BQ7B 1AHWC 4C4KO 1CDCA 2ED7A 5EC2B 4X4YA 5KZCD 2RBLA 5IROC 3QDMA 3EO9L 1ZK9A 3ULVF 2VDNL 4YC2B 3IGAB 2VLRA 3S3PA 4L3CB 4HHAA 2IAMA 1TVDA 1M7XA 2CLRA 1ITBB 1NH6A 3DRQA 5J1AA 3HNTH 4KQ4H 5DO2D 4PP1C 1WISA 2HJKB 3MA7B 4QTIH 4NGHH 3MRKB 5I74B 1JGVH 2X4NA 3QO1B 2QLVB 3SDAA 3WJLA 1K6QH 3HNTL 4KQ4L 1MRDH 4KK6C 3QIBD 4QTIL 4TSAL 4NGHL 1RUAH 1P5UA 2PW1B 4G6JH 3VXRE 2ZSVB 1N8ZB 1JUFB 5FOBA 2Y36H 1K3ZA 3HR6A 1HHJB 32C2B 3ARBB 3FT4A 3WMSA 4Y16B 4XNZB 5K33A 1DDHB 4D9QE 1KCSH 3BH9B 2R56H 1D7FA 4HKXB 4KVCH 2PYED 4G6JL 3I9GH 4UIKH 1WC7A 3RVVD 4RGND 4J2XA 3ECBA 3QDMD 3MJ9A 3RWIB 5FYKL 1BQUA 2NW3B 2Y36L 1XGRA 5L0QC 5T3ZD 4G42A 4Q9BA 2R56L 1BOGB 3MRMB 4PJBB 5I2IB 4OI8A 2IAMD 5IVXB 1FRGH 3SDDC 4JFHE 4U1HA 4RWHA 1VKXA 5FKPB 1KCKA 5DC0A 5GRXG 3CVHA 4UT9L 3WDJA 4LNRB 3GIVA 1MFEH 2NX5A 4WV1A 3GMRA 4DN4L 2IQ9H 4DOHE 1BVZA 1RZJL 2EKSA 1WV7T 4GW1A 1WZKA 3IS0X 3SDAD 4JFDB 1MFEL 4AM0A 3QFJD 4QXUL 4ZPTA 2RCSL 3ZKND 2Q6WB 1PZUB 3PHQB 1LHZA 2QSCH 1FN4A 5DMGD 5BS0B 4BSWB 3B9VA 1IEBB 2APTA 3K81A 2XRAH 5KS9B 3SDXA 2GJ6B 2AXGB 1JTPA 4OFIA 3VXMB 5IFJB 1D9KC 4ALAH 4QGYA 1NGYB 5CP3A 1I1CA 3TVMC 4LVNC 1YMHB 2N4IA 3ARZA 2XV6B 4P2QE 5K59E 1U8JA 1UJTA 3G6JE 3O6FA 5FM5M 5I0DA 5HGBA 2DMBA 1QSEE 2X89D 4Z7WE 1NANH 3BKMH 4JM4L 2X9YA 1MLCA 2HT3D 1QRND 4M61B 1XZ0B 4W4OA 3MLXL 2GK0B 2EYTA 1C08A 4LF3B 4L4JA 2VZ3A 1A14H 3GI8H 2HFEA 2K3TA 4MD5B 4P2YA 3IU4H 5DJCB 4DFIA 4M4PA 3QXWA 2RJMA 3DXAA 3O11B 3BPOC 4NO0A 1A14L 3GI8L 4IOFD 5IWLC 4ZOCA 4N0UE 1VFBB 3IU4L 3OB0H 5CHNB 3LKQB 1EA9C 1RIVH 5D70H 5IHZB 1A1MA 4OZ4A 4RX4A 4EKXA 5D1XB 4NQDB 1MI5A 4NIKB 4PR5B 5DEFB 1JF5A 2XZZA 2EICA 4RMUA 3CLFL 1RIVL 4PGZA 3ARGC 4HXAH 2A74A 2B5IC 1CDYA 1NJ9A 3QIUB 1UB5A 3F12A 4MXQD 2BVQA 4KKLD 2D3VA 4I3SH 1Y6MR 2LVCA 4MS8C 4QTHB 1VFMA 5CJOH 3T0EC 1AQDB 2HG5A 4HXAL 3VXQB 2GSGB 2X9WA 1A7PH 1YEIH 2CKBH 4I3SL 1X7QB 3MUGA 2FL5A 5DFVC 3VXSA 2DIAA 1K3IA 3I50H 4N90E 1C16A 1G7PB 1U8NB 3DXAD 4XC3H 1W0VB 1YEIL 4IRZH 3V0WH 4YE4H 4DCQB 2D7PA 4OZFA 4X9GA 3GSXA 4OZIE 5MP6H 2BJMH 3GMMA 1QD0A 4OZHE 2FHBA 4XC3L 3OJVC 4RWYH 4IRZL 1FLTX 2J8HA 4MGXA 4B5EA 3V0WL 2A73A 5H35A 4YE4L 2OQJB 2VQ1B 3CFEB 2ICWI 5MP6L 3ROOA 1UJ3B 5EBLB 1JVKA 2YR3A 3MOAH 4MDIA 1Q9WB 3KPMA 3SGKA 3RIAK 3G6DL 4L8SA 2E9IA 1DBMH 3S5LG 3K2MC 3RVXD 4AL8H 3U30B 3MOAL 2Y6SC 4MA1B 2R2EB 2GIYA 4OSUL 4X5XB 1Z9MA 3C5JB 5EU4A 4NQCA 3FZUD 1DBML 4HIXH 4ZFZA 1QA9A 3KPSD 3FFCB 4DWHA 3BPNC 3V7MA 3EYFA 2OX5A 2YC1A 1AIFB 4X6FA 2XWJB 3ISWA 4X6CE 4FS0A 1JWSB 1T89A 3RUGB 3DV6B 2P7TB 5GS1B 4X8JB 1GRWA 4ELKA 3PHOB 3MRCB 3QCUH 2M8XA 3BP4A 4UDTA 4JQVA 1EEQA 2VQUA 3V4UH 4PYGA 5FB8A 2J88H 4PRAA 4RBPH 2BY1A 2DQHH 1ZWIB 3S4SB 1J05A 5F88B 2E5EA 3BZ4A 2GYSA 2V5TA 5E00A 3TBTA 2J88L 3ZYIA 3H9SD 1QSFD 3FO0L 1ZKAA 2DQHL 5FF6B 1V7ML 1NC2A 3S35H 1MQKL 1I8IB 2E6QA 1FZJA 1T7VA 4NQCD 1MHHB 3AROA 2X4PB 4XB8A 3VI3E 1Q94A 4YFLF 4P48A 1R5IB 3MV8A 3S35L 4P23A 4G80A 1KACB 3SHSA 4BSVB 5C0NC 3FMGL 4PJXF 3UYRH 1FFQA 3BRFA 4OBSA 5F7DB 3MGOB 4WTZA 4UNUA 2EEBA 3QA3A 2PKDA 1AE6L 1N7MH 2NXZC 1HHIB 1ORQA 3L1OH 4LSSL 2X70B 3N1FC 4XPFH 1LEKA 2ZJSL 1A47A 3D85B 3N85H 4O2CA 3SDCC 3U7WH 3RNQA 1IQDA 5HPMA 1OGAB 5HYSA 1SMOA 2QQNL 3U9UB 5B4MD 2DI9A 1IGTA 1U93B 4Q9CA 3M1BB 2BY2A 1F58L 3KNBB 3N85L 1S9YB 1YEJH 1RVFH 4G8GD 4KKAC 4HWEL 2XICA 3C9NA 1DLHA 4KWUA 1ZEAH 3NFPA 3B9KB 1CG9B 3TBYB 3HAEA 3RJDA 2V7HB 5BW7C 4ONHB 3QDGB 4P23D 3ARVA 3MLPA 5D8JL 5IJVB 3MRNA 4YDVB 3MRQA 4OCSH 1F3RB 3VWKA 3FCTA 5DRZA 4OF5A 5JQ6H 3F8UB 3BPLB 4W68A 4GUPA 3KPRB 4PTUA 3OKDA 1XF2A 5J06A 2VDQH 3BESR 2EXWC 5M94B 1P5VA 3HPLA 1NANI 1UKSA 4K3JH 2KQMA 3IS1X 3GJEB 4PRPA 4PJEA 1KB9K 5I71C 3MRFB 2MQ0A 5I9QB 3GSWA 3TNNB 5F21B 4J1UA 1JZ4A 3ARFC 4K3JL 5I1JL 4AT6A 3JSSA 3HNSH 2JB5L 4HIJA 3ZKXC 4ZUSA 5K9OA 1HNGA 2AK4D 2Y07L 3RZCC 1P9MC 1IVLA 2QQQA 1RMFL 3U36B 3HNSL 3CZFA 1H5BC 4RGNE 3PWVB 3QDME 4DZBB 2YMXH 3TM6A 3FB6A 2B1AH 1FIEA 1G0XA 1KEGH 5T3ZE 2VLRE 1VGEL 4F7CA 5DQ9A 1U3HC 3QB7C 4GRWH 2VDRH 2AERT 1F2QA 2YMXL 2B1AL 1YPZB 4YPGB 1KEGL 4PRDB 4OGZA 4D0DB 3O9WD 3I6GA 5DHVH 2YS4A 1BD2B 1YY8B 4POUB 1WIUA 2DIJA 2VR9A 3F58H 2V2XB 1RK0B 5HI3C 4TNVF 3IKKA 3T0DA 4EUPH 5LVEA 3BUYB 3ORJA 2BOCB 4PRPD 4ZO6A 1AGCA 2JK5A 3RP1A 4ZTOH 4YHIA 3LD8B 3N06B 4BFEA 5MEPA 1V05A 4H20H 5FAAA 1R0AL 2BSRA 4POZC 4U3CA 4MNQA 3T0XA 3AS2A 2C4XA 1I1AB 4Y4FB 5DJ8A 1R3KA 3QCTH 4MCYA 5IVOA 1PKQA 2LQRA 1CTOA 4I13B 3DYOA 4H20L 4HEME 5H2BB 1R5VB 3VDAA 4JRWA 4JFFB 3T08A 4OBRA 1CFNB 5KSVA 4HJJL 3PWLA 2B0SH 2X7LB 3TT3L 3PG2A 4QYOB 1GZPB 2V9TA 2E9JA 5C9JB 1OAKL 3LAFA 1G7IB 5JIIA 1UQSB 1CFTB 5FGCE 3C5ZB 3DI2B 3LH2L 2W60A 4OIBA 1CGUA 3GRWA 1MPAH 2NX5E 3T0WA 1AHWB 4LCIH 5BZWB 4U1NA 4GRMB 1AH1A 2UVFA 4U1IA 2W65B 3TIEB 4EOWL 4LSRH 2VO5A 3E6FB 2YA1A 1X3DA 1QZ1A 1JYXA 1NAMB 5LKNA 3QQNA 4TUJA 4DVRH 4U05A 4HD9A 1TPXC 2QADD 5KJRL 5FCSH 4WUKH 4PJGF 5HPOA 5KBNC 4HDIA 4MNQD 4F7PA 1J12A 5GS0H 1RJLB 2VH5H 1DTUA 4MS8D 5DR5L 2EECA 1B4JH 3SDXE 4ZFGL 5C0GB 4KY1L 2UZYB 2Z92B 5ADOH 5F1NA 1IGCH 3DVGA 5L2JA 4U2YA 5DZLA 1E6JL 3ILPB 5GS0L 2CR3A 5DFVD 2Q76A 1B4JL 5IK3B 4NRZB 4M9OA 1FFPA 3MUJA 4BH8A 12E8H 1NCCH 4HPOH 3OZ9L 5ADOL 1IGCL 1QO3A 3DX9A 3KR3H 2BVEA 1MFCH 4JFPB 1M71A 3SKNB 4PJBF 1KXVC 5IVXF 4JJHA 2NMSA 4JKLA 1TLKA 4FQIH 3SCMC 1KG0A 3RGVA 2EDDA 4Q9QH 2QQKH 2DDQH 3X3FL 2JIXA 5GGUB 5I17B 3KR3L 4UU9B 5T1DL 3BHBA 4FQIL 4GKNB 4Q9QL 2QQKL 4WGWB 2HH0H 4GS7C 3WCYA 5MEQB 3DXAE 4O2FB 4OIIL 4YH6A 1IBGH 2VR5A 3DIFB 4UQ3A 5DF0A 1ES0A 3BT2L 4I18C 1WJ3A 2CIKA 2HH0L 4MJ5B 4OZFG 1BIHA 5FECA 1IBGL 1JPFA 3MREB 3NIDE 2FYYB 4LP4A 5CEYB 2EE6A 1ZLVH 5I1LA 1MI5E 1TQBB 5F8RC 4YAQA 5KN5B 1F45A 3OKKB 2X5PA 3FQWB 4KTDH 1INQA 3STLB 1MJ8H 1ZLUH 2AXJA 3IXTB 5D9SB 2OJEB 4NNXA 4AG4L 4L29A 4K3GA 3IDMB 1RUPH 5LAXB 1KNOA 3DJ9A 3TA3C 4FG6D 4KTDL 3U79A 1MJ8L 4HKZA 2JIXD 5FGBC 4UQ2A 1VCAA 4BKLB 4DVBB 4B41A 4KGLA 2WM0A 2EZ0C 3PDGA 3DYPA 1RUPL 5ENWA 1WT5C 2PTTB 4JFOA 4R7DA 1D9KB 1UA6H 3NPZB 4L3EA 4N9OB 5BV7C 5IT2L 5IHUH 4MNGB 3VXSE 3TBWB 2OL3A 5E2UL 1GC1L 1FNLA 3QPQC 3TVMB 1PW3A 5BOZG 4PBXA 1A7OH 3KPQA 4Y5YA 2FX9L 1UA6L 2IANB 1RZ8A 4MYWB 2E7LC 3VFPA 4NQVB 1PX3A 2GTZB 4QRQA 5DVNA 2UZXB 2HTLD 2LTQB 1TENA 3GBNH 1A7OL 2ZWLT 3AMLA 1IGMH 4UIMA 4OFDA 1I9RH 3CC5B 3CPLA 1MOEA 3MFFB 2BVPA 1L0XA 3D39B 1AXTH 5J13B 2QQLH 3P0YL 1UXWA 4Z7OE 3GBNL 3TIDB 3DROA 1X5GA 1IGML 3IJYB 3BPOB 2P8LB 5FHBH 4QT5A 2VDOH 5JW3H 1F6AA 1KJMB 5L8LB 1XGTB 4Y5XC 1AXTL 1NCWH 3QUXA 3H9SE 2GCYB 2AJXH 4CJ1A 1AR1D 4E41B 1WFUA 3CSYB 4POYA 5FHBL 2VDOL 1LP9A 4GXUM 3WN5C 1MVUA 1P7KB 4HFUH 4NQCE 4CJ0A 1TJHH 5BRZB 4D2NA 5JW3L 3MOBL 3MXWH 4OKVB 4FRWA 4L3ED 3U1SH 3L5WB 2AJXL 5IB3B 2FX7H 3FRPA 3ARRA 2I60H 3ARGB 4HFUL 1B3JA 4H8WH 1TJHL 4MSWA 3HZKA 3JTSB 1CXHA 4CDGC 4U1MA 2CDGB 3U1SL 3MJ8A 1E28A 5B3JE 2FX7L 4JZNB 5GSRA 2I9LB 4GG6A 1HSBB 2I60L 3HRZA 3T0EB 4WTZG 4H8WL 4R4NC 1EZVX 2WANA 3C2SA 2GW5A 4JDVA 2J12B 4S1SH 2J6EH 5DI8A 4KJPD 2ZSWB 5D4QA 4M43L 5C0EA 1DQLH 3LVEA 5EA0H 4QF1B 1INDL 2CO7B 5I1KL 4KH2A 3TCLA 2X42A 4XHJC 5ANMB 4S1SL 4U1SB 2J6EL 4Y5VA 5FIEA 3ESUF 5L8KB 3DMMA 5EOCJ 3FQXA 2JJTA 5HYSG 2IJ0C 5E2TH 1VGKB 2ID5A 3FN3A 3QUXD 4KVNL 2HT2C 2PYFB 2DJ4A 3FQTA 3ULVE 5EB9A 5F7EH 5EBWB 1CGVA 2VLJD 4TUOA 5E2TL 2H41A 4Z7VB 3HAEG 4YNYB 2X6MA 4WO4A 3AREC 3MV8E 4P49A 2EH8H 5F7EL 5IVZA 1J7VR 1N59A 4XVTL 3V95A 4NC1E