3QYMA

Structure of p63 dna binding domain in complex with a 10 base pair a/t rich response element half site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
192
Chain Sequence
SPSNTDYPGPHSFDVSFQTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator/dna
molecule keywords Tumor protein 63
publication title Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 192
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qymA00
1EANA 4AGNA 1KZYA 3WTSA 5ECGA 2RMNA 2J1XA 3D09A 2J6WA 2XWRA 4L0ZA 3D0AA 3US1A 5AOMA 2ADYA 2WGXA 2VUKA 2IOOA 2YBGA 4KVPA 4AGQA 1UOLA 4AGMA 4IBTA 1H9DA 2AHIA 2XWCA 3Q06A 4IBSA 2BIQA 1YCSA 1TSRA 2BIOA 2J1YA 3WTXA 4IBWA 5KBDA 2ATAA 2GEQA 1CO1A 1GZHC 3ZMEA 2J1WA 1TUPA 3D06A 3EXLA 4LO9A 3Q05A 2BIPA 4IBYA 1EAOA 3D05A 1T4WA 2OCJA 4IBQA 3VD2A 2AC0A 5LAPA 3WTWA 4G83A 1GZHA 5AB9A 2P52A 2BINA 4IBUA 5A7BA 5ABAA 2FEJA 4L18A 3WTYA 3VD0A 1HJBC 2IOIA 4XR8C 1EAQA 1E50A 5AOJA 5G4OA 3WTTA 4GUQA 3D07A 4LOFA 2IOMA 1CMOA 3IGLA 4LOEA 1HJCA 4HJEA 3US0A 3TS8A 1LJMA 1IO4C 2J1ZA 4MZRA 4AGLA 4IJTA 4QO1B 2J20A 4G82A 3KZ8A 3Q01A 4AGPA 2H1LM 3WTUA 4L0YA 2BIMA 3QYNA 3IGKA 5BUAA 5AOIA 1HU8A 2X0WA 3KMDA 2X0UA 4IBVA 2MEJB 3D08A 4A63A 2PCXA 5AOKA 5LGYA 2J21A 4MZIA 4AGOA 4GUOA 5G4MA 3QYMA 4IBZA 5AOLA 5G4NA 3WU1A 3EXJA 3VD1A 2X0VA 3WTVA
chains in the Genus database with same CATH superfamily
2QDWA 2XV0A 3E6FA 5EBGA 3FB8B 5FYLE 3LKSB 3X2QB 5BS0E 4RGNE 4YH6A 4DOHE 1EFXD 1SLUA 2BRRL 4L1LA 5GGVY 4HS6B 3MCKA 2XTSA 1IBYA 1HDMB 4JRLA 4X83A 4BQ8A 3CU7A 3FTXA 3RB5A 1VFMA 3AY2A 4F8LA 5LWYH 3TO4C 1T22A 4ZTPH 5L2KE 5FOJA 3QDJB 4XO5A 1X5LA 3W0WB 3MXWL 5KOMC 4N26A 3BGFB 3MLWL 1K4CB 1BAFL 1FAIL 2DWDB 3NOIA 4MD5A 2P49B 4F57H 5J06A 4JQXC 1YQVH 2XG4B 5GS0C 4NP4L 4TSBH 2VR4A 3HPJB 5E4OA 4HISA 3HC4H 5C07A 2XWXA 2LVCA 1TTCA 2FQGA 2BVQB 4WENB 2BSDA 3MRGB 3HZVA 5D7HA 3ARDD 3JYBA 3WLWC 4WV1C 2JCCA 4Z7WA 1T4KA 4Z8FH 2C9UA 2OR9H 3BP4A 3MRHA 3BUDA 5J11C 3N5AA 2IGFH 1ICTA 1OB0A 3KGSA 3NJXA 3P0VH 4HSAC 1S5HB 3WAKA 4ZW5A 2G5BA 1M42A 3IFOB 3F5WA 1EEZA 3FH5A 3QFJB 3QAZC 1E4WH 4K7PL 5L9DL 4U1KA 2OTPA 4FQHB 4J3OC 4IBLT 4MXQC 2X5PA 3G6JB 3IU4H 3K8KA 1SF5A 1AGCB 2NQCA 5E03A 2GBVA 4X4YA 1EO8H 2DQCL 1XMWA 4HHAB 1RUQL 3DXAB 4HEPG 2EUXA 1WICA 2R2HB 1U8NB 2ZCZA 3C9NA 3UBXB 1O6VA 4XWOD 1K8IB 4LPYA 5CWSB 2QVMA 4DKAA 1NCGA 3RWJA 4P23C 1G9NC 3FO2A 3K91A 5E56A 2GTZA 3W0WD 3CK0H 1KGYE 4NERA 4ZTOH 3LMJL 4YXHH 1LE9A 3EZJB 4TVPH 1JN6A 3HC0A 3X12B 2JI2A 4PJ5B 4X2UA 1XCXA 2V6HA 5CEZH 1FGNL 5BQDA 4F9LA 3GWJA 4EZKA 1KDJA 1DN2A 3P69A 4KDVA 3QQ3A 3GXMA 4YZFF 4U1IA 5F7UA 3NZSA 1FNEB 1DJSA 3CDGB 3O4OC 2HFGH 1B4LA 4QLWA 2VE6A 2GK0B 4XNUL 2P24A 4OZIF 2V9QA 3TCXA 4L0PB 3ZR6A 4YAQA 2V9RA 3JWNH 1FNGA 2GABA 4E41B 1JPEA 3FN0L 4UANA 1B4JH 3V0DA 4BXSV 3MTXA 1JZGA 3O2VL 1A6TA 5SWZA 1E65A 1E6JH 3UZVB 1RZKH 3OZ9L 4L37A 2B1AH 4PJFB 2NY4B 1TVHA 4EVNA 2NNAA 4NC0B 3T0ED 4DPRA 1DE4A 2Y22A 2BK8A 1FV1B 1MFEL 1QBMH 2UUDH 3IGFA 1CF1A 4MA8L 4F15B 3N1GC 2EXWC 4NWUH 4X6BB 4F37F 3ZKMC 2GY7B 3FUKA 1N2RB 2NW2A 4UT7H 5HYFA 3VSTA 1MIMH 1CE1H 2E7CA 4N0UB 5SX4I 1S7SB 3M6DA 4EI0A 1S7WB 2KC0A 3DXAD 3VFRA 2AHIA 3ILEA 1PY9A 1AQKL 5D2NB 4AIZA 1IBGL 2OTUA 3ELAT 3ZGIA 2ATAA 4X98B 3DDFA 4WW2A 4NZUH 1COBA 3L48A 3BGMA 4N9GB 1EUUA 1E3FA 3KYAA 5EEWA 7PCYA 1A0QL 1B3IA 2G75A 1AGDA 1FVDA 4KTYA 4WI4A 2KT6A 3HE7B 3JWOC 2MPAL 4YX2L 3FRUA 1SXNA 4H8UA 3IE9A 3FB5A 5D1XD 5FO9A 2UWEA 3AQXA 3VFTA 4PJAA 5DRNB 3I75A 2C4FT 4Y5VB 1BBJB 3WFBH 1EJOL 4E41D 2NY1D 2BVOA 4O4YL 3MN8A 1DYZA 3WO3B 2VDRH 2F5AH 4OFDA 4WTQA 4FQIL 4LL9A 5AAWC 2XKSA 3CFCH 3WHE0 1BEYH 5F9DC 3FU0A 1A2YA 3PQYB 3Q2VA 1U93A 1L9RA 1PZ2A 3LKNA 4MCYB 4AQ8A 4A2MA 2HVBA 1A6PA 5C0BE 5DJYB 3D0LA 2Z31A 3UTZB 1X5KA 3PV7A 4A2LA 5EZOH 1ZOXA 1E9OA 5ILTL 3PCYA 3H8NA 3WKYA 5BZDA 3QE5A 4YDLC 3WHE1 4ZX5A 4DK3A 5EPMA 4X5QA 4Z3FA 4NUGL 2A6KB 2E6JA 2R0LL 4ZOAA 3GIZL 3ZHKA 1BQSA 4BUGA 2WUCL 1PKQB 1A6AA 4EI5A 5INCB 5IQ7H 2FT8A 2BS9A 4WU7A 4TYUA 3NP4A 2EDXA 1AXSB 4XB3A 2DAVA 1OSPL 3K5RA 2VQTA 3EYSH 4Q58C 5I9QB 1UXSB 4I4WA 4OTXL 4N5EC 3Q13A 4PS7A 4Y4HD 4HX1A 4G7YL 1D5ZA 2K7QA 1TTGA 2UY6B 5FUZH 1YNLH 3BESR 4Z7WF 1EZVY 2CBTA 4XCYB 3ULSB 5MERA 3K7UA 4Y16B 2WLLB 1NPUA 2CCVA 4LOUD 2V2XB 2X4RB 4HFWA 1CL7I 4QTIH 3J8F7 5EC2B 3MRIB 1T20B 3U0TB 1ACYH 1WLHA 2O6CA 1MUJB 1YAZA 3TYFA 4QIRA 3GLEA 4R97B 5F6HJ 1P1ZB 3RB7A 4UNUA 4JM2D 4M6NL 5T33H 4XO4A 3CLEL 1S78D 2EP6A 2P8MB 1RI8A 2XG5B 5GRVL 1KIUB 1G7QA 2R39A 4Z7VE 4V2CB 1HKLH 4CADA 2AGJL 2NXYD 2MNJB 3V52L 1MF2H 3EGXB 4D9LH 2IFFL 3EF7A 1LD9A 4Q74A 2XZAL 2NY7L 3P9MA 4P04A 1J5DA 2IPKA 3FOLA 3MSPA 2MHAB 4HJGA 2CO7B 2IANB 4N3TA 4UUJB 4HA1A 1O5PA 2IDTA 2VN7A 3CFQA 2ADIB 2UZXB 4DF9A 1BM3L 4PRNB 3SYQA 4ADIA 4JZOA 4XMPH 5KN5A 1AQHA 1G7PA 1ZHLB 3C5XA 2D7OA 2NYYC 1KT2A 3C60D 3T3PB 4WI6A 5IGXH 1Y6NR 1YMMA 4JN2B 1GGUA 5I6OA 4M4RB 5J57B 3EH2A 1VERA 1X9UA 1GMEA 1N7ML 2YQBA 4PR5A 1B2WH 4AQEA 4BFOA 2ETWA 2VDLB 1VPOL 1J8KA 2P46B 2Y5TB 3TVMB 5F0PB 2FD6H 3L3KB 4MB1A 3GO1H 3L3JB 4ETYA 2AK4E 1JGEA 3MRJB 4PLKD 3VGHA 2VXVH 2YPVA 3QNZB 4V1DE 1NMBL 5DFVD 5LNGA 3CHRA 3WOVA 3PABB 4OQTL 2OZNA 4PRDA 3BT0A 4FTDA 1JVLA 1OGAE 2IDSA 3SE3A 2PW2B 3FTZA 1NMCB 5HXMA 3KYMB 1F13A 4PRBA 3T4YA 5KVGL 3MLSL 5I16B 3D12B 1TYEB 4LEXH 4XVSH 4F92B 1KBKA 3ARYA 5C92A 3D34A 2O5XH 4DKFH 4NKMB 5SX4H 4WZ9A 3LSOA 3IAQA 3VRIB 3NJLA 1DBAL 1RZPA 1W72L 1F58H 3VXPA 4C47A 2P5EB 3SQOL 5CGBA 3NAAH 4CMHB 2O61B 5IROC 1R5WA 2DYRB 5CGYC 4LLVA 1T0NB 3L81A 1GYWA 3FKUS 4OT1H 1UZGA 1LL1A 2W60A 3A4DA 3Q2NA 4ZUWB 3M7FB 2UXTA 4F58H 4WK2B 1GH7A 2WNGA 1NCHA 1HSAB 5I0VA 4BFJA 3OJMB 4X99A 2UWEF 1UT9A 1QA9B 1Z66A 25C8L 5DSCB 3TIDA 4FA6A 1NCBH 5H8DA 3RVVC 3IPBA 2VNCA 2NDGA 5JMRA 1XGTB 4LEBA 5LGHL 4MYPA 2A9ML 4NSKA 2X2IA 4XVTH 2IADA 3TVMD 3WE6B 2Q10A 3WXWL 3LOWA 1UKQA 4JPSA 1XB3A 3CFIC 3KPQB 3D50A 3VACA 4DGYL 1AO7B 3M1BB 2WBJA 5ITFB 1T7XA 4PGEA 4MMZA 1INEH 1TEFA 4LRIC 3PGCA 3T3MF 3ZE1E 2W0PA 1AI1L 3FQUA 3QIBB 3WTXA 3GSVB 4MBRA 3CN1A 5IVZB 3A4AA 4PRIE 3VB9A 1EERB 3K3QA 4NCC2 4QY8A 1G9MH 3DHJA 4XBEL 3ASWA 3GMPB 1B88A 4PJ7B 3ARVA 1OXYA 1XDTT 5E95B 4GY4A 3IRPX 5GZOD 2AMGA 1QSFA 4LHQB 1SJHA 1MLBB 4W9HC 5KSAD 4HFUL 4NC2B 1P5VB 4Y4KC 5E08H 2ZWKA 3CZLA 2P5ED 2V3FA 2Q87A 5AVUB 3GI8L 2QHLA 1T5WB 1IVLA 4KKAD 4APQC 3PDDA 4PH8A 5AKTA 3VH8G 3KGRA 3ARFA 3ZDZF 5IESH 4I3SH 4M7LL 5CMAA 4F7EB 2BP0B 5DJDA 4LLUB 4F5CA 2FZ3A 1I1AC 4J3XA 2YIHA 5CBEA 4RCAA 4WKZB 1A9BA 3A6OA 4UAHA 1DQQB 4JPVL 5FV2A 3AGVA 2IGLA 3GFUA 3MV7D 4GKNA 4YDIH 1TTRA 5CGTA 1AGFA 4G8GA 1JNNH 3LD8C 1VA9A 2PWDA 2PR9A 4N2DA 4KGLA 5GGSY 4BGDA 2CBPA 3PWJB 1CL7H 5CEXB 5T1LA 5HI3D 2ZWZA 3GS7A 3OHXB 4M6ML 3CFNA 1XF2B 2AEPH 1NC4A 3C2AL 5F7KC 2XN9D 2BZ7A 4WHDA 4FHKA 5JQ6H 4UQCA 4BQCA 1JPGB 3EZ8A 3JTTA 3UTQA 2PCPA 4A2GA 5KJRH 1OK8A 3DX9B 5EZPA 1XGUB 5DA0B 1DUYB 3IRZA 1UH3A 3CQFA 4TNWF 3GUFA 1ZT1A 5HGHA 1E4JA 2CG9X 2J6EA 4L9LA 5FUOH 3H85A 4CA4A 3UO1L 3HS0B 1JK9B 3ILQC 2A3TA 2DQGH 3I9GL 2ZPKL 4WO4D 1HQ4A 4O5LL 4W6XB 4JR9H 4OD1L 4EOWL 1JZ4A 3ECUA 3DRQB 4BK5A 2VAJA 3X11A 4IOIA 1NWOA 3AXIA 3LHPH 2HVJB 1DBJL 3PAVA 2CMRH 3LS5L 1TEYA 4KAQH 1N64L 1IGTB 4LL1A 4HZAA 2DQEL 1QSEB 3GJEB 4HXAL 2HUHA 1R75A 1WBZA 1D5MA 3ZTCC 3BPCA 4KMQA 3U9PL 4RAVB 5FYKE 5D7SL 3LXCA 4I18B 5CCKH 2J1KA 4PRAB 5T3XL 5HJGA 4YXKL 1GOGA 4J12A 1ZPLA 5C09E 3PHQA 2Q8AH 3C6LB 5JW3H 2NR6D 3GYRA 1TSRA 1KBGL 4EIUA 1JNHA 2BIOA 3H53A 5EOQL 1EO5A 4YWGH 1TJIH 1E4XI 2V7HA 1GZHC 3M1OA 5JXEA 5K33A 4LGRB 5F89A 3WIIH 4QJ5B 1P4LB 1GGCL 5CS7A 4Q6IB 4MA7L 5FFLA 5IOPA 3TPKA 2N0KA 4OKDA 4DEWA 3AJ7A 1G6VK 4HKZB 5AW4B 3E2HB 4HBCL 1DVXA 3K6NA 3PHOA 4J2QA 1N18A 1M6UA 2Q9OA 3MTRA 4ZW7A 3CG8A 2I9TA 4NZFA 5J89A 2D7PA 2Z7YA 1NAMB 1T6BX 3CX2A 1JF5A 1K9TA 1NINA 4TUOB 4LASH 1ECZA 3DJ9A 4ZAKC 5AW6B 5GIRA 5A16B 1T03L 4LOVA 2QKIB 1UB5B 2XI9A 4G3YH 1ML0A 1JTTA 3ZSTA 1F3JA 4R0LA 3ZO9A 4BFKA 3HAEG 5KG9A 5DD0H 4HUVA 2BOBB 3C5SB 3TT3H 2Z93B 2ZSVA 3US0A 2DY2A 3BEVA 2GB2A 2HFEB 4NHUA 3UX9B 3E9TA 4G8EB 4OJYA 1DFBH 3UERA 1JPTL 3BEWB 4LBAA 3VNZA 3LKRA 1YQ2A 1NKRA 1A7QL 2Y2YA 4XP1L 1IJ9A 1DQDL 3D51A 5C0IA 4XZ4A 5FEBA 2IQ9H 2QPDB 2Z1KA 3L3GB 3L3DA 2V8LA 2PUQT 1HL5A 1A4JB 2PYFA 5C3LD 4IK7A 1O5DT 3BQUB 2DQDH 5E6IA 1KIRB 4M43L 5C9JB 4FQ1H 4O02B 4ZO9A 3S35X 5DJXA 3QWRD 5JIKA 1ZLVH 2GI7A 5J5EA 4PW4A 5ANMB 1R5VA 1KWGA 4NPYA 5LQBH 2M1KA 4X5XA 2JLLA 3O9WC 1OB1B 2EE3A 1NCJA 2C8NA 2RALA 3C6EA 4OZHB 4PCKA 3CN3A 5E1GA 2H32A 3WN5A 1L7IH 4ELME 2GG1A 1ZTMA 2P26A 2J8UE 2EKSB 3T65B 3NCXA 5BV7C 5FHAL 3SO3B 3E3QC 4KMTH 4C56E 5E9DE 4JDZA 4NQCB 2J73A 3QUYA 4HLJA 1JWMB 1BZDA 3IS0X 4JRYA 5JIMA 2O6EA 4FQ2L 1CICB 3NIDB 4MAYD 3ARED 4UOW0 4PM1A 1DQLL 3G6AA 3E3QE 4JQIA 2P80D 4YIQA 4EBQH 4UB0L 4IGBB 5F7EH 1ZT4A 1Z32X 4KXBA 3ZHFA 1LO4H 4G1EB 4BRVA 4ONHB 3T9WA 3VXNA 2GEQA 4DAGH 1PBYA 1EGJA 1ZY9A 2QELA 3BPNB 5KANG 5JQHC 2MFNA 1G7JA 4UOW1 4ZMXA 3GLAA 4N0YL 4AOFA 1IAOB 4AYMC 3L3HB 3MV8A 4Q97A 2EDRA 3PYCA 4OGZA 3A3YB 1SDDA 3O6KL 3E8UH 4JFPB 4NNPH 1C8QA 1N0LB 2EDNA 5HVHC 4Y5YB 4UV7H 1OAJA 2HX8A 3EOYG 2Y36H 1CD8A 1QMUA 4P46A 3NT0A 2YGVA 5EOCJ 2XPGA 1FBIH 3Q7JA 4KRPD 2WZPA 4PD4K 1G0DA 2N7AA 1UA6H 2OZ4H 1K4DB 2J56A 5EU6E 2Q86A 5JTWA 3TA3A 4MDJB 2EXTA 3BUBA 4K94L 1DVSA 5LN4A 3QIWB 4DQOL 4LRNL 3C5ZB 3ABZA 5F7LB 1E4KC 5SWQB 3LNEA 3BISA 5GISH 3F7VB 4Y4FB 4MQXC 2VLKD 1IO4C 2VW4A 2VN3A 1CVRA 1CICD 3GB7B 5AKVA 3U4BL 1D2PA 1HIMH 3BKYL 1ZSDB 2FHBA 1VSCA 2B5IC 3BT2L 3AUWB 4L8DA 5DQDH 5T1JA 3EO0A 4J6IA 1UWEL 1CFQB 4Z7OE 2ESVE 3RWCB 2FK9A 2R0ZL 1TU2A 1Q1JH 2P5WE 3V6OE 1ET8A 1FFTB 4YBQC 2FHCA 4NENA 3GPSA 2VDMB 2XFXA 4Z77A 3TT1H 3L9YA 3ZHDA 3GUTA 2BNRE 1YEIH 1XGRA 3PWLA 2VDOH 3QORA 4K7FB 4WUKL 5D4QA 3OD3A 2FSEA 3AS0A 3HIZA 5ALCH 4G6JH 4HPHA 2YBRA 5IMKA 4GKSA 3TTYA 3A0OA 2H32H 5DGRA 2NW3B 4ONOA 4MA3A 1KZYA 5EU3A 3WO4B 3CAFA 1T7YA 3ETBJ 1ZS8B 1EPFA 4U4BA 2W0FB 4IMKC 2W07A 3NJMA 5D1ZB 3NH7H 1DJIA 1PEWA 4CSSA 4RDQF 3RL1A 3RP1A 3FSOA 3MZGB 4LCCC 4QHNB 4UNIA 3QIWD 2EZ0C 3D30A 2EADA 4ES9A 1T1WA 4KO5A 3C5ZD 4JQIH 4UOQA 3BP6B 3CFTA 2R69L 4FFVD 1BV8A 3K4AA 4QRRE 1NGZA 3MGTB 5E5UB 2ZYIA 1E90A 4OZGA 4KXZH 3B1TA 1ASOA 4EN3C 3H9SB 4XI5C 3GTNA 2CA3A 3ZN6A 4EE2A 3MRFA 4IBWA 4XCNA 4PS3A 3LEYH 2H0EA 3I50H 5DU7A 3CGTA 3GSNA 1MDAA 3QEQE 4YHKH 1ORQB 3EOTL 4OCSH 1DBBL 5EEYA 1HXMB 1CT8B 5D70H 4KV5E 5IBLC 3KGTA 3U0WH 4K5NA 2OL3L 2ITCB 5B8CB 4NLHA 1HZHH 3FB7A 3TH4T 2YK1L 3V4PA 3BP5A 4EXPX 3WS3A 1XSJA 1PZ3A 4R90L 4FULA 3HN8A 1AFVL 4BKLB 2AXHA 1FZJB 4NO2A 1AE6L 3O6FD 2KH2B 5J9PB 3F6LA 1BZEA 3FNKA 4NQQA 4LLYB 2WOYA 2DKSA 1LGVA 5TFSH 4ZG1A 1FGVL 4IIQC 4I0CC 5GRZA 5I1CL 3B2UC 4G5ZH 4H1LB 1X9LA 4IHOB 1QAWA 1T0MB 3FOMB 3EF4A 1OAUL 3LV3B 5ICUA 4ISVA 4WSGA 2XSKA 4AITA 1OAZL 1EK3A 1B0GB 2WXRA 4IJ3B 2J1ZA 1Y6KR 3X1FA 1BQKA 5GS1A 3QDMA 2DV6A 2J20A 3NCMA 1YYLH 2H2PD 5DHMC 4F8PA 2WMPB 3HG1B 3QHZH 6TAAA 2I5YH 5AAMC 3VFUA 1KTDB 5CXPA 3F7QA 4X6DB 5FO7B 3DYMA 2R83A 4X5LA 3Q5YA 3T8XB 4JY4B 3ZE2B 5F1NB 2QPEB 5LWYL 3QCUH 4BZ2A 2WLHA 4ZTPL 3IFNH 1EHKB 1IEBB 3TNMB 1FZOB 1VEMA 3JVFC 4AKPA 3N0AA 3QCVH 3SGEI 5ID0B 5FCUH 3OGCA 1WFIA 3LQZB 4POUB 3UO8B 4EUPG 5LGYA 4ODTH 4PJCE 4F57L 1UG9A 5KJ7E 1YQVL 2JH2A 3S3BB 4TSBL 3DV4B 1P4IH 2KI6A 1PDKA 3BZ4A 4YC2C 2DQJH 1S7RA 4ABUA 3GRGA 3HC4L 4FQPA 4IQHA 1BPLB 1A21A 1S7UA 2WO2B 1D9KC 1Z1WA 2HH0L 3VFNB 1PQZA 2GI0A 2HLFD 1VDGA 3BIAX 3CC5B 3MFFB 4Z8FL 3JUZA 3GS4A 2OR9L 5CINH 5L2JA 2EDWA 4QRPA 4L0ZA 4XPAL 2IGFL 5JPMB 4IU3A 5CD3B 3QQ9D 3P0VL 3BZEA 4JANA 3FCSB 3J07A 5EBLA 3LRSA 1JZ2A 1E4WL 5F7DA 3RY4A 1V3KA 3GBLA 1NFDA 3VWJB 1BFTA 2WCPA 5ACZA 3CXDL 3IU4L 3RPIB 4ZX6A 4OGQC 4I9XA 1RJZB 4YDKH 2IC2A 1EO8L 1NDMB 2WXIA 1EMTH 1MCNA 3IMWA 4G42B 4P49A 1OCCB 3NJIA 1WGVA 1HZLA 1QO3A 3VI4B 4KK8D 3BVTA 1VFOA 4N8VA 2EYTA 3VD7A 2QGCA 1VKXB 4XRCA 2NY2B 4I3RH 2ZP9A 5JHLH 3OXSA 5AG9A 1RJYA 2RHEA 4IS6B 2H3NB 2EH8H 3ZZLA 3CK0L 3D05A 4WIQA 1F6AA 4YXHL 4ZTOL 3GSRA 4TVPL 3IDNB 5JIQA 3KJ4B 3KL5A 2E76C 5CEZL 3SBRA 4NT6A 1R3LB 1OLLA 2EC9T 1B0RA 2CQVA 4MZ3A 2JIXB 2HFGL 2WXOA 4L1HA 3U6RB 2PLTA 2XWJB 4AC4A 2KQNA 4PV8B 2V37A 2NY0C 1B4JL 1I4FB 3WLBB 1OLZA 2YGOA 1L9TA 5GXBB 1E6JL 1RUAH 1RZKL 1F3DH 3AY4C 4PRPA 1C16A 1FZKA 2B1AL 1AIFB 1QLFA 1BZ7B 3BWAB 3KPRE 3LZNA 2GEEA 3UZQB 1A6UL 5EN2B 1QBML 5GZND 1T2QL 3VWJD 2X9XA 1L0PA 4NWUL 1IAIH 2Q6WA 4JE4B 1RJCA 3EGDB 1SMDA 4UT7L 4BZ2H 3HR6A 1MIML 1CE1L 2OTWA 4OZGF 1NM9A 2DWEB 5BJTA 3RZCC 4BCZA 4OLWH 1U8OA 2X0UA 2FT6A 1GGYA 2R29A 4NQEB 2N59A 5AYUH 3WIFB 5F7NC 1IEAA 1PIFA 1U3HB 3VJ6A 1BXXA 1G4RA 1H8LA 1O7SA 2SEBA 3AQDA 3OXRA 4L8BA 4NZUL 2X1WL 1SOXA 4JUSA 5J1AA 5IFAH 3U0PB 2JSFA 5F8QC 4ZUVB 4KJPD 2NNRA 1KMGA 3ZK0A 4KKBC 3FO9B 4RX4D 1NEZB 4X5RA 5D1ZI 1TITA 3DV6A 2A6DA 3T09A 3X1NA 3AXHA 3NYKA 4L48A 2IALB 5F96H 3WY2A 3JTSA 1S7VA 1BF5A 3RVUC 1NAMH 5KVGE 3US1A 4HMCA 3VWKC 3WFBL 1WBYA 1JUFA 5D7LA 5T1DH 4N0CC 2YBGA 5KS9A 2F5AL 3QRLA 4HUXA 5T1KB 3CFCL 4OM0H 4DGVH 1BEYL 4OF6A 4RA0C 2YQ3A 1E3ZA 3FQTA 1FN4B 1U36A 4FFZH 4RAUB 3LXBA 2LTQC 3CZFB 1K8DB 3NJJA 1U42A 5KBDA 1KCUH 1NLDH 3CSGA 4Z7AA 5K1JA 3ZYOA 2FX9H 4N2IA 4I7ZC 3MNMA 4KHXL 2O5ZH 1GYCA 1FL5A 3TH2T 3D06A 3QJOA 3MUGA 1S6NA 5EZOL 4NNXA 4UBDD 2BVTA 1FFNB 3UEZA 1F11B 2Q8BH 1CFVH 4ODWB 2PXYD 4MSWA 4BXVA 1W9XA 4Z7QF 4LU5H 4J5VA 4PGDB 5CZXD 1INDH 1FAKT 4XPFH 5MENB 3D2TA 4FFWC 3GMRB 3DTXA 3IT8D 3VXME 4FG6C 2CDEA 4AJVA 1M6OB 1HHHA 1FJ1B 5IQ7L 4ZUTA 4TUKH 3HKFA 4O02H 4PJIB 3K6FA 5IJCC 1AP2A 1Q0XH 2PTUA 4X7TA 1QD0A 2J55A 3KVPA 5B1KA 2FCBA 3EYSL 3ZW3A 3RI5F 5JLZA 1E50A 3ZBMA 3TBTA 4RVBA 2BS71 4OF3A 5HP5A 1BCIA 1P84K 3N6YA 1YNLL 1FE8H 5FB8B 2VUOA 1LMKA 2ICWA 3AT8A 3D2UA 2BP3A 1AS7A 3P4NA 1J9QA 4QTIL 1GKEA 4GIAA 1OF2A 3VXSE 3CFBB 4NFDA 5HDRA 3SGJC 3K4ZA 4PJ8C 3EJSA 3Q01A 4OIIL 1NFDF 3BH8A 3T04D 5IIEA 4A67A 1J5HA 3ERXA 4R5VA 1OGTB 1TEGA 5TH2B 2CIIB 2BNQD 2Y6SC 4HS3B 4JFEB 2R29H 4U1LA 4HIIA 4QGYA 5T33L 1NCCL 2NNCA 2NXZB 3C87A 4OH2A 5FF6B 5JHDA 1U92A 1HKLL 3TPUB 4GRLD 1T89A 1UJ3C 3D5OF 3FPXA 3EYFA 4QNPF 1MF2L 1X44A 4IOFC 1UHVA 4LPTA 3O3UN 4KJWD 4PTUB 1X7SA 4D9LL 2A4EA 4GBXA 5C0GB 4RMQA 4NS0A 3LS4H 1NC2B 4JZJB 3D85A 4UT6A 3RDTC 2FRGP 2IAMA 2IH9A 4P59H 1UH4A 5MEND 2YC1B 4B9YA 3FUNA 3WIAA 5AL8A 3O0LA 4XMPL 3D7PA 3DVGB 3MA7B 5JOFA 3UG4A 3OKNA 3S5ZA 4KK6C 5IGXL 2JFCA 5HHOE 3NIGF 1SRDA 4KI5D 5C86A 2DJMA 1NBQA 1RJLA 4Q52A 4ZMLA 3LXUX 4A7QA 4UZSA 1B2WL 3SDAC 1A3ZA 5ISZE 2QFRA 1MVYA 1TOXA 4YVNA 5HHMB 3CN2A 4LLQB 1B6DA 3QQ4B 4OZHF 3SKOB 1YYMH 2FD6L 4HJTA 3GO1L 4DN3L 1FYTA 2MOQA 5FIEA 3WDJA 5J12B 2TSBA 4M6OH 2IBBA 3L5WA 3GMMB 5F88B 1HE8A 12E8H 1Q9OB 3ESVF 4PHZA 5TF0A 2HMID 4ZDHA 3ZRCC 1HN1A 2XIDA 4J3WA 2K78A 4MD4A 1YNTA 2P47B 1S9YA 4IOSA 1XX9C 1NEUA 4HUUB 1L6PA 4JFED 1DQIA 2CNZA 4WO0A 5DHXB 3SJVB 1M7IB 2NXZD 3ZKND 3QHFH 4HKXB 4G9FD 4GO6B 4FDWA 2MIZA 3CXHK 1EEYB 1R1CA 2NUPB 4LEXL 4XVSL 4IU2B 3TV3L 4FJYA 1QYGH 2O5XL 4DKFL 1YEKH 1Y18B 5HYJB 4OJEH 2A83B 4NZRH 4UQ3A 1QR1A 3TBVA 1NCAH 3RL2B 1F58L 2ZOLB 5EWIH 2CZNA 4MAUH 3NAAL 3L4YA 5T3XE 2WUBH 3B5TA 2WGNB 1XSOA 1OQXA 4OT1L 3STLA 4U6XA 4DVBB 2MOGA 4GI9A 5HYSB 5I1LA 1QBLH 4L1DA 4F58L 1MW3A 1RUKL 2R0WH 3EYQC 3LDBC 4A7TA 4WHTA 4JDTL 4NCDA 1KG0B 1ORSA 3LY6A 2X6VA 5C08A 1U8MA 3F2LA 3QEHB 3NJKA 1PLBA 4N25A 1NCBL 1RK1A 4M62L 5KS9F 4XXCA 4L0YA 1H6UA 1KTLA 3SODB 4BH7A 2ZX5A 4UAOB 2WBXA 3SPCA 3U9UA 1IC7H 1MG3C 4PS4H 3SDDA 4NO3A 1YPZB 1P6AB 3CH8A 3U4EA 3B9KD 4LSSH 4NRYA 1YUHB 1WRFA 1KNOA 1INEL 3NQIA 4H8QA 4FCHA 3RWGA 1QRNE 1PIGA 3N44B 5ETUA 1KXQE 5DMYA 2AXGA 2E6QA 2B20A 3EBGA 4HJUA 4F7TB 4LCYA 3QDGD 3D39D 4UT6H 3TC9A 4BWTA 5I8CB 4Y1AA 2B3RA 2GT9A 5FO8B 1G9ML 3S7GA 4O2FA 4MQ7B 1BZ8A 1YDPA 1C7TA 4Y8DC 4CN6A 4GLRH 2I9LB 1HI6B 5KJ4A 5A6MA 4GS7C 3DX6A 2RMNA 2K70A 1X9RA 2EYRA 4XTRC 5I5MA 3VRJA 1NBVH 4U7SA 5E08L 3BKMH 3A21A 1ONQB 5KTEL 4UDTA 4H5SB 3ULUD 5IEKB 1MI5D 1SXAA 2QHRH 2VZTA 2WGXA 3OB0H 3OAZK 1YN7A 1HH6B 2XJKA 4H1LH 3TCLB 1KB5A 4I3SL 5EC1A 1JZ3A 3ZE0E 2YMXL 1EDHA 3NJHA 2JNZA 3KYOA 3G5XA 4OZFA 5E5MA 3S5LG 3UAJC 2BCKA 2ARJA 5E94B 1OM9A 5F6IB 4YDIL 1A1MB 3CSBA 1JNNL 5IHLB 4XCEB 3HFFA 2IBZX 5GRVK 2ZSWB 1CR9H 3UPRB 1BFOB 1CL7L 1CQKA 2HFTA 4PGCB 1KTCA 3IU3B 3Q05A 2JXMA 2Q76A 3ZMRA 4UINH 4WWKB 1TCRB 3QG7H 2QR0A 4TSCH 5AB9A 3DI3B 1RK7A 4S11A 3VSVA 1KIQA 1I3GH 5JQ6L 3EOAA 3AQYA 3LKOB 5D7IB 5ID1A 2NSQA 1AHMA 3GXUB 5KJRL 3DIFB 2J2ZB 4NJAH 3F7RA 1J1OH 3U83A 1GIGH 4N68A 1UURA 3Q8EA 5DMGD 4I0PA 2VGLM 3DUUB 5AUMA 1MQ8A 5FUOL 4BDVB 4DHLA 4HIEA 2H6UA 3TURA 4WVRA 2DQGL 4AYFA 2N0MA 2WWNA 4HQQL 5FDWA 3WS6C 4JR9L 3MGOB 3VU2A 1ZIAA 4DETA 4JAMA 2FEDC 4HIJA 3W9EA 3IVKA 4A37A 4KK9D 2CKBB 3G5VA 3GHEH 3LHPL 1SHSA 3O8XC 2X70B 4MS6A 2NYKA 2DM2A 2IQAA 4QXTA 3OKMB 2CMRL 4KAQL 4XHJC 4BM7A 3SDCB 1L3WA 1CFNB 2B3IA 4PY7B 1TR7A 3NPZB 4K94C 4TUUA 3CV5A 4I2XE 2P8LA 1LILA 3HMXA 4FOMA 5AD0A 2Q8AL 5JW3L 1UM4H 3L3IA 4YE4H 4GUOA 2WNWA 1MHHB 1YNTF 2FJHA 1TJIL 1UOWA 4XMVA 4X8JB 3MV9B 4HJJH 1FFOA 2DQTL 3KHOA 2CXGA 4Q2ZB 1C12B 4X6DF 1ZV2A 3N85H 2A9AA 2H9GA 3ZE2F 1ETJA 3VXTB 3GMNA 3ETSA 1G1CA 1RZFH 2B9BA 4LF3A 3WIIL 5BQ7A 2V7NA 1EANA 3OLEA 4F8QA 5E6YA 1FH2A 4MMYA 3KBEA 4P4KC 2BSCA 4P2OD 5KBMA 3K1KC 5JQIB 2FJFA 1VFAA 3L4UA 3QGVA 5FKAA 3U30C 2J71A 2VISB 1ZT7A 1URLA 1ET7A 1FNLA 2HRGA 4WUUE 4BQBA 2BSTA 4LSVH 5IFJA 5CSZB 3OR7A 2IEPA 4P5MB 2WXQA 1QI5A 4LASL 4BSVA 4X80H 5HDQH 4QT5A 4POZC 4DOHB 3IXAB 5BS0B 2A6JB 4G3YL 1P7QB 3F3HA 3R4RA 4OZFH 1Q90A 4ZZFA 2NX5E 4GSXA 4NNYA 1IM3D 5C0DB 3QPXH 5IW6B 5DD0L 3QH3A 4MCMA 5D9SA 2Y1ZA 4JGMA 4CKVX 3UH8A 2A1WH 4JFFE 3VD3A 3GSQA 1AC0A 3D87B 5L2KB 3SDCD 3FYIB 3FU6A 1DFBL 5HY9B 4PQXA 2EC8A 2H45A 4HEPA 3TO4B 2RQEA 3W3BA 1AYRA 2PR4H 4PJDA 5I19H 1FL6B 3WEMA 1XV8A 1CD1A 3QG6B 4KKCC 5KVDH 3SD5A 2OYPA 1U3JA 1UKTA 2Z34A 2I07B 5CHNB 3WNNA 3K74B 4FQ1L 4Y9CA 3VI4F 1R3IH 3NJGA 1FFPA 1UWYA 3UTSA 5I0ZA 5TDPA 2XWTA 3SE4A 1NCTA 3T0AA 1WJ3A 5L88H 3VM7A 4QRAA 5I1GH 1LNUA 4ZFQA 5LQBL 4WV1B 4I77H 2B1HH 4NKIH 4FLRA 3W1ZA 2ZAHA 1L7IL 5J11B 2EYSB 1KTRL 2GK2A 4Z7IA 2ZX6A 3HZYB 3MJ7B 1P7BA 3ARBB 3QAZB 4KMTL 3LQAH 5BS0D 1XIWD 4RGND 5E8NB 3TF4A 3TBSB 2YPLA 1U8JB 1P7QD 3CDCA 1HVXA 4P5TC 3TBWB 3FCTA 3RWHA 4EBQL 3MBED 2BWDA 5DEGB 5DUBA 5HVFB 1K5NB 1ZLDA 2R23A 1OTSC 1T1ZA 2YPKA 3MRCA 3EJYD 3P2DA 4UDUA 4YDNA 4FQXC 1LO4L 3VQLA 1J05B 3T1FA 4OFIA 5HGDB 1G1KA 4HPOH 1AQ8A 5G4MA 3NN8B 5ESAB 2UZIH 4E9SA 1SMOA 3ENEA 4U3XA 2F08A 3HFMH 4DAGL 3TO4D 1T7VA 4PY8J 1CDYA 2QMKA 1UQSA 1JD9A 2VZUA 4GAFB 5E2TH 1I7UB 2AJUL 4NNPL 4XZUA 1S7QB 3E8UL 3G5ZB 4H8HA 1XSKA 3CBKB 5I23A 3BZFA 4PYHA 4XGZA 4UV7L 5GS0D 3P0GB 3DGDA 3DUHA 2Y36L 1YEWA 5CIPA 1MZYA 3PDOA 3B2MA 4B9IA 5K9QG 3JV0A 2UZPA 1NANH 3KYKH 1FBIL 1AGBA 4URTB 1UA6L 3UC0H 2OZ4L 4PB0H 1Z3GH 3FF8A 3LKQB 4H8WH 2DQIL 4HALA 4QHUB 5F3BB 2OX5A 4BYHA 5IV2A 2ICEA 2Y7LA 3NMEA 1VGKB 1G7HB 3EBAA 2QKSA 4P2CG 2OAAA 2QMJA 4YZFE 1KJVB 3MREA 4FQQA 1VGEH 2O72A 1AD9B 5GISL 3WJLA 2ZKWA 3DSFH 1V10A 2UVEA 4OZIE 4J3OD 4MXQD 4NBYB 5D7JA 3RNQB 3UTPE 4D7PA 4TLSA 3PLYA 4M61B 4ACPA 5A3IC 1HIML 3EFOA 1FDLH 5F70A 4ZFOB 3CTTA 2BSSB 3N1QC 3NPSB 3IXTB 1UOVA 4WJ5B 1B0IA 3U25A 4D0DA 2EJ1A 1N8ZB 1XD1A 5DEFA 3VI3E 3BOVA 4CGTA 1Q1JL 1MRFH 3MO1A 4HKJA 3AROA 5JPNC 3OKEB 1IL1A 3QUZA 4BFGA 3IB4A 4NM8H 3QCTH 4P23D 3GQFA 3TT1L 3ESMA 5J6GB 1YEIL 2VB5A 2VDOL 3M86A 1EVTC 5L4FA 5DZOA 2ODHA 4Y2DC 2XY1A 3HVNA 3SBWC 3KCPA 4CN4A 5ALCL 5TDNA 4G6JL 8FABA 4C59B 2C34A 2EUWA 1L7TH 2H1XA 1ES0A 2XTJC 2GY5A 3ZL2A 4PJIF 1E5YA 3C5JB 4G82A 1J9RA 4LBEA 4CBPA 4JO5A 3NH7L 2EE0A 4X6EB 1UEYA 2HVKA 5IB4B 5IW1B 2XTJE 4TVPE 2Q2LA 2V8MA 4QTFA 1O7VA 1FH5L 4HK0B 4YUEL 5CEZE 2J25A 2ZUWA 4JQIL 4NCC1 4PCSA 2K8QA 4R4FH 1BX2B 1T83A 4IBVA 1H0DA 4GT7A 4PRHB 3N42B 2A0LC 4K2UH 1GJWA 2GSGA 3G04A 3KNBA 2E7HA 2EXWD 3K6SA 3ZKMD 1OTTC 1RZKC 5F1IA 5G5DB 4BKSC 2ZG1A 2NUTB 3H4FA 3N40P 5I8EA 1PZSA 5F71A 2XA3A 2YAEA 4JFTA 3LEYL 3TN0A 3FSVA 3I50L 1JJUA 4YHKL 3HN5A 4OCSL 3AC0A 4PJDF 5DRWB 4F80A 2OW6A 5D70L 3IKKA 4E0RA 3U0WL 4GKZA 4JFWA 3D25B 2Z4QA 5DK0A 3CX5J 3BAYA 2KPWA 4MKMA 4AIXA 1HZHL 3DO7B 5KBPA 1X4ZA 2V5MA 4K3EL 3RFZA 1SEBA 3NZ8B 1LXMA 4YHIA 5AZ2H 5BZWA 3AADB 1JCVA 5AVSB 5BNXD 2VH5H 2VUKA 1PX8A 3FQNA 3N50A 3IDMA 5TFSL 3ZZ1A 3IBOA 4CW1A 1AKJB 9PCYA 3BDYL 1RZ8A 4HDIA 1MCHA 1O9ZA 2WIIA 2X38A 4G5ZL 1J87A 2FL5B 3BSHA 2WWOA 3UC2A 4AUJA 5IR1A 2FIRT 4G7SB 4AWJC 3HC2A 4R7XA 4FG2A 1EBPA 3QA3B 5HGAB 3BKCH 3O41A 4TQHA 5DUJA 3LB6C 5M7QA 4LFHD 4HIHB 1LO5A 4Z7VB 5C0BD 5CNHA 4KBPA 1KPVA 4Z7WE 4XAWH 3VDCA 2R7EB 1A64A 2ATPB 1R3HB 3DMMC 2ZOOA 3L2NA 3QHZL 4KKQA 2I5YL 5CZRA 4UNVA 4D0CA 3P11L 3VFMA 1ROCA 4PIRF 1T1XB 2FIKA 2Y7MA 5I30H 3QCUL 4FLHA 3GMOB 2OMVA 4XNZC 2CIKA 5C0CB 2PPAA 4KX9A 4QJ4B 2FQDA 4GKOA 1KF9B 3V8OA 1G7IA 5DS8B 3QCVL 2HTLC 5FCUL 3AT0A 4PLJC 5FGBC 3V5KA 4ODTL 3SGKA 5E23A 1IBZA 2AW2A 4G80A 5L0QB 4G8AC 1P4IL 5B1AB 4KGJA 3Q43A 2K3TA 3CHQA 2DQJL 2EVIA 4JPIA 3GZOA 4JVUA 1ZVSA 1F8TH 5L6YH 1Q9KB 5E00A 4QRUA 2WQ8A 4ZO8A 2F53E 4PJ9B 3WFZA 3APCA 2AVGA 1HHKB 3T0EA 4LLWA 5GGUA 5CBAB 1D6EB 4F9LC 4Z7UA 5CINL 4N5ED 3G6DL 1ZLWK 4B97A 2AK4B 1AKJD 1X4YA 1S46A 2C3VA 2Y5EA 4UOJA 35C8H 4DH2A 1LP9A 4V1DB 1OAYH 2R9HC 1BQHB 3LRKA 5JW4N 4TTDC 2BM3A 3P2TA 5A2CA 4ES8A 3CZUB 2GIYA 3MRPA 4ZX4A 2C9PA 1OGAB 2N7BA 3IJEB 3O2WL 4X6CB 3SHSA 4LLAA 4YDKL 3FH7A 1EMTL 5DD6A 1RZGB 5DRXB 2BWIA 3EHBC 4N2LA 5T5NG 4F2FA 4NYLB 4TLTA 5JHLL 2OSYA 1NFAA 3VE0B 1CBJA 1WFMA 3WTVA 3QPKA 1WIPA 3NA4A 2EH8L 1YPZF 4U2ZA 3BAXA 4G43B 5F2FA 3RVTC 2KS0A 5D1XA 1J0YA 1LEKA 1ZHBA 3N44F 4GAJH 1FZMA 2COVD 4K0OA 1FL3B 4UM8B 3NFSL 1UZ8A 2LVEA 3JVGA 5CJQH 3KCWA 4IIZA 5BXFB 3VGAC 2DBLH 2R4SH 2XCMC 2JELH 2NYYD 1ZA6B 2FWSA 3KEHA 3IDIA 3O3AB 4YSSA 4KU1A 4ODUA 3WMPA 2BP8A 4HCFA 1H3VA 3DOIA 1OP5K 2JI3A 5IT2H 2X3AA 5A40E 2E27H 1I9RH 3VH8A 1WP6A 2BERA 1RFDH 1RUAL 1JWUA 4XXDB 2AK4D 3HN3A 2VR7A 4AMXA 4V1DD 2CKBH 4PW9A 3LEVH 2C9AA 5C0EB 1JGVL 1SJEB 3F12A 4P2RB 3ZE1B 1GCFA 1CBVH 2X9WA 1IAIL 2JB6B 4I48B 1REIA 2D2OA 2P9RA 4X9YA 5DHVB 4BZ2L 2UWEE 5J1TC 1RK0B 4PRIB 1E3XA 2O5YH 2QVIA 5C0RL 2P52A 3SY6A 5E8PB 4KDTC 5FFOA 5AYUL 3FU3A 4U31A 1BLNA 1OCWH 5HYEA 3OWEA 1L5GB 1WS8A 4AQ8C 2ZXCA 4Y4HA 2XC8A 3FTGA 2Z31C 3ZKSD 4H25A 4XNMB 5IFAL 4QO1A 3FHQA 4ZODA 3H6AA 4PJGA 3MJGX 3T3ME 1DL7H 4F91B 2BY2A 5F1KC 2FO1A 5CJXA 5GPRA 1W16A 4LKXA 1DCEA 3BXNA 1JZJA 1IIKA 2R2EB 4D7BA 3RWFB 4DSYA 3SE9H 4RMWA 5B38B 4EI5C 4ZZKA 2LV4A 2YD0A 5IROD 1AH1A 5DHDA 1LK3H 5BOZG 2FBJH 5CGYD 5F96L 2H6OA 2HZHA 3KS0H 2OPCA 5EZLA 4APQB 4NZDA 3N91A 1JHTA 1NAML 3K72B 4G71B 4JM2A 1BD2B 5K9OA 2G9HA 5T1DL 3IGKA 5FYLH 4TULH 5DJ0A 1UWFA 3MGAA 2GJ6A 4YBHA 4JO3H 4OM0L 4DGVL 4ZSOA 1P5UA 1CTMA 2VJ8A 1KY7A 4OVUA 1GJUA 3RVVD 4F2ME 1MWAB 1NH6A 4FFZL 3LD8B 4Y2OB 5LGJB 1OTUC 3KYNA 1KCUL 1NLDL 4IBZA 4JHWH 3FU9A 4ZS6C 2FX9L 2R8SL 3LN5B 4U1GB 2O5ZL 4Y19D 3ZDZE 4KDWA 3ELQA 2W9LA 1GY2A 4JREC 4FYRA 4R2GB 4RMBA 4E42A 3C60A 1CFVL 2IDCA 5DJ8B 2FB4H 5HHPA 3JT0A 2UXGA 4LU5L 5IBTL 4JY5L 2OMTB 1INDL 4XPFL 5IZ7A 4YL4A 3QUMB 2E7LA 1ULVA 3HBQA 5DVMA 1JRHI 5DJZB 3LVTA 3EOBB 5DTFA 5F3HB 3RAJH 4TUKL 3DROA 2CO2A 5EBWB 1Q0XL 1R24B 1DJHA 4UQ9A 4PVLA 2I26N 4RMVA 4JHZA 4K7PY 1H9DA 3EYOA 4Y4KD 4X7DC 4YLCA 3I6KA 1G9MC 4GJTB 3DX1A 1FE8L 4NQUA 4F37K 3LH9A 4APQD 4HH9B 2EO1A 1Q0YH 1NUGA 4GQZA 2D2CC 3HRZA 1P84J 4OCXH 4ZFZB 2ADJB 1U8KB 2HSIA 4Z0XB 3HAEA 2X4NA 3P77A 5C09B 4EDXB 5KANI 5HSFA 1WPCA 1I1AD 4KTEH 5EO9B 1YMME 1PL3A 3HLAA 4R3SB 4CVWA 2IXQB 4D9QE 2GCYB 3MUY1 4D0BB 4OLZH 4ZYKB 2RCSH 2R29L 2RB8A 5MEQB 2UZYB 4LSDA 4IBUA 5HHNB 3D18A 4Y88A 1MKFA 2C1PB 2FYYB 2VMFA 3U1PA 2H6PA 3OQ3B 5HD8C 3DBXA 4PPTA 3OWRA 1EIBA 3TEZA 2JJWA 3EFDH 3LS4L 1KTBA 4NZJA 3SB3A 4NIYE 2JQZA 2APXA 4P59L 3SE3C 2DLTA 5E1HB 1WA2X 2YEZB 3FW6A 4HIQA 1R3JB 2VAAA 4I9WE 1A6WH 3QULB 2J7LA 5IY5B 4DO4A 3EJUA 2FATH 1HINH 4PFEA 5J6HB 1SEQH 3BGFC 4E68A 1RUMH 2QZQA 4ZNCD 1JPFB 3KBFA 4ZAKB 3FHAA 3ILQD 4FJ6A 1OD9A 3F7YB 2A77H 4RQQB 4WJG3 3V0JA 1AVAA 5CF3A 1ADQA 5D72H 4LDOB 3U7AA 1JV5A 4HUWB 3WEAA 1HAWA 1I75A 3KMDA 3FH8A 4ODHH 4HV8A 3MNZB 4HWUA 5GS2D 5DRZA 1YYML 3TNNB 5FYKD 2B0SH 3MYJB 4W9DC 4M6OL 4A39A 2BOLA 2DWSA 12E8L 2QV2A 4MCZA 1A14H 5C09D 4QHMA 3FONA 5EUKB 2JKXA 5HI4D 1FO0B 3GXNA 5ICZA 1P69B 3KPOA 3WHXA 2ZOWA 4MNHA 4HCRH 2YN5A 5B7FA 1INQB 5KYUA 1BLIA 3S2AA 5LG1A 5KSAA 4HGWB 2F74B 2B59A 2H8PA 4L29A 2HX9A 3QHFL 2HT2C 4YHPB 1S8DB 2NT0A 2CLZA 2WBJC 1HEJC 4ZUSB 3VX0A 2YKKA 4R4BB 2P4AB 2QGDA 3GJFA 4MMZC 2QL1A 2VL5B 5DZJA 4G8FA 1KXVA 1YEKL 3VFWA 3MUHL 4NZRL 1CYWA 3CSYB 4K5LA 2XYBA 4TNFA 1GS8A 3CXHJ 4XE0A 3UOAB 3LN9A 1NCAL 2JJVA 4RNRA 5FYJD 4ELMB 1PZ5A 4FNTA 4JK0D 3MBWA 4MAUL 1TJGH 4TPRL 4PJGF 4U1MA 3O9WB 4J3UA 2GAZA 2WUBL 1I8LA 5E9DB 4IRJD 3MV7A 4IEFA 3H3KA 3QZWB 1IQDA 3VDAA 1PKOA 5ACLA 3QFDB 1QBLL 2CLVB 4YR6B 4MQSB 2AXFA 1M56B 2R0WL 4FZ8H 1D2OA 2YA1A 5BV7B 1CO1A 4LSTL 2J4WH 3F83A 4ZAKD 2F58H 4TRPH 5EF0A 4PSRA 4AEHH 1OP9A 1MCJA 3KPMA 4WJKB 1YRKA 3AM8C 4PJ5E 2XN9A 1F86A 3DX2A 4LLDB 1ID2A 4IMLA 3M46A 5E24E 1IC7L 2WW8A 3FQXA 4PS4L 4DP6X 4LSSL 4E2OA 1CZ8H 1S5IH 1CLYH 2KLTA 3GSOB 3HJ0A 5AW8B 2ZYSA 2NY4C 2CJUH 2UVFA 2G2NA 4JEGB 4UT6L 3S96B 4Z5RB 3S88H 2WSPA 3JV6A 2BVPB 1W15A 4WO4A 3VD4A 4G8GE 4LSUH 5HVHB 1AQMA 4RAHA 4NZTL 1M7UA 4JVWA 4EPSA 5EU6B 4W9JC 3DOSA 2W9EH 1JPST 4MJ6A 1NBVL 1ED3B 3BKML 2J12B 3Q6GH 3Q6FB 2XETA 3O9WD 1KYOJ 3MJ6A 4FF9A 4N0UE 1TDQA 1IMHC 1HCYA 1JRHH 1WAAA 2XN1A 5D2NC 2D7NA 5E9DD 3V5DB 5CP3H 4C56D 2QHRL 5IMOB 2ITDB 3KPLA 3U7WH 4X4ME 2V5TA 4DZBA 1F5WA 1KFAH 4L9LC 5L7XL 4G1MA 4CC4A 2NR6A 5A2LH 5D2NE 5SV3A 2VDKH 3EKCA 4F3FB 3UL4A 5FC9A 4AGOA 4Z7OB 5C3IA 3AWGA 3HE7C 3P9LB 2GSIB 4RSVA 4OZ4B 2P5WB 4N6QA 2FTAA 5JIHA 4BK5C 2B5IB 1CR9L 2C3WA 4MASA 3ZUNC 1HWWA 2A99A 5FECA 1U8QB 2C9XA 3TTSA 1AD0B 2I7OA 2BNRB 2WD0A 2E75C 4KJQD 2QQNH 5ECGA 5T8IA 2ZOTA 4GPVA 4KK5C 2YLKA 1TYRA 3C08H 3GJFH 4U1JA 3QG7L 4RZCB 4TSCL 1KIPB 4U33A 5ICXA 5C0AB 1I3GL 2VTFA 1KCWA 3GSXA 4KQ3H 5AVTB 3D0VB 4WQOA 1JZ8A 1WBXA 3SY0A 3I3BA 4NJAL 4AM0A 1J1OL 1GIGL 5JXEC 1ZA3B 2FSDA 2CBOA 4WU5B 1H3PH 5EU6D 3HBPA 5JZ7C 1IU1A 2OJZL 4FGMA 2J88L 3SCMB 4UI2A 2F61A 5F7HA 1IBHA 1IBDA 3AGWA 1Z9MA 4RGOH 4FTVA 1J8SA 1B90A 3ATDA 1XF5A 1FNSH 4X5PA 5D1QD 3HZKB 1FG9C 3VAEA 3CFDB 4QRRB 5JDJA 4PP1C 4ZXBD 1I53A 2YSTA 1D5XB 4LCCB 1AS8A 4M5YH 3VG9B 3GHEL 1A6ZA 5E8EB 3T8MA 4DN4H 1CLCA 2KPNA 3L7EA 1I8KB 1PKQE 5I9QC 2ZOKB 3H0TB 1XGQB 1E9QA 4X8XA 3QEQB 2ESVD 4MHHG 4EN3B 2G2RA 2PCFA 5TGBA 1S9KC 2P5WD 3LH2H 3QWRA 4R0LC 2VRKA 4B95C 3IAGC 4XBPB 3RGHA 2JKIS 2ENQA 1UM4L 1CFTA 3P4OA 1ZGLP 3U36B 3M17B 3PRZA 4GYBA 5C71A 3OLIA 2J44A 1L9QA 4RBPK 3N06B 2BNRD 3NFNA 3GM8A 4YBQD 2QVTA 4EUPA 3N85L 2YWYA 1M1SA 3BAWA 2QT6A 3PHSA 4JJ5B 1RZFL 3UYPB 3S4SG 1B4TA 3T2NL 4JMNA 1JZFA 5ECJE 2D4FA 1RVFH 2C7FA 3QJHA 1IGJA 3OSKA 3UG3A 2LQRA 5E6IC 2BY0A 3MMEA 4MAYA 5IHZA 3VTAA 5IVXB 3L3OA 3AREA 2Y2WA 1IAKB 3GXDA 5DQJB 2L4OA 2ZTBA 4IIQB 2IDFA 4J6RH 4LSVL 4NXSA 4CC1A 4FA7B 3ISYA 2P28B 1OP4A 2OJEB 5ELIA 1D7CA 4X80L 5HDQL 3P1VA 4NQTA 1WC7A 5F97E 1RERA 1CC3A 4OCRH 1A4KB 4QRRD 1J5OH 4K8RC 3L4WA 5JOPD 2ZP8A 3QPXL 3CZKA 2IANE 4H88H 2A1WL 2ZIDA 1A7PL 1F4AA 4Q9RH 5HDLA 1QATA 3OQRA 3ZRFC 4HBQA 3QUYC 3V0VB 3UGUA 1J5IA 4UTBH 1HOEA 2CLRA 1C9SA 3QEQD 4LZKA 3K71B 5DHVH 4EN3D 4WWOA 3C8HA 4UQIM 2X4SA 1I8MA 2A38A 3FUMA 5E5LA 4YHLL 2PR4L 5IFHH 2CJTA 5DR5H 5BRZB 1N0XH 3EUUA 4S0SD 4X6CF 4LLMA 3FN3A 3GBNH 4AH2B 4Q14A 5KVDL 1EHAA 3NZHH 4LDCA 3LX9A 3BW9A 1QVOB 5DYFA 1R3IL 3N2JA 4FYTA 4R7DB 2HJLB 4NX0A 2EDMA 5L4JA 3BVXA 3PFUA 3QPQC 3S34L 1VCBC 5L88L 3ABMB 2X53A 4Y5XB 3FZUD 3N55A 5IEHA 4WI8A 4I77L 1NMCC 2B1HL 1U95A 2VLKA 4NKIL 2OK0H 3FT2A 4F7PA 5ICYA 2YMOA 1LEIB 1HXKA 2VQ1B 4P46C 4PP2A 2DLGA 1AZBA 4GFTB 1UZ6F 1ZXKA 3AMLA 3B2UD 2E5EA 3FK3A 3DWTA 1HQRA 1XEDA 3Q2CA 1A7OH 1BQRA 3LQAL 3OV6A 3B7TA 3V0EA 1IKOP 5DZPA 4BFIB 4AVHA 4ZFGH 2A73B 3FAXA 3DIVA 3RBGA 1RMFL 3TA3C 5I17A 2WXGA 3KL0A 2OMXB 2C1OA 3RUGB 1N4XL 1OT4A 3VXUD 1MH5B 4Q9CA 4AZ8B 4HPOL 5CSBA 1PFOA 3LPWA 1X5YA 3LVEA 2UZIL 3U2SA 3EH3B 5JO5A 2RFXA 3FT0A 2Z4TA 3HFML 5GGSA 3B3IA 4HH8A 4EUPH 3H7LA 1U21A 2NTSP 5E2TL 43C9A 1E5ZA 4P5KB 2BNUA 4HIXH 4AQAA 4FQJH 3SKMB 1L9MA 5BUGA 1HC1A 3NACH 5KWYC 1MLCB 1A7BA 1CFMA 4YGVB 2GUOA 3L2MA 5KUKA 1D9KD 4DKTA 5IHBA 4EIGB 4WWID 3UC0L 4PB0L 3KPRB 1Z3GL 4H8WL 2NY0B 3V6FA 1WYJA 2YSSB 1PNCA 2FO4A 1XCQB 2GSMB 4N2AA 5EEVA 3B6SB 1N12A 3J2PA 4OJCA 1VF5C 2UXFA 1I7TB 5EO1B 1E8WA 2CPCA 3BZDA 2EXYC 3DSFL 3L6FB 3QC5X 4JFOB 1KYUA 1HH9B 4AXWB 1UD2A 3AG3B 1HHJB 1UCBL 1EXUA 1SYVA 3U82B 5FM5O 1FDLL 2ZONA 4QOKA 1QHQA 2WN3A 5ESVB 3QO0B 2EO7A 3PV6A 4R7NA 3QRGH 3RZCB 1TQBB 1ZSHA 3DECA 3RVXC 4OI8A 1I3RB 5C6PB 1MRFL 4LQFL 5EBMA 4Y1TA 2VO5A 2IBZY 3B7SA 3O6FA 4P9HH 1PZCA 4WK4B 5DMKB 2AQQA 3EYUH 3DGCR 2VABA 4NM8L 3QCTL 3NGBB 3VFPB 4A7SA 3QRFM 1XO8A 3QZOA 2VITA 4AGQA 1IGMH 3ES6B 2J3SA 3PWUA 4OZGE 5TQ0H 4AGMA 3IETB 4CMMA 4HD5A 5CKGA 4Z95H 4N8CH 4DP1X 2PO6A 3MV01 5C0NC 1L7TL 5FW8A 4JLRA 4JDEA 3BFWA 2E0PA 3P54A 3FQWB 2V2WA 3VWKB 5IMMA 1W72B 4M8UA 3KPRD 4FFTA 5GSVA 1R3KB 4S2SB 2AC0A 4UU9A 5LCVH 3PGFH 4XC1H 4DEPC 4UQ2A 4UM9B 2DL2A 1G6RA 3W57A 1JZ7A 1IFHH 1YN6B 3CUPA 4R4FL 3VFOB 1YMHB 2ARWA 3MRBB 1SLVA 3O11A 3BH9B 4OFQA 2KLRA 2LTQB 1X7QB 2WVVB 4K2UL 5KYXB 1P4UA 2QQQA 3HJEA 3ATFA 3REWB 2ZUXA 1L9PA 2ZKMX 2DQFA 3GM0A 5HJ3B 1FO0H 1A9EA 2NRDA 4QCIA 3VXMB 3IJ7A 1MXGA 1T5KA 5IJKA 2HT4C 2JK5B 3QR2A 1XF1A 4KWUA 4U0QB 1AAJA 4K5MA 5EDXA 2CUIA 5E2UH 1ZRUA 2XT1B 4U3SA 4AYSA 3QDME 1EX0A 1HT6A 2GBUA 3FJTA 1NM4A 1O6SA 1G7MA 1NCDH 1VACA 2EIJB 3QXAB 4LDLB 1XGPB 2ZXQA 4P4RB 5BO1H 1TJHH 3TBYA 5AB2A 3C6LC 1SN0A 3CFUA 2BC4B 3LZQA 5AZ2L 1DO6A 3WUWB 2XQBH 1L9NA 4KKBD 4QYOB 2VH5L 1CD9B 1NGWB 4W9KC 4Z7QE 3ZQXA 4M03A 1QASA 1P1VA 3GZPA 2QGBA 3JV4B 3RGVA 4M29A 4H20H 2ZD0A 2YD6A 4H8VA 3RVUD 1LK2A 2A9DA 4HKBB 4HLZG 4NUMA 1MAJA 3KPTA 1HSBA 3BKCL 3ULVH 4N0CD 4PJ8B 1U58A 3L54A 4LCUB 1EA9C 4WW1B 3EJRA 4UM9D 3T4AA 3A23A 4MWFB 1IKFH 1XL4A 1XAUA 1E8ZA 3KLKA 3QJFA 5IWLA 2HPTA 5JNYA 1ZHKB 4F33B 1ZD6A 4AI7A 4Z78B 5MEPA 3QQDB 1JWSB 1HHGB 2O1AA 5I30L 2Z35B 1MFVA 2YUXA 3BD5A 1UJ3B 2C7UB 4XB8A 1U4EA 3VXMD 1NFDE 2DEXX 2E74C 4LKCB 3R0NA 4OGXH 2VDNH 4XPHH 1UOLA 2W65A 2IH3B 4O58H 4FFWD 4ZQTA 5HHOB 4FG6D 3AB0B 1KXHA 1TVBB 1TETH 5D71H 4FEMA 5LAXA 3VD5A 2X4UA 1I7RB 1F8TL 3M1CA 1UD5A 3OR6A 3UXFA 1RXLA 4X9IA 4ZTEA 4MDIB 4QNPE 4K71C 3HG5A 3MXWH 5B3SB 5ISZB 2X4PA 2BSED 3G5YA 5GZNA 3MLWH 3IF1A 3CFMA 3BQUC 3MVSA 1GOHA 1JI1A 4WI0A 4ELMF 1QX1A 3D3VB 4LK4A 3VXSD 3SDAB 2DZEA 3SOTA 35C8L 1MFBH 3HI5H 4P3DB 4ZW3A 1RU9H 2NTFB 3BAJA 2OXHB 2J57A 3UG5A 4DCQA 3COOA 3WJJA 1BPVA 3T6WA 4W6WB 4TQ8A 4DIXA 3V0IA 3VD9A 1A7RH 3NIGE 1U41A 3H54A 3GXFA 2MCPH 3VVWA 3ULVF 1SUJA 2ED7A 5ANME 1U8LB 2KQMA 1IE4A 2QFPA 3VXRB 1MCEA 2FWOA 1H9VA 3SO3C 2Y6SD 1YECH 2Z0BA 1OGPA 2FJGA 2CM5A 4FKHA 4OZHE 2D7MA 3QZLA 5FYKU 3A22A 4QRSB 1MJUH 3PWVA 2EDEA 1ND0B 2YUVA 3QSKB 4KX7A 1U8PA 3EG9B 3L9EA 5EIIB 1XZ0B 1NCIA 1ZGLA 1AANA 5DK2A 5JDSA 4A6YA 3AITA 3NCCB 1AG6A 4GAJL 4UV4H 3A5VA 2FDBP 1T0OA 3RDTD 4L2LA 4E5XG 3WFHB 1RPUA 2X44D 3CSFA 1UD8A 2QZ5A 1ZHNB 5CJQL 5HHOD 2O6FA 1JDAA 1KBPA 2FLRT 3CDZA 2R4SL 1ZV9A 3KM2A 3L5XH 3X14B 2N1TE 3IGAB 2JELL 2WINB 4KK6D 3T77A 3KW7A 5HPOA 2EEXA 3IJHB 4HIPA 2JB5H 3MRDB 1XEUA 1MN4A 3MLYL 5IT2L 5C0FB 4YO0B 1DANU 3U46B 2E27L 1I9RL 1RFDL 4XH2A 5G4NA 2G4EA 4FMKA 5EU4A 4WDIB 5H2BA 2CKBL 3LEVL 1A22B 2PXYA 5SWSB 3ZDXF 3S5LA 3V4VL 1E40A 1CLOL 4JFYA 1CBVL 3SYPA 4LEEA 1BDYA 3FCGA 3NJNA 5KSVA 2ZT9C 4PBXA 4UMGA 2O5YL 1HOCB 5FKPA 4Z7OF 1M71B 1NFIB 4RRPM 5MP6H 3LPOA 3NJFA 3NJVA 1OCWL 5KS9E 4AJWA 1MFEH 4N0FB 2FGWH 1CI3M 5CD5C 3ZYIA 1BJ8A 4AE1A 3AFLA 5CU5A 3UAFA 4ADJA 4L8CA 4HETA 3OKDB 5FK9A 4PN6A 2G60L 5T3XD 1GCYA 4GS7B 1DL7L 3ARPA 3VGFA 3N1MC 2X10A 3MLUH 3F84A 5BMFH 3RLSA 1MRCH 4XO9A 1JGIA 1UKSA 5EUOB 4TUJA 2J1WA 5GRJL 3DX7A 3ZE0B 3TWYA 1KY6A 1LK3L 1K72A 1DDHB 2FBJL 4PEEA 2XV3A 2Z8SA 2ICES 2LFEA 2HFFA 2BNQA 1WWBX 1P6FA 3TL5A 1WSST 3EYQD 4LVHB 2MNWA 3MUUA 4HCIA 5ADOH 3FT4A 2K0RA 4GUPA 4GRLA 4JO3L 43CAB 2R2BB 2AKRB 1OPOA 2Z0UA 4EKXA 1QUPA 1RSYA 1BREA 1A4BA 1QRND 4JHWL 4YHYB 4NFBA 4X6FA 5D1ZC 3DGGB 3H2QA 2OMBA 3DRTA 3N9GH 1VCAA 5D6CA 2EVFA 1U33A 4XX1E 3WEXA 1E30A 2BP5M 1XGZA 2R15A 1CDJA 1X6LA 1T1YA 2EDTA 3S36H 2FB4L 1YEDA 3FXIC 4UYPA 3W9DA 5BRPA 4YPGB 1TTUA 3UAAA 3V9EA 2G3NA 1N5AA 4PG9A 5T1MA 3ZDYB 3AS3A 3LTVA 4HUCA 1Z3RA 3MJ9A 2YARA 4EDWH 1HXYA 2D3JA 2W1NA 2D4DA 2WNKA 1SM3H 1KN2H 1T89C 1L9OA 4YNYB 3RAJL 1M53A 4DEUA 1CI5A 1N59A 5TQ2L 3ZHLA 2B7DT 3DPBB 4GBXC 1DLFH 5ENWB 1FA4A 2R1YA 5ERWA 2ENJA 3ALXA 3P3TA 3KPPB 4ODXB 4FKKA 1M2VB 2IAMC 5F0JB 3H9SE 4NUGH 3NEOA 2ZXAA 1KJMB 1QEXA 2BXZA 2WNXA 2HN7A 3MRKB 3KLSA 1O9WA 3U1SH 3GRWA 4ZO6A 3P30H 4ONGH 5B8CC 4CDHA 2FNWA 3X13A 3ILDA 2V17H 3QWOA 1CGWA 4AMKH 5IVXF 1NBYA 3O8XB 1KPRB 4OCXL 3L9BA 2KMWA 4MD0B 5D7EA 1J0HA 1MHEB 4K9EL 4PJEA 4G9FA 5DLLA 4MX7A 3MLTB 4KTEL 4ODBD 3NFPB 3UAJD 3CHXA 3EGSB 1C5DB 2X4TB 3RHWK 1ZJAA 1NJ9A 2X88A 5JORA 2XJLA 3GSUB 2D31B 4OLZL 2KZWA 2Z91B 3KPSA 1GZQA 4YBLB 1U8CB 3AAZA 1E27A 3OAZH 2IAAC 2D7QA 2DDQH 5K9QI 3LPPA 4NQXA 3BFQG 4LPWA 2KZ1B 5C97A 4MNQD 5HPMB 5BW7A 4U6HB 1FYTE 1AHKA 3EFDL 1U8IA 2F1AA 2W88A 2P8PB 4FLOA 3RTQD 1IE5A 2EIMB 4M8VA 4IW4C 5IUSA 5L8JB 2WLIB 2H4EA 3MRRB 4EIBA 4M8QA 4YDZA 3AWFA 1N3NB 4AQ1A 2VZOA 4C8XA 1OOWA 1Z9PA 5EULV 4NOFA 4P4KB 4KKPA 5CCJA 3Q1SH 2F8IA 3HG1E 4OUUB 2AGJH 4RRPG 3U30B 1HINL 4Z3IA 2X7LA 3QUHA 1SEQL 4X6DE 2NX5B 1RUML 1JGDA 5TJWK 1HEZA 3ZE2E 2DLFH 3FRPB 4L3CB 4L4TD 4PJXA 2R1WA 1HCFX 4FNLL 2A77L 1PZAA 1OM3L 4JFFB 3B9KA 1P2CB 2JKLA 5D72L 3LRLA 2AJ3A 3BN3B 4MJ2A 5DO2D 1HHIA 4ODHL 4F9PA 2FEDD 4CJ1A 3QNXB 4J8RA 3UJIH 2FWLB 1EZLA 4Q9QL 3KPNB 5I2IA 2JKNA 3MRMA 2B0SL 4HZLB 3QDGA 3D39A 4PGBB 4XHJD 1ODAA 4YFDB 5AKRA 1A14L 3CD4A 4MJHA 2F7RA 4CN1A 4ZFOL 3WMSA 4HCRL 4XXCC 5CZVH 1VPOH 2GPZA 4O2EA 3EW3B 5C08E 2WHVA 3L16A 1W0WA 3IPEA 5EFIA 4HUNB 3RUGF 4XMTA 3SDDC 4AENB 3GXPA 5JR1H 3MJ9H 2V2TA 3BIKA 4Q56A 4ONFH 3QNFA 1AMXA 1NMBH 1W6WA 1MI5A 4PV1C 4OI9A 2Y07H 5I1IH 4FABH 1G7LB 5AOIA 3OX8A 4PREA 1ZK5A 4WUUD 2NY2C 3POHA 4QI3A 2EIZB 4DP7X 5KVGH 2X4QB 4MTMA 3GRWH 2VXTH 1QUNA 3HBZA 3RTLA 3VI4E 5AOLA 4FZ8L 4Z76A 2DYPB 1Y6MR 2J4WL 2LABA 4M93C 4HWNA 2F58L 1Q1PA 4TRPL 1CIUA 1W72H 4AEHL 5I66A 4JFFD 3WCYA 4N2HA 1PG7L 3PL6A 4ZPTA 4P5TB 1XR8B 3OKKB 2E9BA 3S3CB 1FFRA 2AQSA 5J8OA 2EDQA 2NZ9C 4J1UA 3GSWA 4L05A 1BAGA 1A3LH 1PF3A 1W8EA 4FQXB 3C6SB 2VQ4A 1CLYL 5GGTA 5IB1A 5EU5A 2WQXA 1AHWA 5EMYA 1SVCP 1MW0A 2MNUA 2CJUL 2YUZA 4ZO7A 4WFGE 5EB9A 2Y7QB 3S88L 2J8HA 1R9FA 4XMKH 1Z7JA 3IYLW 3MJWA 5EO0B 5TE4H 3CHOA 5IB5A 5I0YA 2VERA 3I3EA 2P7TA 3V5HA 2VM4A 2W9EL 3O45B 4NN7C 5E2JA 5B1CA 1S7TB 4U49A 4YFLF 3JT2A 1T5XB 3Q6GL 4F8NA 4OCLC 3FFDB 4BK8A 5F9AC 3GPEA 4ZOEA 3VGGA 1JRHL 2X41A 3D1MC 4B9JA 4JPWH 4NO0D 3IFPB 1E9PA 4OZIB 4I0PC 3EJPA 5GGRY 3U7WL 5KVDE 1KFAL 3DSNA 1QABA 1OL0A 4U1HB 4AW7A 1MNNA 4JY6A 4P3WA 2VDKL 3O4LA 1QLRA 4QAMB 2Y69B 3VI3B 1WT5A 1ACCA 4GG8A 4YSCA 5DD3H 1Z5LB 5B22A 4PJEF 3FT3B 5LXVA 4P5TD 1JK8B 1KGJA 5I1AB 1F00I 2GITA 3MODH 2NY5H 2WVSA 3MAWA 3LQAC 3L13A 1WQVT 2QQNL 4P2OA 4BSWA 3MLPA 2VERN 4ENZA 4ZFFA 3SZ6A 2HJFB 2CUAA 3C08L 4AEIH 1CU4H 3BWUF 4P2QB 4I0KA 4EJ1C 1DQJA 3MOAH 3FC8A 1MCFA 1WEJH 3QUXD 4KQ3L 1M7DB 1TJMA 4C83A 3O0RH 4OQ1A 3MC0A 4Y2DB 4NUJB 2YZ1A 3PDGA 4J4PA 4CVZB 4W9ZA 2PMZA 2K45A 2BW5A 5F1SA 1H3PL 5EF2A 1IM3A 2AV1A 1UACH 1AGEB 3LNHA 1IM9D 3UJTH 2XTJB 4AT6B 1GPOH 1CDHA 4N2EA 2D9QB 4RGOL 1NIFA 5AALA 1FNSL 4WI3A 3NSCA 1RCYA 2APFA 3MBXH 4R5TA 4M5YL 3DURB 3D4GA 2WO3B 2LU7A 3UTPD 2AV7B 5I6XC 3WEOA 5ADPH 1CYXA 3A4FA 3ZT5A 1HYRC 1JVKA 4XN9A 4PJIE 1OSZB 4QUOA 2OMZB 4O5LH 4RFNC 5GGTH 3E6FB 3LH2L 4KVCH 4IRZA 4OD1H 4L9DA 5A3ID 2WLJA 2ZE0A 1XH3A 4JN1H 2BSRA 5C70A 1DBJH 2UXVA 3MCKB 5J0BA 1N64H 2ATKA 4N85A 3AU0A 4OSUH 3HOGA 4FXTA 1BQUA 4GIOA 1T22B 2VLJA 5FA3A 2DQ6A 2ZXWB 2L7EA 2EE9A 2HAZA 1SDYA 3GMQA 2Z9TA 5EF3A 1BG1A 1S3KH 4I5BA 2G4GA 2ROYA 2D3VA 1XIWA 3OAYH 4G2AA 4MD5B 4AIOA 1LO0H 3NSXA 4PJDE 3WDHA 1E5BA 2Z6FA 1OSYA 2ZF8A 3UIZA 2GVYA 4J6RL 5C07B 3MBEA 3SDXA 2XTJD 4TVPD 1GGCH 3HZVB 2DIEA 5H37H 4MA7H 3IMTA 3OMAB 2JCCB 3VGDA 5CEZD 3BVUA 3SIKA 4Z7WB 1J9TA 1GZPA 1T4KB 4FP8H 2KHAA 3BP4B 1WZ1H 3MRHB 4QTHA 2ZWLT 2P43B 4ACTA 3MZTA 4UQBA 4JCWA 3GNMH 4H88L 1F2XK 4H8PA 2G5BB 4Q9RL 3F5WB 1EEZB 2F5BL 1G84A 4U1KB 1YEFH 3T2OA 1QEWA 2A0LD 1PX3A 4UTBL 3HNTH 1XAKA 1OTTD 1MHCA 1OOAA 4XNZB 4IJTA 4F7CA 5IFHL 3ABGA 1XB6A 1N0XL 4R26H 4X4YB 2CRIA 3RPBA 3GBNL 3SQBA 2ZKYA 4I1PA 2YPLE 1PLGH 4HAGA 4IDLA 4LARH 5J12C 3FCUB 3NZHL 2EVGA 4GRWB 3C9NB 3S48A 3CFJA 2ITEA 3BDXA 1C8PA 3A6BH 3RWJB 1DQDH 5K59F 4NKOA 2LLNA 4JZNA 3FO2B 2VR5A 2MTPA 4ETQA 2GTZB 3VQMA 2X2UA 3GKZA 1LE9B 1JN6B 3HC0B 3NSFA 4AUYA 5KYWA 3FSAA 1MDTA 3G5WA 3OB0K 1FYHB 5E8OA 3VVVA 2OK0L 3DI2B 2XOTA 4HSCX 4NUPA 3QQ3B 3TIEA 5MHSE 4U1IB 3TH3T 2XZCH 4QMEA 3SJVE 1GYVA 3PPSA 1BMZA 2VE6B 1DVTA 4OF8A 4K55A 2P24B 1A7OL 1QLEL 3QW9A 1TZAA 4GSQA 4WI9A 4YAQB 4FA8A 4ZFGL 1FNGB 4I3GA 4ANVA 1ZXQA 5AW3B 3R7QA 5HYJE 2DIJA 2ICEC 1A6TB 3LB6D 5SWZB 3CDYA 5D93B 3SKNA 3L95A 5EOTA 5IJVA 4P23A 4L37B 1TVHB 4EVNB 2NNAB 3DMMD 2BZDA 1DE4B 3EHBB 3BN9C 1MOEA 3UBGA 1JDCA 2DS4A 1JNJA 3OKLA 4Q4EA 4FQ2H 4M1DH 1YYCA 4XBGA 4GMTH 5E9NA 1BJ1H 2NW2B 2DYSB 1DQKA 1X5GA 1QTPA 3SEPA 3AG1B 3F62A 4WSKA 2MCG1 2HTLD 3E6HA 3BDBA 4HIXL 4UAOC 4PLJD 4FQJL 4WGKA 1DCLA 3VFRB 2O30A 2F53D 2G5RA 3RZWA 3NACL 5B39G 2O5NA 2WAQA 3QUZC 1AY1H 4AIZB 2WP3T 3D33A 4B3VA 4GP8B 2OTUB 3VGAB 1TQUA 3HPLA 4WW2B 3VD2A 4F24A 1ETB1 3BGMB 3E8VA 2VLLA 1YPZE 2F68X 1F4YH 2KKQA 3ET9F 5DURB 2G75B 1BOGA 3FQRA 1BHGA 1AGDB 1FVDB 1YA5A 2A9NH 2XKNA 3LNDA 3O6KH 4HHWA 4MFHA 4GW1A 1WTGT 4HC1A 5T5FA 5EUOF 3MOQA 2EDKA 3FRUB 5DVLA 2Z7ZA 2DI9A 1CFBA 3FB5B 1DVFA 3H2WA 3KWWA 3SOBL 2UWEB 3PY9A 5CO1A 4PJAB 3VFTB 5FO9B 3WTTA 3I75B 4OI7A 4HAFA 4MVBC 4ZBJA 4TTDD 2BVOB 4OLVH 4N2CA 4HJSA 5HDOA 4JDVA 3KVDD 3ZIMA 1W91A 4JG0H 2DMGA 4KUCF 4NDMA 3A4EA 1EJ8A 4K3HA 4WI2A 1FNAA 2XZZA 3QRGL 4Q9BA 4DQOH 1ZLWH 1SJXA 1T83C 1A2YB 4K5OA 1U93B 3VW3L 1N8OE 3LKNB 1TQVA 4P9HL 3D0LB 3EYUL 3VYNA 2Z31B 5AVWB 5F6IC 4POYA 3U4BH 4W70A 2R1XA 2G9KA 3GLDA 1E9OB 1T2JA 4L3EA 3TN0C 1MJ8H 5TQ0L 1PD0A 3IAPA 5BZDB 4MDRA 5AEAA 5EPMB 4Z95L 4N8CL 3OSVA 1XSIA 5LVEA 4E9VA 2VZ3A 4JJOA 2Z8WC 3EBIA 3IMBA 1P7HL 5D4HA 1IKNC 3HW7A 3KL3A 4MJJA 1OCZB 3CHPA 3ZDYF 1A6AB 4EI5B 4NGHH 3AQZA 5F9JA 5C0BA 2NQDA 2AQTA 1H8OA 4NJ9H 1LDPH 4MJID 1I85A 2CM6A 3HHSA 4WU7B 5JOEA 1JFHA 3RFZC 3QT2A 4KVNL 1YEHH 3QYNA 4L4VA 5DURD 2WQUA 1E7VA 4I4WB 4DVRH 5BPPA 5LCVL 3S98A 4HX1B 4XC1L 5I5JA 4PJBA 1D5ZB 1QPPA 2NZIA 4LSRH 5MERB 1IFHL 3ZDZB 4D3CH 3QEUA 2DH2A 2AVFA 4NO5A 5SV4A 2K9FB 5HYQA 2XU9A 2ZOUA 1GR7A 4HFWB 2DQUH 4FE9A 4FERA 4QYAA 5D2LA 2XWDA 4V11A 32C2A 3BC9A 1FO0L 1TCMA 3QIUA 4FEIA 4HEMA 1OP5H 3TYFB 4C4BA 3CCHA 3U2IA 1WD9A 3B2VL 4FD0A 3OKOA 5C6TH 5T5NF 5E2UL 2PN5A 1FRGH 3WI9A 1Q9LA 4AKOA 5BVJB 1BBDH 1G7QB 2MCMA 1NCDL 4B0MM 2BOCA 2Z31D 4CADB 4GO8A 1LMIA 3KE0A 2JKSA 4MJ4A 4M8RA 3TFBA 4GRMA 3RIAK 3RY6A 1E7UA 2XA8H 1TJHL 1LD9B 3ZQ9A 2WLZA 3P9MB 3AS1A 3SGKC 2IPKB 2XQBL 3FOLB 4HJGB 5CCGE 2AMUA 3EOTH 5I75C 3W11D 5KN5B 4JZOB 4EI5D 3JWNG 1G7PB 4H20L 1WFUA 3D9AH 3BP7A 4I1NB 4WCYH 1I1YA 1KT2B 4U6TA 4OVVA 1YMMB 1M9SA 2EDBA 4NN6B 1GS7A 3ULVL 1VEPA 1F1DA 4FFYA 4ZI8A 3CIAA 4LOFA 2XACC 4PR5B 2C4XA 5IBUB 4AQEB 1IKFL 2H2SC 1QFWI 3QUKA 1WVZA 5AVXB 1KLGA 2Q3ZA 1BFSA 2B15A 1OTUD 5KSUA 4W93A 2MQ3A 3TP4A 4G6FB 1JGEB 2ZAGA 3APDA 4JM0A 3RBSA 5F9WC 2EE2A 4RWHA 4A66A 1OAZH 4HU8A 4A7GA 4QGTA 4IRSD 2XN0A 4DPBX 2YEVB 4OGXL 5I15H 3BUYA 2VDNL 2KYIA 2WQAA 4XPHL 4PRDB 3ALWA 3B4NA 4O58L 1YEGL 4W9EC 3VA2C 5PCYA 4PRBB 3T4YB 5D71L 1TETL 5DFWH 2PPEA 4BWWA 4JGNA 4IKJA 2F54D 1KACB 4JQVC 4X4XA 5D1XC 3STZA 5F8RC 1JGUH 4KFZC 1CURA 3B7YA 1DDTA 2IPUG 2PP7A 3IWUA 1MEXH 3LSOB 2P44B 2NY1C 5BCAA 5GJSL 3PWPD 3VXPB 3RYMA 2WTRA 3JVGC 5D1XE 2W9DH 1ZVNA 2HG5A 3DJSA 4JFQA 1R5WB 4GW5A 1MFBL 3HI5L 4LLVB 4JKNA 1RU9L 5D7KD 3NCEB 1HCZA 2ITFA 2W60B 4AJ0A 1YMMD 2HH0H 5M95B 1VJSA 2AS5M 2F7IA 1NIEA 3SPVA 4D9QD 1A7RL 3L1OH 1IBBA 4X99B 5DZAA 2MCPL 3TIDB 1CXFA 2CO1A 4XPAH 2D7TH 4IBTA 1J1XH 3HTLX 1TKWA 4NSKB 2IADB 1J8HD 4N2BA 1YECL 3ARBC 4K9EC 1HWHB 4TS6A 2J1YA 1RHFA 3BPOC 3CXDH 5F88A 3T0BA 2WBJB 4PGEB 1M05A 1MJUL 1D5BA 5HD8D 2BY3A 4MMZB 4ZK8A 3ZT6A 3PGCB 1BQ5A 4MLIA 5AB1A 3FQUB 1WDAA 4J2XA 4I9WD 4UV4L 4NRZA 5KSBA 4KXDA 4NPJA 1EAOA 3WFEH 1LEGA 4QY8B 2OCFD 1KTKE 5KYYA 3L5XL 3B1UA 3QDJD 2K6ZA 5FPIA 1QSFB 2JB5L 2OYMA 2YAOA 3WKPA 1SJHB 5CJXC 4MHHI 4FG0A 4JHUA 2UY7A 1GTNA 1NUFA 5C2UB 4Y19A 3ECQA 4NXKA 3H4HA 1WWAX 5H4YA 2CRYA 3L8QA 4PJGE 4LRIA 4PGZA 3UJJH 2FGZA 2COQA 4BELD 4JM2C 4HSQA 3ARFB 1BSIA 5CMAB 2MKWA 2ZQKA 5ABZA 5DJDB 3Q9PA 2FZ3B 4N1HB 5CBEB 3QUGA 5F72S 1A9BB 3B2DC 2NXYC 1P5UC 4GKNB 2E8YA 2DMCA 5D2LF 3VI3F 1AGFB 4G8GB 1GYAA 3OLDA 5MP6L 4FXKA 4WF7A 2HWZH 1ASPA 4F7KA 3QS2A 5H94A 3QFJD 1FG2A 1A6UH 1T3FA 3VFGH 2GJ6E 1T2QH 4Y4KA 2X0WA 2FGWL 2HT2D 5T1LB 4KNSA 5IK3A 1KPUA 1ACZA 1NC4B 4AEFA 4H40A 3C60C 3NPSC 3RWEA 5CN3A 5L4IA 3MLUL 5BMFL 1XMEB 1MRCL 5E2WL 3ZTNL 3JTTB 2B4CH 2C26A 2OP4H 2PCPB 3UTQB 4NI6A 1I1AA 1TZIA 1X5AA 1NUDA 4K23L 1IEHA 5E0FA 3TOPA 4LHUG 1KWKA 2BMKA 1ZT1B 4MB5A 2VC2H 3BLPX 1IGFH 2P45B 3RPKA 5HGHB 4L9LB