3QYMA

Structure of p63 dna binding domain in complex with a 10 base pair a/t rich response element half site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
192
Chain Sequence
SPSNTDYPGPHSFDVSFQTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein 63
publication title Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
total genus 35
structure length 192
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qymA00
1E50A 5G4MA 2J21A 2IOIA 3IGKA 4IBYA 3TS8A 3ZMEA 2RMNA 4AGLA 2OCJA 2WGXA 3D0AA 3WTUA 3IGLA 2XWRA 3D06A 2IOMA 3Q01A 5ECGA 2AHIA 2J1ZA 1GZHC 2BIQA 1EANA 5AOIA 2GEQA 4HJEA 5AOLA 3D07A 2H1LM 2X0VA 3D08A 3KMDA 4GUOA 4IBUA 2IOOA 4QO1B 4G83A 3WTSA 4LO9A 1TSRA 3Q05A 2PCXA 4IBQA 4MZIA 2J1XA 1EAOA 4XR8C 4AGOA 3VD0A 1CMOA 2BINA 2XWCA 4MZRA 4AGPA 3WTTA 1YCSA 1HJBC 3QYMA 5A7BA 3Q06A 3US1A 3VD2A 2X0UA 3WTVA 3EXLA 2J6WA 1EAQA 5LAPA 4GUQA 2FEJA 4KVPA 2BIMA 3VD1A 2ATAA 1CO1A 2J1WA 1KZYA 2AC0A 5G4OA 5LGYA 4L0ZA 3D09A 1T4WA 4IBZA 4L0YA 1LJMA 4LOEA 2ADYA 3WTWA 1HJCA 2BIOA 2J1YA 2MEJB 5G4NA 5AOJA 5AOMA 2X0WA 4IBWA 5ABAA 1UOLA 4IBSA 3WU1A 3WTYA 4AGQA 1IO4C 2VUKA 2YBGA 4IBVA 4IBTA 2BIPA 3EXJA 4L18A 2J20A 4AGNA 3WTXA 5BUAA 4LOFA 5KBDA 1HU8A 3D05A 5AOKA 4A63A 3QYNA 1GZHA 2P52A 1H9DA 3US0A 4IJTA 3KZ8A 5AB9A 4AGMA 4G82A 1TUPA
chains in the Genus database with same CATH superfamily
1JXJA 4HKZB 2A9BA 4G8FB 4MNGB 1E8WA 1RZPA 2XA3A 1F11A 4H8QA 4PS8A 1URZA 1IGYB 2Y2YA 4LPTA 2OJZL 4AQEB 2A4EA 4CUCA 3MRDB 3L16A 5E2JA 4LPVA 5JHMA 1ZANL 1ZOXA 4L48A 1A7OH 2X6MA 5CLTA 3L08A 3MCLL 4G71B 3IU3A 2Z7UA 5E03A 1DUZA 5IB2A 3C6LB 2YPKA 2A1WH 2Y69B 4YDLC 3U7YH 4NENB 1JAEA 4FOMA 3WG7B 3B2DC 4H44C 2MSPA 4TS6A 4XPAL 4L8SB 5T1MA 4BXSV 4HU8A 1JF6A 2H3KA 4NJAL 1KT2B 5J12C 2BSTA 5I5IA 5DMGD 4JPSA 2XV3A 3T6XA 3TV3L 3Q43A 4R90H 5CD5D 4HGWA 1MN4A 4I3RL 2QPUA 4FEIA 3HE7D 4I1PA 1HE7A 5CEZL 3B9AA 5T8IA 2Q0ZX 5DEZA 2FQDA 5DMJB 4ADGA 1WD8A 2Y07L 3HZVA 3OKKB 4L5FE 1LE9A 5FM8A 1U8NB 5E9DB 2K1MA 2DBLL 5DURB 1KJVA 1TQTA 3VD0A 1KFAL 2XG5B 4WSJA 3TO4C 3LXAA 4GO9A 4N8UA 5GS2H 4PRDB 4Q52A 3MV8A 3OKDA 5CKGA 3UBXG 4L1SA 4NKOA 3BW9B 2CIKA 4GQPH 3SOTA 4RISH 4ONFL 1SZNA 1ZHLB 2V9UA 3OG6B 1KC5H 3QQ4B 3U9WA 4ABUA 5HYSA 1SEQL 5TE4L 5HBBA 4R7NB 2Y6SD 2DQJH 1W8OA 2OCFD 3BAYA 1A3RH 1BWWA 4L0ZA 2Y7QA 2I07A 3MN8A 3EW3B 4AM0A 1BBDH 2AJZA 4PD4J 2NR6C 4UV4L 5J06A 2FGWH 1JZJA 3BCDA 2P5WE 3QUMB 4WV1C 5EO0A 1NMBL 5ICUA 1S8DA 3SSGA 4BD4A 1NPJA 5GS0C 5DS1A 3D0VB 2L7JA 5AWNL 3S5LG 2C8NA 4POYA 1DLFL 5FB8A 4G7VL 4X4MA 1UWEH 1YEDB 2NCEA 3RKPA 2CJUH 5HHQB 1OWRM 2VTFA 5IJVA 2G5BB 2GK0A 2FRGP 4IRJC 2R0KH 3L3GB 2XN1A 1AY1L 1HU8A 3L4UA 3II1A 4ISVA 4TSCH 2DICA 3BQUA 1NDGB 3GSOB 2YQ3A 1SY6H 1TITA 4YLQT 2YXVA 2XWEA 4KK8D 3JQOB 4ZSOE 1QSED 2X4UB 3QO1B 1RXLA 4PR5A 2D2CC 4ZQKB 4WW1A 1L3NA 4GBXB 4QOKB 4XCEA 1KBGL 2ITDA 3GRWL 3OKOB 1FQ9C 4NWUH 4OY9A 4H8WC 3QJUB 5AB1A 3JT0A 4OFYD 3B37A 3O3BA 4DIXA 4UDTA 4JS7A 5C6PB 2FBOJ 3T4AC 2FEDC 1ZHNB 1DDHA 3POHA 4PSPA 3MC0A 2IMNA 3RUGF 1GW6A 3ECVA 5F6IC 4ZW8A 4XVJH 3BFOA 3QI9D 5D2NC 2LQRA 3ZT5A 3U82B 1EANA 1YUKB 5IK3A 3F7VA 1EEUA 1KTCA 2PWHA 4XOCA 4U1IA 2XNAB 3GMOB 4LSVL 1M53A 2NXYC 4GAGL 1T0MB 5DEFB 4MMZB 5EZLA 5EN3A 5JXED 3QJQB 5TJWK 4X42A 5GSVA 3H54A 5DEGA 3DGGB 5FYJE 5JMOC 1FSKB 4NN5B 1OP3K 4FN0A 5F3FA 4FERA 5I6OA 3KXFE 2YMXH 3V2AR 1LEGB 3H2PA 3AJ7A 4FNRA 2BZ7A 3DX8B 2NXZC 2ZUTA 3IS0X 1GYAA 5K9QI 4DKEH 2HLEB 1YMHB 3TYGH 4R84A 4YFLI 5C07A 4EI6A 3HG3A 3T2PA 2ZG3A 3W11C 2DQMA 3E38A 4KV5F 4D3CH 3UYOD 5DJ6B 1GGIH 2KKQA 2WXFA 4M8UA 5BW7A 2Y5TA 4UZUA 1IIKA 3B9KB 3GJFB 1CXHA 5D7KD 1QRKA 2IWFA 2WB7A 2IBGA 4JW3A 2QVMA 2V3EA 1NCDH 4M8QB 3CG8A 5F8RC 3GMMA 5E08L 2UZPA 2BVEA 4YHMH 1CIDA 1DVYA 4KXBA 4ZNEE 5FKPB 5GGSY 2WWKT 4QRRA 3MOBL 3ZLQC 1A4BA 2X89A 4CADA 3ARGC 4O02A 3ZHLA 3DX7B 2EDBA 4LHUA 5GS0L 1U8CB 4OM0H 3DUSA 2Z8WC 4FQCH 3ZE2B 2HG5B 2HP4A 3FQTB 3QPQD 5E4AA 1AGEB 2XWBA 4L1TA 4NIYE 4XOEA 2QSCL 3I9GL 1A9BA 2WZPA 2BXYA 2FECL 4UF7C 1HYSC 2IG2H 3TM6A 5DMKA 2F5BH 1PZDA 4XGZA 3U0TB 4J4PD 2X6VA 3TBSA 4TMPA 5K9JH 3QZBA 1EO8L 2NX5D 4K07A 5CHNA 5DJYA 2CKBL 4FXKB 5CEYB 4KTDL 1QA9A 4GQ9H 4PV8A 3BZEA 1EEQA 4QGYA 2W07B 1W72A 4HS6A 4R7DA 3SDDB 4ALAH 1JVKA 3DXAA 3SGKA 4PI2A 4A2HA 2WLLB 2YFOA 4LNRA 5D7LA 5CEXA 3JV4B 5KSAA 3O0LA 1C9SA 4U05A 4ES9A 3V8CA 1E3ZA 4H8WL 4MYPA 4CU6A 3L5JA 2DKUA 2VC2L 4X6CB 2W0PA 5IMMB 3TP4A 4F9PA 4EI5B 4JFWA 5CCKH 2VXTH 4YZFF 5CZVH 2QV2A 3OX8B 5TF1L 2Y4SA 3VWKD 4F2ME 5E0QA 2Y22A 4LLQB 4DO4A 4HKBB 5HHVL 5LGJA 3QC6X 4QGTA 1YPZB 1FFTB 1G7LB 5C3IA 5E5MB 1FYTE 3WNNA 3EGXA 3WJMA 1ZT7B 3NESA 4FXGC 2EE9A 3K6NA 3NEOA 4HIEA 5D1XA 4FA7B 5H37G 4HH9A 1H6UA 3U6XS 1MQKH 3NIGE 1CFSA 4DKFL 1YCSA 2VM9A 1OGTB 2MRYA 3NPZB 4JB9H 2ZWZA 4ZODA 1XBDA 1YHPA 1AXSA 1DN0A 1HN1A 1Q9OA 1NICA 1R3HA 4JRXA 4BKTC 5J5EA 1Q0EA 3TT1H 2DQFB 3LZFL 3CXHK 1I3RB 1ZS8B 2WXIA 3T2NL 5F3BB 1OP5H 3L1GA 3OKNA 4MQTB 3O41B 2Q8BH 4U6TA 2A3TA 4OCYH 2ETWA 3TH4T 4NERA 1L0PA 4NUJB 3KLAA 4YXHH 1XF5A 3GRBA 5JR1H 2IO5A 3QQDB 4N0FB 3EYOB 5IGXH 1UOWA 2B59A 3C6LC 5E0FA 4LXFA 3QARA 4PGDB 3CFIC 1D5MA 1FVDA 3MLUH 2Q6WB 5I16B 4L8SC 1U3ZA 4XN2A 3UCQA 1MIEH 3C5SB 2HN7B 4UOW0 4KKCC 5AB0A 3DIFB 1OCOB 5CBEA 4OZ4A 2W65A 1YNLH 3Q3GB 3SDXF 5DSCB 1O5DT 2OLDA 4L9LB 4Y7MA 2BP5M 4LFHG 5D1QB 2CO7A 2MCMA 3HC0B 4U6YA 4CVUA 4WHCA 1NFDB 4A63A 1XBRA 3QYNA 5AW1B 4O02H 2ORBH 3ASOB 1T7WA 4D9LL 1KJ3H 2YRBA 5DWUL 3PDOA 4LSQL 2C3HA 1YA5A 4RRPG 2BP8A 2HFFA 1QUNA 2VZ3A 2M26A 3FFOA 4M7ZB 1YECH 3V7MA 1WITA 2WYZA 5AW7B 5LVEA 2ZX7A 3O45B 3PWJB 2WGXA 2AZUA 1J5OH 2CGZA 4B97A 3SZKC 4K94C 3WE1A 1X9UA 4XC3H 4CVXA 1WFIA 4LRIC 1E4XH 2P8MA 3LS4H 1YJDL 4MS8C 4AEHL 1NPNA 3C2SA 3MRBB 2IPKA 3BH8A 1LO4L 3UAEA 1W72H 4J8RA 4ODSH 1IQWH 1DVFC 1WTGT 1HHIA 1G7HA 3QEHB 4UT7L 4EN3C 4AYFA 3P11H 5BS0B 1IBBA 4LLUB 2PXYB 3TO2B 4GUOA 4R3SB 2GAZA 1Z2KA 2YAOA 1QMUA 3HAEB 3P9LA 1YNKH 1RU9L 2VDOH 4HS8H 2OMXA 4HC1L 1S9WB 1I1YB 5I19H 2JJSC 4KJWC 4DSYA 3GTNA 3SE9H 2NY5H 2F5AH 2OTWB 1XGUA 5I8EA 1WFMA 2E47A 5IW6A 3BSGA 3H42L 2Q8AH 3U4AA 1ZGLA 1CFTB 1IKNA 2VLRB 1UZ8A 1LO3H 4JRYA 3E8VA 1N6QH 1OGAA 2MQGA 2YHGA 2NNXA 3IF1A 1P7KB 1OTUC 4NRZB 3LX9A 5AG8A 1I1FB 1DFBH 1GZPA 2BJML 2FEJA 4ZS7H 5IHUL 4OD3L 5A40E 5EU3B 4CDGC 1KN4H 3AG3B 2N1KA 2QKIB 1NCGA 3S9DB 2VXUL 2A74B 1LM8V 3FS9A 3PAZA 2ED9A 1FP5A 4GB9A 4WJ5B 4N28A 4G1EA 4V33A 4TL4A 1TQUA 2UWEA 1C08B 1DQLH 4X2UA 2R0WH 2G3ZA 4B9JA 5AKSA 2GIMA 5AOJA 3V7AG 2XBDA 5ID1B 3PGFH 4M48H 4AQ1B 3CX5K 4I85A 4OV5A 4NQCA 4NO5A 1DQQA 3TVMA 1JXGA 3AW5A 2CE6A 2ZXGA 3GQFA 1JD7A 4LLDB 4HUWA 4PGJA 3RPIB 1Z1WA 2DB8A 1FSKC 2WWNA 2AF2A 4NN5C 4PBXA 4XI5D 5FUCC 4PRID 4NZDA 1UM4L 3ETTA 1WIUA 1DUYA 5J6HB 2K8MA 4OKVB 2YJLA 5BQ7A 4IKLA 2BHYA 3BUBA 4GAYA 1YEEH 3UJIL 4JJ5B 4Q56A 1IRAY 1MRDL 5CAYB 3D4GA 1XR8A 3FQUB 2WXOA 1DVQA 3RAJL 4U7MA 1UCBH 2XTSA 3MMEB 4JQIL 2PW1A 4K3JL 1ZA6B 1YEFH 1FZOB 2RCSL 4G5ZH 1HSBA 5BZZA 4OSUL 2QT6A 1UXWA 4YSDA 2DQTH 1NINA 1YN7A 1CZ8L 3SBPA 1FFQA 4PMFA 3SDCB 1MZZA 2B16A 1G7IA 4NAQA 2IGFH 1MJUH 5AVUB 1FE8L 5FYLH 3CFKB 1P5VB 3B9KC 4BSWB 1L6XA 1WZ1L 3VM7A 4DKAA 3FQNA 1XZWA 4YFLF 5C0AE 1U91B 3ECBB 2YGPA 4JDZA 5B39A 3F5WB 3S34L 5JDSB 4K94L 2ZKYA 5IZ7A 3AG1B 3K4DA 3MLSH 1A6AB 3L48A 1UYWL 1LD9A 4YHZH 1WE5A 2HJFA 3VRLF 1CIUA 2JTYA 3UGEA 2GT9A 5A6MA 3U30C 1S7XB 3Q1SL 3ME0A 4GSDH 1BVLB 1HS6A 3R4RA 3RBSA 1E2ZA 1I8IB 1IARB 2GYSA 3AACA 1FH5H 1QRNA 2J8UE 4CDHA 4FA8A 5D6CA 5FHAH 2J5WA 3PQYA 4C83B 2VE6B 2GBUA 3EO1A 1F42A 1CG9A 3NCWA 4YDMA 2HXAA 1EFQA 1XIWC 2FX9H 5HHOE 3K74B 4N0YH 1N6VA 4N2LA 3FCBA 1R5IB 3BZFB 1TO4A 3OMZA 2AAVA 4QRSB 4JKPH 1SOSA 4JY4B 4XBEL 3PG2A 3FXIC 5M94B 3IKCA 3ZKMD 1TQCB 4X5XA 2BSDA 4H8HA 3V4PA 3RVUC 4DGIL 4ZMPA 1M2OA 2FO4A 2WB1A 3BX7C 1FZMB 3SDDC 3ZN6A 4ONGL 4P3DB 2UZIH 1AIZA 2XPZA 4JG1H 4QTIL 4HSCX 1CF8H 4P23B 2A9AA 5LB1A 1P7HL 3LNHA 5EU4A 5J3HC 1HNYA 2BMKA 4JN1L 3U1QA 2VZUA 2AXJA 4FFZL 3WNKA 3GMLA 3ULVD 2VR3A 4JFEB 4NZRH 3P0GB 1P7QD 1JGVH 4XC1H 3PWNB 2KERA 1WO2A 3GSNL 3O4LA 4UBDD 3OSVA 4XPHL 3CQPA 1FLRH 3ATFA 4N6QA 2A6KB 1QEXA 4U1NA 2ARWA 3CQQA 5DD3L 4L8CB 1UT2A 3JWNH 4FJ6A 4P2QA 3EFDL 4Y9CA 1JHTB 4BUGA 2GQHA 5DJCB 4AQOA 4L0PB 3M46A 1GZQB 2OZ4L 2VSCA 3U2JA 3JTSB 3UMNA 3MUZ1 1NBZB 1E2VA 3ARBD 4A7GA 4L3AA 4ZUWA 4E41D 1RJCA 4X8CA 5KVGH 4LHQB 3ALXA 4U1MB 4D0DA 1K2DB 4GW5A 3AVEA 3L4VA 3UZEC 4H4NA 4RMRA 3N1QC 4H0GA 4MFHA 4YZFE 3HA0A 5KVFH 4JNXA 4DGVL 2WVTA 3RL1A 5FO8B 4IDJL 3G08B 4Y19D 4PW9A 4XCNB 3KPRE 2EVIA 3MNMA 4G59C 4GIPD 4IRSC 2Z4QB 1EGJL 3DRTB 4S0TD 3VFVB 5D2LE 2XXFA 5EZOH 1HXMA 2YKLH 3V6ZA 4R9HA 4QR7A 3MGOA 4WWKD 1TQVA 2R15A 2W60B 4ORGB 4X6FA 1HK6A 5F1NA 3LZQA 5E2WL 2OMUB 3FFDB 3QAZC 4ANUA 3KCWA 1F6LL 2GBTA 3HHSA 1AE6L 1ZVHA 5GRYA 3VQ1C 1AI1H 3UTZA 3EJCA 1C5CL 1AMXA 2XZQH 4L9DA 4P59L 3G6AB 4H8PA 2EEXA 1HQRB 1N5AA 3JV0A 5AZEL 2O5XH 1DZ0A 5DUBB 5DHVA 3RDTD 1ET8A 1WWBX 1GVIA 3WEOA 2ZCLH 5GZOA 2QSTA 5AENA 3A24A 3V0HA 5I2IA 1CK0L 1Z9SA 2D4FA 2J8OA 3PDDA 4KRPB 2BNQE 3UAFA 4HBQA 4L29A 4NRXA 4OZGA 4Q89A 1Y18B 5KBMA 4ACTA 4HOXA 3O2DL 1BWMA 1DBML 4EUPA 2EEAA 4Z95L 5I8CA 2K45A 3SD2A 1KEML 4ZXBA 1CGVA 5IMOA 4M7ZC 3SDAC 1XV8A 3O3DB 1DQMH 1I9IH 1TYRA 1FG9C 2V4LA 2GJZA 4G8AC 4LLVB 3V7AE 3LJ3A 1KCRL 3ULUD 2ATAA 3LRLA 4HBCL 1NBVH 4AK1A 1JGIA 1UWGH 1P2CA 2CO1A 1NCUA 1RUQL 3FTZA 5C9JA 1AQHA 5I0VA 2MKLC 4BCZA 1AJ7H 3F6JA 5F2FA 4OF5A 5B22A 3O6ML 3V4PH 5GRVK 5F72S 2NW3A 4Q9RH 3EJJX 1KLUA 2H8PA 4PAZA 2HAZA 5K39A 2XN9E 1MF2L 3ZY7A 1F4AA 2PABA 3I9AA 5KBNC 3JV5A 4Y4KC 4PI0A 1IE5A 3MNZA 4R7VA 3QCUH 4KJYB 1FGVH 1XF1A 3LIZL 4PJDF 1R3IL 5EU7C 3UROR 4EAEA 4F80A 1DJGA 3VXRA 1EZVX 4UQ3B 3SOBL 1LQSR 4F3FB 1QLRB 1TZGL 2WBKA 5AW6B 2MCAA 4JZOA 2DEWX 4Q2ZA 1MVUB 1NKGA 2V37A 2G4EA 2QHRH 3VI4E 2YRLA 4QXUH 1DCLA 4JPIB 1EEZB 3H3PH 3WIAA 3T77A 1FNGA 3HUJA 4X4XB 1EMTL 4PY8I 1PLGL 1KBBA 1VZHA 1WPCA 4M9OA 1UACH 3O8XA 5T33H 4PJ7B 5L2JA 4Z8FH 3ZQ9A 1XCXA 1NLBL 4I4WB 2YUZA 5MEOA 4HV8B 4PRHD 3D0AA 1RHHA 1HL9A 1QSEE 4ZTOL 1KPUA 1UXMA 1RK1B 2QKIC 4JL2A 3OB0K 2A74C 2DIEA 3NA9L 2COQA 1CL7H 5DRWB 1N5YH 3UO8B 2VH5H 3BVTA 3G04A 1KXQE 4UTCA 3L81A 5F93C 4DVBB 2YA2A 2IALA 2Q7YB 3W5MA 2ZSVB 1D2PA 3D5OF 2ADGB 1EVTC 1T04A 2XI9A 4OFKA 3IDXH 3QJTB 2Y7SA 4R0LB 5F7DA 2P42B 1SM3L 3IFOA 5LDUA 3WL9B 2D73A 4CMHB 1VB9A 2VITB 2Z31B 1I8KB 1ZT1A 2E4FA 1ILSA 2VM4A 1R5VA 4L4TA 4Y2DB 2J1XA 1P4LA 4HJ1A 4PUBL 1FZKB 4W1TA 3DJZA 4GW4A 5DJ2A 4Z0XA 5F7EH 3W2DH 2NR6D 4XMVA 1BIIB 4YNYA 5I18H 4NCDA 1KCVH 1CGYA 1QASA 4QY8A 5CP3H 4J3TA 5GS0D 3TCTA 3TH3T 1TJXA 2B3IA 4MB3A 5ECJE 4A68A 3BUPA 2ILLA 3PNRB 5DHVH 2PO6C 4MAYA 1TENA 4KMLB 1XH3A 5EC1B 4DPBX 1LK3H 3BMWA 3IETA 4K71C 4YSPA 3GUTA 2XPYA 4ZMZA 2VDNL 1PGRB 5JXAL 1FL6B 3PCYA 5L6YL 3FO0L 3SDCC 1KZYA 3S48A 5IUCA 2HT3C 3AB0B 1Z6JT 4AMKL 4EUPH 1A4CA 5BQDA 3H9HB 4M56A 3OAUL 3SKMA 5ICYA 5JOPE 4OI8A 3O9WA 3S3PA 3DX2A 1OQXA 3U6RB 4AEEA 4Z3EA 2FHBA 4W9LC 1UUSA 3ARQA 5D7KE 2AXHA 4MD0A 2A5UA 3OLGA 5C0DB 2CLRB 5J11C 2WXKA 3HZMB 2EE3A 4KUZH 2FEDD 3P77B 4ZT1A 2E0PA 2AXWA 1A7PL 3OXSA 4L18A 4GO6B 1T83C 43C9A 3X3FH 1CLYH 1LO5A 1AGDA 1ZEAH 1IGMH 3GEFA 3GJFK 5I0YA 2XWZA 2FNWA 5CS7A 3ZUCA 1UURA 1PLCA 2EABA 5JIPA 1J1PH 4ANKA 1SFHA 1IAII 4J27A 4MQ7A 4JRFA 1N19A 1ZWIA 4KGLA 4JN2B 3B7RL 3VFNB 5EPMA 4YIQA 4BZ1L 1X5HA 5IESH 4OQTA 1ACCA 1O9ZA 1AZBA 3TWCH 3ULVF 4Z7IA 5E5UB 5IR1B 2PMZA 1BFTA 1H6TA 1TQCC 3AY4A 3IN0A 4LCWE 3REWB 1T1ZA 3U0PB 3FO1A 3GM8A 4MJ5B 1PZCA 5DJAB 1X9RA 5L8KB 1C1EL 1ZLUH 1JHLL 3C8HA 1XGZA 1BEYH 1XHHA 1MKFA 3VRLE 2MH4A 3ZDXF 1RSFA 2DS4A 2UXFA 3BFQG 1Q0XL 4MMXA 2WWMC 2NXZD 3GFUA 2VLKA 5BUGA 5FUOH 3QFJB 4ZI8A 3L6FA 3MNVB 6FABH 5TDPA 4CC4A 1OT1A 2AEQL 1FC1A 2V2WB 3GXDA 3W11D 1ASOA 1MW2A 1I7TB 1YYCA 4HIJB 1A5FH 1A6VH 3FQ1A 1DJIA 3GM0A 2PTVA 4Y5YC 1HHGB 4BINA 3PWPB 3JVGA 5K9OB 1EIBA 1JGLL 4LL1A 3WFCH 3ZRFC 35C8L 1ZIBA 3ZOAA 3D25A 1A1NA 2E9GA 4GKOA 1L9RA 2WBWB 3BIKB 3L13A 1CDHA 1XH0A 2XWCA 3NCEB 3N41B 3RB5A 2IH8A 3HLAA 5K69A 4AZ8A 5KG9B 3OAZH 1FFOB 5E7FA 5GZND 5E1GA 4XRCB 1RZGA 1OANA 2CUHA 2QSVA 5B8CB 2HLFC 5E2TL 5BO0D 1O7DE 1AXIB 3KW7A 1XEDA 3MRCA 1E8XA 1QFWM 3HMWH 3ZR5A 2AKRA 1I7RB 1Q4NX 3K72B 3F04A 4MDIA 3JXAA 4LCYB 2NUTA 3FCGA 1IGIH 4XH2B 1A65A 1CFQA 3FUIA 4NC1C 4WU7A 1MIML 4X98A 1YYMH 3U36A 1YO4A 4EKJA 3K6FA 5BO1L 3Q1EA 2Z92B 1SPDA 2AJSL 3CMOH 3EF7A 3MNWB 1ES0B 1JF1B 4RFEA 2E6JA 3FH7A 1OSZB 2XZAH 4JDTH 4ZW6A 4Z7NF 3D0LB 3THML 3KPSB 2CD0A 2ZNXA 4W6YB 5JO5B 2DJ4A 1AQDA 5CP7B 3U7AA 1FF5A 4GSRA 3RZWA 2C4FT 4FABH 1T6WA 3MLTA 1TLMA 3O3AB 3QPXH 4XVTL 1WJ3A 3S3DB 3WXWH 4YSAA 1UT1A 4D0CA 3ULUF 1HHKA 3HN5A 3L3JB 3U1PA 3BO8B 1E9OA 4LBAA 3CV5A 3ZMNA 5IQOA 3WSQL 4A2LA 2R1YA 1B3IA 5D7SH 2N0KA 1YY8B 2A9ML 3ZT6A 1JYNA 4WNSA 3PXHA 3RGVB 1UD4A 3ZMEA 2I32A 5GISL 2IBBA 4DQAA 1BQSA 2ADFH 3FF7A 5D4JA 4HK0A 4FTVD 6PCYA 4HJ0C 3TEUA 5FC9A 2WNWA 3KM2A 4K23L 2PF6A 3DX9B 3F58H 1JZGA 1YMMB 4KTGA 4OV6F 4W9JC 4YO0B 4P5RA 3VD7A 2JIXB 3K6SB 5LBSA 4Z3IA 4OQTH 5HGDA 1E8YA 3WJJC 3P69A 2HYMA 3CSYB 2Z91A 1JTOA 1GSKA 4JR9L 3RL2B 4BSJA 4ENED 1U8OB 3VXUB 4HJEA 2D9CA 4I7ZC 3AXLB 3QGVA 4YDVA 3DO4A 3I3EA 1AKJB 1Y0LA 4AIOA 2C3VA 4P4KC 1TMQA 4IBUA 3GMRA 3GDBA 4PM1A 5J6GB 2BVOA 1S5IH 2EE6A 3DURB 3EOBB 4AV5A 4LDOB 2BVUA 2IC2A 1CE1H 5HGBB 1QPKA 2LR4A 2L7QA 3FDWA 4H88L 1OO2A 4EDWH 2F53D 2AQ2A 2HVJB 3A6CH 2WBJB 3GO1H 1BJ1H 1ETB1 1H0DB 3QS3A 3VACA 1RZFL 3C6LD 3LPWA 1BYNA 2CHWA 4MA7L 2OMWA 4RZKA 4UNVA 2E7DA 4U7KA 4QRAA 1TJIH 3EDDA 5EU6D 1EBPA 1I8LA 3PGDA 2Q5BA 1MY5A 1NC2D 3O81A 1MRCL 2CMRH 4KKCD 3U7WL 5ITFA 3OF6A 5T5NG 3IU4L 4Z3TA 2KC0A 3LAFA 3WAKA 2IDSA 3CLWA 3IFNL 5EWIH 3VTMA 3CVCA 5EIIA 2H32H 4PD4K 1KTDA 4TULL 4Z7VA 4XVSH 5SX5H 1NBYA 3KS0H 4A39A 4F57H 3CFBA 1QTPA 4PJDE 5DJXB 4BDVB 5C09E 5E9DD 2WJ7A 4LOEA 4AYGA 2ZXQA 2A83A 2G2RA 5DURD 1V55B 1KGCD 5E00A 2EH7L 5ICZA 4CMMA 4ENZA 1M7IA 4XT1C 1OIOA 4EZLA 2XV0A 1R3LB 3NJXA 3C5JB 2BWDA 2BRRH 3GBDA 2E8YA 4Z77B 5F7NC 2WIMA 4JFTA 1TTCA 1S7QB 2DMBA 2GUYA 4YSOA 3SB3A 2IQAA 3PXLA 4GG8A 4FCAA 3IDIB 3GB7B 3FAWA 2XYBA 4JANA 2Z31C 1SJVA 4EIGB 2GB2A 4HOWA 4IIQC 3VXQA 1WBXB 4G9FA 3EJZC 4WU5B 5T3XL 5C0FA 1IILE 3FSWA 4KKAC 1JWMA 3MUGB 1KEGL 5KAQG 1DVFD 1F45A 5DQJB 4W9CC 1HHHA 3BPOC 3L2LA 3T71A 1GH7A 1U8IB 3L4WA 5IQNA 1MWAL 2O4EA 3UTTB 1LP9B 1N9PA 2CDFA 2VDKH 3O6LH 5EOTB 2LHAA 2QDVA 2XYCA 5C0BA 1SHWA 1JZ8A 2BSRB 4HEME 3NIDB 4LU5H 3DDGA 4KJWD 2V0AA 4IKNA 3U9UB 1PD1A 2WZ5A 4OUUA 4HUMB 5FR3A 3EF4A 3AB0C 4NNYB 3F65A 4ZPTA 1KCUH 4G1MB 1NMCB 2Y36L 1L4IA 3H9SE 4LCCA 1FN4B 2YD9A 4HLZG 5CILH 1INDH 1I85A 4XNXH 2ZWNA 3LNIA 1V3MA 4GBXD 4QOKD 1OTUD 1ZLEA 5BZWB 2VAAA 4FS0A 5I74C 1RULH 2X4TB 3BJ91 5LBSH 1V7MH 3EG9B 4HFUH 4KUCD 2QR0A 1UM5H 3CFJA 3SPHA 1ZD6A 4G43A 2HFEB 2O1AA 3CPLB 4IM8A 1NAML 5AOZA 3GRWA 3TN0B 5JPMA 3QIWC 3AM8C 2IGTA 3X11B 3P3UA 2JKLA 2NYZA 2VZSA 3I75A 4P5MA 2JELH 4PIBA 3T6WA 5DXWA 2K0RA 5FM5O 3MV7B 4H25A 3VD2A 1WZLA 4HK3N 4OGYL 4JKLA 3LEYH 4P5TA 5IMLB 2HFTA 3NFNB 4PV9A 5F89B 2JFCA 3GXPA 3BZDA 4PHXA 4QIRA 1CU4L 5J1TC 3QORA 1URIA 3POCA 4U6VL 1R24A 2XG4B 3HIZA 4HXBL 1WFOA 2Q2LA 2R7EA 2CLZB 2E56A 3QFGA 3TURA 3BKYH 1WIPA 4XO4A 5TE7L 3MRLA 5GS1C 4JRWA 4YJZL 2Q10A 4OLXH 3G5YA 3BGAA 4JAMB 1T22B 2WZAA 3DDFA 4FNTA 1ZV5A 4ZRGA 1GHFH 3EO0A 3IDYB 1JK9B 4HWZA 5FECA 2UZYA 5H35A 4K7PL 3E2HB 4KZEL 1GOHA 3GEWB 2WXGA 4IHOA 4JGMA 3ULVE 4E9YA 3TFKC 1P84J 3B9KD 1FJ1B 4FX5A 3HZYB 4P06A 2GJPA 4MSWA 1YEIL 2CHDA 1K4CB 4LGSB 3TGXA 4O4YH 5IJCC 2IVFC 4YC2B 3BSZA 3RGHA 4G3YL 1RAMA 1GY1A 2J21A 2Z7YA 3AQYA 3NCBB 2IPTL 3EBAA 1N3NB 4O2CB 4E9WA 5B8CC 3E6HA 3VXPB 4PB9H 5FFOA 1DVZA 2R4SH 3SGEH 4G6ML 5HJBA 3V6OA 5TPWH 3F6IA 2AVGA 5AUMB 4QRPD 3P3TA 1XIWD 5ISZB 3O6FB 4S1RL 1MREL 2X4SA 3PABA 3B83A 4MCZB 4M61A 1G6RB 2JTDA 1GOGA 2EXTA 1GYUA 1NUGA 4JO4L 1E4WH 4D7PA 4WI6A 2XZCL 2AQSA 4PRBA 4OCSL 1OB1A 3RVUD 1UQSA 1QFWL 3WLBA 2DQDH 3WUWA 5A6LA 4AUUA 2IQ9H 2ZP9A 3DJRA 4PJAF 3SDDD 3IDJA 1IVLA 1IL1B 3N44F 3RWFA 4IRJA 4UM9B 5CJOL 4W4OA 3QJOA 4NZUL 1JWSB 3RIAK 1GYVA 4LE8A 1KIPA 1U8PB 1WAPA 2HKFH 1MI5B 3MA9L 3UG3A 5CFHA 3QDMB 4EI5D 2PPEA 2PYED 3UC0H 3TX4A 4TVSa 3WO3B 5I1CH 1OARL 2FQGA 4HCIA 4PGCA 2KS0A 3KXFA 1M05B 4OZIB 2FT6A 3RGVC 2QZ5A 3IAGC 1G1YA 4Z7OB 2A73B 3T4AA 3Q7JA 4TKWA 1KBGH 1R6VA 5E6IB 2VMJA 5MERB 3N1GC 3IDNB 3VH8G 4B6ZA 3P2TA 1QEWB 4ONHA 3C9NA 1HJCA 1OLZA 1QVOB 1MHEA 1GGCL 3MBXL 3UP1A 3F7PC 5CGYC 4P2RB 4ZFOA 2YWZA 3ULUE 1T0OA 2AJVL 4NCC1 2J55A 1JZ6A 4FQXB 3M17A 4LAQH 4TTDC 2N7AA 5AVWB 3ZKXB 2V2XB 5J7CC 5K33A 1SDDA 4FNQA 1HXKA 3HN8A 3D69A 3EGDA 1GTFA 3EBHA 4RAVB 3V4LA 3O11B 1HILB 1JZ7A 4HAGA 2FJFA 3CVIL 4ZNEA 4ABQA 4IRSD 4KQ0A 4ZUTA 1EXUB 5E1IA 1A4AA 4RVBA 4F9LA 3D12B 1P9MC 4YDNA 4DK6A 2ZX9A 2X2UA 1QX1A 3ABKB 5DDHA 3BT2L 4DJMA 4UINL 2EKSB 2GVYA 3NCCB 2B08A 4OFIA 2BP0A 5HYEA 3UEQA 1A6PA 1D6EA 1QSFD 2NW2A 4P4RB 1BXVA 3QFDB 4Y4HB 3L3IA 3T4YA 3U9PL 2OSYA 3QG7L 3LKQA 5IOPA 3VGGA 1E4JA 3STLB 1ZTXE 1PY0A 3V52H 3RDJA 1LE5B 3A47A 4BKLA 1NCWH 3SE4C 2R8SL 2RMNA 2YD3A 3QNXA 2V7HB 2XC8A 4L8DB 4KTEH 1MCOL 1E6OL 3NEXA 2PCYA 2P5PA 2R9HD 4N8VA 5DS8A 1UVQB 4MMYA 2KQMA 3MFFB 1KCSH 3APFA 3BSZH 4QXGL 1OGSA 2GBVA 3X1EA 1UFUA 2E7MA 3PJSB 5EBLB 4FHJA 1H3VA 2WW8A 3IDMB 3RNQB 3MROA 4NLAA 4XBMA 5LKNA 4PRHE 2CUAA 2DYPA 3ARGA 3ZTJH 2BOCB 4TRPH 4YLBA 1M7XA 4ILDA 4FA6A 3QXDB 4Z7UE 4DN3H 2JQMA 2H6PA 4GMSL 1K8IA 3RWIA 3C60A 4X7CC 4H7VA 4MXWL 4U1SB 4F2MA 3VMOA 3VNYA 3IGAB 3MRIB 4CJ1A 4HGKC 5HI4D 3CZFB 1EXHA 1V8HA 1G7MA 3DK2A 3QJFA 4XNZB 5ALBL 5KYXB 2ESVB 4G8GB 3FB8A 4TNGA 4Q0XH 5JIMA 4XNMB 4N26A 4MCNA 1C5BL 2J6EL 1QI4A 4LVNB 1RURL 1M6UA 4Y4KD 1ZV9A 2AI0L 1B0RA 3EXLA 4N5EC 1W8EA 5BS0D 2OJEA 2XFXA 5F7UA 1EO8H 3RJOA 5C0ND 3CLFH 4HPYH 2AV1A 3QA3A 5AL8A 3ATBA 3W9EB 1KENL 5FYJH 2C9XA 2XKUA 4LPWA 4M03A 2YBRA 5K1JA 2W8CA 1VGEH 4G7SB 3KYOB 1F1GA 4TQPA 1TQWA 1H8OA 4OQ1A 5DUMH 1JN6B 2IADB 1NGWA 4H2CA 3U46B 4G8IB 3DV6B 3WFBH 3FT2B 1XB6A 1NUFA 2EINB 2VLRD 3JUZA 1OAZL 2W0LA 3L5IA 3MX0A 4HC1A 4F7CB 1G4RA 2BPBA 1O9WA 2VXSL 3HN3A 4FFWD 4ANVA 3GGWA 2NY6B 4OIIL 5GJTL 3PP3K 3VYNA 5FWQA 1RUAL 5FK9A 4EO5A 4PJFA 4S2SA 1N59B 5CXPA 4CNIB 3T2LA 4KQ4L 1RZIA 1QUPA 5BVJB 5HPMA 5I73C 1MLCB 4JFPA 4NQEA 1DVTA 4I89A 5J1SC 2LU7A 4RGNC 1KYDA 2O93L 2DM3A 4MD5A 3TJEL 3CZKA 4Z7WE 5D7JC 4FMVA 3H7BA 4RMBA 3HOGA 4HXAL 3WNMA 1VFMA 3OWRA 4QLWA 1WHPA 1ZJBA 4QRUA 3GBEA 3VQMA 3APCA 2Y6TE 2JKWA 2DQCH 3L1OH 1XSOA 4JREB 1W0VB 1Y07A 2XA8L 1NAKH 3BPLB 3N85H 4N25A 1JPGA 3T1FA 1JZ4A 5FDWB 5GS3A 4I13B 4AIXA 3ILPB 5ESVB 3C2AH 4N2BA 2FIKB 1EXGA 2P7TA 3F7YB 1NEZB 5C70A 4GXFA 1YEGL 1HEZA 4X6EB 3STZA 5KS9A 3ELAT 2EC9U 2LVCA 2VXQA 1UXSB 2APVA 4P2OB 1QBMH 4U1KA 3AQXA 5KOMC 2MCPL 3E2HC 2D0FA 3VWJB 2F74A 3SDCD 4NN7C 2TSBA 1HCVA 2HT3D 1Q72H 1W91A 5T5FL 4BELD 4JQIA 4DKTA 3B9EA 1WZKA 1IAOB 1WZAA 2OR9L 3ZE2F 4AUYA 3R0MA 3OM3B 1BVZA 3AU1A 4JZJA 5FGCE 3I2CH 3MV9D 3W3BA 3WIHL 1QBLH 1JDAA 1AYOA 1F3DH 1TCMA 2EDFA 2OULB 2ZJSL 4GRWF 4KK5C 4D9LH 1BPVA 2APSA 3UL4A 3CHSA 4CKQA 1OCWH 1XTLA 4IMKA 3GXTA 4A7VA 1BVOA 1IEAB 5AW9B 2VSDA 2ROXA 1X5IA 4FJYA 2WM0A 3KWWB 3ZO9A 1ZIAA 3BRGC 2ZX5A 3BEWB 4TXVB 2HKHL 4XXDB 3UGUA 2A6IB 2UV3A 4ODHL 4AEIH 5T1JA 2XUWA 5A1AA 1JNNL 1KWKA 4NAJA 4F93B 4ANXA 3SGJA 4FFVC 3ATEA 3HCVB 4PV1C 4NZJA 3NFPB 1YJDH 2CK2A 3ARTA 1CDCA 4G9DA 3ZE0E 1IM9A 3CGTA 3SPJA 3LPGA 1QWHA 4O51A 5F7BA 4N5UA 4PBWD 2CLVB 3DTXB 4M7LT 2X4RA 5E2UL 1ZPLA 5C0GB 1MLBB 3BH4A 4UT7H 4K2UH 4KDTC 4QCIA 3IBEA 3QUGA 5BRZB 1RK0B 1KJMA 5I0XA 1PG7W 1YPZF 4MNHA 5CZKA 1XGYL 3MLPA 1J1OH 3KR3H 3S37X 2WWMD 2YEQA 4P23D 1BM3H 2GSGB 2MMXA 2O6FA 1HL4A 3ZIMA 4HC1H 1IBZA 4FQJH 5FX3A 4ES8A 4WHDA 1K8DB 2R2EA 2DV6A 2NTSP 3KGRA 3P4NA 2PCPA 5CN3A 1ADQA 5BCAA 3UYRL 4D2NA 4TVUA 3DOIA 4ICXA 5JIIA 1P1ZA 3HR6A 2H9GB 5T1KA 2HRPL 1WIOA 1JRHI 3MRHA 4DP2X 1KLFA 4PYGA 5I0ZA 4BA8A 3JWDC 4JKKA 4XCYA 5EZJB 3LRSB 4G70B 2GSMB 3RUGA 3RA7L 4FADA 1L7IL 4FI6A 2V3FA 3IXAB 3LNEA 3GSNA 1NMAL 4BGLA 4FZEL 2FLRT 1IC7H 4KO5A 5I76B 5DJZA 4YMPA 2ICWJ 4FTVE 4H1LA 3EYUL 1UWFA 2DEYX 2HLFD 3IMTA 3WE6A 1I1AB 3RZCB 5E5RB 3ZDZB 1CT8A 3T65B 4M6ML 1BHGA 4MAUL 3O6KL 1AG6A 2CO6A 3WFHB 3KPLB 2CNYA 5TDOB 1OTSC 3G6JF 3NABL 3QT2A 5FUZL 1Q38A 4WI7A 2VXQH 3IJYB 2VCOA 2C34A 4MNGE 1HJBC 4KMTL 2J8HA 1UM4H 3QVAA 3ZDYF 1FL3A 3OMNB 4KHXL 1NFDF 4GYBA 4Y0GA 1S3KH 4NO2A 2ZSWA 1HOEA 1PYWA 2ATKA 4XE5B 5HPOA 5HHOA 4XNUL 1YQVL 4XWGL 4HIXH 4DP5X 4B96A 3DOHA 1KG0A 5HHNA 2V2TB 4U3CA 3HI5H 4XWOC 5DFVD 3SDYH 4UQAA 2AMUA 2IDTA 5CGBA 4OSUH 3WD5H 2OMYA 5HY9A 2CA3A 5EU6E 2HB0A 1AGBA 2VDRL 2MNWA 1DBAH 3KLLA 3QUHA 3ZTCC 5KSVB 1PX4A 5JOFA 4A7TA 2NY2C 3HJ0A 4Q9BA 4JFYA 3FO2A 1A6TB 4NO3A 1FVEB 1GJIA 4EOWL 4Y16A 1AIFB 4Q6IB 3BKCL 3BVVA 3S34H 2AAAA 3N40F 5KUKA 5DJDB 5E9DE 4I2XA 5IT2L 4M1DL 4FRWA 4U6HA 5PCYA 3GZPA 4QRQA 5DRXB 5EA0L 3CTTA 2AERT 2BXZA 1PG7L 1KGCE 4M62H 3V4UL 5HYJE 4Y9EA 4FULA 2Z35B 1CLOH 3LH2L 2KZWA 5TQ2H 2M1KA 3SKOB 3WEMA 3Q6FB 2X87A 4NAMA 4X5LA 5DVMA 5AOKA 1WF5A 2NLJB 3DMMB 3DVNB 4F20A 3UGXA 1TZ8A 3KJ6H 5JW5A 1WFTA 2YS4A 1JMXA 3OAYH 1AGCA 3GK8L 2EO1A 4XN7A 1CN4A 3FQWA 1MW3A 4LVNC 3L2MA 1Q9WB 2YPVL 5F0MB 4LRNL 3G5VA 2Y7NA 4X9YA 1XGRB 3AC0A 1T1WA 3QH3A 5C8JB 2H47C 5FOBB 1E4HA 4OCRH 4R97B 4K7PY 2C3GA 3ZJAA 1GC1C 2OS7A 5MEPB 4HX1B 2BIIA 1ADQH 4ONGH 3JWDL 3G5ZA 1G9NH 1OZUA 4RGMC 3V0JA 5EBMB 4ODWB 4RX4A 4JZNA 3V4VB 3LIZA 4PVBA 3S2AA 1EDQA 1G0YR 1MELA 4JN1H 4DERA 1NCJA 3KPRA 5DFTA 2BZDA 3HS9A 2PUQT 3HC3L 3NTCL 1E30A 1KNOA 2V17H 1X44A 2VB5A 3EDEA 4WUKL 4CSSA 1J0HA 1XDTT 5E8OA 4DKDC 2Y9RT 3CHXA 3DARA 4GXVL 3NACL 5F1KC 5I6LA 4XPHH 3IMSA 1R3JB 3CDGA 4HJIA 4X7SL 5C9KA 1MFEL 3IJEA 2VLME 1XH1A 3UAJA 4I77H 4H1LH 5DD3H 2QVKA 3AUWB 5KVDE 4WJKB 4QOKE 5LXGL 5DF0A 1ZVNA 4JM4L 4M4RA 2VDLH 5IVXB 4ENEC 4N6RA 1CYXA 2K4AA 1S5HA 1KPVA 4X50A 3UZEA 3MOQA 3LZPA 2GBAA 1VKXB 1A7BA 2EDHA 1MOEA 3BLPX 5IQ9A 3B2MA 1AHWB 3FU7A 5KBKA 3OVUB 2GTZB 2BNUA 3S5ZA 2VIRB 3T8VA 2BNQA 3DYOA 4MASA 1TG8A 3JTTB 1CUOA 2GJ6B 5AAMA 2QADB 2P49B 5LJYH 4JREC 3BPLC 2Z31D 4GRLA 4QPEA 1T4KB 3QIBA 4Y2DD 1USZA 3EJZD 2EDEA 4KKAD 3V0WH 4HUVB 1EJOH 4L3EB 4BFIB 1EVUA 1XR9A 1HNFA 3MHZA 2DH3A 3VXMB 3C5XA 4ETQA 2ENJA 4C56A 3L3KA 5DWPA 4NC0B 4Y2OA 4EZKA 3DX6A 3EYSH 3N42B 4PJBE 4BRVA 1IFGA 3VG0H 4DTGL 5EO9B 4L1BA 4F8QA 3SDXA 4H13C 2F1AA 2JKXA 5DC9B 1BQLH 4P2OC 2EDNA 2BIPA 3RFZA 1B0GB 3WJLA 1C5CH 2XN9A 1TJMA 3HZKA 4P59H 3VWJC 5HDWA 3FO9B 5C08D 4ZMOA 1Y6KR 4IMLA 1K72A 3NQIA 2YPKB 3HW7A 3ESUF 4JPWH 2GUOA 4ZDHB 3WKPA 4GLRI 4MLSA 1OF2A 4BSVA 3PIQB 4NI6A 4GINA 4WHYH 2BSTB 3HG4A 4MQXC 4ODXA 4HGWB 3TS8A 4P9HC 4FQIL 4KOCA 2JXMB 5BV7H 4MJIA 3V0AC 2Z1PA 1D5IH 4PJGF 3TZVB 3LVTA 2XXGA 1BPLB 4MJJA 1WK0A 3T0WA 4X99A 5HI3C 1Z3GL 4Z95H 3SY6A 2AABH 3PS6A 1KEMH 2CBOA 2FWSA 4GI6A 1LE9B 4NJ9L 1AD9A 2XV6B 4HT1L 4Z5RA 2HT4C 3QIWD 3ZTDC 1CFNA 4HBCH 2JLLA 5DQ9B 5FLUA 3OKLA 1RUQH 1QNZH 1VESA 3MRRB 4FC3E 1GC1L 1CFVL 3P3YA 3GDCA 4UQDA 3CZSA 3ZE2E 4HJGA 1FIGH 3H0TB 3N1MC 3N3EA 5CM1A 3QCTH 4XZ4A 3QZNA 2JB5L 2E76C 4LO9A 1HZHH 3E0GA 4A7QA 1NCBH 5FCUH 4RWYL 2I07B 2PPAA 4KO6A 5IW1B 2BERA 3SO3C 43CAB 2EYRA 4UQ9A 4F8OA 4DF9A 1GS7A 4OVUA 3SOBH 3BLBA 1NC4D 4L4VD 2HJLA 2IPUK 3QI9A 4BIKA 4KI5F 2ZUVA 3RU8H 4P2CG 3QJHB 2YC1A 5GJSH 2QFPA 3SY0A 2D3NA 3L95A 4XCCL 4FQ2H 2F1BA 1LWHA 1N64L 2J6WA 2VR6A 4YDIL 4WVRA 4YHKH 5IG7B 3KLDA 4QD2E 1ZE3H 3WXVH 5IJVB 2GK0B 1CXEA 4X6CE 3U83A 3PWPD 1FZJA 5D93B 4ZMTA 3TFKD 3IFPA 2EXYC 3UZVA 1BVNP 3UBHA 2AJYH 4XAWH 3AT9A 3KG5A 4K5LA 3DSNA 3BQUB 3A4AA 4JFDD 3D09A 4K9EL 4P9MH 3RY5A 4A2GA 4AKPA 2DQHL 4GH7B 1A3LL 2WWOA 1WAEA 1ROCA 4MB1A 2BY2A 1FNEB 3RIAF 1SDAB 2ADJB 2XBZA 1KDIA 1U8MA 2B0SH 4HHGA 4WI0B 1NEPA 1SXNA 1QAWA 2VZOA 2P80D 4TQ8A 4BK8A 3WY2A 3GS4A 4L2YA 4X9HA 2CALA 3TA3A 4O2EB 4TLUA 5LQBL 3J7HA 1PNDA 2BWQA 5MEND 1I1AC 3RZCC 4UDTB 4YDKH 4WO4C 1A9EA 5DR5L 1DDHB 3C09C 4FF9A 4QF1B 4APQC 4W9IC 4UYQA 4X5PA 3ET9F 2ICWB 1KY6A 3VA2C 1T21A 4WW2C 4KRMB 1HH9A 4R4FH 3B9DA 4MCYA 1TNNA 3L9EA 3ZMRA 2Y1VA 1ZHBA 3F7VB 4P5SA 1QACA 2IDUA 4U1IB 3VGEA 2ZPKL 3S5LB 4XNAA 3VD4A 1OW0A 5GSVB 3MJ6A 5DEGB 2OX5A 3B9VA 3KPSD 1VFOA 3HTLX 4LSUL 4UT9L 4M29A 2YD2A 5DHXB 1T89C 1QSFE 3LV3B 4P9HL 1V10A 3VE0A 1ZKAA 1J0YA 4JM2C 3VGDA 2X4QA 4Y9FA 5FXCH 3WBDA 1P4IL 2VDNH 3QUYB 4OLUL 1BD2B 1KPRA 1A6WH 1T5WA 5B38A 4LCWA 2WZ6A 3UPRB 4XNQA 2R1XA 3CE1A 4ONOA 4P46B 1U8HA 3D07A 5C07B 4EI6B 2J4WL 1UA6H 4S1DC 5EIVA 5DFAA 3RGVD 3I50L 1JTTA 3VQ2C 1O6SA 3J2PA 5D1QE 3U2SA 1YQ2A 3C8KA 1YYLL 1NFDE 2GKIA 4OZFA 2PETA 1H15B 1HXYA 2OFQA 3L9RA 4I5BA 3GUFA 4N0CC 4PJ9B 1PS3A 4P49A 4DWHA 1XGPA 1YAZA 1YMMD 2ZCHH 2IIJA 5INDA 3GMMB 3V6BR 5ILTL 2P46B 1A7PH 2ZUQC 5HTSA 1IAKA 2V7NA 3CC1A 3MCG1 2Y7MA 3DMMC 4XP9H 4WK2B 5CGYD 2WKOF 1CDYA 3D18A 1NCAL 4RSVA 3VXUD 1MCLA 2BSSA 5CINL 4CADB 3H55A 5B3JF 4KRNA 4O02B 3GHBH 3MLZH 3UG4A 2WXLA 5AD0A 1B9KA 3DJTA 1Z5HA 2O5ZH 1AKJD 2ZOKA 1EO5A 3ARDA 5IF0A 4XE0A 1T7VA 4XO8A 3DUSB 3QZOA 3PAVA 5DJ8A 1JZHA 5IB5A 1FNLA 2FJUB 2EIZA 4PJ7F 4C4BA 1C1EH 4G6AC 4R97C 1A9BB 2C9AA 1CICB 5BS0E 2DF3A 2RALA 3HG1B 3L7FA 5DMKB 4NHUA 4UU9A 5T1DL 3EDKA 5EU7E 3TBSB 4X4ZA 2XKNA 1D5RA 3QDJD 3K4AA 1A7NL 1P5UC 1RIVL 2PPCA 3D2UA 4PV8B 1ZXKA 5L0QB 3LOWA 3WTYA 4Y5XA 3QZLA 3BZEB 5FYKL 5B1JC 5IEKB 5IHZA 3DXAB 4NT6A 2ALWA 3IRCA 4AQ8C 5KSAB 1WV7T 1UGNA 2YA1A 4OLEA 2QPFA 5KBPA 4PGBA 5A16A 3SBQA 2C3WA 5DJ0A 3MRKA 2VLRE 5F1OB 2XN2A 4PRPA 4DAGL 2YR3A 1GKEA 4PJEF 3S2CA 2MPVA 3ATAA 2YSTA 4XPGL 5SX5K 1GCFA 5DD5H 4OUOA 1ZY9A 5KYUA 4BM7A 2VGLM 4UB0H 3I6KA 1U21A 1E50A 3QK0A 5AG9A 1XF2B 2E75C 2RFXB 4V2CB 5DGQA 5ACMA 3EGXB 2F7PA 3CFDA 3WJMB 1BMGA 1IEBB 2PR9A 1KB5L 3CLEH 1KLGA 3BUTA 4NS0A 1PZ2A 2Y0SA 4HIEB 3HRPA 5D1XB 3QC5X 3FQYA 1TJGH 2X1XR 2FX8L 3A4FA 1CFSB 2DI7A 3RY6A 4WAFA 3H56A 1AXSB 1DN0B 1Q9OB 4JRXB 4TSAH 1KWGA 1G7QA 1ID5I 1VCBC 4XX5A 5EF3A 4N5ED 4MB5A 3EFOA 3IFLH 1NGQH 5DVOA 2Y1YA 2NYKA 1A7OL 1J05A 2P4AB 1NGYA 4PCSA 2QGDA 3FBKA 3PFUA 1S7WB 2Y2TA 3CSTA 2A1WL 3THMH 1MH5A 2PCXA 3U7YL 1DJSA 1CQKA 3KLAB 4GXUN 2AXFA 1XF5B 5CO1A 4ZZFA 2OI9B 1IGFH 5KSUA 3U79A 2ENQA 1H9VA 2G2NA 4WTZA 4YAQA 2H2PC 4R90L 4AMXA 1D5MB 3V79C 4OZFH 1OSYA 3NJMA 2BVPA 4K5OA 3PRZA 2PYFA 2NUPB 4KRLB 4RFOH 4AG4H 1FFPB 3J27A 4OZ4B 4PPTA 4PP2B 4MHHI 4KKQA 3ABZA 2NY7L 2BIMA 3I9IA 1CO1A 1XGQA 3D52A 2WMPB 4MXQC 5G4OA 7FABH 3KHQA 4XTRC 1ED3B 3VJ6A 3ZRCC 4J3XA 2XACC 4K23H 4RGND 5D7EA 1E5CA 5LN4A 3TN0D 2X10A 4GXUM 1NLDL 4KJPC 3B2XA 4RISL 1S7SA 4HWEH 3PDOB 5L2KD 1FLTX 1KC5L 5D7JD 1MJ8L 2VRAA 5GGTH 2BVQA 4I18B 4PJ8A 2HFFB 3MV7D 4EBQH 1QUNB 2CO2A 2W1NA 4HKXB 2DQJL 4D9QD 1P84K 3FQXA 3W9DA 2X7LB 5C09A 2Q3AA 1A3RL 1NAMA 3PJLA 3QIUB 1GXEA 1BBDL 5E2VH 2X42A 1PMYA 1HC1A 2MJWA 1F56A 3MR9B 2XDHA 4LDCA 1G9EA 1OHZA 5D72H 4DO5A 4AW4A 2VERN 1JGEA 2WQSA 4DUXA 4ZX6A 5C3LD 1TPXB 3D50A 2IPKB 3II2A 4NGHH 4N0RA 5EOCH 5F88A 4ELMF 2DEXX 3FTWA 4LF3A 3OLIA 4E0RA 1G7HB 1UWEL 4AYFB 2CJUL 3N41F 1I3VA 2GAZB 2Q3ZA 4OVVA 1KIRA 4BUQA 5IHWA 1RJZA 2R0KL 2FEEI 1U92A 3CFQA 1OSPH 3P9LB 3EOAB 1B4JH 1E7UA 2OMXB 2O5YH 3MA7B 3PV6B 3PL6B 2JB6B 1ZK5A 2LTQB 2RGSA 2NY4C 4JFEE 1DEDA 1SY6L 1XQ4A 2VN4A 4OD1H 5D93C 4B7LA 4OLYH 3R8QA 5E24E 4I9WD 2J43A 3VXNB 4ALAC 1SVCP 5DYFA 5IW6B 3BQUC 1FA4A 1ZMYA 1ZGLB 5GGRB 3WMSA 2EEFA 4HEMA 3K0WA 3IJSB 1L0QA 4M6OH 1XO8A 2IGLA 3IF1B 2FR4A 4KI5E 2BOBA 3NZHH 1TZHA 4JPKL 5GQBA 3CSFA 4P3CL 1BQHA 3FCTB 3BD3A 3GF8A 1TF4A 2VZTA 2ZWSA 3H9SA 3R19A 1NDMA 3W81A 4WEUD 4F8NA 4IBQA 4R8WL 4EQ2A 2HLAA 3MBWA 5B3SB 1SGKA 3PWUA 2UWEB 4HUXA 3VFPA 5DRNA 2W81C 4GO8A 1BJ8A 4F92B 5JZ7D 4FFVD 5EBGA 3NSXA 2VLJA 5C92A 4UZGA 4EQ3A 3PV7A 2HVBA 2QHLA 4ODUA 4KWUA 2X0UA 3ZKQD 1VACB 1D9KA 2FD6H 4NC1E 2W95A 3X13A 5DVPA 5IIEA 4HUWB 2YMXL 4PFEA 4K7FA 4YSQA 3W0WA 3IVKA 4N3TA 5AW0B 1VFUA 4UM9D 3DVIA 3TBVA 1HQ4A 2Q76B 4MTMA 3QE5A 1DUYB 2NY1B 4GKLA 3SYCA 4DKEL 3TYGL 1MI5D 4GAYB 5I1HH 2ZP8A 5ID0B 4DPCX 4AE0A 3QDMD 3Q44A 1XR8B 4D3CL 1ZLVK 1GGIL 4U1HA 3AREA 4F2FA 3F7QA 4PSRA 4JFXA 1E42A 5KYYB 4ZK8A 1OALA 1SYSB 3ABGA 1YN7B 2ZTBA 4Q6YA 5ALCH 3ZL4H 1JGUH 1G7IB 3CDCA 1E28A 1NCDL 3T2OA 5C7ZA 3GSUA 3KPQB 5AEAA 1CBVL 2BNRA 3FYIB 2VQUA 3FQNB 2EIKB 4XOBA 4YHML 2PTTA 4U31A 2G5UA 1N8ZA 2HZHA 1JMZA 4JDZB 2F08A 4C4KO 4KX7A 3WEAA 1W80A 4PWKA 5KBLA 3S8GB 2C4XA 4RA3A 1NAMH 1MFUA 3GMNB 3LHAA 4P2RD 3RX8A 4Q9CA 4OM0L 1OE1A 2GT9B 4FQXD 4KI1A 4LPCA 2Z1KA 4FQCL 5IJDC 1TJHH 3ENEA 4QYOA 5F21B 4HCGA 1QRNB 3B2PA 5D6CB 2C9VA 3PQYB 4PTUA 3EO1B 3QRBA 2Y06H 2IG2L 1IBHA 1OTSD 2ZWKA 5E8DL 2F5BL 3KLSA 3B3IA 2FATH 4KDVA 1RV6X 2E7HA 4JJOA 3DJ9A 4ALAL 4X5XB 4J39A 2X0VA 1GA2A 5L0QC 1CR9H 1YUHA 5ITBH 2LABA 2Y72A 1W16A 4ZTPH 4EVNA 1HEJC 4XWOD 5CZXC 1PZ5B 1MFDH 3CFEA 3SGKC 2YJQA 3OPUA 5KSAC 5CCKL 1UKQA 4E9VA 5CZVL 4GY4A 1A2YB 3TL5A 5I8KH 1D7CA 2QVIA 4EDXB 2NY2D 1R46A 4F9PC 2K3TA 3QJXA 4PJ7E 4UDUA 5EUKB 4ODTH 1GMIA 1KGIA 3JVFC 4RMVA 4K5MA 2NY5C 5ANMA 3BWSA 4LIQL 2NY0B 2OAAA 3H6JA 2BWIA 4G3YH 2P45B 2VJ0A 3MV01 4U1NB 1EH9A 1IGJA 1MQKL 2IPTH 3BUYB 5ENWA 3ULSA 1HNGA 3GT6A 5PAZA 4PJXA 5D1XC 4JB9L 1MCEA 3LSOB 2FUTA 4BK4A 3NIDF 4ZUWB 5BZXA 5F9JB 2ESVD 3TT1L 1UXLA 3VNZA 4HQQH 1YC8A 4GW5B 5I15H 2BY1A 2NQ3A 2W94A 1JPTH 3TYFA 2JJTA 1MJ7H 2Q8BL 4WFFD 5CLZA 4OCYL 2MQCA 3RL1B 5I6KA 3CVHA 3T0VA 3U0WH 4KXDA 4TUJA 5E8PB 2XQBH 4ZW7A 5EEZA 5BJTA 3WFDL 5JR1L 3GXMA 3V0VB 2HJKA 5IGXL 1HAWA 1PD6A 3VRJB 4MNQD 3V6ZB 3D9AH 3NSCA 2OXGA 3MGOB 3MLUL 3FFCD 4X6FB 4ODBD 3TJHC 5FPIA 3ZTNH 1MIEL 1NCTA 5F1NB 3G7TA 2X6BA 4L3FA 4IBYA 1YNLL 3UTZB 1ECYA 4K3DH 4TSBH 4B5ZA 1HHJA 1ORSB 1OARH 1N5AB 2EDMA 2IV8A 3MVSA 2YD4A 3B1UA 5GHWH 2UY7B 3KL3A 2WKGA 3APMA 4O02L 5T3ZL 2ORBL 3BAEH 5I2IB 4Z76A 1KJ3L 2EYSA 4U4IA 3ULVH 1Z9SB 1AMYA 2CXGA 2XIDA 1QFPA 1VF5C 1I1CA 1SN5A 4L29B 5EEVA 3EHBB 1ASPA 3VDBA 2EUVA 4YXLH 3H1ZA 1J12A 1YECL 1CI5A 3M1OA 5I8CB 2DL2A 3OGCB 2YQ2A 4F7PB 5IMOB 1X7QA 4Z76B 3MJ9L 1R3KA 2ZCKH 1C7SA 2OCCB 3LS4L 2ZONA 1P2CB 2J2ZA 4HALA 4A6YB 2EYTA 4WHTA 4F15B 1XSKA 1W72L 2C9SA 2VR5A 4E5XG 4ODSL 2WNXA 3GYRA 3C75A 1JNHA 3P11L 1KLUB 2H8PB 2NNRA 3ESNA 3BVUA 4NC2B 4JKNA 2NX5B 1QKZH 5A43C 3HNVL 3BT2H 3FQRA 3MNZB 1YNKL 3LKPB 2X70A 2VDOL 3QZWA 5GGSB 5IB3A 5I19L 2AEIT 3KPOA 1J0JA 2BVYA 2V5MA 3P9MA 4U1GB 3SE9L 2NY5L 1T7ZA 4P2OD 2F5AL 4C57C 3FC8A 3QFJE 4IK6A 1EV2E 1KYAA 5KYWA 3NJNA 3VWJD 4JZOB 2Q8AL 3F3HA 4ZMYA 2LTQC 3FUKA 4IU3A 3UTPD 2H0JA 1G87A 1LO3L 4NOFA 3S36X 4ELKA 1N6QL 1U3HA 3PHSA 4C47A 4ZFQA 1FV1A 3HUJB 5I1LB 1DR9A 1BZQK 3AAZA 3PWPE 1IKNC 1DFBL 4FNLH 4ZS7L 1A1MA 2B1AL 4YXKH 1U93A 2V5YA 2VL5B 5FM4A 4UQCA 2C1PA 1KIQB 1JPST 2DTML 3EZJB 2APBA 3P0YL 5L2JB 4YS4A 2HWZH 4F7EB 5HI3D 3GSVA 1RHHB 1BSIA 1J8HA 1DQLL 5BOJA 1INQB 2R0WL 2V6HA 4PLKC 3IM1A 2HT4D 3SCMA 3PGFL 4HF5H 4M48L 4MXWH 2DLHA 4IOSD 3WIHA 4KDWA 5DVNA 3KYMA 5MENE 2IALB 3MACH 3L4ZA 4FI7A 4RDQF 4OJEH 4OU3A 1RMFH 3CVHH 4KKBC 2L3BA 2DWSA 5FKAA 5HYIA 3D30A 4AXWB 1CGXA 4PB0H 3NDZE 3TASA 3Q9QA 5F7DB 3TVMC 3IJHA 3ULUH 1AR1C 1NEUA 3IFOB 4Z78B 3HKFA 1RI8A 4Q58C 3DRQB 3OPZH 5IROA 1ZT1B 1R47A 2JF1A 4L4TB 1JZ5A 1R5VB 3APDA 4OZIF 1FPTH 3FTGA 2VWEC 4NPYB 3H8NA 1P4LB 4FXTA 4KFMA 2LGNA 1KJ2A 1YEEL 2VDQH 4GW4B 5CZRA 4Z0XB 4Z7OF 3UOAB 1A3QA 5F9AC 3VSUA 5IQMA 3HE6A 4UQ2A 3SQBA 1KENH 2XPGB 4HJTA 4PCKA 4HSQA 3RVWC 1UCBL 4QY8B 4WUUA 3P0VH 2KMWA 3KPSE 1JXDA 1HCYA 1YEFL 4G5ZL 3CIQA 3B34A 5T1LD 2DQTL 1CGUA 3KPTA 1L5GB 4PW4A 4C55A 3FB5A 4OGAD 1G6VK 1OEZW 1XH3B 3RWDB 5JHLL 4QRTA 5FYLL 1K4DB 3GUTB 1ID2A 3FT3A 1OQOA 1ZTXH 1Z0MA 3WO4B 1Q94B 2WLKA 2EXYD 5C7XH 5LXVA 1TZIB 3KYNA 4YWGH 3KBFA 3MO1A 2VL4A 2XQYG 5CR1A 3VD9A 3RTQA 4AGOA 1OOAA 3MLSL 2QFRA 5FYKD 1TO5A 5ICYB 5IFJB 4YHZL 3L3OA 1IC5H 4WK4B 3MJGX 5TGBA 1RVFH 3FL7A 2X2IA 2UYLA 2HT2D 1OAKL 4GSDL 3MLVH 2PWDA 2HVKA 3GXFA 3L2NA 5EN2B 1UWYA 3QR0A 3V6FB 5FHAL 1I1AD 1ROWA 3LKOA 1Q9KA 1YMME 3LXBA 4PJIA 3RZCD 3BAKA 4GKZA 1TKWA 2VN5A 1CGSH 1LQBC 3OXSB 2FX9L 4APQD 4N0YL 1M6OA 5DO2C 4A38A 1LO5B 1AGDB 1X9LA 4PY7A 4WENB 3VYOA 3VXUE 4LDLB 4GAJH 1BDYA 4JKPL 3I3DA 2QZQA 3ZUNC 2VYRE 5D7IB 4MQ7B 1ZWIB 4UMGA 2GTWA 3KPMA 2NPLX 4GNKB 1VENA 2VDMB 3M45A 4IBSA 5GZNA 4HAKA 2FBJH 3BDXA 4GG6B 1T1ZB 2UZIL 3FO1B 3HEIB 4JG1L 4K3EH 1M1SA 2AV7A 4TM9A 3O3EB 4ZUVB 5C0IA 5HYFA 1CF8L 1T2QL 1IB5A 4ZFZA 2FWOB 2CG9X 1ZLSH 1BFSA 5EFIB 3TT3H 4MMXB 3OLDA 2DM4A 1ZTMA 1TU2A 3UXFA 3DPDA 2X3CA 1OM3H 1JGVL 2CDEB 4XC1L 4HZLB 3L6FB 2WXPA 5TDPB 3ZHKA 4DGWC 3UJJH 4XPBH 4LSTH 1FLRL 1AAJA 1FUNA 1LEKB 1WEJL 3LYRA 2YPLA 2NSQA 2YEVB 4AGMA 3PXJA 2ATPB 4NDMA 4S1DD 4P57A 4A7SA 2AQTA 3QDAA 3VRIA 3GJEA 1KMGA 3MRQA 1F3JB 5LCVH 3QZPA 1E9QA 3ETBJ 3HPJB 1BGXH 3Q5TA 1IM3D 2F8OA 4XPFH 4ZPVA 3WIHH 2ZKXA 4DGUA 1TDQA 1B4RA 2XX1A 2Z65C 1NSNH 4HIIA 3P3SA 4XVUC 5KVGL 3PF2A 3D3VD 1LO2L 3L5WB 3HLAB 2CK0H 3VU2A 3DMMD 2KZBA 4KGJA 3OJDB 5KVFL 2DPKA 4KKPA 3NZUA 4PJ5A 1ZDSA 4GUPB 4POZC 4HKJA 3T0EA 3NGBB 1PZUB 1NGZA 3MRCB 3H9ZA 2G3NA 3ZPDA 2VZVA 2AKRB 4PJAA 1KJ2H 3UTSA 2VSKB 1N0XH 1ML0A 3MOAH 4NQDA 5EZOL 1FL5B 4BV1A 3IDUA 4XNDA 3NJIA 4PRIB 3ISRA 4ZG1A 1CFQB 2YK1H 4G6AD 1YN6B 4WU7B 4JDEA 2AGJH 4XR8C 3DV4A 4X98B 2YPVA 3A4DA 3UTTE 5JORA 3T0DA 1LP9E 1EUUA 2XWJB 3FU9A 1AI1L 1WC7A 3GLZA 4YE4H 5B1AB 4D8PA 1WS8A 2WTPA 2XZQL 4RFEB 3NIDE 25C8H 3GBMH 1OSEA 2JH2A 1CDUA 2O5XL 4QMEA 1G9MH 5I5RA 3REVB 1AQDB 1EHXA 3E80A 4FHKA 4HHAA 2ZCLL 4HKZA 5I1IL 5JHAA 4K55A 4G8FA 5JHBA 3MLTB 1IGYA 4QI3A 5E1HB 1JNLH 1U8QA 4D0CB 1S9YB 4NQQA 1HHKB 2XOTA 5GZOC 4A2EA 1E43A 5IBTL 3RA7H 5I1DB 2MNJB 2X12A 1NBQA 3HR5A 1T20A 1L9NA 3MLXL 4BQ9A 4FZEH 1B6DA 4AM0Q 4F7TA 1SJHB 3EHBC 4BFRA 1IAIH 4MDRA 5KSBF 4W70A 2PPFA 4R4BA 5C0CB 3H7LA 1NBVL 4YHNB 1UWGL 2UX7A 1SYVB 3EYUH 1DANU 4ZXBC 1QSVA 1AJ7L 3MI6A 2CR3A 1XVSA 1OLLA 3V4PL 4FNSA 1CDJA 3MV7E 1H3TA 1CLVA 4DP1X 3OKKA 4F15C 4D9QE 4W9GC 3X12A 1WCBA 1PX3A 5E9DA 1E40A 1G1OA 4L3ED 3QCUL 4FG6D 5FUZH 4YDVB 1FGVL 2XG5A 2VR9A 3VXMD 2H1PH 1F41A 4AKOA 3IGFA 5I75C 5SWQB 2FTAA 1H8SA 1Y0LB 3GMRB 3N9GL 2BVOB 2ITEA 4YK4B 3CU7A 4J3OF 3BW9A 1JXFA 4QXUL 1ZHLA 2CWRA 5CLXA 2B8OT 3ZBMA 1MJJA 1XMEB 3H3PL 1MXDA 3Q8BA 1F97A 2PW2A 2VKWA 2HX9A 1M3JA 3HFMH 2G3XA 2H2PD 1ZVSA 2DWTA 2DQGH 3WS3A 1OAYH 3M88A 1UACL 3R06A 3RHWK 5T33L 4G80B 1U33A 3UCRA 4Z8FL 4B41A 1IMHC 3EO9H 4P8QA 1MAKA 3CWGA 4MYWB 5F9OH 5EEYA 3T8XB 5AAPA 4I9WE 1T3FA 1O0VA 3O8XC 3P4OA 1RZ8A 4EOWH 5EIIB 3K2UH 3BKCH 1CL7L 3SE3A 4Z7VB 1N5YL 1ZJAA 1YEDA 1JPFB 4JY5H 3TBTA 1NBYB 5HHQA 5CF3A 5D1ZC 3CFBB 3LNGA 4MXQD 4QXVA 2AQQA 3RFRA 3VG9B 1F2XK 4XTRD 1SXCA 4KAQH 4Y5VB 4NUGH 2BK8A 2YARA 2A83B 2G2RB 3ARBB 1KCBA 4MWFA 4RMTA 4AQZA 2YD6A 1GCYA 3L3GA 4E41B 4KJPD 2JMRA 4PGEB 5E00B 3UPAA 5ICZB 4CMMB 1PZAA 4WNQB 1M7IB 1NDGA 3GSOA 4DQOH 3OHMB 4TVPL 5DT1H 1BX2B 1GS8A 4LVHC 5F70A 4B9IA 3GK8H 4DP9X 5ISZE 4QOKA 2KZ1B 4Y19B 3OKOA 3O0RH 3W2DL 2IQAB 1G1KA 2YPVH 4GG8B 3QXVA 5F7EL 2TRHA 4C8XA 4B53A 1WBYB 1F4XH 1NOLA 3JYBA 1KCVL 1SEBB 4HD9A 4JANB 3S4SG 4F8PA 2O6EA 4M4PA 1ZHNA 1OE3A 3UBXI 5C0FB 4G9FB 4XB3A 1U42A 5L7XH 1JWMB 1Z9PA 1F00I 5JIHA 2GG1A 1NEZG 1LK3L 2XIIA 3QXAA 3BSHA 4PVLA 2W0KA 4XNYH 5D8JH 2CDFB 1A6ZA 1NCOA 2ICWI 2JE8A 1EK3A 3GMOA 4WI2A 4MAYC 2I25N 5E6YA 1MI5E 1T0MA 4BFGA 3LD8C 4MMZA 2JKNA 3RDTB 3QDME 3ZDZF 3BVDB 3DGGA 1KGWA 2J20A 3IDGA 3QWRA 1ETA1 4OUUB 3MQIA 1MHPH 3RNKA 5JMRA 3BQUD 5DK2A 4HGMA 3V5HA 3EJSA 2YAFA 3X3GH 4Z7OE 5LXGH 1UTDA 3O9WC 3DX8A 3I6GB 3DHPA 5BVPH 3ZKND 4B27A 4KUZL 4CJ0A 1WG3A 5DZPA 3N5AA 4G7YH 1YMHA 1YLBB 3X3FL 1ZEAL 4ZW5A 1IGML 1EHLH 4Y1AA 3CFJB 2EUXA 1CD9B 4OIAA 5DJ6A 1DCEA 4G43B 5FW7A 1J1PL 3TBWB 4QJ5B 3GBNH 4P2RE 2QEJA 3T3PB 3GJFA 1VERA 1JERA 4KJQD 4LP8A 3Q01A 3I75B 5L4FA 5IESL 3TWCL 1IZKA 4M93C 1YNTB 4M8QA 4H40A 4FMFA 5I26A 2DM2A 4MB4A 1BCIA 1CD1A 4R5TA 5HGAA 4PV9B 3GKZA 5FKPA 1BEYL 3NRPA 4FZ8H 2OV0A 1J86A 4D9RD 3F05A 5EB9A 3ARFA 3AY4C 2X6UA 2EZ0C 1AVAA 4XB8A 2ERJB 2VNCA 4XP5H 1SXAA 1CF1A 4UUJA 1R24B 5FUOL 3B5GA 5DHEA 2R7EB 4GRMB 3NCMA 4N9OB 3MRLB 4MMXC 5D7HA 1OP9A 2LW3A 3W39B 4F33B 3ATDA 1BD2D 4MZRA 1AGEA 3G5YB 4DZ8B 3T0AA 1A5FL 1A6VL 5J12B 4CC4C 1W0WA 3MRFB 5A2AA 5AYQA 4L3CA 5C07D 4HPHA 3HMXA 1FAIH 2E3VA 3I74A 3WFCL 5FECB 1V54B 3ZE1B 4OI9A 3GWJA 5D96C 1SN2A 2RD0A 4IHOB 2FO1A 1RPUA 4QO1A 2W07A 1X5FA 3OB0H 5I1GL 1FCGA 4MSWB 4RZCA 4PCTA 3LN5A 3S96A 5F7KC 1E4XI 1ULVA 2WLLA 3ARXA 2XRAH 2ARJQ 3TTYA 3TO4B 2D4DA 1G0XA 1S78C 4PJ6A 1J0IA 2NNAA 4DT2A 1DEEA 2FJSA 1NTDA 1PKOA 2QMKA 1BZDA 5KVDH 4EI5A 3HMWL 3DTUB 3MUY1 2DOCA 4V1DB 2IAMA 1OZTG 2X89D 1M4KA 3OX8A 1XCQA 4I1NB 4N2AA 3NGBC 4LLQA 4ZZKA 4LHUD 3CXFA 2BHFA 4QHNA 4WEBL 2ICCA 4LSSH 2H0PA 1YPZA 3MV11 2ESVE 2L04A 4XMLH 3MDJA 3ZYJA 2DMCA 3NH7H 2ZUSA 2QQNH 2XXMB 1YYML 1ZT7A 3WDJA 3BVXA 3PYCA 1S9VA 2FJGA 3PLYA 4NFDA 4OJYA 4M61B 4PLNC 3CMOL 1SRDA 1GY2A 2FL5B 1IU1A 2VR4A 3AS2A 2XZAL 2P52A 3JTBA 3NP4A 3I6LD 1BVNT 3R1GH 4PRBB 3DROB 2ZWLT 4G82A 3QRLA 3Q2LA 1OTTC 1OGTA 3AS0A 1LYQA 4QJ3B 5IVXF 3WUWB 4FABL 4QHLA 2BFVL 3KDPB 4OLVH 2NZ1A 3QPXL 2IDCA 4IJ3C 1FRGH 3J8F7 4X80H 5DCCA 2DQFA 3DXAD 5CZXD 4IRJB 4LNVA 3RWFB 3WXWL 1I3RA 4NBYB 5D7LD 3RPBA 5KSAD 5DTFB 2ZUYA 4BWUA 1BYPA 4NOBA 2JQAA 2CKBB 3OJMB 3O41A 3NQKA 1UKTA 4HOZA 4YSUA 4X8GA 2ZUWA 4NUJA 3RPKA 2CZNA 2HMIC 2DQHH 4FLQA 3EYOA 4B7IA 1HOCA 2ADFL 4P0DA 4AL8L 3BYYA 1SUJA 4PGDA 2DW5A 4KROC 4N2NA 4WO4A 1UG9A 3T4AB 4DP4X 3F58L 2WN3A 3MKKA 3GJFH 2P5EA 4PH8A 3C5SA 2HN7A 2KI6A 3N42F 2MOGA 3DIFA 4OQTL 3G6JA 1AO7A 5D1XD 1IGCH 1GPOH 4WW2A 4IOFD 2H2SC 5D2NB 3ETSA 2Q1EA 4HWNA 4ONHB 3BPCA 1UB6A 1MVFA 3C9NB 4PWIA 5DSCA 2RA1A 3ILQC 3K8MA 1FYHB 4L9LA 1MHEB 3PHQB 3GSRA 1D5BA 2G30A 5D1QA 8FABB 4I48A 3HC0A 2DL9A 4JRXD 2NXYB 2B1HH 1PL3A 1S5IL 1CE1L 1SDDB 2VO5A 1P6WA 3D69B 3EGDB 4URTB 2WP3T 1NBCA 3GO1L 3TPKA 2FZ3B 4OGZA 3IWUA 4ZUTB 4FGMA 1TQBC 4JM2A 4O9HL 2Y5EA 1VHPA 2OW7A 3O45A 3PWJA 3R18A 5DDHB 3DI2B 3S98A 3NJFA 5E99H 12E8H 3VD5A 3B6SA 3S37H 2O30A 3HMXH 1D6EB 4JCWA 4M00A 2CMRL 3L3IB 2WNGA 4OLUH 4GKSB 3MRBA 4BK5A 3BKMH 3NPSB 5EWIL 4Y4FA 1I8LC 3CHRA 3UTPE 3QEHA 1UCTA 2YUXA 3QNXB 2Y23A 3QRFM 4XVSL 4GMTH 4F57L 1A0QH 1XTMA 2PXYA 3TO2A 4AIZA 4R3SA 1RZKL 5DS8B 4MMYB 2MPAH 3S88H 2JKSA 3HAEA 5KJ7E 1D5XA 1S7VB 2PPDA 3VG9C 1S9WA 1I1YA 4K4KA 1V27A 1I9JH 4N2CA 5FYLD 1UADC 2DRUA 2BRRL 4N90D 4OAWB 1J9TA 1I9EA 1VZGA 3NIFB 2DYPB 4AC2A 3ARGB 1MUJB 2E4TA 1TUPA 5C0RH 2X9ZA 1E6JH 1BQRA 3A5VA 3DPBA 2GJJA 4IDLA 3RWIB 4AENA 2BY3A 3K80A 1PSKL 1MPAH 3QIUD 1P7KA 2PWEA 4RNRB 5M95B 1G7MB 3TNNA 3LHPH 1DBBH 4I9XA 4MJ6B 5EU3A 3DTDA 3HC4H 5K1VA 3FB8B 1TZOA 4B0MM 3Q8FA 3UACA 4AVHA 1CYWA 4WJ5A 3PGCB 1LDPL 1WP6A 2VDKL 1C08A 1LK2A 1OT4A 1YEWA 5AOLA 2F8XC 1TEFA 5BRZE 4AI7A 2OJEB 3H9YA 5C2BL 5B39G 3T6QC 4LU5L 1XL6A 4AQ1A 2WVUA 2OBGA 1A7NH 2DI8A 2AV1B 2X41A 3TH2T 3QA3B 2CQVA 2I9TA 4YDJA 4LLDA 1KCUL 3N91A 1MRFL 2D7TH 1DFXA 1ODUA 4YHIA 5CILL 5E4OA 2BO0A 2WIIB 1E5AA 1JE6A 4XNXL 2BINA 4ZNCD 4HZ1A 4CN1A 2Q7NA 4OKVA 3MX0B 2YUWA 1KN2H 4JRYD 4LCCC 5IM7B 1RULL 1OGAD 1BREA 2F61A 1I85C 1V7ML 2AK1H 4XPGH 5LBSL 3GSQA 4HFUL 4JJ5A 2ODIA 3GGWB 1UM5L 3D39A 3FQUA 3GI9L 3OJVC 2MKWA 2Z8SA 4FXGB 5A2JH 4HISA 5FYKE 4PLJC 1ZA6A 2LAAA 4WCYH 1OGPA 4KK6D 3F12B 3EJPA 4PLKD 1NM4A 1CDBA 2JELL 3D85A 5AKRA 3GI8H 5HPMB 3QO0A 4JFPB 1T5XB 2DN7A 3CFKA 4NQEB 4KOBA 4HMEA 5IB4B 4BSWA 4MD5B 3MU3A 4M5ZH 5FGRA 5JPMC 1M56B 3LEYL 2X5PA 1U91A 3QG6A 5AOMA 4KKBD 2OMTA 3Q8CA 5DI8B 3H7BB 1OY3B 3CUPB 5JDSA 4K3GA 4GS7B 3TVMD 4QRUB 2YD8A 1AR1D 4P5TC 3MJ8B 5HYSG 5CIPB 1KACB 5FGSA 3BKYL 1S7XA 3QORC 2ERJC 3H3BC 2F53B 4BUHA 3CHQA 3QDGB 4OLXL 5AAWA 3NG5A 1TTRA 2NY1D 2VE6A 3RVWD 4NN6C 4D8OA 4NFBA 1GHFL 2MCG1 3RIFF 1N2RB 3STZB 1HEZB 2QPSA 5KS9B 3W37A 1R5IA 3BZFA 4HJUA 5EU6B 4NP4H 1NC2B 4AVKA 5CCGE 3BGMB 3QNFA 4N2DA 1PEWA 2IOIA 2R2HB 3HAEH 4E9QA 4PJGA 2JK5A 3F00A 2WXMA 4BH8A 1U58A 2D7QA 2F74B 4O4YL 3WTUA 2V8MA 1U4FA 2IBZY 2NY7H 2F9BT 4P23A 3NBNA 1ZT4A 4LARH 1JV2A 3OKEA 3AU1B 4JZJB 2N4IA 4PB9L 4F5CA 2R4SL 3OC5A 1P6FA 2JKTM 1DHKA 2XCMC 4FE9A 4JFEA 5E8EB 1NLDH 3TONA 3PWNA 3QZMA 4XMKH 5TPWL 1MJ8H 5CU9A 2CCVA 4NO0A 1J1XH 5DO2D 1QRND 1S3RA 4GSQA 2YMTA 3PQYD 1R34A 3V6OC 2A6KA 2VMCA 2QTVA 2LE9A 4L8CA 2RQ8A 1E4WL 4OD2A 4HLEA 4KKLC 2OR8A 4S1SH 5DJCA 1GZQA 1YEHH 4RMSA 1DVFB 2EAEA 4PLOB 1AR2A 4EN3B 2DQDL 3LKRA 4FL4C 1NBZA 4G9DB 1IM9B 2IQ9L 5HYQA 4TQEH 2D7NA 5LLIC 3ES6A 2X4RB 4U1MA 1UASA 1E9PB 1K2DA 2F7QA 5I0DA 1MFCH 1RPQA 3GIVB 4W4NA 2NZIA 2HKFL 1E7VA 4MNHB 2FBRA 2ZG1A 4ZO9A 4HMCA 1XF3A 4W4OC 3N50A 3G08A 3PWLB 4XCNA 5DZVA 2ZQKA 2V3DA 2VMDA 3RRQA 1CXKA 3UC0L 5I1CL 3SPVA 4NRYA 2Z4QA 3VFVA 3EOYG 2WPGA 1SLUA 2FH6A 3AWFA 3MCYA 1JF5A 3GXIA 3O4LD 3VFSB 2W60A 4ORGA 5CN2A 3LRMA 3FFDA 2NY0D 2QV4A 1VIWA 2WCPA 3RUGB 4GPVA 2X40A 1MHCB 1SF5A 4I88A 1IQDB 2H1XA 2QPDB 5IVXE 4P2QD 5JQ6H 1OCZB 3GSNB 3G6AA 4L5FL 1HQRA 4N2HA 4JPKH 1OXYA 3ML9A 4P3CH 4XVUD 4PRAB 4LOFA 4V2BA 5M7QA 4IW4C 1OHQA 3HBQA 5DJZB 3WY3A 4LAQL 3RY4A 4R8WH 2VUYA 3LQMA 3TEYA 2ED7A 3OL2A 4POZD 1H9DA 2C4FU 3LZOA 3WE6B 1CGTA 2JCCA 2VRKA 5F1IA 2W9EL 1EBAA 3IPEA 2GJ6E 3ZVVA 2AJUH 1OKEA 2FNBA 1Y18A 2FK9A 1JV5A 2QELA 4K3HA 4LHUG 2OYLA 4U3SB 3SJVA 1IT9L 1PF3A 1PTZA 4L3EE 2CO6B 2NTFB 3M8OH 2OQJB 3C12A 3OR6B 4PJBB 4RMUA 3VXME 3LQAH 4UTAH 5LN8A 1BEXA 4LLVA 4F9LC 4UM8A 5HGHA 3D06A 1T6BX 2QTEA 2O6PA 2IOMA 3OZ9H 2FHFA 5CGMA 3V52L 3RVVC 1FL3B 1NCWL 3BWUF 2J8UF 2KDYA 4KTEL 3PY9A 4NO2B 2ZSWB 5IFAH 1PYWB 2WANA 4MA3A 2WGNB 3NPSC 2GHWB