3QYMA

Structure of p63 dna binding domain in complex with a 10 base pair a/t rich response element half site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
192
Chain Sequence
b'SPSNTDYPGPHSFDVSFQTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein 63
molecule tags Transcription activator/dna
source organism Homo sapiens
publication title Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
pubmed doi rcsb
total genus 35
structure length 192
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qymA00
2IOMA 4LOFA 1HU8A 1H9DA 2AC0A 4AGLA 4L0YA 3Q01A 5G4MA 3EXLA 4IBSA 4AGPA 3KMDA 4AGQA 4GUQA 2J1XA 2BIQA 3WTTA 2VUKA 4G83A 3Q05A 2WGXA 1CO1A 2J20A 3D09A 5AOKA 3WTVA 2GEQA 3Q06A 1GZHC 2FEJA 3WU1A 2P52A 1T4WA 1IO4C 1TUPA 2J1WA 4AGOA 4IBTA 3KZ8A 2IOIA 2J1ZA 4IBZA 4IJTA 3D08A 3TS8A 4L18A 2YBGA 5AOIA 2BIOA 2J21A 4GUOA 1TSRA 2X0UA 3WTYA 2BINA 2J6WA 5ECGA 3ZMEA 5ABAA 4QO1B 4A63A 2MEJB 5AB9A 1YCSA 2J1YA 3VD2A 1KZYA 3US0A 1HJBC 4HJEA 4G82A 1EAOA 3WTWA 1EANA 2RMNA 3WTUA 2ATAA 4IBYA 5AOMA 5AOLA 4AGMA 3D06A 4MZIA 1E50A 2PCXA 3D05A 4LOEA 4XR8C 1HJCA 5A7BA 4AGNA 1CMOA 4LO9A 5AOJA 3VD1A 3WTXA 3QYMA 4KVPA 5G4OA 2IOOA 5KBDA 4IBVA 2XWRA 3QYNA 3US1A 2BIMA 5LAPA 3IGKA 5BUAA 4MZRA 3D07A 1UOLA 1EAQA 3EXJA 4IBWA 4IBUA 2ADYA 3IGLA 1GZHA 5G4NA 2OCJA 2X0WA 3VD0A 2AHIA 4IBQA 2BIPA 5LGYA 4L0ZA 3WTSA 2X0VA 2XWCA 3D0AA 2H1LM 1LJMA
chains in the Genus database with same CATH superfamily
1H3GA 3G5ZB 3ZQWA 2IWEA 4JFDB 1KEML 3CMGA 4MA8H 3FU6A 1CZ8L 4JRXA 1CGTA 4GEIA 1CGSL 3I9IA 3ECQA 4G6ML 3T2PA 3VJ6A 2ZKMX 3PF2A 4PGCA 2Y5TA 3QIBA 4BKLA 1KEGH 3QO0A 5E6RB 3WLBA 1ZT4B 4ANXA 1KB5L 1QP1A 2VL5B 3PGCB 4J1UA 3JVFC 3ZHLA 4UM9B 1WBXB 4HIXL 4WUKH 3FTZA 4JFQB 1BD2D 4WHTB 3L9RB 1L5GB 5IFJB 3A4FA 3GBML 4GP4B 2W9DH 5CGTA 3H55A 5CEZL 4JDZB 4OZHE 2I69A 1HH6B 4K9EH 1FVCB 3HE7D 1R24A 4K73A 4KK8D 3WU1A 1G9NL 1MDTA 2WD0A 1XGPA 4JFXA 5CCKL 5LGJA 5IR1B 1HZHL 1BF5A 4OKDA 5D5ME 4J7RA 1B3IA 2I25N 4AGOA 3P3UA 4E9YA 1UD2A 4P9ML 5E08L 4ZT1A 4Z23A 5EOTA 3N40P 1ZA6B 5J1SC 3THMH 4OFKA 1MNUH 5EU5A 3BN9D 5I26A 2CLVB 5CLWA 1D9KD 2EH7L 1A3ZA 1JHKH 4KROB 3QUZD 5JW4M 5HHME 1F4WH 1Y0LB 3D69B 3F8UB 1N3NA 5JIIA 3GUFA 5I6XC 1VFUA 2DTMH 5F9AC 3EUDA 2RQEA 3JTTA 3DYOA 3WHXB 3F3HA 2F1BA 3IK2A 5GRUL 2JIXB 1MPAH 1IE5A 1YNLL 2NY6C 1QSFA 3DX4A 2XU9A 4LSQL 4NQEE 3BP5B 3PWUB 4UUJA 2UVEA 4YE0A 2NTSP 1OOWA 3OQ3B 3TBTB 4N9GB 2YD1A 4L3FA 5E99H 4DP8X 1BA9A 4TLSA 3VQMA 1WITA 3SBRA 1IEAA 2YQ2A 3EHBD 4MJ5B 4JHWL 3SGJA 4K2UH 2Y5TB 3CH8A 5TGBA 4QXGL 5E5RB 1OT2A 3JWNG 4QRTA 3LXBA 4K7FB 1FJ1B 1TIUA 3N43F 4YNYA 3VI3E 2YMXL 4Z6AT 2BNUB 3TT1L 4CC1A 3RVXD 3QSKB 4XMLH 3CMOL 4QYOA 3QQ9D 1NLDH 3ZDYB 3KS0J 2ZX6A 1NDTA 4KAQH 3VJ6B 2VO5A 2XWZA 4P23B 2PW1B 1TTCA 5DTFB 2XA3A 3FT0A 4IM8A 4PJ8C 1D6EB 2A0LC 4MAUH 1E2VA 2VDNH 5ANMA 2NYKA 4KITB 3VD0A 5CGYC 2IH1B 3GKZA 4JZNB 4MMYB 2F53E 4XVSH 1RZFL 5TPWH 1J8SA 3DECA 3HZVA 4KX8A 3US9A 3APCA 4CJ0A 2ZYIA 2ZAIA 3T2QA 3EGSA 3FQRA 2LQRA 1DBAH 4RMBA 2IV8A 5BPPA 3MV11 5AVUB 1NIAA 5E70A 4N5UA 3W3BA 4R4BB 5JPMA 3CZSA 2B3IA 4NRXB 1Z9NA 3CVIH 5SWZE 3FN0H 1NPJA 1RV6X 2Z92B 2OQJA 1NMCB 1X5FA 1W2KT 4AGPA 1YEJL 1VSCA 2R7EB 1ZLEA 1WGOA 4LCUB 4TYUA 4O02L 1TLMA 4XC3L 5IBUG 3QHTC 1K2DA 2BSED 1YC7A 2GW5A 1G7HB 3CDFA 4KKLD 3KPLB 3QARA 4I1PA 3TA3B 1N3NB 1TTGA 2CUMA 4PG2C 4A7UA 4DTGL 4CJ1A 2XTJC 1ZK9A 3RUGF 5TE4H 3LRSA 4OBRA 3VFRA 2DMGA 4MD0A 1CYGA 2OMTB 3SGDH 2GSMB 1NBYA 4LBEA 4LPWA 3TBVA 2OZ4H 2ADIB 2YD6A 4AIOA 1OGAD 5EU7C 1DR9A 1Z9SA 4LSVH 1PD1A 1RVFH 1UB6A 1WAAF 4OTXH 2IFGA 1CTMA 3PIQA 4MNQB 3MC0A 5E0FA 3MBED 2IOIA 1OCRB 5IHUH 2X3CA 3JWOH 3LNFA 1YYMH 3LIZL 4OZFG 4B9FA 3WMSA 1JZ3A 4OFPA 1TJHH 3O9WA 4OGYH 1JV5A 5EV7A 2CUHA 4YXLH 3NBNA 3EYFA 3EOAB 2VR4A 2ZWKA 2CWRA 5ABAA 4U6VL 3IFPB 3VXRA 1ZIBA 4CDGC 3O6KH 1A9VA 1MCEA 2E9GA 4JZNA 4MMYA 4X42A 1DVFB 4G7YL 3RDTA 1Q0YH 4G82A 3ZTCC 1C5CH 3OM3B 4LFHD 4ODTH 1WWCA 2VM3A 2X4TA 3BKCL 3MUGA 4MHHI 3VQ2C 1DE4B 2D9QB 3A22A 3D4CA 2CJUL 4QRPD 4NZJA 4BA8A 2XWBA 4FX5A 4PV1C 1YNLH 3T2NL 1YEKL 5DWPA 3K2MC 1D7CA 3FOMB 4WWOA 3TH4T 2EDYA 4JREC 4M3HA 4NKMA 2KQNA 5D1QE 4M43H 3CSPA 2QR0A 3NYKA 4HT1H 5KOMC 5DR5H 1QLEB 2D03H 1HZHH 5EZOH 4D3CH 3VXQA 4ICWA 4UBDC 2P5EB 4QY8A 3BKYH 2LW3A 4O4YH 1A6ZB 5SWZA 4QXUH 4BRVA 5GZOD 5LG6A 1R4XA 4PJXA 4RGNB 1EPFA 1RK0B 4LSUH 2F53B 3FQTA 3LPFA 5KYYA 2XG5A 1EJOL 2HJLA 1I8IB 2H8PA 3OMZA 2R7EA 4Z5RA 4LRIA 4OZHB 2GJRA 4G42B 5IOKA 2V7HB 4O51B 5T1KB 3O3DA 1KJ2L 2CO4A 2J56A 5DHVH 3UBXA 1I8MA 1GCFA 2DQHH 4PVBA 5TE4L 1MJJB 1N10A 3PQYB 4N9OB 4ZDHA 3H2PA 1AGDA 4WKZA 5F1IB 4ZUUA 4FTDA 1HI6B 3QUYA 3V6ZB 4FQHA 3KLHC 4LU5H 4TL5A 3MRCA 3IJSA 2RR3A 4PJHE 4GOSA 2Y1ZA 3GYRA 3KXFE 3L3GB 2Y3AA 3HI5H 1KBGH 1JXDA 4XP5L 5D1XC 3UTSA 5IGXL 3K6DA 1EO7A 4B9PA 2HT3C 5IJBC 4AYID 3U1PA 1HH9A 3Q3GA 1J8HB 3ZYIA 2AJYH 3ZE0F 5ACLA 1XVSA 2QL1A 3GMPA 1EMTL 2E6JA 2J2ZB 1D7DA 5FFGA 4P4KB 2FNWA 1CG9A 5E1AA 1CD8A 1H3PH 3KPSD 4YXHL 3SE3A 4DGIH 3F64A 1L0XA 3ESUF 2YSSB 3ULVL 3RILA 1E8WA 2WXIA 2XQYA 2DLGA 5HJDA 1RUMH 4F8LA 3IMUA 1MFEH 2WXNA 5JPMC 3IFNH 2DRUA 1OAKH 4XE0A 3F04A 5LJYH 5KVGL 1CXFA 1P4IH 4EOWL 1IFHH 2DD8H 2WIIA 3DURB 3FUKA 5GS0H 2R4SL 3ECBA 2AQRA 4FQ2H 3WS3B 5GGTH 4IOFD 1BG9A 3OPUA 1CD9B 4KRPB 2CDGB 3K1DA 3SGDI 2VUOA 1HYSC 5GS1A 2PWHA 1Z2KA 4MQ7A 3LHPL 4TQIA 3ZBMA 5KSAD 2A6KA 1X7QB 3U0PA 2AQ1A 1R33A 4PJAE 4G6AC 1RAMA 3CZKA 1PZ5A 2ZX7A 1BZ7B 3KPTA 4UOW1 5FGRA 5HDBF 1TQUA 2WWKT 1XEUA 3NN8B 4DO6A 4Z7VF 4P46C 3FXIC 3MA7A 3RKDC 1RUQH 2WLMA 1EZSA 4YXLL 1KNOB 3IF1A 1T5KA 1NOFA 3JTSB 4Q6IC 5E8DH 3IU3A 1IAMA 1F45A 1PYWB 3Q5YA 4GUPA 5JYLA 4MLSA 1WBZA 4PAZA 4OZHA 3RU8H 5DJ8B 4JM4L 3RFZA 3ARXA 3QORA 2JH2A 1G7IB 2B20A 4OI7A 2Z64C 4CVWA 4U2YA 3IWVA 3U9UA 4AYEC 1AJ7L 1KSRA 1BECA 5D7EA 1IQDA 2OA9A 4YVUA 2WPGA 2JI1A 4ZW7A 2NCMA 5TJWK 3QWOB 3RVVC 1AD0B 2R2HB 1R19A 2XKUA 5J6GA 1UVQB 1HEHC 5ICUA 1IVTA 1BP3B 5AYUH 2FCBA 1FH2A 5FM5M 2FJGA 2KKQA 3N42F 4N2OA 3SBPA 4HUXB 4U1JB 2UWEE 3NIGB 2YLKA 3QJOA 3MLTB 3OHXB 3CVIL 1T03H 3IJ7A 4QXUL 4WW2F 2MHAA 1BYNA 2KYIA 4RFNB 2AQTA 4R2GD 2IOMA 4ZPVA 5TH2B 1HHIB 4A2LA 2GHZA 4D7BA 4ZZFA 2AC0A 3FK3A 3KPSA 3VTMA 2GTZA 1AR1B 2V2TA 2PKDA 4LIQE 5D2NE 1FQ9C 2XIDA 3TM6A 4K23H 1BXXA 1UEMA 1VESA 3KBHE 4PN6A 5IESL 1N5AA 3MCYA 1DUZA 5ICXA 3SOBL 1B0IA 4OZFB 4N8VG 1F2XK 1F11B 4HZAA 2UXFA 1I1AB 3FQNB 4X83A 2CHZA 3QH3B 2OZ4L 1JWMB 2WN3A 3QCTL 1COBA 1AP2B 4G6KH 3U0WH 3H9ZA 4DETA 4X7FC 4V1DD 4KI5D 1RH8A 3BISA 1DBJL 1UFGA 1QABA 4JGMA 1NC2B 4Z8FL 4MYWB 2UY6A 4OIBA 3WN5A 4IRJD 5JQIB 1NC4B 1XIWB 1LQSR 5E56A 3C2SA 1TZGH 3QDGB 2X28A 4Y1AB 2P5ED 1A7OL 3ZGIA 3TA4D 3ULVH 1A1NB 2VLJB 1SYVA 5E94A 1FFTB 4W4OA 4LLVA 3B7YA 2WB7A 1DZ0A 4B0MM 3C6EA 3SY6A 3ETSA 4Z78A 4RDQG 1GGUA 3VXSD 2CBQA 2DQJL 3OF6A 1MCCA 5HPMB 1BZ9A 1E7VA 1S7VB 4V2CB 2IALA 1IQDB 4D0CA 1XF4A 3HI5L 4LKXA 2ZCHL 1A7NH 2FHBA 1ZTMA 2D3JA 4M8VA 3NRQA 4NQDB 5TDPA 2VXSL 4PHXA 2N59A 2EDTA 2A74A 1DVTA 1S9VB 2E6PA 2NY3C 3CC5A 2EYRA 4UIKH 5CWSA 3SQBB 1JI2A 1XF1A 4XVUC 3WFCL 3S34L 2NY4D 4Y16C 1RUAL 2BWIA 1MJUH 4KXBA 3E7JA 2GT9B 2OTWA 1PIGA 2BJMH 3LNIA 5FDYA 1VFMA 2ED6A 2V5TA 2WY3B 3VFTB 5EU6B 4DGVH 3TVMC 2PR4H 1ORSB 2Z8VC 4D0BA 3LKQB 3OR6A 4PS7A 1G9NH 4NQDD 5J06A 3SIKA 5D5MB 4KZEL 3WFHA 1AP2A 1IBGH 1QEWB 4N90D 1VPOL 4MB5A 1NAKL 2ZSWB 4HG4K 5KYWA 5DO8A 3DYMA 5F6IC 4NAQA 3EBAA 2Z91B 4TSBL 1DLHA 2DI7A 5G4NA 3MRGB 4A68A 2OULB 1FO0H 1WS8A 3WN5B 1NMAL 2NLJA 2O6CA 2XX0A 4XMKH 3EOBA 4CBZA 1AR2A 1XZ0B 4X4YB 4OV5A 1YMHB 3LB6D 4R8WL 1MJJA 2R1XA 2V6HA 3BAIA 2CQVA 2PO6A 3UEZA 4HF5L 3I2CH 5AWNH 8FABA 3C08L 3N0PB 5D7JC 4AIXA 4ZNCD 4G80B 5H37A 3GRWH 3ULUH 1QRKA 1KYDA 1NANI 2JB5H 5F88A 2G75A 4PR5A 3FYEB 1A1MB 5LBVA 2A9NL 2IAMB 3SDXA 5HPMA 4Q58C 3VSUA 4AYGA 4P4KD 4NN5B 4PGEB 2OI9B 1U8IA 4EBQH 4NN6B 3VFUA 1RZIA 2DS4A 4X9GA 4WCYL 1A1OB 3MACH 4JPQA 1HSBB 5LCVL 4UQBA 4KQ3L 4J28A 5ENWB 4ZDHB 1BZ9B 3NJMA 4Y9BA 3B9EA 2XYCA 1OE1A 4HCRH 4YZFE 4D0CB 4EN3C 3JZYA 3A3YB 4PGBB 4Y89A 1MY7A 4RLDA 4EMZA 1RUAH 2A74B 4I4WA 2BIOA 2YEZA 1OAYL 3L3KA 4M9OA 3JYBA 1SBBA 1M57B 3IB4A 1J9RA 1KMGA 1VGKA 2B4CC 3N3EA 1KGXA 5EG6C 1KLFB 3KWUA 4LIQH 3FONA 2IGTA 3QZMA 2CR6A 4PJGE 4E5XA 1B0RA 3CFCH 3DMMC 5H2BA 1GCYA 3HS0B 3CSFA 1OGAA 2JKJA 4R97B 2XBDA 3FMGL 4JUTA 5FB8A 2ETWA 2AJUH 1LEIB 4QJ3B 1AHMA 1U42A 3Q8EA 5LNGA 5KJ4A 1V7ML 2ZX8A 4HWUA 1NFIB 3CXDL 4R4NC 5E6IB 1DO5A 1TENA 3UPAA 3FTUA 3TX4A 2P8PB 3T0DA 3JT0A 4U6HB 2VSCA 1GKEA 2HVJA 3B7SA 1W8EA 1QZNA 1MJ7L 2FYVA 4ABWA 3NA9H 3OQRA 3BSZL 4OF5A 3MLXH 3BT2H 2VZ1A 1R9FA 2PW1A 1J1OH 2DMBA 1XCQB 4UAOC 4H0IA 5FLUA 1Y1DA 3CWGA 4U1HA 5FEBA 4FI8A 4K5NA 3WKNA 3VFWB 4JUSA 4FQJH 3SY0A 2EAEA 4HPOL 4S1QH 2IDTA 1HHGA 4PLJC 1LO2H 4P3WA 1NWPA 4Y2DC 5GGSB 1N0XH 1MCDA 4R90H 3VQ1C 1J12A 4ADJA 3FQWB 4HMEA 4JGJA 3U36A 3VFOB 1LQBC 3VFNB 3TO2A 1UZGA 4PB0H 2JJUA 2XIBA 1NFDE 3ZTNL 3N0AA 3SN6N 2Z92A 3VCLA 3P9LB 5BS0B 5F1OB 3C6LB 4E5XB 2OMZA 1IKNC 4I4WB 3CUPA 2CM6A 2FJHA 4O2EB 3UYRL 3FO1A 1DBJH 3D0LB 5HVGB 1OT4A 1TF4A 4WWKB 1FN4A 4F7EA 1KYFA 1JMXA 1KYAA 2W9EH 2X4PA 3CFDB 4KI1A 1TTUA 3FUIA 1UD6A 5DVNA 1JF5A 1ZHNA 4I18B 4LSTL 2OKMA 1CE1L 2NY0C 3IBOA 5IBTH 2ZOKB 4PS3A 1SM3L 1NGXA 3PGCA 5FUOL 3QRBA 4LARH 3FO0L 3V10A 1AGBB 2JMRA 1S4IA 5ALBH 4U7MA 2WVVA 4Q0XH 1WFMA 3NOIA 1YNKL 4GEJA 4OB5L 3VXME 4Q9RL 1CDIA 1OY3B 2Z7YA 3W57A 1HH6A 3IS0X 1MHEB 5DZOA 5HVFB 3DVNB 4OSUL 4JFFE 1RIVL 5IMKB 1QLEL 1IGYA 3MV9D 4DUXA 5F9DC 4FFZA 4U6HA 4N25A 1U93A 3O2VL 3BGMB 3T8XA 4Z7IA 4HHGA 4YHKL 1U2CA 1KJMA 1A6UL 1EFXD 3GHEH 5FV1L 5I82A 1RERA 4HV8A 2H3NA 1JFHA 4LSSL 4GS7C 3KLAA 1T7YA 2VLKA 2R4RH 4DWHA 4M48H 5GHWH 5L2KA 4KMTL 5CZXC 4GSUA 3H8NA 3JTTB 2JB6B 4L8SC 4U7SA 3E6HB 1HEZA 4R3SB 5JHAA 1WIUA 1ORQB 1G9MC 2BMKB 4KHXL 2WKOA 3UMTA 5C0BB 5D1ZI 2HAZA 4XPHL 3TNNA 3C60A 3CUPB 4O2EA 5E8EB 4KV5F 1W0WA 2IANE 2P7TA 4ZYKB 3D07A 3QRGL 4NN6C 4Y0GA 4H8WL 4A37A 3LIZH 4WV1B 3VCLB 1AGCA 2ZCLH 2P42B 3D2UA 1HIML 4XMXA 2Q2EB 3NESA 3SKMB 2V7HA 4IBQA 1WIOA 3L8QA 3T6XA 2FJHB 2OJ1A 2VNCA 1CYXA 2ESVB 2QKIA 3O3DB 4PLKD 3LEXA 5M7QA 3U6XS 1I3VA 1S7UA 3AITA 4WKZB 4P48A 3MLZH 2WLZA 3FW6A 4LOUD 1GW0A 2NR6C 5F7FA 4MKMA 4F37F 2NOYA 2A74C 5JIDA 1S9XA 2JK5A 5ADOL 4BQ8A 4Y16A 4ODHH 4RETB 1QLRA 4UB0H 2VQUA 2QPUA 2YEVB 3OGCA 1EO8L 3VI4A 1QFPA 4AIEA 1DQML 1A6TA 2EH7H 4C83A 4FXKC 4GP8B 4R26H 3VH8B 4RMUA 2R59A 3L2NA 1GGIH 2IH8A 4JO2H 3BRGC 1QO3A 1SYSB 2F1AA 2J3SA 2OM5A 5I24A 5F7EL 2GEQA 4QHNA 1FE8L 5E4OA 2X2HA 1VB9A 4MD4B 1B2WH 4WFED 3IJHB 4PJ9C 1ZIAA 3BWUC 4E9RA 4ZD3H 4H25B 3QQ3A 4LIQL 4DN3H 1NMBH 5F1KC 1KJMB 2Z7ZA 3MSPA 3OLIA 1LO3H 3P11H 3RKPA 3OB0K 5I5IA 4AKQA 2J6EA 4LLUA 5I6NA 3LZFL 3IKKA 5IMOB 5HI5D 4FXKB 1S3RA 4KNSA 4NCDA 3P3YA 4AVIA 1JYNA 2GTWA 2OJEB 3FL7A 4HWBA 2IXQB 2ZF8A 3EFDL 3NZUA 3O6FB 4HKBB 4ORZC 4PM1A 3HMXL 1J05B 4LSRH 4NB7A 4NO2A 3GF8A 5CSBA 4AJ0A 4XMZA 4H8WH 4QXTA 4X5WB 1ETZB 1JZDC 1PX4A 2V7NB 2VDKL 1XV8A 3NH7L 3PP3K 2FQFA 2UYLB 3AMLA 4N2FA 1CJYA 3MRLA 3X14A 1A6VH 2AJZA 4RISH 6CGTA 1FFRA 2EXYC 2HLAB 2A99A 4JY5L 2JK5B 1OAUL 5H37G 3SKMA 3HE7C 1VGEH 5A7BA 2BZDA 4X6DE 5JUEH 1IBDA 2DJSA 1QG3A 1WUZA 4DVBA 3FFDB 3C5JB 1F3RB 2WTRA 4WSJA 1TQCB 3DC0A 1KN4L 1U3HD 4OZIF 5DMKB 3ATEA 2LVCA 1E42A 2H32A 2NY6B 3I2CL 5AWNL 5T8IA 4M02A 4QRRB 2AERT 5B7EA 2VGLM 2GIXA 1AD0A 2R2HA 4LL9A 4KHXH 5T5NG 3WFEL 2EIMB 1IFHL 2DD8L 2IQ9L 4AEEA 1UURA 5L8LB 5KYXB 4J3XA 2QVKA 3CIQA 3PJNA 5E2VL 3QIWA 5TDNB 3IGLA 3DGGB 2YPLE 4PJBE 4QRQA 1GZHA 4WTZA 3DI2B 1UATA 3LEYL 4HGMA 1FFOB 2EH8L 1UXWB 4YWGL 3P0VH 4ODUA 1WZ1L 3QEGH 3QZNA 3EYOA 5I73B 3ZL4L 4NSKB 3MACL 4W6YB 4X6EB 4NHCL 4NYLA 3CFQA 2KC0A 4FJ6A 4OCRL 5F7KC 2N3JA 4XN7A 3GFUA 1BVLB 4OTXL 2GYSA 4JCMA 1I9JH 2C34A 3CQFA 1SVCP 2NY7L 4EUPA 4OIIH 1TZAA 1VFAB 5AZ2H 5BZDA 2WZ5A 3JWDH 3U83A 3CBJB 2IAMC 4X6BA 1JWMA 2E27H 4DVRH 4YDKH 3QIWD 2FX9L 3GM0A 4X99A 3VXRD 4QT5A 3DOSB 2H9GA 3CSTA 1A2YB 3WJMA 1JERA 3NCJH 3QIUC 1MOEA 2N7BA 3RIFF 3IFLH 2PTTA 3UTSB 3CPLA 5FV2A 1MZYA 1K8IB 5CJQL 1PLBA 4TNEA 4IRJB 3LPOA 3V4VA 1PL3A 5F1IA 4E5XG 1J8HA 3VXRE 3TV8A 4OCXL 4ZD3L 1JZHA 4FQHB 5BZWA 1S7XA 5LAXA 4XB3A 4FQIL 4NKIH 5CCGE 4P4KA 2F5BL 4M5YL 3S9DB 2J4WH 3WYRA 3F00A 4GO8A 2EDDA 3TN0B 4QO1A 5KYXA 1I8KB 1ZRUA 3FN3A 3LSOA 3MLUH 2BDNL 1JXGA 1YUHB 3W2DL 2ESVD 4KQ4H 2IDFA 2WLHA 3PWJB 4LSPL 3TBYA 1F4HA 1M2VA 3V5KB 3TYGH 2GC7C 4YLCA 2YKKA 2IVFC 3FB6B 3VDAA 3ULUL 3RBSA 2BOLA 2RCSH 2EYRB 3SQBA 4DGYL 1RULL 4YSOA 1XBRA 2BRQA 4MNQE 4ZFOB 4XNDA 4GKSA 1IEBB 2OS7A 3D25A 1J0ZA 3TPUB 4NRZA 4IMLA 2G9KA 4HUWA 4DP5X 1K6QL 4PQXA 3BIKB 4WU7A 1MAJA 3IMTA 3QYMA 3P69A 5B38B 2P44B 4KJWC 5LXGL 2ISDA 1NJ9B 2AI0L 1KTLB 3KYAA 3ECBB 2G2NA 5D7KD 4ZUSB 4XBPB 3IJYA 1HIMH 4APQC 3ARUA 4HCIA 3O3AB 3FTXA 1P7KB 3IF1B 1TTRA 2MNJB 1NQBA 3O3UN 5GRXG 4HKJA 4YHYC 2Q87A 4QXWA 4OD3L 1XH3B 4GMTH 3X3GL 1FGNL 2XIIA 1FHNA 3TO4C 3HG1D 1KCSH 5EU7E 3B5HA 1YMHA 2OTPA 3M1BA 2CH8A 2DLHA 4IGBB 4S0TD 4RSYA 5D1QD 5HYQA 4L3EE 1O7SA 2FO4B 3OHMB 1NGPL 3QUXB 3RG1C 2E7MA 5DFWH 3MCKB 2MKLC 1INEL 2HT4D 3UJIH 3WNLA 4JKNA 4ZFZB 4NQCB 3ML8A 4KUZL 1BD2E 4IK6A 2ITFA 4YDLB 3KJ6H 4OIAA 3DO7B 1WHPA 1S7QB 1IRAY 1INQB 3MV7A 3NJGA 1NEZA 3VGAB 4N0CD 4JW3A 3G5YB 3CFBB 3H6AA 1B2WL 4NQUA 3AACA 5KUMA 4HEPG 3MRQA 4IGBD 1G87A 2VTFA 1XIWC 4M6ML 3CXHK 3BGAA 5J6GB 1E5ZA 1QFHA 1ZANH 4HJGA 4WTXA 1R1CA 5HP5A 2NYYC 3BT0A 3DX8B 1FBIL 3IXAB 4R96A 2R29L 4GKSB 1UWXK 4JQIA 4M62H 4MAZA 2IWFA 2XOTA 3ARBB 5FWRA 3TPUA 2P43B 2I7OA 4OLWL 1ODAA 3CVHB 4M8UA 1IGJB 2K4WA 4M29A 4ZOCA 5G5DA 4WY7H 2GSGB 3P4OB 2EICA 2YPKB 2IH3B 2YOAA 5I8OH 1FZJB 3ISYA 4G6FD 4J3OG 1I3GH 4UQ2B 4IEFB 3HG2A 4GJTB 5K93A 2FGWL 1UM5H 3TONA 3QIUA 1XH3A 1I1AA 3OJMB 1A6VL 3FUNA 1P4LA 2DWEB 3PL6A 4RISL 4A7GF 3POCA 2LVEA 3B3BA 5F8QC 4H0LC 4BFOA 4OM0H 2CHDA 2P48B 2FO4A 3OKYA 1JNLH 2KI6A 3RTQD 1OAQL 2BVPB 1JV2B 4BWUA 2UY6B 4WEBL 4N6QA 2BSSB 1N2RB 5IUSA 1PMYA 2ZUXA 3E38A 3MJWA 5T5NF 3U7YH 1N7MH 2YXWA 3DGCR 4NCC1 4APXB 2P8PA 3I9GH 1OAZH 1WBXA 2WC7A 2WTOA 2OXHB 3QPQC 4FNLH 5DUJA 1WCBA 5AVZB 4YXKH 5TFSL 2AK1L 3N6YA 5FOJA 4DOHE 2HVKA 1BMZA 3GSXA 3SYCA 3UBGA 1JHKL 1NA8A 4JAMA 1NCOA 3LQMA 1Q90A 2ICWB 4PJ8A 1JF1A 4Q52A 1AD9A 1QSED 3T4AC 2HFFA 3LZRA 4AQ8C 1AI1H 5GRJH 1WBYB 3IT8D 4Q6IB 2QTEA 5DJAB 1HYSD 2BIPA 4U33A 3CVBA 2EACA 4BZYA 3QG7H 1JK9B 1QSFD 4TS6A 4URTB 5L4IA 2MCG1 5KSAC 4XCEB 3DPBA 4H88L 1Q1PA 1CFQA 1Y6KR 5F97E 1EHXA 5JDSB 3LKQA 4ONGL 2CSPA 1CXHA 1LJMA 1J48A 1D6VL 3QXUA 3BUPA 4ZK8A 1UQSB 4PRBB 3FU9A 1UWGH 2YBRA 1NM9A 3H4HA 1Z3GL 3BEWB 1QEWA 4AK1A 5I8KH 2VN7A 2YPKA 4J3BA 1AOZA 4PWIA 4YLQT 2Z9TA 5J6HA 4P2RE 3JV4A 4QPEA 3GK8H 2BXZA 2Y06H 4IEFA 5EEZA 3IDMB 1QSFB 2X6BA 3NIDB 4GAGH 4KNQA 5IW1A 2Z8RA 2DQTL 2QSCH 3A67H 1A7OH 3GI8L 2HPTA 2K70A 1MDAA 5SWSE 3N43B 1J0JA 3EDJA 4CN1A 3X11A 3RQ3A 2NY1D 1XH2A 1JDDA 3NIGE 2D7OA 4F8QA 3ROLA 4JDVA 2XTLA 5BQ7A 4JREB 3RYMA 3K72A 1WG3A 2BP3A 4ZJ9A 3LXAA 3BLBA 4X5PA 3SOBH 5GZNC 4X7DC 4JANA 4PJHA 1OF0A 3VYOA 2WZ0A 1D9KB 1G9HA 3QCTH 4G6KL 3IMVA 1JZJA 1XF2A 1CFVH 1T89C 4UIMA 4OGYL 4OKVA 1OK0A 2GJ6B 4M5SA 4P57B 3LNHA 3LRMA 4K71C 1CS6A 2ZUWA 3EBGA 4R2GC 4UM8B 2VUYA 1DQDH 1AD9B 5C3TA 4F80A 5DJYA 3BAKA 4YDIH 3FHEA 3S5YA 4QHKI 5IK3A 4MMZC 2VXUL 4BFKA 2IPUG 1JTPA 1X9QA 2OXHA 4BCYA 3K71A 1GYWA 1SHSA 2YPVH 3LV3A 2E4TA 1F86A 4H5SB 1VACA 5H35B 3VXOB 2ATAA 3IETA 4KXZI 1S7RA 2PYFB 1DSFL 5DJ0B 4YQXH 2EP6A 3H9SD 2FB4H 1RJZA 1KV3A 1SJEB 1G7PA 1VZGA 1INDL 4XB7A 1P2CA 1P84J 3MRHA 4MX7A 1VGKB 3QPKA 2R2EB 1EEQA 3NCXA 1FFPB 3OXRA 4KI5C 4XX5A 4HU8A 4Z77A 3BDBA 4H2CA 5IOPA 5IIEA 2ARJQ 1JGDB 5F3BA 4DSYA 4ENEC 4E41A 5C71A 3DXAD 4XZ4A 3UYPA 1VENA 4BYHA 4GI6A 1AFVH 2DQGL 3D48R 2ZCZA 3O45B 1YMMA 3QG6B 1ED3A 2J12B 4IRZL 1FNEA 4KZEH 5FUCC 1B0RB 4JFZL 4FQLL 1G7QB 5CN2A 4N2DA 3UC2A 5AKVA 2W0FB 3KXFD 4G9DA 1EFXB 2WNWA 3FB5B 4DGWC 3ZIMA 3AT9A 3OV6A 3VGFA 3L3HA 2FIKB 5DVKA 1EGJA 1Y1UA 3NCCB 4W9KC 5G4MA 4QWWD 3V6OA 4XMKL 1XCQA 1ESOA 1LE9A 3NJXA 5DMIH 5DC2A 4TQHA 3R0NA 4WENB 3RDTB 1OD7A 2WUBH 2WWMD 3HZYB 3LV3B 1IM9A 4P5SA 1MFVA 4W9FC 1W72H 4EDXB 3L2MA 4GBXA 2LABA 1FNSL 4AWJC 4Z7OB 4BA0A 1ZSHA 1S7RB 2VDOL 3EH4B 3EHBC 5AVWB 3VD9A 4LASH 4Q9CA 5K1JA 4ADGA 2E4FA 2J8HA 2PCPA 4ABVA 1P2CB 2W88A 3V8OA 4WWID 4H44C 1Q38A 3AM8C 5K39B 5HI4D 3VFWA 3AVEA 4WEEA 3V0HA 5CIPH 3ARFD 3C5XA 3P4NA 1H8SA 1A6AB 1TJIL 4JPWH 4OM1H 3QQ9C 1PLGH 4BXSV 2HG5B 1Q4NX 4MS8D 4X2UA 5CILH 1INDH 2BPBA 1RU9H 4TVUA 5F3BB 4GRLA 3PWVB 5HJBA 4YHNA 2A0LD 2XN9A 4XI5D 2AJ3B 3QJSB 4YHIA 5EDXA 3KR3H 4PS4H 3H9SA 1A7BA 1H6EA 3PGDA 4G5ZH 3D3VA 5EMYA 2XQ0A 3SO3B 4OLVH 1IM9D 4NQTA 1C8PA 2EILB 4CC4C 4L4JA 2VAJA 4JDEB 2BIHA 4LSUL 3BVWA 4OCRH 3ZY7A 4G9DB 1TQVA 2A9CA 2C9XA 2UYLA 2X4PB 5E1GA 3WKYA 3O45A 4A2MA 3FB5A 4DP2X 4LRIC 4L37B 2HVBA 1E50A 3O8XD 3WEXA 4RA0C 3P73A 5CJ5A 2R9HC 3FKUS 3QUXD 3MNMA 1ZD6A 2WYIA 3QISA 1M1SA 3WV0A 3QA3A 1QW9A 5T5FL 1FG2A 4ZSOB 1GGBL 3L5WA 3ZL1A 5I17A 3J27A 1KBWA 3GBLA 3CZNA 2EIZB 1GYVA 2UY7B 4LF3A 4RGMC 1IBFA 1NCAL 1A21A 3K80A 5DR5L 2IPUK 1QR1B 3BXNB 3BUYA 5GS2H 1PNCA 4P8QA 4X9FA 1FV1A 2GITB 2BSRB 2G60L 1X5IA 1CFBA 2NXYD 2OMUB 3GS4A 3ZRSA 3MBEC 3O6FD 2Q2LA 5LGYA 3N55A 1UACH 4NJAH 1A4JB 3B9VA 3JBG7 2ID5A 2ZCKL 3EGSB 2VW6A 3MI6A 3OVUB 1AXSB 4UYPA 4O58H 1R47A 3KAAA 3TNNB 5IUCA 2UXGA 3GSNL 2H3NB 1G7JB 1K3ZA 4ZO7A 4ATWA 2WAHA 1U41A 3JT2A 4BSJA 4BE6A 2CDEA 2HH0L 1E0OB 5B7FA 2C7FA 1T83C 4YSSA 4N87A 5E8DL 4ZYKA 2YQBA 5GS1B 2XG4B 5C0ND 1LVEA 3BRDA 2E9IA 2DQ6A 4KJQC 3FFOA 4BZ2A 3J2PA 2IGFH 4PMFA 3VM5A 1LO0H 2EIJB 3RWDA 5EBWB 3HBQA 2F61A 2FJFB 1CN4A 4QRPA 4UILL 5IHWA 3NFNB 1FAIH 5J4MA 5IROD 2BOCA 3ZPDA 3HG3A 3LKRA 5EUOF 3H9SB 1BVZA 5T33L 1HOEA 4J12A 3SZ6A 2D7MA 4Z7AA 4YDJB 5CFHA 4MNHB 5L8JB 5TK2A 3TWCH 4CVZB 2CCWA 1WH0A 2FX7H 1IC0A 2Y6TE 3AABA 3D3VD 3IJEA 4Y16B 1BLNA 4FZEH 5INCB 3T5WA 5JXEC 3CDCA 4IRZH 3ARBC 4JRXE 4HJIA 1U8LB 2EO9A 3D9AL 4OAWB 4CDHA 2ADJA 2FQGA 4KJYA 5IREA 4LNRA 2EVHA 3EW3B 2X12A 3W0WB 4KKQA 1S9XB 1DHKA 4OM1L 2VDQB 2Y3NA 4PLJD 5E5UB 4RNRA 3BXNA 3TBBA 3WNPA 2DYPB 1CXEA 1UD8A 1G0DA 4H7VA 4JKWA 2CLZB 3DK0A 2YAPA 3CVCA 3MGAA 4I89A 1LO5A 2DJ4A 5D96B 4KTEL 5FA4B 4ZMAT 1P5VB 1RUPL 2CKBH 1MVUA 1I3UA 1VKXB 3QHFH 3CC1A 3V0EA 4ECNA 3VRIB 3BUYB 1IAII 2RIKA 1FNGB 4RGND 4EF3A 3QJFA 2ENJA 1P4BH 4L8DB 2V37A 1IM3A 1RUKL 3MLRH 4AW7A 4Z3TA 2IPTL 2OMXB 2BS9A 5JZ7C 4FYQA 4AC4A 4IKNA 2Z0UA 3P77A 5E00A 1AQDB 3NPZB 2CR3A 2VR7A 3F05A 4MGXA 2KZBA 3B3IB 5GZNA 3LH8A 5EZJA 5I1EL 1CFNB 3I50L 4M00A 3S35X 3U46A 4NO2B 3H2QA 3VXQB 4XMLL 2CJTA 3VO0A 1CD1A 2K0RA 3Q2CA 3INUH 3GJFB 4NUGL 4QXTB 3LMJL 1UG9A 2P1YA 1J9CT 5DEJA 3ZT6A 2KZ1B 1I1AD 1Z3GH 3NSJA 4Z3FA 1RP9A 1XSIA 2Z3FA 1E8XA 4JNXA 3AB0C 1ERNA 2UWEB 1WFJA 3HKZA 1MEXH 3MJ9L 2ICWI 4KTDH 5DYOB 3VVVA 4LARL 1F1AA 1N18A 1OARL 1JCVA 5GRUH 1NGZA 5GGSY 2X2JA 4JO1L 5HVHB 1WZMA 2AITA 2BOCB 3OLGA 3FYIB 3ZTDC 1DQLL 1IZJA 1URIA 1OL0A 3QJZA 3OLEA 3MPCA 3EO1A 4AL8H 3LYRA 3QUYD 4FQCH 2C3GA 4GKNB 1BM3H 4L9LB 1M7IB 1D5BA 4A67A 4I0PD 3K91A 4AW4A 1K85A 4AXWB 2PYED 3U7AA 2F08A 4P46D 1ZHLB 3RAJH 4JKKA 1IGFL 4NJ9H 1HKLL 4JN1H 5TQ2L 1H3XA 1OGPA 1R3IH 1QI4A 2GJ6E 3APDA 1Y6MR 1KIRA 3C5ZD 1QKZH 4LVNC 4PHZA 3EH1A 4W4OC 2J2ZA 4F33A 1T1ZA 3L3OA 1GGBH 3T0XA 3IRZA 2HFGL 5MHSE 1S9VA 3CC5B 4NSKA 3QULA 2PP7A 1KXTA 3HN8A 2F7IA 3INOA 3DETC 1KT2B 1S9WA 3S96B 1NLBH 1BF8A 2QV4A 3NZSA 2ZUTA 4EN3B 5DURD 4KC3B 3EFOB 5DYFA 2ARWA 3KPPB 4TRPL 1P5VA 2HCZX 3H9YA 4XVSL 1XD0A 4F8NA 1BREA 1AIFB 3BO8B 2X53A 3C6SA 5IKCA 3TS8A 1HQRB 2OSYA 3DX7B 4OLXH 3P9MA 3U1SH 2DBJA 2MQ3A 2D2CC 3MX0B 2APTA 2J6WA 3LRGA 2BRRH 4UT6H 5HDOA 3BH9A 4JFVA 3SDDC 4DEWA 3PRZA 3VXSB 4CILA 5I0YA 4LFHG 3WY4A 2YAHA 4X99B 4HK0A 1FZOA 3MYZA 5SWSD 1KTJA 2WBJD 5AB9A 5BRZA 5B3SB 2ZG2A 1DBMH 5CCHE 5BVPH 1KLUA 5C08D 1SMDA 4EUPB 5D4IA 4ZI8A 1NGZB 2Z65C 2ZKXA 1BAFL 5F9OH 1NL0H 2E6QA 4CAGA 4JFED 4GG6A 1JCKA 4PH8A 3L3JA 3W9EB 5ILTH 4MRCA 1L6PA 3GK8L 4QF1B 4TUKL 1AZUA 5HY9B 2XZAH 1N2RA 1HS6A 1NTDA 2VDRH 4H88H 2G75B 4P2QE 4HT1L 1AYOA 4LZKA 5BO0D 3HPLB 3E8UL 2PPEA 1F2QA 1URLA 2FLBT 5KSVA 3CZLA 4W93A 3ZHFA 2XV0A 3WAKA 3ZXAC 1A8JH 1O75A 3WFDH 3KPRD 1GVIA 4FZEL 3IRPX 1KGJA 5T3ZL 1KXVA 5EIVA 2BIMA 1NDGB 5C0CD 3LZOA 2CA4A 2P46B 4GKNA 4K3DL 2JKSA 5J6SA 2YAFA 5JR1H 3HNVH 2C9SA 1HE7A 2V4LA 3K2UH 4ONHA 4JGNA 4G8GA 5K1VA 4AMXA 1YHPA 2WVUA 1VLXA 2Z8WC 5L8KB 4P9MH 3H9SE 3Q5TA 4L0ZA 5E08H 2NW2B 1IC4H 3AFLA 3CH1B 3QQXA 3B6SA 1UXSB 5E9NA 2MCPH 2K9FB 2W8CA 1LO0L 1PG7W 3F2LA 5FUZH 3WS6A 3KPRB 2QBWA 4OF8A 4YX2L 5J7CC 5DUBA 5CKGA 1BLIA 2ARJA 3B5TA 1MI5A 2A9MH 2GSIB 5ALCL 4DFHA 2ZG1A 3EFOA 3HR5A 3DXAA 4OFDA 2Q8AH 2NY5L 3VXSA 2EVJA 3V6FA 3DBXA 1IIKA 1HESA 5IJVB 4UV7L 4IJ3B 1KLUB 2OL3B 2GY5A 2DIJA 3H2WA 2AXHA 5EOCL 2IJ0C 3OSVA 4NNYB 1R34A 4XVUD 2R0WH 4YHOL 3RDTC 5K69A 4JJ5B 2CIKA 2QQQA 3L9BA 1IGIH 3VG0L 3X11B 1MRFL 1PG7L 5I73C 4X8XA 4QRRA 2JXMA 3T8MA 3HE6B 1FGNH 1XB3A 1LP9B 3N5AA 2BVYA 4ZAKC 4ZUWA 1JHTA 3SD2A 3BKCH 4N2MA 2DLTA 1ZGLP 2KLTA 3R4RA 4U1IB 1INQA 2KH2B 3MV7B 5HXMA 4LCVA 4YO0B 2AXGB 1YC8A 4HIHB 1NEZB 3LCYA 4XVTL 3N1MC 4B9ZA 3NTCH 5KBKA 2HX7A 4KJPD 1KENL 2XZCH 3A4EA 4LDEB 4WSGA 4HZLA 3TESA 5ESVA 2ENSA 1XL6A 1ID2A 4ONHB 4WNQB 3L3IB 5HHOB 2W9DL 3FU8A 2BP8A 2V17L 3WNNA 1IJNA 2ZKYA 2PNDA 3U7WH 2BY0A 5I6XB 4BXVA 2ZXQA 1KYUA 4OCYL 2HXAA 3DOHA 4OI9A 2IFFH 5CR1A 1FORH 4TUJB 2I9LA 1XMEB 4NQVB 2XACC 1U30A 3BMVA 1HE8A 1BZEA 2O26U 3JV6B 4I0PB 3CFNA 4WI0A 1I7RB 4F2MA 3SDDA 1U0QA 2D7TH 2ZIDA 4HSAC 1JF6A 3FUHA 3MJ7A 1ORSA 4P99A 4IIZA 4WUUD 3GSUB 3S4SG 4LU5L 3BPOB 3OR6B 3DTDA 5FO7A 1EZVY 4N3UA 4NNYA 3QQ4B 5BUGA 3IMBA 3S3DB 3DXAB 3CZUB 2NRDA 1YMMB 2MOQA 4EXKA 2DQIL 2DQMA 3LH2L 3UC0H 3UZEA 4EN3D 1I1RA 3C9NB 5EN2B 3A21A 4WI6A 1NCNA 1U36A 5LBSH 3BD3A 5FECB 5KSBA 4MD5B 2X4OB 2G0LA 4YC2B 1TXKA 5C0RL 2ILLA 3RVUD 1BYPA 3KR3L 1DBML 1YPZE 3MRRB 4PS4L 4R6UA 5CN3A 1EFXA 4U1MB 3FT4B 5LB1A 5ANME 2OMWB 3LZPA 3VNYA 2DDQL 3WO4B 4PP1C 3AT8A 3ZDYE 4FFYA 3GMMB 5DXWA 5DHXB 2ICWA 4PJ8B 3BVXA 2O6EA 5IVXE 4H8PA 3DMMD 1E9OA 2R0ZL 1F0LA 2HFFB 3H7LA 1NKOA 2HP4A 3OKOA 1MW0A 2NY3B 2VIRA 5DVMA 4FNQA 3V4PB 4AE1A 3SDXB 3L48A 4MCZB 3O0RL 5FCUH 4DP7X 3M1CA 3HB3B 1IARB 1RIVH 5ESVB 5PCYA 3QEHB 2J6EL 1JF1B 2H2PD 4PWGA 5LBSA 1R3HB 2N4IA 2XI9A 3EOYG 4APQD 1EZVX 4LEXL 4R4ND 5DD1L 5IVZA 4MAYD 1MAML 1RY7B 5AYQA 4AQ1B 1HX0A 2EECA 2YAEA 3DVGB 3I85A 3OBAA 3UXFA 3RFZC 4ZUTB 1ZV5A 2QGBA 5DD6B 2YO3A 2HKHH 1CFTA 4DK3A 5A6IA 3II1A 4I18C 3CSYB 3FB8B 2R15A 1O7VA 4NKDA 4QHLA 2CA3A 1UXMA 4WI0B 5FYKU 3LVEA 1NH6A 4YS4A 3KPMA 4QXGH 1PEZA 1YCSA 1WC7B 2G0KA 1OTUD 5D7JA 5DJCB 2VR3A 2WM0A 3IDMA 4OFYD 1TCRA 5EBMB 2E7BA 4MXQC 4PY7A 4PJHB 1WV7T 3FCUB 4UDUA 1QFWM 1ZMYA 3T71A 1DZBA 3ZYOA 1CI5A 5EBLB 4OUUA 1C12A 5ISZA 2VRAA 4TULH 3LPWA 3PGFH 4NLHA 1USZA 4WGVB 2JLPA 5GJSL 4DHLA 3BZEA 4A39A 3L7FA 5DHMC 3TCXA 4WNSA 3SQRA 3ESMA 5FECA 1JGUH 1Q9LB 1PCSA 3QG7L 4HIIB 4N0UE 3PAUA 5I17B 2X9WA 3Q6FA 3RWHA 4Z7OF 5KBPA 1T5WB 4I48B 1MIEH 1CDBA 4WHTA 5IFJA 4YGAB 4XCYA 1D3CA 3VSVA 4Z7NF 3HRZB 4G71B 2BWDA 4NENB 4KK6C 1QR1A 2B1HL 4AL8L 3GMMA 4AG4H 1KCRL 3HLAA 2VN4A 5DJ0A 4C56A 3RVWD 1T7WA 2AZUA 4BGLA 2EO7A 1T66C 3LEYH 5BNXD 4QYAA 4K5LA 1PCXA 2GK0B 4OIFA 1P4IL 4GB9A 1U3YA 3T0WA 4PWKA 1FE8H 2O6PA 5A43C 5AB0A 2OYMA 5F0PB 5F3HB 1JTTA 1OP5H 4PJHF 4LAQL 3O81A 4FL4B 3SPIA 3I6SA 3SQOL 4ZZKA 2WZ6A 1WFNA 4OQTA 3NGBC 5E1IA 4HK3N 4POYA 4QUOA 3UTTA 2G2RB 1VGEL 2HFTA 2KUTA 3B9KA 5EUKB 3DOIA 3WIFB 5LXVA 1AZVA 5LG1A 5DD6A 4JRWA 4YNYB 1WZAA 4NI3A 1MWOA 5D7SL 1I75A 5EBWA 2QJDA 3VE0A 2VUKA 1GZPB 1S7SB 3T8VA 1K8DA 3G04B 3OC8A 4MSWA 4PIRF 4QYOB 4X6CE 1GXEA 4ZMXA 2KPWA 3KW8A 1IT9H 2D3NA 5I0VA 1Z1WA 1ZTXE 2WB1A 2Q10A 1D6EA 4XHJD 3V0DA 4HFUL 1T7ZA 1IBZA 1G7QA 4Q97A 4FABH 3NQIA 1GH7A 4FQXA 1G6RL 1BD2A 2NXZB 5I0WA 4XB8A 3S48A 3PHAA 4XAWH 5KG9A 2PABA 1KF9B 4K15A 4K7PH 2J44A 1HAUA 1T5WA 2BNUA 3CBRA 2XBZA 4I48A 2H0PA 2H32B 2J88H 2GIYA 3NQKA 1SXSA 4JPKH 2EDXA 4U1SA 4P4RB 3W11D 3QI9C 4QJ4B 5JPMB 4ANWA 4UTAH 4YOKA 3NIDE 5DU7A 4JPVH 5E2UL 3K2IA 1FZMA 1Q9LA 1WFTA 1OP4A 2V2WB 4AVHA 3GGWB 3MOQA 2NT1A 1FFOA 2DM7A 5DQ9B 3S98A 1CB4A 1TNNA 5C0GA 1K2DB 4OZ4A 4X6DF 4NENA 2EUXA 2F5AH 5LKNA 3QDHA 5C0JB 3SO5A 4ZQKA 4AJVA 3D06A 5AZEH 2PCXA 4HLZG 4P5MB 2P80A 4GYBA 4FQXD 3T4AA 4X8GA 3W5NA 2BNRB 3J7HA 2DM3A 2OQJB 2A7BA 2UV3A 1M1XA 3HZMA 3HZKA 2J8UA 4FKKA 1ZVSA 1SF3A 1J87A 2R56L 3POHA 1S9KC 1VDGA 4JO3L 5TE7H 1U8JB 2ZWLT 4PVLA 4E9WA 7CGTA 1WUNT 2CBMA 2Z4QA 4ZTOL 4M1CC 2RGSA 5KYNA 2Q8AL 2XFGB 5BUPA 2VB5A 5AUMA 3CFKA 2B8OT 3SYOA 1ACCA 2IBGA 1YG9A 5CLZA 1I85A 3MRIA 4J4PD 2IIJA 2FBJL 2G5BA 3L3DA 2MMXA 1UKSA 5AALA 3WSQL 4BQ6A 4PBXA 3VM7A 3GSVB 3ZDXF 2QKSA 2EH8H 2R0ZH 4ERSL 4ODWB 3VFPB 1DUYA 1RULH 4YBHA 3B37A 4JG0L 3EYFB 5KSBE 2BS8A 3ISWA 3PHOA 1KJ2A 5MEOA 3BAJA 3V2AR 1TU2A 1MCJA 3DJZA 1UFUA 3P2TA 1PLGL 4N8UA 1MAMH 5DD5L 1QSZA 1KIQB 3WJJA 2IV9A 3TEUA 2UY7A 1JGUL 1E4JA 4LF3B 4AZUA 4YDMA 2EDWA 1YEDA 1HZLA 2Q20A 1ZHKB 1E6JL 3FQ1A 2ZXBA 4I77L 4NUPA 4AMWA 4K9EL 1PX8A 4K9EC 1QLEH 4MMXB 1J5HA 4GI8A 4ZW5A 3DIFA 4KMLB 3KM2A 4P5KA 2Y6SD 3ZE0E 3KPPA 4HPYL 4OGAD 3RGHA 1CIDA 1MI5D 1X5MA 1U3HA 1RIUL 1SEBB 1LGVA 2XV6B 1PGRB 5E1HB 1ZJBA 5C0JA 4BK5A 4ZUUB 2W0LA 3ZK0A 1NGPH 4X7TB 3BHBA 3AADB 2PYEB 3DSFL 1E4KA 3FZUC 2MCAA 3CMOH 2F53A 2WUCL 4J8QA 2EE3A 3DX2A 3AAZB 4PCSA 3Q48A 1QBLH 2BVUA 5EC1B 4GAYA 5JPNA 1KPUA 1WHOA 3FFCA 3LN5A 2C3HA 3KNBA 5GGVL 1SHWA 2YIHA 3MRIB 4QRPB 1H5BB 3TNMB 1DBKL 4R7XA 3PAYA 3S3CB 4IGBA 5FHAL 2BDNH 3LKRB 4GG6B 4OAWA 3OKLA 3QUXA 4MQXD 5F7WC 3CJJA 3MV8E 3QEQE 3FCSA 1TJGH 4YDJA 4OVVA 3FF8A 4X80L 4CVZA 2GJZB 1YEEL 2DQUL 4NP9A 3RWIB 3MFFB 3WEOA 3IJEB 1NIEA 1N68A 4ODXB 3JXAA 5MEOB 1KCWA 4NKOB 3TBSB 3ULVC 2J73A 4L1HA 3FH8A 2FBRA 3SJVD 2E74C 4AG4L 3GKWL 3H3PL 4YE4H 4YBQD 3ZE1F 3D1MC 3MODH 3RL1A 2ZKWA 2VDOB 1QFUL 5AKSA 3SDCD 1HHHB 2VM4A 2F53D 5JHLA 2WANA 4I9XA 5IW3A 3TO4B 2EEBA 1E2WA 1QSFE 1SXAA 3V7AE 4AQ8A 4IBWA 4ODHL 4FKEA 4MJIB 2UZIH 4G8EA 4PRHD 5FO9A 3BLKA 1NCDL 2EXTA 3WCYA 5GPRA 2NPLX 4FTVA 4P5KB 3WO3B 1P6AB 3ZLQC 3LD8B 5BRQA 1BXUA 5EZIL 4UTAA 3VRIA 1RQ5A 3IDXH 4HC1A 4HUNB 4YC2C 4XE5B 2WSKA 5D6DC 3MRJA 1JPSH 4WEBH 2FH6A 2VQ4A 3JWOL 1CR9H 2XETA 4R7NB 4X7TA 4Y2OA 4GMSH 1DFBL 2NXYB 2FT8A 5E00B 3HI1B 1DQIA 4JG1H 3MBXL 3S97C 1CLZL 1B4LA 1G7IA 2NNFA 4JRLA 3KNBB 5I2IB 2JF1A 4PRPD 4Z7OE 4K8RL 2VMFA 1OP3K 4NRYB 4HFUH 2O5XL 1UENA 1XR8B 2ZUQB 3FU7B 1GIGH 3NABL 3JTSA 5F6HJ 5TF1L 4P05A 2PXYC 3FBKA 3QFJD 1JBJA 1MHHA 2QQLL 3BZDA 2Z31B 1U2YA 2XDHA 3RFZB 4YSQA 4L9LA 1NBZB 4K94L 2ROYA 1NMBL 4WO0A 1T04B 3JWOC 5E2WL 4ZFFA 2Q7YA 1LO4H 2APBA 2JJSC 3L5HA 4GG6E 1M7DA 2QFRA 4F20A 1HL5A 5AB1A 3ULUC 5AW0B 3L4CA 5I8KL 4BUQA 5I1CH 2YN3A 4G7VH 1U92A 3RJOA 3MFFA 3VYNA 1M7IA 1NAML 4B6ZA 1KWKA 3IYLW 4XNQB 1THAA 4Q6IA 1KN2H 2IDSA 2P8LA 1HL4A 2TRYA 4G8FB 3ILEA 1DDTA 1SY6H 5DI8A 2NW3A 5C6TL 4POZD 1PTZA 4KNTA 3S37H 4X6FB 3LZQA 1C7TA 5GRJL 2P49B 3WD5L 4EUPH 2Q7AA 1N0LB 1MH5A 1ZV9A 2X40A 4Y4FA 4LPVA 1QUNA 4V1DB 4OF6A 4BK5C 1RZ7L 1J10A 4NN5C 1A22B 2GTZB 5H4YA 1IGIL 3BH9B 2YC1B 3UX9B 3VG0H 4HJUA 5L9DL 5MENE 1WRFA 2O5YL 3FCTA 4TNGA 2LAAA 4KTEH 4PRHA 3QPXH 5IB4A 4NBZB 3TC9A 2VLKE 4JQIL 1YN6A 2VAAB 4R5TA 1E6OH 1XIWD 4FQQB 3JVGC 3V0AC 3KWTA 1KTLA 5IW1B 2B4CH 2HFEB 3P9MB 3GXTA 4PLNC 3O2WL 3QJQB 3KDMB 4PJCB 4F7PA 3O3AA 1BQRA 3RY4A 1CLZH 3L3OC 4XBEL 4WAFA 2I32A 2ZWNA 4HIJB 2IO5A 2W1NA 1GOGA 5EA0L 4QHMA 3D30A 4HBQA 3VFSB 1ET8A 4NUGH 5I2IA 5I6OA 4MASA 3V9EA 2ADFH 5D4JA 1NBZA 5I8CA 4HGKC 3FRUB 2IALB 1R3IL 1E30A 2V9UA 3HUJB 4HMCA 5IJDC 1H0DB 1EEUA 1XR8A 2JKWA 4Y1AA 3PNWA 4MJ4A 4UZSA 3L9YA 2X6CA 3C09C 1AR1D 5CD3B 1H6TA 5EUOE 2MWCA 2UZIL 4Y88A 4LLVB 1ZT7A 4M4PA 4KFZC 2VQ1B 1DQLH 4G8GB 1JNHA 4PLOB 3RNQA 5I1IH 4C56D 3B2PA 3VSQA 3CBKB 4PJ7B 5E9DA 1KCVH 2VZVA 1S5IL 4QLWA 1OF2B 5HTSA 3RTQC 4YR6A 4OZIB 1ZE3H 2Y7SA 4O02A 2PYFA 2ZG3A 4X4ME 1BMWA 1TVHA 3IE4A 2A9BA 1KJVB 1YEIL 3ELAT 5IB3B 2W07A 1YAZA 4D0DB 5EHFA 1DLHB 4G8FA 3IN2A 4BWTA 3WY2A 3KCPB 3D39B 1LNUA 5C0FA 5HDLA 5EUOB 1L7TH 4X6FA 5F7LB 5FYLH 2N0MA 1A6PA 2J55A 5J5EA 5I8EA 3CSYA 2LHAA 2BERA 2PR9A 4PJ8D 4B27A 1TSRA 3QUMA 1N67A 2AEWA 5I19L 1U3NA 5B3JE 2OZNA 1U8KB 2Z4TA 3U1SL 1X6LA 3UYRH 4F2FA 3VD2A 4EQ2A 2BZCA 4A1RA 4DERA 43C9A 1JHTB 2VCOA 4H0HB 3QIUB 5HGHA 4I0PC 2IBBA 1QWNA 5ICZB 1SRDA 5IVXB 1UZ8B 2JFCA 4HIHA 3GC3A 3OKKB 3L5IA 5E6IC 1CVRA 3LQAL 3PE9A 4HIJA 4HXBL 2XTSA 1S7WA 1N12A 2QZQA 2ADGA 3SGJC 4A66A 1GA2A 4OQTL 5FO2A 4XXDA 4U2ZA 3D05A 2JTYA 1A25A 2VDLL 1BHGA 1H19A 2BLFA 4R0LC 5ENWA 2ED7A 4X6CB 3WFBL 5IQ7H 3BQUD 2R27A 2Z93B 4ZPTB 2RA1A 4MZ3A 2L7JA 4MZ2A 3R06B 2AQ2A 4QAWA 4ZOBA 4FRWA 2MCPL 5D9SB 4GINA 1M6OA 3EDKA 4NM8H 4BZ2H 2YEZB 1GL4B 1MREL 4CSSA 2R4SH 1J5DA 4HKZB 4BWWA 2VJ0A 3LS4H 3MAWA 2A83A 3F85A 3HLAB 2XT1B 2EKJA 4FG0A 1RLWA 4ABUA 4LKCB 4LP8A 3A47A 4IBUA 4UYQA 2Z31D 5C07E 3SPCA 3IEAA 5JW4N 2OCJA 2V9RA 1QSEA 1HFUA 1B4JH 3DDFA 4F2MB 3HNSL 1JK9A 1YEFH 32C2A 5E5MA 2WBJC 4QOKD 1O6SB 5TE6H 2NUPB 1EGJH 5EN3A 5J3HC 1ZDSA 2AJXH 4P2QD 5D71L 4JS7A 3JWNH 3MBXH 2CALA 5C0AD 3PWVA 1DJSA 3T6QC 2EDRA 2AJ3A 3VGEA 5A3ID 3QORD 3JV6A 1LE5A 4W81A 5IT2L 4DPCX 3HKFA 4WVRA 1LNUB 2GBTA 3QO0B 3WLBB 5C0FB 4DEUA 1NFIA 5E6IA 4AH2A 1YEGL 1FNFA 3ZHNA 4OJYA 3VE0B 2PTUA 1A5FH 2CO6A 2QGEA 3ARTA 5FYLE 2HVJB 4F7TB 2R83A 3IWUA 2B1AH 5BMFH 5IY5B 4LRNL 1OGSA 1WPCA 5BO1L 3FT4A 2ZKHL 1X5YA 1YO4A 3T77B 5SV3A 1T0NA 3QZLA 4OFQA 3ZOAA 1LEIA 2FECL 4L3ED 4WKXA 3TJPA 3S34H 4YJZL 2I60L 1OEZW 2IF7A 5EWIL 5GGVY 4ENED 5HHQA 3WN5C 2CO1A 1U95B 1OSPH 5D7HA 3V4PA 2BHUA 5GZOC 3LPPA 1M6OB 2EEXA 3X1GA 1JZ5A 4NWUL 1P9MA 2ZX9A 3QEHA 4HJJL 4NZUL 2XZCL 4Z18A 2SODB 1RP8A 3O0RH 5FCUL 1MPAL 5FUZL 4RBPK 2YK1L 4XVTH 5D9SA 3DSNB 4C55A 3UO8B 1J5IA 2VSDA 5K9JL 4GG8A 3PFQA 2VMJA 3RGBA 2W94A 4UT9L 5GGRY 2OSXA 1CLYH 1RPUA 2V3FA 4BDVA 4G5ZL 1OP3H 4Z8FH 2QFPA 3L95B 3QS2A 2V8MA 3SCMB 3SYQA 4RX4A 2GABA 2XA8L 3BWSA 3OKNB 4Y1TA 2OJZH 3QUZA 3UIZA 4GW1B 1FFPA 3OXRB 2CG9X 4YHOH 2E7LA 4WLCA 2IFFL 5FPIA 1Q9WA 3DBSA 3ECUA 3T65A 1JZ8A 2X1XR 5CP7B 4K7FA 3V4VL 3M88A 2C1OB 1KLGA 1YNTB 1AGEA 4PJ9B 3INUL 3FB8A 4PY7B 5IQ7L 3HHMA 1JWSA 3QYNA 1V3JA 1TQSA 4ETQB 2QELA 1JWUA 4Q2ZA 1DDHB 3PS6A 4JGUA 1KCUH 4LLQA 3OF6D 2OR9H 3SE8L 4Y2NA 2ZYRA 4FYTA 5D7JB 1MCPL 1I3RB 1BLNB 5INCA 3NVQA 1X5LA 4X9IA 3HJEA 4NM4L 3AREB 2CCLA 3QUMH 5AAPA 1AO7A 1OW0C 2X5PA 4HQQH 3ENEA 2JCWA 2WLIB 1OE3A 3MNVA 3NDZE 4V11A 3M8OH 5I1IL 4P23D 3SDYL 1ZLSL 3HAEB 1T0OA 4N0YH 3MJ8B 1I7UB 5I1HH 1SN2A 2XWJA 3SPHA 3F5WB 4HC1L 2EIKB 1IZKA 3GDCA 4OLZH 4M7KH 3DSNA 1U93B 4X5LA 5EORH 2CIIA 1P53A 3HZYA 2D4DA 4GG8B 1XGUA 4OGXL 5E2TH 4DPBX 3T6ZA 2VR9A 4EPSA 4JY4B 4WCYH 2HLEB 2V33A 5D93B 2FAUA 3CHQA 4TSBH 3NJKA 3VG9B 3LRSB 4BDVB 2EVIA 3BP4B 1R5VB 1VEMA 3HC3H 2OMXA 1O5PA 2C8NA 4BBWA 4ACTA 4XP4H 2IC2A 4GW1A 4YLBA 3T6VA 2YEQA 4Q4IA 5J13B 1UB6B 1NCJA 3BZFA 1Z9PA 4K3JH 1BIHA 2HRGA 1MG2C 2NY2D 3GO1H 3PIQB 1S7UB 1BOYA 1SDDB 3ARFA 4MJIE 1OLLA 4AM0Q 3ABGA 2HTKD 1T20A 1BM3L 3ATFA 3Q13A 3VD3A 3QFGA 1WF5A 2W60A 3PDGA 3QR2A 3O6FC 2YOCA 4LE8A 4DO5A 3N41F 2O5YH 2ZPKL 5DT1H 3MREB 5AZ2L 3PAZA 3CFTA 2XXFA 3MUJA 3Q2WA 5I6MA 1OANA 1OP5K 3K2KA 5CJ8A 4S1DD 3GI9H 3WL9B 4Y9GA 1FC1A 3WTWA 1UA7A 3LN9A 4IRSD 3QHZL 3NACH 4HUMB 3WKPA 3MBEA 4NZUH 2V5MA 4KDTC 3HE7B 4C54A 2XZAL 2UX6A 4LLWA 2YQ3A 5F7BA 2LLLA 1DO6A 1XGZA 3AY4A 4ODXA 3DRTB 1XH1A 3G6JB 3QQ3B 4LLDA 5EZPA 1L9SA 4FNSA 3I84A 5DFTA 2N56A 3KYNB 4HIXH 4WUKL 2DTML 4MAYC 4YSCA 3FHQA 5DA4A 3RP1A 1FYHB 3SDYH 5I23A 2NQCA 4AMKL 1T83A 2XZZA 4ADIA 2JCCE 2ERJB 2I60H 2COVD 4NIYE 3IDNA 4YPGB 1GZQA 3IPBA 4JJHA 3GXPA 4M7JH 4QHNB 3U4BL 1EIBA 1FV1B 3WBDA 3NIGF 4HISA 3F7YA 15C8L 4YSPA 5GGTA 5D2NA 2BNRA 2JIXA 1TTFA 1QRNE 4H25A 3STZB 2HPOA 3ZR5A 4RAHA 4W9ZA 1OTUC 3BP5A 2ENYA 1LMIA 2DM4A 1M56B 4NN7B 3RX9A 1UT1A 1JPST 3WXVH 3QXAA 2TSAA 2WQ8A 2VXTH 3GMRA 3QUYB 4MCYB 4QNPE 4I3SL 3PU7A 4H20L 5KJRH 2W65A 5BJTA 5DEGA 2XG4A 1YNKH 1XGRB 2WP3O 3F7VB 3HI1A 3PDDA 4FA7B 4OLYH 3BZFB 1OWWA 2CKBA 2R51A 4DVBB 4CUCA 1KEGL 5CJXC 3LXCA 3OWRA 5ES4B 2JQMA 1Z5HA 2V3EA 3AWEA 4HXAL 5HSFA 3IDGA 1PQZB 3EF4A 3DUHA 3KL3A 2BZ7A 4N1CA 3OJDA 3GSVA 3GINA 4Y5YA 3ERXA 1MF2L 1KFAL 4F5CA 3MXVH 3QEUA 3QIWB 3FSZA 3VMOA 3UG5A 1QSVA 2PUQT 2F19L 5E4IA 4CSPA 5K9QI 2ITCB 3SPJA 1KJ2B 3ILDA 4TPRH 4CL7A 2H4EA 2G3ZA 3M17A 4PBVC 1EA9C 1T66D 2VDPB 4U1KA 3DX9B 3ULAB 4WW2A 1OXYA 5HDBE 2F74B 3OMNB 5DMKA 2FZ3B 1ASOA 2ADJB 3UIYA 1SJMA 1EJFA 3N1QC 4G1MB 4XC1L 4YVNA 4FFVD 1EEZA 4JFWA 4LPTA 1ZHKA 4RNRB 4MS6A 1LEGA 1SJHA 4KPHH 1QNZL 2DI9A 2J88L 5KVFH 3ARQA 5EOQH 2AW2A 3X1FA 5I1JL 1N64L 1IAOB 2WBKA 4K7PL 4OZGF 2F7QA 1KIQA 3WGUB 1MFAH 5EPMA 4EQ3A 3IMRA 1H8OA 5CUSL 4AYDC 1VFOA 3EYOB 4NT6B 3BJLA 1UB5A 2YSTA 3DRQB 4XMPL 1KB3A 3FRPB 3K6NA 4MD0B 1YPZF 4GXVH 2PYEA 2DI8A 4BSVB 1A14L 4P4KC 2XQYK 1XGQA 2GBUA 3T4YB 4PGJA 4MNQA 1NBVL 3V6OC 4AT6B 1UEYA 1F58H 3IVKB 1V7NH 1J88A 5SWZD 2XWRA 3IDGB 3TA3D 4AYFA 3KDPB 1S7XB 3DETD 3BVNA 5LAXB 3QRGH 2PTVA 2R56H 1XGRA 2DOCA 1SEQH 4OJDH 2ZONA 3QI9D 2Y5QA 1GGCH 3FFCB 4OZGB 3ARDB 1YUHA 4RMQA 3GBNH 4NC0B 5FYKL 4ZS6D 3PWJA 4I1RA 5C09E 4UQ3B 3A6BL 4YUEH 5ETUA 2OSWA 5HYFA 4DUVA 4TTDC 5EU4B 3MRMB 1M7XA 1IV8A 1OCCB 3G6DH 25C8L 3NSDA 1H6UA 4X98A 4A7TA 1M2OA 4ZFOA 3O6ML 2QHLA 3ILQD 1E4KC 5ACZA 5C08A 2P8MA 2EKSA 5AAMA 1HCYA 1DBBL 4PJXE 1NCUA 1ZE3C 8PAZA 4G83A 2R2BB 2P5EA 5AW4B 3TO4A 3ARGD 3K4DA 1CUOA 4JLRA 2WXQA 3GSQA 5E51A 4JY5H 4QDGA 3P54A 1WIPA 3V4LA 3L4ZA 2K8QA 2P5EE 2VZTA 4NFBA 5C0AE 3D39A 4TUOB 3HMWH 3MUY1 3UTQA 3NJLA 4NO5B 4X7SL 4A2EA 1JNNL 3KHOA 2DWYA 3QZPA 1TG8A 4HGWB 3D85A 5HDBB 3ZHDA 1MN4A 4UDTA 5FX3A 3WIHH 4CMMA 1I7ZA 4U49A 5BQDA 3VH8G 3CHXA 1P7KA 3EFDH 2WXJA 4BSVA 1R6VA 5IP4A 1XGYL 7PCYA 1IX2A 1X6NA 3DX6A 3EF7A 4H20H 1ZLWK 1NCAH 5KJRL 5KSBB 3ARGA 3F65A 1TR7A 1PSKL 2VJ8A 3SBWA 1P6WA 1SUJA 4HS6A 2Q7YB 4NQDA 1G7LA 3FU7A 4HG4J 4TF4A 4DNLA 1MFNA 4NQCD 2YSSA 1DQTA 1ONQA 2J25A 5D7LB 3DX8A 2JSFA 3ARDA 5T3XD 2ZCKH 2OTWB 5ACZB 5HYSB 3BD5A 2Z93A 4ZPTA 2VITB 4MMZB 2VLLA 4M43L 2NNAB 3MXWL 5AW2B 3DDGA 4M6OH 2EE6A 2PCYA 4HCRA 5DFVD 1GS7A 5PAZA 3ZE0B 2YMTA 3K7UA 2H0FA 5ESAB 3VD4A 2R1WA 4ZAKD 1HCVA 4FTVD 1K4CB 4ELKB 5MI0B 3DXAE 1CGYA 3GKWH 2VDPL 4G8AC 1HXYA 2B1AL 1A9BB 2Y7OA 5IG7A 3AQXA 3FCTB 5GS3A 4ORGB 4AJYV 2LU4A 3ULSB 4PYGA 2MKWA 5CILL 3MA7B 5KZCB 4ELME 1VFBB 2CK0H 5EO1A 2ZE0A 4FQQA 5KW9L 3AREC 4HH8A 1N0LA 4HYTB 4Y2LA 5JORB 1QASA 3LDBC 4S1RL 4G59C 4QCIB 5I16A 3HR5B 4HD5A 1N8OE 1F56A 3LQAH 2F8IA 4U0RB 4W70A 2DWXA 4Y5VC 1XWVA 4YZFF 3VXMD 5MI0C 2P4AB 2A6JA 2Q3ZA 3SKNA 3PL6B 1AKJB 4ETYA 4XO5A 3GSXB 1VCBC 4I3RL 2FX9H 2OJZL 2XCMC 3RIKA 4F9LC 3PNWB 4QRSB 1TMCB 5EIIB 3BYYA 1UZ6F 3QNYA 2MOGA 2NY1B 4ZUWB 2XPYA 2BSSA 5B22A 1SBSH 1ZT7B 1B6UA 5F44A 1F4YL 2K6YA 4PI2A 2K7PA 5GS0C 2JJVA 1JUFA 1MUJB 3S37L 1RSFA 1WWBX 3WUWG 1E3ZA 4WU5B 1ACYL 3NCYP 3PWNA 4P2RD 1KIPA 4MXVF 4PYHA 5TH2A 2DLFH 3RX8A 4FQ1L 4UOZA 1O9ZA 1PZAA 1EO5A 1OALA 4NKIL 2AQQA 3B2VH 2GJ6D 1TVHB 5CO1A 3K6OA 5TQ0L 2W38A 3ZRCC 2F58H 4OT1L 2WUBL 3ARDD 4P0DA 4BKTC 5I1CL 1F4XL 1LWHA 1UC6A 2GK0A 5DZVA 5LQBL 1A4KA 5T5FA 5HHPB 4JG9A 2VXQH 1DJWA 1T0MA 1WTLA 2IG2L 2VE6A 3FT3B 4RMSA 1IGTA 4EXPX 3HFMH 3DWTA 5CBEB 3RL2B 2E8ZA 1F42A 2FSDA 2XXCB 5GISH 1YNTF 3VXNB 1FFNA 5ID1B 1C5DB 1KB9J 1NC4D 3V55A 2JCCA 2ODIA 1IGCH 1CMOA 2PXYD 2OTUA 5IFAL 1ZT4A 3MRPA 1HHKB 3WTXA 2WO3B 1LEKA 5KVEE 4J1UB 1J8KA 3FQ2A 4X4MA 1RHHA 4S1RH 5FO7B 3UZEC 4RIRB 1L5GA 3L9RA 4HZ1A 3GPSA 2AV1A 1OHQA 4F8PA 2GJ6A 5L88L 2X3AA 2XBTA 2AAAA 1MWAB 5E2UH 3U1QA 5DUPH 1BQHG 2GCYA 4JFEE 4YH6A 3AS3A 43C9B 2QPFA 1J0KA 2B4CL 4XPTL 5CEYA 2RH0A 2WWNA 4DGYH 1OCOB 5IQLA 4H5SA 1ZKAA 3VXMA 1MCSA 2PO6D 1XR9B 4MNGB 2C26A 2X4QB 1B90A 4QRSA 3ATDA 3RIAK 5EF0A 2BWQA 3BFWA 4HDIA 4LHUB 1WQVT 1F8TH 2ZOUA 3AXIA 4UM8A 3M46A 1WZKA 1ZS8A 2F54A 2L7UA 3K0WA 1RZJC 3KJ6L 4ZG1A 5L4JA 4L0YA 4LKCA 2G4GA 3GSOB 4KY1H 2FATH 3P9LA 3CK0L 3IS1X 4LLAA 3B8YA 4MCZA 3F6JA 2V5YA 1RUPH 5BVJA 1E40A 2JJSA 4NO0B 2VLRA 5FF6B 4AQAA 2NNRA 4XP1H 4L4TA 1H5BC 1AIZA 1AC0A 3OPZL 5DJXA 5L7XH 5A6MA 1ED3B 2YXVA 1C08A 4I18A 3T4AB 1II4E 1A4KB 2XKNB 1U3HC 4OD2A 3QAZC 4JRYE 2O61A 4AV0A 2ATPA 2CCVA 3ETBF 3VX0A 3CZGA 4WI2A 3ARFB 4NO0D 1RHHB 3RIAF 1OPOA 4O2CB 1IGMH 1PKQE 2OX5B 4DAGL 4EE2A 4GUOA 4BGDA 3LS5L 3P0YH 1X7SA 4JRXD 1YEGH 1AR1C 4W9IC 4XNUH 4EIBA 1SHMA 1E4WH 1AO7E 4AYBA 1DCEA 2GEEA 1FDLH 1SFDA 4UILH 2ZOOA 2CO6B 3MV8D 3QEQD 1F00I 5D72H 1TCRB 5EBMA 4MJ6B 5KS9E 1ZCRA 3KPQA 1RZKL 4PGEA 3OZKA 3T8XB 1ZWIA 2WINA 4I77H 3S8GB 4PJBB 1U95A 2W91A 3T1FB 3H3BC 3AWFA 1FBIH 3K74B 1YN7B 2ED8A 4R4BA 4I87A 2DW5A 1W8OA 3OB0H 3PHOB 4FFYL 1JGIA 3B9KD 4M9PA 5D96C 1BWWA 5FKAB 1NPUA 1ZS8B 4KO5A 1IKOP 2A9AA 3P4NB 2WYZA 1E5CA 1QHQA 5ITFB 1IGFH 2VOTA 4NJ9L 4Y8DC 5C70A 3WDHA 2QLYA 1KBPA 2H26B 3AY2A 4X5QA 2WAQA 1J5OH 1L3WA 4YHNB 3MKKA 3TWYA 2JKIS 3UZVA 2V9TA 1HILB 2HB0A 3DX3A 3WFZA 1L6ZA 3EO0B 3KEDA 1T6BX 4YIQA 2CJUH 4H1LB 3RPBA 4FL4C 2VSKB 1A0QH 1NCGA 1NBYB 2BHZA 4OQ1A 3O4LA 3TBVB 4UT7H 4DN4H 3MLWL 2YD0A 3O9WC 4K94C 2D3VA 4GUCA 4JKPL 3RWCB 4XNYL 1CYWA 3WIIL 1MRFH 3FQXB 5KVGE 3BPNC 4XOAA 5HYSG 5IQ9B 5HI3D 3LRLA 5I66A 1DLFH 9CGTA 5CSZB 1UM4H 3T09A 5EIIG 5C8JA 2OX5A 5I71B 3DKHA 2EUZA 4GMSL 4BCZA 1OTSD 3QUZB 1JWUB 4Q2ZB 5DEGB 3E3QE 5E6ID 4AGLA 4BSWA 3BKYL 4M7LL 3O11A 2R2CA 4Y2DB 5K9OB 3Q2LA 3N2JA 3PJSA 4KH2A 4Z3JA 2WXLA 1KLGB 4ZFQA 2LOEA 3VMPA 4EVNB 4GIPD 4FG2A 5LWYH 3Q6GL 4MMXC 3HUJE 4XXWC 4I7ZC 2Y7NA 4L4VB 4FFZL 4FQXC 1QBLL 1NIBA 4YHMH 3RI5K 5JPNC 4ZTPH 4KK5D 3S4SA 1F4YH 1LD9A 1QOKA 1R24B 1BBJA 3EDFA 1W72A 4NAJA 3AUVA 4PJ7F 5M95B 5FFLA 2YA0A 4TQEL 2XRAL 4KJWD 2Q8BL 1O0VA 3KHQA 3SYAA 3PLYA 2WOBA 1EHLH 4NC1E 3MV8A 3QEQA 4UT9H 1ADWA 2H47C 4PBDA 3TCLB 1XO8A 2F58L 1OGAE 1QFOA 1JD7A 3O41A 5IMOA 3F12A 4I9WE 4JQVC 1BQKA 4GH7B 2N1TE 3MJ8A 1EMTH 4PJGA 5LCVH 2GTWB 2OJEA 3EO0A 3VMNA 3TO4D 5I76B 4D8PA 1I7TB 3MNWB 5SV4A 1ZXKA 3AG3B 4JG5A 4YHPA 1F8TL 1MFMA 5CGMA 4AI7A 4WRLA 4LLMA 1KJ3L 1HL8A 1I1YA 4RQQB 5DDHB 1KB5H 5F9OL 4GFXA 3UZVB 2Q86A 5INDB 1UB5B 2LLGA 2JKRM 2VLKD 5GGRA 3WHE0 4EI6A 5KBNC 3FU3A 4QTHA 1TZIA 3EJCA 3S5LA 3IJSB 3TN0C 2FWUA 4MJ5A 3NP4A 3REWB 5E4EB 4RWYL 1IQWL 3VD1A 3CN2A 2JKLA 3C5JA 4IGBC 1UD4A 5FM4A 3RWDB 3E8UH 1GMIA 1N70A 4MXWH 2IOOA 2ZTBA 4MKTA 4N1EA 4UAHA 5CJOH 1LO3L 2FSEA 3P11L 4FJZA 3S5ZA 1REIA 2XQBL 3BKMH 1SNRA 2Z4QB 1S5HA 2L7QA 3U2IA 2I9TB 4C8XA 2LTQC 1GPOL 1OVZA 2VABB 3VWJA 1AFVL 2DQGH 5MERA 4ODSL 1TQTA 1IBHA 1NAMA 3O4OB 5DUMH 3S3BB 3U30B 1K6QH 3LKPA 3BEVB 4OCLC 3FSVA 2QADD 3J8F7 5FM5O 4PV9A 4UT6A 4L4VA 1NCWL 4JFFB 2VW7A 4HUUB 3ZZLA 3S4SB 1V3MA 3HJ0A 4TSCL 2FD6L 2Z8SA 3KPOA 5AKRA 1P5UC 5FA3B 2FL5A 2EDOA 1LL1A 4L8DA 2JV6A 4K4KA 3TF7C 3MRBA 1ND0A 4S10A 1NUGA 4JM2D 1PKQA 3WI9A 2CRZA 4KZDL 1PIFA 2GPZA 3FO9A 1SLVA 2P5WB 4OJFL 4P2CG 1IFGA 5D2NB 4EIGB 5HHMD 1E4XH 3PPSA 4N2AA 1LO5B 5FA4A 5FGBA 3WEMA 5C0BD 2EYSB 1QZ1A 5DI8B 1MIEL 3NN8A 3AG4B 1ZEAL 4QR7A 4L1LA 1IUZA 2KL6A 4OCSL 3BWAB 4WFHE 1PX3A 3QJRB 4QRUA 1M6UA 3UTOA 4HEMA 3CZFB 5ITBH 1QYGH 2H9GB 1GAFH 3ULVD 1RZJL 3MCLL 4LSTH 2N7AA 3Q8FA 1FL5B 1A8ZA 1ULVA 3GZQA 2GHWB 4LLMB 2HN7A 2IDQA 3KPSE 2E9WA 5D8JL 4RQQA 5DDHA 5AQ0A 4IJTA 1HWGB 1U2HA 2E59A 2Q86B 3ES6B 1JHLH 5AOIA 3SDCA 3WUZA 4EIZC 4GQ9L 1NZRA 4JKPH 4NQSA 3VFGH 4DKDC 1OSEA 1P1ZB 4NPJA 1QI5A 3K8MA 5MP6H 3OJDB 4M6AA 3WNMA 4RCAA 4BZ1H 1VEPA 2UWEA 1QVOA 3UPCA 5EF1A 3UADA 4P23C 1RURH 3G08A 2FJGB 1L7IH 2D2OA 5EOCH 2H7WA 1MVYA 1DJIA 4AV5A 1MCQA 2ITCA 3WKQA 3EADA 2B77A 3NAAH 3EJPA 4FEMA 5FDWA 4C83B 1AZNA 2VZSA 4ZMLA 3MLTA 4Y9FA 1BPVA 2F7PA 4WW2B 4DP1X 3P3RA 1KELL 4TLKA 2A9DA 4KRLB 1PZBA 1T7VA 3V0JA 4X9HA 4MD4A 5T3XL 4Y4HA 5E8OA 2CHNA 2ENPA 3D4YA 4M7KL 1IEBA 4NDMA 3R18A 5DK0A 3MRBB 1LEGB 2X4NA 3N42B 2VQ1A 3GXNA 3V52H 2WXOA 5IJKA 1JZFA 2VITA 4MMZA 1IC4L 2WN2A 5T1MA 2O1AA 4IOSA 1AIFA 4HOMA 1RHFA 2DWDA 2XNAA 4PJ7A 4XC1H 3DROB 5E9DB 2FZ3A 4DP0X 4RDQF 1G1CA 1EHAA 1CU4L 4N2CA 2BY3A 4LEOB 3ETBJ 1VERA 1A64A 3IGFA 2D3LA 5DEZA 3QFJA 5E6SB 1YY8A 4Q7DA 2ZCHH 2HTKC 4J27A 2JIXD 3C08H 1DN2A 4LSSH 2FEEI 4WO4A 4XX1G 3FQTB 4B50A 2FX7L 2XVKA 2ZOLA 4U1GB 4Y9CA 4LGPB 5KYYB 4A6YB 3QRFM 4JL1A 1DQJB 4FTVB 3P0GB 4DKAA 5EPMB 3ULUD 2WP3T 4K55A 1G94A 1NEUA 4PW3A 1BJMA 4NT6A 1UJ3A 5HYQB 2QQKH 3BDYL 3BWAA 3ES6A 3GEFA 5I8EB 3VX1A 4S1DC 2MPVA 1G1YA 4ALAL 1IC7H 4OV6F 5IT2H 4W9DC 3S0PA 1MCRA 1EBPA 2QMJA 5D7LD 4LCCB 1Z9MA 5FHBH 4XHQA 2HN7B 2XVGA 3A5VA 4LVOC 2H0EA 4O5LL 4POZC 1J86A 1T1XA 3UCQA 3MV01 3FDWA 4HAFA 2XVBA 3RUGB 2R1YA 1DQMH 3BI9X 3DHMA 1UM5L 4RAVA 3ESVF 4P59L 5F7AA 5BRPA 5D1ZA 1JRHI 2EDJA 1CG9B 2OP4H 5E1AB 2YD2A 3HG1A 1XFPA 3NFSH 3U0WL 5FYJE 2FBOJ 2ZP8A 3VU1A 3MKGA 2OV0A 4WV1C 2Z31A 3APNA 5CHNA 4QRPE 4HUKB 5A2CA 5FFOA 4M1GL 4O9HL 5E8NB 5TK4A 5IEHB 4ZXBD 1G9NC 1M7DB 3DROA 2WHVA 1KTDB 3CFEB 3TBWB 4QRBA 5D93C 2OCFD 1YJDL 2GSGA 5DMJB 2A83B 3OAZK 4J6RH 1MEXL 2FE0A 1OKEA 1J9SA 2LFGA 4HWNA 4A63A 4G6JH 4WO4B 4Y8AA 1U8MB 4F7CB 3DBXB 4Q56A 2IEPA 3NJIA 4XGZA 3SE4C 4RGNE 1DQJA 1I9RL 1J1XL 2GBAA 2NW2A 3QDJE 2VXTL 4LQFH 1U8QB 3FAWA 5LHDA 1LMKA 3OAUH 2ZKHH 3MBWA 4LDOB 2CIKB 1TTAA 4MLIA 3ZDYF 2QQNH 2VMEA 3QFJB 4TLUA 3VGGA 5HJ3B 5F0MB 2ALAA 3GSNA 1NKGA 2OXGB 3ZDXE 3QCVL 3GMNB 1MCWM 1L7IL 3UTSD 3H54A 4M1DH 5BRZD 4P49A 4HPHA 1TYEB 4HWEL 5I1KL 4B9JA 1GC1L 4LO9A 2VH5L 5JW5B 2E76C 4U31A 5DSCA 2D4FA 3TJEL 2X1WL 3O6KL 3BUTA 1MIML