3QYMA

Structure of p63 dna binding domain in complex with a 10 base pair a/t rich response element half site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
192
Chain Sequence
b'SPSNTDYPGPHSFDVSFQTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein 63
publication title Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
total genus 35
structure length 192
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qymA00
2XWRA 3ZMEA 4GUOA 2J1XA 3WTWA 5AOLA 3QYMA 3US1A 4AGPA 4MZIA 5AOKA 2MEJB 5AB9A 1GZHC 2PCXA 3D09A 4QO1B 1E50A 2J1YA 4IJTA 2IOIA 5AOIA 2IOMA 3VD0A 1LJMA 2J6WA 2RMNA 5ECGA 3D05A 4MZRA 1KZYA 3Q01A 2J1WA 3WTYA 2BIQA 3EXJA 4A63A 4L18A 2P52A 3WTVA 1HJBC 3IGKA 1IO4C 3TS8A 3D06A 3VD2A 1EANA 4IBSA 5LAPA 3Q06A 1HJCA 2IOOA 1UOLA 4XR8C 4IBVA 1CO1A 1GZHA 4L0YA 5KBDA 2X0WA 2BINA 3WTSA 3VD1A 2GEQA 2WGXA 4IBZA 3D07A 4HJEA 4AGMA 3QYNA 1T4WA 1YCSA 3WTUA 3US0A 2BIPA 5LGYA 3D0AA 3WTXA 1EAQA 2BIOA 5ABAA 4IBYA 4AGNA 2OCJA 2J1ZA 3Q05A 1H9DA 2XWCA 2J20A 1TUPA 5BUAA 4L0ZA 3D08A 4GUQA 2BIMA 2FEJA 4AGOA 2ATAA 4KVPA 4IBTA 5G4MA 5AOJA 3IGLA 1TSRA 2X0UA 1HU8A 4LOFA 1CMOA 2H1LM 2X0VA 4AGLA 3WTTA 4IBUA 5AOMA 2YBGA 2J21A 3KZ8A 5G4OA 4LOEA 3WU1A 2AHIA 2AC0A 4IBQA 4AGQA 2VUKA 5A7BA 2ADYA 3KMDA 4G83A 4IBWA 4LO9A 4G82A 3EXLA 5G4NA 1EAOA
chains in the Genus database with same CATH superfamily
1NSNL 3DOSA 3HC0A 5FHBL 5D7JA 1WS8A 5A40E 2YAEA 5HDBB 2XN9A 4FFYH 2FWOA 2H32A 5AVTB 4Z7VB 5AG9A 4HH9A 4F15B 5I1IH 1OE2A 3FQUA 3WYRA 2W92A 5D5MF 1DVUA 2BWIA 4IRSA 3B2PA 4NUGH 2F9BT 2XDHA 4B9YA 3OR7A 4OF0A 1MI5B 2AK1L 1JYVA 1ONQB 3EYSH 2CA3A 5LWYH 5C1MB 4BA8A 4YSDA 1N0LB 4WW2F 1M71A 1MIEH 5T3XE 4G42B 5T5NF 1WQVT 3QIWB 3WL9A 4F37F 4XXWA 4HKXA 4R90H 1AHKA 2NY6C 2OA9A 3GXDA 2WIMA 3OBAA 1PZ5B 5HHNB 2WINB 2WLJA 5J12C 1IGYB 5EFIA 1KCWA 5J1AB 4PVMA 3GM8A 4JM4L 1HKLH 4ACPA 3EHBB 5GGUA 1M7IA 1T83A 2NX5E 4WCYL 1MNNA 4C56B 3UROR 1QBML 1B3IA 2D9CA 4GRWB 2C3VB 1AS7A 1FYTE 4PWEA 1BLNA 4Z23A 2WSKA 3OPZH 2J2ZB 3IAPA 2ZX6A 3MRGA 3MRHB 5D93B 4L1HA 5CEZH 4P5MB 2XWTB 2ZOWA 1YEEL 5FGCE 1NCOA 2W0KA 4FQCH 3P11L 2IWFA 3UH8A 1KCUL 4ZRGA 5IHZB 1CFSA 3ATEA 3UZQB 5C0BB 5I6MA 5D96C 1E30A 4G9FB 5KYYA 2D3LA 2O93L 2Y2WA 3LRSB 2J5LB 1E42A 4TSAL 4L4TB 3A4AA 4NFBA 5D8JH 2VH5H 5L6YH 1AKJD 1CICB 3UXFA 1JZHA 1BVLA 1YMHA 2ZUXA 4DK3A 2EYRA 2HFGH 4HAFA 5T5FL 5FUCC 4R9HA 1KPVB 3G5ZA 3TJPA 1SQ2N 1J0ZA 1Q9OB 1OARH 4J8RA 3RB5A 1EUUA 5HYJB 1NEPA 4YWGL 1CF8L 4KY2A 3WD5H 3VGFA 4JPWH 4YQXH 3HE7B 4TTGA 3M8OL 4YXKH 5FLVA 3BSZH 1ZLUH 5LNGA 5J6GA 5I71C 1D2OA 3UBHA 5B38B 3VXRE 2JKTM 5EORH 1JK9A 3M46A 4XO3A 1OW0A 2ZICA 3TA3C 3ILEA 3ISYA 2FJSA 5FGBC 3Q44A 5CGYC 3SO3B 2X4QA 2VR7A 3UPRA 3NZ8A 1NBYA 2R23B 1EBAA 1JMZA 3W9EB 2G30A 4RAUB 4E42B 1JWSB 1NEZB 4EN3D 3B9DA 2QSTA 2CHWA 3MRJA 3FB5A 3M1BA 5HSFA 3H9ZA 3EH3B 4AK2A 3T0XA 3ZDZE 3A4DA 5BMFH 5H35A 1A1NB 1MREH 4FCAA 3EH2A 3HE6C 4EI5C 1X44A 5DD6B 2NY2B 4RA0C 2APSA 1TQCC 5AOLA 5DJ8A 2HFEB 2RGSA 2LV4A 5AOKA 3SDXF 5DK2A 2HT2D 5D70H 5A2KH 5I0VA 4QHKI 5T3XL 4AH2B 4A04A 2Q9OA 3EDFA 3TX4A 3NSJA 5EH1A 1V10A 3HUJA 2Z7UA 3N91A 1YEIL 5KBMA 3PHQB 4PRPA 3UDWA 3UG5A 1FL6B 1I8AA 2X4PA 4NNYA 4UNUA 2IADB 1CTNA 4HH8A 3JWDH 1CG9B 5EN2A 4R26H 4ENZA 3TBVB 2LU3A 4G72B 2TSBA 4H8VA 5JW4R 5K9OB 3KPSA 3VWKB 3QCTH 1I8MB 1T6BX 3Q5TA 3MDJA 4Z9KB 1T5WA 2FL5A 3BC9A 2Q7YA 3BXNA 4AYMC 4A6YA 3HCVB 1QZNA 4K8RC 5L8JB 1G7HA 1DVFA 4GBXA 5MP6H 3QDME 3ZK0A 5KBDA 3MV9A 3GWJA 3HVDA 3TN0A 1G6RB 1NUGA 1PBYA 3O2DA 5C0RH 4PWJA 5J3HC 5AB0A 1R9FA 4N5EC 1DVZA 2CRZA 5I17A 3L3OA 1KB5H 1ZWIA 5JIMA 1NGPL 1E9OA 1R3HA 4BFFA 1NTDA 4APQC 4OFDA 3VXOA 3X2QB 2TSAA 4MDIA 1RHHA 1KIRA 2CGRL 4PP1D 4R4ND 3GLZA 4NQCB 4G1MA 3U25A 4LHQB 2XWCA 4ODBD 3TM6A 1JCKA 1D9KB 4JCMA 4XCEA 2ZX7A 4K3EH 1B0GA 1B9ZA 5LN8A 1FVEB 2FJHA 4N1HB 4X5PA 3D3VE 3MRIA 1NAMA 4XMKL 3FUEA 1OAUH 2FGWH 4L5FL 3BGAA 2E6JA 1YLBB 2OQJB 3FH7A 5EEYA 2DIAA 4OFPA 4ZOAA 2VRKA 4DTGH 4PJEA 2RR3A 3VGHA 1AO7E 1ZVSA 4XO5A 5DWPA 2BZ7A 2LE9A 2R0ZH 4UNVA 3FO1A 1SDDB 3TT3H 15C8H 4JM2B 2WXPA 2BVYA 3L95A 4LHUG 3O2WL 3CX5J 2XIIA 4BSVB 4G43B 2EIBA 1MFVA 2WLLB 2OMWA 1OPGH 1UD5A 5E51A 1JI1A 3D87B 4I18A 5HHME 3QG6B 5LJYH 1Z5LB 1YEHL 3KPRA 4HEPA 3MLWL 4K5MA 2IH3A 1XH3A 1OPOA 2VGLM 3QFGA 1QSEB 5HJ3A 1ZIBA 1YEFH 4LSQH 4OIBA 5E9DB 1ZDSA 4BFIA 4WJKB 3B5GA 5DD3L 4NN5C 4FDWA 5E6ID 3SKJH 1OE1A 2XVBA 2WVSA 4ODSL 4ODXA 1GZHC 5I6XB 5GGSB 3DX8B 2J1YA 2YPKB 2OPCA 5TJWK 3VD0A 5KOVC 5HI3D 1BBDL 2V2WA 3OJVC 1L4IA 1Y7VA 5GS2H 2BS9A 3BP7B 3HG1E 3HI6H 2HA1A 1MRDH 3U4EA 5IEHB 2BJML 4XI5C 5D7LA 2FGZA 2X4OB 3EGXA 4JPIA 4DVBA 4F9PA 4PJHE 1HSBA 2DLFH 4XPBH 3Q1EA 4BFEA 2XZCL 3B7TA 4FQXB 1MRFH 4HPYH 3DX2A 4JLRA 3T2QA 5E4OA 2R15A 1GH7A 2F0CA 2X4UA 5EIVA 4MQXC 2H41A 3ZE2F 3REVA 4NZTL 4TUOB 1KDJA 2BWQA 2DN7A 2HRPL 3R1GH 1FZJA 3KVDD 1CXFA 1WGOA 2J3SA 1EX0A 4JQXC 4ZSOA 2P44B 4CKQA 2DM3A 2IWEA 4AVHA 4YDJB 5KSBF 3WNKA 3G6AA 3MOAL 4LFHG 3WDJA 3W11C 2O5YH 3NCYP 2PCYA 4PW4A 2GJ6A 5C08E 2R0WH 4U6VH 3FO2B 4GB9A 2EEFA 2QFPA 2MTPA 1N7MH 2B4CH 3S5LB 4QAWA 5E5RB 5GIRA 3SYQA 3K91A 2PP8A 3X3FH 3ZO9A 1B4RA 3FNKA 2ZTBA 1RK1B 2W0FA 8CGTA 4NQDD 1TR7A 4PD4J 1P7QA 1RUKL 5ERWB 1N2RA 4LBEB 5IW1A 2CK0L 3CN4A 5E8DL 5FX3A 4HW6A 2ZJSL 3GK8H 5DYOA 3MLTA 4RX4A 1S9YB 3VA6A 4FNTA 1OTSC 2DLHA 4YSRA 2V6HA 5D7IB 2X2JA 4OLVH 3IFNL 1U2YA 2VSMB 1HWWA 3ZLQC 3H9SB 4WWKA 1JZ7A 1K8DB 4R7NB 2X4NB 2V3DA 4RGNB 3TH2T 3WEAA 3MNZA 3TOPA 1B4LA 1ZAGA 2QV2A 2AEQH 4JB9H 3DLQR 2VITA 3A6BL 1K85A 2AEIT 1I3GH 2EUWA 2ADFL 1LTXA 1U30A 1P53A 3MJWA 3PNWB 5KTEL 1LD9A 3ETTA 4QRPA 1CXKA 3U7WL 2V2TA 4KKAD 5ESQB 5JORB 4NO2B 1KEGH 1P4BH 2XN1A 2XWJB 3NSFA 3PGDA 5FV1L 3VMNA 3RI5K 4MDJB 3GXFA 1V55B 3MLRL 4W6XB 5BS0B 5KYNA 2W9LA 3UJTH 3P73A 4KXZH 3T4AA 4ETQA 4WQOA 4F1ZA 3MGTB 1FFRA 3TT1L 1SJHB 4EZJA 4YFLI 3MA9L 1CDCA 2ICWI 3ZTDC 4NUJA 4OUUB 5GS1C 4GLRI 4H44C 3O6FC 4QGYA 2DQHH 2UY6B 1QFPA 1L7IL 5DFVD 1WBYA 2OJEA 4Q0XH 1OEZW 3W2DH 3ILQD 1OHQA 2R1XB 4QRQB 1VFUA 1EO8H 3CFEA 4JRYB 3QH3A 1ACCA 5DJ0A 3GDCA 3DX6B 4QHNA 2YAHA 4U2ZA 3AQXA 4MB4A 3TCXA 1U92B 2BSSA 3T65B 3IDUA 3RIAK 3MRKB 3IU3A 4OW6A 1N67A 4X6CF 3E9TA 4JO1H 1NWPA 1U8CB 3QUMA 1S9KC 3ULVF 1XBRA 1JGVH 2FLRT 4TL5A 4BH8B 5D5ME 4NENB 2ODHA 5IR1B 1B90A 2XZAH 3IN0A 2BRRH 4Z7WF 4HIHA 1I8LA 3MLVH 2XI9A 3SDYH 2DM2A 3LRLA 3EBHA 5ICUA 2JFCA 3FTGB 3X1FA 2A6DB 1EJFA 4I2XA 4KAQH 3IDYB 3V8CA 2XG5A 3P3UA 3HW7A 5C0AE 4DJMA 5CXPA 1JNLL 2N56A 1KG0B 3OKNB 4PQXA 4BWWA 2F54A 2ZAHA 4Q56A 4N6RA 5TQ0L 1DQTA 2R59A 1S9VA 4JEGB 2WLIA 1BVKB 4LCVA 1F4AA 2O6DA 3BGFB 1FV1B 3TBBA 2EXSA 3L1FA 4OZGB 2TRHA 4IIQA 4L8DB 4N68A 4Y19A 3VFOB 1QO3B 3N1FC 4JPSA 3BUYA 1IBFA 1U93B 1E2ZA 3C09C 4X6FA 4PRHE 1QR1B 3IXTB 4GFXA 3L9BA 1BPLB 3I9IA 3B8YA 4WEBL 1Q94B 1TTUA 4YSUA 1R3JA 4Z0XB 5I18L 1F18A 3P9MA 5DMGC 2OMUA 1S7VB 4F2EA 1HVXA 2C4FU 1JDAA 1KF9B 2J6EL 4YHPB 3CK0H 3GMPA 5DWUH 4ZQTA 4UTAH 2FATL 3JWNC 3TBTA 4UT7L 3U4BL 1A3LL 4DETA 1TJXA 3KBFA 4RDBA 4E9SA 5F72S 3QYMA 5FO8B 1NEZG 5JPNB 1VAHA 2NY5C 3IJHB 2CIIA 4QCIB 1JNHA 2I5YH 5KZCB 4AYFB 3NZHH 4ZX4A 3FCGA 4L1DA 2IPKB 5HJDA 3UTSA 1E4KC 4PV1C 1PNDA 3LKSB 2A9BA 4B95C 2DDQL 1BEXA 3OAYH 4DEPC 2Y23A 5FCUL 2NQ3A 1T1YB 1UADC 1MCPH 2KZBA 4M1DL 4X6EB 3W82A 1MCIA 2VXSH 3NCWA 3D2UD 3TXAA 1UQSA 3SJVD 4FHJA 1GGBH 3GJFH 3KDMA 2OTWB 3FQNA 3MOQA 4ETYA 4M1GL 3MGAA 1JV2B 3PWPB 3PWJB 1MVUA 1WCBA 2CGYA 1SBBA 1OL0A 1H9VA 2J43A 2PW2A 3VXUB 5E4EC 4Z0BH 3KPPB 4POZC 3AREB 1EJOL 2YRZA 1CFTA 1MDTA 2O6CA 1XZ0A 5AKVA 5DRWA 1G43A 2V5RA 3RY4A 1BFTA 3NDZE 4XR8C 2GW5A 1UH2A 3MXWH 4QRUA 2VM4A 4KU1A 3VYOA 1IBYA 1KGYE 2MNWA 1G94A 3S2AA 4EZLA 4R4BB 1NCBL 2GIYA 1GSMA 2C3WA 3SDXE 3D85A 5AB1A 1WEJL 1FH2A 3ZDXF 1QNZL 1S7TB 3S35L 4TNVK 2HN7A 1TO5A 2R2HB 4ZTPH 3WHE0 2ED6A 3IF1B 3L5WB 2WXHA 3ASNB 2EIZA 2HJKA 3SD5A 3MUJA 1I7UA 4M56A 4NO3B 3TNMA 3VFSB 3VI4B 5FUZL 2Y4SA 5J6HB 3BDBA 5JXEC 3WS3B 5DT1L 3QO0B 4FQ1L 5FA3A 2ITFA 4W9JC 4WK0B 1JRHH 4XHJC 5E2UL 3GIZL 3CPLB 3GKWH 5IBLC 3THMH 3WEMA 2OMYA 2FEEI 2LVCA 4ERSH 4HJSA 2RH0A 2GHWB 3G6JE 1PG7W 5ICXB 5C86A 2X6AA 1Y6NR 3MJ8B 3VTTA 4YAQA 5MEQA 2XKSA 2EIMB 2XV0A 3QQ9C 3HG0A 4HCRH 5I6KA 1N68A 2P8LA 1IGTB 4PTTA 2GSGA 3WKQA 3KYNA 2GK0A 4Y89A 4BQ8A 2CRMA 5B8CC 2H1PL 3IU4H 3JV4A 3VUAA 5B7FA 3MTXA 2HX8A 4HAKA 3VCLA 5T1DH 3FTSA 3FHQA 5AKRA 1MY7A 1GC1C 1AD0A 4ZPTA 3SDDC 2IAAC 1P7KB 5GGQL 5IGXH 4N22A 3GXPA 4AK1A 4B9PA 3GRWA 5F9OL 1MLCA 3BKCH 5DHVH 4FL4C 1DE4B 1NOAA 4DK6A 5D71H 2BSTA 4N2OA 3CFDA 1PLGL 1TFPA 4LSTH 1AD9B 1X9QA 1X3DA 3C8KB 4LARH 2JB6B 4WV1A 4ZAKA 3EOTH 3QIBA 4XVTL 3MFGB 3HAEB 1QBAA 1UWFA 3LSOA 4ZFFA 3B9KD 4UTBL 3INUL 3BAWA 3DIFB 4O4YL 2E7CA 4J4PD 4G6FD 2WLNA 1BZOA 1CGUA 4JGMA 2RCSL 1UD3A 3DBSA 3AGWA 1B0WA 1F1GA 5I15L 4MS8D 1AKJB 1A02N 3EH1A 3HR6A 3FU3A 4AC2A 4PYGA 4PS3A 4S1SH 2N7AA 2ICEC 2EE0A 1UZGA 3B5HA 3M6DA 3P54A 4YXHH 3BSGA 3DVNB 1S5HA 1EFXD 3VJ6B 3NJIA 3EYQD 2VMFA 2ZKHH 1VLXA 3DMMD 3VFUA 4KKPA 4W9FC 5GRWA 3NCJH 3HZYB 4X4XA 4MZ2A 3E8UH 3S9DB 3RIFF 4MGXA 4KH9A 4CBPA 1WTLA 2XWEA 1DDHB 3QDJE 3ZBMA 3L1OL 3LPGA 4PP2B 1UD2A 5HVWA 1AZZC 5DJ6B 3X1EA 4ZT1A 2JB5L 5HYSB 4I77H 4HS8H 2WBXA 1E5AA 2R0KL 4LHUA 3AWEA 3G5YA 2EAEA 3VFRA 5JLZB 1EAQA 2YAMA 2JCWA 2D3NA 3RFZC 4WI0A 3R4DA 3LN4A 3QHFH 4EN3B 1GC1H 5E6ZA 3MV7A 1I9JL 4H8WH 4JDVB 3DJZA 1FZKA 5AW8B 1Y07A 5J9PB 3TBYA 1YEGL 4YO0B 5C0CD 4RIRB 2WYIA 1BX2A 3Q8CA 3S5LG 3H6AA 4C4KT 3BPLC 4LNVA 3ZU8A 4XNXL 4YN3A 3GUFA 3ZE2E 2KDGA 4WUKH 1AJ7H 1PZ2A 2X1XR 3KPMA 3LZFH 2IG2L 1OCZB 1QASA 4QT5B 5DS8B 3T2PA 3GSOA 4BK5C 3UTTE 2AEOA 4QDGA 4UDTB 4MNHA 2BH0A 3HZVB 5CMAA 2F8OA 4KKBC 5KSBE 4EJ1C 5JYLA 1FNEA 1QFOA 3QVAA 3CHQA 4JR9L 1ODAA 1LK2B 2W9EH 2B1AH 4MLSA 2J73A 3FTVA 1RZGA 1YNKH 5T1LA 4MD0A 2AJSL 4OM0L 4TL4A 1GKOA 1R34A 4AIOA 3G3LA 3OKDA 3O9WA 1E5YA 1TZOA 1WWAX 4OFQA 1HWGB 4GSRA 4U3SA 1QNIA 3LD8B 1HXYB 4LIQE 4XP6H 1DJYA 2QSCL 4EVNB 4JBSA 4RBPH 3HUJF 2XY2A 1T5XB 2APFA 4TLKA 5B1CA 1CE6A 4HQQL 4TTDD 2VXQH 2XIDA 2WIIB 3QUXD 2W9DL 1UM5L 3Q6GL 4AM0B 1PNCA 1HK6A 3MLZH 1T66D 3RJOA 4KHXL 2AJZB 5D2LB 4L1BA 4NC0B 4J1UB 3RY6C 5EF0A 4JQVA 3ULUC 3PAZA 2ROXA 2HX9A 2X87A 1FFTB 4DGIL 1PZBA 3AXLB 2AEWA 3J8F7 4MAUL 1U8OA 4FKEA 4PFEA 1G7IA 3EGDB 4IQHA 3D4GA 2BNUB 5FA4B 4AEEA 1Z6JT 2H6OA 4Z7UF 3PJSA 4GRMA 3S5ZA 1UWGH 1KIUB 4BJLA 3B2UC 4WK4B 1N8ZB 3CZFA 5A3ID 4ZO6A 4HXAL 3G04B 1FVDB 3HBQA 3FB8A 4L8BB 4NGHL 3KNBB 4PIBA 4WUUE 4ADIA 2AMUA 4NAJA 3RNQA 3RWJB 4OUOA 2OMVA 3VXQB 2F68X 5JHLA 5JO5B 1DSYA 1CK0H 4LCYB 4Y8DC 5IM7B 3DV6A 3GMQA 4W9GC 5E6IB 2D7NA 1MNUH 2PXYD 4BWTA 5AENA 1M7DB 1KLFA 3EJCA 4AKPA 4R96B 4YBHA 4HLJA 4NYLA 1HXKA 2X2UA 2HAZA 4LASL 2BP5M 4HXBL 1M2VB 5JDSB 1OAXL 4F8PA 1N70A 1MCDA 2BOBA 3NA9H 4JDEA 1JP5A 5EU3A 1JE6A 4HZAA 1MCSA 1UD6A 2YOCA 2RA1A 3O3AB 3WJLC 3TO4C 3Q2WA 2JI2A 4LCCB 2IJ0C 4MX7B 4R5VA 3GI9H 2NW2B 3M1OA 4X6CE 2QADD 3TWCH 3M17A 3CFKB 3LIUA 1IBBA 2WTRB 2XZQL 3PWLB 2A3TA 4Z7VA 5KN5A 5D4QA 4F9LC 3LVEA 1GGIL 4PJAA 4Y2OB 3ULVE 1YMME 2XPYA 2OSWA 1CBVH 4HPHA 5IJDC 4YDIL 3F2LA 2IBGA 1RUPL 1WFIA 4JAMB 5GJTH 4FTVA 3F85A 1I7ZA 1D5BA 4IRZH 3CMOL 1LHZA 3OWRA 5CKAA 4U1MA 1SOSA 3QQ3B 2QQLH 3OX8B 3IK2A 3ZTNL 2V4LA 2WUCH 2P47B 1YNTF 2NYZA 4RLDA 3QIWA 1R3LB 4LIQL 4WSJA 2AXFB 2DI9A 3PFQA 3CSGA 4CVWA 4HUCA 1JZ8A 5D7KD 4GXFA 4C83B 3L4VA 5FOBA 2WINA 2DM4A 2NRDA 1IGYA 4N8CL 4Y4HD 1J5OH 3NFNB 4IOSD 4M43H 2UWEA 4MJ6B 3PL6A 4C56A 3N0AA 4DUVA 2K6ZA 3IMRA 2L8AA 2EXWC 1H6TA 4HA1A 5D1XC 2MCG1 3CG8A 4AQ1B 4PRBB 3Q8AA 4P5MA 2L7QA 3QEHB 1KIPB 3FBKA 5BRQA 5K59F 5DO2C 4FEMA 1R3KB 1IM9A 2JKLA 1EGJL 5I1EH 4NQDB 1NGWB 3UZQA 5C0BA 1C16A 1F11B 1RIHL 3GBMH 3O45B 4OCLC 1IAKB 3KLHD 4G9FA 5E2WH 5CLWA 2YMXH 3LRSA 3RVXD 4L4TA 2DM7A 4G11A 1F6AB 5C0DA 5C3TA 3IS0X 2NY3D 1BQHG 3GXUB 3GBDA 3QRFM 5JDJA 1CICA 4D0CB 3B8SA 3SGEI 1J8HD 2XQYK 3CQPA 3NCCB 2HKFH 3VRIB 3GZOA 1R75A 1LE5B 1QWNA 1MCOL 3T09A 3ATAA 3WIAA 5FCSH 1KPVA 2DJUA 3UTQB 3CLEL 4GEJA 3NZSA 3NABH 4UDUA 5HYJA 3R8QA 1OAQL 5D2NA 4N90E 4OTXH 2BIPA 4CA4A 3U0PA 1ANUA 1X7SA 1IKFL 2JVUA 4OGQC 2C9VA 1BXVA 3B3IA 1I7RA 4O2CB 2OCJA 3FTXA 1HL5A 1OZUA 5ES4B 4YUEH 1JZ6A 5CJXC 2XJKA 3QS2A 3ROOB 3ZGIA 1MCCA 4U1HB 4ZX3A 1S3KL 4FYQA 1I85C 1RXLA 1MKFA 2H3KA 5FUCE 2R23A 5T1KD 3PABB 3W9EA 3LPFA 1OM3H 4RAUA 1HIML 1NEZA 2EDDA 4OGYH 4ODVL 1M7UA 2A9CA 2J5WA 1UENA 4ZQKA 1A5FH 3ULVL 1A1NA 4ZMXA 2BXYA 4NNXA 3I50L 4ODHL 5ANHA 3N04A 1KFAL 4PGBA 3WMQA 2H6PA 3DSFL 3K5SA 3QPQD 1BM3H 2VMCA 4I0PC 3QFDB 3H4FA 4P4RA 4AH2A 1T6WA 3ZUNC 4D9RE 4EMZA 1FNLA 3ZXAC 3GBLA 1YPZF 3ME0B 4XX5A 1G0XA 1JPTH 2PMZA 4KKQA 5F7WC 1GHFL 1OSPL 4C54A 3EXLA 1M05A 4HUWA 4L8CB 1I31A 4OBRA 3CN3A 4E9VA 3PV7A 1ACXA 1RY7B 2VR3A 1CG9A 4GRLD 4R84A 1S8DB 5C0IA 1MQ8A 4M8RA 4RAVB 2DMHA 3S48A 2PCPA 1CGWA 1NLDH 4XNMA 1PF3A 3T0EC 1AFVH 4MA7L 3BISA 3TPUA 2FDBP 3PWNB 2ERJC 2YXWA 1SVCP 2R2EB 1PCSA 1A8JH 3B2XA 5C0ND 1EHKB 3HCVA 1UGKA 4HYTB 5JZ7D 1DEDA 1MFBL 5MENA 3H4HA 1GGCL 1G6RA 1CGXA 2QPEB 3LIZL 4QJ4B 2UXVA 1BF8A 4P2OA 2X2YA 4KUCF 4F15C 2DQGL 3O2VH 3MBWB 4OQTL 5C92A 2NSQA 1BZQK 3MV11 1PLGH 4Z7QB 2UYLA 4AMKL 3IGAB 2R2BA 5CN1A 5C0GA 4A37A 3QZOA 4QTIL 1V3JA 3GS7A 5LAPA 2A9AA 3BAXA 2A0LD 1FLRL 5D1QD 4OFYD 5B1JA 5I82A 4PWIA 3GGWB 4OZFB 1UCBL 5IIEB 3F04A 5EB9A 5T1MA 2M83A 3KW7A 5L8KB 5IBTH 5GGTA 2XVLA 3UAJA 3L3JA 2K7QA 4W9DC 3QZBA 4LLMB 1LEGB 3MLUL 4LLWB 4PJGA 5DVPA 1X6LA 3BAKA 4JE0A 5C2UB 1A6VH 1F5WA 1RZ7H 25C8L 3FQTB 3ZE0F 4B7LA 1Z9SB 3RZCA 4QLRA 5KYUB 2ZWKA 2G2NA 3DUHA 4ZFQA 5EHFA 4MNQE 1ASOA 4UQEA 2EDYA 2PF6A 2CLRA 3FYIB 3HC2A 2Y0SA 1JHLL 3OB0H 4GP5B 5AKTA 4AJ0A 5DC9B 1CTMA 2BZDA 1SYVA 3BP4B 3MQIA 1KBWA 4I3RL 2P43B 5BXFB 4BELD 4BSVA 2WKOA 4GAGL 1NFKA 2Y7LA 5CO1A 1EJ8A 5BRPA 5IWLA 3WKYA 1ZPUA 5ESVB 5MEPB 2KPNA 4OD3H 4G59C 4NT6B 5EOCH 2NSMA 1PLBA 1LEIA 2CO3A 3BE1L 1MCRA 1T1XA 1QWHA 1XL4A 4U6XB 5D4IA 5EA0H 1JV5B 2A1WH 4DVRL 4IHOB 5LBVA 1DQDL 3D2UB 3SJVB 5GGSA 4K7PX 2XTJB 3EW3B 3CD4A 4J3OH 5JW3H 1XZWA 3APCA 2K4WA 3C5JB 5J11C 4AT6B 3HE7C 1DBMH 5BW7A 3PHSA 4U1GB 2P80D 4KZ0A 3Q2CA 2UUDK 5IEHA 1PEZA 4GUOA 4X7FC 2ZUYA 2DKMA 3OXRA 3EJJX 1E43A 3VQMA 1TZ8A 5JW4N 1RIVH 4LSDA 4FQXA 3SO3C 3DGGB 3B2VH 3HMXA 4DERA 1GYCA 4LPTA 4XB8A 1A4JB 1T89C 4H40A 4WFGD 3SE9H 5JOPD 2Y1VA 1MJ8H 4LB8A 1CLZH 5GZND 1PKOA 1TEGA 2HPTA 4QXUL 4F20A 1JFQL 3UO1H 2VC2H 4QXGH 4NQED 4HUMB 2BVPA 1DVTA 2I32A 1IMHC 1J9SA 1KEML 3NFSL 4YDJA 4KTEH 4XPFL 3CC5B 4W4NA 4FMVA 4AUUA 3ZMNA 3EF7A 1BQKA 1ZGLP 5GS0D 4K8RL 3L4XA 4B7IA 5K39B 1BYNA 3DJTA 5E4AA 3FO2A 3IS1X 4LL1A 3L9YA 1HH9A 4GI8A 2FQDA 1Z7JA 1SYSA 3S5LA 4AYID 2EACA 1ETZA 1SEQH 3FOLB 4GMTL 5BQDA 4PJFB 5DQ9A 5A2AA 2HVKA 1QPPA 3QB7C 4CVUA 3PPEA 4W1TA 3VD1A 4LBEA 3VWKC 2NXZD 1ZHLA 3M86A 4XOEA 4KZEH 3JVGA 4KNUA 1N10A 4EI6A 1JZIA 2NR6A 4M7LT 1MCNA 4NZUL 4PRNA 5ABAA 3HUJE 3SGDH 1XB6A 2P24A 4PRPE 4HIXH 4L3FA 4BQ6A 1G0YR 3LNEA 3T9WA 2A6KA 2ZWYA 5JXAH 1XVSA 1E4XH 3LZLA 3RYMA 1K8DA 4R7NA 2D03L 1XGYH 2PWFA 4ODUB 1GS8A 4Q9RL 2DI8A 2XJLA 2X6VA 1VGEL 3MXVL 3F00A 3ZYZA 1RMFH 3N3EA 3WHXA 5ADPL 3KPSE 1E6OL 3IBEA 2CO7B 1EUTA 4XP4L 2FT8A 2PCFB 1IB5A 3L1EA 4KZDL 4BXVA 3A4FA 1C5DA 3EJYD 2EO9A 4DT2A 1CDGA 2JCCB 2OMTA 3BGMA 5IMOB 1JHTA 4J3XA 1F8TH 4OF7A 3I02B 3B9KB 4JHAL 1D9KC 4M7JH 3MV9E 4FULA 4G6FB 1KTCA 3CSPA 1EVTC 2D2OA 4MDJA 1AOZA 4FQ2L 4Z7UE 5DZOA 5BZWA 4QHKJ 5LBSA 4M8VA 4JCLA 2X6BA 3QA3A 1VGKB 1HT6A 3MGTA 4H13C 3KCPB 1GCFA 1ZXKA 4G6KH 3ULUF 4G5ZL 4OUUA 5D7LE 1EFXB 3NTCL 4MWFB 3DMMB 4JG1L 3X14B 3FH8A 1A1MB 3F7VB 4ONGH 2FH8A 3QUYD 4JM2C 5DMIH 1Q0XL 2P46B 4NAMA 4AL8H 3EYVB 2Q3XA 5IQ7H 1IGFH 2LOEA 3KEDA 3PS6A 3V6ZB 3BZEB 1O75A 2AP2A 1A6UH 3DX6A 5D9SB 4XX1E 3QEUA 2JV6A 3FZUD 4ONFL 3T65A 4DO6A 2WAHA 3GHBH 4AJWA 4U3XA 2A9MH 3MRKA 1SVBA 3DETC 3LVTA 2ORBH 1U8CA 2ZAIA 3WG7B 4PJEE 1ORSB 1HNFA 1KPUA 5CJ5A 3QFJA 4BH8A 2NQDA 2Z8SA 4OF8A 4NENA 1HC1A 4PLKC 5C0CB 3VU1A 1UKSA 1I1FB 1CD1B 5ACZA 1X5ZA 2WWKT 4PCYA 2F53A 1GSKA 4N0CC 3ZKXC 2JE8A 2DYPD 2ZF8A 1CQKA 4JN2B 1QKZL 4QRSB 1KG0A 2OJ1A 4R8WH 3OKNA 1GTNA 5G55A 1LXMA 3FRUB 2XXFA 1IRAY 2PTTA 5HVHC 1BVKA 3P40A 2DWSA 2W1NA 1FV1A 5IESH 4OJFL 3U2IA 3P2TA 3TJHC 4G8GD 4WY7H 2E74C 3GI8L 4L8DA 3V8OA 3ZPDA 3ALPA 4HK3N 3VFOA 1I8IB 1QO3A 5FO7A 4PRAA 3STZA 1JWMB 3FUNA 1QR1A 3IXTA 3MBED 5CIPA 3IKCB 4PV9B 4HV8A 2C34A 3TBSB 5KUKA 3ARPA 3UYOD 1Q94A 5K59E 2R69A 4Z0XA 3ZMRA 1E5CA 2GC4C 2GABA 5CSGA 4NZFA 1FCGA 2F8VA 1OCCB 3PDOB 5DJ2B 3WGVB 2VAAB 4BFGA 3F12A 2N3JA 2Q0ZX 5IT2L 2H3XC 1IARB 2Z8RA 3DVGA 4ZK8A 4PCKA 4PJXF 3ARGD 3O4LD 3FOMB 1T7XA 1TTGA 5FO8A 4X4ZA 5TTRA 1UA3A 3FFCD 4OLYH 3K71A 4ZSOE 3HN8A 1JVOA 4PJBB 5FHAL 4MFHA 4YNYA 1HXMA 4Y4KA 2CSPA 1D5MA 3ZT6A 1KXTB 3TU6A 1BIHA 1H3GA 2WZAA 2GJ6E 3DTXB 4UT9H 1T1YA 3RDTC 4QEGA 5A1AA 5LGJB 4ODVH 3FT3B 1SBSL 1HQ4A 5AW1B 4GP8B 2MFNA 4O5LH 2ZNXA 1JF1A 4MMXB 4X9GA 2P28B 3O6MH 1BQSA 3QC6X 4EOWL 2AAVA 2YXVA 4RGNC 2VDLB 1J11A 1B9KA 3AT9A 1BQHA 2XLLA 3PWPA 3HRZB 1CIUA 3PWJA 3UTZA 3VXUA 2P5WD 3CFCL 4HD5A 4PW9A 3AREA 1NFDB 1MCEA 1MCWW 4OCXH 5M94B 3QC5X 4DP4X 1LGVA 2B77A 2G3XA 3QZMA 1SDYA 3S2CA 1EAJA 1T20B 1W80A 4NN6B 4AIZB 1ASQA 4ZTOH 4PVBA 4GEIA 4PLOB 4CMHC 5L7XH 2HPOA 3CSFA 4IHBA 4R4BA 4A7QA 2I27N 4FHBD 5DUML 5HGHA 3TEXA 4ABWA 1KTJA 4UQ3B 5ID0B 3P69A 3U48A 1LE9A 1DL7L 3II1A 3KW8A 5AOZA 1TU2A 2R2HA 2PXYB 3OKOB 4QTHB 3IF1A 2CPUA 3L5WA 3Q06A 1NANI 3I6LD 2D7PA 1G9NL 1WA2X 4NO3A 4G7YL 4Y16D 2V17L 2VSCA 3B7UX 4HC1H 2WXOA 5FYKD 3VFSA 2Y36H 2SEBA 1W8EA 1TTCA 3LH9A 2Y5TB 3VI4A 4Z8FL 3FU9A 3KYMB 3FAXA 2JI3A 4WZ9A 3OKEA 2MPAL 2QADB 1WA1X 2DEXX 1CWVA 1QBBA 4IRJD 4S1DC 3MCKA 3WS3A 2X44D 4Z5RB 4YX2L 4NSKB 1U3HD 1NMBL 1HH6B 1ORQA 2VDQL 1M4KA 3CPLA 1TZIB 4OZFG 5J8OA 4JFED 4J6IA 1HE8A 5ICXA 4RMRA 3AG1B 3MJ8A 1FORH 1PD1A 2YD9A 3SZ6A 2DBJA 2KL6A 2D7OA 4XRCB 4GXUM 1CGVA 3POCA 4OZIB 1T7WA 1IGTA 2JXMA 4LDCA 5JUEL 4AQ8A 3FC8A 1HDMA 1JZ5A 1AKPA 3OQRA 3SY6A 3IVKB 4H0IA 1ADQA 1AANA 3FQRB 2IGLA 1PJWA 3VXMB 1EJ6A 3BD4A 1VADB 3NPSB 1XV8A 1NL0H 3UADA 2J55A 4YDLC 3R0NA 3AXIA 3OF6D 4Y4HB 4L4JA 4NQQA 1F4XL 1HWHB 1RI8A 1IFHH 3GNML 3MKGA 5CJQH 2WXNA 1U8JB 2CHNA 4Y4FC 1YUHB 3T08A 5HDBF 2UY7B 2OX5B 2V9TA 4XC3H 3FSVA 4WI5A 1AD9A 4Z7VF 3VDCA 3C8KA 1JWUB 4Z95H 3X3GH 2JB6A 2GT9B 5AEAA 4FI6A 4DFHA 3TESA 5TDNA 4XVSH 4ELKB 3L3HA 4LRNL 3WIFB 4W70A 3U2JA 3UBGA 1JXFA 2ICWJ 1JDDA 2OZ4L 3ZE0E 1TJGL 4PH8A 3S8WA 3B1TA 2X4TB 2HKHH 4F27A 3FN9A 3DIFA 1CDYA 5I1CH 2XA8H 5HGDB 2NY5L 1T0MB 4R2GD 4RMVA 1LO3H 3KBEA 5F3BB 1AHWB 2NY3B 4L29A 1NFIB 2FR4A 5IMKB 4N26A 1J8HB 1UEMA 1F58L 3SKMB 1M6OB 4FX5A 4BHUI 3V10A 3VJ6A 4N87A 4F2MB 2ZXCA 4O02B 4F37K 4JZJC 2X42A 4X7SH 5CILH 3WFZA 3U1SH 3ZZSA 4ZUUA 4HOXA 4UUJB 4XCNA 2EADA 3ROLB 4GRWF 3HZYA 3CDGA 4P07A 2F2HA 2EO7A 4M02A 4O00A 5DO8A 3VWJD 4D8OA 3RVVC 3T1WA 5JPNC 3Q43A 1SVZA 3N9GH 1MAML 4PN6A 5HYSA 4G1EB 4KXAA 4DOHE 2X5PA 4D3CH 4CU7A 3KGRA 4MXQD 5JLZA 4XGZB 5T1KB 4AEHL 2A73B 4R4FH 3WDHA 4EN3A 3TIEA 4JMXA 4GKNA 1JPSH 1UWEL 1BAFL 1OTUD 1HOCB 1RZPA 2B9BA 5J9PA 5C09D 1KC5H 4PV8B 3VFMB 2R0LL 1HZHL 4YO0A 4IDJL 3PGFL 2ATKA 3SCMD 1GCYA 1FJ1B 2IC2A 5TDOB 3FU6A 5ICYA 4OZHB 2CMRH 2DTML 3QRLA 4RNRB 3G5WA 2WVVB 1C8QA 1CYGA 2DICA 5SWSD 1L5GB 4KK6C 1GRWA 4W4OA 3UTSE 3WN5B 1CIDA 5FM4A 4YSOA 2EABA 4HISA 5CLZA 4YZFF 4GH7B 2GJPA 4JRXD 5DS8A 4LSRL 1YDPA 1ZD6A 5ENWB 2H32H 1OP3H 4CC0A 5H37G 3SE6A 1ZT1A 4GRLB 3HZVA 2VT0A 2Z6FA 4L3ED 3SKNB 1GPOH 2NUPB 4U1LB 3MV8E 3FT2B 3S3BB 2IV8A 4L3CB 4TQIA 1UM6H 2EXYC 2WUBL 4LCWE 4KNTA 2HKAA 4H4NA 2PR4H 3O8XD 4N0FA 1I1CA 4D0BA 4YHML 5ID1A 1OWRM 4QTFA 1T1WA 1A7RL 3PGCB 2L04A 3J2PA 1CF1A 4V2CB 5GRJH 3QCVL 4ONHB 4PCTA 3TYGL 4HSAC 4ANKA 3GM0A 5JIIA 4TRPH 4PGEA 4K94H 4JFPB 4DGVL 4YL9A 2GYSA 1QABA 3QEQD 1Q9WA 2H45A 4XN8A 5JMRA 4PMEA 1BQLH 3W81A 2CXGA 5DEJA 5I8KH 1KN4H 1LDPH 1MFDL 3RP1A 5D1QB 4PJ8C 5IFJB 4GQ9H 2UXFA 4JY5L 4KI1A 3V4PH 5B8CB 5KAQF 1IVTA 4KI5C 4AM0A 2Y06H 3ET9F 3QWQB 1X5HA 2DEWX 4N0UA 3L3DA 4HAGA 3JT0A 1MHHB 5D2LA 5GGRA 1JGUL 4J1UA 5I1DA 1CE1H 1WFMA 3K2KA 1H3XA 3AXLA 3NMEA 1LWJA 3FRPB 2ID5A 3F5WB 4LVOB 4G5ZH 1CS6A 3EGDA 4U6YB 2X4SA 3QO1A 2IWKA 5CU9A 1JVKA 4FNLH 4OZ4B 4OU3A 4P3CL 5AZ2L 3VDBA 2VL5A 2WCGA 1T2QH 4XE0A 3G5VB 4G8EB 5DUPH 2DQTL 2ZYHA 5E8NB 1D7FA 4P23C 4PBVC 2NNAB 2Q8AH 1R5IB 1RU9H 5EU5B 3CZJA 2IGTA 2DAVA 3B56A 1WH0A 4ZUTA 1N8ZA 5GZOC 1UXWA 1GOFA 5HDQL 3WAJA 2P49B 2Y9RT 5EEZA 3G04A 4OY9A 1FVDA 3KYKL 4L8BA 3ULUE 5CJOL 3LXUX 1UYWL 5AAPA 3VXQA 2F5BH 3AABA 1NCNA 3AC0A 1A7OH 3LXAA 5E6IA 4HIEA 5DRNB 3KPNB 2AJUH 1GYVA 5KVFE 1M7DA 2NQCA 4RISL 1P5UC 2AANA 5SX4I 4XZUB 4TNWF 3WKML 1ROWA 2XQYG 3VSTA 4Z3FA 4MX7A 1DJIA 4HFWA 4OT1L 3PWLA 1ZS2A 3VFTB 1YJDC 4GUQA 5IP4A 4XWGH 4KJQC 1QLEH 4JM2F 4L37A 1D5XB 2LU7A 2LU4A 2WKOF 4NKMB 2KC0A 4KFZC 1BBJA 1SFHA 4IYKA 2ZXWB 1TSRA 4XT1C 5CLTA 5JOFB 2FJFA 3IJ9A 3QQ3A 3OX8A 4CDHA 1TOXA 3QJSB 3LV3B 3QR1A 2EE2A 1A6WL 1IQDB 1R3LA 4KTYA 2AXFA 4PB0L 4C55A 5E24E 4C83A 4Y1AE 3MV01 5AVWB 4I18C 3SPVB 4NQEB 2ESVD 5CP3A 5IVZA 4AE0A 1HCZA 4FFVC 5KSAB 2ICCA 5AYUL 5DS2A 1CXHA 2WZ6A 2Z8VC 3NFNA 4HKBB 2P3YA 3ARRA 2BX5A 2HT2C 1M7XA 2QR0A 4GT0A 4PW3A 3MRRB 4MJ6A 3K4AA 2Y5EA 4A6YH 2VDOL 1ES0B 5FUOL 1ZPLA 1H8OA 3F7YB 3Q5OA 4OSUL 1HAUA 3O2DH 3RWGA 1XR9B 3QEHA 4GKSB 3MV7E 1OM9A 2K8MA 2XCMC 2QVIA 3VXSD 6CGTA 4AGPA 4PS8A 4CSZA 2QVMA 1ZOXA 5B7MA 4DN4L 4K7FB 4HJJH 4NQDA 4DKFH 1F11A 3O45A 3WGUB 3MYZA 2NXZB 2CNZA 1VPOH 1GGTA 2PPEA 2C7FA 3MA7A 4ZD3L 3FTWA 5D7EA 1SXBA 4KO6A 1WZKA 2AQQA 5HDRA 5D1XE 4D0CA 2OM5A 1I1AD 4H2CA 4PJXE 3VRIA 4QRRD 1EMTH 2FBRA 3ULUL 5I73B 1JGIA 3QXUA 3UTQA 1GAFL 1NAMH 4E0RB 1RVFL 1LNUB 3LD8C 4K23L 1R33A 1MHEA 3ZTJG 4PLJC 2M1KA 3ML9A 4AQAB 1H3PH 4RRPM 1G9ML 5KVFL 2VM9A 1CFVL 4XVJL 5EU6E 3ROOA 3VM7A 4R4NC 4FTDA 4U1HA 4CGUB 2ZKWA 4NQVB 1VF5C 4XMXA 2MPVA 5DJAB 5DZLA 3QI9C 2VZ3A 5E2TH 3PABA 4H0HB 1X5IA 1HE7A 3D4CA 4UQ2A 3LKNB 1IKNA 1T1ZB 4DP7X 3HN3A 3DHMA 1R17A 2FB4L 5D7IF 1NICA 1JTTA 2YD5A 1A7NL 1RIUL 4GW5B 3UJIH 2ZX9A 3T4YB 2Y6TE 3L2MA 1BVNP 3S37L 5JR1L 2OL3H 4U2YA 1ILSA 2FSEA 5ITBL 3QUYB 3TFBA 3I6KB 3IXAB 4MQTB 4UINH 1KJ2B 4N2MA 2WD0A 2YRPA 3G7TA 3GXTA 3VFGL 5MEOB 2V5YA 4L8CA 2F7QA 3GLEA 2AJYL 5I8CB 4JUTA 1OAKH 5CGYD 2N7SA 3BKYH 1FNAA 3R7QA 3BWAA 3JTBA 1HHJA 1TSHA 4GAJH 2JKWA 3IJSA 5GRZA 4TM9A 2BNQD 4RAVA 4ORZC 3FH5A 1H8SA 1WHPA 4GW1B 1DJXA 4JFHE 4WSGA 4XMPL 1F42A 1CUOA 3GBNH 2RBLA 1OZTG 1ZSDB 3MRNB 4EI5D 3LMJL 3PWNA 4LMQE 1NGZB 1U8KA 4TUKH 4EN2A 4KJWC 5TF1L 2R2EA 3P9LB 3UX9B 1OLZA 2C9RA 4LK4A 4DF9A 3BUPA 5CGMA 3AU1B 3I9PA 3QQ4A 4NM8H 2V8LA 2VO8A 4WWOA 5TD4A 1DUZB 1MWOA 3HJ0A 4PVLA 5HVFB 4LCCC 3EYFB 3SDAC 4NLAA 2EVJA 4NS0A 5DD5L 3B37A 2DLGA 3DVFA 2DYPB 2VQTA 2D7QA 2VABA 2QPFA 4DIXA 4JVWA 3OMNB 1Z0NA 4J3UA 3COOA 3H3PH 5D7SH 3T0EE 2IAMA 5K9JH 3HG4A 2A77H 1FWXA 3N41B 5CINL 5DYFA 5EEXA 1MWAL 1URIA 3BWSA 2VDMH 4OD1H 1ZA3B 1ZLSL 2AEPH 3GGWA 3L4ZA 4G8GB 4OZFA 4XBGB 4NBZB 3T04D 5IIEA 2DRUA 2AW2A 4QJ5B 3O0RL 4HWZA 5HDBE 4FLRA 3UABA 4Z7VE 1EZUA 1R5WB 3U7YH 1YA5A 3ZO0A 5GJSL 3MBEB 1LEGA 4LLMA 5BRZD 1FO0B 2RACA 4W6YB 1U91A 3UGUA 3U30B 4IS6A 4JZOA 2CM5A 4KWUA 2Z8WC 3FQTA 3KJ6H 4A2GA 1Z9SA 3OKMB 5J3HD 1MI5E 4N5ED 2DQDL 5F3HB 3V0HA 1RD6A 1NCAH 3NK3A 4TKWA 1PKQB 4AQ1C 1E67A 2Z7YA 4BWUA 1BYOA 2H26B 1HHHB 4D8PB 5A6IA 4DKAA 4K4KA 3SY0A 4LAQH 1Z9LA 4TQEH 4APQD 5GS2D 4M93C 4PBWD 5BXFA 4B50A 3ARGB 4ZFOA 5IBUG 3O4LB 1AR2A 3DX7B 2J25A 2YPVA 2QGCA 3F7KA 3ISWA 5IB1A 4OLWL 2HX7A 2YUVA 3FFCB 3MJ9A 4MNGB 5LUMA 2KS0A 5ESVA 1BQRA 2GSIB 3HBZA 3HHMA 5IHUL 2OR7A 4NT6A 1ZHNA 4OZGF 4WGKA 2UWEE 4C56E 2BVTA 4GRWE 1NMCC 3J07A 1B0RA 2QLYA 2CKBA 1QVOA 2VWEE 3U0WL 5LQBH 1S78C 3D08A 1OANA 1IEBB 3D2UA 1PX8A 3SJVA 5DMYA 2CDEB 3V52H 1VFOA 2ZKMX 3L2NA 2OMXB 4LP4A 1WIUA 2IGFH 4KRMB 1MIML 2YA1A 2P5WB 3C5JA 5C0BE 4AT6A 3JV0A 4G9FE 1VFBB 1T0NB 3DUSB 3ZUCA 2ICWA 3FXIC 4L4TE 5KYWA 3VXNB 1P6FA 1SY6L 3LH2L 2R29L 4ACTA 1NLBL 2C1PB 5IHBA 3LEXB 1TG8A 3DGGA 5TH2B 1SHMA 5E6SB 1XSIA 1O0VA 5HHQB 2Z0UA 4RFOL 4AKOA 5IOPA 5HYJE 5FYLH 5IF0B 1QLFB 3D5OF 1QYGL 4A2FA 3S35X 6FABL 5JHLL 1CLOH 4YDVB 4B5EA 4MJ5B 4YZFE 2ICES 3QUMH 3A21A 1BMZA 1EH9A 4U1SB 4CN1A 4Y16B 1SJXA 4N0YL 3BH8B 3V0FA 1MCQA 2MEJB 3CC5A 4E2OA 4F2FA 1ZV9A 1EZVX 2ZT9C 3D12B 2AJXL 4U4BA 3X1GA 4F7MB 1F90H 3WXVH 2AVGA 1WRFA 1DQJB 5DVLA 4FF9A 2RQEA 4IRJB 5K39A 1ET5A 4NWUL 3LHPL 3WE6A 1U3HB 1MQKL 1SOQA 1NGQL 5F6HI 2O6PA 4HSCX 4P4KA 4TXVB 4JRWA 2IXQA 5A16B 4ZO9A 3FOLA 4WLCA 1N3NB 4JFEB 4PJFA 3WNLA 2Y7MA 5EC2A 2DQ6A 2K3TA 4GMSH 3MRMB 4MQXD 3BDYL 4N0RA 1C8PA 3HN5A 2HT3D 6PAZA 3ZR6A 5BZDA 4H25A 1CLCA 5GSRB 2BIIA 2KZ1B 4LKXB 5H37A 1PGRB 5CCHE 1SM3H 2YQBA 3OGCA 2CUMA 5EZIH 2O1AA 4PSRA 3BZ4B 3LKRB 2E7BA 3OJDB 4NBXB 3VI4F 4ODUA 5B3JF 4U6TA 3KPQB 3N40F 3BMWA 5CZKA 2COQA 5GHWL 1G7PA 1N4XL 4LU5L 1QFHA 1KGCE 3DBXB 3HEIB 5F1OB 3BVNB 5FYJH 4AMWA 4PY8I 5CCKL 3BCDA 1IGIL 2B39A 2EUXA 2G75A 5K5YA 3TTSA 1AP2A 3I6SA 2JCCA 2Q8BH 5K9KB 3US9A 2DLEA 3I02A 3KJ4B 3B9KA 3Q6FB 4OR1A 2DJMA 4ZS7H 1OTSD 4F58H 4J4PA 5MENE 1N12A 4DZBB 2XPZA 3OLDA 4R2GB 3L3IB 5IQ9B 1NBQA 1ZKAA 2JF1A 4KBPA 4KVPA 4NFDA 4LPXA 4XBEH 1AGCA 2N0MA 2YK1L 3B3BA 4U1JA 3F7RA 4TSCL 3KCPA 2QZQA 2YPLD 2N1TE 1O5DT 2YR3A 5DR5L 4MWFA 5EZJB 3QIUA 3S97C 1FLTX 2OLDA 4G7QB 5FR3A 2QGBA 1CYWA 4NQCE 3MACH 4PMFA 4YSTA 3GMLA 3KH3A 1K72A 2YBGA 4JO4H 1NC4D 3EYVA 2VXUH 3VWJB 4CN6A 3P0VH 2BHUA 3BH9A 2AHIA 2A74C 3EJQA 5ELIA 5D9SA 4MJID 5FPIA 2NTFB 1IFRA 4F8OA 1JK8B 4I88A 1KGJA 1JYNA 4UYQA 3Q9PA 2YWZA 2J1XA 4NJAH 1V7NL 3SE8L 2X1QA 5GGVH 3CSYA 3GSQB 1EAPB 5B22A 5TQ2H 1FRGH 3DX3A 2PCXA 1VCAA 1OF2A 2AV1B 1GY2A 2PW1B 2WVUA 3O6FD 1OP5K 2XTJC 3MOBL 4G9DA 3SCMB 1AY1L 1GTFA 4MBOA 3NACH 1ZGLA 1CD1A 3MYJB 3GUTB 3ILPB 1SXSA 3UOAB 1M56B 1NDMB 5SWSB 4G7RB 4P2QA 1A3RH 1QSEE 1TVBA 1DYZA 1XF3B 5I1JH 1PTZA 4LE8A 3S88H 1O5PA 1OSZB 3R0MA 5E9DE 1RQ5A 2XQYA 2Z35B 4JRXB 4LSUH 3NG5A 4BE6A 3E2HB 4F5CA 1U6AH 1MCFA 1LM8V 3MRBB 4LSSL 3OZLA 4GJTB 4WI6A 3RIFK 3U9UB 3OHMB 4L3EB 1QI4A 5LHDA 3ZL2A 4UV4H 4YSPA 5E99H 2DL2A 1HHIA 1P1ZB 4QRTA 1I8IA 2WQVA 2VLMD 4IU3B 2WSPA 4AY0A 4RWYH 2R51A 3SOTA 2R56H 1OIOA 2GTWB 3LKOA 3O8XB 2BCKB 2B8OT 1KN2L 3DV4B 3TBSA 5L4MA 4XCFL 3IGFA 4OIFA 4QOKA 1GYAA 4C47A 5E1IA 3DO7B 1KPRA 5IB4B 1MFMA 5DJ2A 3VB9A 3PDOA 5JHDA 2VAAA 3L5IA 4MA8H 2E4FA 2E6QA 2VLKD 3FCBA 3WO3B 4Z3HA 4D9LL 5ITFA 4HUXA 5IMMA 4JN1L 3GRWH 4TSBL 4KROD 1EZVY 1GL4B 3HZKB 4OCSH 3UERA 2XQBL 3QEQB 4AZUA 5EOTB 2V7NA 1OK8A 3MSPA 3MO1A 3BP6B 5JQ6L 1D2PA 4ZUSB 4PJBA 3HMWH 5E5MA 3QUXA 5ALBL 3AB0B 3LZRA 5BO0D 1KXTA 2GK2A 4MBRA 1J1PL 4JZNB 4I87A 5LGJA 3DTXA 1DJWA 5H94B 1RLWA 4XAWH 3CN1A 4H1LH 5DMJB 1MRCL 2ITCB 4E41B 3IKKA 3BJLA 4G3YL 4GAYB 3DJSA 1DQLL 1ECYA 3GMMA 4DWHA 3BAEH 2BOCB 3HRZA 1CDIA 4AGQA 2JJTC 3FSWA 1NCHA 2LQRA 2I60L 4GO8A 4WTWA 1J05A 5AUMB 1MHPH 4LO9A 4NHCL 2E6PA 1D7CA 1U8NB 1DLFL 4UM8B 2OR9H 4N25A 1T20A 1BOGB 4P3WA 3BWZA 2AQSA 3AQYA 3X13B 4MA1B 1C7SA 1PIGA 4FMKA 2F7RA 3KYOB 2VQ1B 2F1EA 3UZEC 3H9SE 5T5FA 2GPZA 3DC0A 4RGNE 3TV8A 3AY2A 4UQ3A 4OCRH 5LCVL 4X5WB 5ID0A 3UG3A 4YSSA 1M9WA 5HHOD 3R19A 2PXYA 3OKOA 4QTHA 3TONA 3GO1L 5D2LF 4A7GA 1DBAL 4YL4A 1PYWA 1VERA 2EDMA 4L2LA 3ZHFA 1AC6A 5BUGA 2IFGA 3NGBB 3BAJA 3DMMC 4K5NA 4OFKA 1PCXA 2Y5TA 3KM2A 5FK9B 2X9WA 1IX2A 3EDJA 1UH3A 3KYMA 4NJ9L 3CH1A 1F4WH 1L9MA 4PY7B 5T5NG 1JHKL 3RKDD 4HCGA 1PQZB 5EPMB 4GXVL 2FIKB 2F5AL 4NSKA 4DKEH 1HZKA 3C2AH 4OCYH 5BS0E 2YBRB 4BUHA 3QUZD 5B21A 4XPGL 2UZIL 2VLJD 3R06B 4PS7A 5HHXH 2WZPD 2G2PA 4XRCA 1P4IL 3MR9B 4UT6A 3KHOA 3HMXL 5C2BL 3U6XA 1KCVH 4OZIA 4L9LB 1PZAA 3WTSA 1L0XA 5EZOH 5HVGB 5TFSH 4W9HC 2EIKB 3HG5A 4PJCB 3IVKA 5T3ZE 3FQRA 1FFPB 2E4TA 5MHSD 4W9ZA 2ESVB 1VADA 2MH4A 1TYRA 3H56A 3NN8A 5FO2A 2ZPKH 4JRYE 4KUCD 1NCIA 1OE3A 4S2SB 4Y4HA 4EQ2A 4WDIB 1I82A 1L9NA 5JXED 2Y07H 1FF5A 4NLHA 1FQ9C 2DQFB 3QPXH 5C97A 2J1ZA 3T77B 5EULV 3I9AA 3WJJC 1YUHA 4XHJD 4Y2NA 3V6OC 1H9DA 4I13B 3QJQB 4XP1L 2Q5BA 5KVMC 2OX5A 3IE4A 2QT6A 3GEWB 3VXTB 2Q6WA 2IFFL 2GT9A 1ZCRA 3HZ3A 1FYTA 3OQ3B 4LQFH 2APBA 3VXSB 1BLIA 4ELKA 1JXGA 4CRPA 3WIFA 3GZPA 1QAWA 3D4YA 1UZ8A 4XOAA 5LAXA 5F8RC 4AE1A 4UQBA 3WUZA 3B1UA 4B6ZA 1T0MA 5F3BA 2HCZX 1A21A 2OYKA 2VSDA 3C6LD 1HQRB 5J12B 1WHOA 3SDDD 1KNOA 5IMKA 3VNYA 1J8HA 1I1AB 1KB9K 3W0WB 1HYRC 4QRRB 1M6OA 4R97B 3UG4A 4F2MA 4XNQB 3DNKA 1XF2A 4G8FB 4UUJA 2WNWA 3ESNA 3L5HA 4WTQA 4YZWA 3ROLA 5LXGL 3TV3H 5G4NA 3MJ7B 5DA0B 5TE6H 1BD2D 3EFDL 3QG7H 3FK3A 4ESKA 2IH9A 2ZCLH 3RTQA 3KLDA 4HWEL 1A6AB 2ZCHL 1VZIA 4YHKL 4G1EA 2VDRH 3FN0L 3LX9A 1WK0A 3K8LA 2PP9A 1MF2H 4QXVA 3BRDA 4UI2A 4OCMC 4XWOC 5FW8A 3L4CA 1JGEB 4N2NA 4ZOEA 1RL1A 4JY6B 1FGVH 2CG9X 1TIUA 3QCUH 3QXWA 5TE4H 3FAWA 1HEZB 2ADIB 4K3DL 3GPEA 4LDEB 4MMXC 1KZYA 3LS5H 3QNXB 4PV8A 5KVDL 3TEUA 3VFMA 2QFRA 2Z1KA 4MXWH 4U0QB 1I8KA 5TDOA 5LDSA 5KVEH 2OK0H 2WVVA 2P26A 1PIFA 1RZJC 4DKTA 5EBLB 2GFBB 3BEWB 5I8OL 2WP3T 1FNSL 1CB4A 3QJHA 5K1JA 3WN5A 2WSDA 1PSKH 5F88B 5T3ZL 1KB5B 5A3IC 3WSQH 2YXMA 4NN6C 2JQMA 5ENWA 4WNQB 1P1VA 1A7PH 2BINA 2J57A 4GRLA 3UTPD 2YAQA 4PJIF 1ZLWH 5D2NC 3I2CL 2GJZB 2BNQB 4XMLL 5FWRA 1RUML 5INDA 1FUNA 3PWPE 3AWGA 3SKNA 3VXUE 3RURA 1UWXH 3FT2A 1YY8A 2HTLC 4L3CA 4EI5B 4M6ML 2D4FA 1NUNB 2OTUB 4GSUA 4PLNC 2GCYB 1WG3A 2DQIH 2C7UB 2FRGP 2NY0C 2OSLB 4JO2L 1L9PA 4DESA 5K9QI 2L7EA 3NJMA 1H3WM 5K33A 4B60A 3ARWA 1K5NA 3QDMA 1WD9A 2ITDB 5C0JB 2YLHA 3P0GB 2PPAA 5DJCB 4A2LA 4HULB 1F2QA 5DC2A 2X0UA 1FE8H 4KKBD 1DN0A 4FP8L 1C5BL 4XNUH 1IGCL 3GZQA 2CHDA 4RMBA 4X9FA 5D1QA 1BF5A 3VI4E 5TF0A 2Y2TA 5DFTA 5B3JE 4OGXL 2O5ZL 5I28A 1CR9L 4A2EA 1M3IA 5A2JH 2VDKH 1FIEA 3K2UL 5DJYA 4OH2A 5DGQA 3TL5A 2ZXEB 1WT5A 2XXGA 3CXHK 3BSHA 1B4JH 4IMKA 4MVBC 1UOKA 3V4VL 3ZZ1A 5BRZB 3FB7B 2EDHA 3JXAA 1F2XK 1C9SA 3D52A 4PWKA 3TBCA 4KDWA 4U6YA 5EMYA 4MJJA 2R69L 4JKKA 4OZ4A 3KL3A 4PEEA 2YC1B 1LO0L 2ZYIA 3G5VA 3AQDA 3GSVA 4G8EA 4KUZH 1AXSB 4Z78A 4UILH 1FG9C 5E8NA 4MYPA 4APQB 4FG0A 3OHXA 1NCDL 2V2XB 3Q7JA 3DUUA 4EIGB 1XTMA 3I74A 5B1KA 4Z7QF 4YHZH 2E3VA 3KLHC 1EPFA 3IDIB 4CC4A 3REWA 5AAMA 3WY3A 3RVXC 4BZ1L 3KPOA 3I9GH 1AHWC 4KO5A 3IJEB 1SUHA 5FGSA 2JKJA 4LLUB 3KPNA 1V7NH 3WFBL 2O61B 1FIGL 1AR1C 4UNIA 3ARVA 3CBKB 4R5XA 1BOYA 5E1AA 5ETUA 2N01B 1IT9H 2R4RL 4S0HA 1A9VA 1NOFA 3HG3A 4FXLA 2K4AA 2HH0L 5JNYB 4IBLT 1NZRA 2NDFA 2YUXA 3E6FB 3VFTA 1C08B 2IDCA 1RH8A 1JNJA 1RULL 1D5XA 2FJGA 3WMSA 4NO5B 4OIIH 5AG8A 1OCWL 3IPBA 3MUGA 4P46A 4JHUA 4B41A 4R7LA 1QRND 3I85A 1JMXA 4YBQC 5JOFA 1G7MB 1H0DB 5F97E 3ZW3A 2OMZA 1A9EB 2HUHA 4DAGL 5GZNA 1IQDA 1YYCA 4AIXA 2Y1AA 3CTTA 3RBGA 3VFNA 4L1SA 2W91A 3T0AA 3H3BC 3SHSA 3SPVA 4NQEA 2XY1A 1YQVL 4TNEA 1BWWA 3MBXH 3OGOE 4LOUC 3AXHA 3OJMB 3TO4D 1VEMA 4HK3J 4HZ1A 4MB5A 1IC4H 2WKLA 1CZ8L 2X3AA 1XD0A 1ET7A 2F19L 2EDLA 4WFHD 3LZPA 1QSZA 3V9CA 4UIKL 3KM1A 4X80L 2NZ9C 2E59A 3MFFA 1H6FA 3HLAB 1WIOA 1QG3A 5DI8B 1G6RH 4LCIH 4YFLF 3WEXA 1QUNB 2WQAA 4JHZA 5GSVB 3WMPA 4HCFA 1ZS8B 1PY9A 1BJMA 3QISA 2J21A 4JO5A 2OS7A 3JTSB 2XTLA 3QJFB 4K7FA 4G8AC 2CUIA 4U6HA 3V9EA 4AVKA 3OJ2C 3AM8A 2IWGA 4Y8AA 1AACA 2W8CA 5LVEA 4M5YL 4XXDB 3WIIL 4QI3A 1D5IL 4F7EA 5JIQA 3Q9QA 1ADQL 2ZXDA 2W65A 4FNQA 3CUPA 1IBGL 3M7FB 4RMWA 2P48B 2GUOB 5GGTH 4XC1H 1AGDB 2EXWD 3VI3B 4AYBA 1IC5H 3AT8A 2EECA 1LO4L 2PP7A 1BF2A 1U8QA 3MZTA 3MJ6A 5I8EB 3WY1A 4AQAA 1Q0YH 3UP1A 3PE9A 2X09A 3X1NA 2A9NH 2P4AB 3GZKA 4JFDD 2Q2LA 5FV2A 5LB1A 2DW5A 3H9YA 2J1WA 4AI7A 4PJFF 5JTWA 4F7TB 2D0GA 4OD2B 3QUGA 3ATDA 3QAZB 1TLMA 3QRBA 4FXKB 4NQVA 4PRHD 3SQOH 3P0YH 5CP7A 2RIKA 4L18A 1IO4C 3DI3B 5CWSB 3LKNA 2GSMB 3ML8A 2J6EA 4M7KL 4KX9A 1MN4A 3MNVB 4H20L 2YPLB 3T3MB 2GBTA 5I1KH 4LVOC 4GW5A 3NP4A 3CLFL 1X5KA 3T4YA 1X5XA 1A6ZA 2QJDA 5L88L 3RU8L 4J3TA 1EXUA 3N6YA 2EDOA 3QUYA 1NMAL 3D2TA 3QW9A 3TYFB 2EDBA 3LQZB 3I6KA 3IXAA 4Q9QH 5I16B 1NC4B 4ZMQA 5HHPB 1MFEL 3BUQA 3G9VA 1IAMA 4N0UE 1HESA 1OHZA 2WBJC 5D2LE 1BEYL 5F89B 4EBQH 4FHKA 1S7WA 1YJDL 2AGJH 5I8CA 3H53A 3QORC 4MJIB 4C4KO 5KVDH 2AK4D 4YSEA 4I1PA 1TQSA 1WFNA 1RZ8B 1UB6A 1H8NA 2XA3A 1A64A 4CAGA 1CT8B 1OD7A 3ARBC 5KVGE 4NM4L 4LEXH 1CVSC 4M00A 1WIPA 1E4XI 2F74B 3UMTA 3MRNA 4GG8B 2KQNA 3GMOB 5AOJA 5DLMH 5GS1B 2Z1PA 5AW0B 4LXFA 3O6FB 1DQQB 3QS3A 4I0PD 2CWRA 4M6OH 4U3HA 3S36L 1DUZA 4NRZB 5E8PB 4DGYH 3EYFA 5LNDA 4JGJA 4LLVA 3DIDA 3SB3A 4DPBX 1U8HB 1WBXA 3N0PB 4UQDA 4K5LA 5JPMC 2I7SA 1FNGA 1EEZA 5JHAA 4LF3A 5CD3B 4PBXA 4WW2A 2AABH 5C0AA 1PPIA 1QFWH 3VA2C 2J12B 5CGBA 4UQCA 4NWTH 3SGJA 4DP6X 2DIEA 5I30L 4HBCL 2FQEA 1ZA3A 1UXMA 5FB8B 3ZKMC 4G8GA 1K6QL 1D6VH 3D25B 4HKZB 4XBGA 2PR9A 1MAKA 2E8ZA 4YPGA 4B96A 3FFOA 4JY4B 1J8RA 4QRAA 4R0LB 3NYKA 5J1TC 4YK4B 3T1FB 1R5WA 1RFDH 4Z7OB 5IG7B 4L0PB 4AV4A 5BO1H 3MBEA 3VRJB 5KSAC 3QUKB 1B2WH 1XGRA 1KCKA 4WO0A 5INCB 4L05A 4FQIH 2X89D 1CPUA 3GJFB 4TS6A 2B2XH 3OKMA 4ZDHB 3WNPA 4FABL 4JGNA 3J7HA 4JFWA 2BY0A 3L5XH 2VLKB 1PKQA 2GB2A 2H26A 4OV6F 1U8PB 5E08L 1R47A 1TMCB 4KROB 4N3UA 2TRYA 2WWMC 3ARGA 2XYBA 5LG6A 3U9PH 1NAKL 4XPTH 1C1EH 3FFCA 4MNGA 5DEFA 3PF2A 4O9HH 2YZ8A 4PJ5D 3V0DA 3QRGH 4NPYB 5ESAA 4L23A 1XDTT 2FIRT 4CSTA 2JNZA 2GJRA 1E6JH 1L0PA 1MFAL 4I1NB 3FQYA 4YE0A 2NX5B 1HINL 2O30A 3U2SB 1DBKL 1TNNA 3UGEA 5TE7L 3ZIMA 2GBAA 1IEBA 4XN7A 5AAWC 5I73C 1URZA 5LBSH 4FN0A 3IBOA 3MODL 5EEUA 4ZPVB 2VTFA 2P5WA 4NQDE 5A2CA 4AENB 1ZHKB 4ZUWB 5DD1H 5GRUL 1CD8A 1A2YB 2A83B 5KVGL 1T0NA 2V0AA 4G8IB 4H5SB 4X98A 4P8QA 3HNVL 5I8OH 1WE5A 2VJXA 2HLEB 3RJQB 3VXNA 3Q8FA 4QO1A 3WE1A 3DSNB 3RL1A 4KC3B 3ILDA 1KTRL 2SODB 1YUKB 1RZKC 3EBIA 5HBBA 4DEPB 1DO5A 4PJBF 1JPEA 1KBBA 3MRFB 4IIZA 1UA6L 2ADJB 4R3SA 4E9TA 5IF0A 1QLFA 1O6VA 3I3DA 1IAIH 5HHOB 1LMKA 4YDVA 4ZOBA 2ZOLA 1NQBA 4MJ5A 1G0DA 4HETA 3TZVC 3AAZA 3VX0A 4B53A 2A6JB 2B1HH 1A14H 2CDFB 4Y4KC 1YPZB 2DBLH 4WHCA 4BH7A 1IUZA 3RZWA 4NQSB 4F7MA 3ARDD 3PIQA 1DQJA 1IC7H 2D7TL 1KXVA 1PG7H 2J88L 1X6NA 4I0KA 4IRJA 4NZDA 3GINA 1KCSL 4TUJA 4IJ3B 1NFDF 2CKNA 4G83A 1U42A 7CGTA 1AI1L 2VXVH 3DRTB 5IJKC 3BPNB 1OOAA 4H8UA 1J18A 3ETSA 3GS0A 4QYOA 3FZUC 3SPCA 3V6FB 4IKIA 1E3FA 5IROD 1CQYA 3QUZB 3STLB 2VLJB 1VCBC 1DP0A 3BZFB 4KO9A 4MRCA 4MZIA 4N2AA 1V7MH 1TZGL 4NHUA 4DZ8A 1TETH 3VW3H 1HHKB 1GY1A 2WJ7A 2WTPA 3QXVA 4TULL 4LSVH 1Z3RA 2NW3B 5AD0A 2MQ0A 3MNWA 3C9NB 4A7GF 2BNRD 3T0BA 4ZMZA 3BZ4A 3LKRA 2VN4A 4WO4B 3OJDA 3QNFA 5CIPH 2WJ5A 4WAFA 1B0IA 3KPQA 2ODIA 3UTTD 3FFDA 1PD0A 1G7LB 3RY5A 4P2YA 3DBXA 4IDLA 4P9ML 3VD3A 5D1ZD 1W72L 4WU5A 3BFOA 2CR6A 1RZKH 3G6DH 3WHE1 1UJ3C 5CZVL 4JFQB 5F0MB 1TT6A 3CBRA 2YIHA 5EWIL 3CVHH 3TASA 2IOOA 3VWKD 1CGSL 1BSIA 3Q6FA 4L0YA 2HXAA 1H5BC 3L6FB 4HJIA 4DZBA 1YVLA 1F86A 3OMIB 2HG0A 2KKQA 3L3IA 5IQ9A 4OZIF 1MFCH 3UYRL 3C6LB 4ISVB 3SDDB 2WBKA 3GHPA 5I26A 4NXSA 1F4YL 4ZI8A 1AHMA 3U30C 5EU7C 1K2DA 3E38A 4X99B 2QLVB 3E3QE 4Z7QE 2OZNA 2CGZA 5IB3B 5EZJA 4XTRC 1N6QH 1YEJH 4QWWC 1R5VB 4M5ZH 2X2IA 3Q05A 2PPDA 3V0JA 1MHCB 3F6IA 4HUNB 2FECI 1BD2B 3C6SA 4JFXA 3VWJA 1JG9A 4DW2L 2XYCA 2YO3A 4A55A 1VKXA 2NTFA 2YD8A 2BW4A 1ED3A 1TJHH 5JIHA 3VG0L 5B7EA 3F7LA 1JK8A 1BIIB 4N6QA 4F7CB 1A66A 3WFEL 2MQCA 3LQAH 1DJSA 1CMOA 1RCYA 4NDMB 5J57B 2VN7A 3GSQA 4Z3GA 5J06A 4XNYL 4LCUA 2ICEB 5DJDA 5HHVH 5C09A 5IV2B 4PS4L 4GQZA 5A2FA 2AV1A 5G4OA 4BBWA 3WBDA 1OTTC 3WFCL 3WKNA 1MZYA 5BUPA 4BZYA 5I2IA 4N86A 3MYJA 2ISDA 3ILPA 4ZMVA 2BVOB 3C5SB 4FADA 1ECZA 4JM2D 5SWSA 3TH4T 1K8IB 3L4UA 3ARYA 1UXSB 3CSTA 2DLIA 4PJDB 1QQDA 5D4HA 5DRZB 5A2BA 4ELMB 4C58B 2MQ3A 3ZMEA 4XNAA 2F7OA 1KENH 5FKPB 1TKWB 4JRXA 2CRIA 3TF4A 1UUNA 3FTUA 1JXJA 2Z93A 4F8QA 1WZMA 4A1RA 3RX5A 4KHTH 4CADB 3SJVE 3EGSB 3MRBA 1SNRA 4L3EA 4HS6B 1BGXH 1SGKA 3OLEA 4MCNA 3CZGA 1ZEAH 1PS3A 3GSNH 1KGWA 2CIKB 4IU3A 5ECGA 4PLKD 3EJZC 4DFIA 5IJVB 1IGML 4MZRA 3OAZK 4MASA 2GTWA 3O8XA 4JDZB 4Y16C 4N3TA 1EO5A 4JM0A 3HG1B 3U0TA 1I3VA 4PTUB 3N85H 1OAYL 3BPLB 4Y0GA 4Z3TA 5KJRL 3DO7A 4KQ4H 4N0CD 5DRXA 5IB4A 5BVPH 4BK4A 3L9RA 4OZHF 3C08L 4I7ZC 5F0LB 1WWBX 1U3HC 1TTFA 3D50A 12E8L 4QYAA 3KBPA 5F96L 1YECL 1T6VN 4P2AA 3ECBB 4YXLH 2XACC 4KKRA 3KPLB 4NN7B 5E2VH 5EOTA 4JO3H 2X0WA 4IK7A 1FYHB 4MMYA 1QW9A 3BP6A 4MAYC 3W5NA 4ZUSA 1IBZA 2WLYA 4XPHL 5IJBC 2H9GA 3TNNB 1S5IH 2WLMA 4WI4A 5KW9L 3UC0L 2VSKB 2F1BA 2R83A 4RMTA 2XV3A 3D6GA 4JZNA 2MCPL 4DCQB 5H94A 4O2EB 4X4MA 5A6LA 3MLSH 3ARTA 2E76C 4IBYA 1WZ1H 2I9TB 4GIAA 1YYMH 1A4BA 4GAYA 1KJVB 5F2FA 5GISL 1HSAB 1VFMA 4PJFE 3NIGB 5IKCA 5H4ZA 3KVQA 5E7BA 1HCVA 1EGJA 1UACH 4Y5YA 3ULSB 1R0AH 2C1OB 2YKLL 1UG9A 1SEBB 2VDPH 4FFYA 5B4MD 3QEGH 4YFDB 5AUMA 1OGSA 1KY7A 4BHUA 2VDNH 2EYTB 1X4YA 1VSCA 1U8NA 4XX1G 1RJZB 3ZQ9A 3T3PB 4AC4A 2BRQA 1BOGA 2FX9H 5J13B 3KJ4C 4N8VG 1X5AA 2ZOKB 2X0VA 3X13A 2DWXA 2OJZH 1KB9J 2D31B 35C8H 3KYOA 2VQ1A 3MJ9L 1BWMA 2E75C 3RDTD 2EH7L 4NP9A 2ZXQA 3ERXA 4WUUA 3RWCB 2AC0A 1KBGH 1ACYH 4FFTA 2DQEH 5CSZA 4M6NL 1YNLL 3OAUL 4KDTA 5F6HJ 3VH8G 4N20A 1DN2A 2W80C 4XN2A 5F7BA 1XBDA 3UBFA 2LLGA 4YLQT 3SGKC 4K2UL 4M3KB 1FL5A 1OQXA 2JCCE 5FK9A 4PY7A 4JDTL 3WV0A 4FZ8H 4NQTA 2H6UA 1PQZA 3D18B 4OCWL 5EPMA 4TQ8A 2FIKA 4HOWA 2QQKL 1DLHB 1I9RL 4V1DD 4X6CA 1QRNB 5FM5O 1MJ7H 1XAUA 4X8CA 2WVTA 4ICXA 3R06A 1H3UA 1P84K 4MXQC 2DD8L 2CPCA 4AZ8B 2IDFA 3MR9A 3MCYA 3PPSA 4WU7B 3L45A 2ZKXA 3MNMA 3WUWG 4KK8D 5I76A 2FX7H 1AMYA 2PWGA 4HBCH 4WWID 4Z7WA 1WO2A 2JK5B 3UPAA 3DK2A 1Y1DA 4OLZL 3BESR 1ZK9A 3ARQA 1RJYA 2ESVA 4N9GB 3D9AH 4PY8J 1AE6L 3SCMC 2VMEA 1GZPA 4S2SA 3TO4B 4WDIA 1QLRB 1VDGA 4JKPL 4X4YB 4WF7A 4S1DD 1Z1WA 4N8UA 1E65A 4CUCA 3T77A 2R1YB 5TPWH 1U21A 1QI5A 3FTZA 4LSPH 2I85A 1AQDA 3CFQA 4Y7OC 3VXTA 1LDSA 4TNWK 1TQWA 5DK0A 1OY3B 2WGXA 5BZZA 3CH8A 4CGTA 1J1OL 3HNSH 1CN4A 4LPVA 3TEZA 1BFVH 3RQ3A 4H26B 3EO9L 4OLUH 2VZOA 4JHWL 4ALAH 5C0CE 1G84A 3U36B 3T2NH 5E00B 1ASPA 3OD3A 1INEH 1IJ9A 3D69B 1JBJA 1KT2B 2PPCA 1AXTH 4RESB 2G60L 1NIDA 2A38A 2JWYA 4XMVA 3C5ZC 4H88H 3JWNG 1E3ZA 3GB7B 4FNRA 1IVLA 2P8MB 4OQTA 3WLWC 4RETB 4B9GA 2Z7ZA 4XNQA 4Y4FD 4F5CE 1JZJA 2UVFA 1KB3A 4UM9D 4Y9GA 1U4EA 3P3RA 4NZRL 5IFHH 5C7XL 2IBBA 3HI5H 3PV6A 2J4WH 2ZOUA 4M48H 2V5MA 4XAKD 5IB2B 4YHOL 1FG2B 5GRVL 1KOAA 3W9DB 4JFDB 1IQWL 5D7JD 2D8KA 5B3NA 2DQMA 2XN9D 1UD4A 1GIGL 3CXHJ 3AB0C 3KG5A 4PRHB 3K5RA 2G2RB 1JGEA 4JY6A 4EXKA 1X7QB 1JUFB 1HEZA 2ADIA 3QUHA 2PO6C 3L17A 2D0FA 4ZMAT 3C5XA 2EO1A 4O58H 5DDHB 3NPZB 3QJUB 2HVJB 1J1XL 1JNNL 2GIMA 3IRZA 3WY4A 3APMA 4EDWL 1G5AA 1XH1A 1SJVA 2QKIB 2YMTA 4PJBE 2B08A 4KTGA 4AG4H 5AKSA 4PGZA 3RVVD 2Z31B 3C8DA 4BFNA 1KTLA 2PYED 3PQYD 4JG0H 3EYUH 1BV8A 5C07D 1KB5A 3IRCA 1KCSH 2H2SC 1IZJA 4JFZL 3TA3A 4QMEA 1ESOA 5FGBA 2WWKO 3NFPB 4MA1C 4EUPG 2AK4B 4KNSA 5J5EA 4ZFGL 2GJZA 3KR3H 2BNQA 5E6UB 2P5ED 3IFLH 3S34L 3VD2A 1EANA 3QDGD 4ORGB 4ODWB 3HE6A 4EI5A 2W95A 1TMQA 1NFDE 1NOLA 2OTUA 1AZCA 1TJIH 4I0PB 2ATPB 2DQJL 3H42L 3K4DA 4UAOC 2OSLA 1KCRL 3QDHA 4WJG3 3V5KB 3HKFA 1WAPA 3VFWB 5IHLB 4KK6D 4KV5F 4OM1H 3PWVA 4PGCB 5CP3H 1NGXB 2NLJB 5ALCH 2CO6A 5IK3A 1OWWA 2HVBA 3KGSA 3BKJL 1I7TA 3DHUA 4JRLA 5C0JA 4R7VA 3VGGA 1Q1JL 4KMTL 3UIYA 1KJMB 5DEGB 2CK2A 2BIOA 4Z77A 3O6LH 1U3ZA 4S1QH 2AXGB 3PRZA 5LKNA 4WRLA 4CC1A 4IEFB 1UM4H 4YHLL 1TUPA 3BUIA 4L9LC 5TGBA 3BPOB 1F00I 3Q2VA 4HGMA 4OB5L 2EXYD 2DEYX 2FYVA 2ERJB 3QJXA 5IW3A 5DZPA 3V0VB 2CHZA 3VSVA 3PHOB 4D2NA 4A2MA 2FEEL 5BRZA 1FFQA 1EDQA 3QE5A 4V33A 2AI0L 1M6UA 1SUJA 2OW7A 5J6SA 2FX8L 3KL5A 4RDQG 1INDH 1Z9OA 1Q72L 4EO5A 3G6JB 4LQ1A 3MPCA 2CD0A 2OMNA 1YYLL 5DURD 4W9KC 3TJEL 4OZIE 1M42A 4APQA 3C12A 4E5XG 4I3GA 4BZ2L 4MNQA 5A7EA 3NEOA 5D7KE 1XF4B 1DBJL 3OMZA 1P5VB 1SXZA 2C9PA 1FHGA 3K2IA 4PJ8D 4XOBA 3IDIA 1JZDC 3N41F 1PAMA 4PJ5B 4JK0D 4GSDH 1KACB 2LTQC 1DQMH 4KI5D 2AJVH 4JO8A 3UJJH 4Y2DC 4MQ7B 3SYPA 1KJ3H 4ZG1A 1FAIH 3CXDH 1LILA 3H9HB 3ZRSA 2K0RA 5I75C 3DO3A 1I1AC 1QR4A 1ZA6B 4AITA 1REIA 4E9LA 2FQFA 1K4CB 5F7KC 4R97C 3VNZA 2VC2B 2DI7A 3AS1A 4OAWB 4PWGA 3RAJH 2IH8A 3CXFA 2HRGA 3BHBB 5AW2B 4KNQA 2AJ3A 4TLUA 1UOWA 2GQHA 2VDLL 4P23D 3E6FA 3AS2A 5GZOD 1C08A 1PDKB 5SV4A 3BT2H 1AQKH 1DVFD 1HILB 4GBXD 3ZQWA 1RZJL 3KWWB 1DVSA 1O6SB 4MRBA 5MERA 1FN4B 2R4SH 4KQ0A 1J8HE 3NJHA 4HKJB 5L4FA 3FB6A 3JWDC 1O6TA 4G6ML 5T33H 4C8XA 1M3JA 1G1YA 1VACB 1H0DA 7FABH 4F2ME 3O41A 3QJVB 2ZSWB 3DROB 3CVBA 1TCRB 1GZHA 4K7PH 5HYFA 2ZCKL 4DK5A 3SYOA 4X2UA 1ZT4B 4M1CD 3B4NA 3L7FB 2FZ3A 2L7UA 4JQIL 1BQ5A 3EO0B 5SWQB 2HB0A 5J11B 1CFQA 3IMSA 4HJEA 5FWQA 1CDJA 5L9DL 2YSSB 2IBZX 4LPYA 3ARDB 4GG6B 1IL1A 1SLWA 4QKXB 1GA2A 4KJQD 5EIQA 3HPJA 4XVUD 4AQZA 2Q87A 3HLAA 2B0SL 4HX1B 4L5FE 2IPTL 4OJDH 1A1OA 3MROB 4AYGA 1WZAA 5GSVA 4PVNA 1ZS8A 5FO9B 1FDLL 4KVCH 3CHPA 2FUTA 3OKLB 4DP8X 5I66B 3PAVA 3CAFA 4NFCA 4BD4A 4OZHE 1AYRA 3JSSA 1U33A 5HGGS 1DO6A 2WXJA 5E70A 4ZMNA 2DB8A 4UT6L 4QY8A 3KPRD 5EBGA 4JQXA 4FFVD 4XXDA 2MCPH 3PP4L 4UBDC 4OZFH 1TYJA 2BNRB 3N1MC 5F7MC 5AOMA 4OVVA 4HT1L 5CUSL 3WKPA 1AGDA 4M7LH 2GY5A 3OZ9H 3BD5A 4G6JL 3DPBB 3UTTB 5EG6C 1JXDA 3EYOB 2BFVL 5LLIC 3JWOH 2ZP8A 2R8SL 3ARFC 5D1ZB 2VISA 4MCYB 5DF0A 1DBBH 3BP5B 4KTDH 3GSUB 5F7EL 3U4AA 4FQJL 4NQXA 4KQ3H 1U8IA 2N0KA 3QZNA 1FH5H 5K93A 4F7TA 4OD2A 4OFVA 2CRYA 3P4MB 1RSYA 2YPVH 1OGTA 7PAZA 3EAKA 4FQLL 5F7LB 4QAMB 5AB9A 1HN1A 3BFWA 5CWSA 4DN3H 1FPTH 1R6VA 5IHHA 2Q20A 1ZTXH 1JAEA 3MLYH 1A0QH 1PD6A 4XMTA 4ZMLA 4HUVB 3W3BA 2YPLA 4Z7UA 2VQ4A 2XUWA 3MRCB 2CKBH 2ZAGA 3EBAA 3CC1A 3T0DA 3LEVH 1KWKA 4J3SA 4P9HL 2RQ8A 4PLJD 4O02L 4XMZA 5D1QE 1XL6A 1AC0A 2J44A 3H0TB 3O11B 4I85A 3LQZA 2EH8L 3CDCA 1KZQA 1NPNA 2FHFA 3FS9A 4NAQA 1NC4A