3HMXH

Crystal structure of ustekinumab fab/il-12 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
217
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAYLQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/immune system
molecule keywords Interleukin-12 subunit beta
publication title Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 217
sequence length 220
ec nomenclature
pdb deposition date 2009-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxH01
4WI5A 4JY6B 4R90L 4Z0XA 2VH5H 3P30H 1U91A 4Y5YC 5K9KB 3FJTA 2X05A 3RJDA 5I8EB 2Q8BH 2VDKL 1KJVB 3I6GB 4FN0A 3K4ZA 2HG5B 5EU7C 1IGFH 5F70A 3S8WA 4P59H 4L1DA 3ULVL 2CK0H 4R8WL 5C07B 5D9SA 4IRZH 5EORH 3W5NA 4QTIH 5JQ6L 1OVZA 1C08A 1QKZL 2HJFB 5BZWB 5IVXE 4Y19A 3GHEH 4JRXA 2X1OA 2MJWA 1SVZA 3MNVA 5HY9B 4IIQA 4JKWA 4KKCD 4Y4HB 2DI8A 1JUFA 2GYSA 4LCWA 5FYKD 1I3RA 2EDFA 3DSFH 5CJXC 5K9OA 1OAZL 1K3IA 3TBSB 1U3JA 4LSTH 2MQ0A 4G8FB 3WFEH 5FO9A 1RJZB 2X1QA 4Z7UA 3UTPE 3IRPX 3T1FA 4U6YA 3SE9L 4M61A 4L8BB 1L9NA 2QHLA 2V9QA 5ALCL 4WV1C 4PJ9B 3CFJB 4AM0A 4WDIA 4XWGH 5LCVL 2P7TA 3MR9A 5DLML 5T33L 3QRFM 1D9KD 5D2LF 2JIXA 1NCCL 4L4TB 1QA9B 4BQCA 2GSGB 2LABA 4LPYA 4QWWC 2AAVA 1DSFH 1A1MB 3MV7E 1JZ7A 5C0BE 3SO3B 3HE7C 3GSNL 4M4RA 5HHME 1CK0L 2D3VA 4WI3A 3O3EB 1JGDA 3TO2A 3D25A 4ONGH 3DURA 1JGVL 4FQQA 5CD3A 1N3NA 2EEBA 3T08A 1B0GB 4QKXB 4RSVA 4RFOL 1T89A 5JHDE 2XQBH 2NW2A 1NC2A 1UWGL 2VSCA 1N0XH 5E2TL 1OP3H 4TUOA 2P8PA 3U36A 5DD1L 5EA0L 5I1EH 5LGJB 3VGEA 4QRUA 4K8RL 1MWAA 3V0AC 4XC1H 2Q3AA 3OKEA 1OGAB 3M17B 1T03L 1MCIA 3MUJA 2Z93A 4FXGA 4QTHA 3ZTNL 2ZUQC 4GAGL 2QSCH 3LB6C 5GGRB 2W60A 4CMMA 1T3FA 5H35B 1S7SA 1T1ZA 5HHPB 1TPXB 1HNFA 3HZVA 6FABL 5IV2B 3FO0L 4NJ9H 4K3GA 5ICXB 1WC7A 3KPLB 2HLAB 4PGZA 3TVMB 4PBWD 4HHAB 4LARL 1JPFA 5TE7L 4MDJA 3OXRB 5I2IA 1ORSA 2C1PB 1P7QD 3RX5A 2BVOB 3L5IA 3U0WL 1I1AC 1JMZA 3QDJA 3L3OB 1BZ7B 4HLJA 1CXLA 1EV2E 4JGUA 1RAMA 3DVGB 3VFMA 1LK3L 5I8CA 4ONFL 3MRJA 3JTSA 4N0UA 3S9DB 1PEWA 1FLTX 1JBJA 1EUUA 5JUEH 5F3HB 4V1DA 4LCYA 3TT3L 1NFDF 3X3FH 5T3XE 2XKNA 3W0WB 1K4CB 4W6YB 4JRYE 2C7UB 3U2SA 1KLUA 4PJAB 1SY6A 1QLFA 4Y0GA 4WJ5A 4YDKL 1FYTE 3UP1A 1YYLL 4CVUA 4A2MA 3U30B 1W72A 3T77A 1YQVL 3JSSA 4POUB 5ETUA 3UDWA 4RGNC 2E9JA 4YHIA 5I16B 1YMMB 4TTDC 2X9XA 4U1NB 1H8SA 4ZUSA 3A0OA 5L88L 2ZG3A 1HILB 4GBXC 5IBTL 5CMAA 3V5KA 3RUGF 3SDCA 4MXQC 3R8BB 1G7JB 4J3OC 3SE8H 3VGAC 4JQIL 3ESVF 1HKFA 3TV3H 3MCG1 1TETL 3WSQL 1VGEH 1EO8H 4OD1H 4XP6L 3VD5A 4KI1A 3BZ4B 4U3CA 2P4AB 4I13B 3WJJC 3OV6A 3BRDA 2ZUXA 2Z0BA 3DXAA 1ZHKA 2YN3A 5E8EA 5KSUA 5TQ2H 3VWKD 2V17L 5IB4A 2BNQB 1H0DA 4R26L 3PHQB 3VJ6A 1I85C 3QDMA 2RB8A 4NGHH 3BP7B 4X80H 1EO5A 4ZTOH 5DC0A 4XPTL 1GGUA 3FO2A 3P4MA 1N64H 4FQXC 4XC3H 3RVXC 1ZV5A 5GSRA 1AXSA 3CVIL 2BSRA 3HI1B 5GHWH 3IKCB 4IDJL 1GHFH 3CCHA 3KXFB 3NGBB 4G6AD 1NDGB 3GKWL 3MODH 15C8H 3QZWG 1E27B 2DKSA 4H1LB 5DUBA 1FIGH 5I1JL 3BPOC 1FE8L 4YBHA 1ADQA 1FFNA 4KRPB 5ALBL 1VEPA 4JQVA 5DHYB 5EUKB 1DVFB 5KS9F 2K9UA 1W0WA 2DI9A 3AB0C 3BT2L 1GVIA 5HYQA 3TBWA 1AGDA 2EDLA 5HYJA 3O6MH 4PJEB 4N0FA 3QUKB 1ZGLB 1IL1A 4LSQH 4U0RB 5T3ZD 4X6CA 3BPCA 1GJIA 2GFBA 1XIWB 2ZUTA 5JW3H 3BPNC 5L8JB 4X98B 4PJCF 3ZT5A 4F33A 3BQUD 5FYJD 1ERNA 5IMMA 4PLNC 5T5FH 1S7VB 5DK2A 4GG6A 3OHXB 3D2UB 4KJYA 3TIEB 3PL6C 4LEOA 1LNUA 3OAZK 4E0RA 3QA3B 3CK0L 5DK0B 2XKUA 1AR1C 3DOSA 3AS3A 4Y88A 1J86A 4YZFF 1Z0NA 1J0JA 4NBXB 1I9JH 2DWEA 1T0NB 4JZNB 4MB4A 3W2DH 4AL8L 4P4RA 1QO3A 5IMKB 2IBGA 1GZQA 4NKMA 3H9HA 1A02N 3OMZA 4TUKH 1PZ5A 3TPUB 4P2QD 2NY1B 3MFFA 1KIRA 5GRYA 5DT1L 4L9DA 3OKOA 4ZOEA 4JO4L 3X12A 4YK4B 4YDIL 4Z0BL 1AGFA 3K0WA 4Q2ZB 4EUPA 4LLQA 3MRBB 1KJ2A 4LOUD 5B38A 3NIGE 5BVPH 1YY9C 5CJ5A 3ULUE 4PLKC 2NW3B 4MCZB 4MGXA 3V4PL 5IJVA 3QI9D 4M7KL 1NMAH 2OTPA 3MRIA 5DJCB 4KMTL 5MERB 3ARQA 1QEWB 5F9WB 1FZOB 4GKNA 4HS8H 4M93C 4X5XA 1IC1A 3MLPA 3U0TA 4ODUA 2D0HA 2Y25A 1ES0B 1MUJA 1D9KA 2BSTA 5DQJB 4AEEA 3QHZH 5E7FA 1BGXL 5DA4A 4QF1A 1AGBB 4HC1H 4R2GB 5JW5A 3O3BB 1KIPA 1GC1H 3M1BA 4I3SH 3DARA 3Q3GB 4XHJC 1A9EA 1NCNA 4HWNA 1CD0A 1KT2B 5L7XH 5D1ZB 4LCUB 2PR4L 3TO4B 1A7BA 4YLQT 2YUXA 2A6IB 2VWEC 2I9LA 1QSFD 4X6BA 3C6SA 3Q5OA 5CBEA 1W0VB 3T0AA 3WE6A 3OZ9L 2P24A 4MQTB 3WLWC 4OCXL 1EDQA 4X4ZA 3BDBA 1WBXA 35C8H 3AUVA 1SQ2N 3UBXB 2F53B 1TNMA 1MCSA 2MOVA 1ZHNB 5K93A 3P4OB 1EEZB 4NQUA 3Q2CA 3IDXL 1G7PB 4N1EA 4LU5H 1B88A 4FQJH 5L0QB 1ED3B 1F8TH 2MMXA 2VDOH 4HUUB 1AFVL 1RIVH 3O6LL 4Y4FC 3BH8B 2LTQB 1FVCB 1HI6B 4NN6C 4J3TA 5IVXB 1KLGB 4FG6D 2DYPD 4L4VB 3KGRA 1YDPB 5GRXG 1PFCA 2E27H 5IBLC 3QUYD 4Z7VF 3WV0A 3CIQA 1J11A 1HNGA 3AMKA 3JV4A 1P7QA 1MHCA 1GPOH 1OTUC 4ODWB 4F7CB 3QQ9D 5E08L 4Y2DB 1U8KA 1WBYA 3OJ2C 4HUNB 4PRIE 3HR6A 1AGEB 3WS6A 1M7DA 4M1GL 5IESH 1IGCH 5CD5D 4NT6B 3VD7A 4Z7WE 4GRLD 3HPLA 5CUSL 5CINL 2DQCL 1LO0L 3WUWB 4F3FB 3G5VA 1G6RL 2BVUA 3BESR 5DRZB 2D31A 3K8MA 1D5MA 3WNMA 5HVFB 4JR9L 1X5XA 1NLDH 4LHUD 4ODHL 4OCSL 3TFKC 1T80A 1RUMH 1A3LL 4UTBL 4NUJA 1RZKL 3IJSA 5F6IB 5HDQL 1MRCL 3MV7B 5C0BB 5BXFA 3D3VE 1YEIL 1XH3B 3BRGC 1CXIA 2IBZX 3B9AA 4HEME 1CLOH 1MHPH 5IHUL 4N0RA 3V8OA 3VFRA 3QHFH 3HC3H 1NANH 1DQQB 4ZAKB 5F9OH 4M7ZC 2FZ3A 3MLZH 1DZBA 3HMXL 3MLSH 1CF8L 3KPMA 2HFGH 2A0LC 5SWZE 1QYGH 5DJ2B 1DDHA 5DRWB 1A6AB 3BAEH 1P9MA 4LSSH 1CE1H 4WWID 4S1DC 3L7EB 1NBZA 5HDLA 3MPCA 3I50L 1CFVL 2JE8A 1QHOA 4PGCB 1T04B 4JKMA 2EYRA 3V52L 1P7HL 3EO1B 4KKBD 2BJML 4F8TA 4MJ2A 3ZDZF 4DN3L 5J1AB 4JFHE 2Z9TA 2NQCA 3EJZC 5JOPD 5L2JA 5GJTH 5F7DB 3WO3B 7FABH 1E0OB 4MXWH 1EJOL 5ESAA 1D6VH 3MA7A 2ICWJ 2IMMA 3BO8B 1S9XA 1C5CL 3MYJA 2IH1A 4Y1AD 5GGSA 3ZE2F 3ARDB 3VCLB 3OGCA 3VRJA 4UNTA 1JHKH 2VXUH 5D2NA 4JFFD 4ZFGH 3UJIL 3L9RA 4PJ5E 5EN2B 3C5ZC 5HHQA 2AK4E 3B6SA 3RU8H 4F7TB 3GM0A 4MAYB 1JWSA 1CFSB 1CYGA 1IAIL 1TZGL 5C9JA 5HGBA 5JPMB 1NBYA 2G9HA 5BQ7A 1CBVL 1KN4L 2P5EE 4WNQB 2AQ3A 3D18B 5HJ3B 1F90L 4HBCL 3SGEH 4D9LL 1S5IH 4PD4K 3INUH 4NKIL 5HDBE 2A9NL 4YFLF 5BV7C 4ACPA 5I6XB 5F8QC 4DAGH 3WXWL 1RZGB 4WVRA 5IHLB 4I8DA 3K2UH 4JRYB 3AAZB 4JFDA 4NQSB 2IH3B 4WWKC 3R06B 1HSBA 1YEJH 3I6LE 5EFIB 1U3HD 3BQUA 3QUMA 5FYLH 1KTLA 4BH7A 4OF5A 1NGQL 3RVVD 4P23C 4DW2H 3GMPB 4K94L 1KTRL 3MBXL 4DEPC 3VFWA 2E7HA 2NY6C 2W9EH 4APQC 3FB6A 4LBEA 3BH9B 3MNWB 4NO3A 3IETB 3GSUB 4WHTB 3IS0X 3MTRA 2PW2B 3DRQA 1CLZL 1PD6A 2X4PB 2KL6A 5MEPA 1N8ZA 2WINB 2ZJSL 5TDNB 4DUXA 3I2CL 1MIEH 2VDLL 3QT2A 2CIKB 4WFHE 4UUJA 4MD0B 3QYCA 2FH8A 5I71B 3D85D 3HR5B 4P2QA 3UTOA 3GRWL 3VG9B 4R0LC 4JLRB 3JWDH 3T09A 1BF8A 1A14L 4ETQA 3BWUC 4OGXL 5KANG 2NR6C 1BJ1H 3S5LA 4WEMB 2CRYA 3BUTA 2I26N 2R1YB 1KGCE 3GI9L 4KI5F 4LAJH 1R3KB 4EBQL 1UM4L 4YHML 4CN4A 3QI9A 5CIPA 4Z8FL 1FBIH 3NFSH 2V7NB 4XP1H 4L3CA 1FNHA 5EG6C 4C83B 2DM4A 2A74B 4PJGA 4KDWA 4PJFF 1FZKA 1S5HB 3O3AA 3UZQA 5I74C 5DMKB 3TYFB 1RPQA 1HYSC 4PJ8D 1T22A 3WKNA 4OM0L 4G80A 1A6WL 1A9BB 2Z8SA 2NY5L 3CX5J 4MD4B 2ADGB 1OGAD 2X2YA 1BIHA 2WAHA 3HMWL 2H6PA 4WENB 2YC1B 1CGSL 1DE4A 2AJZB 4U1GB 4HIHA 3PWVB 2BNRD 3O45A 3ZHDA 3W81A 1IEBB 4EEEA 4PY8J 4UU9B 1T0PB 5E1HB 5GZND 4BSWB 2XRAH 3LEYL 1CGWA 1QSFA 3P0VL 3ZKXC 3UJTL 1JRHL 5MEND 4KJWD 3LOWA 1FN4B 1HCFX 1QFUH 3FAWA 4RAUB 4WEBH 1XEDA 4YWGL 1BOGB 3MCLL 3IU4L 5TE6H 4PS4L 4L8DB 4O2EB 5AWNL 1BVLB 1S7QA 3SQOL 4XNUL 3FFDB 4LKXA 3C5JA 3V5HA 5KVGH 3B9EA 3PJSA 4KRNA 3R1GL 2O5ZL 1YY8A 3IDIB 1QUNA 1P1ZA 1CDIA 3EYVB 3GSVA 5FGBC 3MOQA 1R3JA 2PXYC 3I75B 1KB5A 1F4HA 4LLYB 5E99H 1JYVA 2DYPA 3GI8L 4KPHH 4PJHF 2ZOLA 3LQAH 3LZFL 3QUYA 4P2OC 3NCMA 2G5BB 3TBYA 5GRWA 5CEXB 3GNML 2V9RA 4X83A 3AREC 1A7PH 3CFIC 2MQCA 3G5ZB 2Z92B 1NUDA 4IRJD 5KSAD 1UXSA 4XZUA 3T0EC 4GRLA 1FCGA 1A7OL 1CDJA 1V3MA 5I1LB 3E6HB 2MNUA 4PYHA 5FO8A 1YMMD 4UBDC 3PWJB 4M7LL 2IPKA 5DURD 3CFEB 4WW1B 5DYOB 1IC4H 5HHOE 1MJJB 1BQHG 1A7NH 1AJ7L 3ZT6A 2P5WD 4LHUA 1J88A 4RQQB 2EKSB 3QXAB 3WD5H 4OD2A 4G9FD 4JHAH 3TBVA 3ZZ1A 3MRRA 4ONHA 3G5YA 1PKQA 2LU3A 2F19H 4MJ6A 4U0QB 3GDBA 1AD0A 2NXZC 2IFGA 2IJ0C 3BP6B 5D7LE 4BQBA 5D6CA 3O2DA 4NC2B 4HS3A 2H32A 1YEGH 3RAJH 1YMHB 1YEDA 5EU7E 4PJIE 4XNMA 2WV3A 3CLFH 4CUCA 3KYNA 5HHNA 4XVSL 2FJGA 1KFAL 2V2TB 2VLMD 3QWRD 5E5UB 3FQTA 1DANT 1U3ZA 1BFTA 1DLFH 5IIEB 2CMRH 3OJDA 4OKVB 1F3JA 1A47A 5TE4H 3QP3A 2YRZA 3FT3A 2HFEB 4WU7B 4XMLH 3SGKA 3WFHB 1UB6B 2YSSB 3DI3B 1DBMH 1QZ1A 1RUPL 3QSKB 3OBAA 4NRYB 1MRFH 2VZVA 3HNSL 4JREB 3C60B 1DBJL 1EJ6A 1NC4D 4N0CC 3TNMA 1RVFL 3HLAB 3QG6A 4TPRH 4MA7L 5HYIA 3C09C 2DLFL 4ZTPH 4HEPG 1LMKA 4NJAH 3PE9A 4LLWA 4XVJH 3ARYA 1IEAA 5I17B 5SWSB 4Y1AA 4OZGE 3RRQA 2E9IA 3MV11 4QXTA 4I1NB 5DC9B 1OAUH 1RMFL 4PBVC 4S2SB 4KHTH 1ZA6B 2IAND 4JFFA 2OTUA 4Z77A 1OLZA 1H5BA 4R7NA 2YD3A 3RVUD 4NNPH 4D0DA 4MNQE 1DFBH 2QQKL 3DX7B 4YX2L 2KH2B 4PRIB 4YAQB 2V2WA 4BZYA 4X4YA 2PO6D 4N68A 4PY7B 2P43B 5D4QA 4OM1L 4XNXL 3RQ3A 3ZT7A 2YD5A 3IDMB 1K6QL 1QLRA 5SX4I 3RTQD 1ZEAH 3IAQA 1QP1A 1KENL 3RDTB 5BRZE 4JY6A 3EFDL 3QDGD 4FMKA 1JN6A 2PNDA 1Q1JH 4TULH 2YD6A 1J8HE 1AHWB 3B3IB 3GK8L 2O61B 1U3HA 3VXPA 3FRPA 4M5ZH 3PWPD 4LASL 1U92B 1QPXA 4ELMF 1D5ZA 2R1WB 3C5SB 3BKCL 1I9EA 3S4SG 2Y1VA 5BZWA 3QQ3B 1MRDL 1QFOA 2HTLD 5GZOD 3K4DA 1OAKH 3P3YA 4GUPA 5DMGC 2NY1D 3BWAB 3P11L 3MBEB 1URLA 4JO2H 1TVDA 3KPQB 4HCRH 3ULVD 1KEML 3FO1A 3FHQA 4POYA 2ORBL 4BFEA 3MMEB 4RNRB 1QSED 4EI6A 2CUIA 2H8PA 1IGJA 5JA8B 1CD8A 4HK3J 5DJAB 1N2RB 2D03H 3D85A 1VDGA 1MPAH 1RUAH 2ADFH 1KIQA 3EOTH 4L8BA 3IFPB 3SDDC 3DRTB 5HI4D 2EDWA 1P4IL 3C8KB 1NAMA 3NFPB 4K3JL 1X5FA 1ZA3B 3MJ9A 3P0YL 3QIWC 5B8CB 5MP6H 2M2DA 2ICWA 3DX6A 1FDLL 4TOYH 2VABB 1RUKL 1A1MA 2GSIA 1UACL 2AK1H 1VESA 1JGLL 4O51B 2OXHA 2FX9H 4U1HA 4XNYL 5F1OB 1A21A 2DQUL 5EOCH 3MRDA 4YPJA 1S8DA 2JJSA 1E4WH 1I7ZA 5FOJA 5D7IF 4PJ8A 4LSPL 2AJYL 1JV5B 5INDB 2OM5A 1RK1A 5J9PB 4NKDB 3UO1L 3VW3L 4NWUL 1OGAA 3MJGX 1QSZA 1NUNB 3WN5A 1X4YA 5DFWH 2VR4A 5L6YH 3NA9L 1MLCB 3I3EA 5H35A 5CCKH 4KK8C 2BNRA 5HHPA 3ULVH 4TTGA 3L3HA 4FQHA 2K7QA 4OGAD 2XT1B 4K8RD 2VLJE 4LLDB 5IP4A 5IV2A 1INEH 1OQXA 2ICWI 3O8XC 2NY3B 2FBJL 5JXED 3HS0A 3EOBA 2HLAA 3EOAB 3BZEB 4XBPA 5B4MC 3PWLB 4NQEE 4F15C 1GIGH 4EQ2A 1SYSA 2VDML 4MWFB 2JK5A 1J0IA 2OJZL 3MO1B 5IKCA 2DDQL 1UJ3B 4YFEA 3L3OA 4OZFG 4NHCH 2CRZA 3T4AA 1IFHL 4OT1L 3DVGA 3D39D 1R5VA 1P53A 2H9GB 5EUOF 5IB5A 3EO0B 1JPST 4R97B 3GJFK 3UTPD 4LAQL 4W6XB 2UVFA 3DVFA 4LKCB 3W0WA 1INDH 2KZ1B 3CLEH 4MS8C 2AEWA 1F4AA 5IB2B 2MPAH 4C55A 1NCCH 3DUUB 4DVRH 4UV4L 5DJZB 4IRJA 3VXMB 5FA3B 2DD8L 1WEJL 2J5LB 1Z9SA 2E8ZA 3SDYH 2BHYA 4FRWA 2D7QA 2EXWC 3A67H 1KIUA 5HHMD 5I16A 4ZYKA 1YMMA 4WU5B 3AVEA 4YJZL 4P4KC 3SE4C 4NM8L 4M48L 4AENA 3T2OA 2VN7A 1J5OL 5JMOC 2J6EA 1JFQH 1V7ML 2P5WA 5JHDD 5ICYA 5JHLH 4KTEL 3EYFA 2VR9A 4NZJA 2DLGA 5EA0H 3VRIB 2DQEL 2NXYC 2PTTB 4G9FA 4M7JH 4JM4H 5IVZB 2IPTL 2JB5L 3LKSB 1A4KB 1EFXB 3QFJB 1T5XA 5J11B 1T03H 1FVDB 2IWGA 2VIRA 1G7LB 2IQAA 2J8HA 2G60H 3UMTA 4KK5C 1CFNA 4GAGH 4XVUC 2FH6A 5HGGS 5I8KH 4W4NA 1RIUL 3PGCB 4UILL 2C5DC 4PJDE 5CP3H 3NCFB 1A7QH 4PJ7E 1OTSD 4HKJA 1NLBL 4M43H 4Y16D 3QWRA 3PHQA 3T8XB 5BS0E 2APBA 3SKMA 3TA3C 4I0PB 2MHAB 4PRBB 1JWMB 2D7TH 3DV6B 3HZYA 4CW1B 5DMIH 2AEQL 4B5EA 3ALWA 5HYSA 3GSRB 4FZEH 5GS3A 5KSBB 4UQ2B 4LARH 2ITCB 4L3AA 5TE7H 5DF0A 3S7GA 1UVQA 1QBML 2N7BA 1N6QH 2YPKA 3HI1A 1WVZA 3GMMA 1YNLL 3NIFE 3QPXL 4PGDA 5ELIA 4KI5C 4BM7A 3BW9B 4NQDB 4H1LA 4HF5L 2BNUB 4DK3A 2FEDD 1FQ9C 3Q6GL 3F65A 3ILQC 4W70A 1LK3H 4OTXH 3S36H 2AJSH 3FRUB 2DBLH 2WWKT 2VISB 4S1RL 1MCBA 2LE9A 3TT3H 1I4FB 3VXRD 2ZSWA 2ICEA 2IANA 5KANI 4AYFA 1K4DB 3F7QA 2HRPH 4XNQB 2BK8A 4GQ9L 4YGVB 4MNHA 3WIHL 4HKXA 1AO7E 4NKOB 1NGZA 2PO6A 3KPPB 2J4WL 4K7FB 1FYTD 3BUYB 1YQVH 2VXTH 3U0PA 1WIUA 1H15B 4PY8I 4UAOC 4NRXA 5I75C 4JZJA 4E41E 3VWJD 4EN3C 5GGUA 3RTQA 4TQEH 3LDBC 3MROB 3C6LC 3IFOB 3LKOB 3QDGA 3MLVL 4IMLA 3F5WB 3P4LA 3ARGD 3IFNL 1GGIL 5JTWA 3ZYZA 4XNZC 1I8KA 2HLFC 2IGFL 1NCAL 5T1MB 2VWEE 2DB8A 5IW3A 25C8L 2ZCLH 4JZNA 3PWPA 5MI0C 3HC4L 2W0LA 3QBTB 4LEXL 4Y5YB 5D7LB 3THML 5MHSE 1ZK9A 2JTDA 5JDJA 3KR3L 1YNKH 4NIKB 3ARFB 3GMRA 3VXSE 4DZ8A 2YD8A 4WFGD 3RY6A 3HE6D 3IVKB 5E5MB 2EO9A 2YWZA 1B6UA 2BRRH 3S34L 2JJUA 4B7IA 1S9WB 5DUML 2Q8AH 1ZLSL 4U3XA 3T4YA 3E6FB 2C1OA 4WUUE 3CSGA 3CUPB 4IDJH 1QSEA 4MCZA 1UC6A 3SE3A 3VMNA 1PG7X 2XZAL 3EJYD 5E8OA 3UTZB 1C5DB 1U95A 1A5FL 3B2UD 1TZHA 3O81A 5MERA 5ALBH 1E4XL 1BOYA 1JNHB 2D7PA 3LPWA 1UCBL 2EYTB 2YHGA 2Q76B 3H9ZA 5JO5A 1CL7I 2QQLL 4OZGB 1CE6B 1C12B 2BVYA 4OLUL 5DQJA 3RWJB 3C08L 4DK6A 4MCYB 2I9TB 5DJDB 4P99A 4OZFH 4BZ1L 1XAUA 4WV1B 4EXPX 4MNQB 4WI8A 5IQ7L 4NM4L 3FT4B 4A6YL 3OAYK 1MIMH 4H25A 5F89B 5E24E 2Q7YA 3HE7B 3WFBH 5DQ9B 3Q1SL 3GSNA 5BRZB 1B0RA 1S7TB 1W0VA 3O3DA 1U8HB 5IOPB 5IQ9B 1MQKL 1BLNB 5JZ7D 2VXQH 3H3PH 4OIIH 4Z7UF 4HLZH 5A3ID 1J8HB 1CU4L 3MLYL 3BN9C 4XPBH 1Z5LB 1GAFH 1EEZA 2G75A 2XZCH 5I1GL 4G3YH 3WHXB 2ICES 1RZ8A 1SEQH 3O4LE 4PRHB 1ED3A 4U1KA 4AMKL 2ZUQB 4M1CC 1TVHA 2M26A 1KYOK 2EEAA 1I7TA 3MRHB 1FVCA 4HG4J 5JXEA 5LVEA 5IVXA 1H3XA 3NCJH 1OAXH 1J9CT 5DT1H 5EOTB 1RHFA 5IB1A 1H3PH 4YDIH 4KZDH 3RVWD 1B90A 3OAUH 3TJHC 5JXAH 1TXKA 2BDNH 3CDYA 2OZ4L 3UTSE 1AD9B 5IEHA 1L7TH 3V4PH 2FD6H 3D39A 2CDGB 3QIUD 4NT6A 4OCMC 4CVXA 5IB3B 1A1OA 1X3DA 4FQPA 3WUWA 5CZXC 1FPTH 2CKBH 4G8EB 3KPOA 1BREA 5CZVL 4RMTA 1I1AB 4C57C 4XVTL 3QO1B 1XR8B 4L3EE 2XN9B 4U1IA 3S4SA 4WFFD 4HD9A 2DTMH 3V7AE 4WUKL 1HK6A 1Y0LA 3BGAA 4RFNC 5BV7H 3KYKL 5FB8B 4HGWB 5C0BA 5D7JC 4BQ8A 2JCCF 1I1FB 2DQGH 4MQXD 1J1OH 4Y5VA 1MY7A 4HK0B 4WHCA 4FQCL 1BX2B 1MFAH 3GSQA 3DYMA 3LCYA 5EWIH 1KNOB 2UWEA 1UZ6F 3M8OL 1EGJL 4JFQB 3AU1A 3PIQA 1DQQA 3GGWA 5JHDA 1AIFA 1RZFL 1UM5L 2XWJA 5C0EA 5C0JA 4RGNB 5BCAA 5DJ2A 4ZMAT 4GXVL 4FP8H 2F15A 3DIFB 3SCMC 5FYKU 4TRPH 1RURL 3OZ9H 2QEJA 5KG9B 2X4TB 5DHVB 4LIQE 5DD0L 5I1DB 3L7EA 3BE1H 3MJ7B 2ZP0T 3TT1L 3LRGA 4GBXB 1I3GL 4CDHA 2YR3A 3ES6A 3U6RA 4PGCA 1JGEB 2DM2A 3R4DA 5CJQL 5IK3A 4KXZH 1KN2L 2VO5A 2B1HH 2XTJC 1LEIB 3IDNB 4I77H 4Y16A 4OLWH 5IW6B 3ARUA 2VLJB 3L1OH 4X4XB 1BQHB 4TVPE 1ORQB 4HJGA 3BO8A 1NCTA 2YPLE 4QHKJ 2AXHA 5E9DB 4NQEB 3RA7L 2I60H 4GRWH 4YDLC 3LN4A 1K5NB 5IGXL 3TP4A 3BOVA 4MMXC 5L2KE 1P4BL 3MXWL 5EN2A 5TPWH 1NFDE 1EH9A 1MCEA 4FQXB 1FLRL 3GIZH 1CFSA 5ISZB 4PRNA 1WIOA 5KZCD 2IG2L 1TENA 4D94A 1LO0H 1G6RH 3GSXA 1IC7L 5E8NB 3TM6A 2V9TA 1KPUA 4LLMB 3CZJA 4PRPD 5HJ3A 3D0LB 1FJ1B 1R5WB 5C0RL 3VXRA 2A1WL 4Q9QH 4HX1A 2NZIA 3ZE1E 1QHPA 4PG9B 4JR9H 5I15H 3W39B 3BPOB 3RDTD 4LSRL 1QLEH 3QXTA 5ACMA 4JRYA 1KXTB 3IRZA 1A3LH 2IH3A 5B3JF 3R06A 2Y5EA 2CJUH 1ZVYA 1SBBA 3GSOB 1BFOB 3AB0B 3LY6A 1FYTA 1G7MB 5HYFA 1NBVH 3MA9L 5BZDA 5IFHH 5F1IB 1IGIL 1OWRM 3D3VD 4LCCC 5CKAA 3AFLA 3VI3F 1AC0A 1UA6H 1LO2H 2FWOA 3VWJA 4LIQL 2AKRB 3AXLB 1WFOA 2MKLC 5ANME 4ALAH 2A6JA 3OKKA 4OZFA 3BPNB 1ACZA 4KK9D 3G6DL 2HT2C 1EK3A 1OAYH 2BC4B 3BH9A 3K8LA 2AI0H 3P4NA 3MNWA 5CGYC 3U4EB 3ARGA 4P5TC 3GSUA 4D0CA 2VRAA 3WLBB 2ZUYA 5SWZD 4NCDA 3RGHA 4CJ0A 4JN2A 2PW2A 3PL6B 1VSCA 2NNAB 2QQNL 2FGWL 1R24A 3TEUA 3WFCL 4DCQA 2X4PA 1MFEL 4KDTC 4LRNL 1AI1H 4JPVL 4TVPL 4U33A 1F3RB 1OGTA 3V52H 2FX8H 1FZMA 3WNLA 5HI5C 3DBXA 3OXSB 5HGHA 5FGCE 4PJ7B 2HRLA 4UT7H 5AZ2L 2J8UB 3HE6A 1S78D 4GOSA 2R15A 3HUJE 4JFHD 1K8DA 4JANA 3DMMD 3K8KA 1BD2D 1RV6X 5CBAB 5HXMA 1FAIL 1C5CH 1A1NB 2EC8A 1PY9A 1ZT7B 5DC4B 4GG6F 5EZJA 1LGVA 1ZVSA 2JKXA 1OT1A 3OKMA 2KDGA 4UT6H 3LS5L 4XP4H 4NO0D 5IMOA 4GRMB 5KS9E 1XF5A 3SPVA 4DZBB 4PJ5D 3CZFB 2AK4D 2APWA 1TZGH 4L9LC 5K59F 3ROLA 2A74A 4YHOH 7CGTA 1T66D 1YYMH 4KQ3H 1NGPL 3T0EE 4HBCH 4D9LH 1XCTB 1E4KA 1A6ZB 4NKIH 2P5ED 3HAEG 4WCYL 3DUHA 4X9BA 4ZS7H 4PJCE 2H1PH 3D0VB 4Y4HC 4KVCL 4M93B 5C0CB 2GT9B 5EIVA 4NQCE 5CILH 4ODBD 4JKKA 2H3NA 3MRCA 5C0AE 4L4JA 3IT8D 4Q9CA 2GTWA 3T3PE 1NDMB 4K07A 1X5AA 4XBEL 4JAMB 2X41A 1F45A 1EMTH 2FHBA 2MFNA 2CLZA 4ZXBC 2DQTL 3PDOB 4NDMA 3A6CL 5IVOA 4OQTH 5E2UL 3MV01 5D1XD 2ILLA 4KGJA 4KDVA 2YZ8A 4NWTL 1BFVH 2IADA 3MNZA 2CDFA 2H2PC 3KYMB 2ADJA 1UT9A 3RWDB 4L8DA 4AIXA 5FHBL 2R2HB 3IDGA 1YECL 3FFDA 3IGAA 5ITFB 4D9RE 4XX1E 4AIZB 1G7QB 4IOSD 3N06B 5H94B 1R3HB 1KF9B 5CLTA 3G6JB 4JPKL 4F58L 1HH9A 1FG2A 3ZL4H 1U8PB 5DVMA 5F96L 4EQ3A 3SEPA 5C0ND 3V8CA 4LLUA 1ZT1B 3REVB 1LO4H 1HHGB 1VFMA 2FYYA 3B9DA 1V3LA 2V5TA 3OG4B 1JPSH 4RMRA 3HPJB 4Y4FB 2GJ6B 3ZMRA 4NN6B 4ZUWB 3JVGC 5FYJU 4FFVC 2Z92A 4BH8B 3QIUA 2OK0H 1A0QL 1RZIB 3WXVH 5I1LA 1OAQH 1A22B 5INCB 4YQXH 2D2OA 1X4ZA 5I19H 5D1QD 4HPYL 1UGNA 2EKSA 3BEVB 3QXAA 4BKLA 1IQDA 4P5KB 4QGTA 5B39G 3MV8E 1BWWA 4XGZB 3T04D 1G6RA 5JIIA 4RAVA 2F74B 1KCUL 3A6OA 1OP5K 4UT9L 4GW4B 4OLXL 5D72H 3O11B 5T1KB 1P6AB 3MZGB 1QVOA 2VLKE 3EYSH 1A6TA 4P3WA 2RJMA 1A6VH 4H0GA 3TCLB 3WKMH 5D5ME 4X9HA 2VZ1A 4XP5H 3P0VH 4PREA 3UJTH 1VA9A 1VENA 3KPSD 4L8CB 1XF3B 4RA0C 3CSPA 4C56E 2V7HB 1MCQA 4LQFH 3VFUA 2BFVL 2ZSVA 1NMBH 4M7ZB 4OFYD 3SJVD 4PS4H 3HZKA 5E00B 3UYOD 3FN0H 1SJEB 1OF2B 3JTTB 1UB6A 4IOIB 4TSAH 5HI3C 3RX7A 2BY2A 3HMXA 1DJSA 3V0VB 2QADD 4AH2A 1KCRH 4HIIA 2FB4L 2AV7A 3HLAA 3O4LB 3HI6L 1LE5B 1TCMA 5IF0B 5JPNA 2FCBA 4XP9L 2E8YA 2Y06H 1L9MA 1JNJA 5GGTL 1RIHH 5J3HC 3TBTA 4S1SH 2BERA 2PTUA 3G08A 3GBNH 2J7LA 4QOKD 4MD5B 4FQ1H 8FABA 3SKJH 3CFDA 3U1SH 3O41A 3QPQD 2RBLA 4JG0L 4GW5A 4YNYA 1NPUA 3KLHC 4YAQA 1BBDH 1OARL 3UTSB 5HD8D 4Z7WA 2HMID 4IIQC 4PRPA 5D2LB 4RZCB 4DGVL 1S7WB 4LVHC 2UY7A 3C5ZB 3K7UA 2CKBB 2LAAA 1ONQA 2DLEA 3RDTA 2RFXB 3GMOB 2XWBB 5HHOD 3VGGA 1BMGA 4UB0H 4Q9BA 1JHTB 1GXEA 3ETBF 1AHWA 2Q1EA 5DR5H 3PHOA 1RK0B 3D3VA 5BV7B 1U8QB 5ADOL 3CU7A 1A7RH 4MB3A 2R1WA 4WWKB 5GS2D 1FNSH 3HAEH 5E7BA 3MV9B 2YRLA 5FM4A 4P9HC 5GRJL 3QQ3A 2QV2A 3B8YA 3FFCE 4HIXH 4XI5C 5SWZA 2ZKHL 2AS5M 3LKRA 5I1HH 2Y07L 4JN1H 4P23B 4HQQL 1CLYH 4DEPB 3ZDZE 3IDUA 2NY6B 3G5XA 2Y4SA 4APQB 5EU5A 1ZHBB 2B4CL 3WL9B 1T89C 4R4BA 1JYNA 3JWOL 3MMEA 2I5YH 5JORA 1A4JB 3RWGA 5F3BA 2XPGA 5ICZB 1QBBA 4HULB 1E28B 3SN6N 2HT4C 1RVFH 3ZE2E 1LO3H 1U8IB 4N9GA 1VKXB 2QKIB 5C8JB 4RMVA 4CL7A 3MRFA 1HDMB 3DGCR 3DMMA 1BD2A 1N7ML 1IAII 4P2CG 3IU3A 4EI5D 4XCFH 5DD3H 2X44D 2X1WL 4HXAH 4UTAL 1OP3K 5DK3A 1WT5A 1DLHB 1MFBL 2G2RB 2R4RL 3LV3B 3UTTE 2Z31D 4YE4L 4NO0A 2EIZA 4R0LB 5J6GB 5K9JH 4N8CH 3GRWA 4FXKB 4G43B 4PJ5A 1MNUH 2AK4A 3SDAD 3NZHL 4I4WB 1JYXA 1PQZA 1X5GA 4JVUA 1MCJA 2LFGA 4J3XA 1J0ZA 4KKAC 4WY7L 3Q6FB 2P5EA 4ZS6D 4H26B 4MJIE 3RWIB 4K3EL 5GS2H 1Y6MR 4WW2A 1ZANL 2LQRA 2Z4QA 4FA8A 5DEGB 2KUTA 2F5BH 1BAFL 4RGOL 5I74B 3GK8H 4RBPK 4OJFH 4YBQC 4U49A 3PGDB 4QHMB 3ALPA 3MGTB 4NO2A 3RUGB 3OX8B 4Y8AA 3HTLX 5C0DB 1N5AB 5D1XA 4H8WC 3FT2A 3FAXA 2WZPD 4O9HL 3U9UA 4CNIA 5JDSA 3GSWA 4P46D 5JOFA 2O26U 4ZFOL 2VC2H 3LKPA 4QHKI 4H20L 2PYFA 4JFYA 4KROD 4M6MH 3PWLA 5DJ6A 2XYCA 3QFDB 3ZDYF 4MWFA 1N4XH 2ATKB 3ZKXB 3NA4A 1IGTB 2AJ3A 1ZVHA 5J6HB 5BVJB 1WWWX 3W11C 3S97C 1TCRA 4G9DB 3SDCC 2W65A 3BZFA 4PPTA 4DGYL 3TO4C 2BOCB 2C4XA 2ZCKH 4X6DF 4LPXA 1F6LL 4OV5A 3MCKB 3LKNB 3CFBA 2AJXH 1K2DA 1XF4A 2PUQT 3RNKB 1PG7W 2C4FU 1NSNL 2F54E 4QYOA 2DKUA 4ODTH 4RMQA 5DJZA 1L7IH 4PJFE 4HBQA 1BJMA 1SVCP 1MJ8L 3QH3B 5IMLB 4KHXH 5KS9B 4P2OB 1I7UA 3HC0B 4XWOD 1HINH 2ARJB 4U6HB 2CSPA 4ENEC 3AREB 1ACYL 4KZEL 3QULB 5TDOA 3UYRL 2PW1A 5D1QA 3QNYA 5TJWK 4KV5E 2P44B 4RX4A 5KVFH 2DBJA 2XKSA 1MAJA 5TFSH 4FABL 5IVZA 1F58H 3LKSA 1UQSB 2JELH 4PJCB 1JRHI 1Q8MA 4WI2A 3D9AH 3KPNB 1P2CB 3P9LB 3WJLA 5D96C 4JQVC 2Y23A 5C0AB 1BZQK 1EFQA 2JJTA 2R0LH 3NA9H 1IAOB 4TNWF 1DP0A 3ME0A 4MXQD 2I07B 3LIZH 2H2SD 1ZS8B 2WLYA 4X7SL 3MRNB 1F3DH 4HIJB 3QNXA 2MHAA 2NXZB 1D7FA 2WLZA 3ECBA 4P5MB 4CW1A 3FB7B 4HMCA 2WUBH 1V3JA 4OFYA 4UQ2A 3SJVA 4MXVF 4N1CA 5GGQH 4DGIL 4EDXB 3LH2L 5J7CC 4WO4D 4HH9B 5D8JL 1T83A 3TLRA 3ULSA 5CAYB 4PGBB 3RWCB 5ADPH 2XA8H 4PBXA 4PJHE 1S3KH 4NBZB 5F88B 4X8JA 3BW9A 1H3GA 1MCOH 2P45B 4J12A 3OB0H 3H2WA 2EE9A 5EO1B 1Q9OA 2EDBA 3FB8A 2R0ZH 3HRPA 1FNEA 4KK6C 3NN8A 5AUMA 1NCBL 2VISA 3FCTA 4MAUH 4QOKA 3GJFH 1KOAA 1H9VA 1U58B 5CWSB 3VMPA 1NFIB 3U9PL 3KYOA 3C09B 1K4DA 3FB5A 3UC0L 2YBRB 3FOLB 1ULVA 2XACC 3VE0A 5EC2B 1C7TA 2HT3D 3H8NA 1YZZA 3L3KB 4LVOC 1I9RL 1RULL 2P8MA 3IJYB 4CU6A 4W4OC 4YHYB 1Z0MA 3HCVB 1QRNE 2BCKB 3TGXA 1XR9B 2YD2A 5HTSA 5IW1A 4KKCC 1DQDH 3D5OF 3WDHA 4NM8H 4Z78B 1F4XL 4X9IA 1PVHA 1Q0XL 1XFPA 4P9MH 4XPFH 1GGYA 1K8IB 2DQJL 1TJIH 1MF2L 5HHOA 1DL7H 2IBBA 4OFKA 4YR6A 1SBSL 3DETC 1RZ7L 4ODSH 4C4KT 2H26A 4JFPA 1XGQA 1X7QA 3ZE0F 1ZGLM 2D9CA 3GO1L 4ISVB 3SGJA 3SOBL 1H8NA 5T1MA 4JO3L 1T0MA 3L5XH 3VRLF 2ZOKA 5D7KE 4XAWL 4WEUD 2ZUVA 1XMWA 3QJHA 3PGFL 4I5BB 1D9KC 3DO7B 1OPGH 1JPGA 2R4SL 4XRCB 4PJIA 2N4IA 1KUMA 5D71L 1AKJD 1CS6A 2X09A 5BS0D 5E5MA 1RHHA 2DRUA 3CC5A 3O9WD 2AEQH 1UZ8B 4X0KA 4DVBA 3OGOE 3BYYA 2EH8L 3E6FA 5DSCB 1KCSL 1NGXA 3OKYA 2EDDA 4K3DL 4D8PB 5B39A 4U2ZA 2PCPB 1RU9H 4N5EC 1MHEA 3DTXA 3LMJH 3KJ6L 1X5HA 3Q6GH 2BRQA 4Z7VB 5BO1L 1IAKA 1I8IB 1I1RA 4EI5A 4I9WD 1FNGB 3ARSA 2Q76A 1SEBA 5BJTB 4OZGA 3SKNA 4AK1A 1PDKA 4OLZH 3K1KC 3RWJA 3SY0B 1VFUA 5TDPB 2WWMD 3SDXE 2Z91B 4QHUA 3BKYL 5KN5A 4CBPA 3PWUA 2VKWA 4GQ9H 5KJRH 3SDDB 3K74B 4OUUB 5E8DL 4XH2A 4LSVL 5K9QG 1YN6A 2J4WH 1Z9OA 3FOMA 4OLYL 3JUZA 3QIWB 1AO7D 4GKOA 1VFOA 4U7KA 4C4KO 5C70A 1U8NA 4RIRB 2A9MH 2C3VA 5KSBF 5HGAB 4E41D 2A73A 3BIAX 3OR6B 1BQUA 3ARRA 3ORJA 4AG4H 4DFHA 1U8JB 4ZO9A 3WS6C 1WUNT 1FFRA 5IQ9A 1Q9KB 4PV9A 1BLNA 1DBAL 3IFNH 5EU3B 2OYPA 1B2WH 4NC0B 4ELME 1NJ9B 3U7YL 1NCAH 1N0LA 4QCIB 1XGRA 4BFIB 2GCYA 1XGUA 4CVZA 4R96A 3U4AA 3BHBB 4JY5L 3HC4H 1EBAA 5EU6D 2QR0B 2R29L 1T21B 5FF6B 2QTEA 1GZPB 1DUYB 4EOWL 3BD4A 4JPIB 4UNVA 1FO0H 3EW3B 3RL1B 2GJZA 4P46A 5C2BL 4UMGA 2HVKA 3V7AG 3VMOA 3VXSD 3BXNB 4G5ZH 3HAEB 3HA0A 3STZB 1WCBB 3BGMB 3GBML 3KPRE 2DQIL 4OLVH 1C5BH 2AXGB 1YEFL 4NQXB 3DHMA 3O8XB 4K2UL 2BVPA 1J05B 3Q48A 1SJHB 1YN7A 3BKJH 4FFYL 2HWZH 4WUUD 4HFUL 3L5JA 2ZUSA 3FMGL 3RPIB 2F5AL 1GOHA 3PQYB 4F15B 4HPOL 3CPLB 3EDEA 3T0BA 5CEZH 5IR1B 3WS3B 4MA8L 1T1YB 4G42A 2DOCA 4G8EA 5JIKA 4U05A 1I1AA 1CZ8L 2XICA 4Q0XL 4JM2D 1GOFA 3QNZA 4FFZH 4YHZL 4JHZA 3MUGA 2Q6WB 3C08H 4Z95H 5HVHC 4I0CC 5ID0A 3VWKC 4XPHL 3U83A 3UTTB 1HZHL 4G7YH 3MJ8B 5DDHA 1DQLH 5BMFH 5D7IE 3IAGC 5C0FB 4AZ8A 3WHE1 4NM4H 2X4OA 1HHKA 4LPTA 1XGTB 2R0WH 4JFEE 3H7BB 3WO4C 5KW9H 4FXLA 1GOGA 4TNWK 4QRRE 1NBQA 2BMKB 5FHAH 2AXFA 1HIML 5D2NC 4M6NL 4MJIB 4UDUB 4Q6YA 4G6AC 1T20B 1S7UB 3S96A 1SYVB 3QEHA 3SKOA 3IKKA 4P4KB 5FDWB 5ACZA 4OFIA 4X99B 1MJUH 1AY1H 5C09B 4Q9RH 1DBBH 2WUCH 4Q58C 5CGTA 3BDYH 2NXYB 5AYUH 4H88H 2FO4A 3GHBH 2AEIT 2MCG1 3S37L 3LQZA 1FG9C 4NP4H 2C3GA 4ZUTA 1KJMB 2OQJB 1P4LA 3PABA 4P2YA 2VLJA 2QBWA 4X4XA 1FGNH 3J8F7 4U6VH 4HUWB 3WJJA 3HNVH 1S9VA 3PP4L 4X6FA 1N6UA 2ZZUT 3HI5H 3BQUC 4WO4A 1NUFA 3C9NA 4M5YL 1IGML 4NQEA 5DFVD 3ARXA 1D5BB 3TA3B 1I85A 1BZ9A 5TH2A 1RY7B 1UEYA 3AC0A 4P0DA 2EZ0D 4M9OA 5C08D 5BOPA 2CIIA 1P69B 1FHGA 2O93L 4O2FA 5E8NA 3IXTB 4LLMA 3V6FB 4MJ5A 3RWEA 5C07E 4PUBL 1XGPB 1WZMA 1ZTXH 5E1AB 4ONOA 3MRKA 4DKDC 4HFWA 5HPMB 3W39A 3E3QE 4L3ED 2F54B 3EYOB 32C2B 4J1UB 5I30H 4UIMA 3MREA 3B43A 1EHLL 5D70H 2VUYA 4PJFB 4JB9H 5CSZB 1ROWA 1T4KB 5A2FA 2R8SH 5GS1A 4V2BA 5ESVA 5DD6B 3X11A 2FIKA 4I3GA 4FQCH 5LWYH 2NX5E 1C16B 3EHBD 4LOUC 2DICA 4UV7H 5HGDB 1Z9MA 2ZUUA 3LN5A 4O4YL 3WIHA 1FP5A 1JHLH 1OM3L 2BC4A 4YDJA 4KH2A 3T2NH 3WLBA 4UAOB 3QI9C 3DPBA 2ED7A 5I75B 2A83A 5LAXB 5SV4A 4NQVB 1RURH 1HHHB 3H0TA 4EN3B 3PL6A 3HG1D 3LDBB 4M1DL 3C6LB 5C71A 4KY1L 3LHPH 4JFOA 3VFPB 5F7EH 1YJDL 5L8LB 4L4TE 3U4BL 4PJDA 4XNZB 3OPZH 4PJ7A 2DF3A 2DMKA 1HHIB 4HUVA 1R3IL 2OI9C 5MI0B 5BS0A 1VEMA 4LMQE 4OCWL 3CVHH 1F6AB 4IRSD 4TVPD 3PDGA 1A1NA 4PR5A 3PWNB 4OAWA 1Y6NR 5HHXL 2YPLD 1OW0A 3O0RH 2BP3A 4H0HB 3BP4A 3EO9L 3I6KB 1GGCL 4GFTB 4JFXA 3HN3A 1SJXA 2V5SA 5E6ID 4BUHA 5ILTH 3W9DB 5L9DL 3IDYC 4PJHB 1E6JH 4YXKL 4DZBA 5L2KD 3S37X 4NFDA 5BW7A 1S7RA 2ITDA 3CZFA 2ZCHL 4WIQA 1TLKA 4K7PL 1VGKB 3HB3D 1JZ3A 4QT5B 3S3SA 4HGMA 1I75A 2VAAA 2YS4A 5I1KL 1CT8A 4FTVE 3VD4A 5DO2D 5MEQB 3I3DA 1KCVL 1B4RA 2Q20A 4ODVL 5GRUL 3GJFB 1NCWH 4JKPL 3L5WB 1ZHLA 1J7VR 4O02H 1MFDL 5EZIL 2GTZA 4QY8B 5CSGA 1QR1A 1AO7A 4JRXD 5DRXA 4FG6C 4XPGH 5A16A 3O2WH 4GG8A 3ULVF 1KB9J 3QUYC 5ID1A 4NPYA 5TQ0H 3BSZL 4M3JA 4E41A 2FATH 2UZIL 3K2MC 3QQ9C 3TYGL 2BSSB 3U7WH 1GH7A 4ZDHB 4HWZB 4Y4KD 2DQHH 4LPCA 1EHNA 4ZOAA 4OGYH 5CD5C 2FGZA 4DKEH 1T2QL 4GRLC 4A6YA 3TWCL 4OLEA 4YIQA 3RWDA 1M71A 1MELA 3MLUH 1JJUA 2BVQA 4UI2A 1MFEH 5EU6A 5DQDL 4AIZA 1XGYH 3CAFA 3MLWL 2X4RB 2GITA 2HFFB 1VFAA 1WITA 4PJAE 3Q5TA 4BSVB 3O2VH 3F12B 1LVEA 1TJHH 2JIXD 43C9A 3BIBX 2XV6B 5DWUH 3VXSA 1LD9B 5CFHA 2SEBA 1HKLH 3S35L 1YEEL 2X4SA 1FAIH 1E4XI 1U41A 4WI7A 1ZE3C 1MI5E 2HTKD 1MAML 2AGJH 3NPSC 3HPJA 1FL6B 2PXYD 4F9PA 1HE7A 3GUTA 4WUUA 2IFFH 1HSAA 1R5IA 1RJLB 3G6AB 4JVPA 2OL3B 1MJ7L 2I24N 1J1XL 4PRDB 3PP3K 2P49B 4JM2A 5FM8A 4YHLH 3V4UL 3VA2C 5IT2L 3SGKC 2OZ4A 2R2BA 3T0ED 1G0YR 4KKBC 1H3UA 3OWEA 5IEKB 1CXFA 2V5RA 4S0TD 1WBZB 4KWUA 5D6DA 2K3TA 4H5SB 1MH5A 3VFOA 4XGZA 5IFAL 3T0DA 2NLJB 2WBJD 4F7MB 1DCLA 4NQCD 4GW4A 3GJEB 3S6CA 4QRTB 5I1AB 1DQML 1QQDB 4RFNB 4AIOA 3VG0H 4TN9A 4Z7UE 4K7PX 1Q0YH 5D7JB 3A6CH 3KXFE 5EH1A 5JIPA 1FORL 1T1XB 3U46B 4ZFFA 1KPRB 3AM8C 1KPVB 5ENWB 2YK1L 4O5LL 4ELMB 4HS6B 3KLAB 3RVTD 2CUMA 3QISA 4RGMC 1EGJA 1SJEA 5FHBH 1OF2A 1HQ4A 1YECH 3KS0J 1CDCA 3QEGL 5E94B 4PJEE 1KEGH 3V0VA 1IC5H 4GSDH 3V6OE 3BP5A 3QIBC 4D9RD 3SCMB 5FKAA 2RGSA 2FR4B 4JPKH 5F6HJ 3IS1X 1RJCA 2VUOA 5F96H 1FH5L 2VDRL 1MWAH 1TTUA 1T7ZA 2VLRB 3LSOB 1U3HC 1FO0B 4RWYH 2XTJB 4QNPF 1U2CA 3KPRB 1ZLUK 1G7HB 5ERWA 2R2EA 2K1MA 1CR9H 2UWEF 3BIKB 4IS6B 4NRZA 5EU4A 1JK8A 3CX5K 1MHHA 3RVVC 1R0AH 1F2QA 2X7LA 3OTTA 5B38G 3VFTA 1MCWM 1X6NA 3JWNC 2VQ1B 2VXVH 1C8PA 4G6JH 1BF2A 3ET9F 1C1EH 2A6DB 3X14B 5GISH 5DJYB 4I18A 4YDLB 4RZCA 5AAWA 4I0PC 5DD5H 5KTEH 3S35X 4PB0L 4ELKA 2HYMA 3QEQE 4L3EA 4HPYH 4O2CB 2JCCE 2RFXA 4TSCL 3TH3T 1HQRA 1S7XB 2AJUL 3DSNA 4MVBD 3WEXB 4P3DB 2RCSH 1O0VA 2V2XB 1JHTA 1UZ6E 1U8MA 2A77H 4CADA 3QDMD 3MV8D 2OJEA 1T7XA 43CAB 5K9QI 4HUXA 5D7IB 1DQJA 1OP5H 3QDJE 1LEKA 3DVIA 5M7QA 4PYGA 2CLRA 1CFBA 4P9HL 4X6EA 5B21A 4JFEB 3DUSA 4FNLH 4P2RB 2VLKD 1M05B 1JGUH 3PV6A 1MREH 1DN2A 1KTDA 4U1JB 3CMOH 4N8VG 4R7DB 5FUZH 5HHVL 5HVGB 4LCCB 2QHRL 3OKNB 1MCHA 3GBLA 1CGUA 5I0DA 4IEFB 4H8WH 4P57B 1SY6H 5IHZB 1N59B 2YMXH 3ARBD 1F97A 1PSKL 4C56D 3B2VH 1W72H 2VE6B 5CEYA 3WL9A 1T2JA 4PTTA 4KQ4L 3GB7B 4K23H 2JJSC 4P5TB 4YUEH 3QUXD 4NYLA 2BX5A 4M6OH 4PJ8C 1FGVH 2HJLA 2HVJB 4OZ4B 3QQNA 3FQUB 3VXNB 4WHYG 4ZSOB 4QRPB 4EDWH 5LQBL 5GS0L 1UXWA 1AE6L 4RRPA 1NEZB 2ZNWA 1HDMA 4HJJL 3MRGB 4LF3A 4QHNA 4B41A 1KCKA 5F7WC 4IRSA 3N0PB 4K9EL 5F9JB 2X4UA 2YPLA 1LEGB 2YPVL 2D7NA 4XCNA 4G6FD 1U8LB 4E5XA 1QNZH 2IPUG 3CXHJ 3LV3A 3A6BH 4KJQD 4HDIB 5AG8A 5GZNC 5E6IA 3F7YB 3SDDD 2NY2D 4LDOB 5EUOB 1AQDB 1FVEA 4YDVB 1OQOA 1EPFA 3EDDA 4KJWC 5L2KA 1OARH 2OTWA 4DN4H 5C7XH 4PB9H 1NFDA 2XFXB 4ERSL 3ARFC 2F53E 4P3CL 4OSUL 3EIFA 4NN7C 4OCNC 5MEOA 5B3JE 3L3DB 4DGVH 3D48R 2OSLB 4L29B 1JTPA 2B1AH 3MOBH 4UQ3A 5I1IH 1YNTA 4MQ7B 4NUGL 1Z6JT 3RZCD 1L6ZA 2VL5B 5GGVY 4L9LB 3V95A 3VI3E 1EERB 3CXDL 4ZFZB 5DS8B 4L4VE 3RY5A 5T1LB 1LK2B 2HKFH 1IM9D 3CDGA 4G6ML 1QSVA 1ADQH 2ARWA 3PGDA 1JPTH 4NO5B 4EKXA 1Y6KR 2PN5A 2NX5B 1G9NL 2NY4D 2J1KA 5ANMA 4Y4KA 4IRJC 5KSAC 3KDMA 2EDQA 2AABL 2ATPA 4Y7MA 3KS0H 3FFCD 5C0IA 2OR9L 3L3IB 1JNLL 4ZXBB 4HUKB 3QWOB 2FSEA 1ITBB 1CICD 1DEEB 2ATKA 5I8OL 5ITBH 1K9TA 2B4CH 2P47B 5AD0A 3QG7L 3WFDL 3MRQB 3VI4E 2YKLL 1CQYA 4JKLA 3HUJA 1PYWB 2NY7L 5GGVH 2O5YH 2EICA 4N5UA 5J0BA 1EAPA 2VH5L 3P30L 1XF2B 3CVHB 3LVEA 4I2XB 2PXYA 1MFBH 3CNKA 4WTZA 1R3LA 2W0FA 4OZHF 4F7PA 5KVMC 3N50A 4AEHH 5IMLA 4XTRD 4P59L 3E8UH 5KS9A 4P2OA 1GSMA 1A2YA 4XXDA 4IRZL 5EORL 3NZHH 1LP9B 4QTIL 4UINH 4M62H 2GK0A 2OP4H 2CLVB 1F11A 2OS7A 2Y36H 3T0EA 4LCIH 3GHEL 5FK9A 4FTVB 4EUPH 4U1MB 4MJID 5F8RC 5FYKH 1KJ2H 3L7FA 1W0YT 3FQWB 2IEPA 1UQSA 4PJCA 3VXUB 1R6VA 5FYKE 3ARZA 2WBJA 4JY4A 3H9SB 1YUHB 4KJPD 4NQCA 1RJYA 3PNWB 3HNTH 1D5IH 4RBPH 1OTTD 3KJ4C 1Z9LA 2ADIA 3GIVB 4MNGE 4LSTL 4HKBA 2I07A 3WFEL 2R2CA 2ZWLT 1B0WA 1QFPA 2AV1A 4HIJA 3RVUC 1EO7A 4NZRH 4XWGL 5D7SH 2PO6C 2Y72A 1F4WH 3ZHKA 1MLBA 2D7OA 3QDHA 1FRGH 2X4NB 2HJKB 4Y5XA 2VTFA 4IHOB 2VZSA 4GRWF 4JZJC 4PGBA 4N8PA 3RTQC 3F62A 3KNBB 4ONGL 2GAZA 5KAQF 4YXHH 1MCFA 2XWTB 3WIIH 4X7TB 5FO7B 1B3JA 2J88H 2XQBL 1N0XL 4ODXB 4IDLA 3REWB 2VOTA 1INQB 5I1EL 1IGYB 4HMDA 4NC1C 4Z0XB 4XC1L 1MI5B 3B9VA 2O5XL 3WBDA 3F58H 3FOLA 3CFKA 3GM8A 3S5LG 2LVEA 2QSCL 4WHYH 2HTLC 5GZOC 5GGTA 3FQXA 2YD9A 3RY6C 3IJYA 3DX9A 2N1KA 4E42A 4NZUH 1UH3A 1XR9A 5D9SB 2OX5A 2CDEA 4YHKH 3ULVC 3TC9A 5T1DH 1C08B 4LPUA 4XXCA 4NJ9L 4Y19B 3SE3C 1WTLA 4FABH 2UUDH 3MNVB 1NL0L 4IIQB 1KC5H 3MLXH 3RBGA 5GSVA 4RISH 2DLHA 4Q6IA 4BA8A 3CSBA 3MV8A 4LVHB 2EDNA 4LCWB 1EEYA 1I3RB 4XMKH 5HI4C 1IE5A 4PV8A 4F7EA 3QO0A 4JRWA 2VLKA 5FO9B 1Q72H 4Z7UB 2WIMA 3QUZD 5T3XL 5D5MA 3T1FB 4U6YB 1X5YA 4M61B 1CDUA 5LXGL 4QLRA 3KYAA 5JUEL 3EYQC 4LDLB 2NCMA 3MACH 3UYPA 4WDIB 4AM0B 1E6OH 4Z7WF 2P7TB 3MLTB 3MR9B 3ARBA 5GGSY 4C56A 1UG9A 2Y7QA 1PLGH 3RIAF 1TZIB 3T0XA 5IFJA 4N90E 4YO0A 2EIEA 3QUXA 3EJJX 2AEPH 2FEEL 3RGVD 4YPGB 2Y5TA 3FO9A 1JGDB 2BY0A 2PCPA 4PJBF 4MA3B 5GIRB 3MZTA 4FQQB 4MMZC 1MEXH 4JFDD 5CD3B 1N3NB 4F80A 1U6AH 2NW2B 1NC2B 4TUOB 1YEHH 2P8PB 3U36B 1BPVA 5DA0B 4QRUB 2FX7H 1MWAB 2EH7H 1UFUA 3U9PH 3VFSA 3OKEB 1MSPA 3SE8L 3UC0H 4OGAC 4QHLA 2BOBA 4K8RC 1GCFA 3QCTL 3TV3L 3SDDA 2Z93B 4OUUA 4FXGB 4G8GD 1TMCB 4QTHB 2B0SH 1VGEL 1EO8L 2XNAA 3CDFA 4KTDH 2W60B 4OD1L 4CMMB 5C9KA 4G8IA 1T3FB 3QIWA 4XMPL 5JXEC 1JF1A 1T1ZB 1MCPH 4NSKA 4Z18A 2FHFA 5TQ2L 5SWQA 2UYLA 1QRND 1KBGH 3HZVB 1KXQE 4RIRA 2YUWA 2QJDA 4YC2C 3RZCA 5J13C 4NGHL 2ESVE 3QEQB 3WNNA 1WC7B 2Q86A 2JCCB 3PXJA 4LPWA 2DLIA 4LHUG 1AH1A 3GFUA 1N64L 4XC3L 1JPFB 2D0FA 2P1YA 1BIIB 4MDJB 3GMNA 5DZOA 5D2NE 3GO1H 1IM9A 5I2IB 5DJXA 3SOBH 1ORSB 3SO5A 4FQIH 4JPWH 5GHWL 3NPZB 3LKQA 3KWWB 1GHFL 5CP7A 4RMUA 2Q7NA 4Z7OF 3EOYG 3QDJB 5EOQH 3U7AA 5JNYA 3MODL 1GZPA 15C8L 2JF1A 3T1WA 1FIGL 5F6HI 1YC8A 3VFMB 4OFDA 2GIYA 2APVA 5I8CB 3MRJB 2I27N 3JTSB 4N0UB 2QLVB 1G7IA 1U93A 2F8OA 3TNNA 4HT1H 3RNQA 3FFCA 1NGYA 4V1DB 4LCYB 2XKNB 5T3ZH 1RI8A 4XCCH 4LFHG 3KLDA 1MVUB 3O6ML 4Y5VC 4IOFD 1CICA 5C0GA 1CFQA 2E9BA 4ORGA 4LSQL 4JHWH 2EH8H 4OCYH 1QLFB 5FYJH 4WJ5B 3QUMH 5HDBF 5JW3L 2AJVH 4GMTH 3T77B 4ZO8A 4K55A 3VH8A 4GMSH 4ZFOA 1HWHB 1J10A 3QQ4A 4YHIB 4ZUUA 1BWMA 5T5FL 3B9KD 5DUPH 4Q7DA 2B2XH 4J8RA 3DHJA 1K3ZA 1VADA 1II4E 2E7CA 3V5KB 4JG1L 5LGKA 3SDCB 5DJ0B 1OTSC 4N8VA 5J89A 2Y6SD 1ZT4A 1JWUA 2AQ1A 4JDVA 4Y16C 3MJ8A 1TJGH 4Z7QE 1I9JL 1GGBH 3LEXB 3B8SA 1VFBA 4ZOBA 1KELL 3VDBA 2BY3A 1I9IH 1F42A 3NCYS 3DGGA 3AROA 1IJ9A 3DXAB 1ZHKB 4DUWA 4DTGH 3H7BA 5KSUB 1H0DB 12E8H 3BDXA 4BQ9A 4TUKL 3SQBA 2C3XA 2CRMA 4P2QE 3VJ6B 2IC2A 4D9QE 4MJIA 1UWEL 3RWHA 4OKDA 4PJXF 4JVWA 4P4KA 2FEDC 3FO2B 1Q9WA 3ULUL 3E1F1 2XTLA 3OKDA 5GSRB 1HYRC 5CIPH 1AXSB 5SWSE 5BVPL 2BSRB 4TUJA 1V05A 4R4FH 2VZTA 3CCHB 2V5MA 4ZQKA 2VMFA 1CIDA 3MGOA 3FRPG 4ZODA 5DUBB 4ZPVA 5D96B 1KJMA 1FFNB 4JQXA 4D3CH 4DOHB 3ZDYE 4HS8L 5I1CH 4OCRH 1I8LA 5C2BH 5FKPA 2W9DH 3UCRA 4AT6B 1CDYA 4HUWA 1W0WB 4U3HA 5HYJB 5EO9B 4N0FB 4WHDA 3T3MF 2V6HA 1IL1B 3LQMA 4HC1L 4NNYA 3VWJC 1IQWL 4AJ0A 1EHXA 3BPCB 1GC1L 5FA4A 4I3SL 2BXZA 4X6DE 2LU4A 1AXTH 4F33B 2HP4A 5IMMB 4GJTB 5GRVK 1UM6H 1XT5A 5L7XL 5DK2B 4GG6B 2DJSA 4KJYB 4LEOB 3RKDD 3IXTA 2IQ9H 4ESKA 1LNUB 1Q9LA 2QSVA 4E0RB 1GGTA 4GO6B 2VDNL 4QRSB 3QCVH 5AEAA 3ZKND 3O6KH 3B5HA 2MCPH 2DJ4A 4O58H 4PP2B 5HPMA 3IFLH 3TN0D 2F54A 3EYUH 2DTSA 3TJEH 1T7WA 35C8L 4PJFA 3HE6C 1U8OA 5CSZA 2DWEB 3VFGH 3I9GH 1BQLH 2H45A 4LFHD 2R69H 4P4RB 3FL7A 1Z3GH 4LU5L 4Z5RA 1KB5H 3QCUL 1GZQB 3H42H 4FQJL 3ZSTA 2WP3T 4NKMB 1JVKA 1F8TL 3D6GA 3H9HB 1ODAA 1H3WM 1IRAY 4LVOB 2X4QA 4HG4K 3WUZA 4HMEA 2NY0D 1PZ5B 4NHUA 4QRRD 1MVFA 3EJYC 3MFFB 3P77A 2HKHH 3OKOB 3N9GH 5EZOL 3X12B 3B2UC 1AGFB 4EUPB 5I66B 4LLQB 4FQLL 4Q97A 1GPOL 1KJ2B 3TIDA 3VFNA 3IB4A 3BPLC 5B38B 3GKZA 3BISA 3V6BR 5EBWA 3VFPA 1B4JL 1EBPA 1EA9C 1TTFA 4L8SA 2GY5A 5IJVB 1E4KC 1IGCL 1WF5A 3RIAK 5IESL 4MNGB 1BVKA 2X70A 1TDQA 3QUZA 3MRIB 3QJFB 2WIIA 4GKNB 2IAMD 2HN7A 3JXAA 3PP4H 4HV8A 3U0TB 5FECA 4GXUM 4ODUB 4F9LA 4D0BA 1IT9H 1MUJB 1D9KB 1V8HA 3TZVD 1NLDL 2BSTB 3P73B 1UB5A 2X42A 1RUML 3LS4H 4QF1B 1AP2B 4F2MA 4U1LA 4JDZA 2KZWA 4PG2A 2EYSB 4M8QA 5JW5B 1LO5A 5J06A 4OF0A 3RGVA 1PKQE 3M1BB 1G0DA 4WGVB 4TSBH 3O2DH 2N56A 2H32H 2R0KH 1V5JA 4FZ8H 1CLOL 1MHPL 1A9EB 1CI5A 2VITA 1IM3B 2A6KA 1P7KB 3QHFL 4OF8A 5A3IC 5F9OL 3MXVL 2HFTA 3MLZL 5IWLA 3MLSL 4HIEA 4I48A 3BGFC 2HFGL 5KOVC 3WNPA 1QYGL 5SX4H 2I9LB 4X6BB 5C2UB 5CBEB 3RIFF 5C07D 5CS7A 3WE6B 4L5FH 3BAEL 1OB1A 4LSSL 5FYLE 1CE1L 2P24B 4CU8A 3KAAA 4G8GA 4PJIF 1WFNA 5E2WH 2WP3O 1WBXB 3VXQA 2VDPH 5EZLA 3N1GC 1CQKA 2FL5B 1JZ4A 3V6ZA 1DN0A 3UPRA 1QRNA 5T5NF 4Y4HD 3RVWC 4M03A 5FXCH 3L6FA 1CFTB 2BSSA 7FABL 4HWZA 4MXWL 4O4YH 1D6VL 2Z35A 1IBGH 4LNRA 4OZIA 1HXMA 3QIUC 5FUOL 4JFFE 1JNNH 2EXYD 3V5DA 1P7QB 3LEVH 1FL5A 1JHKL 2VXUL 4ZFGL 2H41A 2DL2A 1U8KB 1EZVY 1WBYB 4PJ9D 1CVRA 2R23B 1M7DB 3RU8L 3U4BH 3U79A 5C6TL 3VXTA 3VXME 1T1WA 4L4TD 4W6WB 3RY4A 2VZOA 3G5VB 1K85A 5TF1H 2D31B 4I3RH 1S5IL 3INUL 3BFOA 1MQ8A 1D5MB 4FFWD 4MQXC 2P8LA 4ZG1A 5F1SA 5DGRA 4QEGA 1FL3B 3GMQB 5EBLA 1BQSA 2YEZA 3K2UL 5HYSG 4U1SA 4NUJB 1YEJL 1WAAE 1HOCA 5BXFB 4KRMB 1RZKC 3DV4B 3QFJE 4B0MM 3B9KA 5FYLL 4GXUN 5IM7A 1YEKH 4H1LG 4PRDA 3VFRB 4DW2L 3P40A 2FZ3B 2W9EL 4PLJD 1REIA 3P9WB 1DDHB 4BK5A 1I7RA 3Q5YA 4YXLH 2E7LC 1BM3H 1ZSDA 3SDXA 1JZ2A 4H5SA 2CR3A 1LHZA 5I18L 3WIFB 5EBMA 1S9YA 2KPNA 1NBZB 3DVNB 1MFDH 4OBSA 5KSBE 3IYLW 1QFWM 2QSTA 2GK2A 1OD9A 3WMSA 3G04A 2FRGP 4KC3B 3OF6D 2L7UA 2CGRH 5HVHB 4LHQB 3TVMD 3VWKB 2QL1A 1MIEL 3V2AR 2W38A 4J6RH 5E8PA 3L5HA 5D7JA 2UZIH 1CG9A 1JF5A 1NAMH 2XXMB 3GZKA 1LE9A 3MJ9H 1TFHA 4GT7A 3VGBA 5J56B 3JWDL 5ESAB 4NQDE 1WWCA 3MA7B 2AVGA 2ESVB 1T1XA 4NNXB 2BXYA 1S9XB 3MYJB 2IH1B 5GGSB 2YA0A 4IMKA 3WO4B 1EXUA 5FV1L 4XCEA 3VRJB 5AZEH 5E0QA 4HS6A 3KLAA 1LILA 5D2NB 3M45A 4HK3N 1TQBC 3MRLA 4OV6F 3UTQB 3W0WD 3SBWC 4JJ5A 1FBIL 3NFSL 5HHQB 3B6SB 2EDJA 4LHJB 3B4NA 4HKZB 5JR1H 1JWSB 5C9JB 2GY7B 5HGBB 1NBYB 2G9HB 5BQ7B 1TVBB 2R9HD 5HI3D 1X5ZA 5H2BB 3LSOA 3NAAH 1WQVT 4IS6A 1T5WA 3BIKA 1U3YA 5FGRA 5D93C 1WZ1H 3L3GB 3JBG7 1RZJH 3UEZA 1DR9A 1HSBB 2JB6B 5LGHH 4XCYA 2VDQH 4KK9C 4F8QA 4JFZH 3BQUB 2LU7A 3QUMB 1KTLB 4BH7B 5JLZA 1J1XH 5DJYA 3HRZA 3NACH 5MENE 3F7VA 4AEIH 6CGTA 3PP3H 3VFWB 4CN6A 2XRAL 3FB6B 1WTGT 2DQFA 4K94C 4LBEB 2D0GA 3JV6A 3TN0A 4NO3B 3ZKMD 1QFUL 1IKFL 3EAKA 3QDAA 3S88H 2AXJA 3AS1A 1G9ML 1SM3H 3F6IA 2BNQD 3DRQB 1S78C 4XBGA 4G7VL 4QXUH 5MEPB 4KAQH 5D7IA 1NAKH 1N8ZB 3DMMC 2MWCA 2B39A 4KUCD 3IJHB 4Y2OA 2UZYB 3LRHA 2GHWB 4JFEA 1M05A 1WT5C 4MHHG 5E99L 4QRRA 4R7DA 4P2QB 3KXFD 4QXGH 3LQAL 4EXKA 4ETQB 1NMCC 3ILPA 1ZLWK 3MYZA 2BVEA 1U2HA 1J18A 4KRPD 2AQ2A 3S5LB 1A7PL 3OR7B 1WV7T 5ACLA 1T66C 1DVFD 3IF1A 5H8DA 1GYAA 1EHAA 5CHNA 4HAFA 4P5TA 3V4VH 1XZ0A 3QI9B 1EX0A 4YHYC 3ROOA 2HVJA 4OQ1A 1RFDL 4L3CB 3NH7H 2J6EH 3FQUA 4PGEA 3E2HC 4FQ2H 5F1NA 1ZWIA 2IAMA 1NEZA 3DX8A 1FZKB 1BFSA 1XIWD 1IC4L 3O3AB 1FFPA 1A7NL 3TZVA 4OB5H 1T22B 1KG0A 3H6JA 3PHSA 3OJVC 5CKGA 3WD5L 1ZLUH 4JHAL 2OI9B 3D2UD 3FQNA 5DEFA 1HH6A 3F7YA 3RIFK 3D69B 5AG9A 2NY5C 3KVQA 1AQDA 1DE4B 5D1XC 5GS0D 2F19L 4KFZC 4X6DB 3UPCA 5K9KA 5I8EA 2F9BT 2R56H 4HIHB 4U7MA 1KJVA 2HH0L 3O45B 3I6GA 3RAJL 2HG5A 1PGRB 3WUWG 3CLFL 4JCLA 4OD3H 2DQDH 5DXWA 1QSFB 3QZWB 1X5JA 2ENYA 3IDYB 5C07A 3S98A 1DLFL 4PRHE 4PJDF 2CMRL 2AW2A 2VL5A 1N5YH 4LP5A 4ZFZA 5JA9A 2HJFA 3C8DA 4GKSB 4N9OB 4XMLL 1J0HA 5E56A 5GJSH 5C0NC 4LKXB 4H1LH 1DBML 5HY9A 5FCUH 1MRFL 4Y4HA 4LRIA 5DTFB 1YY8B 4TPRL 1P1ZB 3GSVB 4ZTPL 1R3JB 5E2JA 3OJMB 3TBSA 3DECA 3NIFF 2DYPB 4NJAL 4EJ1C 4JO1H 4XVJL 4G8FA 3QUYB 1OAUL 2F58H 2IANE 2IALB 2XZQH 1RJZA 4ZXBA 4KHTL 3TBYB 4G6KH 1T2XA 4PJ9A 3CFJA 2XN9E 4NNPL 3CFCH 1DFBL 4KQ4H 1UXSB 4XZUB 5D1QC 3PDDA 3N85H 2MQ3A 4GRLB 2DIJA 4L4TA 1QA9A 2RR3A 2GSGA 1C7SA 1U0QA 3DWTA 4R2GD 3O3EA 5E2VL 4POZD 2IPKB 3WJLC 4KVNH 1ZEAL 4K9EH 4GAJH 4LHUB 1CL7H 1DTUA 1B0GA 3V79C 1RUQL 2CO6B 4XHQA 1Q1JL 4OD2B 4R6UA 1PY4A 4TULL 1KXVC 5D1ZD 4RGNE 3TO4D 3MRRB 5LGJA 3BVNB 1PKQB 4PLOB 4R90H 4MJ6B 4NC1E 1AD0B 4M5ZL 3M17A 1U36A 3NPSB 1BVZA 5D6CB 1CDGA 2VDKH 2H32B 3QR2A 4OSUH 2NYYD 5GGRA 1YEDB 2DKMA 4XNMB 2F53D 3KYNB 5HHNB 2FJGB 1T83C 3FQTB 2QADC 4R8WH 1JZ6A 4B50A 3QEUB 3ULVE 4JO2L 5JQ6H 1NKOA 1F3JB 4BZ2L 1FCCA 4HCRL 1QKZH 4U2YA 3RKPA 3FT3B 5ICXA 3KPLA 3OF6A 1UCTA 3TVMA 5E9DE 4L4VD 4HHAA 2DI7A 3DROB 3OXRA 4LMQI 3TNMB 4MX7B 2C1PA 3QG6B 1YPZF 1CGYA 2D9QB 2BVOA 1BBJB 1OAZH 3QPQC 4Y2DD 1MPAL 1RUAL 2ADFL 2AERT 3EOTL 4ZO6A 5F44A 1BZ7A 4GQPH 5ISZE 1IEAB 2AABH 3OB0K 4Y1AB 4QXTB 5HD8C 4GH7B 2QSQA 3SE9H 4TOYL 4JFFB 4JM2F 2HMIC 2OTUB 5ALCH 4Z77B 5F3HA 1H5BB 2AK1L 5DFTA 5LCVH 4OF3A 4D0DB 1K4CA 5DLMH 3K1DA 2V2WB 5T33H 4X4YB 2C7UA 4PJAA 5EOCL 3WFZA 4RGMB 1IMHC 1P84J 3GSNH 2ZPKL 3MV7D 1CK0H 1E4WL 5C0BD 4J2XA 1D3CA 1QLRB 3SGJC 4ODXA 2NY7H 3QIBB 1BJ8A 1JGVH 1IGYA 4AEFA 5IJKC 4U1NA 1MI5A 4RFOH 1JN6B 1UWGH 1HILA 5E2TH 1AQKL 4UDTB 4ZAKD 5L6YL 5DD1H 3C2AL 2L4OA 1U3HB 4KK6D 1WSST 4K8RH 4M6AA 3VXPB 1G7JA 3Q0HA 5A40E 5CCKL 5IROA 3VDCA 3SGDI 2R39A 2DL9A 1CXEA 1D5ZB 3FZUD 3ZTNH 4J3VA 3BZ4A 2YZ1A 1PG7L 1INEL 2XG4A 4GUPB 1CDHA 2J8UE 4Z9KB 2BNQA 1OCWL 6FABH 1GIGL 3FO0H 3FO1B 3BP7A 1LDSA 4EI5C 2WM0A 4EI6B 3D39E 1UJTA 3PF2A 3QWQB 4NHCL 2H8PB 3ARDD 1IGJB 2VSDA 3DETD 5I73C 2X89D 1UYWL 3TESA 3IKCA 5F71A 2Z31C 3D85B 3U0WH 3BN3B 3KXFA 1KIQB 1NDGA 5GXBB 1CD9B 2FBOJ 1E27A 1INDL 3CLEL 4MAYD 1NAMB 4R4ND 3MLTA 1IAMA 3SKUD 3SDAC 2MPAL 5EUKA 4ONFH 5DHYA 2ICWB 4DVRL 1DVFA 3DX6B 5JW4Q 1VB9A 1TZIA 2GSIB 2CD0A 4ZS6C 1D5XB 3SDYL 1LP9F 4PJEA 5T3XD 3A67L 4YPGA 5M94B 4JEGB 1N26A 3QUKA 4U1HB 3V6OA 1ZGLA 5K33A 4MA3A 2VKXA 5C0CE 5GIRA 4QNPE 4JRYD 2UWEE 4YDKH 3ZLQC 1YYLH 3MRDB 1XIWA 5CGMA 1S8DB 5FOBB 1X5KA 1JFQL 4ORZC 4X98A 1I7ZB 4M7LT 4PJ8B 1WWBX 5JHLL 4MZ3A 1S7VA 4N5ED 4M7JL 4JM4L 1MCDA 1RK1B 1JF6A 3OHXA 3D2UA 3TIEA 2O5XH 5L88H 1EIBA 3WN5B 5IBTH 3QA3A 2G60L 3BZDA 2WW8A 5DK0A 3ZYIA 1JL8A 4P46C 4GLRI 5I8KL 2BNRB 4X5WB 4JQIH 1A7QL 2JLLA 4KROC 3L3HB 2XQYK 4FQHB 4M43L 5H37G 1TETH 3WSQH 4LNVA 1T0NA 4XP6H 5MENB 3ESUF 2D7TL 3G6JE 4Z7NE 5IMKA 3QEQA 3UX9B 5DMIL 3HS0B 1Q94B 2JCCA 3EOBB 4FZEL 4XBPB 3T0WA 2V17H 4NN7B 1NL0H 4R26H 1SYSB 5KAQG 1BIIA 3T0VA 1N6QL 2JK5B 3TPUA 5FM5M 4RAHA 1MCLA 5IKCB 3KWWA 4XPTH 2DMBA 2OBGA 1VEOA 5FM5O 4Q2ZA 2GJ6E 4WTWA 3RL2B 3T4AB 3MRBA 3CVIH 1KJ3L 1R5VB 2NW3A 4OTXL 3S36L 5T3XH 2WWKO 3OG6B 4IBLT 2AJSL 5IB5B 2EDHA 2DBLL 5LXGH 3VXRE 4TVSa 1J0YA 3GKWH 4XWOC 5I1JH 1MVUA 1FE8H 1F13A 3F8UB 5DJCA 4LVNB 5C92A 1QEWA 2HRPL 1FZOA 4WTXA 3ISWA 3P2TA 5SX5K 4IRJB 5KSAB 3BT2H 1ES0A 4N90D 3X13B 3ZE1F 2VXTL 1AGBA 2BZDA 4ZUVB 4ZYKB 2YXFA 4XB7A 1BEYL 3O3BA 2D7MA 3ZDXE 5DURB 4AENB 2W92A 4TQEL 4YEEA 3Q3GA 2P5WB 5ICYB 5F97E 3EYFB 1D6EB 5LJYH 1KT2A 4G9FB 2IBZY 5D1ZA 5DJ0A 4LCUA 1PJ9A 1T5XB 3TO4A 2H2SC 4J4PC 3BEWB 3QCTH 2VIRB 4BSJA 2A6IA 2IQAB 3CK0H 1CFNB 2ZCLL 4OF6A 3LEXA 3QAZC 4M3KB 2Z8WC 4XMPH 3C87A 2EDRA 3H7LA 1G9EA 4HKJB 1JE6A 1YNKL 1QPPA 4WFGE 2F53A 2L7JA 3UBXA 4WO4C 1ZHNA 3P4OA 3SKMB 4AL8H 2VXSL 1G7PA 3HZYB 2BRRL 3WCYA 5HYSB 1QFWL 2ESVD 4HUUA 5TGBB 2Q8AL 2FLRT 3BH8A 3HUJF 1HI6A 1UVQB 1KLGA 2YPKB 4L4VA 1YDPA 3GMMB 1NC4B 4PGDB 4JO4H 4Z0BH 3CSYB 4ODWA 4F7CA 1MCWW 4Y2DA 1AGEA 2HT3C 4MHHI 4AT6A 3ULUD 3KJ4B 5A43C 3NBNA 4M7KH 4QO1A 1MCKA 4PTUB 5EO9A 2ZSWB 2ICEB 2IANB 5D2LE 5GS1C 4F3FA 3DNKA 4KMTH 1A64A 2ZG2A 4Q74A 5DRZA 5DVKA 4MNHB 4HKXB 1NGZB 2PO6B 3UBXI 2EC9U 2KBGA 3LRSB 1BGXH 3U0PB 3CGTA 5A1AA 1HXYB 1MIML 3MV7A 4NRXB 4JZJB 3S36X 1FFQA 5GGUB 1LWRA 1XH3A 3RTQB 2RIKA 4IM8A 1RD6A 3WFBL 1JIBA 2EIDA 4OZHE 4QRSA 3T3PF 3QDGB 4PP2A 4IMLB 4JG1H 3MV9E 2VXQL 2PR4H 1M4KA 3H3PL 4OIIL 4ZAKA 1I8KB 2UY6A 4PP1D 3B5TA 3EFFB 5DRWA 4XPBL 1IKNA 1GAFL 3L3JB 3PWPB 1A6AA 2XZCL 1KELH 3O9WC 1X4XA 4G3YL 3ZO0A 4OCXH 1SEQL 3GMRB 4DZ8B 3AGVA 2BY1A 1T04A 5BOZG 1OW0C 5E6ZA 3UJJL 3EO1A 3IDXH 4W4OA 1OD7A 1UWEH 2ED8A 3NCJL 1OAXL 3C60D 4D9QD 5J1AA 4R3SB 2X10A 1AFVH 1H3PL 3DJ9A 4KZDL 3O6LH 5F7DA 3OAUL 3ULUH 5BW7C 5JXAL 2BDNL 1Y18B 5I66A 3T4YB 3OSKA 2C1OB 1X5LA 4K71C 1U9KA 1X9QA 1QSEB 5H37H 3UAJD 5SWSD 4KKLC 3ARDA 1L7TL 3VCLA 5E8OB 2FD6L 4MNGA 2X89A 1I8MB 2WWMC 1U95B 1TZHB 5E08H 1FPTL 2CKBL 5F7MC 3QJFA 1U42A 4GRWE 4M1GH 4F7TA 4PRID 4MAYA 4ZNCD 4WFFE 5JO5B 5CUSH 5CINH 2DQCH 5JPMA 3P73A 2DTML 1AP2A 4WNQA 5BV7L 3D18A 2EYSA 4YHPB 1IQWH 1AC6A 1I3VA 2GJJA 4CU7A 5HDOA 2YD7A 1RZGA 2DQGL 1J1OL 4ODHH 4OCSH 3AAZA 4NQSA 4UTBH 4DKFL 1MFAL 5EWIL 1RZKH 4LLVB 1E4JA 4H25B 1IM3A 1MRCH 5EFIA 1P7KA 5HDQH 4BQ6A 2Q7YB 1YEIH 4HWBL 5F7NC 4NZTL 2VDNH 3GSNB 3RUGE 5IHUH 1B0RB 4FP8L 3O3DB 3GMPA 4TRPL 4NZDA 4WFEE 5D5MF 1CN4A 3HMXH 4JGJA 3BE1L 2VLLB 1CF8H 2OR8A 3IETA 4WHTA 2G75B 2FL5A 2X5PA 2B1HL 3MBED 3STLB 4I77L 1RZ8B 4OLWL 3QCUH 4U1KB 3I50H 1CFVH 1CFTA 1IILE 3L1OL 2WINA 1TVHB 5TDNA 1I7TB 4D2NA 2AP2A 4F9PC 2BJMH 2E6JA 4R9HA 4DN3H 5FV2A 2EEDA 3EBAA 2CIKA 4X6CF 4MD0A 5EZOH 5IB1B 3HR5A 2I60L 1EJOH 4FQLH 4JLRA 4YC2B 2MKWA 4RDQG 5J13B 4JM2C 1B4JH 2R23A 5TPWL 1BJ1J 5IEHB 3IAPA 2V5YA 1KACB 3D39B 3GIZL 4CVXB 1A1OB 2FEEI 2R1YA 3UJIH 4PRPE 5D6DC 1R3KA 3JZ7A 3KPOB 5EBGA 4NCC2 2V7NA 2FLBT 4Q9QL 1IAIH 1FL3A 5I15L 3GMQA 4C83A 1QBLL 4U1IB 3S4SB 1QLEL 4PJBE 5AAMA 3O6FC 1DEDA 1NGWB 1Y0LB 1CBVH 1KN4H 2CJUL 1F90H 1S5HA 5DMKA 3TYFA