3HMXH

Crystal structure of ustekinumab fab/il-12 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
217
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAYLQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-12 subunit beta
publication title Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 37
structure length 217
sequence length 220
ec nomenclature
pdb deposition date 2009-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxH01
1A6TA 3T65A 2ICEA 4HUMB 2FBOJ 2FBJH 1CK0L 4OKVB 4ZUSB 3P4OB 3ARBD 4XMLL 4N5ED 1NDMB 4WEUD 3B9KD 5ICXA 4JFFB 2IQ9H 2XFXB 2ADJA 2GCYA 4LSUL 3UZEA 3MLTB 2J5LB 4XBEL 3RHWF 4HZLA 1CE1L 5ILTL 2P49B 2Q76A 3HAEB 1JYWA 5I17B 5DEGA 5A1AA 5HGHB 1NGXB 4JREB 4HUWA 3TBTB 5T1MB 2RAMA 4ZNEE 2PXYB 4XAWH 4OI7A 4NP4L 3U0PB 4F37K 5F7FA 1OM3H 4QCIA 2OSLA 3CAFA 1D5IH 3DYPA 4KKBD 3BE1H 4R96A 2R2HA 4I9WE 3BH9B 4OFKA 3KYOB 3RWCB 1DUZA 4LIQL 4P5KA 3C8DA 4YZFE 3CDGA 5CCKH 5AD0B 3EGSB 1CDGA 5BXFB 4ZSOA 1JI1A 1BQHG 3A6BL 4AEHL 2VLLB 3GBML 3G5YB 1OT1A 3STZA 3OF6A 1HNGA 2ICWA 2QKIA 3EFFA 1HH9A 4W81A 5BV7L 2GTZB 2FX9H 5C8JA 5D6CB 5L8JB 4PRAB 1EEYB 5JUEL 4MQXD 3UTPE 2P5WE 4U2ZA 3OHXB 1CYGA 4YX2H 1MFBH 1KJ2H 4LVNC 1MRDH 2UZIL 5J11C 1LNUB 1GOHA 1WBZA 4R4FH 3BPOC 2XQYK 1BMGA 3MLYH 3V4VL 2CDGB 3C5SB 1I3VA 3IKCA 5A40E 2FB4H 2DF3A 5C09E 2Z31D 3MA9H 4Y5YB 2F8XC 1LK2B 5E2TL 2IF7A 1ZKAA 3PL6B 1DDHA 2KQMA 2QR0A 4P5TD 1Q38A 2L0DA 2WWKO 4J3OC 2DL2A 5DVLA 5LG1A 1CCZA 4FQPA 2BP3A 2X70B 4F7PA 4JFYA 4MWFB 1QRKA 3RP1A 5IV2A 5ESQA 3FO2A 4P5MA 3TNMA 1BREA 1RZIB 1AE6H 1QP1A 1YEGL 2FGWH 2AXGA 2ARJA 4E41E 4LVHC 3R4DA 4P59H 4XAKD 5KVGH 1KPUB 2EDQA 4Y19A 5HGAA 1DBJH 1YYMH 2P5WB 1EUUA 1NAML 1V3LA 1NDGA 5TQ0H 1HHKB 4JGUA 3HNTH 1IKFH 1U93B 3S5LA 1T4KA 4MAYC 4I3GA 4G8IA 1MLBA 4XPHH 5C09B 3GNML 3ZDXE 3GSQB 2OI9C 2YZ8A 2NY3C 3VDAA 4LLYB 3S9DB 3V7MA 2XQBL 3LRSA 4CNIB 1V3KA 3KPRA 1NUDA 3I84A 4OZIA 2IAMA 1X3DA 12E8L 3HI5L 4PJ8A 5JO5A 4QYOB 3GMLA 1W0VB 2X4OA 2EKSB 2OP4H 4L4JA 4HEPG 2W60A 2VO5A 4OM0L 3MV8E 2BHZA 4HQQL 4KPHH 3DUSA 1RZKH 3K74B 4ZS6C 4E41B 4JM2D 5GQBA 5MP6L 5FA3A 3O6FD 1IBGH 5I8CB 1Z3GL 3W0WE 4OCWH 1MVUB 3MMEB 2F19L 2WIIB 1EHNA 1TVDA 4YE4H 1RU9L 5L2JA 4NPYA 2ATPB 4X9BA 1J1OL 3JV4B 4TVPE 1GGYA 1IEAB 2KZWA 3TWCH 2D4FA 3KG5A 4N68A 4UIMA 1S9XA 5JPNB 3G6JE 1MCOL 4LEXL 5E4IA 5CEZL 2YD2A 4XP6L 1FYHB 4N90E 3TFKD 1EO5A 3QO1A 1DFBL 3I2CH 3VXOB 4YUEH 1I1YB 3HC0A 4CJ0A 4FOMA 1OLLA 2AI0L 5FK9B 3S4SB 5BS0A 2QADD 4XZUB 1MFAH 1WGOA 1L0XA 2X4RB 4JHAL 4LKCA 5I1GL 2XXMB 4HK0A 2XTJE 1QOKA 2Q7YA 3KPQB 4QT5B 2P8PA 3FQXB 2OK0H 4DKAA 3FHAA 3ZHKA 3DBXA 2AGJL 3BIKB 4MJ5B 3FFDA 1L0YA 3MV8B 4MCYB 2HWZH 2V9QA 2WBJD 1UCBL 3MRFA 1UWGH 3CLEH 5SWQB 2FD6H 1LEKB 3ARGB 3RX5A 3W0WB 4KHTH 5KJRH 4OLZH 5JW3L 1JGEA 1FNGA 5SX4I 4XCYA 1WK0A 3GSOB 3MOBL 3MR9A 4HXAL 2X05A 4J6RL 3GZKA 3VH8A 1H5BC 3MLSH 4EN3A 5LQBH 5EBLA 3U0WL 1C5BH 4U1MB 1OTTC 3G6JB 4HS3A 4KY1H 1EGJL 3QUXA 1RUMH 4OM1H 3TIDB 2DD8H 5DHVH 5IF0A 4MMXC 3CSPA 3SDAA 5ALBL 2J88H 3U79A 5H2BA 4GS7C 3IDIB 1HIMH 5KAQG 1IJ9A 4QRUA 4WFHE 4DAGH 5A2KH 4NO3A 2XTJB 1FFPA 3WJJC 4LMQI 1HSAB 4M7KL 4X7DC 3ZKSD 4OLEA 5I2IA 1H15B 1J88A 3UZVB 1ES0A 3DRTB 2N1KA 3E6FB 4MHHG 3WEXB 1Z9OA 4YIQB 4J3WA 4ONHB 1JE6A 3MJ8B 1FV1A 3BPCA 3VMPA 1MREL 3D6GA 5E2JA 4IRZH 4OLXH 2K7PA 1UXSA 2B1AL 1AGCA 4IRJA 3LCYA 4YXLL 4TPRH 1D9KB 4Z7OF 1OB1B 1G7HB 2Z91A 3MSPA 4Y16D 1P7KA 5IFAL 4OF5A 1T0MA 3RA7H 4PJAE 4KUZL 3MREA 1B4RA 4U6VL 1UM5L 1RJZA 3NCEB 4HCRA 2BNQE 5GRZA 5I18L 3E1F1 3IJYA 4RGNC 2OX5A 3PV6B 4JM2F 3MBXL 2X42A 4S1SL 2JJTC 1MSPA 4M1DH 3CX5K 3BDBA 4QTHB 3HFMH 4OLWH 2X4TB 3H3PL 2EXWC 4NRXA 1OARL 1QRNE 4R7DA 5F9JB 1UM6H 4U1JB 4NBXB 3TCXA 1TVBB 4NNPH 1BJ1J 3DRQB 3DMMD 3VD4A 3V5DB 3WFEH 3LHPL 4FABL 5GRJL 4UDTA 1FN4A 4JZJB 4JHWH 4AIZA 1J1XL 4LU5H 1QSFD 4YPJA 3NPSB 3TYFA 1JIBA 1PG7H 4H1LA 5HVFB 1NGPH 1JGVL 2HVKB 1JPTH 1CXLA 2GY7B 5E00B 3GO1L 1K6QL 5D1QB 4U0RB 1YY8B 3LN9A 1QLEL 5KSAB 2AAVA 1YNTB 4PJAB 4HIHA 1SJHA 4NZUH 3VE0B 2BNQB 2IMMA 4JAMA 1OAQH 3P0VH 3MYJB 4P4KA 3UTTE 3MUZ1 4FQIL 2GSIB 5TJWK 3GKWH 4G7VL 4X9FA 1AGBB 5AYUH 1Y0LB 4F37F 2CRYA 1YUHA 3AREC 4KQ3L 1IAKA 1FPTL 5IROA 4MYWB 3SDCA 4R4BB 3BX7C 3GMNB 5DLMH 3BYTA 3AB0C 2HLFD 1V7ML 2ZPKH 4YQXH 1TCMA 2Y6SD 3VWKB 3JWDC 1UZ6E 1CT8B 1QRNB 4Z0XA 4NKIL 4ZS7H 1D5XB 5DQ9A 4LCCC 3MXVH 3U36B 3OAYK 3HPJA 3TP4A 2DI8A 1KB9K 3L3GA 2UWEE 2ZCHH 1KEGL 4KVCH 2GJZB 5IMKB 4MDIB 4R97C 4Z0BL 1PZ5A 2IBZX 1OSPL 4V1DD 2VLMD 3X3GL 2XICA 3C5ZA 2Y72A 1MNUH 3ARRA 4WGVB 4P2QB 2A6IB 1RY7B 5CBAB 4NWUH 4XC1L 5EWIL 5C3LD 1B90A 3IDGB 2Y4SA 1HZHL 1IARB 1BLNB 2XG5A 2VLKD 1FGNL 4KMQA 5GPRA 3UTTB 3VFWB 1AGEB 4U1NB 5EN2A 4OV5B 4MQ7B 1KB5H 5AG8A 5DTFA 4U7MA 1QA9B 4EBQH 3LQAC 4XNMB 5CZXD 3ELAT 2VDKL 4UTBL 2DQJL 4YDLB 2MCPH 2C4FT 3TNNB 4U6HA 3W9DB 4BSWB 4K3HA 4LDOB 4ORZC 4N9GB 2BRRL 3C09C 1T3FA 4JB9L 1YEIL 4NRZA 1NBVL 2UWEB 2OR7A 1MPAH 4OZFH 4CU7A 1PKQA 3VFPA 1XMWA 4IRSA 3SE4C 1JWMA 1U8MA 4ONGL 1JRHL 1I8KB 5C0CE 2ILLA 1TJHH 1BBJA 1UENA 4KK9C 1DSFH 5DD1L 1KFAL 4H20H 1LD9B 2IBGA 3Q6FB 5SX5H 1DQML 1FSKB 4WUKL 1T66C 4E9LA 3VXME 1R6VA 1I8MA 4YDKL 3QHFL 3NCYS 4KHXH 4KXZI 1SM3H 5IHZA 3KPPB 3D85D 3DXAA 4RFEB 5IB3A 1U8PA 2GJ6A 2YOCA 4JFQB 3CFIC 4HKJB 4XNZB 3SDDA 2W0KA 5BVJA 4NJ9L 3UPCA 1DQQA 5D2LE 4HKBA 4R26L 3OB0H 2FWOB 5FECB 1FO0B 1NCBL 2MHAB 4NOBA 4UQ2A 2DQHH 5E4EC 3ARFD 3LEVL 1RURH 4PYGA 3HG1A 1LO3H 5IMLB 2P43B 4CN6A 4PRPA 4DN4H 4OIIL 3U0TB 1UEYA 3TPUB 5HHQA 4G6FD 1ORQB 5C0CB 3HZMA 5DJXA 5F1KC 5JQ6L 4CDGC 4NM8H 1U8NB 3CVIH 3QCTH 1N5AB 3BGMB 4FP8H 4F9LA 1CICA 5DC4B 1YECL 3O3EA 1OAZL 3I6LD 4O4YL 3STLA 2BOBB 3VWJB 3VXMB 4XPAL 5EO1B 1YQ2A 2R1XB 5C07A 4RGOH 5CGTA 1C1EH 2GHWB 4JY5H 4KWUA 1KELH 4NQEE 2PF6A 3FKUS 1PEZA 4AMKH 2C1PA 1ZLSL 1RZ7L 1U8QA 4WV1A 3TVMC 2XZCH 3ZHLA 1X5IA 5IK3B 5D2LB 4YHLH 2BSRA 1ULVA 1Z5LB 3BDYH 4L8BB 2QEJA 2EO9A 2HKFH 5BW7A 1J12A 1NMCB 2NY5C 1N5YL 4JY6A 5F21B 5LGHL 3SCMD 3S35X 1YQVL 2Q8BL 3OMZA 4GUPA 4OIBA 4PRDA 5DA0B 5GISH 1TVHA 2VR4A 3W11C 1SY6L 1CGWA 4LK4A 5LVEA 1SHMA 2NY1B 4ODVL 2MTPA 2VQ1B 3C60D 1KCUL 4MA1C 2VZUA 1PYWA 3TJEH 3B83A 2C3GA 5F96L 4QOKE 4FFZL 5GS0L 2ESVE 3QDGA 4ODSH 1RHHB 2D7QA 4QHNB 3UBXG 3S34H 1QVOB 3UX9B 4I3RH 1T5WB 4ZD3H 1GOGA 4ONFL 4X80H 3MACH 5C0GA 4NQEB 2F8VA 3QDME 4WDIB 4K23L 3BIBX 4GH7B 3KAAA 3ZKXC 3ARBA 5E2VL 4R96B 1ZT4B 3B9KA 4BQBA 2FLBT 3K0WA 3UPRA 1M05B 3CDGB 4FMFA 4HC1H 1VEOA 5B8CC 3BQUB 1A3RL 3ZDYE 3HZYA 1RJLA 2H45A 1XGTB 5ICYA 1OF2A 1R3KB 1Q72H 4GQ9L 3O2WH 2P7TA 4X4YA 1BGXL 1VENA 4D9QE 3EFFB 3PDDA 1NJ9A 1CD9B 5FGSA 4MAYD 2OTWB 1WF5A 2VE6A 3T0AA 4I1NB 4UU9B 4BZ2H 2DBLH 3GSXA 1CXFA 3MUY1 2B39A 1FLRL 1CFQB 1G7PB 1N59A 2ESVB 1F90H 1WBYA 1I3GH 3ZMRA 3ABZA 4QHMA 3WL9B 1EK3A 1F2QA 3ZDZE 1HKLL 1OPGL 4GRLB 4KZEH 4M7LL 3UTOA 4YAQA 1KTLA 4MD0B 5TGBB 1A7OH 3UJIL 1REIA 4ENED 3WIHA 3QDMB 4F58L 3O41B 1JZ7A 4O58L 1F3JB 3FRUA 2VXQL 3CCHB 3DUUB 3FQWA 2VYRE 4F7CA 2AJZB 4ZS6D 3S37H 1UKQA 1M6OA 5A2IH 1T83A 5F9OL 3DI3B 5CWSB 1V7NL 4BM7A 4WJ5B 3CU7A 1OAKL 5ID0A 3NCFB 1U9KA 4ZDHB 3NCCB 5EUOE 1SBSL 3ZT5A 4CW1A 3EZJB 3PWPD 2B5IB 4WW2B 3OKLA 3C5JA 4U1IA 1S9WB 2Z31A 4I48B 5E08H 1E0OB 1AC6A 5D7LE 4D9RD 4AEEA 1EVTC 1DEEB 1UADC 1K9TA 2IPKB 5D6DA 3ZTJH 2WINB 1CD0A 3ARXA 4F7MA 3SE9H 2CDEB 2R1WB 1G6RA 4P5TA 4KTEL 1NCCL 5E8NB 4YXHL 3TZVB 4Q6IA 1AI1H 2X4SA 3F7RA 5DMKA 3W39B 4F7TA 1O5DT 1LHZA 4X4XB 5HHME 1IC5H 3NGBB 4XCEA 1B4JL 1MLBB 2N56A 5GGTH 1F11A 3PJSB 4LBEB 1NBYB 1MCNA 4Z7VF 5ID1B 4PGJA 3RUGF 2EKJA 2O5YL 1N6QL 3KPRB 1PBYA 1T1ZB 1A4JA 3VXNA 4M1CC 1U58A 2EZ0C 2GUOA 4OGXL 4U6YA 1CFNB 4NO5A 3OJVC 4ZTOL 4XVJH 4CBPA 1IGJA 4XCNA 1A7QH 2Y06H 5EUOB 4Y4FB 3CFKA 4GG6F 3SGJC 4ODWB 4PR5B 1JFQH 1J86A 3QEUB 4LPTA 3PABA 5M94B 5B3JF 3BPLB 1OTTD 5D7LB 3CXDH 5KANG 4NKOA 2VDQL 1S5HB 4PRIE 1AD0B 3WN5C 4G80A 4L29A 4OJFL 4KI5E 2FEEL 1NEZB 4LCWD 2FR4A 3KJ6L 3EYUH 5DA4A 2YA0A 3RWJB 5HHMB 1A6WL 5GHWL 2KPNA 4MB3A 2O61B 1MFEH 4OCXL 1KN2L 1XGPB 2ORBH 3FB5B 1H3PL 4JM2A 3O6FA 1A0QL 2BSED 4HW6A 5E56A 3NOIA 4L3EE 3GSWB 3QIBB 1F58L 2MMXA 2JIXD 1S9VB 1H8NA 4LCYA 4NP4H 4X6EB 4AM0A 3AFLA 4AQOA 3KYMA 1S3KL 1IAII 3NFPB 5CJXC 4DGYH 4NFBA 1QKZH 2FO4A 4UUJA 3HCVA 3FFDB 4JDZB 4LIQH 4MA3A 3PF2A 4FNLL 2C3VB 5DMGC 1OP3K 4P4RA 1B3JA 1DR9A 4ELMF 1P84K 2H3NB 4OD1H 2G5BB 1EEZA 2FCBA 2HFEA 4PRIB 2R29L 3BO8A 5ESAB 3A6BH 4JQXC 4RAUA 3GBMH 2NY2B 2DQGL 4DVRH 1CLOL 3UJTL 5BV7H 4RGND 1KN4H 3H42H 1FZKA 5CJOL 2YPKA 5EC2B 3MRMA 3GI9L 2VL5B 5JR1H 2VWEE 2WBJA 1MFDL 2EXWD 1R3LA 4G9FE 4R7NA 2OR9L 4NN5C 5H2BB 4L3EB 2HAZA 2Q86A 5FYLH 2PR4L 3V4VH 3GIZL 4RQQA 1YMHB 3ULVC 3VDCA 3QJFB 5CSZB 5FYKE 3BZ4B 4QXUH 3T1FB 3EYVA 4P23C 5MEND 2UYLA 1KULA 3QRGL 1BF2A 3T2NH 2ATKB 4E5XA 1KTDB 1OHQA 4OD3L 2P47B 3C8HA 1GOFA 5E2TH 1P1ZA 1JWUA 4MQTB 3BEWA 4OCYL 3QNXB 5KSBF 1AXIB 1UXSB 2DAVA 5JDSB 4PJEE 1WBXB 1I9IL 2W9EL 1YEGH 3V4PL 4Y2DC 2FGZA 4TUOB 1B6UA 3FRPG 1UA6L 4PJBE 3ARED 1Q9KA 2WM0A 2GFBA 1T7ZA 2HVJA 1XF2A 5C0RL 4LRIA 1NAMH 4PY7B 2YPLE 3X13B 4G9FB 4ZAKD 3AVEA 4NHUA 1BD2E 2APTA 4FXKB 2AXFA 2W0FA 3H9HA 4WHDA 1R0AL 1A1NA 1HQRA 3VXUE 1IEBA 3GNMH 4YGVA 3OAZK 5F7NC 2DM2A 3LEYH 5TE7L 1R5WB 4HT1H 4J3UA 2XQBH 4Y16A 1EFXB 1TJGL 1GC1L 4HKZA 1ZK9A 3ULUH 5FFLA 1QFWI 1E28B 3O3AB 5D7JC 1MI5D 5M7QA 3VI3F 5HHOA 5A43C 2X9YA 1BQLL 2CUIA 12E8H 3VI4E 4F3FB 4NSKA 1T80A 2W1NA 3QEQE 1IFHH 4JO3L 4PJEB 1X7QA 1FFOA 1HHHA 2BY1A 4OM0H 3ZTNL 2AK4E 2F15A 4O02H 5C9JA 3UZQA 1F6AA 5E8OA 3RDTB 5MP6H 4L8CB 3EO1A 1MJ8H 4PJBB 5CIPH 2BFVL 3WO3B 3EFDH 3P11L 3TJHC 1NGYA 3R06B 1BFOB 3JV6B 1PQZB 2YPLB 1RU9H 4JAMB 3DMMA 1U95A 1J1OH 1AP2A 2GT9B 2E27L 3SDXF 1BD2B 4NQDD 1GYAA 2LTQC 4KXZH 4XB7A 3SGKA 1QSFA 2HG5B 2OL3B 2FSEB 1MCOH 2IGFL 3PWJB 4LHUB 3ULSB 4RSVA 4XP6H 2H41A 1JWSA 3VXUB 3V5KA 2XNAB 3FN3A 4BKLA 4ZFOA 4Q7DA 1HK6A 1RJCA 3EIFA 3QQ4B 4LLWA 1NUNB 5FO8B 4U1SB 1P9MC 5I66A 2RJMA 4ZNCD 4WO4B 1VADA 2AW2A 2Y5TB 4K3GA 3WJLA 5I74C 1T66D 2AGJH 4Q0XL 3QEQB 4P3CH 4LARL 3RY4A 4L1HA 5DZNA 3TBSB 3MRLB 2AK4B 1SYVA 1FRGL 1MHEB 1UCBH 3LSOA 1KIPB 1WSST 3T2OA 2FJGB 2L7UA 1BQUA 4HIJB 3NA4A 5HYSA 3MOBH 4HXAH 3SOBL 3MNZA 4F80A 1PFCA 4N9OB 2NY6C 4HHAB 2IH1A 4JFHE 4V1DA 5D7KD 1EGJH 2EYTB 5L0QC 1AHWA 1TCRA 5GGQL 4HWBH 5ALBH 3M45A 4LLUB 1J0JA 1RSFA 2QSQA 4YPGA 2DQDH 4EI5D 1I9EA 3QFDA 4WY7L 3WXWL 1U8JB 5FKPB 1JPGA 2VLKA 4DFIA 3BUYB 4WWKC 4M7KH 1I7TB 4KFZC 4TSBH 4J4PC 4X98B 1RULL 3RZCD 4WFGE 1JF1A 3M1BB 5DRZA 5FYJD 2FYYA 2I26N 1G7IB 2ZZUT 3CXHK 4BQ8A 1WFOA 1MREH 5INDB 2G9HB 5C0DA 3U30B 2X6MA 4BUHA 2R15A 1CD1B 2BMKA 2HT2D 3L9RA 1KF9B 4AEFA 4YXLH 3GMQA 4JPIA 1A9EA 2G5RA 1JN6A 3REWB 2GTWA 3PIQB 2HMIC 5FUOH 4O5LL 1QUNA 4KUZH 1BBDH 4Y5XC 1RI8A 1DQDL 3KPOB 5CJQL 1WFUA 3TH3T 5EA0H 1FVDB 2ZOKA 1FO0L 4ZPTB 3W11D 1EDQA 4HJJH 4NGHH 4UMGA 3PUCA 5KBNC 4S0TD 3O2DA 3MBXH 4IMLA 3RWDA 1LO5A 3QWRD 4KROB 4JFOB 4NDMB 3D85A 1GGBH 3IFPA 4S2SB 5TF1L 4XNUL 4G6ML 5IVOA 3BJ91 4WW1B 1U3HC 3LHPH 4FABH 5GRJH 3WBDA 5L88L 3DX8A 5C08D 4PS4L 2E9BA 5TE6L 1J1XH 2WBWB 3STLB 1NMBL 2VZOA 1JGVH 3KPLB 4KK6C 2VDRL 4PB0L 1EAJA 1ZANL 3ARFA 1X44A 1CBVL 1K6QH 4Y5YC 1MH5B 3DETD 3GSVA 3U2SA 1QLEH 3V5HA 3IFNL 1MRCL 1IQWH 3HRPA 3G04B 5GZOC 1ND0A 1W72H 4WV1B 4EOWH 1K8IA 1IMHC 5DEFA 2OS7A 5I1CL 3VA2C 3IS0X 1TTFA 4OUUA 4FQIH 1GHFL 5EIIA 3WKML 4G7VH 5DXWA 3QPXL 4Z7NF 4M48L 4CU6A 5BOPA 4KQ3H 3ZSSA 1FPTH 4KKLC 4JN1H 4MJID 5E6IB 5T33L 3S4SG 1MQKL 4WGWB 4M93B 5JHDE 5GSRA 4NKIH 1NFKA 1M7IB 2E5EA 4J12A 5CEZD 3O8XB 3S36X 2BDNL 3F5WA 2AXJA 3CDFA 1LEIB 4Y88A 1OSPH 4PJCE 2XPGB 3GMPA 3X3GH 3VRLF 2DQEH 4FQCL 4BSVA 5FYJU 3SCMA 2FJFB 4Z7VA 3RUGA 1NC2B 5EWIH 2EEBA 3KPMA 1YC7A 3ARBB 4PJDF 5D2NC 1FGNH 4JFEE 3C60A 2EH7H 3TBVA 5C0JA 3SDYH 3GRWL 4MSWB 1EJ6A 4GG6A 4UTBH 1O0VA 5DUMH 2HT3D 2UZYB 5JHDB 2GAZA 5FOBA 1B0RA 1F13A 2BRRH 2CMRL 2HRLA 4PJFF 1FZOB 4QTIL 5H8DA 4YDVB 1VGKB 4G9DA 4QNPE 4OCRH 1EZVX 3WUWA 4M5ZL 4PJCB 4ONGH 1DQLL 3ROOA 1JRHH 2PYFA 2LU3A 3OJ2C 4JDTH 2B4CL 3IDMA 1I1FB 5B39G 5DD1H 2I5YL 1KFAH 4YWGL 4M1CD 2CXKA 1G7QB 3BKJH 4NO0D 1DQMH 3OGCB 3GMRA 3D39E 4CVZB 4N1HB 4YDKH 4MAYA 4K3JH 3F58L 3QHFH 4JFEB 2GSGA 5DJDA 5CHNB 3K80A 5IB2A 1GJIA 1DLHB 1EXUB 3WFDL 4X6BB 1CF8H 1DTUA 3STBA 3CH8A 3RGVD 4JFZH 1UCTA 4OZ4A 3H6JA 1DANT 4FTVD 3MRJB 4CMHB 2VAAB 3L7EA 3GJFB 4R26H 4PRHD 1NCWL 1MHCA 4ELMA 1RZGA 1NCBH 1N2RA 1QG3A 2J7LA 5GSVB 1G7MB 4FMKA 3LEVH 1GIGL 3PDOB 1K3ZA 2H32B 4OIIH 1KT2B 4OZGE 1YMMD 4JZOA 1L9MA 3PGCA 5IW6B 2AEQL 1T7VA 5JQ6H 3DV4A 1IT9H 4BK4A 5F6HJ 3GK8L 3HLAA 1ZGLP 3RL2A 1TITA 3IETA 1T7YA 5CGMA 5I15L 3PWPA 3X12A 3HZVA 3ZE2E 3D39B 4H5SB 2HP4A 4XPAH 4OI9A 3MLXL 5ESVB 3RIAK 3WNPA 5J7CC 1MEXL 3L3KA 2BVYA 2VLJD 3QUMB 5DFTA 4HLZG 3SN6N 4LSPL 4OFDA 1EHLL 3KS0J 3D18B 3E6HA 4UILL 1SBBA 2MFNA 1IGJB 1NGZB 4PJHF 2AXHA 2ED8A 3C6LC 2W91A 5J12B 4I18C 3OKYA 4DN3H 4M9OA 5CBEA 3RWIA 4B0MM 3ARUA 4APQB 3GSNB 1LO4H 4U2YA 4OF3A 5KSBA 1E4WL 1HXYB 4PGDB 3TGXA 1PZUB 3V0VA 1D9KC 3CX5J 1P53A 4HXBH 3MJ7B 4NCC1 1N5YH 4JO1L 1HXMA 3C8KA 4NNXA 3NIFE 2AERT 4OZGB 2NQCA 2Q8BH 5HVHB 1SY6H 4ODVH 3OG6B 4MAUL 1OTSC 2G75B 1ZWIB 1KCUH 1W0WA 1U8HB 5HGBA 3ULVD 3T3PE 4EUPH 1H5BA 5F96H 2CH8A 4FFZH 1A3LH 2LABA 1BQSA 3T4AB 4LLVB 1G9EA 3QWOA 5BCAA 1NUFA 1NFDF 3WNMA 2I9TB 5IVNA 4N8CL 1FC1A 2VISB 1WZKA 4ONFH 2YN5A 3L1OL 3GHEL 5T3XE 2HJKB 2PW1A 1TZGH 4OGYH 1GC1C 4AM0B 1NSNL 5IHUL 1DQJB 3T0ED 4PB9L 3O6LL 4JZJC 2VXTH 3V8OA 1AY1L 2M8XA 3MLRL 4LCWA 4I8DA 2C1OB 3NPSC 4X6CA 4G8GE 3WJJA 1A22B 3VXSE 1MQ8A 2PTTB 4NWTL 5ACZA 3DO7B 3B9VA 4P4RB 3O6KL 2NX5E 5D1QC 3B5TA 4GRWF 1A3RH 4U7SA 2VUOA 4U0RC 1IM3B 5KSAC 4KJWC 5J9PB 4TUKH 2JIXA 4BFGA 5DSCB 5HBBA 2WP3O 1FL6B 4ZOBA 1BOGB 3QQ9C 4LSDA 1KB9J 4YH6A 1T2QH 1FZKB 3CPLA 3B9DA 4DUXA 2BY0A 1ZV5A 3MXWL 3BKYL 5EORL 2AKRB 1ZA3B 1F6FB 4I0PB 4O2FA 5CZKA 4U31A 1I7ZA 3SDXA 1FLRH 3FOLB 4K2UL 1Q9LB 2JLLA 3H9SE 3UP1A 3H7BB 4RDQG 2ZG2A 3VWKC 1HKLH 4JFXA 1ZOXA 1KJ3H 5DFVC 1ITCA 4M7LH 2Q86B 5D7JD 1NH6A 3BEVB 4OQTA 3S8WA 3UJIH 4PJGE 3U7AA 3FO0H 2HYMA 2NTFB 4FXGB 2GEEA 1MJ7H 3EYVB 5DQDH 1JK8B 5D70H 1RUKL 1A6UH 3BH8B 4ODXB 4C4KT 1X5KA 3D69B 3NAAL 4YDJB 1RAMA 4G8GB 5BRZD 1A3QA 4L1DA 1EBPA 4POZD 5EBMA 2RIKA 3VXSB 2JJTA 3Q2CA 1F4WL 2QSCH 1TENA 4KJYB 4IEFB 4AENA 3MRNA 5F9OH 2NX5B 1RUPH 1V7NH 1U91B 2BSSB 5IIEA 1AJ7L 1NEUA 1OAKH 1ZHNB 1KCVL 2I60L 3TJHD 2XKSA 4NO2B 2J6EA 3CSBA 3K4DA 5MENA 4NQCE 4XGZA 3DURA 2GK0B 4HCRL 3KPNA 1XF2B 3S88L 2Y7QB 5EOTA 5F88B 3WS3A 3F12B 2VITB 3H9SB 1EO8L 4MXQC 1NFIA 3MRGB 1ZLVH 5F6HI 4YDLC 4PYHA 2F53D 1QFPA 4OBSA 4JO2L 1ZT1A 5FHBL 4Z5RA 3WFBL 3D25B 4PJGB 3DGCR 1B4JH 3C9NB 2A0LC 5E1AA 3VGEA 2P44B 3ILPB 2E9WA 3RTQC 5IGXH 1Q1JL 1GZQA 1WTLA 4UAOB 1YEKL 1CS6A 5I76B 3AREA 2AJ3B 1DBMH 3LH2L 5EC1A 3LOWA 4QRPE 1ZGLB 2NY4D 3N9GL 4OGXH 3ULVF 2BVPA 1ACZA 4ZAKA 5F72S 4LLDB 3QBTB 1QHPA 4RBPH 1BVKA 2JELH 4GKZA 2YK1H 2NY6D 4PRBA 3N1PC 3OR7A 5GS1B 1F6AB 4NQCB 3LKPA 1QFHA 4XTRC 1R5IB 3KPSD 3MZTA 5DVNA 3I6GA 1VFAA 3MJGX 2VDQH 1D6EA 4LQ1A 4XNZC 2ITCB 2YD7A 3NPZB 3KJ4C 4JFDD 3SO5A 3CU1A 1MI5A 3SJVE 4N0FA 3VGGA 5DURD 3KR3H 3QNYA 4Y2OA 4EQ3A 4AQ1B 1E6OH 2RCSL 3KJ6H 1QSFB 3F6IA 4PPTA 3SBWC 5HHVL 2UVFA 5GHWH 1X5FA 4MB4A 1T20A 5LXGH 5CD3A 4MA7L 4NM4L 3FQTA 4K07A 4WWKD 1CR9H 5DC9B 4OCXH 5J56B 1MJUH 1P5UA 2A74B 2WLZA 5SX5K 4JFFD 4LVOB 1A0QH 3DV6B 3A67L 4XHJC 2A77H 3EAKA 5I1DB 2XZQL 1Q94B 8CGTA 4QRPB 2BHUA 5GS0D 3JSSA 5DRWA 3O11A 1I7RB 2BVQB 2PXYD 3NCJL 4NQDA 2R0LH 4MXWL 1MWAH 1VESA 1ROWA 4DZBA 2BNUA 1N7ML 5E2WL 5ADPL 4FNLH 2X4NA 3EZ8A 3SE4A 2HMID 1YNLL 3KWWB 4KI1A 1B2WL 1UJ3B 2R29H 4PTTB 2P8MA 4X7TB 3VGDA 1CDBA 3SJVB 2BCKA 3RIFK 3QAZB 1JHTA 3SY0A 1CLOH 1YEJH 3CFCL 1DL7H 1NLBL 4K94C 4WUUE 3W5MA 1XCTB 5JA9A 4XH2A 4AH2B 1JUFA 5KVFH 4FQLL 5HHNA 1HOCA 1NMCC 3BW9A 3GI9H 1JV5A 4M1GH 4NQXA 5CGYC 1MFDH 4H88H 4OD2A 3C6SA 2K1MA 1QSEA 2Y25A 4PREB 4QY8A 1UWEL 2W9DL 3LQMA 1RVFL 2HRPH 2NY1C 1ZA6A 2XY2A 3QRGH 4Z7UF 3TYGH 3QSKB 5I1IL 4BFBD 5CAYB 4O2CA 1IM9B 3TN0B 5ADOH 2CIIA 4KK6D 3I50L 1QO3A 1ONQA 1INEH 1FFNA 2VERN 1A64A 4I9WD 4OCYH 4LSVL 3CFJA 3PL6D 2ZSWA 2FH6A 4EI5A 3GMQB 4JPIB 3IJHB 4NN7B 1KLUA 1VACB 2Z4QB 4N8VA 2W9EH 4WUUB 5IFHH 4OLUL 3V4PH 5AG9A 1KIRB 1D5ZB 2F5AL 1KPRA 1UA6H 2V9RA 3MNWA 4PJDA 3DSNA 5FA4B 5FM8A 4KKLD 3ZYZA 5C0RH 4EZMA 3RZCA 3TC9A 4PGCB 3VXTB 1IC1A 1CIDA 2AJVL 4ZQKB 3V6ZA 4PGBA 4PGEA 3UTPD 1J05B 3X14B 2P5WD 3EOAB 4CGTA 1MCBA 1ZVSA 4X4MA 1WC7B 2XT1B 2O5ZH 1B6DA 4EDXB 5I8OL 4DWHA 3HRZA 4YBLC 2E7LC 5FDWA 2HFFB 1WEJL 3L3DA 4UI2A 3KNBB 5TE7H 2CK0L 4PJFA 1U6AL 5C09D 1TJGH 1QR1B 1KNOA 3ALPA 5KG9A 1X5HA 4GRLC 2IQAA 3ES6A 5TDOB 1G6VK 3GSUB 4G7YL 2I07A 5EFIA 3VFTB 1FDLH 1J8HE 2P48B 2PW2A 3ZTNH 3R0MA 3LKQA 2V2WB 3CX2A 3QWRA 2BZDA 1UT9A 1VEMA 1LGVA 4MD5B 4F33B 3P11H 3BWAB 4E41D 5HDOA 4DQOL 3G6DL 1X4XA 3ZYOA 1MCDA 2DM3A 1X6LA 5HYQA 2E27H 1NEZG 5C08A 1A6PA 3U4AA 4HUKB 4XPBH 5IKCA 4JFPB 2X41A 3LDBC 4XMPL 2XRAH 3V4UH 4U3CA 5EU5A 3RWEA 1A7NL 1AXTH 3TZVC 3I75A 1TNNA 4KVNH 3QPQD 1E27B 2VIRA 2VDOL 3NGBC 5GRYA 1J8HB 2A73A 2YD9A 4KAQL 4D8PB 4WNQB 3MRRA 1XR9A 3RWHA 4MJIA 2B20A 4NUJA 4LF3B 1VFBA 1HQ4A 2FL5A 2KUTA 3MV8D 2EE2A 5JLZB 3L7FB 4LVNB 2D03L 4HFWA 2UVEA 3EOBA 3ARGD 3BPOB 3W0WD 4PG2C 2ZSVB 4ZUTB 2ICCA 3OB8A 4R0LA 4HUUB 4PJHA 1HYRC 4TVPD 4S1DD 3DVNA 4YZFF 3BPLC 5GGQH 4PTUB 1J0KA 4N90D 2X09A 5FOBB 4FQJL 3O3DA 1CL7L 3MRIB 4XVSH 3BKCL 5KN5A 2VJXA 4WY7H 5LGJB 2J8UE 1H0DA 4ALAL 1CIUA 2XTJD 3ROOB 1JNNL 2NW2A 1RULH 4WHTA 2EIDA 4X0KB 1A6ZB 1WVZA 5J13C 1T1YB 3CJJA 3WIHL 1P84J 3CVHB 5HGDA 5GZNC 3QIBC 3BRGC 1JHKL 5JXAL 3FB6B 3SHSA 5JOFA 2DWDB 5LAXA 3FONB 1NFDA 1A5FL 1BQHB 3B5HA 1CZ8H 4HJGA 4YFLF 1HHGA 3WMSA 2M26A 1UYWH 4ZFZA 2DJ4A 3GMOA 3MV7E 2FX7L 3FO1B 4PLOB 4GAYB 1D9KD 2NY3B 3NIDE 2DB8A 5I1LB 1MCFA 3BP5A 5KS9E 5F3HA 1WLHA 3MZGB 1I8LA 1DQDH 5IR1B 1K4DA 2IH3B 4BH7B 1JF5A 3SE8H 2ARJQ 3F7VB 3AC0A 1D3CA 1T1WB 5ALCH 4E42B 4NO0A 1N2RB 1OTSD 5JTWA 3CD4A 3K2UL 3EJYC 3HPLA 3GB7A 4KI5C 1KPVA 2XXCB 2EXYD 2OQJA 3S96A 1A21A 2J8UB 1A4KB 3MOAL 1G6RL 4WFHD 3Q5YA 2YD1A 3U4BL 5TF1H 4OFPA 1F4XH 3BP6B 4PP2A 3RGVA 3VXPA 3OZ9L 4UNUA 4KRNA 4ZFFA 5L88H 3JWOL 4FTVA 1K4CA 5TE6H 4QRTB 5E03A 5IB5A 4PRHA 4HGWB 4RAVB 2LVCA 4HWZA 4GBXC 2DS4A 5J1TC 3D0LB 3FQRB 3P0YH 4KV5E 2VDRH 4PB0H 3QUML 1P2CA 1E4KC 1ZANH 2DM4A 4Z7WE 3ZDXF 3IU4L 3MV7B 2C3WA 2P5EE 3E2HB 4F2MB 4GKSA 3RY6A 1YMMA 2CKBB 3EO0A 5KS9B 3FOMB 4YNYB 1IGYB 5D1QD 3V2AR 5DD0L 3FQNA 5I1CH 5KSAD 4KJWD 4X6CE 5HJ3A 5C0BE 1GHFH 3RWFB 1BOYA 4HWEL 2BNQD 3QQ9D 3WKMH 1XF3B 4P9ML 4HEME 4M48H 4MNHA 8FABB 5MEPA 2VKXA 5BO1H 3EOYG 4YHNB 4BYHA 1BZ7B 2VLJA 3UAJC 3SO3B 4ZO8A 5DK0B 5F1IB 3VWKD 3CFEB 4GMTL 1RIVL 4JEGB 5AZ2L 1YDPA 1QRND 1U8LA 4ZTPH 1B0GA 3D0VB 4G43A 1BX2B 1NCTA 4JQXA 2R2CA 5EOQL 2ZWLT 4N0UE 2D31B 1ITBB 4P3WA 3RIFF 3G6JF 3WD5L 4C83B 1ZHLB 4EVNA 4QHLA 4NT6A 1MRFH 4M43L 3VU2A 5J6HA 4Z7WB 1F5WA 4FQ1H 4R2GB 3QIUC 5DJ2B 3ZO0A 5DDHA 2P5EB 5EPMA 4Y5VB 2VQTA 4U6TA 1JNHA 5CMAA 4UOW0 4KH2A 4P3DB 4XCFL 4JDVA 5K9QI 4X6CB 4IOIA 5C0IB 5C0BB 1O7VA 5TH2A 4ZFGL 5AWNL 2XA8H 3P77A 3UTTD 3DLQR 3MGTA 3OL2A 3RDTC 4GJTB 3V6BR 3PWVB 4X99A 2V7NA 4ZUUA 3TBWB 2BNRE 3VD3A 2YSSB 4ERSL 5CINH 3ZKMC 5T3ZH 4QHUB 3L5WB 3BJLA 5IEHA 5E8PB 5MEQB 1QFUH 2V2TB 4L8SC 4W4NA 4MXQD 2CMRH 1C7TA 3FB7B 3QULA 1MJJB 4QTIH 4YHOL 3T0EA 1QSVA 5DS8A 4HS6A 1Z6JT 3NA9L 5DJZB 2P8LA 3QZWG 4JANB 4N0UB 2XTLA 3VRIB 1C5CH 1SEBA 1KG0B 4ZYKB 1DQLH 5IM7A 1D6VL 2VNCA 4WRLA 1BVLA 3GBLA 2Q87A 4JJHA 2AJSL 2I5YH 4YFDB 4S1RL 4YWGH 1C08B 4K7PX 2RFXA 3BT2L 3S7GA 1P7QB 1C16A 1FNHA 4XI5D 4KKAC 4WO4C 5IQ7H 1YN6B 3M17B 4UOJA 3IJSB 3WFDH 4X7EC 3UTSE 4ZUVA 1MCQA 4YHPB 5I1KL 4XTRD 4GKNB 4AENB 4QGYA 3S35L 5HHPA 3KYAA 3O2VL 5F7EH 2BNRB 1XR8A 2WMPA 2BRQA 5D7JA 2KDGA 4HZAA 1LDPL 3GDBA 4EUPG 1HH6A 3NZ8B 2FNBA 3SQOL 3HZKA 5HHXL 1GIGH 2ZP0T 3PP3H 5EO0B 5DD5H 3G08A 5TPWL 2PYEE 4TRPL 5BRZA 2WUCL 4L9LB 1LQSR 1DBBH 4X5WB 4K3DL 4PJAF 2JB5L 4M6OL 2VZSA 3NACL 5D7SL 4XHJD 3GK8H 1IL1A 1WTGT 1K2DA 2LE9A 4CADA 5C0CD 1CFSB 3DX7A 3WSQL 5I15H 3QUKB 2Z9TA 3BP4B 4IMKC 1GGTA 4WU5B 5JHLL 4QWWC 3VGBA 1J8KA 5H94A 3PHQB 3AREB 3Q5OA 3V7AE 1VCAA 3VXMD 3VWJD 2OCFD 4DJMA 1C12B 5F7WC 5DO2C 3UTSB 4Z7UA 1BZQK 3AB0B 4RZCA 1A6VL 2CPCA 2R2BA 5BMFH 4JVPA 4UILH 5J3HC 1CLZL 1JPST 1IE5A 5DJ6A 4LCCB 2F53A 3HR5A 1T22A 2JK5B 4GW5B 5L9DL 1T1XA 2J4WL 1P9MA 5ISZE 3VFRB 3QXVA 2DYPD 5LBSH 4U4BA 4R97B 5ANME 4W6WB 5HI3C 4JO1H 3L3HA 1KJVA 3ZT6A 5L2KE 2PYEB 2HJLB 1OVZA 5DD3L 4JG0L 4JCLA 5ABDE 3MRHA 2APBA 4QXTB 5CGYD 3QNYB 5E99L 4M03A 3JZ7A 4NCDA 1S78C 3PWLB 1PY9A 3PGDA 1INDH 4MDJB 4NQSB 3B2VL 5I0ZA 1Z9MA 2IMNA 3T0DA 1OWWA 3RX7A 2N4IA 2ZCKL 5I1AA 1HHIA 2NY1D 5DF0A 4R4NC 2I9LA 4QF1A 2EDOA 2C7UA 5CILL 1BM3L 3KPSA 1SJVA 4N8CH 2X4UB 3MNVB 1UZ6F 2V5SA 4IIQB 4X5XA 1BZ9A 3L3OB 2O5XL 3EJZC 3L1OH 4GG8A 2XZAL 3GHEH 4JFDA 4MX7B 2CLRA 5T5FH 5IHUH 1ZEAL 5KSVA 3CMOL 4LLQB 5DRWB 4PB9H 4MZ2A 4M00A 1KLFA 5C0ND 4NQED 1AY1H 2UWEF 7FABL 1KC5L 2ZKHH 1M7DB 2CD0A 5ISZB 1CI5A 4J3TA 4OKVA 4ZUSA 3P4OA 1YN7B 1NDMA 4NWTH 4WWKA 1FZMB 1MCRA 5ANMB 3O6KH 5F1OB 1NLDH 4JFFA 2XFXA 4RDQF 4P46C 5L2KB 3BGAA 3MLTA 4L4VE 4PJIE 2BCKB 3BQUD 3HAEA 5I17A 1PX3A 3VW3L 3OPZH 4MQSB 5HGHA 1NGXA 1XF5B 5K9OB 5DHYA 5T1MA 3TBTA 5GGVL 3WFCL 3WLWC 2PXYA 2NTSP 3MXWH 3U1SL 3IRZA 3U0PA 4F8TA 3BKYH 5EORH 1S7TB 3HC3H 4Y4HB 3X3FH 1FYTE 2B1HL 3HKFA 3PHSA 4NKDB 2E6JA 1GGIH 3BH9A 5E6IC 3KYOA 4QOKD 3RWCA 1LK3H 3PHOB 4M93C 2X1OA 2ESVD 2UZXB 3LD8C 3O8XC 5AD0A 3EGSA 2JF1A 4GRLD 4C55A 5BXFA 2V2XB 5EU4B 1CU4L 4FZ8L 3D87B 2VLLA 3G5VB 3QDMD 3G5YA 4LQFL 3NAAH 4O2CB 1KXVC 1HINL 5I1HL 2GTZA 5E4EB 1ONQB 5IG7A 3TO4C 1FIGL 5D6CA 4URTB 1EEYA 1AJ7H 4NNYB 4GAJH 4HS8H 3JBG7 4LPVA 3OHXA 4NN6B 2ZSWB 2HN7B 4L4VB 4PJIB 2W59A 1LNUA 3FZUC 1G84A 1DBAH 1NMAL 4OSUL 2CDGA 3C5SA 4ZNEA 4D9QD 1FNAA 4HCRH 1FORL 4JVUA 3MLVL 4XX1G 2D7OA 1FYTB 4LEOB 4Y5YA 3RZWA 1N8ZB 5D5ME 4EDWL 1CTOA 4PBXA 1LK2A 5D2LF 3PL6A 3VFOB 4JO2H 4LLMB 4RNRB 5FHBH 3TVMB 4ZUWB 1B88A 3TZVD 3WFBH 4XXDA 5F97E 2P24B 2X70A 4RWYH 1Q1JH 2AV1B 3S37X 1YEKH 1J9CT 3CGTA 3LH2H 4BQCA 3UYRL 4BZ1L 4IOSD 3N9GH 5DYOB 4KJPC 1KPUA 3TO2B 1CFBA 2P5WA 5IWLC 1EMTL 3ROLB 4M7JL 5H37H 1CDUA 3X17A 1HHKA 3RX8A 4MA1B 5F89A 1U93A 3OJDB 2YMXH 5EH1A 1F8TL 1AO7E 4Y4FD 4RRPA 2IPUG 3MLUL 5JIHA 5C09A 2MOVA 2DQUL 1MCLA 4LLYA 5D7LD 1M4KA 2QL1A 1DUYA 4CNIA 5D5MB 2YN3A 5IVZB 1HHJB 5C0AE 2OMNA 3EKCA 4CU8A 3LB6C 1JGDB 1QBLL 3QG7L 5HHVH 4UTAL 5GGRB 1U8KB 1J10A 3OKNB 4QYOA 4LSSL 4JLRB 4Y8DC 1W0VA 5HHMD 2EKSA 2NY0B 1KGCE 1KCSL 3WFHB 3LMJH 3RPIB 5B8CB 4TULL 4E41A 1CXEA 5I8CA 3FQUB 1T04B 4YFEA 3QIBD 1MVUA 5L6YH 5ITFB 3MMEA 3QCUL 2WIIA 2QQKL 35C8L 4MXWH 1G0YR 2ATPA 4UV7L 3QFJE 4DK6A 3JV4A 3NMEA 4DVBB 4TSCL 1IEAA 3LN4B 4PD4K 1TNMA 5E2WH 1AO7B 5JPNA 4WEBH 1YNLH 3VXOA 1FAKT 1FNSH 1I1YA 3ET9F 3MGOB 1QZ1A 2XACC 1K5NA 3S4SA 4XB8A 5GJTL 3CFCH 4GAGL 4PRID 4XZUA 2X4RA 4PUBL 5C0AB 3SGEI 2NY2D 3ZHDA 5E94B 3EJYD 4APQC 4QT5A 3KPQA 4KI5D 2IPTL 3NZHL 3FQXA 5I9QB 4B7LA 3DVGB 3V6OE 4NC2B 3BIKA 2CO6B 4MJ5A 3ZDYF 1ZLUH 4HWUA 1QSZA 1GZPB 1UZ8B 3MV8A 4MCYA 3O3DB 3UBXB 5SWQA 1LDSA 2W9DH 1LEKA 3ARGA 1RVFH 4WW2F 5EZIL 2EDFA 3W0WA 1EH9A 4L3ED 3HE6B 5F7LB 3BIAX 5I1IH 1QPXA 4WHTB 1HNFA 1ZXQA 3QFJB 5CEYB 3CVHL 1CGTA 2Q8AH 3LQZB 1QEWB 1PGRB 1ORSB 3G6JA 5D93C 4G6KL 2D0FA 1S7QB 2X1XR 4LSVH 3ZDZF 4S1QL 3IU3B 3TIDA 5E7FA 1ZHBB 1C5DB 5LAXB 1IGTB 4F9PC 3TPKA 3L95B 2CRZA 3D9AL 2AJXL 2DMBA 2R23B 4DGVH 2NZ9D 3GMOB 4OLUH 1WJ3A 3IDIA 2R1YB 4JPWH 1LVEA 3GMMB 5F3HB 4R3SB 1HSAA 2AJVH 2C3XA 3JTSB 1F4AA 3HMXL 1H15A 3UAJD 4RISH 2Z8SA 3DRTA 3E6FA 3WEXA 2MSPA 2NW3B 4YIQA 2Q3AA 2VDPL 5EUOF 4ONHA 1WWAX 3KXFE 3MJ8A 4ZO9A 5FCUL 4G9FD 1MAML 2GIYA 1WEJH 1IGFH 4M02A 2CK0H 1U6AH 1MY5A 5FYKD 4G6JH 1IC7H 1D9KA 5J1AB 3L5HA 1OB1A 1RJYB 3N1GC 1G7HA 3GBNH 2YHGA 4A6YB 1EFXD 3WN5B 1S5IH 2AP2A 2ZUQC 3BGFB 3VFMB 3FT4B 4O9HL 5FV2A 3P9MB 5DVOA 4PY8I 5D72L 5IJKA 1AGFB 3W9EB 3PV6A 3DROB 4U1GC 1AQDB 1SJEB 3QDJE 4QRRE 3RDTD 4K8RL 2APWA 1IGML 4QTHA 3FQNB 3N85L 4DQOH 3O0RH 3G6DH 5DRNB 3QJHB 2JCCE 2X4TA 5F9JA 3ZKMD 5GGSY 4U1JA 1TVBA 3NBNA 2YPLD 3DRQA 4XPGL 2HH0H 1RUQH 3V5DA 3KXFB 1XZ0A 5MEPB 1JGUL 4TUJB 4JZJA 1BD2D 3ZZ1A 5C7XL 3U83A 4LHUD 5KSUB 3OKKB 4KZDL 2HVKA 1WQVT 4XWOC 3T04D 3VXUD 5ENWA 1K85A 5DI8B 5E00A 4BA8A 5D1QA 2RB8A 1YY8A 4NZDA 5KSAA 4KI5F 1YNTA 1LP9E 3A0OA 4PJAA 1KYOK 3VE0A 4DKFL 1ZVHA 1Q9OB 2BNQA 3C87A 3D2UB 4EVNB 3PWNB 4WO4D 3MYJA 3ARZA 3QUZC 4RIRB 2GSIA 5JMOC 1ZTXH 3HMWL 3QEQD 1AGBA 3ARSA 1Y0LA 2CUHA 5EPMB 4UAOC 3QDJB 2AK4D 1KJ2B 4LFHG 4QRRB 4R4BA 3ARQA 3GMNA 2D03H 4FXLA 2DKSA 3VWKA 2JCCB 4XP4L 1CT8A 1QRNA 2VXVH 5JQHC 1D5XA 3U36A 4XNQB 3Q5TA 4P23B 1URLA 5DD6B 1ETZB 2IFGA 5GS1C 3MLZL 2GYSA 4LGRB 3RBSA 2GJZA 5IMKA 4MDIA 4M62H 4H8WH 2NR6C 5FUZL 1SYSB 4Z18A 1CL7H 3BKCH 2Y07L 5JOPE 3SEPA 2A6IA 1VB9A 5CBAA 2QQLL 4RCAA 1JYNA 3MO1B 3QCVL 1LP9B 1CDYA 4FS0A 5KVEH 3IDGA 1S7WB 1BLNA 3V0WL 4Y2DB 1UGNA 4QWWD 3UTTA 2VTFA 4OQTL 5FYKU 5EOCH 5HD8D 3VFWA 4RBPK 1AGEA 2MPAH 1IKNA 1B0WA 4LVOC 4M6ML 4U1NA 3WIHH 4OZHE 5KOMC 2CLZB 4MQ7A 1A1MB 2HKHH 4GLRH 1JHKH 1JGLH 1QA9A 1X5XA 3DHJA 5TFSH 5MERB 1A5FH 4XNMA 5J3HD 1I9RL 1YEHH 3TNNA 4EQ2A 3W9DA 4BSWA 5HGGS 1XCQB 2VH5L 4N9GA 1IQDB 3K46A 3SKUD 4M6NL 1UH4A 5F7DB 3GJFK 1PDKA 2UWEA 4NCC2 4FFVC 4PV9B 4Y7MA 4XP1L 4JR9H 5HI3D 4PP1C 4FA8A 3U7YH 2UUDH 3VFSB 4JFHD 4W6XB 3LS5L 2J6EL 4G42B 1KENL 1UJ3C 2EDXA 1I8KA 2CO7B 2Q6WB 3S36L 2V6HA 4AY0A 1YEFL 4PJEF 3K2UH 1LD9A 4GMSL 3Q6FA 4HH8A 3MOAH 1G6RH 3BSZL 4R4ND 25C8H 4NKMB 4PJBF 3U4BH 3WIIL 1N6UA 2VXUL 4KROD 5LCVL 4JGJA 2X89D 3KPPA 3OZ9H 4RFEA 1I85C 4EKXA 4OZHB 4WFGD 3U4EB 4JFQA 3EJZD 4HKJA 1MIEL 1XGRB 4LSTH 1BWMA 1KBGL 1HI6B 1LO0H 4D0DB 5E0QA 1DZBA 2LTQB 1G0XA 1ZAGA 3IU4H 3V52L 2FWOA 4XNXL 3SBWA 5FECA 4UZGA 3ZLQC 1FO0A 2MHAA 1Y6MR 3JWDL 5JA8B 5INCB 3MBEC 2VSDA 5IMLA 3O6ML 1T7WA 5DD0H 2F5BH 4JN2B 5DR5H 5DJ6B 4O2EB 3U0TA 2MKLC 3TPUA 3LPFA 1ORQA 5C0CA 2IPUK 3VI4F 3V79C 1KLGB 4Z95L 1U8NA 4HWEH 2D7NA 1N5AA 3BGMA 4NN7C 5AZEL 3QRFM 2EDRA 5GRXG 1FCGA 4FG6C 5I74B 4MLIA 1FL3B 3B8SA 2BOBA 3VWJA 3VXMA 2YEZA 1AD9B 5EO1A 2R1XA 5E6ID 3T2QA 4GMTH 5AZ2H 3PGDB 3WNOA 2JJUA 4LRNH 3O8XD 5C6WH 3NH7L 5HYJE 1QLFB 1ZS8B 3WD5H 4QF1B 4JKKA 2DYPA 4P9HH 5IK3A 4X6FB 5D2LA 2NY7H 1YYLH 1Z5LA 4L8BA 5FM5M 3LQAL 4X5XB 2Z35B 5DHVB 4P57B 3SGDH 1MELA 2CUMA 3GEWB 3V8CA 5E6YA 1VFOA 5I0DA 5KSVB 2OTUB 4XCFH 5I75B 5T5NG 2DLFL 4JQVA 1NC2D 4M61B 4N1CA 1T6VN 1AKJB 2ZNXA 4D3CH 1NPUA 2EDLA 3MRBB 3T3ME 2VQ1A 1G9MH 4WWKB 4XP9L 2IANE 3S5LG 1HDMB 3Q6GL 2ZUTA 4WFFE 3RNKB 3GIVB 1RZFL 4M9PA 3GKZA 4IDJL 1S9YB 1RHHA 1XGQB 4QHNA 4HKXB 1QVOA 2F54E 1T5WA 5DHYB 5JHDD 1WCBB 5FDYA 1GAFL 4NQEA 2AJUL 1JL8A 1MF2L 4WDIA 1U2CA 1R5VA 5HYJB 1NUGA 3WNKA 5F9WB 4Y89A 1D6VH 3BKML 1QBAA 1ZT4A 4JKPH 3KYNB 4NRYB 5F9DC 4UDUB 3TBYA 3ARWA 3OKDB 3I9GL 2VDNH 3EYFB 1M05A 4Y5XB 4S1RH 1R3IH 2LQRA 2ADIB 5CKGA 4KJPD 3FJTA 3BT2H 3BQUA 5LGKA 1XGTA 3GRWA 4XXCA 1AC0A 1R3KA 3MROB 4FZEL 4EEEA 4IBLT 1CDCA 1KV3A 4HGMA 4NYLB 2OZ4L 2E7LA 4UT6H 3LIZL 5IG7B 2OTWA 5I1KH 1S8DB 4JFED 3RJDA 2IANB 3S35H 4UU9A 5DJ0B 2B2XH 4QOKA 5I8EB 1NL0L 1CFQA 1G7PA 2ESVA 1OGTB 2C5DC 1U3HB 3BMVA 1LDPH 3WL9A 1JJUA 2R4SH 4GRLA 4OGAC 1SEQH 5GRWA 4BFIB 4MD0A 5FYJL 5TGBA 4J8RB 4WI5A 1AQKL 1HEZB 3QDMA 3QXDB 5TPWH 4TRPH 2WUCH 3O41A 2A6DB 1F3JA 4K3DH 1TMCB 1GGCL 3CCHA 4KQ4H 4M6OH 3DUUA 3NACH 5D7SH 3S3PA 4K7FB 1SMOA 1VA9A 3L6FB 1AIFB 2AJZA 3SGEH 1A6AB 4XXDB 5CWSA 5D2NE 3VFGL 4LSQL 4WJ5A 4ZDHA 5JHLH 2MCG1 2NY5L 3MLWL 2EIEA 3D39D 4WW2A 2IAMC 2EYRB 1S9WA 4WTWA 4Z8FL 4I48A 4PIRF 1DEEA 3P30L 3UC0L 2IPKA 1CLZH 2WINA 5JW5B 2CDEA 2R1WA 3IKKA 5E8NA 2J4WH 5JW4Q 4N0YH 3TZVA 2DTML 1FVCB 3GFUA 5F89B 1RMFL 3IRPX 3W39A 4X4XA 5DUPL 3Q48A 1FL5B 5IW1B 5JW4M 5IP4A 4OLVL 4APQD 4HDIB 2HLAB 3PJSA 4HPOH 4LBEA 1NBYA 1WZ1L 4JG0H 5ID1A 1DUYB 1UACH 2ED9A 5HI5C 2DDQL 3BP7B 1EHXA 1T1ZA 4L5FH 2Y36L 4GRMB 1U8IB 3DTXA 3T2PA 1CFNA 5DJAB 1EVUA 3NTCL 5C6TL 3BISA 5D2NB 4HBCH 4UV4L 4PG2A 1RUAL 1JZ8A 5EUOA 2CR3A 3N06B 1EA9C 1BM3H 4Y4FA 3D5OF 4ODWA 4PR5A 2H1PH 1KB5B 3QEUA 2QSVA 5L8LB 2O5XH 2XZAH 5D7LA 2APFA 1ZEAH 1S5HA 3CMOH 3KLAA 1AD0A 1HCFX 4C54A 3QR2A 3MV9E 3WXVH 1OAYH 1N3NB 5CZVL 1KC5H 1E4XL 4JPKL 2Z92B 4P2OB 4PJCF 1NEZA 4A2MA 4OZFB 1NBZB 3RWJA 1G9NC 2L7JA 3EO9L 2CGRL 5KZCB 3WFZA 4G6AC 3E2HC 1LO2H 1BAFH 2O61A 1DJSA 1XGUB 3I6KB 4TSAL 5CP3A 1K5NB 1XGPA 2BVOB 3FB5A 4QRQB 1BIHA 2W07A 4MD4B 5F9AC 1EAPB 4ETQB 4XPFH 3GSWA 4K8RC 3QIBA 3GHBH 3VW3H 4PJ9B 5TE4L 3UPAA 4IM8A 5GGVH 1BFVH 1S9VA 4X6EA 4UB0L 1KXQE 2DQTL 2V5RA 4Z78B 3NFPA 4DGIL 2ZJSL 2B1HH 3ESVF 4I0PD 4JDZA 4H1LG 3SO3C 2C3VA 3QIWB 5FM5O 1OTUC 4EJ1C 2H3NA 5H37G 2G5BA 1I1AB 4PRIA 4FZ8H 3QA3B 5ITBL 4H26B 3MV9B 4NUGL 2E9IA 5ESAA 1MHPL 5T3XD 4QNPF 2Y1VA 4LQFH 2EE6A 1HINH 4HD9A 1UB5B 2Z8WC 1JHLH 4MJ4A 1TZIB 2AQ2A 4N0CC 3T09A 1FIGH 4R2GC 3TF7C 5EC2A 4Z7QE 4G8GD 3CDCA 4X7CC 4U6XB 3VXSD 5FF6A 5A2LH 2VL5A 1V3MA 2V5TA 4Y5VC 5FGBC 2NX5D 1FH5L 3AS0A 3VFVB 1ZHKB 1J5OL 1NMAH 4L3EA 4MXVE 3BFOA 2DQIL 1YMHA 2WLYA 3QJFA 5BZWB 3SKJL 1FORH 5CSZA 3BZ4A 3T1FA 3MLVH 1OSZB 1E4KA 2ATKA 1KTDA 1EERB 1V3JA 4LAQL 4XWOD 1GH7A 3J8F7 3O2DH 1A7RL 4ZG1A 5B39B 3T8XB 3H9SD 2LAGB 4LSRL 3DGGB 3QNXA 4P2RE 3C6LB 1BP3B 4UNTA 4I18B 5SV4A 2J8HA 2LV4A 4J3XA 5JDSA 4YHKL 1WBXA 1PLGH 3WHXB 2EDJA 1P4IL 2H26B 2FX8L 4OZGF 2EE3A 4PRNA 4DK3A 4BZ1H 4TUOA 5F3BB 5ECJE 1BJ8A 1WZMA 5MI0C 1EMTH 2PETA 4PY7A 4G8FB 2MQ3A 4M7JH 3X13A 5EIVA 4G9FA 2IQ9L 3ZE2F 3LPWA 1DBKL 2RHEA 3IDUA 1F8TH 1G0DA 4FXKA 3E8UL 3E3QE 4WI6A 4M7ZC 4NQCD 2YBRB 4WCYL 1OAUL 1R24B 3DJ9A 3GI8H 1QQDB 1R5WA 2CK2A 3K8LA 1UVQB 4XAWL 4HK3N 3SPVB 2NR6D 1EFXA 1OM3L 4XRCB 1T5XB 3QT2A 1WT5C 1E28A 3O3AA 4MA8H 1XZ0B 5E8EB 3BE1L 1MCWM 1QBLH 3QG7H 3FFCE 4UTAH 5DJ8B 5SV3A 4G8EB 3QEHB 4P2RB 3BAEL 5FGCE 4F3FA 3LKSB 4X7SH 2XI9A 1VHPA 4PJEA 5CCKL 4C56E 3NIFF 4L9LC 5ENWB 4CVXB 3V7AG 1X5JA 3RDTA 4TULH 1IEHA 2NNAB 2X5PA 4L8CA 4JGMA 3UO1L 3CZFB 4PJBA 1OAXL 3K81A 43CAB 3FT3B 1ERNA 4MNQE 3VD7A 3IDNB 3QCUH 4QRPD 5E95B 3R06A 3WCYA 1BFOA 1PQZA 2YPLA 3JV6A 4BH8B 4HUVB 2GJJA 3T3PF 4JJ5B 1HILB 2GT9A 2FECL 1BD2A 4TQEH 4YX2L 5HDLA 2HG5A 2OL3A 1KJ2L 1I75A 2FSEA 3PWJA 4LHUA 3ULSA 1MRDL 5IMOB 5JXEC 1S7UB 5EU3B 4X5LA 4FFVD 3VXUA 4PP1D 2XNAA 4UT7H 5K9QG 1MCIA 1IGIH 3ULVL 3QNZB 4LFHD 1FGVL 2FB4L 3QQ4A 3VJ6B 2A9ML 3B8YA 4PUBH 4MNGE 3SJVD 3R0NA 4K9EC 5FO8A 4U1SA 3RGHA 1CDIA 2BOCB 2R69H 1DN0B 1JI2A 1T21B 2OJZL 3FFCB 4WO4A 5J8OA 5FGCB 2Y5TA 3OXSB 3EBAA 3OR6B 2D3VA 3QEQA 3FO9B 3B3IB 5EIQA 3TBSA 4C56B 5HDQL 3MRLA 2AK4A 1MHEA 3IXAB 5JIIA 1KIPA 4OFYD 1EJOH 4UT9L 5I30L 3K3QA 2AQ3A 2WWKT 2FJGA 4LMQE 4MNQB 4HIJA 4YHIB 5FV1L 5J0BA 4OQ1A 4P59L 5KVGL 5A2JH 3RAJL 3FAXA 4HHAA 1YNKL 3QUYB 1IM9D 4G6KH 3TN0D 1A2YB 4S1QH 4B53A 2EYTA 4IIQC 4W4OC 4I5BB 1IKFL 1CVRA 2DM7A 1MIMH 4M5YH 4PJGF 2NXYC 4XP5L 2AJXH 32C2B 4LLUA 1W8OA 4XPHL 5EU7E 3L5JA 4ZOCA 4MNGB 3WIFB 1L4IA 2DQFB 1JZ5A 2G2RB 4IMKA 4WUUD 1U8JA 1F45A 5FKPA 1AXSB 3JTTB 1DVFC 3RTQB 3BUYA 3QZWA 1F3DH 5D1XB 2BVUA 1I7TA 4YBQC 1UH2A 1X4ZA 5K9JH 3MUGB 4X98A 1I7UB 2ENSA 5IW3A 4PG9B 3M1BA 1G7IA 4QRSB 1S7XB 3O4OB 5FCUH 3UMTA 2HJFB 2OP4L 5INDA 2G9HA 4KPHL 5CLWA 1CD1A 3VA6A 3HE7B 4G3YL 4DKEL 2EDDA 4RMQA 4LIQE 1IBGL 3LPGA 3R1GH 4Y4HC 3LKNB 3REWA 1MCKA 3QXAB 1Z0NA 5T1DL 3PIQA 4UNVA 4L8DB 2IJ0C 4FQHB 3KJ4B 1U36A 3FN0L 4S10A 5FCSH 3TWCL 5DMJB 1X4YA 3KPOA 1RIUH 2EEDA 1FVDA 4O9HH 2DLGA 4ZPTA 2QHRL 1JMZA 4PLKC 4AEIL 3I2CL 3RY5A 4D0CB 5HDBE 4YJZL 3U7WH 4IJ3B 2EICA 1GSMA 3OKOB 5DWUL 3IVKB 3N85H 4JFOA 5BZDB 4NDMA 2PO6B 2X89A 1I1CA 3S98A 3CZJA 4H25B 4NN6C 4S2SA 5FYLE 4AL8H 2AS5M 1FCCA 4WW1A 4XPGH 2OK0L 2G60H 2DWEB 2GK2A 2VLRE 2YD6A 1CLYH 1KXTB 4HMDA 5A3IC 4ORGB 5D71H 2HWZL 2R0WH 4Q2ZB 1UWGL 2VN7A 2YEZB 3CLEL 5F70A 4YR6A 4WI7A 1OQXA 3KPLA 3PQYE 1CVSC 5KJRL 2OR8A 4OLZL 5JOEA 1MH5A 1JZ4A 3FMGH 3SKNB 4KK5C 2VDML 3G04A 2PTUA 3IS1X 2CJUH 3PP4H 5F7KC 1C5BL 1FP5A 2CR6A 2NXZB 3LV3B 5BV7B 2DYPB 5DRXB 4UIKL 3I85A 3MUJA 4KY1L 1J8HD 2MQ0A 2R4RH 3RKPA 2BSTB 4LP4A 4HLJA 3U46B 4WFEE 2I24N 3OWEA 4DUVA 1BFTA 4Y1AE 3ZKNC 4I2XE 3K4AA 5E6IA 1HIML 2CQVA 3B9KC 3ARTA 1CLCA 4XP4H 5IB1B 1M7IA 4GSDL 3O8XA 4XCCL 5JMRA 4LKXB 4OGAD 3OV6A 3OBAA 1OWRM 1YJDC 2XKNB 2VLRB 1TQBB 5C92A 3MJ9A 3TT1L 1LEIA 1RZJC 3ULUE 2KKQA 2XPGA 4H8WC 2ZOLB 3PQYB 5FUZH 3IT8D 4OLXL 4JHBA 2ADGB 2Y07H 2FJFA 4HBQA 1WIUA 2QQLH 4OCSH 3QCVH 1NC2A 1R5VB 1MFNA 3ARVA 1PEWA 4PD4J 3V0WH 5F1NB 5GRUL 4OQTH 4JKLA 2NY0C 1Y6NR 3TBYB 4M6MH 2EIBA 1NGQH 1MAJA 1M7XA 4IS6B 4MSWA 1NAMB 3B6SB 4Y1AB 4LCIH 1S7SB 3AAZB 1QBML 4XVUC 2YD8A 4MQXC 5JHDA 3PGFH 1OY3B 3GGWB 4M1DL 4YBLB 1BPVA 1FZOA 3HFML 3TCLB 4OLWL 3JUYA 4YDVA 1VGKA 2IC2A 1U8OB 4XP1H 1FFQA 1WICA 3LS4H 2YD4A 4NNPL 3RL1A 4JY4B 4QOKB 3LS5H 2J6EH 4PJCA 2NY3D 3DHMA 2LVEA 3S36H 9CGTA 5HI5D 2Z31C 1I1FA 3FCTB 1P7HL 2E7CA 4MB5A 1NGPL 4IHOA 1YA5A 4NZRL 4GMSH 1G7QA 2WUBL 4WHCA 3GJEB 3OGCA 3DIFB 4XC3L 2P46B 3BSZH 5GGSB 4GW1B 4U1LB 4RA0C 4CVZA 4C57C 3T4YB 3BZFB 3WIIH 4OF7A 5I9QC 4JFEA 2VXUH 5CHNA 4K55A 4RGMB 5LCVH 1DLHA 4NZUL 1EXUA 4X6BA 5CIPB 3HC4L 1OAQL 4PJ7E 1MIEH 3LKRB 1WWCA 3UYPA 1KBGH 3GKWL 2N7AA 5DUBB 3MRJA 3TLRA 2VAAA 3GJFA 3HE6C 1TZHB 3V52H 4J3SA 1A47A 5DLML 3U6RB 1NGWB 2ZPKL 5GSVA 1XIWB 4C59B 3JWDH 3VCLA 2YWZA 5SWSE 1G7MA 3PDOA 3VFNB 3MV7D 3O6MH 2QTEA 3MXVL 3LDBB 1EPFA 4G6AD 2H32A 1KT2A 4P2YA 4ETYA 5IW6A 4KVCL 4Z95H 4OCMC 4GAFB 4K8RD 4WTZG 1KIQB 4KGLA 2RQ8A 4JQIH 2YXFA 2FO1A 5JW4N 3D39A 1MNUL 4H5SA 5ESVA 3CSGA 2PCPB 2KQNA 2A6KB 2E6QA 3BXNB 3V6OC 3QUMA 4F15B 1U92B 5FO7B 4K7PL 2R2EA 4PJ7B 5T5NF 2APXA 3DTXB 3BOVA 4XBPB 3KGRA 2LU7A 1VPOL 1OTUD 3RHWK 2NCMA 4YO0B 3D18A 4M8QB 5JPMB 4JM2C 1BHGA 1NGZA 3O6FC 4P9HC 3ARPA 1KB5L 3NFNB 4UBDC 4EBQL 5FHAL 4APQA 3LQAH 4KMLB 3VRJB 3GSNA 5H35B 1HXYA 2YD5A 4PGDA 3B9AA 3P4MB 4N0CD 4XBGB 2MCPL 3RVWC 1ZSDB 3MJ7A 4JRXE 5SWSB 4R2GD 1NCAL 3KLAB 2P5ED 1MLCB 1KSRA 1JRHI 4OZGA 4LPWA 1Y18B 3BGFC 3CUPB 5DMYA 4DKDC 3DYMA 3DNKA 1CK0H 4HIIB 4QO1A 4XMLH 2G75A 1ZWIA 3MRDB 2QADC 5C0BD 1K8DB 1U8HA 3VGFA 3Q6GH 1TJHL 1DSFL 4LSUH 5J13B 4XBEH 4IDJH 1CE1H 1FFRA 4H20L 3T4AA 1PKOA 4LLVA 5ILTH 3LEXB 2I9TA 2VISA 3UTQB 5GS2D 1KYOJ 1CQKA 2HJKA 3DO3A 4KHXL 1SM3L 3OX8B 1DQJA 4HUXB 2DQCL 3AXLB 2C1OA 1RK1B 4XVTL 4I0CC 2EIZB 2B0SL 3JV0A 1AGDA 2VR5A 4Z9KB 2PTTA 2HFGL 3DO7A 4JRXB 1FIEA 1X6NA 3LRHA 5F93C 1IM3A 1OLZA 5CJ8A 5IQ9B 4JG1L 5K9KB 4FZEH 5J9PA 2L4OA 4AEHH 2DQHL 4TVPL 5DSCA 2J8UF 1P7QD 1FL6A 3GUTB 1BOGA 1LO3L 1D5MB 4DN4L 2XV6B 3EW3B 5JUEH 4QHKI 2AKRA 3H3KA 1ZA3A 4I0PA 3CVIL 5FF6B 5KOVC 2IALB 5I19L 1NL0H 4FP8L 3FOLA 1Q9LA 2UZIH 2X4PA 2C3HA 3H7BA 2BNRD 2X10A 2QQQA 3FT2B 3BEVA 5FYJH 3AUVA 2NTFA 1AQKH 4FXGA 1A9BB 4GBXB 5HY9B 1JK8A 4J3VA 4RGOL 3AS1A 3BH8A 1C1EL 3NIDF 4JY5L 4ODXA 1GGCH 4U1KB 5KS9F 3D69A 4UQ3B 4YDJA 4AMKL 4G8GA 4ELKB 3HUJE 3VXSA 3KLSA 1W72B 4KJYA 3UROR 2NX5A 1U91A 2BSSA 3VFGH 4MJ2A 5IFJB 1ZHNA 3BDYL 3P0GB 5EU6E 1WAAE 2ARWA 2HKFL 2XYCA 4Y16C 1FC2D 3KHQA 1EBAA 4NO2A 3BHBB 5MHSE 5HYSG 4PRNB 4PV8B 4Z76B 5SWZE 2VKWA 1ED3A 1D5BB 5JXED 4TVSa 4O51B 3AU1B 2GK0A 3P30H 3UC0H 3UTSD 2Y7QA 3F7QA 5F88A 1Y6KR 3WUZA 1ZLWK 3F12A 2VITA 3H9SA 4Q9CA 3MRGA 3QI9C 2DTMH 3F62A 1RMFH 5L8KB 2VL4A 5EO9B 4KV5F 2GITB 5DUPH 1HWGB 1ACYL 4Z7WF 3D25A 4PJGA 4JRWA 2BXZA 3C9NA 3S34L 2C9AA 1WZ1H 5T1LB 3ILPA 3QIUB 4GKOA 4AG4L 3OAZH 4X80L 1LE9B 2PYED 3U48A 4YK4C 1ZT7B 5I76A 3SKMB 2AJ3A 3HUJB 2Y36H 1ZGLA 4X6CF 1P5VA 1MUJB 3NTCH 5C6TH 2DMCA 3HI5H 4UV4H 5DC0A 2X4QB 1RUAH 5EU6B 5JDJA 43C9B 4LLDA 2X9XA 3EDDA 3VD5A 4HC1L 4I4WA 4Y4KB 4HQQH 2KBGA 3O3BB 5GS1A 4NQCA 1RZKC 5SWZB 3OKMB 1R5IA 3T08A 3RWGB 1Z3GH 5B22A 3O2WL 1INQB 3RKDC 2F19H 5EZOL 4L8SB 5DJCB 2ITCA 2K9UA 5I16A 2UUDK 4OFVA 4RAHA 5DZLA 3RNQB 1AR1C 3KDMB 4LEXH 1RZ8B 5CEZH 5ISZD 3EO9H 2CGRH 3MRPA 3VMNA 1DFBH 1XH3B 3U9UB 1DVFD 4TSAH 4KZEL 1CFTB 4YBQD 2A74A 2AI0H 5FKAB 3DV6A 5L2KD 2D9QB 2W65B 5KW9L 5I1DA 5TE4H 1WITA 1Q94A 4JHAH 4KK9D 5E5MA 1P4BL 3IF1B 5I1GH 4QRPA 3T77B 3P4NB 1AHWC 4UB0H 4MS8C 2DQTH 1I7RA 4DGIH 2BVQA 2ZJSH 4EI6B 3S37L 5IMMB 4JKMA 4KUCD 4F7EA 1CE6B 4Y4HD 4ODTL 4D0BB 5HI4C 1WIOA 3CFDB 1BIIB 5TDNB 2JB6B 3Q3GB 3KWWA 1UB6B 5JW3H 4KGJA 1UJ3A 3TA3B 3ZE1E 4NUGH 4PTTA 2EDEA 1MHPH 4X7TA 5KAQF 4J6RH 3SJVA 3EDFA 3FTGB 3NIGE 3MC0A 4B41A 3U0WH 4PLKD 3AS2A 4PBVC 4I3SL 1XCTA 1R3HB 4NFDA 4AH2A 4NBZB 1TTGA 2DKMA 3CH1B 1FH5H 3N1FC 4OFYA 1I85A 5GGTL 4L4VD 1G7JB 5I75C 2IEPA 4PREA 2IG2L 2VDLL 5JZ7C 3SKJH 5A3ID 3QZWB 5E9DE 4LGPB 3VGHA 3TT3L 1VKXB 4LAQH 4GRWH 3TIEB 3G5XB 1IM9A 3TN0A 2IADB 1A7QL 1FYTD 1F4YL 1MCPL 1N26A 1UXWB 5JORB 2K3TA 4KK5D 1JF6A 2B8OT 2B1AH 1I9JL 1KACB 3TVMD 3IJHA 4PGZA 1VACA 2Z4QA 3H0TA 2FEEI 3QO0B 1P4IH 3KHOA 2FX8H 4WUUA 5F9WC 1P4LB 4K71C 5IOPB 1KIRA 5IFAH 3OKEB 1D5ZA 3FB8B 5D7IE 4S11A 4RFNB 4U6VH 5FA4A 1UM5H 3FHQA 1CXHA 4PGCA 3SKOB 3ZKND 3VXTA 5I18H 5I71C 3EYUL 4ZQKA 3ARFC 3DX6B 1J05A 2JKXA 3X14A 4BUGA 3EOAA 1DBKH 1WC7A 4EUPB 1MFEL 3E8UH 2ORBL 4EDXA 2HFFA 4S1SH 4WCYH 3KNBA 1OAUH 3IDYC 5E9DB 3H3PH 4GOSA 1OARH 1S7VB 3BVNB 4TTDC 3P73B 1QR1A 2VABB 3G6AB 4YHML 5FO9B 3WUWG 4KTYA 4DGYL 3OXRB 1QKZL 2UY7A 5TDOA 3BAEH 4HJ0C 4WVRA 5F8RC 3GSUA 4YR6B 3VFTA 3N50A 1JP5A 4OD1L 5GRVK 2V2WA 3GO1H 2ITDB 4TNVK 5J1SC 2NY0D 3QQ3A 4P46B 3NVQA 3UO1H 3ZL4L 2FEDC 4DVRL 1OAXH 4MD5A 4K94L 5D7IB 4F33A 5IESL 3X11B 2EYSB 3BWAA 1KN4L 3H42L 2EC9T 2DL9A 4WEMB 2A9NL 5GIRB 2VR9A 4KUCF 4XVUD 3BRDA 2A6JB 3SCMC 5EUKB 4DEPC 4OZFG 5JR1L 3BMWA 2NZIA 5KVDL 3RU8L 1U3YA 1V7MH 1AO7D 3WLBB 2DN7A 4JE4B 3C60C 5FYLL 4ISVB 4JFPA 3B9EA 5B4MC 3ULVH 1FGVH 3LD8B 2A9MH 4QXUL 5DK2B 3T2NL 4JZNB 4RMRA 1J87A 1JZ3A 1OP5H 2OJZH 1KEGH 5C0AD 1E27A 5ETUA 2EECA 4Z0BH 1J8HA 5C6PB 4D2NA 5HDQH 3TO4B 4D8PA 4WNQA 5A16A 4PJIF 1FJ1B 1KGCD 4UT9H 4LF3A 5D9SB 5I30H 1VSCA 4N5UA 3MCLL 5JLZA 1UH3A 3L7FA 3DX9B 1ZE3C 4XC1H 3CSYB 1N4XL 5B38B 4DCQB 1Q0XL 1UJTA 1HZHH 2CDFB 2H9GB 3HE6D 4ZOAA 3ZKQD 4XT1C 2ZSVA 4ZUTA 3RAJH 1T0NB 1YNKH 4FN0A 3WO4B 5E1HB 3IXTB 3QFJD 4HUUA 1R3JB 3F7YB 1WIPA 2OM5A 2ZG3A 2QQNL 1Q0YL 4KDTC 2VDKH 2DQJH 4PTUA 2XWTB 1OGAE 4XP5H 1DQTA 4L3AA 4PBWD 3MRIA 4JB9H 1YEIH 3LEYL 4P2OC 4HT1L 2E7BA 1NBVH 1HKFA 5LGJA 3MRKA 5T1KB 5ICZB 3ULUL 1S7RB 1JBJA 4X8JB 2QJDA 3RL1B 4WIQA 2VUYA 4XX1E 3D3VD 4U33A 1EV2E 4ENEC 5FXCH 4X0KA 1A6ZA 1N64L 3MV01 5GGUB 1T1YA 4FQQB 3CVHA 4HX1A 1IFHL 4IHOB 1UQSB 2X7LB 2EZ0D 2WIMA 4PJ9C 3TESA 1OCWL 3FB6A 4O02L 4WUKH 2DWDA 1MHHB 3FONA 3DSFL 1BQHA 1CGUA 3IDJB 4G3YH 4DKEH 2D7TL 5ERWB 4X6DE 1MJ8L 1VEPA 1XEDA 3EFDL 5T1DH 4UBDD 3FO1A 4OAWB 4GAYA 3RVWD 2YC1B 1OOAA 5D5MF 5I1LA 5IB4B 3FN0H 4R90L 3QIWC 3W81A 4HV8B 4NJ9H 5IR1A 5FUCC 2IH3A 1OGAB 4BH7A 1I1AC 1Q9WB 2QHRH 3F7VA 4AEIH 3HMXA 1T1WA 4DZ8B 2YUWA 4E42A 1QBBA 4NIKB 5CLTA 3VCLB 1OL0A 4YEFA 4PJ5E 5DWUH 2J8UA 1A4KA 3C2AL 1H3XA 5CEXB 3RQ3A 3UJJL 3MA7B 3HI1B 4D9LL 3N1QC 3BP6A 4KRLB 2DIBA 3PXHA 1YECH 3MUHL 4P3CL 1PJ9A 2IBBA 1OAZH 5CP7B 4QRTA 2XN9E 1KCRL 4HGWA 4O4YH 4RAVA 5IBUG 5C86A 1MWAB 3KXFD 4HMEA 1W0YT 2BX5A 1NC4B 3D0LA 3FQRA 4X6DB 3REVA 5LKNA 1SVZA 3MV7A 2H2SC 3P3YA 4OFIA 3QH3B 4F2MA 2R2EB 5DMGD 2VDMH 2CKBA 5KS9A 1ZLSH 1MCCA 1RZ7H 3FOMA 4YNYA 1IGYA 4MCZB 2ICWJ 4RX4D 2MNUA 1MCSA 4NQVB 4UIKH 2E6PA 1IC4L 2FIKB 3O4LE 3RWFA 3D2UD 2QSTA 4HWBL 1XF3A 8FABA 3UCRA 5DQJB 3WS6C 4LPUA 4PJ5B 4NQTA 5LGHH 3BN9C 2SEBB 2DQDL 1YQVH 4YHNA 4W6YB 3MFFB 4M3JA 3QDJD 1BZ7A 4DTGL 4QRRD 5DK0A 4GSDH 4HF5L 5F1IA 2JJWA 4XCCH 3CFEA 4HH9A 4YHYC 4TSBL 2BC4B 3D0VA 4YC2C 3HR6A 1BX2A 2XN9B 1X5YA 3TT1H 2D31A 4P23D 1FNEB 3HAEH 3EYOA 4C83A 1ZHLA 5GS0H 4Z7WA 4OF6A 5D93B 5DJ2A 1YPZE 2W0LA 2A38A 1CN4A 5CD5C 1KTRL 1YY9C 2P5EA 3DOSA 4KRMB 3N1MC 4Y5VA 2ZUUA 5FGBA 4AT6B 4F8QA 3ECBB 2R8SL 4K23H 3P9LB 1W2KT 2HTLC 2HT4C 4P3DA 5E2VH 2AV7B 5FUOL 5GRUH 3O4LB 5C0IA 5C0BA 1BBDL 5F44A 1AGDB 1LWRA 5HHOD 3ZTJG 2O93L 4Y2DD 1A8JH 3O45B 5EA0L 5EBGA 1HSBB 2V7HB 3PWVA 4HJJL 2XWJB 3TBWA 4NGHL 3BZDA 4ZMAT 2YSSA 3WNNA 1QBMH 4QHUA 3L5WA 4GQ9H 5E8PA 5MEQA 1BGXH 3CLFL 2V2TA 1I8IB 4X9GA 2AEWA 3QI9D 3FB7A 1MJJA 2M1KA 1VFMA 3CC5B 1GGBL 5IVXE 5DJZA 1G7LB 4JANA 4N0UA 3VRIA 2WV3A 3VXRE 1KG0A 4ZYKA 3E3QC 2X4PB 5MEOB 1YPZB 1OPGH 3DECA 2ZUQB 3THML 1KJMB 4NZRH 1C08A 3IFOA 4CMMB 2WUBH 3F65A 1P7QA 4XC3H 4F58H 5JOPD 4O58H 4P2QE 2VXQH 1YN6A 1IQWL 2H8PB 3L3IA 3M17A 2ZNWA 4U1GB 1W72L 4JRYE 3IJSA 4L4TE 4EOWL 3ARDB 3UTZB 4L3CB 4YHPA 3HC4H 5EBWB 3VD9A 4GKNA 1SVCP 2IBZY 5BQ7B 3RKDD 2BNRA 1SBSH 1WT5A 3O9WB 5I1JL 5J6GB 3HS0B 4U0QB 3LN5B 5BJTB 3OQ3B 3NZ8A 4JN1L 1AR1D 2VZ1A 4KRPB 1ED3B 5IVXB 3PXJA 3UDWC 4ZAKC 1L6ZA 5EO0A 3WKNA 3QUYC 4L9LA 4WI2A 1GVIA 3VXRB 4X5WA 5E5UB 4KTEH 1RD6A 1NCCH 3LKOA 4TNVF 4WTXA 4YXHH 2R56L 5IEKB 3WDHA 1CFSA 5FYKL 2FZ3B 2DQEL 3QUKA 3WNLA 3QUZB 2OMBA 5D1ZB 3BP4A 4MS8D 1QD0A 4WU5A 1FG2B 1RV6X 5D1XC 1CD8A 2O5YH 1N6QH 1W8NA 5JXEA 3PHQA 4JRYB 4CUCA 4L4TB 1YC8A 1C12A 2JCCF 1F00I 4HFUL 4I77L 3ZYJA 3UTSA 4K7PH 5HI4D 4Q9RL 2NLJB 3GSRB 3PWUB 3WE6B 1VPOH 4ZTOH 2EH7L 3O4OC 5TDPB 2ICWI 1DE4B 4LCCA 3SDYL 3I02A 2JK5A 4GW5A 2VRAA 3I3BA 3I3DA 4I4WB 3HE7C 4RFOL 5FHAH 3MCKB 3VFRA 5DUML 4N8VG 1NCAH 3DI2B 3IGAB 1I4FB 4F57L 2A83B 5IJVB 4NZJA 1YEDA 2HJLA 2PYEA 1I3RB 5DJYB 2A1WL 4ZPVB 4HIEB 1JPFB 1LP9F 5FEBA 4QXTA 4E0RB 2OL3L 3C08L 4OJFH 3HA0A 1RQ5A 3PWLA 2RBLA 4OCRL