1N59B

Crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 16
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n59B00
3D39B 5F3BA 1BD2B 4OCRH 2HJLA 2R0ZL 5A2LH 4XPHL 4FQCL 3G6JA 3RJDA 2GUOA 4K9EL 1I75A 1MHCB 3KPSB 4KJPC 2PYFB 4YHIA 3QP3A 2FWOA 3FB6B 4HCRL 3B9KD 2ZWLT 3MRLB 2YWZA 3MV7E 1NGQL 3ARBC 4WU5B 3W11C 4L1HA 5DK0A 3MJ8A 3OR6A 1J87A 1A4KA 4G80A 3BP7A 1K4CB 1Q0XH 1FZMA 5HYSA 1WIUA 2OI9B 1Q9LB 3P0VL 2W9EL 3P30L 4JAMA 4YHML 3MA7B 4ZNCD 1WUNT 3MGOA 5LBSL 1Q0YL 4KKAC 1NANH 1ZHKA 1IGJA 3FOMA 3U0TA 1Y6NR 5F1IB 2PTVA 1F3JB 3TWCL 1Y0LA 4CMMA 1A9BA 1MLCA 5E8DH 1CICD 2VR5A 1UZ6E 4M1CC 2NTFA 4TOYH 3TBVA 2ICES 1Z9MA 3WXWL 2BVQB 2IFFL 4IS6B 1JWMA 5DD1L 4Y2DD 3UTPE 5H94B 1KCUH 2J5LC 3QQ4B 4PTTB 4UTAH 4YE4L 3FQRA 3VRIB 1CLCA 4NQSA 4R6UA 5JO5B 1M71A 4HJJL 2OBGA 3QEGH 5B3JF 2YPLA 1MCDA 4JB9L 5IMMA 4WNQA 3PWNB 5BZDB 5EO0B 1A7PH 2RAMA 1IBGL 1LK3L 3RP1A 5LWYH 5BOPA 3EDFA 4LHQB 3K1DA 1AKJA 3DO7B 3CDCA 3VMNA 3L5XH 3QG6A 4JVUA 3EO1A 5IB1A 1QA9B 1S7UB 2WBWB 1A6PA 5JR1L 3EGSB 1RULH 1VEOA 1ZT7B 2XWTB 4N5UA 4KRPB 1J05A 2VDOH 3SE8H 4G7VH 5E6ZA 1TTGA 3QWOA 3S3SA 2QADB 2VABA 2H2SC 3EYQC 3V4PH 3OZ9H 4P3DB 3DARA 2X1XR 3RFZC 5AYUL 1IC5L 5JW3H 1A7NL 4PJ9C 2MJWA 3BEWA 5ICZA 3P77A 1OHQA 3SDYH 3BDYL 1FHGA 1JNNL 4Y4HB 1T1YB 1YA5A 2ZSVB 3WLWD 4K3DL 4J12A 5EG6C 3CSYA 2KDGA 4DEPB 4Y5XC 2X4SA 4XPTH 2DQCL 4GBXA 4X6EA 3LEVH 4QXWA 5TPWL 2F5BL 4AY0A 2NY3D 3TC9A 1CE6A 1AIFA 3DHJA 2F58L 5IIEA 3NCFB 4HC1H 2QEJA 1I7TA 3FZUD 3MLYH 4LHUG 3KPTA 2A74B 4NYLB 3MBEC 1MRFL 3WNKA 1X5HA 5L2KD 3ISWA 4MD0B 4DOHE 4CU6A 3U9UA 4I0CC 3FO2B 5C09A 3AUVA 1FIGL 2Q76B 2ADJA 5I1CH 1OTTC 1MUJA 3VGEA 5MHSE 1FVCA 3DETC 3BPLB 1BFOB 1I3GL 4KHTL 1JK8B 1I85A 1EEYB 1QFWM 2FO4A 1FG2B 2AK4A 4W70A 2JKXA 4KGLA 5L88H 4BZ1L 5C08B 1F90H 1XZ0A 3QG7L 1RU9L 1N8ZB 2VXTH 4K3JL 4OQ1A 1QVOA 1UACH 3N50A 4P4KB 5ADOH 2Z31D 5HJ3B 1YEJL 3NN8A 4NCC2 4D2NA 4QRRD 5C07E 2JCCF 2V5SA 1M7IB 5IK3B 4WO4D 1DDHA 4DGIL 3TN0A 4MJ6B 3DBXB 2NXZC 5ILTH 2VDRH 1E4WL 2WBJB 3KPQB 3NFNA 2X70B 4JZJC 4U1JB 3T2QA 3VRJB 5F6HI 4KROC 4G8FB 5C08E 1YUHB 4X4XA 5DK2A 1RUMH 4YBQC 1LP9F 2PXYD 4JN1H 1UENA 2CRIA 2IMNA 5I8EB 3B2VL 3PQYA 2E6JA 1KT2A 2FH6A 1MCJA 1MCHA 2WQRA 3GMOA 2P24A 1RV6X 4C57C 1MF2H 4AIOA 1WQVT 5EZOH 5IWLC 4HUKB 5F1KC 2GAZA 4JFQA 4QRSB 3JTTB 1Q94B 5DRNA 1VFBB 5IK3A 4NN7C 3E6HB 4PJ9A 5T3XH 1C5DA 3SDXA 5D2LE 2IBZY 1A1NA 3H42H 2GIYA 1RPQA 1NGPL 3IDXL 4ZFZB 4LASL 3CSPA 3KPRA 3OPZH 4FXKA 3LV3B 1HNFA 2AK4B 1TCMA 2CIKB 1HHGA 5F1NB 3CZFB 5F7MC 5BV7L 2VLRA 12E8L 3MV9E 3DX9B 4N90D 3ARED 4KMTH 3CXDL 1QYGH 5EU7E 3LQZB 1UKTA 3LZFL 4O51A 4BK4A 5HYQB 5CZXC 5I6XC 3M1BB 4GAFB 2EE3A 3C2SA 2XN9A 5IQ9A 2HFTA 1BQHB 1E6OH 1A7QH 3HI5L 1P7QA 4CVZB 1NSNH 4PB9L 4FFZL 1L4IA 5TQ0L 2NTSP 5IIEB 4Y2DA 2AGJH 4X4MA 2DQJH 4O58L 1OAXL 3DVIA 4PJHE 1HXYB 1TQCC 2I5YL 1CXFA 2ESVE 3NVQA 3QIUB 2PR4H 4GW4B 3QI9B 5L0QC 3K81A 3DROA 5DHVH 5J06A 2C1PB 3QXWA 1CXKA 5AZ2H 2XG5A 2XRAL 1VHPA 1A1OA 4KK5D 3VXMA 1UM6H 5AUMA 1S7XA 1TJGL 3HC3H 1JNLH 2D9CA 4WI8A 2NY1C 3O11B 2ORBL 5IFAH 1S7SB 2X1WL 1DEEA 1X3DA 4ZPTA 5EO1A 1YNKL 3RX7A 3T4AB 4HBCL 1D5ZA 2AEQL 1P9MA 1UM5H 2NMSA 3KJ6H 2I07A 5GS2H 1S7UA 4HPYL 1U93B 2X9WA 3HA0A 5L7XL 2GJZB 3C6LA 2P5WA 4JREB 1MFAH 4L3EA 3SEPA 3VFNA 2Y6SD 5D7LA 1HHHB 3QDMA 1FVCB 4I2XA 5I8KL 4LIQL 1NQBA 5FDYA 4PJFA 1FVDB 4ELMB 4KI5C 1CD9B 2RJMA 3RWFA 2YN5A 5GGVH 2PO6B 3M1BA 1FPTH 2D7OA 5DJ8A 3WIIL 4PJ7A 4WY7H 2VUYA 4PLJC 5JO5A 1N2RB 1LP9E 4TVPE 5FKPB 1CFVL 4NQDD 2AVGA 2V5TA 4M9OA 1R0AH 4H20L 3RA7L 2ID5A 3FFDA 3GJFK 4M7ZC 3MRCB 2VZVA 3NMEA 5TFSH 2DBLH 1HI6B 3V6OA 5I1HH 2ORBH 2F54B 4M62H 1ND0B 4S2SB 5DD3L 1K9TA 4FZEH 3E6HA 3FT4B 1KLGA 4L8BA 3ZKXC 3ZTJG 2F15A 5DUBA 3MLXL 4JFQB 2F8XC 1ZHKB 2B1HH 3P9WB 5JUEL 4XNXL 5DEFB 1GC1H 3HAEA 5DVNA 3ARTA 4I9WE 3TBWA 2ED9A 2NY4B 4Z77A 4DZ8B 4RNRA 4K8RL 3OWEA 4YNYA 3VDAA 4XAKD 5BO1L 5JPNB 2HMID 5IVZB 1BQHG 3MRMB 5IROA 4NJAH 3T0DA 1MCIA 1A14L 3LEXB 4PJDB 3V5HB 5T1KB 3ILPA 3QUZD 4YHIB 2PYFA 1ZLWK 2JJUA 1PZUB 3G04A 3KPNA 4KI5D 1YN6B 5A16B 4RZCB 3RUGE 5DJXB 3SJVE 4E9LA 5FFLA 3DV6B 1DDHB 2EO9A 3TZVA 3QZWG 4OF3A 2HJLB 1BZ7A 1S3KL 5I1JH 1E6JH 4RA3A 3LPGA 3DGGB 4OIIL 3VD7A 2NY4C 1FNEA 3QUYA 1XGRA 4YQXH 1TZGH 1TMCB 4Y0GA 3UTSE 4YGAB 4KK9D 5C08A 5D7JA 1T83A 3ZKNC 2VISA 4LCCC 3VFOA 2JLLA 3QUYD 3MJGX 1BIIB 4NWTL 4ORGB 3GSXA 3BQUB 2EIZA 5C2BH 4OGYL 3U9UB 4P2QB 2NW3B 1OTSC 1KGCD 5GHWH 1MH5A 2QSTA 2HLFD 3N1QC 1G7IA 1SJXA 5JIHA 1OF2A 2DICA 2CDEA 2D9QB 3MJ8B 1T2XA 4PS4L 2IBGA 1GZQA 4X83A 4FQXC 3QCVL 3EDDA 5MEQB 2ATPB 4P0DA 1G6VK 5IFHL 4WFFD 4IJ3C 2BK8A 3DOSA 1CBVH 5J57B 4XNYH 2DLIA 2GY5A 4NC1E 4L8BB 5LQBL 3V9FA 5F6IB 3MJ9A 4QHMA 4MNGE 4PS4H 1WZKA 3LN9A 3T2NH 5B8CB 1MVUA 4LLQA 5GSRA 4QHKJ 5KSUB 4POZC 4XC3L 1A8JH 4Z7QE 1FN4B 3D87B 3MREB 2YPVL 5EULV 3MMEB 4LKCB 2D7NA 1BVLB 4O02H 5E5MB 4LLUB 1N2RA 4NP4L 2DWDA 3C2AH 4ZTOH 2F58H 4EQ2A 4XC3H 5FB8B 4I3GA 4MA1C 5IBUG 2J6EL 4HZLA 3VFWA 3RWFB 1MLBB 4RQQA 1ZLVH 4XWGL 3BGFC 3F6IA 5D6DA 1NDMA 5FO8A 5DJXA 3KS0J 4F7EA 1AE6H 1EHAA 5IVNA 2CQVA 1QR4A 3ZHDA 4Z7UA 4F9LC 2ZUYA 5C70A 4MJ2A 4UBDC 1KPRB 2Q6WA 1QFWH 5GRVK 5FCSH 2Z93B 4KKCD 2AJZB 4FTVA 1CFQA 4MAYC 5LCVL 3RGVD 1M1SA 3G5YB 3TZVC 1CD0A 2NY1D 5F6HJ 5FCUH 2YK1H 1JNJA 1IZJA 1J0IA 2UVFA 2XTJD 4LLYA 5D7KD 1OCWH 1VGKB 4GKSB 2AXFA 2ZKHL 3B3IB 5E9DD 4JQVA 3D1MC 4QNPF 3WHXA 5HI4D 3SCMB 3ZL4L 1U3HB 2J8HA 3WFDL 3S9DB 3U0PB 1KLUB 2A6JB 1HZHL 4HUXA 3VG0H 4YHMH 4JZOB 3F6LA 1T4KB 3KAAA 2Y06H 3NIGF 1JPST 4GXVL 3OGOE 2GJ6D 5JLZB 2DDQL 4XHQA 1YNTA 5GXBB 3LOWA 1ADQL 3MA7A 3HNSH 5FK9A 5FAAA 3QIUA 2Y72A 4P49A 5MEPB 4OKVA 2YC1B 2NY0D 4ZOCA 4LPYA 4MA8L 3HUJA 2WMPA 5I1LA 2DDQH 3UTQA 1GC1C 3PHOB 1RUAH 1SYVB 4NQUA 4BH7B 1QTYT 3CDGA 4OQTL 1UJ3A 2MOVA 1HDMB 3R0NA 5E24E 2E8YA 3QPXH 3LKPA 1TZHA 3TESA 3ZE2E 5MP6H 1BREA 2D31A 4M6ML 5ANMB 3SO3B 2XA8H 4QCIA 1MFDL 1HHGB 4J8RB 3DMMB 2AI0H 2X4QA 4OZ4A 2OZ4A 3IFOB 1BLNA 4FP8H 4XCNB 3QNXA 3SGJC 4ODWA 1MFEH 1T6VN 2FJGA 5TH2A 2PXYB 3CH1A 4JRXA 2DTMH 3KPMB 4JFPA 4PV8B 1DBKH 2KBGA 1BBJB 5FM5M 4RAUA 1YY9C 4J6RH 4KJQC 1JHKL 2OM5A 3SDDB 1LE9B 1MI5B 1NGYB 1N5YL 3V4PL 3RWDB 4MCYA 3PWVB 5FYJH 3X11B 5T3ZL 1F5WA 3WSQH 1JI2A 1MQKL 1A1OB 3P11L 3RUGB 3R06B 3FQXB 5FYLH 2NY3C 4D9RE 4V1DA 5KS9E 4LDOB 3FQTB 1ZE3C 4ELMF 2P5EE 5C08D 4PRAA 4KUCD 2ZG2A 2VLJB 1J88A 4OUUB 1MQKH 2ADFH 3R1GL 3S3JA 35C8L 4DUXA 2WINA 3BT2H 4WW1B 2VMFA 5DHXB 2EIEA 2WK2A 1YEIL 2EYRB 4PUBH 3TPUA 4CKVX 1U8LA 1KCUL 2A77H 4HMEA 2R0LL 3RZCB 3H0TB 1AGCA 3ZKND 4NKIH 2OJZL 3NAAL 1ZLUK 2DWEA 3TA3C 2I27N 3F7RA 3QO1A 4KV5E 5IB5B 4Z7VE 5F1NA 1BPVA 2NY6C 4XGZA 2P8LA 3OKMA 3P9MB 3BPCA 4K3HA 1MJUH 4N1CA 2C4FT 2AEQH 1R3JA 1A1MB 3BDXA 3B9VA 5FA3A 1DSFH 1EHXA 4PJ9B 1MWAA 2VKXA 3DYPA 1UEMA 2YPLD 2AJXH 3ZE1E 4KROD 4K94H 1JYNA 1H3GA 4X6DE 3L1OH 4NM8H 1ZGLA 1JGDB 1CFTB 1MCFA 3CX5J 1FH5L 3Q5TA 4NPYA 4RFOL 1T7ZA 3SE9H 4LPCA 1XF4A 4LSTH 5I1DB 5D2LF 2OSLA 3GSVB 1NAMB 4G7VL 3VXUB 1IILE 1C5CH 2N56A 4JDTL 2YRZA 1XCTA 4Y4FC 1GGUA 5LAXA 4O2FB 1KT2B 3VXUD 3FQUB 3C5JA 4OT1L 1QO3A 3ZSSA 2DQJL 1FH5H 4RFOH 3STZA 3TO4B 2P5WE 2MSPA 1MWAB 3BN3B 4CU8A 4PGBB 5F97E 5KZCD 3H9SB 4JPKL 1NBVL 4L3ED 5E08L 5CSBA 4Y1AE 3ZSTA 1IAMA 4GMTL 5DFVD 1U8QB 3W2DH 1IEAA 5ICZB 1V7ML 4XBEL 1OAKH 3IETA 1OVZA 3BRFA 4I13B 1FBIL 1J9CT 2XY2A 3CC5B 2B1HL 2PXYC 5JUEH 4JQIH 4JPKH 4PG9A 4JFZL 2DRUA 5K59E 3T1WA 5LG1A 5J6GB 3H9SD 2J8UF 3QWOB 3NN8B 1D5XA 2V9TA 4UNTA 4GMTH 4PG9B 1PY9A 5D7SL 4OIBA 4U31A 3FB7B 4N9GB 3IJYA 4LCCB 3GK8L 1UT9A 5J6HA 5F9WB 4L9LC 4Y1AB 1N59A 5JPMB 3V6OE 2FX8H 2WINB 3RIAK 4Q6YA 3AGVA 4H26A 3QFJE 25C8L 5EC2A 4PGBA 4BQ8A 2R4SL 1YMMB 3V5DB 1A7RL 1NUGA 1H3PH 3REVA 3WJJC 4O2FA 3LS5H 5D6DC 1KB5H 3T0EC 5F7DB 2WBJC 3RDTA 1ZGLB 1S3KH 3WN5A 1MFCH 3AROA 3R06A 4Q2ZA 2YPVH 2EE9A 5J0BA 4QYOA 2R0KH 1XF4B 4KKNA 2FLBT 2H6PA 3VMOA 2F54E 4M03A 1P4IL 1SM3L 3MROB 2DQGL 4FQJL 2IPTH 3C8HA 4J23A 5JHDE 1N6QL 3U48A 4XVTH 2IGFL 4FQCH 4JY4B 5GRYA 1MLCB 1WIOA 3QAZC 4IDLA 2VL5B 1J86A 2UY6A 3BMWA 3MODH 4ZTPL 1BF2A 1SM3H 4NN6C 4EJ1C 3HMXA 4PJFF 4KXZI 4NRXB 3TN0C 5F7EH 2D31B 5GRXG 4LSUL 5IEHB 3AXLB 2VABB 4YAQB 2HT3D 3RHWK 4APQB 1AXSA 4JDVA 3RZCA 4KHXL 5EU3B 4N5ED 2CDGA 3ARVA 3O3DA 5A2FA 4WU5A 3W11D 1HHJB 4U1LB 1UM4L 1KG0B 4MZ2A 4JFXB 1X5AA 1G7MB 3P9LB 3GHBH 4JN2A 3WO4B 1XF1A 3VWJC 4AIZB 2J3SA 4GLRI 3RKDC 5BZDA 1MCLA 4LVOB 5MEPA 2V2WB 4ZPVA 4H0HB 3RWHA 3RL2A 3D9AH 3ARGA 3VXPB 4PRIE 4ALAH 1DQLL 4Z7NE 3I3DA 5F3BB 4MXQD 4X80L 1JVKA 2OLDA 3CXDH 3O9WB 4EN3D 2X42A 4PRPE 2A6JA 4CDGC 5H8DA 1UH4A 4IIQA 1E6OL 1NKOA 1PBYA 5SX5H 1KEMH 2HT2C 3ELAT 2V17H 1IFHH 5GGSB 3DMMA 5TF1H 1U58B 1UYWL 5D2LB 3CFBA 3SQOH 2ZG3A 2P45B 2ATKB 3QNXB 4LSSL 32C2B 5EOCH 3ROLA 1FRGH 3PWPA 2Q8BL 3UXFA 4B7LA 4LDLB 2DQTH 1IZKA 5C8JB 2IFFH 4JAMB 2GTWA 2BNQB 3MLRH 2EXYC 3S96A 3TM6A 3IXAA 3BPOB 3H7BA 1S9XB 1DQDL 4FQXA 4WHTA 3TH4T 2XICA 5EDXA 1I9IL 4PJAB 5K9JH 4GAGH 2IANE 3TCLA 5DVKA 4UU9A 1PQZB 2IADB 5IBTH 2GW5A 4Y4KB 3BUYA 2RBLA 1AD0B 2JK5A 3QXAB 4L4VA 3TA3D 1GAFH 1S7QB 3PQYE 1Q0YH 2ED8A 3MNWB 4JDZA 3DURA 3VG0L 5GISL 5DS8B 5E7BA 4UIMB 2NCMA 3CK0H 3MREA 3O6ML 1CLOH 1GGCH 3BH9B 3MOAH 5JORA 5HYEA 1CGXA 1FC2D 3G5XA 3ZT7A 2DQDL 5D72H 4MAUL 1XGUB 1UCBH 1YYMH 4HH8A 3IJHA 4OZHB 4FQJH 2YUZA 2L7JA 4EZMA 3RVTC 3R8BB 4C56D 3BKYL 3SCMA 3WJJA 4OLVL 3T2NL 1FYTE 4ZUTB 3O45B 3WFZA 2ZP0T 5C2UB 5CJQH 4RMQA 4MDIA 1GIGL 4PP2B 1TITA 5HHQA 5L6YH 5T5FH 3MV8B 5ILTL 3WIHH 2AJZA 3ULUL 2R2EB 4TULH 3HB3D 2DQEL 4X4YB 2ADIB 1MH5B 1NCCH 3SDCD 3U7YH 5ALBL 3STBA 1L7TH 4P57B 1G7PA 2LTQB 1BD2E 3L5XL 1YZZA 5DQJB 4QOKD 5ITFA 5IB2B 1XGYH 4I1NB 3MCKA 5KG9A 5DYOB 5GS3A 1IKNA 4HUVA 1DVFC 4JZNB 5A3IC 3G9AB 1HCFX 2E5EA 2NX5E 4U7MA 1VFMA 2JELH 1N5YH 3FO1B 5EOQH 1JHKH 1TTFA 3ZHLA 5KSAB 5GSRB 4M7ZB 4DJMA 2CH8A 4DQOL 5ESQA 4M48L 1X5FA 3JV5A 1AXIB 1AQDA 5DURD 5IVXE 1FO0A 1MREH 2QHRL 3C08H 1NGWB 2C3VA 2NR6C 2UZXB 1IAOA 4XT1C 4JRXD 4P2OD 5IW1A 1CG9B 4WI6A 1TVBA 3UBXA 4R96A 3E8UH 3NGBC 1WTLA 4KKLD 1KTLB 3LEXA 4PJDA 2XI9A 1M05B 4NM4H 1AGEB 3QJFA 5E8OA 1CDHA 4AENA 4K8RC 4GW5A 1DBAL 2IPKB 2OL3A 4B5EA 5ID1B 4NZTH 4L3EE 1JI1A 1OSPH 2BVOB 2F5AH 1JE6A 4JKKA 4M7KH 1NKRA 4U1SB 5K9JL 1GYAA 1BJ1J 1YNLH 1IAOB 4XMKL 3OQ3B 4V1DD 3ZDZE 2BNRB 4JFDB 1H3UA 5CUSL 4NO0A 1NC4A 5F9OH 2FGWL 2XXCB 4JFDD 1LMKA 4XNQA 5TE7H 4R4BA 1BZQK 2QQLH 2P8MB 2XA8L 3MRIB 5SWSE 2R23B 2GSGA 1OGAA 3NFSL 3BEVB 3K8KA 2VQUA 2V9QA 4Y5XB 1MFEL 1OGAD 3VFPA 1EGJH 5IESH 1PY4A 5F9JB 3LB6C 4ONHB 4ONGL 1F3RB 1FNAA 5IB4B 2J12B 3RPIB 3W5NA 3QUZB 2RQ8A 2EH8L 5DF0A 4H5SB 3O6FB 5T5NG 1UWGH 3QRFM 5FECA 3L3KA 2F19L 2IAMC 3F5WB 3WXWH 2CKBB 3Q48A 5HHNA 1NGXB 3TH2T 43C9B 5J1AB 3BZEB 1HHHA 4CN4A 3WDHA 1OAZL 4JG0H 5E4EC 4M4RA 5EA0L 1A2YB 5C6TL 3MJ7A 4PRPB 4EDWH 1ES0A 3V5HA 4N1HB 4EN3C 4JGMA 4PGCB 3ALPA 5SV4A 4YDVB 5CUSH 1ZHNB 3HZYB 4JHZA 5DEFA 5H2BA 1J0HA 5ACLA 3BZ4A 1RMFL 3IGAA 1IC7H 1INEH 3HNTH 1UXSA 3KPRE 3GM0A 4K7FA 1NAMH 3HS0B 4FQ1H 5AYQA 4X6DB 1UA6H 1BWWA 4RAVB 3CVHB 4MJ4A 1UM4H 1AJ7L 5DD0H 1CXIA 5JORB 1R3HA 1QFHA 2FX7L 2YMXL 4IOFD 4GAYB 1U8HA 4W6YB 2BDNH 1UFUA 3C09C 4NDMA 2DTML 3D25B 3MV7B 1S7WB 3I50H 3MRBB 3RY4A 4X80H 4PJFB 1E4XL 1U9KA 1QRNE 4OFKA 4ZUWA 8FABB 1B0GA 1CXEA 3IJSB 4XVUC 3RVVC 3UAJD 1NDGA 4CGTA 2DYPB 2BY2A 4DK6A 4ZFOA 5GS0L 5D7KE 1K3ZA 3TWCH 5ENWB 1BMGA 1ZVSA 4OCWH 3KWWB 4G7YL 5HD8D 2AV7B 3TT3H 3ZE1F 1KLFA 3QH3A 5E9DA 1Z6JT 3CFBB 3TO2A 3NFPA 4TYUA 1LD9A 4M5YH 5KW9H 4MVBD 2GITA 3MRRB 1MFBH 5DLMH 1P9MC 3VWKB 1CVRA 2V7NA 2X7LB 1S5HB 3LIZL 2FHFA 3O11A 4QHUA 5BMFH 2BVYA 5KN5B 1KULA 1MELA 5ANME 4QOKA 1UKSA 1XGPB 2KQNA 2YRPA 4DN4L 5CGMA 3EO0B 4WUKL 3C60D 1YEEL 3IGAB 5CWSA 1CDUA 4HHAB 1U3YA 4Q7DA 1BFTA 2G9HB 3HB3C 5DJ0B 2APBA 1ZLSL 1WLHA 4TSCL 3QI9A 1LK2B 4PJBF 4EIGB 2H41A 3RWHB 4MJID 1AGDA 3VFTB 4LVOC 4PGCA 3PDGA 2GITB 5J56B 3RAJH 1ES0B 4QO1A 2BY3A 2C3HA 2H8PA 5EU5B 2L7UA 1T5WA 5D1XC 2PN5A 4KAQL 5IQ9B 2GTZA 4FG6C 3O4LD 4NKQB 4RMRA 3BAEH 4JKLA 5FGSA 4UILL 5HHMB 2BNRE 4PJCB 3C6LC 4Z8FL 3K2MC 3ARDD 3N85H 5FO9B 1A7RH 4K23H 3QISA 3QUZA 3TN0B 1UH2A 1KELL 4GXUM 5A2KH 1FORH 1WV7T 3D18A 5IW6B 2VLRB 3MGTB 4C4KT 4N0CC 4LSTL 5SV3A 3LQZA 2ZSWA 4I0PC 1I8LC 3DECA 2AQ2A 3HZMB 1GH7A 1TVDA 3T2PA 3LMJH 1M6OB 4WFGD 3U79A 4FXLA 4FZEL 4P2OC 1UJ3C 5D4QA 4P2CG 3SKJL 4JFOA 4G6MH 2GSGB 4D9RD 4F58L 2NX5D 1VFBA 2W38A 2X40A 4CN6A 3L3JB 1F4WH 4ODXB 4Z7WE 3LDBC 4APQD 4AT6A 2C3WA 3PABA 3TEUA 1Q94A 4UV7H 1DR9A 3X3GH 3E3QE 2XV6B 4UDUB 1CQYA 3C8KB 1Z2KA 3AAZB 5GRUH 3V5DA 2E9BA 4URTB 4QRUA 5FM5O 5HHVH 5DXWA 3C6SB 5L2KB 1CE6B 4MQTB 1SJEA 3N9GH 1CGYA 3VFTA 4TTGA 4XXDA 1XGTA 4OCXH 4DQOH 4PJBA 1GAFL 2GFBB 3PWUB 4YHKH 3WNNA 3BKMH 5EOQL 5I71C 4LNRA 5BVPL 4HAGA 1H3TA 1NCWL 3VFSA 1UCBL 1YYML 4LOUD 3LB6D 3TJEL 1FYHB 3OV6A 1OAYL 4N1EA 2E7LA 4K94L 3DBXA 3IFPA 2X4OB 1U8MA 3VXMD 3VWKA 5LJYH 2PYEB 5C0FA 3MGAA 5D7IE 1CWVA 4E42A 1U6AH 2XWTA 2MCG1 5C9JA 3BSZH 1A9EA 3KXFE 1MUJB 1PAMA 2FATH 3L5IA 4R90H 4L3CA 4UZGA 3OAUH 4MD4B 4PJHB 1EMTL 1KJMA 4K2UH 4JY6A 3TV3H 3B6SA 2GCYA 1ONQA 4LF3A 4ZOAA 3RDTC 2P5WD 1FYTA 2ZPKL 2Y25A 1CDGA 4N90E 4EDXB 5K59F 2YMXH 1ED3B 2XWBA 5A1AA 2ZUSA 4NPYB 4QTHB 5AEAA 2BDNL 4JFED 4UT9H 3K3QA 5JW4N 4XPBL 3DI2B 5C6WH 3PDOB 4F8TA 1T04A 3MCG1 3SN6N 1M05A 1G7QB 4X99B 3S34H 5IB3A 12E8H 4FTVD 4QT5B 1PG7L 1BECA 5IESL 3KJ4C 1YYLH 3GHBL 5F7WC 1T1ZA 3TNMB 4CVXB 2D7MA 1DQLH 1NGWA 4MNHB 4YFLF 4F2MA 3CPLA 5DHYA 4LAJH 1RURH 1KJ2H 5J9PA 1U6AL 3IAGC 3ILQC 4FZ8L 1G6RA 2YRLA 3MLSL 1CFVH 4JFEB 3L1OL 4KJYB 3MGOB 4XRCB 3W0WE 5C0IB 1JGLH 1QBML 2VLMD 5MHSD 1EBPA 5I2IB 4P3DA 4L4VB 4P9MH 3PWJB 2JK5B 3I75A 3QXAA 1W0YT 4EDWL 5KOMC 1TETL 4OFPA 3RJQB 4JO4L 3DETD 3A0OA 4HUVB 1U3ZA 1HILA 5HHOB 1MFDH 2CKBA 5A2IH 3EO1B 5C0DB 3KJ4B 1WVZA 3RDTD 1HQ4B 3DV4A 2F8VA 3VXTA 3X3GL 5D7LE 5TE4H 3GSOA 5GZOC 2IH3A 4J3VA 2BHUA 4HFUH 1XCTB 3O6FA 3VG9C 1R3KB 5DD5H 3RIFF 5BS0A 5F7NC 2HT2D 4NQSB 3PXJA 1B0RA 4PLJD 5D7IB 4CAGA 4OD1H 4O00A 1IVLA 4WO4A 3WS6C 3O4LE 3CJJA 2HFEB 2DQHH 2FX7H 4FQLH 2FLRT 1MY5A 2K1MA 1BZ9B 1TQBB 2XZZA 4U6YA 4HG4J 2FSEB 3BP6B 2LABA 3T77A 1B4RA 5KS9B 5E94B 4R4FL 5KVFL 5HGDB 2OQJA 3MLWH 1T21B 3HUJE 3MOAL 4EIZC 2NY6D 3HE6B 2BHYA 1G9MC 4L8DB 4F37K 1XAUA 3RZCD 4P9ML 2A73A 4YHYB 3EOBB 1W0WB 1K85A 1AR2A 1OD7A 1UVQA 1WICA 1CE1H 3BO8A 1AGCB 4GW5B 4MA1B 4KDTA 1C12A 1R0AL 5DK0B 4Q9QL 2OP4L 4EUPA 4PB9H 1J1OH 4ZS6C 2DD8H 2FL5B 3K8LA 4NFBA 3OXRA 2MPAL 5E9DE 5EA0H 1FNFA 2R1YA 4XVJH 3CSBA 1QZ1A 2R15A 1F8TL 2LV4A 3O3DB 3TCLB 1DQTA 3V95A 5I1IL 4XCEB 1HOCB 3QWRD 5CSZA 2B4CL 4H0GA 3OX8A 3CGTA 3DMMD 5IMLA 1FJ1B 3AY4C 2WP3O 2V6HA 1CDYA 3IS0X 4JFDE 2DKMA 5JNYB 2EDJA 1DUYA 3U0PA 2COQA 2CLZB 3PWVA 3MA9L 1WBYA 3H9SE 1T21A 1FFOB 3OKOA 3MRJA 4ODHL 3KDMB 3QUMA 4LEXH 1KJ2B 3U82B 4Z76B 5LXGH 3K2UH 4R4NC 2HKFL 4FNLL 4OGAD 2IAMA 1FL6B 4U6YB 4XAKE 3LKQB 3KR3L 3GKWH 2XFXB 1OQOA 4P57A 1YJDH 3BFOA 1FDLH 3VWKD 4PJHF 5JTWA 4LLVB 5T3ZD 1CFBA 4HAFA 1MAJA 2VAAA 4ZXBB 3V6OC 3SJVD 4LU5H 2V5RA 1R5VA 4AIZA 3E8UL 1BFVL 3T4YA 1FDLL 3TVMB 1KGCE 4M8QB 4LP4A 2NY0B 2XPGA 3B2VH 1P7HL 5T1DH 5D7LD 4YEFA 4KMQA 1D9KB 1ZSDA 1E4XI 1FYTD 4J3XA 5EC1A 3L6FA 3VDCA 1NCNA 5BMFL 3CFJA 3PGCA 4S1SH 3VXRB 1D6EA 1WFUA 3QHTC 3HNVH 3GI9L 4U1NA 4Q9BA 4QRTB 4XVTL 5D1XA 3VGGA 1G84A 4ZFFA 4NKOB 1QLEH 3QDME 3LSOA 3AMLA 3CPLB 2FDBP 3LQAH 4ZNEA 5DMJB 5AWNL 1KLUA 1NH6A 5E7FA 1X5LA 3RBGA 1XGYL 1G0DA 4K9EH 5HI5D 1VGKA 4AEEA 1Q9OB 1U91B 5HVHB 2R1YB 1T7VA 3X14A 4NNPH 4Z8FH 4UAOB 4ODUA 4M1CD 1PEZA 2CO7B 2CDFB 5I66A 1C12B 3HRPA 4GMSL 2XTLA 4OF0A 1HYSC 4J3OC 3O4OC 5D1QC 2Z91B 2NZ9D 3CDFA 3EOBA 2XN9E 5JMRA 2QQKL 5HPOA 4FQHA 1ACZA 2VRAA 1QBLL 4MS8C 3TP4A 1OAZH 4JG0L 2Q86B 2BZDA 4KC3B 5E8PA 3B6SB 5FF6A 2Q8AL 3VFMB 4U3XA 4NSKA 4KI5F 4R9HA 3SDYL 1EBAA 3OAUL 4L4VE 4XPGH 4GG6F 1H3XA 5CD3A 4TUOA 1BZ9A 2ZUQB 5E2UL 2GY7B 2QQNH 4M6MH 2DLEA 1F58L 2R56L 5E2WH 4ZYKA 5IEKA 2JJWA 1RK0B 5C07B 3RL2B 1FLRL 1K6QH 2B20A 5HI3C 5D1QB 3O4OB 5IW3A 4ODHH 2GI7A 4ZQKA 5EN2A 1F11A 5CINH 4RGNC 5IF0A 1YNKH 1C08B 5GZOD 1T0MA 3LS4H 5E8NA 3MLPA 3L3GA 1QSEA 1BQUA 2G75B 4R7DA 4KK6D 5GJTL 4LAQH 5T3XL 4H1LA 4UV4H 3MV9B 2EDHA 4BQCA 3S6CA 3OKLB 2RR3A 4HULB 4Z77B 4GXVH 4QRUB 2YUWA 4XRCA 1X4YA 2O5ZL 4PJ5A 4UMGA 4QRPB 3DUUA 5SWZE 1YQ2A 1IKNC 1UVQB 4NNXA 4XVJL 4NO3A 2IGFH 4TUOB 4OUOA 4G5ZH 4D9QD 1T1ZB 2QQNL 3TNMA 1TPXB 1RZJL 2FBJH 2SEBB 3C5ZD 4TTDC 5T1KD 4HD9A 5IGXL 3JWDH 1V7MH 1R3JB 4PRHD 4XBEH 4JFHE 3U1SH 4OLEA 5FF6B 5E8PB 4DGYH 4KQ3H 2UYLA 3HAEG 4X99A 5EBMA 1TZGL 3C5ZA 2FSEA 3VXSD 4X5XB 1A4JB 2AKRB 2ZOLA 3QQNA 1FNEB 1AFVL 5ACZB 1MPAH 1YY8B 2MMXA 5D96B 4L5FL 3LKPB 2VN4A 4Z7VB 3RY6A 4NBXB 3V52H 2VITB 5BS0E 4QHNA 4ODUB 4CADA 4NQVA 1EHNA 2ZOKA 2M8XA 5LXGL 5DFVC 1RZIB 1K3IA 2N7AA 3BH8B 3MJ6A 1BM3H 2A1WH 2HJFA 4LCYA 1S7RA 5LKNA 4JFHD 4KKBC 2UWEB 5E8NB 3GRWA 1NFDE 1U8PB 4NUGH 5CBAB 1S5IL 1X5XA 4OLVH 3U0WH 4O4YL 4I0PD 4OZHF 3SDCB 1X5KA 3ARQA 1FSKC 1VFOA 5T5FL 4HUXB 1X5GA 1E4XH 3BQUC 4P23D 1X7QB 3QUKA 5GISH 2N1KA 3LKOB 5IV2A 5EOCJ 5F7UA 4JCLA 3E6FA 3MUY1 3BSZL 5C0JB 5IHZB 3OB0K 5SWSB 1CFQB 4KVCL 4C83A 4AQOA 5IB3B 4JO4H 4CW1A 2J1KA 3IFOA 5EPMB 2VB5A 1EEZB 2WZPD 4BZ2H 5I1EL 1EZVY 4U4BA 2W1NA 3SY0B 3AAZA 5D7SH 2YPLE 4PJ7B 5GGUA 3WIHL 3OKEB 2XWBB 1Z5LA 2CRMA 3T8XB 1FVDA 3WNMA 1RMFH 1UB6A 3S3PA 4KZEH 4M7JL 4XPBH 4XP9H 4UV7L 4O2EB 3RWGA 3U0WL 3HCVA 3UTQB 5J7CC 4Z7UF 2VWEE 2Z31A 5D7JC 2O5ZH 1H5BB 5CAYB 3IKCB 5DJCB 5C3TA 1E4WH 5GGTH 1YEFH 2EDRA 4H0IA 4JFFD 4G9DB 3X13A 4XI5C 4ZXBD 2WIIB 4F3FA 4HPOH 4GKNB 4GRMB 5JLZA 1KENL 3QIWA 1R5IA 3WFDH 3CX2A 1N0XL 1MCRA 3OX8B 4JO2L 3ZDYF 2OTPA 3D18B 2CO6B 3ULVD 1QACA 3MO1B 4YWGL 5L2JB 5EZIL 4MMZC 1MY7A 4OLYH 2GAZB 2VXTL 3I6GA 4W4OA 1J8HA 1RUKL 1KJ2L 1R3LB 1U3HA 4GQ9H 1D9KA 1K4DA 3T65A 2CDEB 5I1AA 2D0FA 3O9WD 3LN4A 2WLZA 3ABZA 1MAKA 1MHPH 3RIAF 1HSBA 1WISA 1WZ1L 2CLRA 5ABDE 1I8MA 2A38A 4OCWL 5FUCE 3GMNA 5C9KA 2NY2D 1HWGB 1U2HA 3QSKB 3SGEH 4E41A 5CJ8A 2XKUA 3PWLA 5C0NC 4NZJA 4MCYB 2XQBH 4GLRH 1SY6A 2QR0B 3SO3C 1VFAA 2LVEA 4R2GB 5SX4I 5FB8A 1QLFB 3SBWA 1S5HA 4ZAKC 5IB4A 5HI3D 3DXAA 3EYVB 4U1GC 1I3VA 4MHHG 3QWRA 5DMKB 1UXWB 4WV1B 3IDIB 2A6IA 2ICWI 2EXYD 5JNYA 2Y1VA 1DN0A 4BFIB 1UM5L 5E6IB 5L8KB 4FXGA 5H35B 1UWXH 3DIFA 4HWNA 1G7LA 4XVSL 5IMLB 4E0RA 4WWKB 1BP3B 4P5TB 1JGUH 4S1DD 1NDGB 3QDJE 3GDBA 3WSQL 5DFWH 4X7DC 4UT6L 1P7KB 4FZ8H 5I1LB 3I6KA 2BVOA 2GTZB 3MFGB 1MRCL 1NMBH 2ZCLH 3VXQB 3X17A 1MWAH 1A6AA 4GAYA 2AJ3A 2XQBL 4ZTPH 4U6TA 4NHCL 1AGEA 5KVEL 3A6BL 3BP4A 3P4NB 4L4VD 2J8UB 1REIA 5IVXF 4KWUA 4X4XB 5E2WL 1XGQB 1PSKL 5DHYB 2YPKB 3NCCB 1NMCC 3UX9B 2E6PA 4MWFB 1LNUA 2ARWA 1TFHA 4D0DB 5L7XH 1EGJL 5HGDA 3S35L 3I50L 4QT5A 3T77B 1OTUC 3BZ4B 1SEQL 2LU4A 4K3JH 1I3RB 1PGRB 3T0VA 4JR9L 1YEFL 3JUYA 5D2NB 1J05B 2AI0L 3PGDB 1MEXH 2AJYH 4FTVB 4BQ6A 1HIML 1G7HA 4QTHA 4F37F 2HFEA 5I8CA 5HGGS 4QNPE 5IFAL 4UV4L 1LD9B 2VWEC 4NN7B 3GM8A 4J3UA 1AKJB 5DD0L 4KU1A 3SKOA 1Q72H 4PD4K 5HDBE 3MUGA 4EI6A 4P23A 5EFIA 2W9EH 2IANB 3P30H 3A6CL 3NIDE 2P43B 2QSCL 3O41A 5A16A 3IU3A 3G04B 3KPNB 3L3KB 1U8JB 4HJ0D 4WFEE 5HY9B 1WTGT 5CLTA 2P5WB 3CDYA 4MX7A 2HVKB 4NHCH 4YFEA 4H8WL 2CD0A 2JIXA 3K46A 1X5JA 3WCYA 5D2NC 2DQEH 2HYMA 4RWHA 4E42B 2IAND 1UWEL 3WN5C 3T4AA 1X6NA 1U8HB 2NPLX 5TF1L 4MA3B 4PLKD 4G9FD 2NXYC 4S1SL 3MRDA 4Y4FA 2PYED 4NKDB 1DUZA 3MUJA 3VXMB 1A3LH 2JCCE 5KZCB 4OQTH 4YEEA 1I1AA 1PW3A 2B4CH 3GO1L 4YHLL 4Y4FD 3FKUS 2ITCB 5CILH 1RJLB 4J4PC 4L4TE 4XCFH 1AO7E 3DROB 4DUWA 1B9ZA 1FFQA 5B39B 2QSQA 1Q9KB 5DJAB 1A6UL 2BFVH 1TENA 4KK5C 1G7IB 4Z78A 1NAKH 2CKNA 1HKLL 4TN9A 1Q0XL 1CT8B 1EUTA 1AQKH 3EJYC 5GRUL 2Z92A 2IADA 1OW0A 2XIDA 5T5NF 3QYCA 4HJ0C 4X0KA 2Y23A 2XTJC 5E6IA 3TBTA 5LBSH 3DX7B 3MLWL 3P4LA 4XP5L 1JPFA 4JY6B 2VQ1A 1CLZL 3EHBC 1G7LB 4TRPH 3FB8B 3IDIA 2CSPA 2AJUH 5DR5H 1OWRM 3IFLH 5DD1H 3N85L 3FO1A 1I7RA 2FZ3A 2PW2A 3QDJB 3OB0H 4X5LA 3GSUB 3VFPB 4WRLA 4HLJA 1CD8A 3O0RL 1UM6L 2MPAH 5EOCL 5TQ2H 3MGTA 5BJTB 5HHXH 4NUJB 3T0EE 1N6QH 3ULUC 1G9NC 4YE4H 3HAEH 2R23A 1BJMA 3UJTL 3BIAX 3TCXA 5C0AD 43CAB 5AUMB 4Z0BH 4NIKB 1V3KA 2FGZA 2VLRD 3B2UC 4DKFH 2A0LD 1RJZA 3U4EB 1XGQA 5HI5C 2J88H 1AO7A 3T3PF 1EO8H 4U2ZA 2PCPB 5HHMD 1Q9WA 5CJBA 2A1WL 2AJ3B 3QUXA 1DVFB 5IHLB 2X9XA 4FS0A 4XXDB 4XMLL 2VDLH 4WEBH 2XYCA 2BRQA 3EFFA 2OL3B 1FSKB 5DK2B 5GJTH 1UG9A 3F7QA 2VDPL 3VCLB 4G8FA 1WCBB 1CDCA 2DMKA 3JWNC 3GZKA 4HH9A 5HDBF 4UDUA 4UT7H 1GGYA 1KTLA 4WEMB 3GI8L 5LGKA 5AYUH 2AJUL 2M26A 1P7QD 1R5IB 4GQ9L 5H35A 2AJXL 1P4LB 4YDKL 1H8NA 3I3BA 4M93B 3D39D 5EZIH 3EO9H 3O8XD 3RL1B 4WDIA 4PJEF 3P0GB 3U7WL 5T3ZH 1DLHA 3KGRA 1H5BC 1JPGB 1I1AC 2OCFD 1BVZA 1GPOH 4KK8C 3JWDL 1XZ0B 4BUGA 3UTSB 3LRGA 3FRPG 4NKMB 1JYXA 1A1NB 1FGVH 4MQ7A 4LNVA 3KLAA 4GAJL 3KWWA 4MJIB 1P2CA 5B38G 1J0ZA 2P8PA 2VE6A 4MVBC 4Q9CA 5TGBB 1LE5A 4JZNA 4YHOL 3BGFB 1NBVH 4OGZA 2DM7A 1JF1B 5GGUB 1AY1L 3KHOA 3SCMD 3S8WA 2BVEA 2DQFB 3H7BB 1UB6B 2DYPD 1RD6A 2RCSH 3V6FB 3IU4H 4Q2ZB 1I9IH 3KNBA 1G7PB 3WMSA 1QG3A 1MFNA 1XIWC 4OF7A 3RWJA 5GS1B 2VC2L 3X3FL 2ZNXA 1R6VA 4M7JH 4P46C 3PQYB 2AJSL 3TJHD 3VD5A 3WIHA 1FFNB 2NY5C 4D8PB 3QI9C 1LEKB 5C6PB 4UAOC 2JELL 3A6CH 2QHLA 4RRPG 4PJ8D 3BE1H 3QUKB 2HAZA 3CVHA 2VIRA 4BFGA 5D1XD 1K8DA 5IHUL 1C16B 3MFFA 1DQQA 3EYOA 4Q6IA 25C8H 3EO0A 5D71L 2FO1A 4NN5B 1WWWX 2NY1B 4PJ7F 5DQDL 3SDCA 2C1PA 1OP3K 5H2BB 3ARDC 3W0WD 1GJIA 4Q9RL 1G9MH 2X7LA 3RWEA 5HDLA 1HZHH 5FM4A 1JF5A 1EFXD 1S7RB 2AGJL 1N6VA 1QBLH 4LHUD 3UJTH 1I8KA 4PJ7E 4YGVA 3UTTB 5IJKC 1D6VH 4TNWF 2FEEI 3F12A 3OKYA 1OM3L 2VL4A 4ZG1A 3U6RA 1T0NB 4QKXB 3GO1H 1PKQA 5JDSA 2ADFL 2YS4A 3R1GH 1EV2E 1F8TH 3S35H 3VXME 4NQEE 4UINL 4ZO8A 3V6BR 2R69H 2LU7A 1OLLA 1W72A 2CR3A 3O6FD 5H94A 2BNUA 4Z7VA 4BKLB 5EU6B 4HBCH 3T0XA 3HRZA 3CMOH 3FFCA 3FL7A 3O2DH 4NCDA 1OGAB 2IBBA 1VGEL 5GGSA 6CGTA 4APQC 1B3JA 5GQBA 5LQBH 2OL3H 3VXOB 3SGKC 2NY7H 1U2CA 3L7FB 3PF2A 3O2WL 5HHPB 1Y0LB 2BX5A 4LIQH 4PJIB 2V7HB 5I16B 4AIXA 3OZ9L 4Y2DC 4G6KL 3O81A 4JFDA 4X6DA 1FAIL 2DMCA 2OTUB 3BGMA 4OZGA 3JUZA 4PGDA 2DM3A 2DL9A 3V7AG 5GGVL 3LVEA 1AHWA 4XBPB 5GS0C 1K2DA 4P2QD 5I8EA 4NRYA 1YMMA 3DVGA 1L6XA 4UDTA 2OJEA 4LSDA 4KRLB 1OAQL 1NLBL 3EHBD 3GJFH 4GSDL 4U3HA 3L3OB 5FDWB 3MV9D 1HHKA 2X4PB 3S7GA 4BSVA 4N0FB 1QOKA 4PRAB 3EYFA 3M17B 4XCFL 5DJ2B 4P2OB 3L9RA 1HSAA 1DBBH 3O6LH 3HZVB 5F88B 3Q2CA 1NMCB 4HS3B 3HHRB 1ERNA 4KJPD 1VGEH 5F9DC 4LRNH 1UA6L 3QULB 4A6YB 4TNVF 2OTUA 1MIEL 4PRHA 3EOAA 4WFFE 3SQBA 4HKXA 3C5ZB 4EVNA 4JFFE 4K8RD 5D6CB 3F7YA 4MJIE 3RI5K 3RWCB 2FJFB 2HH0H 2BVPB 3LQAL 5DSCB 4QRPD 4XP4H 4Z95H 1Y6KR 1ZLWH 2KL6A 3BPLC 1KN4L 4MHHI 1OY3B 3PXHA 4H8WC 2FYYB 4Z7WF 3C08L 3UJJL 4AEFA 5I66B 4X5WA 2QSCH 3LCYA 4OLYL 4OI7A 2CRYA 1AIFB 4BJLA 1YPZF 2W92A 3BP7B 4JO2H 3UYPA 4TVPD 3CVIL 1HKFA 1YMME 3LD8B 5JDSB 2IC2A 1PKQB 5HI4C 4M43L 3NIFE 4ELKB 3UJJH 5HHXL 2DI9A 2HFFA 4JEGB 5I1GH 2EIDA 1SYVA 4MQ7B 3UBXB 1FAKT 2MWCA 1JYVA 5DVMA 5DRWB 3HUJF 4LU5L 3RVUD 4MB5A 4LKXB 4OFYA 5J6HB 4YDIH 1DLHB 5ELIA 3PIQB 2HTKD 3ECBB 4HKZA 1IC7L 2DWEB 2EC8A 3UBXI 1EUUA 2XRAH 2YBRB 2R2HB 5IROC 1P4LA 5E2UH 2VDLL 1QRNA 4HIXH 1JHTB 1MCWM 3EGSA 1DANT 4DWHA 4KGJA 4IMKC 1YPZB 1TNMA 1H3PL 4HH9B 1KPUB 5CHNA 2W0LA 1FNSH 3T0BA 1T1XA 3TA3B 1A7PL 1EX0A 4KHXH 5DO2C 2QQKH 2BVUA 3QCVH 4IRJA 5FEBA 1FZOA 3H3BC 3BKML 3S96B 4X9IA 3QUYC 4BZYA 1TNNA 3W39B 4UUJA 5FOBB 1RZKL 3QI9D 3W0WB 1UACL 1UADC 2Q20A 2XFXA 4MDJB 5B3JE 2AQ1A 1E6JL 1RJZB 3U4EA 4WTWA 2OX5A 5HGAA 4IRSC 2R1XA 4EKXA 2C9AA 1JF1A 5FUOH 4NO5B 1F13A 1T1XB 4G6ML 3PDDA 1I85C 1ZA6A 3MRJB 1F4XH 3VFUB 4IMKA 1EA9C 1TCRB 1RSFA 4G6AD 4PBWD 1FNHA 4C55A 1QUNA 2R0KL 4Y89A 2ZPKH 4NBYB 1JHTA 3LKSB 3NGBB 4WI5A 3HNTL 5BRZB 1ACYH 4EN3B 3AB0C 4HC1A 5F6IC 1B6UA 3D0VB 4M62L 1FN4A 2OR7A 3G5XB 5JHLH 2VUOA 2VC2H 3X3FH 3FRUB 1OSPL 1HOCA 1A4KB 3OR6B 1BX2A 4JZJA 2X44D 3ARDA 1WBXA 3V0VA 4HXAL 4OD2B 1K8IB 1MHEB 2EYTB 5EBWB 2QLVB 4HIEA 5IG7A 1KC5L 1WEJL 4M8QA 1AR1C 4ELKA 1M7DA 1T22B 5FV2A 4Y4KA 4HXBH 3LKRA 5DK3A 2HJKA 2QBWA 4L8SB 4I48B 2CMRH 2MQ0A 3IXAB 3OAZH 2D7TH 2FX9H 4PY8I 3GBLA 3OPZL 5GZNC 3CVIH 1DP0A 5HVHC 1P4IH 3MUZ1 4JHWH 5BRZA 1MJ7H 1YEJH 2NY5H 3WYRA 2IPUG 2E3VA 2EDXA 5HYSG 5CEYB 4L8DA 3VI4E 2BVPA 4O02L 2VZTA 1OP5H 2EKJA 1B2WH 1RUAL 3MRGB 3G6JE 4WI3A 3S88L 3H9HB 2FHCA 2ZUTA 4X7TB 1BIIA 4IIQB 1CIUA 2FJHA 2CXKA 2IPUK 4OZIB 4WO4B 4RMTA 4M6AA 1XFPA 1NCAH 1QFPA 3KYOA 4JM2F 1T66C 5I76B 1PKQE 1XR9A 2GYSA 1QLEL 1NBZB 2IBZX 3U4AA 4J8RA 1FCGA 2ZUQC 5GJSL 4KXZH 1B0RB 3RTQB 2HT4D 4F7EB 3BHBB 4FQLL 1AC0A 5T3XE 4NQCE 5T1LD 4HK3J 3TIDA 1DSFL 2HRPL 2ESVB 1YJDC 5BW7C 1A6UH 1KNOB 3VE0A 4X0KB 3VH8G 1JCKA 1IM3A 3S34L 3QEGL 1J12A 4GG6E 4PG2A 2Z92B 2JJSA 3CDGB 5CIPH 4C59B 3DVGB 1YPZA 4YK4C 2HP4A 4JPIB 4NJAL 1DBJL 1E0OB 4GRLA 2APFA 1VERA 2R9HD 1BGXL 4MXWL 4HWEH 2FEEL 4HLZH 4HWBA 5F89A 2N7BA 5DRXB 4WUUA 3I75B 3PL6C 4Y19A 3CAFA 3KJ6L 4IOSD 4FHBD 4UILH 3BVNA 2VLKE 3TBWB 3SDAB 4TOYL 1WFTA 3D6GA 3VH8B 5D9SB 4LSVL 1NJ9A 3BWAB 4LKXA 3UDWC 1GPOL 4O4YH 5L9DH 3FT4A 1FVEA 1RZ8B 2EDEA 1JL8A 1XF5A 1AD9B 3QQ9D 5C0BB 5E8EA 3TBSB 4ZTOL 1ETZB 4YC2C 1IC5H 5J4MA 4GW1B 4X6CB 4HWZB 1CD1B 3BKJH 6FABH 1S78D 2Q3AA 4F58H 2O61A 5E2VL 5E2TL 5F93C 2BNUB 4P4KC 2AABH 2VLRE 3EZ8A 4JY5L 3VWJA 5CJOL 3RUGF 5CKAA 4P3WA 3JV4A 3RDTB 1H0DA 1UWXK 2F8OA 3ULVE 3LIZH 1JGDA 5JMOC 5KVGL 4NQXA 1IM9B 3VWJD 1D5BB 3BI9X 1RAMA 1EEUA 1IQDA 1T0NA 5D96C 2FECL 2IANA 2FJFA 3I84A 3MLYL 4ENEC 2LFGA 3MZTA 3GSXB 1QFWL 1JYWA 4L3EB 1KJMB 5CJ5A 5CGYC 4PP1C 2PYEA 5C0FB 1L9MA 1QEWB 1E27A 1IM9D 3DXAB 3W81A 4ONFH 4QXUH 4TUKL 2DQIL 4LSRH 2E7CA 2UV3A 5TDPB 5E4IA 3HE6C 2G60L 4OLWL 3ARBA 1ZANL 5GGQL 4HPYH 4XMPL 4HJGA 3PIQA 4RDQG 4G8GA 1FAIH 3VFSB 2PTTB 4LLQB 1K8DB 1OAUH 3IDJA 4M9PA 3FCTB 1N4XH 2Q87A 1QHPA 1G0XA 1DBAH 5DQDH 3JWOH 5I17A 4HS6A 4PJEA 3FHAA 4IOIA 4XP5H 1L7IL 3IXTA 4XH2B 1CICB 1OTSD 1Y18A 5CSGA 1IGCL 3IAQA 4J3TA 5EU6E 5IVZA 3V52L 1DE4A 4L4TD 4AQ1B 1MCNA 3NCYP 4KQ4L 2IFGA 3BMVA 4KRPC 4I0KA 4H25A 4Y2DB 4R7NB 3HAEB 1P7KA 3DO3A 1QSFB 2HMIC 1BQHA 5GGRA 2A9NL 3PV6B 4E0RB 3L7FA 2D4DA 5L0QB 1KXVC 1MJUL 4FABH 3UYRH 1ND0A 4TUKH 1BBJA 1I7UA 2YK1L 2CMRL 5T1LB 4OZIE 2VNCA 2G5RA 2ZZUT 4M02A 5GSVB 1MNUH 2ZNWA 1FNGA 3VFRA 5C0AA 4D3CH 3QEQE 3WL9A 4DUVA 5JW3L 4LPXA 2NX5B 1BD2D 3ARFB 1ORQB 4AM0B 4KY1L 4OM0H 4XP1L 1U8MB 3CLEH 3QIBC 3T1FA 1QLFA 3VXSA 5IQ7L 4X9GA 3LS5L 1U8NB 4PJCA 2PO6A 1QLRB 1XCQB 3G6AA 3L9RB 4MNQB 2XXMB 4JDTH 5C09E 3WLBB 1JNHA 1X5IA 4MMXC 4TNWK 1LO2L 3S35X 4P2QE 2HLAB 4B41A 1FORL 1F2QA 5ADPL 3LPFA 2I9LB 1JGEB 2BOCB 2F19H 4JQXA 1DVFA 1VADA 1YNTB 3VFVB 2LQRA 4YQXL 5TE4L 3ROOA 4ZS6D 4TVSa 2R56H 4JFZH 1I8IA 3MODL 2DQUL 2ZCHL 2WWMC 4LLWA 4PGDB 2PNDA 3SJVA 1WK0A 3I6LE 2KQMA 1R5WA 1T66D 4Z7OF 2NNAA 1JBJA 2VIRB 1UKQA 1FZJA 1A7OH 4DTGH 3QPXL 5CWSB 3NZ8B 1GXEA 2CUIA 4PY8J 2AXFB 3IFNL 3SDDA 3UEZA 1LEKA 1OGAE 1Q38A 4FP8L 3VXUE 3FOLA 2APXA 4U7KA 3MTRA 4O9HL 4XCCL 5ADOL 1N64H 2HVJA 2EH8H 4JFPB 3VGAB 1F6FB 1FQ9C 4ORZC 3WE6B 2UWEA 1L6ZA 1CXHA 2Q6WB 4KDVA 1ZVSB 4DCQB 1AJ7H 2H3NA 3DMMC 1KB5L 2YHGA 5FKPA 3OAZK 3MRHB 3RBSA 4U1MA 1DANU 4JANA 3O3BB 2XN9B 2K9UA 2VLKB 4LCWD 2QQQA 4U0QB 1LE5B 3OKNB 3MJ9H 1RZJH 2FBJL 1U8NA 1NCWH 2J8OA 2VLKA 4O51B 4YHPA 5EUOE 5KSVA 1VENA 2GJ6A 5GRJH 1OP5K 3CZFA 4D94A 4ZFOL 4MZ3A 1ADQH 2X1PA 4KKAD 2ICEB 1RZJC 2UYLB 1UZ8A 3NTCL 5I1JL 4QGTA 4HW6A 1LK2A 4M7LL 2YEZB 4XBGA 4QY8B 3RKDD 3QNZB 1IKFL 4PGEB 1GSMA 1LEIB 4XCYB 4TUJB 2E9WA 3LH2H 1A3RH 5DGRA 5GGRB 1EFXA 1U3HC 2H32H 2Z8VC 4MA3A 4GKZA 1F90L 3D3VD 2DB8A 5J11C 1A3LL 1PZ5B 2X41A 3ULUF 3SDDC 5HBBA 1P6AB 4NQED 1RZ7L 1IGIH 2BOCA 3D85B 1D5IL 4TRPL 3FFCD 4ZD3H 4E5XA 4KMLB 4N0RA 3IVKB 3MRKB 4J6RL 1IGYA 5JOPD 3HKFA 4LLDB 3MCLL 3TFKD 3WFBH 2BHZA 1YYLL 3CH8A 4ZSOE 2OXGA 4K3GA 4ORGA 5A2JH 4PB0H 1B2WL 1CBVL 5L6YL 2GJ6E 4F7TB 3GSUA 4S1DC 1BF8A 4A2LA 2AXHA 1IAIM 1V3JA 1YDPB 2DWDB 4AM0A 3PE9A 1J8KA 4AL8H 3FQNB 3ZT5A 2A9MH 4Q58C 5F9JA 3DGGA 1TJHH 3ILQD 5MERA 4LSPH 4E41E 4HZAA 4M6NH 1QSED 3H3PL 1MHHB 4D0DA 2XTJE 4OKDA 4NO0D 4MXVE 1OAQH 5CIPB 2NTFB 1KSRA 1LO5A 1R24A 3BZDA 4TPRH 3BT2L 2VLLA 5ERWA 1BAFH 5EUOB 4CVUA 4OLUL 3ZT6A 1OP3H 3SDXE 5D70H 5IT2L 3H3PH 3GSNH 1WZMA 4U1SA 1S7TB 2XWJA 3RIFK 4M6OH 4PRPD 3KLHC 1JRHI 5HYSB 1GZPA 2EKSB 5GRVL 3UTZB 3GMOB 4Y5VA 1Q9KA 3MV9A 5DJAA 1GZPB 2EKSA 3QUXD 4PFEA 4GW1A 4X6CA 4K23L 5CD5C 3ARFC 3V2AR 2NY4D 4ALAL 2C3VB 3CXHJ 2Q7YB 2CRZA 3TJHC 3VRJA 5IW1B 1HHIA 3H8NA 4RGNE 1LO5B 2D0GA 2F53B 1DN0B 3GSWA 4UI2A 5DA4A 5CJXA 1MHPL 5F8RC 2VXVL 4FFVC 4K94C 3D39A 5IR1B 4JVWA 4YX2L 1JUFB 5TPWH 2OR9H 2FZ3B 3TF7C 5LGJA 4EXPX 4TVPH 5FO7B 1JHLH 1KPVB 2BJML 2HVKA 3MCKB 4WUKH 5KG9B 3NH7H 4KTDL 2Y5TA 4ELMA 4M4PA 2DJUA 5EZJA 3O41B 2RIKA 3PWLB 1GOHA 1URLA 3WD5L 1D5BA 5INDB 3PHQA 1BQLL 2Q3ZA 4P46D 1OB1A 2XQYG 2A6KA 3D2UB 1OT1A 3L3IA 1EMTH 4K2UL 1U41A 3NA9H 4OZHE 4NQCB 5IHUH 1LDPH 1QRND 5JPNA 4WU7A 5L8JB 4HIXL 1KOAA 4OZIA 1JWMB 1I9JL 4X8JB 5IVXB 1DEEB 4ZPTB 4OIAA 5FGCB 2JIXD 1CG9A 4PR5B 3Q5YA 3WXVL 3OJ2C 4QHLA 5C0AE 4AK1A 1A7BA 4LCWA 4Z7QF 2PTUA 5DURB 1MREL 1X4XA 4IM8A 3UO1H 5KVDH 1RUQH 5KSAD 3RPKA 1OAUL 2R4SH 1AQDB 2FEDD 3EW3B 4GRMA 3UJIH 3MV8E 1NFKA 3BP4B 2F74B 4FMFA 3QB7C 4G9DA 5BVJA 5CJQL 3HI5H 1A0QH 2HTLD 4G42B 3MRCA 4JN1L 1CFNB 3BZFB 2ICWJ 5D1ZC 4KI5E 1JNNH 4A6YH 1PX3A 5KVEH 3SHSA 3QIUD 1ZT7A 4CN1A 5C2BL 5IFJB 3OJDB 3ARSA 1AD0A 1IT9L 3P0YH 4HIEB 2VDNL 4LHUA 4ZS7H 5EO9B 1EHLH 1L7TL 2DIBA 1KIQA 4OB5L 2KKQA 5F9OL 3TIDB 3MLVL 3O3BA 1DCLA 3IDYB 3MRPB 4KH2A 2BNQA 4KZEL 2CGRH 3B9KC 4LLVA 5E0QA 3MV8D 4BQ9A 1EEZA 2DQTL 1MIMH 3QHZH 1KYOJ 1ZWIB 2JB6B 5AG9A 4CW1B 2X4RA 4YFDB 5LWYL 4V2BA 1R3IH 5IOPB 1U8KA 2BNQD 5IFHH 2ATKA 4LASH 2LAGB 2WUCH 4EEEA 2YA0A 3SDXB 3VWKC 3F7VA 3GGWB 4TSAH 4MDIB 1RULL 2EEAA 4RA0C 5IV2B 1JZ3A 1DBML 3O9WC 1KJ2A 4NZRL 1T7YA 3TVMD 3U2SA 2GT9A 2BY1A 3L5WA 2HWZH 1X4ZA 5F1IA 3D0LB 2QTEA 1FNLA 3K8MA 5BCAA 3IYLW 3QO0A 5F9AC 1MCPL 3CFCH 4JDZB 2VDRL 3ARGB 4RAHA 2ITDB 4OV5A 1I8MB 2CLRB 3VXQA 3FQWA 4WHYG 4IRJB 1XF2A 3G6JF 1F6LL 2OTWB 4BH8A 1HILB 4NNYA 1U8OA 1PQZA 3ULVF 1YPZE 2NW2A 4NKIL 1WZ1H 4PJAA 4Y2OA 1P7QB 3VXNA 4APQA 1EO7A 4YAQA 1FP5A 3AXLA 3MRLA 1IC1A 1O7SA 5KS9F 2ZOKB 3MLXH 5EZLB 2ENYA 4WUUE 5C3LD 4FQQA 3WUWA 2CDGB 3BW9A 4B50A 1INEL 3IDGA 1FV1B 4N8VG 2KUTA 3E2HC 5TE7L 4F3FB 2WIIA 1KCSL 3CMOL 3O2DL 5DHVA 4DAGL 3ECBA 1HXMA 1W0WA 5EBGA 4QWWD 4MNHA 3E1F1 3L5HA 3U30C 3ZE0F 2Z31B 2P44B 1HIMH 4N8VA 5IMOB 2R1WB 4IRJC 4BZ1H 1FE8L 2BOBB 4I9WD 5KS9A 4GUPB 4W81A 4UB0L 3MV11 5CFHA 1MCOL 4TTDD 1CZ8H 3BIBX 4CNIB 3RX8A 5J13C 2P1YA 4LSRL 1UJTA 5DJDA 4QRPA 1JZ4A 5DC0A 3KPLA 3BD3A 5INDA 3WN5B 3QDJD 5I71B 2QHRH 3ET9F 3QEUB 2EYSB 4HV8A 5EWIL 3ARYA 4H1LB 2NY6B 3QCUL 4ODTH 5DDHB 4GRLD 4QGYA 2X09A 1QD0A 1UZ6F 1EAPB 2ZCLL 4L3CB 1XEDA 4LCIH 2GK0A 4HT1H 5E99L 1CTOA 5MEND 4Y19D 3DX8B 4PY7B 5CHNB 4GFTB 3TNNA 2JE8A 4DN4H 2UVEA 4ZMAT 3I6GB 2VZSA 1JJUA 2NLJA 2H9GA 1FG9C 1LEGA 4FQ1L 1CK0H 3IFPB 3GBML 4JFEA 1G6RB 2ADGA 2FIRT 5DMYA 5HJ3A 4RFEA 4LSSH 3RNQA 2X05A 1INQA 4LQFL 4F7CA 3MRFA 5K9QG 1UH3A 2Q7YA 3IKCA 2ARJB 1QEWA 1NC2B 4YBHA 5FYKU 1HHKB 3H9SA 5I8OL 2VDPH 3PL6B 3QG6B 1BEYH 4IDJH 1FIGH 1IGFH 2VZOA 5FYJL 2J2ZA 2FECI 5GGVY 1U3JA 5ISZA 2HFFB 5IBLC 4Y16C 5EBLB 3C60C 4NQVB 5IMMB 2OSLB 4LIQE 3S36L 1GGBH 1YEKL 1M71B 4M1GH 4W6WB 3N06B 3TO4D 3VWJB 4JJ5B 4PRNB 2EIBA 2GK2A 4K7PH 4LF3B 3RU8H 5KSAC 2BOBA 4K3EL 1J1XL 5IMKA 1A6VH 2ERJC 4PJHA 3E6FB 3JTSA 4GS7B 5C0BA 3B83A 4R0LB 4NP4H 4XGZB 4WWKC 3RWIA 1T1YA 2ZSVA 3A6BH 5C9JB 3I6LD 4WGWB 1UQSA 3RA7H 3G6DL 1JWUA 1K5NA 5C0BD 4NWTH 4G8EA 1MWAL 2N4IA 1JZ8A 2CGRL 3BEWB 3KS0H 1IEBA 2EDOA 3H0TA 1G0YR 3TZVD 3X12A 2CK0H 4QRTA 3IDMB 3BW9B 3QBTB 5CEZL 3LHPH 3QO1B 2H9GB 4GRWB 4OGAC 5FO9A 1NL0L 3N1GC 4HKJA 4OFVA 1IGYB 2IEPA 1U8QA 4WEBL 5A3ID 4R97C 1M7XA 5DJ2A 1INDH 3ULVC 1MRFH 1FRGL 3NCBB 3IVKA 3NZHL 3LAFA 3AVEA 4JM2C 5BO1H 3VW3L 2XNAA 4YIQA 5CGTA 4Y5YA 2P7TA 5DVLA 1R5VB 3K4DA 1B4JH 4XWOC 1FL5A 3JXAA 2NY5L 4F80A 5EU4B 3KPPA 1CL7L 1I8LA 2BSSB 4WNQB 3GSVA 4X6BA 2FIKB 1P5UA 1EJ6A 3VW3H 3C5SA 1D9KC 3Q6GH 1CFSA 3TYGH 3O6FC 3ARZA 3G08A 5AD0B 1I7ZA 1JMZA 3MCLH 5FYKH 1DJSA 1VB9A 1A4JA 2RFXA 3BYTA 3GMMA 1KF9B 2YD4A 3IFLL 4HBQA 4G7YH 1C16A 4XI5D 4ZXBC 3LMJL 3FHQA 4QY8A 5MENE 3GSQB 2FJHB 1F58H 2BVQA 4IS6A 4NO2A 3HI6L 3QUMB 2WANA 3EJYD 4ODWB 3L95B 5ICXA 4HIJB 1TDQA 4D0CB 2P8LB 5KANG 3KPSE 3KPSD 4FQHB 1RUML 1ZHLA 4JRWA 1X44A 3WFHA 4X9FA 2FNBA 4KUZL 4HUWB 4OBRA 5GGSY 4GRWF 1P4BH 1IAIH 1JWSB 1TJIL 3MUHL 2A6DA 3WS3A 1FV1A 3IDGB 1HK6A 3KG5A 3KYKL 5LGHH 3D39E 5I9QC 5HDQH 3V0WL 5JW5B 2XA3A 2P5EB 2HTKC 4DGVL 3HTLX 2OZ4L 3QEHB 5JZ7C 2X4UA 2R8SH 2OYPA 3LH2L 4HUNB 1JMXA 3MRBA 5HGBB 5K9KA 4NNPL 1QSEE 1YECL 2ICCA 2DQDH 4OF6A 4XWOD 5FCUL 2VLJA 4JKPH 3OXRB 1GGBL 2FWOB 1JTPA 1QNZH 4LLMB 3TBYB 3EYSH 3V79C 3UTPD 5HYIA 3SDXF 1QQDB 3C9NB 4KHTH 4YUEH 2H2PD 4P46A 2EE2A 1RK0A 5C07A 5FK9B 3O3UN 3MLSH 3EBAA 3SDDD 4N9OB 4WUUD 4Y16A 4RISH 1DQML 1RURL 3RGVA 2CXGA 3QQ9C 4PRHE 4LLWB 4MLSA 4CU7A 4F57L 4Q6IB 1IQWL 4HC1L 1VADB 1ZA3B 3QXVA 3GIVB 4X9HA 2FJGB 4BK5A 3B3IA 4P2YA 5F1OB 4FFZH 4XZUA 2R1XB 1N26A 5CZVL 5F7EL 4G6AC 4ERSL 2V5MA 4NGHH 4KPHH 3W0WA 1BAFL 4FRWA 4K9EC 4P5TC 2IWGA 2B7DT 4KK8D 1W8OA 4JKPL 4F7PA 4PRDA 1I4FB 2IF7A 1AE6L 5C1MB 43CAA 3C60B 2DTSA 3EYSL 4HS8L 3MYJA 5JOFA 2BSED 4JPWL 4Z76A 3JVGC 4XTRC 4NUJA 3IKKA 5TGBA 3INUL 3WL9B 3Q6FA 5EH1A 4ONHA 4WFHE 4JHAL 5J1SC 4LRIC 4U7SA 3PWJA 4PREB 4RX4D 1CFNA 1VESA 1J7VR 1JIBA 1CZ8L 1I7UB 4KJYA 4YXLH 4JPWH 3VGFA 1LO4H 4UIKL 2W07A 3SGJA 3FB8A 2F53E 2VH5L 4U1NB 2OR8A 3ALWA 3OKKB 3UZEA 4JZOA 4M1DL 3IDYC 5DI8B 4AEIH 4WI2A 3UCRA 1ODAA 1D3CA 4IJ3B 1CGSL 4FFYL 2R29L 2QL1A 4G8GD 4KDWA 1T03L 1I3UA 1N5AB 1HCVA 3O3AB 4JM4H 4NQEA 5DFTA 5EUKB 4I3RH 4WI4A 1WJ3A 3MJ9L 5EOTB 5CMAB 4OCRL 4WTZA 4DVBB 1ULVA 3CX5K 4PJCE 3WFEL 1NBYB 2MKWA 1YEIH 4WHYH 3MLUH 3MLZL 5CP7B 5MEOA 3SE3C 1T6WA 3Q3GA 4X7SL 5DD5L 1Q9WB 5T1MB 2YKLH 3HR6A 3OKDA 1U95A 2MHAB 2VSDA 4P2QA 5DJZA 5HYJE 3LKQA 4G8IB 5E94A 1MCCA 3VFOB 1SHMA 7FABL 5DD6A 1CDIA 5GGTL 5MERB 4OI8A 3M07A 3BQUA 4U6VH 4EXKA 1ZOXA 4RGNB 3WDJA 3CK0L 3AU1B 4UB0H 1F00I 1ZV5A 1QBBA 4M61B 3ZZ1A 4EVNB 2FGWH 5D7JB 3BQUD 4P23C 1UB5A 2JCCB 3EOAB 3K80A 5FHAL 2PW1A 4NHUB 2HTLC 3QUYB 5ITBH 2DAVA 3MSPA 4HS3A 3H2WA 3MV01 4DKEL 3HC0B 3SKMA 4MD5A 3TIEB 3ZTNH 2Y07L 3PL6D 4PRDB 1AQKL 3FT2A 5FYLL 1NC2D 3S5LG 2GKIA 5J1TC 3IU3B 1F2XK 5HY9A 3DX7A 2Z8WC 1ZVYA 4OCSH 3DTXB 4JPVH 3HPJB 3ZDXE 3BN9C 3GEWB 3SE4C 3MRQA 1OAYH 4OFIA 4OZGF 4UOW0 4X8XA 3UP1A 5M95B 3MNVA 1SEBA 1CICC 3S5LA 4DKAA 5I8CB 4AENB 1V5JA 5HSFA 5HGHB 5DJ6A 3MRMA 1NUDA 1X5ZA 5F7YC 4WY7L 1TETH 1NLBH 1AD9A 1XF5B 1VPOH 1W8NA 3FAWA 4GAJH 1J18A 4ZUTA 1CLYH 5J89A 1KEGL 4HGMA 3AS2A 4WJ5A 3OHXB 3SDAD 3NIFF 3QEQA 1E28A 3QNZA 4GOSA 3HE6A 5KTEH 3TV3L 4KTYA 4MJ5B 4YDLC 3UYOD 2E9IA 3OKKA 1VSCA 3GNML 5TDNB 5SX4H 5JIIA 4IMLB 1WAAA 4NJ9H 2BCKA 4P2RE 4PJXF 4OFYD 1HI6A 4YJZL 4GBXC 4OFDA 5D1QD 1SEBB 5C07D 4CMHB 1V3MA 1QPPA 4MS8D 3GJEB 3TT3L 2Y36L 5L8LB 4ZAKD 3W9EB 4P5TA 5ACMA 4GG8B 3GMQB 4LCUB 1A14H 4LVNC 3ZKQD 3TIEA 1WAAF 3WUWG 2H2PC 2JF1A 5HHOA 1NBZA 3F12B 4XC1H 2I07B 4EI6B 2EEBA 4XAWL 2KPNA 4PYHA 1ZHLB 3W5MA 2HKHL 1FFPA 1MF2L 3C6LB 3ES6A 1D5ZB 1PZ5A 3LQMA 1AGBB 3EYUL 1JGVL 5F7FA 3I2CH 3NZ8A 5HHQB 1ZT1A 4PRBB 4OD3L 3UTOA 4M3KB 4QRQA 4GKOA 3CFKA 2I60H 5K9OA 1JN6B 5EO1B 2X6MA 4IRJD 1A6TA 5FYJD 2QR0A 4MWFA 3FZUC 3OKDB 1XGPA 3ORJA 4QOKB 1CFSB 4PUBL 3PWUA 4U6HA 5C0RH 5C0CD 5BOZG 5FYLD 1WT5A 3FO0H 3MR9B 4QRRE 1SJEB 4U6XA 4QTIH 1NGQH 4HEPG 1V7NH 1MJJA 5DS8A 1YECH 4L8SA 3OGCA 4PTUA 4D0BB 3K2UL 3SGDH 1IGFL 3IF1A 4PJIE 3QIWD 4XVSH 4HGWA 5ID0A 4U33A 2WUBL 4XNMB 4A2MA 2AW2A 2UZIL 1MHEA 4XPAL 3VRLF 3PQYD 2R0WL 4AT6B 1P84J 4OTXL 3ZMRA 1R3LA 5HDOA 1FYTB 1MJ8L 1QHOA 5IEHA 3DX9A 5D7LB 3ZL4H 1ORQA 4JHWL 2GTWB 3D0VA 1B90A 4K55A 3QIWB 2GSIA 4DCQA 4JO3L 5JW4R 5JQHC 1QR1B 3QRGH 1KIUA 1F4XL 5DQ9B 4G5ZL 3V6ZB 1QFWI 4OSUH 3RWIB 4CVWA 2NXZD 5TJWK 4ZFZA 1R3HB 4YPGB 3CFIC 4Z5RB 2GEEA 5DRZB 1JNLL 2VXVH 3HCVB 3NPSB 1ZLSH 1GC1L 4NO5A 4K07A 1Q1JL 4BSJA 3V0WH 5JXAL 2EICA 3R4DA 3JTTA 4QRSA 5JHLL 4LNRB 5TQ2L 5GZND 4E41B 3BUTA 4YHZH 1DQJA 4AG4L 5I73C 3QG7H 3O3EB 5HYJA 1IBGH 1LK3H 4ZSOA 3BKCH 4RFNC 3DHMA 5BXFB 4H26B 4R3SB 3SE8L 5AWNH 2ZUVA 4NN5C 1W2KT 4U1JA 5I0DA 2MTPA 1F97A 2L0DA 5JA9A 1FPTL 5FUZL 3FB7A 4N9GA 3GMPB 1GCFA 1DVFD 3W9DA 4JVPA 4ZAKB 4EBQL 4V2CB 2OMNA 3HG1E 3S97C 1QRNB 3U36A 5KN5A 2YBRA 2E7BA 2WM0A 1RZKH 4PLKC 1LEGB 3ZHKA 4NM4L 4P9HC 1AGBA 3P4MA 1FNGB 4P46B 2B8OT 1PYWA 4AH2B 2O26U 5GSVA 3LEVL 4G3YL 4JFOB 3QDJA 4LBEA 2H1PL 5FIEA 2X2YA 3RU8L 3V6ZA 2AV7A 4QRRB 1PSKH 2P49B 3RI5F 1A0QL 1EAPA 1RZGB 3MROA 4QXGL 5I73B 5C0EA 4JGUA 1TJIH 2FD6L 4J7RA 5LAXB 4MD0A 4X7CC 1NFDB 3UROR 3MBEB 1T2QL 5DUPL 3AB0B 3CLFH 4QHKI 5C0CE 3C09B 1YQVL 2DJ4A 3G9VA 4JJ5A 4PRNA 3VXUA 3RGHA 4X5WB 2VR4A 3K7UA 2XG4A 1I3GH 1QSFE 4GAGL 3WXVH 3R8QA 4OCYL 4HGWB 1DL7L 2PKDA 2UWEF 5I1CL 3BXNB 4HCRH 3F62A 1OWWA 1B88A 3CSYB 2XZQL 3DXAE 4OGXL 3FO9B 4IHOB 2WBJD 3FFCE 1RZ8A 1MIEH 4U6XB 4D9LL 3LEYL 4XP6L 4ZUVA 1AGDB 4RMWA 4N0UB 3GUTB 2E6QA 5IHZA 1IL1A 1VDGA 4UIKH 2X4SB 1LO3H 1R3IL 3QNYB 3OR7B 2KH2B 4LCCA 2RFXB 4P4KD 1UWGL 1CL7H 2UUDK 5HHOD 4Z6AT 2XKNB 3MRDB 4MAUH 2YOCA 4NZUH 4Y4FB 5L9DL 1QSZA 5TDPA 4P4KA 1P6FA 3BJLA 1JF6A 4YDVA 1GIGH 3FAXA 1I1FB 4F33A 1JPSH 3BDYH 5E6IC 1QA9A 5JIKA 5GS2D 4U0RB 3RHWF 2FO4B 1PLGL 4OCMC 4C54A 1KNOA 4ENED 1UC6A 1VPOL 4HUMB 5ESAB 2QADD 1QSEB 3HPJA 2OP4H 4KRNA 3UDWA 3FQWB 3TO4A 4Y1AD 5IF0B 2HT3C 1IM9A 5EO0A 3QEUA 4H5SA 3QWQB 2CPCA 2LVCA 4FMKA 4OZGB 2OL3L 4AEHH 3VU2A 1RVFH 5GS1C 2VXSL 2O61B 1WCQA 1KTRL 4LSUH 3MV8A 4CRPA 4OZFA 3U46A 3L7EA 3MRGA 4HDIB 4CNIA 4H1LH 5CD3B 3CFEB 5INCB 5ITBL 1IAII 2MCPH 2B4CC 3GFUA 2JJVA 3CZJA 1CDBA 1A3QA 3T3MF 5J11B 5EU6A 2VH5H 2X4RB 3SBWC 2JB6A 4S11A 2Q86A 5BV7H 2EH7H 3QDAA 4J3WA 4DGIH 2DKUA 4BFBD 2OI9C 4KRPD 1EGJA 1SJHA 4QF1A 5CP7A 1NCTA 3BVNB 4Q0XL 4R8WH 3BKYH 1TZHB 1NBYA 5EB9A 5TE6L 3RKPA 2CDFA 1NCDL 1RQ5A 1OGTB 3SE9L 1ZS8A 5DLML 4CMHC 4S1QL 1DTUA 1MFCL 4XWGH 5IG7B 3VXNB 3KYMA 3LRHA 1ITCA 4Y88A 3ULUE 4PJ9D 2FR4B 1SBSL 5L2KE 3WO4C 1NGXA 3PL6A 5J1AA 4BZ2L 5F44A 3BHBA 2BSTB 3DWTA 1C08A 4JQVC 5AZ2L 5HVGB 5ALBH 5D1XB 3O2DA 5HYJD 5EU7C 4EI5C 5CCKL 2ZCKL 5C0RL 3N9GL 1U58A 3CFJB 1CGWA 5IEKB 3ZKSD 1DEDA 2O5XL 4LCWB 2EDBA 2XN9D 4M61A 4WTZG 4YH6A 1RZFL 5DT1L 2DMBA 2L4OA 1IJ9A 1MFAL 5HGAB 4PV8A 2H32B 5F3HB 4JFEE 2VLJE 1F3JA 4HPOL 4CMMB 2Z93A 3RVTD 1Y6MR 5K33A 1J0YA 4MQXC 4G8GE 5DWUL 5FOBA 5K93A 3W39A 5GPRA 3CUPB 1OTUD 3O6MH 2VXQL 3P4OA 5JOPE 1S9VA 4XPFL 3TA3A 1TVHB 1XMWA 2FATL 3QUXC 1UJ3B 5I75C 2P8PB 2VE6B 1HSBB 1QKZL 3V4UH 4LGSB 1CDJA 3TH3T 4U1LA 1KPVA 5JHDA 1AXTL 3QXDB 1KCSH 5D1ZA 1HH6B 3BIKB 3ARDB 4LQFH 4NKMA 5F7LB 2O5YH 1KB5A 4OBSA 1KCKA 4KQ3L 4LCIL 5D1ZD 1TJGH 2Y7QB 4KKBD 4ACPA 3VJ6A 5T1DL 4QXTB 4UIMA 3ULSB 4YLQT 1IGTA 3K0WA 1J1PL 2NQCA 1OAKL 2D7QA 3EDEA 4OCXL 4Y8AA 3BUYB 4HKBB 3AFLA 4RGOH 1HH6A 3BIKA 3THMH 3JV6B 1ZSDB 2VZUA 1TVHA 4L8CA 2UY7A 1RY7B 3JWOC 4LMQI 3VD9A 1XIWB 2AQ3A 4BA8A 3LN5A 5IBTL 4BSWB 3RGVC 3ARWA 1B6DA 2K7QA 2M1KA 2FYYA 2LAAA 4EBQH 3D2UA 3S37H 4ZXBA 2BRRH 3SKNA 1F4AA 3M45A 1FZOB 4HLZG 3WS6A 5EZJB 4PBXA 1LO2H 1NDMB 4N68A 4RGMC 3L3HB 2OQJB 1J8HD 3MC0A 4LP5A 5CZXD 1PX4A 2OR9L 4NWUH 5T3XD 1O5DT 4YR6A 4PLNC 5TFSL 4Y1AA 3EDKA 1SBBA 1W72H 1H8OA 3O9WA 3ZTJH 2PW2B 3LKOA 2VXUL 4OZFB 4R26H 3U46B 1I7ZB 5D8JL 4PP1D 1IGCH 3RGVB 4RMVA 3EIFA 1ZWIA 3O6KH 4XPGL 3HR5A 3GSWB 3QDGA 2BSSA 2BSTA 1QPXA 2JB5H 3DV6A 5B8CA 1CLYL 1KEGH 4YHZL 5HVWA 1MCEA 1YN6A 3RVUC 1FJ1A 4HJJH 4XNXH 3BWUC 4MXVF 5GHWL 2OJEB 5C0DA 4UDTB 3T09A 2VQTA 4OZIF 2YZ1A 4L29B 3D85A 5K9KB 2C7UA 1OGTA 4HS8H 2YZ8A 1K2DB 1JV5A 2EH7L 4ZUUB 2CJUH 3GRWL 1N64L 15C8L 5H37H 4JRXE 1I1FA 1QFUL 4F33B 4RMSA 4NRXA 1BM3L 4W4OC 1MCBA 1M4KA 1MJ8H 4GKZB 4P9HL 2DIJA 3ZYZA 1QNZL 1IEBB 2UUDH 2R0WH 3GJFA 4KJQD 3ROLB 1CFTA 2V7HA 2VDOL 5E56A 5I16A 3NPZB 4G9FB 4K7PX 4PGEA 5ERWB 5EUOA 4JREC 2LE9A 2VXUH 3DLQR 3OR7A 3EJZC 2AXGB 3VRLE 4M1DH 2AK4E 5BV7C 1EK3A 4PR5A 1G7JB 2A83B 3QFDB 5KBNC 1OPGH 2H6PB 3KXFD 1EHLL 2SEBA 3FO9A 4IHOA 4BKLA 1K6QL 5JIPA 1BOGA 1HH9B 3HG1A 3UPRB 3GBMH 3MLTB 4O58H 4AMKL 4O2CB 2YUXA 5I19H 5E1HB 2RCSL 3MYZA 3H9ZA 5IBUB 5D70L 2HFGL 4NRZB 2XZCL 1S8DA 4ODSL 4BSVB 2X4PA 5LCVH 4ETQB 1T83C 3DUSB 3OJVC 5ISZB 4XMLH 3UC0H 5CILL 4YGVB 3UTTA 4K8RH 3NCMA 3ZKXB 3DNKA 3RZCC 2EXWC 1NGZB 4M5ZL 3GMLB 4IRSA 2E7LC 3ZYOA 3SPVA 2QQLL 4WHDA 1T0MB 3MRFB 2YUVA 2X4TA 4DGVH 2BNRD 4L9LA 2HVJB 1DZBA 4V1DB 4HUUB 3GBNL 4HKJB 3B43A 4IRSD 5IP4A 1I3RA 5FGBC 3HPLA 3C5ZC 1PYWB 5C0IA 1GHFH 4P5MB 1V8HA 3MFFB 3IETB 4HIIA 4ZYKB 2NNAB 5J9PB 5B4MD 1IL1B 4I4WA 5E2TH 1MI5A 1NGYA 4ZAKA 1LO4L 4Y16D 4JRYB 1WWCA 4CVXA 1NCCL 3U7YL 2OK0L 3EFDH 5DO2D 5D8JH 5JHDD 3NCJH 2YEZA 3TGXA 5CD5D 2AV1A 1HEZA 3CH1B 4JRXB 1U42A 5TH2B 1XGTB 1JGEA 5GRJL 1X5YA 1PLGH 4U3CA 1HXYA 1LVEA 2X4QB 3GI9H