4X6BA

Bk6 tcr apo structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
201
structure length
196
Chain Sequence
b'EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha
molecule tags Immune system
source organism Homo sapiens
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
total genus 40
structure length 196
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA02
4LQFH 1IFHH 3NAAL 3CFEB 3PQYD 4S0SD 3RWCB 3TVMA 1T5XB 4M62H 1P84K 2V2WB 4JPIB 3WSQL 5H35B 1I7UB 1MJ8H 4KJPD 3IJYB 3TN0B 4GRLB 2EDRA 3MCKA 3PXHA 1F4YL 2E6JA 3GJFH 3DXAA 4JR9L 1XFPA 3PQYB 4U1MA 2WIIA 4MB4A 1OGTA 1QRNE 3ZTNH 5SWSB 4XPGL 4C54A 1DZBA 3LPWA 1ORSB 2EO9A 1J8HB 1B3JA 1KCRH 2CGRH 2FBJH 5CILL 3T0DA 4K3DL 2DQJL 4CVZB 4X6DF 1KT2A 1L7IH 4X99B 5DQ9B 1RI8A 5E94B 4PJAF 5JXAH 4UNTA 1F6AB 3MUY1 4K23L 1T04B 1T3FA 3FQUA 1QP1A 1JGDA 5HI3D 2O5YH 4FMFA 5ALCH 1CXKA 3P9MA 3SO5A 4GG8B 5CD5C 3HC0A 3B5HA 4HIHB 3QIWB 4JG1H 4POYA 3NA4A 2VXUH 5D6DA 4LFHD 5TDOB 2OTUA 4GLRH 4UQ2B 1CGTA 1MCOH 4JAMA 4NP4L 4OD1H 4LKXB 1A1NB 1NJ9B 2PXYC 5KSUB 2IWGA 3K46A 4L5FL 3BIBX 1D6VH 2A77L 1A47A 3TNMA 1FFOA 5GRVL 3WFBH 1RUMH 1UZ6F 1QSEE 2Y5TB 5GRJL 4G6KL 4G80A 3BQUD 3RX5A 1ZA6B 4YO0A 3DYMA 5EZOL 3OZ9H 5E6IC 2UYLB 3LOWA 1YNLL 3CUPA 1U3ZA 4TRPH 1IEBA 4XPTH 2V2TB 4QHMA 2ICES 4YDIL 3G6DL 4ZUUB 4H0HB 4CMHB 1KXVC 1U2CA 1WWWX 4H8WH 1W0VA 3GRWL 4NC1C 2GTWB 5HSFA 5MEOB 1V8HA 1KB9K 2O5XL 3H9SE 2ZUTA 2CKBB 2H1PH 5EIVA 1AQDB 3AM8C 1NUFA 2E9JA 5C0DB 5SWZE 4KRPC 4MAYC 4PB9L 5TQ0H 3SJVD 1DFBH 1XGQA 2BSSB 4P23B 4PJ5D 3W9EA 4DKFL 1OL0A 5I74C 4YO0B 2YMXH 3D2UA 4YHPB 3V0WL 3TA3B 3BZDA 3O2WH 1MHEA 4OF5A 4XH2B 3GI8L 5T33H 4LEXH 5IMKB 2FX9H 3K1DA 1CIDA 1ZLVK 1RFDH 5M95B 4BKLB 1C12B 4JN1L 2YXMA 5C0CE 2RAMA 2DWEA 3D39A 4KUCF 3GJEB 2VLRD 4H25A 5TE4L 1JNNH 3TZVA 2IGFL 2W0KA 3DNKA 5DT1L 4UT9L 1CD0A 4M7JL 3MRQA 1F58L 5MEPA 1NAML 4NDMA 1F11B 25C8L 1GGBH 1MREL 3BIKB 3ULVL 1N4XH 5JIKA 3LKPB 4HS6A 4F33B 2NY0D 3QXTA 3LQZA 1KLUA 4H1LB 1IC5L 1A2YB 1X9QA 3CGTA 3OBAA 1R5IB 5T1KB 5F88B 1NC2D 1IMHC 3JTSA 3VFWA 2NY6D 1PQZA 5I9QC 1NANH 2D7TH 1RMFH 1GVIA 4AENB 4ZUVA 3C2AL 4KKLC 5ICYA 4RMQA 4F7CB 3O41B 4HK0A 4NO2A 1BZ7A 5L2KB 3P9MB 5DR5L 4KRMB 4GMSH 1NAKH 1F4XH 1I8MB 3KYNA 2EYSB 4GQ9H 3G9VA 5ILTL 4L4VA 2VDQH 2B1AH 2P5EA 5D1XD 4PJXF 4ZNCD 2P8PB 3OAUH 1U8LA 1IGTA 2PR4H 4NHUA 2XTJD 4GRLA 1LGVA 4H25B 1ADQA 2MCG1 2YD8A 3TO4B 1MPAH 3BZ4A 2PKDA 1E4KA 1P4IL 1BP3B 1NC4D 4PTTB 3L3GB 2FEEL 2V6HA 5ADPL 3DURA 1NCTA 2NY3C 4YFEA 1G9NH 2CK0L 5GRVK 4XAKD 3T0VA 4FG6D 2WW8A 4QXGL 3VXSE 5I1AA 4RSVA 4DW2H 2RCSL 3DX8B 2NX5A 2GUOA 2XQYG 3IETA 4NQSB 4OCWL 4Y4KC 5DD1L 5BVJB 4HAGA 4YHPA 1J1OH 3O3DA 5K9KB 3KYKL 1EO8L 1W72A 4YPGA 4I3GA 5HGHA 5HHQA 2OSLB 5JW3H 1I4FB 4M1CC 4RAUB 4OF3A 5JOEA 4FA8A 1YJDC 5FDWA 2NXYD 4ZUSA 1Z5LB 1KCVL 3RX8A 4UT7H 5C0RH 4ZSOE 3E3QE 1A7BA 1YN6A 1ZSDA 4JZJC 3WUWG 5C07D 2DQCL 5HYJE 1YEHH 4HDIA 4DGVL 4MXQD 1SBSL 5I0DA 1CLOL 1WAAA 3NCJH 3P77A 1MCWM 4GW4A 4YHNA 2YKLH 3DHMA 1UH2A 1JNLL 1MREH 25C8H 1KJ2H 5E2TH 4ZO7A 1T0NB 3STLB 5KS9E 3QHZH 4XP6H 1WISA 4UNUA 5C86A 5TGBB 3MRHA 4JFZH 5F70A 3EO0B 2J2ZA 3ARDC 1ZHBB 4X6CA 3TNMB 3NCBB 1N7MH 4U1GC 4OFVA 4H20L 2ATKA 2DM2A 1OW0C 3CVIL 5I8KH 3SOBL 1U92A 2HT3D 1A6UL 5C2UB 3ULUL 4L3CB 1A6WL 2OQJA 3GSWB 4OZHF 4K9EL 3QIWA 4OCWH 5B4MC 4DN3L 1V7NH 2BX5A 4HXAH 1Q9LA 3DMMB 3KPNA 1AGCA 1HINL 1BLNB 3B2UD 1FV1B 4NCC2 1OOAA 4S1SL 3RP1A 2G75B 4XNMA 2SEBB 1R3HA 3QIWC 5DD6A 1NCNA 3QDJB 3HI5H 1P4IH 3QWOB 2DLHA 3JWDH 4TVPH 4F9PA 4CDHA 4E5XB 2NY3D 1QSEB 3IFNH 3S35H 3BT2L 3SDCC 4LSSL 4OLZL 3LN5B 3UTTB 3BZEB 1KPUA 3GMQB 3C08L 5D71H 4XZUB 4LDLB 3T77A 2BY2A 4HMDA 1CLZL 3UBXG 2Y9RT 4Q6IA 2VO5A 3GBMH 4TNVK 3TYGL 4PP1C 5TQ2L 3QJHA 2P5WE 4OGAC 1G6VK 4OZFA 4ZTOL 3FQNA 5J13C 1FNSH 5KSBF 1CE1L 2LQRA 3QIUB 1WCBB 4HIXH 3C8DA 4I18B 2HWZH 2P5WA 5GJSL 5E7FA 2K1MA 1QO3B 2VXQL 5BV7L 3ESVF 5GGSA 2GITB 3F12B 1NFDE 4W70A 4IRJC 4W4OC 3O3DB 2CDEA 3ZHKA 1BEYH 5I74B 4JFFD 1HWHB 1GPOH 4HKXA 4JVUA 4OD3H 4HC1H 4OCLC 4CW1B 5FO9A 1PG7X 4LLWB 2EEAA 2PW1B 2CJUH 4YHIB 2ADGB 4QWWD 1CE6B 1EHLH 5TQ0L 5IVZA 3TGXA 4PV9A 3KWWB 3MA7B 1DQQA 2GK0A 2FEEI 4DW2L 3U1SH 1RJZB 3BMWA 3T4YA 3BDYH 4B50A 4YFDB 4FQIL 3SE9L 4RNRA 3VFVA 1JWUB 1T1YB 3MV7B 2AJZA 5ANMA 1CI5A 4PD4J 2GJJA 1BLNA 4O02H 5C0BD 1VESA 2OBGA 1MJ8L 3ZHDA 3U2SA 1J88A 3WDIA 1QR4A 1MCPL 4JR9H 5TDPB 3DETD 3NVQA 1Q8MA 3SY0B 2FSEB 4JDVB 2IH1A 2N7BA 5HHPB 4P2OA 4Q2ZB 3MRFA 3RHWK 5ICZB 1DQQB 2GK0B 4QRRB 3BEVB 1DBJH 2JELL 1PX3A 1M6OA 1YNLH 1G84A 5BS0A 4NCDA 5C2BH 3OXRA 1GGIH 3EOYG 4YIQB 1BZQK 3GKWH 4TSAL 4I0PC 2IFFL 3STZA 3C6LA 1KTDB 4I3SL 4NRZA 1P9MC 3SDXF 5GS0H 1Y0LA 3MNWA 2ICWB 5KOMC 3QCTH 2R69L 3TZVB 1WWCA 2EIZB 5I18H 2XTJE 4HFWA 5E6ZA 4F2MA 4PRPD 3H3PL 4NKDB 4HJJL 3V5HA 3MCLL 3W2DL 4BH8B 4C59B 4RMRA 4CN1A 2ZNXA 2C3VA 4PB0H 1NDGA 4JPKH 2MKWA 4ZFOB 1MIML 3JTTB 4NRYA 3TA3A 3D69B 3SJVA 4R3SB 1BF8A 3DYOA 2GTZB 4PJGE 3PWPA 2X4PA 5KVGH 3BPNC 4KKCD 3LS5H 2Q8BH 1AGBA 3KPRE 3SKUD 2VKWA 1MJ7H 1S7UB 1TLKA 4PTTA 4D0CB 1IAIH 1CBVH 3VXOA 5C9JB 2OQJB 3GSWA 4NM4L 3DX9B 1L7TH 5DVNA 2V2TA 2IAMA 3GB7A 5ENWB 4C83A 4FZEL 1VHPA 2DWDA 5KOVC 4S1RH 5EC2B 3LQZB 4H1LA 4FTVA 3RWEA 2XQYK 5HVFB 1H5BA 4I13B 4XNMB 5I19L 2D7QA 5IBUB 3V6ZA 2QHLA 5DQDL 1FFOB 1S7QA 2IBZX 4F7CA 4QXTB 2ZSWA 3LEVH 1K6QL 2HT4D 5A3IC 4ZUVB 4ZO8A 1QR1B 1X5KA 2PXYB 3FFDA 5IBTH 3L3JB 4OLWH 2B1HH 3BO8B 4M02A 5CEZH 2IFFH 2VLLB 2X89D 1D6EA 5C0AE 1HSBB 1ONQA 3BXNB 4H5SA 3FO2A 4O9HL 3B43A 1LE5B 1MFAH 4YFLF 5EWIL 3WNKA 3RKPA 2LU4A 1IEAA 1U41A 3O8XA 4ZFGL 4X6FB 2AJ3A 4GRWF 1MJUL 2Q8AL 4X4XB 4G9FA 1KXTB 2H9GA 4RMSA 1M7DA 4ONFH 5DJ8A 4P23A 3LN4A 1FVDA 1Q38A 3HAEH 3IFNL 3VFPA 5JPMA 5C0DA 3DX8A 4GW4B 4QHKJ 2FIKA 3SCMD 1CU4H 3KDMA 2C3HA 4I2XE 3RVUC 1I9IL 2QQNL 1M4KA 1K5NB 1NC4A 1IAOA 2WP3T 3SE9H 1K5NA 1OPGH 1FORH 3D0VA 4KI5D 4J2XA 1NBZB 2P42B 4NOBA 3FT2B 2W60A 1A21A 4HZLA 5JXAL 2FJHA 4HCRL 4KQ3L 5EBGA 1OF2A 4GMTL 4LLDB 3BOVA 3VXTA 4LMQE 2DYPA 4N9GA 4G9FB 2AEQH 1YC7A 1CBVL 3MV8D 4ISVA 1S9VB 3U1SL 3L3DB 4LSTH 3P0VH 3OKDA 1MH5B 2OMBA 1AD9A 1ZT1A 1U3HD 3KLAB 3BXNA 4KZEL 2FIRT 4C58B 1A1NA 1NJ9A 1NGPH 1RSFA 1C8PA 4IMKA 3RUGA 2NY0C 5CEYB 4DVBA 2JB5L 4OQTA 1R3LB 2NLJB 5CP7B 5EORL 5T1MB 1EBPA 3DRQA 1XGRB 3VWKA 2J4WH 3VWJA 4F57H 4FQCL 4XNUL 5JW4M 1MRCH 3E3QC 1GOGA 1EJ6A 3U82B 4DGVH 5EZJB 2HT4C 3U7WL 5A3ID 3D9AH 3KYNB 3W2DH 3CJJA 3RNKB 2A38A 1BZ7B 4F7TA 4Y1AA 5CGMA 4Y16B 5FCUL 5IEKB 4CVWA 2P43B 1ITBB 3OB8A 2NW3B 2VWEC 2HA1A 4D0BB 4O4YL 5IW6B 4RBPK 5LWYL 2CDGB 2MSPA 1JP5A 4ZOEA 3TBYB 1TPXB 1M71A 2VJXA 1U8HA 4WEUD 1G9MC 1MHEB 4BUHA 3PL6D 1ZWIB 1VEOA 4BH7B 4RX4A 3P4OB 1HDMB 2FX7L 4FQIH 1OHQA 4PJ9C 4GBXD 5DJZA 2ICCA 1TMCB 3NZ8A 4L8SC 3RJDA 1W72L 4JFXA 4PRNB 5T1MA 4F37F 1QKZL 2Q6WB 4AL8L 2JJVA 3VGAB 1NBZA 2DQIL 4XP4H 3RFZC 3DO3A 1MUJA 1MWAA 4XBEH 3REVA 3HE7C 1CR9H 1PKQE 5DA4A 5FKPA 5B8CA 1JFQL 3MLYH 4U0RC 2DICA 3K8KA 5SWSA 4YBQC 1KYOK 4JY4B 1X5JA 2F5AL 4P5MB 3W39B 4P46D 4Z9KB 4RMWA 3RA7H 1F4WH 2XYCA 1PZ5B 2AJVH 2XY2A 4R97C 2BRRL 15C8L 2Z0BA 5E70A 5IVXF 4DN4H 4X80L 3C60B 1ED3B 3HC3H 4PJ7B 5BS0B 4ODUB 1KF9B 1DEEB 2R4RH 4BJLA 1BQHA 4YHYB 1MF2L 2DAVA 3K3QA 3HNTL 3HZYB 1J0HA 1QRNA 4F15C 5L2KE 2CMRH 5CBEA 2YA0A 2JIXB 2CMRL 2VLJD 4UDTA 2DQCH 1D5IL 3V7AG 5C0EA 1KEMH 5JHLH 1T4KB 2AS5M 1A7PL 1P1ZB 4KKAD 1DN0B 2OCFD 2VH5H 1CICD 2G5BB 2HRPH 3CX5J 4JANB 2R23A 5ANMB 4EDXB 1RK1B 3T09A 3WD5L 3CDGA 2FGZA 4UZGA 5LAXA 1WBYB 2BNRD 2FECI 3HFMH 2D9CA 4JQIL 3KPRA 3VWJB 1RIVH 1KT2B 3AUVA 4DWHA 2WQ8A 4TVPL 9CGTA 4OSUL 1KCSL 5E2VH 1CGUA 3VCLA 5IWLC 2VLRE 4YDVB 1DQMH 2RCSH 4WFED 5DD1H 4OT1L 1J9CT 4DKDC 1PSKL 3LQAC 4FQXB 1ZVYA 2QADC 1JMZA 2WWMD 3E2HB 4PJ9D 3ULSA 1KELH 4MJ5A 2WUBH 2HFTA 1BJ8A 3DX7B 2HLFD 5IWLA 1NPUA 1A7OH 1B6UA 3G6DH 5IM7A 1OAXL 4PY7B 4NQEE 4WO4C 1B9ZA 4RQQA 4P2OD 2D0HA 1C08B 4LLUB 4IRJA 2R56L 3RL1B 4Y4HA 3F62A 3S96B 3W0WD 1S7UA 3V52L 5DJXA 3HKFA 1J8HA 3OKEA 1SEQH 3QXAB 2F15A 2A6JB 4KI5C 2FZ3B 4HW6A 4JDTL 3SDXE 4N90E 1EGJL 3I6GB 1JYNA 3WXWH 1LEIA 3EOAA 4ZSOA 5JOFB 1KTDA 1HK6A 1FAIL 5JIPA 3RVXD 3IS1X 4KQ4L 1Q72L 5IT2L 5EO1A 1HI6A 2HTLC 4N8CH 3SDAA 3FB6B 3DVGA 1LP9F 4Z77A 4IIQC 2PYFB 3PWPD 4V1DA 3LKQB 2NY4B 1PEWA 5HPOA 2FX9L 2ESVD 1JHTA 3FO0L 1B2WH 5ITFB 3H3KA 4JFYA 3TT1H 3VXQA 4XP5L 4AMKH 2L7JA 3TVMD 2QQKL 1RURH 2ATKB 5DHYA 1TJHL 4GRWE 1WWBX 2BNUA 5IVZB 4R96B 3BH9B 2CO6B 5CBAA 3EJJX 5D5MA 1AC0A 1RZ7L 2R23B 3O3EA 4K3HA 3PNWA 2I27N 2HLFC 4I2XA 5HYSB 4XPTL 3NACL 4WENB 1G7IB 1CL7L 1FIGH 4KDTA 2AQ3A 2YZ1A 2V5YA 4OZGF 3SQOL 1WBZB 1T83A 2UWEB 4AQOA 1KOAA 1EHXA 1OSPL 4LSQH 4PRHA 1F97A 2VISB 3CSYB 1XIWB 1EX0A 3CPLB 1FNFA 4I0PB 5C8JA 2Y36L 3NCEB 5D7IA 3WS6A 4WUUE 2F19L 3BUYA 5D7IB 3AREC 4L4TE 4TUJA 3ES6A 5C0FB 1B4RA 1EO5A 2B1HL 4PUBH 4WWKC 1G6RA 4NKIL 5JXEA 2VR5A 5E8EA 2A6IA 4Z0BH 4M5ZH 3UYOD 1DBML 3ULVE 4P2RE 1YEJL 5T1LA 4XNXH 5I8CA 4X7DC 2XNAA 3WE6B 1JRHL 4P2QB 1UYWL 3ZL4H 5TE4H 1N64L 1X7QB 4HJGA 5EN2A 2E7MA 2UV3A 3L7FA 3OKMA 3BZEA 2P5WB 4M7JH 3M8OL 3O45A 4EI5B 1IQDA 3U48A 4W81A 4WU7B 1BJMA 4M1DL 4LSTL 5F7KC 5GISL 4F8TA 4PJIE 3BQUB 3MRCB 4L3EE 5FF6B 4FABL 4X80H 2N7AA 3B8YA 3N0PB 4JFPB 3VXUB 4PRHB 2R4SH 4W6XB 1UM5L 3SGJA 5E8PB 4KKLD 4XP4L 2BC4A 2C3GA 4QHUA 1JNJA 3U36B 2R0LH 3QUMB 4YGVB 3VW3L 5D2NE 4YHYC 3RY4A 1I1YB 4U49A 4HG4J 4Z0XA 4BQ6A 4UV4H 2X4UA 5CJBA 2XWTA 1VEMA 4YZFE 4X7TA 3LQMA 1AO7B 4RBPH 1RJLA 4RWYL 1CXLA 2RGSA 4F7TB 4XHJD 3GB7B 3D3VA 3RL2B 4I4WA 4C83B 1U3JA 4P23C 3TESA 4IEFB 3GRWH 4QGYA 5FHBL 1IM9A 3KJ4B 4YHIA 2Y6SD 3WL9A 4UILH 3GK8L 1SVCP 3FZUC 4WUKL 1BOGB 3CFBB 1IQWL 4JM2D 3S4SA 4WWKB 1LEGA 1MHHA 4HLZH 1DL7L 2VL5A 3GSQB 2AW2A 2VOTA 4ODVL 2VLRB 3P30L 1A9EA 3HZKB 3LCYA 4M1CD 1S5HA 3NFPA 4DTGL 3D85A 4KK8C 4WTZA 5GRYA 1ZOXA 1RIUL 2QHRL 5DUPL 1RK0B 3C5ZD 1NCWL 1JF1A 3L9RB 4N8VG 1FRGL 2H2SC 4EI5C 4NYLA 3UTSD 5CUSH 5ISZD 4JZNB 4I9WE 4EQ3A 5FA3B 5J6HB 2QL1A 4LSVL 3KPLA 4LF3A 5KVEL 3REWA 5D7IF 5B21A 1AY1H 1IAKB 1J1XH 1NUDA 3C6LB 3MNZA 3LN5A 3UTTA 5E56A 1NGPL 4RWYH 4MDIA 3VMNA 3UTSB 2F54D 3HB3C 4M7KH 4WTXA 4JE4B 4ELMA 1KN2H 3QI9D 3TBWA 5IM7B 2H9GB 4OLUH 5DD5L 1KJ2B 1JWMA 5DD5H 1O7SA 4NNXB 4PJAA 5DO2D 1Q94A 5F96L 1R3JB 3DGGA 3NABH 4D9LH 2DD8H 3GMPA 2A6KA 4L9LA 5F7DB 1P6AB 3VXRA 1FFRA 4Y8DC 2IADB 4U1NA 3I6KB 4OLEA 1EEQA 1KACB 2X7LB 2YUWA 1GAFH 4YHZH 1RQ5A 3SGKC 3OKNA 4N68A 4GXUN 3HZVB 1J05B 4M62L 3QXWA 2IQ9H 5C3LD 5BMFH 1S78D 4JHWH 1S9WA 1B88A 1JK8B 4PRAB 5DK0A 2D31B 4AY0A 2WBJD 5GS1C 4F3FA 2GJ6A 3DTXB 4ODUA 2FRGP 1T2JA 4KVNH 4HUMB 1RUQL 2UVEA 4LBEA 4GAJH 1N64H 2OTWB 4EI6A 3O11B 4ESKA 1W0YT 2AKRB 2PCPA 1FZKA 2AK1H 4TOYH 2VDML 3TCLA 1LO3H 1LP9B 2J6EL 5D71L 5GSRB 4J3WA 2ITDA 3MXWH 4BZ2L 4G7VH 4N9OB 3VFRA 1A2YA 4FQLH 1QHOA 2XPGB 2Z4QA 3S36X 2E27H 1TETL 2D7OA 2WV3A 1UXWA 2VABB 5C0JB 3UBXI 1S5IL 1XF3A 5SWZA 4TVPE 1E4WH 1I1AD 1S7TA 1SVZA 1H8NA 4K94L 1BFOB 4G6AC 3TJHD 3VA2C 1XGQB 3QFDA 4NM4H 4PGCB 4M7LH 3KXFA 5CSBA 1KULA 4AJ0A 2NMSA 4LP5A 2C26A 4JHZA 2CLVB 3T3PF 1FL5B 4Z7UB 4IMLA 1HCVA 4N1EA 3SDDC 5BZDB 2YPKB 3GUTB 5E2UH 3NBNA 1MCFA 3CFCL 4JJ5B 5TJWK 5EA0H 1RUPL 1BZ9B 3H42L 1ZVSA 3S4SG 3DOSA 1TJGH 3S6CA 2X4RB 2ZG1A 3UDWA 2CRYA 4DGYL 3SE4C 4NC2B 5CS7A 1EHLL 1CD1A 1N6VA 1UM6L 1Z2KA 3NH7H 4NQCD 5KW9L 5J3HC 4JRXD 4P9MH 5F89B 1RPQA 5IVXA 4NQDE 2YZ8A 1I8MA 4HD9A 4NFBA 3FN0H 2X09A 4IRSC 5EZIH 2GIYA 1A7NL 1N0XL 1BFSA 1JK8A 2DDQH 1PKQB 4OBRA 4NQCB 2XQBL 4HJ0D 2VMFA 4V1DD 1GC1L 4HKBA 1T7YA 3MRRA 1MRFL 5EOTA 4Y19D 4PLOB 1BIHA 3MJ7B 3VXRB 4PJHE 4JFDE 4M00A 3S7GA 5FECB 5KBNC 5C0GA 3C08H 1O7VA 1RUAL 4XBPB 4GKSA 2QSCL 3STLA 1SYVB 3W5NA 3QIUD 4Y89A 1DVFA 5IEHB 4MCZB 5JA8B 4BFEA 3BP4B 1ZVSB 4FFYH 1YNKH 2DWEB 1T2XA 2L4OA 2GK2A 2FJGB 2WM0A 3PGDB 3BT2H 3JWOC 5J1AA 3EW3B 1SM3L 4N0FA 3B9DA 2C3XA 4OKVB 2W91A 3BKMH 4U1GB 4CRPA 4MD5B 5E2JA 2H8PB 3QUZB 1HHIB 4B5EA 5ILTH 4XX1G 4YR6A 4PP2A 5EBWB 2E8ZA 1MI5E 3IAQA 3DSFL 3ARGC 2MFNA 2FJHB 4GW1B 3DXAE 2BNQB 2D7TL 2EXWD 3QP3A 2IG2H 2YEZA 2BHYA 5JW5B 1ZMYA 3MRDB 3O3AA 4JZNA 4ONGH 1KBGH 1RAMA 4FXGB 2F5BH 3IKCA 3I2CL 3NZ8B 3ZKMC 2V5TA 4OLXL 4AM0B 1MLCA 3N9GH 4GRMA 4Y5VB 4M93B 1ZANL 3KPQB 3SGEI 1TZIB 3C87A 3O6MH 1JNHA 1QFWH 4L3EA 5JLZA 35C8L 5TPWL 2A0LD 4M6AA 4WWID 4OCXL 2WANA 4XNXL 4NZRH 1V05A 2PO6D 5IT2H 4P2RA 4PJ7E 4CADA 3TN0D 3HI6L 5GGVL 3LH2L 3MGOA 1UENA 4QTIH 3B9KC 4JO1H 2J88L 1ADQH 3LQAH 5SV3A 1MFBH 3BW9A 3WS6C 2BSRA 2PYEA 3NIFF 5LGJA 2ZCHH 5DRWB 5GZNC 4PRPA 5FYLH 1HNFA 3KLDA 1N5AB 3PWLB 4LU5H 1KJVB 1CFNA 4E42B 3RL2A 4Z7OE 3T0EA 5EU4B 1F6AA 3NMEA 4WJ5B 2R56H 1JPTL 4Y2DA 3UTQB 4KROB 3WJJA 3Q6GL 5CKGA 1JWSB 5JPNB 3SCMC 4BUGA 3EYOA 5T1DH 4JGJA 5E9DB 2ZNWA 5ADPH 1QNZL 4D3CH 1ZT1B 3KLAA 1ORSA 4ODTL 5GGSY 3ISWA 1H0DB 4JM2A 2YPVL 3EYSH 4XH2A 5FUOL 1ZVHA 1XZ0A 3MUZ1 2DB8A 3NCYP 3GSOB 1EO7A 2MPAL 5I8KL 5JR1H 1OF2B 4JDZB 4Z78A 1MRFH 4WFGD 1ZEAL 1YN7A 3FQRB 4FTVD 4C56B 2EDXA 3CPLA 3K2MC 4I0PA 1BBDL 3MV11 1CLOH 3NCJL 4OCYH 4P4KC 4MNGE 2ZCLH 2C1OA 4XPBH 2GUOB 3WIHH 1GOFA 2UWEA 5L9DL 3UTZA 1QSFD 3U2SB 4ETQB 1YMHB 2P45B 1KTLB 3B9AA 2D4DA 3I6LE 4RCAA 4K3EL 5BO1H 1DQDH 1PVHA 3SDDA 4YNYB 4M1GL 1KSRA 3UJIL 2NQCA 1ORQA 1BQUA 5KVFH 4MMZC 3BZFA 2P47B 3BPCA 3O8XD 4OD2B 4DN4L 3OJDB 4PBXA 3WMSA 2ADIB 4NQXB 1RZ8B 1BD2E 1TFHA 1U8JA 2KBGA 4P23D 1J05A 2VDRH 4QYOA 5LGJB 3T3MF 1JHTB 1HOCB 4GG6E 4D2NA 5CJOL 5E8DL 5E08L 5C6TL 2O93L 1A6VL 5I30H 2Q7YB 4LRNL 4DEPB 2KZWA 5ADOL 4PJBB 5D7LA 4XNYL 2IAND 2JLLA 4PB9H 3N1FC 1JWMB 3IGAB 4L8BA 1A1MA 3EUUA 1CGSH 3Q3GB 4Q97A 1PEZA 2A9ML 4QF1B 3L6FB 1NAKL 3BPNB 5T3ZL 1ACYH 2HYMA 32C2B 4LQ1A 4MDIB 2FX7H 4ACPA 1AC6A 2B1AL 2E9IA 5TDNA 3IDGA 4ZFOL 1OLZA 3GSNB 2E9BA 1AKJD 1KTLA 2QSQA 1L0XA 4YUEL 1OQOA 2CDFA 1D5BB 5T5FH 4ERSL 2GJ6E 5IHUL 3V6FA 4KTEH 4B7LA 3D39B 2JB6A 4P46C 4QTHB 2UZIH 3CLFL 4J3TA 4LOUC 4YJZL 4RGOL 2D0FA 2J8UB 3RAJH 1F58H 3LB6D 1HSAB 4K71B 2CIIA 1DQLL 1X3DA 2CIIB 1CL7I 3CSPA 2VAJA 4PRBA 4O2EA 4XTRD 1OP9A 35C8H 4JFHE 4YBLB 2AJUH 5AAWA 5I8EA 3QDJA 4I77H 2R1WA 2X70B 6FABL 4HFWB 4F2MB 4XAKE 1F6FB 1ZLUK 3SGKA 3L5XH 4IHOA 4FQCH 4KI1A 1FE8L 2DLTA 3PHSA 4DGYH 4ALAL 1PFCA 4YAQA 3HRZA 1A3RH 2IMNA 4BZ1H 4R4FL 5HVGB 1G7QA 5AEAA 1P53A 1GAFL 4YHZL 4UINL 1JZ8A 1U3YA 3H9ZA 5INDB 4J3XA 4NHUB 1RJLB 2PW2A 1DVFB 2DQJH 1YDPB 5LAXB 4PY7A 1UEMA 2FR4B 4LIQL 5TE7H 4L4VE 1CFNB 1RK1A 4OLUL 5DUBB 4GS7B 4LEOA 4LGRB 4JCLA 1RU9L 2XZQL 3MYJB 3CFKA 1IKFH 4PGBA 4PRHE 5FYKL 1NEZG 3F7YA 5CUSL 3H9SD 1V3MA 5F6HI 1H3PL 3KR3H 4F7PB 3OB0K 4K7PX 3CAFA 1HXYA 3SGEH 4DUXA 4IS6B 2BK8A 3UC0L 1KLUB 4OCRL 3PWNB 1NGWA 3CLEH 4G8GB 3ARRA 1QYGL 4MD0A 1Z5LA 2AK4D 3QHFH 3D25A 12E8L 5GS0L 4R97B 4RAUA 1MIEH 1AGDA 2DQHL 2O5ZH 3C60C 1Y18A 2Z91B 3V6OA 3S36H 5KJRH 5I18L 4PJEE 4APQA 3TIEA 4QCIA 2AERT 4PJFF 4M8QB 1Q9OB 1HHJB 4JVPA 5HVWA 3KPSE 1A1OB 1GGIL 3F12A 4BSVB 2AK4E 1AGEA 3G6AB 4ODSH 4PRBB 1T1ZB 4X6EB 1TZHA 1GXEA 2XZAL 2WWKT 1DTUA 1F2XK 2VXVL 5ESVB 3IFLL 3EOAB 4RQQB 4ZSOB 2DD8L 3C9NA 4BQ8A 3W9EB 3O4LE 5DD3L 3QUKB 4OKDA 2VISA 1ZWIA 1WAAF 4R0LB 8FABB 1JF6A 3VI3F 1CXHA 3NH7L 1UM6H 2NX5B 3IETB 3KPSB 2LE9A 4OUUA 1ZLUH 2CRMA 1UXSB 1UM4L 3QXAA 3HE6A 4ZS6C 2OXHA 5CIPA 1BOYA 2JKXA 3EDDA 4U2YA 3PHQA 4LIQH 3JSSA 4U3HA 5CEZE 1T03H 1YEKL 3WFZA 5FCSH 3N85H 2R2HB 4XXCA 4HC1L 4P4KB 4A2LA 1QBMH 4HJ0C 1GCFA 2HP4A 2Q8BL 3LS5L 5DJCA 5MP6H 1IZJA 2AKRA 2H2PD 4L8DB 1CGYA 3GKZA 3LRSB 4OM0L 3G5XA 3U83A 2YRLA 3DMMD 1M71B 1W0WB 3THMH 5EUKB 5IW1B 2VXQH 3MJ7A 4WFGE 5LG1A 3NCMA 2BSRB 1DQLH 2PO6A 1B0WA 4WUUA 3QFJB 5F6IB 2HMID 3W0WB 2MHAA 4EN3D 4XCCH 2Q3ZA 5HDBF 1TETH 4ZYKB 1G7PA 1C5DA 3R06A 4YHKH 4I3SH 5L88L 1MFCL 3V6OC 3B5GA 1OD9A 4JLRB 3MRNA 3QCTL 5F8QC 1FG9C 4S2SB 1L0YA 4JQXC 5LVEA 1YECH 4POUB 4RGOH 1EH9A 4EN3B 4RZCA 4NZDA 1F13A 3MRQB 2HJLA 1L6XA 3VWKC 1YPZA 3DUSA 2DQUH 3N1PC 1WV7T 3QEUB 4S1DC 5IBTL 3MRIA 3WIHA 2CXGA 5GS2H 4OF7A 5DFTA 4R7DA 2FZ3A 1TQCB 2R2HA 1N0LA 2W38A 1HHHA 1BBJA 1A0QH 3CCHB 4NQUA 5F6HJ 43CAB 5C92A 4HMEA 1KLFA 1U8MA 2ERJC 1DDHB 3QUZC 1VEPA 1QPXA 5DI8A 3RY6A 3A67H 2CKNA 3U9PL 1LO4H 1XCQA 2HTKC 3FQTB 4OZFH 1IKFL 4N8PA 1F5WA 5DRZA 4X4ME 3LN4B 4OI9A 1CFBA 4UINH 3MV7E 5D2LA 5DK3A 5GRUH 2ZSVB 3G6JA 1HINH 3P0YH 3WBDA 1V7MH 1T7XA 2IBGA 3NFPB 1YA5A 1VADA 4XP5H 4PBVC 3MR9A 3UMTA 5FB8A 4D0BA 4JAMB 6FABH 4P9HH 5AG8A 4O58H 1JYWA 4C4KO 1WSST 2DF3A 5IK3B 1YY8B 4LSVH 5FV1L 3MRLB 4QXTA 3ZT7A 1JJUA 5IW1A 1IC4L 1XIWC 2ZCLL 4X9FA 2R29H 2VE6A 2NTFB 5DXWA 4JN2A 5K9JH 2BVTA 2QBWA 2NTFA 1X5HA 3RGHA 2QSTA 5BOPA 1I3GL 3RX7A 3OHXA 4NPYB 1S9YA 1FAIH 4ZTOH 5INCB 5GS0C 4XCYA 5DLML 4K7PY 4QRTA 1YEIH 5FAAA 3MV9D 3GMNA 1WC7A 3EHBD 2OZ4H 2V9RA 2Y25A 4MX7B 3AM8A 3HC0B 2F19H 2ZSWB 4OZ4B 4X9GA 5F9AC 1MH5A 5T3ZH 1S7VA 2FL5A 5HDLA 4KU1A 3RZCD 4PREA 2P5WD 4F7EB 4GW5A 1AFVH 1H5BB 3TF7C 1QEWA 2IPKB 1GGCL 2H2SD 4EI5D 5JZ7D 2PW2B 5JDSB 3MLTA 1WGOA 4R4BB 3FQTA 1BZ9A 4ZOBA 1DLHA 1MHCA 3SBWA 1JGVL 1CTNA 2OR9H 2QQKH 5E6ID 4PGEA 1KCSH 3X13B 4RFOH 2FX8L 1QNZH 1D5ZB 3EZJB 3V5HB 4BH8A 1NEZA 4C55A 3VRLE 3OKDB 3U0WL 4AEIL 2ATPA 1V7NL 4H88H 1J10A 3KDMB 4JZJB 3EYFB 1YPZF 5ERWB 4K7FA 4PJXB 2ADFL 5BZWB 4NN5C 1JYVA 1KXQE 3TT1L 4D9RE 4G6ML 2ZUXA 4FQ2H 1P7KB 5EC1B 2HFFB 2I07B 3W11D 3TBVA 1N7ML 5D9SB 4N0FB 4R4NC 5C0JA 1C5CH 5JW4Q 3M07A 5ICZA 4MNHA 3P9LA 1XF4A 1BD2A 3CFEA 3J7HA 3MRGB 1SBSH 1EFXA 2IH1B 4AQ1B 1FNHA 4L4TA 4PRDB 4F7PA 2XWJA 3LD8C 4DKEL 1LP9A 1J0JA 5D2LF 4PJHA 3OJ2C 5DVLA 3MJ6A 3TNNB 5F7EL 3HPLB 5F3BA 1OT2A 3G5ZB 4PGDB 3M1BB 3UCRA 3UZVB 4JN1H 3JUYA 2XACC 1A3LL 1OSZB 1KLGA 1N59A 4L8DA 5F7FA 3V4VL 3DRTA 4RGNC 1SBBA 3MRRB 3EHBC 2B20A 5IVXE 3WYRA 4FQHB 2Y36H 4J23A 4JEGB 3UO1L 2V5RA 5IOPA 4Z0XB 4WEBH 5GRUL 2YPLA 1JL8A 1J1OL 1A4KA 4OB5H 4L9LC 3U7YL 3OKNB 5ITFA 2ARJB 4TVPD 3EYSL 4NN6B 3HE6B 4ZG1A 3NGBB 2EYRB 3G08A 1W72H 1R0AL 1E4JA 2FATL 5DGQA 3IS0X 1R0AH 4QYOB 1QVOB 2XKUA 4ELKB 1CK0L 1G0XA 1EAPA 5IB5B 4NNXA 4PJAB 5FA4A 2WSKA 3RGVC 5IF0B 2PETA 4LDOB 4OSUH 1RZJH 3QSKB 4RISH 3UO1H 2VN7A 5E00A 4ZPTB 2XXCB 1T22B 2P8MA 2C4XA 1ADQL 4J4PC 4XCNA 3ARFA 5J13B 1RUAH 1C16A 1RZKC 4GQ9L 4MJIE 1KB5H 2B2XH 1YNTB 2BVOB 4WHYG 4Q0XH 3UYRL 1W8NA 5J11C 3E6HB 1TVBB 3EFDL 3QDGB 1TVBA 4OGAD 3U6RA 1M05B 4N90D 2H3NA 4ZUWB 1DE4A 5ETUA 3QUKA 5DHVH 2DTMH 3UZQA 4V2BA 3QPXH 1ZT4B 1KJMA 5J9PB 2J7LA 4XNQA 1LDSA 5GS1B 1YN7B 3FQRA 3RL1A 4ZQKA 2C4FU 1NDGB 3OPZL 4FNLL 2NY5H 5KN5B 2Y5EA 4NQED 3FCTA 1SY6H 4H5SB 3RWCA 2VDOH 1HHJA 4L29A 3P11L 3I50H 2AJSL 5AYQA 3QHTC 1BOGA 5JQHC 1BPVA 3MNWB 2WIMA 1LQSR 2P1YA 1TJGL 4MGXA 5E2WL 1XF1A 2OP4L 4H8WC 4GSDH 2Z92B 4BK4A 2HJFB 1CYGA 4CJ1A 5KW9H 4EUPB 1QSEA 2WLZA 3BEVA 3RGVA 1I1AB 5E4EC 4KY1L 4M43L 4AEIH 1I1AA 3ZKXC 1OPGL 4X4YA 4KK6D 3WHE1 4EDXA 4ELME 1TDQA 1A7OL 5GGQH 2YD1A 1YEDA 3ZDZF 2Q86A 3U36A 4GMTH 2UWEE 1YC8A 1LK2B 1CFTA 4FFYL 3C60D 1QSFE 1E4WL 3VI4F 1X5IA 4OIIH 5F7DA 5GRXG 1T4KA 2X10A 5C7XH 2KH2B 3I75B 3G5VA 4NZJA 2W9DL 2XWJB 2GFBA 4LPTA 2OZ4L 5I1KL 4HDIB 4LQFL 4JB9H 1KV3A 5HYFA 5I0ZA 3IDJA 3WSQH 2BP3A 1AH1A 4Q7DA 3MNVA 3MV8A 4JRXB 2FJFB 1NUGA 1QA9A 4EOWL 1MFCH 3RJQB 2X4SA 5HY9A 1MIEL 4Z7VB 2D7NA 4NKOA 4YAQB 3HG1A 4HKXB 3U30C 1F6LL 4RAVB 3U0TA 3CX5K 2GAZA 4P2OC 5BJTB 2DLEA 4BELD 1G1CA 1N3NA 1QLRA 2IEPA 1FJ1B 3VWJD 2ZJSH 2DBLL 1P2CB 4KPHL 4U1IA 4XZUA 4WW2A 2IQ9L 3MOBL 5DMGC 1ND0B 4HWBL 3S37H 3HR6A 4ZFFB 3BUYB 3WLBA 3QDMD 2VLJB 2E6QA 3QUYA 4PGZA 4Y5XA 3IF1A 1IL1A 3GSUA 4MJ6A 4UV7L 1V7ML 4JFED 4WJ5A 3JV4A 3O3BA 5T3XD 3QO1B 3V6BR 5I1GL 4NCC1 2YC1A 3S4SB 1WITA 3DMMC 1ES0B 3IDNA 3HS0B 2G60H 1FGNH 3EJZD 4GXUM 5C0CB 2BNRB 5GQBA 1QBLH 2F58H 3O3EB 2IBBA 1J1XL 2F58L 2F8VA 2HLAA 3ILQC 1FLRH 3GBNL 3OG6B 3SGDI 1UACH 3FRUB 1J5OH 2Z93B 1QKZH 1T1WA 5GHWL 5CCKH 3ROOA 4Z6AT 1QQDA 2DI9A 5BQ7B 4E41D 3QIBB 2W9EL 4NNYB 1J0ZA 5FA4B 1KJVA 4WFFD 1UVQA 4ZUTB 3F6LA 1CE6A 4YH6A 3I3DA 3HLAA 5IBUG 4J3OC 5DSCA 1KENL 4IRZH 1A6AB 4HS8H 3FFCA 3MRLA 5ALBL 1UQSB 5D96C 3MGOB 4QOKE 3MOBH 4PJEB 5C08D 1I9EA 3Q5OA 3MRPA 1FFNB 4MD4B 4UTBH 2CLZA 2EDTA 4FFZL 4BKLA 4X8XA 4TQEH 3H3BC 3VFTB 2YD7A 5F21B 4PR5B 4R2GC 4DFHA 3PDDA 2D03L 1JTPA 2Q76B 4JDZA 3AFLA 4LHJB 3RWIB 1HYRC 2A2QT 3RWFB 3GSOA 1OCWH 4LRIC 1KEGH 1LO2H 4WI8A 5D2LB 2DKMA 3WDHA 1KUMA 4MJID 2EDLA 1VACA 4UI2A 4YHNB 2EE6A 3PDOA 2XRAH 5HHXH 4NO3B 1VKXB 2WINA 2J6EA 2X42A 1YEFH 3HUJA 5BOZG 4UIKH 1RZ7H 4XGZA 3N85L 1BREA 1DANT 5EOCH 3O6FB 4U6VH 2BNQA 1D7FA 3Q48A 2BVEA 2HFFA 4R7NB 3ZE2E 4PGCA 5CJ8A 3NABL 1T20A 3QA3B 4MQ7A 4D9LL 2BSSA 3DUSB 3V6OE 5J6GA 1A7RH 5CD5D 4GKSB 5B3JF 1QBLL 3KLHD 1MCQA 2UUDK 1FGNL 2YS4A 2EYSA 1T2QL 3NCFB 1DEDA 5LCVL 5C07A 2OL3B 4RA0C 2CKBL 3LKRB 2OK0L 1G9MH 1R6VA 1AI1H 2NX5E 4GXVL 1OP3H 2H6PA 3VFSA 2VC2L 2WMPA 4QNPE 4I77L 5HPMB 2Y06L 1I3UA 2FJGA 4LSDA 2NW3A 4ZUUA 1AHWA 2JCCB 1IARB 3IYLW 5I1LA 3IFLH 1KB5B 1UKQA 3UPRA 1ZGLM 3AU1A 1VGKB 5FKAB 2EH7H 1K3ZA 2UY7A 4NZUH 4X4MA 1N59B 1OSZA 3OKKB 1CFVL 4Y4FC 1FFPB 1UKSA 1YEGH 3PDGA 2I25N 1NQBA 2P5EE 2WQRA 4KPHH 1K8DB 3QDJE 4W6WB 5KVDL 4FTVB 2PTVA 1SMAA 4LKXA 4KV5E 1MFAL 2FYYB 3QAZC 4HIEA 3LEYL 5JMOC 4I0PD 1S9WB 3QIWD 5KANI 1CVSC 4WW1A 5CGYC 2F9BT 3GJEA 4JJ5A 4CADB 3IXTB 3PP3K 3P9LB 4KTEL 3HS0A 4M48L 2Y23A 1MY5A 4IRSB 4HCRA 3LZFH 4POZD 1NFDB 2IH3A 3U4EB 2XV6B 2E6PA 4HC1A 4PV8B 3CH1A 4YR6B 3UX9B 1U91B 3EYUL 4PV8A 4TPRH 5DRNB 4OQ1A 2YRPA 4K7FB 5E1HB 4LHUD 5GHWH 5CCKL 5I1DA 3AGVA 1D3CA 3TFKD 4KGLA 3V4UL 1U8MB 1WZLA 1UXWB 5E03A 2AV1B 5CZVH 2EYTB 2G60L 5CWSB 5HBBA 4JO1L 3OQ3B 2A74A 1MCEA 2YWZA 5DJZB 5D8JL 1R5WA 1S9XA 1GSMA 5IMOA 4FQQA 1OW0A 5I2IB 4L4VB 3ME0A 1OTSD 4QRSA 4BSWA 4P48A 5JW4N 1OM3H 3D25B 3QQ3A 4UV7H 5AD0A 2BCKB 1GPOL 3LDBB 3ZYIA 1LE5A 3R0MA 1YEJH 5MI0C 5MEOA 1Q72H 1DQDL 1FNSL 4QY8A 4Y4FA 5IB1A 1FFQA 1MHHB 1NGQL 2VLKB 4MB5A 5DO2C 2DBLH 2I9TA 1FGVL 4PJEF 1TVHA 4ZAKA 1BWWA 3IDMB 3O6LH 5E95B 2OI9C 5L8KB 4XHQA 5A43C 2OL3A 3MACL 5D7KD 1XR8A 1KC5L 3IDXL 3NIDF 3P4NA 3V4PH 2VLKD 2FR4A 1UWGH 2Z35B 4I48A 3BD4A 4Z7NE 5JR1L 4WFHD 3VFMB 1RZKL 4KJQD 3PG2A 3VJ6B 5DF0A 5EOCJ 3QIBC 4PJCF 4OLZH 3TIDA 3HMXH 4D0CA 3ECBA 4JKMA 2OTPA 4KGJA 2P8LA 3QUXA 4YLQT 3OGOE 4OLVH 4WFEE 4G42B 4G5ZH 5HJ3B 2DTSA 2VERN 4N0YL 2NY7L 5E8PA 1RZGB 3WIFA 4KH2A 3BH8A 3ZYOA 1HZHH 4I8DA 4JM2F 4LLYB 5I76A 5ITBH 3OTTA 5ITBL 5ISZB 2YUXA 1FPTH 4ORZC 4K3GA 5DJCB 3B9KB 4KRNA 1A6VH 4ZO9A 3R1GL 3C6LD 1TJHH 2E7HA 4QOKD 1H9VA 2YK1L 1FNLA 4JO4L 1A6WH 4WI7A 1A6UH 3ULUH 3SN6N 3I84A 1NC4B 2Q3AA 5IP4A 4LF3B 1G7LB 1QLRB 2WBKA 3BGAA 1Q1JH 4P9HC 1JPGA 4HWEL 3T65A 1KC5H 3IDXH 3BRDA 1Y6NR 4KMLB 2XQBH 4K2UH 2W92A 3LPGA 4X6FA 3O2VL 3D3VD 3LKOA 2DQFB 1ZLWH 5GGTA 3QDMA 1AGFA 4ZS7L 3AS3A 3N1MC 2CDGA 5F9OH 2NY5L 2F5BL 4LKCA 4X98B 3MRFB 3IDJB 1XGYL 1JIBA 1PJ9A 1DQTA 1EO8H 4NWUH 5T3XE 1KIPB 4HWEH 2D4FA 1T6WA 1RJCA 3TYGH 2NY2C 3DO7A 1FC2D 3L3HB 3UJJL 2IAMD 3CXDH 5KSAA 4G43A 1CR9L 3H2WA 3U0PA 4RDQF 2FX8H 1CD8A 4WU5A 4PJGA 4KVCL 1FL6A 4XPFL 5DWUL 4LSSH 3CVHB 3VMOA 3O9WC 3RHWF 1NCBH 3BKML 3ZE1E 1YY8A 3IDYC 5D7SH 4OLVL 2F53B 3UTSA 4OZHA 2IAMB 4GOSA 5BV7C 4HS3A 3HE7B 1R3LA 4HGKC 2CLRB 4F7MB 1HZHL 4U0RB 1QSZA 3SBWC 2APTA 5JIIA 4JY5H 3OB0H 1HWGB 4U6XA 1Z6JT 1FO0B 3C2AH 3PE9A 3KHOA 4NYLB 1BVZA 4R0LA 4DVRH 5I73B 2AJXH 1EMTH 3HZMA 4HF5H 2AABL 1F4XL 5EU7C 4GMSL 1T5WB 4WU7A 1N6QH 3ARED 1U8KB 2PUQT 3BP7A 1IC1A 1RVFL 3QPQC 2NY3B 4MNGB 3FO9A 3FT2A 2V5MA 1WF5A 2C3VB 3VXRD 1P7QD 3BJLA 1DANU 5A2LH 3TLRA 5DJ6A 1AIFB 2YRZA 3CCHA 4IOSD 1CIUA 4JO2L 4LRIA 1YY9C 4KHTL 4ZS7H 4U1HB 2O5YL 2X9YA 4Q6IC 4ONGL 3GMQA 1KJ3H 2KKQA 1LNUB 3EJZC 5CBAB 3HE7A 32C2A 1MCSA 4P4RA 3P0YL 2GQHA 2VNCA 1YEKH 4EBQL 3JWOL 4WDIA 4FQ2L 4X5XB 1C7SA 4G6MH 4U6YA 1D5XB 4ZXBC 5HGAB 1J0KA 1WBZA 5L2KA 2ESVE 5MHSE 4XXDB 3ZMRA 3P0GB 3KJ4C 1FG2A 4NO5B 4UOW0 4QLRA 3QCVL 3VD5A 2DQEL 3K2UL 4XVTH 4XWGH 2YPLB 3QG7H 1VFAA 4NSKA 4WO4B 3K80A 4PD4K 3X11B 3BD3A 2QQNH 3B6SB 1MWAH 4NJ9H 5ACLA 5FF6A 1KN4L 1MIMH 2N1KA 3MBEC 4YXHH 1I75A 3RU8H 3X17A 1ZHBA 3QEQA 3FRUA 1I8KA 1GGCH 1OGAD 2DQFA 1MSPA 3WN5A 2AXFB 5BRZD 5CIPH 5I1EH 1X7QA 3T2NL 3VFGL 4P2QA 4DGIL 1HQRA 4OUUB 3HNSL 3OJDA 3HNVL 4CN4A 4PP1D 2WWKO 3HMWL 4JM4H 4R8WH 2H32B 5EPMA 4EVNB 5C2BL 1MFEH 4OZIB 1U8IA 2QSVA 1N0XH 3QUYB 4QRRD 3SJVE 2YN5A 4LLUA 1YQVH 5I15H 3SO3B 1A6ZB 5EIIB 3ARBB 4J4PA 3RTQD 3WNPA 3ALWA 3BP6A 5J06A 4HHAB 5GGRY 3FN9A 1DR9A 4P5MA 4I3RH 3V5DA 1JZ2A 4MDJB 1MCDA 2R1XB 3P73A 1CVRA 3RVTC 3KLHC 5B39B 4J8RB 4FQXA 3FFCE 1NEZB 4LCUA 1J11A 3CFJB 5IQ7H 3ECBB 4NRZB 5A2JH 5HHMB 2CR3A 5EOQH 4YIQA 2VC2H 3GMLA 4IRJB 4WCYH 1L7IL 1JWSA 3O4OB 3NFNB 5A16B 3Q1SL 1PG7H 3CSYA 4KDTC 2GY5A 4WU5B 3T2OA 1DFBL 4DKFH 1XH3B 4KUCD 4M6ML 3GO1L 3T2QA 3Q6FA 2BHZA 4ZDHA 5EOQL 3MBED 4UQ2A 7FABL 4EEEA 4X4YB 4Y2DC 2Y07L 4YC2B 1R5IA 4KXZI 5DUPH 1I3RB 1RIUH 3QNYB 5I15L 1YDPA 1OTTC 4NPYA 1TTFA 5I1HH 3MFFB 4MA3B 5FFLA 4N0UB 3MLUL 5GJTL 4PV9B 4PJGB 1W0WA 3NIGE 2W0PA 3OX8B 1KEGL 2X1XR 3OKOA 3WLWD 3ARQA 5F89A 3QAZB 1J12A 2PYEB 2DM3A 3ZDXF 1R5WB 4PJXA 4AM0A 4DTGH 1ZGLB 5I71C 2W1NA 4LDEB 1MQ8A 3LKQA 1CLZH 1MFEL 3VA6A 4JZJA 3CZFA 1MY7A 4OD1L 4ONHA 4QRUB 2DMKA 3MODL 2YPKA 4YHKL 3PWVA 4C56D 1OSPH 5IHUH 1EIBA 4M4RA 1QLEL 1YZZA 4LSPL 4LVNC 3RZWA 4OIIL 5HI4D 3FB5B 1F3RB 1L9MA 4BM7A 1BX2A 3RVVD 3D2UB 3MZTA 3TZVC 3P4OA 3K2UH 4XVTL 1WZ1L 5C0NC 1MLCB 4JY4A 4PREB 4KDVA 2MWCA 4DQOL 2EDQA 3TN0A 1JPGB 3EYFA 4RFEB 3SKJL 4GXVH 1CDUA 4WIQA 4JO3H 2W60B 1ZS8B 2DMCA 5MENB 5D7JA 1FZMB 2GTWA 3BYTA 3D2UD 3ZE0E 1MCWW 2GCYA 1PG7L 4KJPC 1KPRA 1U6AH 4H20H 1BIIA 4HKZA 3NGBC 5E2WH 1J8KA 2RFXA 2HTLD 4ZPTA 4FFVC 2YD4A 4XB7A 5DYOB 5E99L 3L5WB 1BJ1H 3QEHA 3BKCL 4PB0L 5MEND 3CH1B 1YPZB 1IGYB 2V7NA 3D39D 4XBPA 2ZUWA 3K4AA 4OAWB 3I6LD 1HKFA 4PJIA 4JANA 4UIKL 1XF5B 4MA3A 3PWNA 4AEHH 4R6UA 1PLGH 3MUHL 4XAWL 4JVWA 4MNQE 3GMRB 1FRGH 1QUNA 1IE5A 5CGTA 3FONB 4OIBA 5DTFB 5I71B 4HIHA 5E1AA 1MEXL 3MLRH 1DBJL 3BIKA 3ARYA 3L3DA 3MV01 3HMWH 4R8WL 5AUMA 1QD0A 5FYKD 4JHAH 3MRKA 3CFDA 1G6RH 4HUWB 4QHNB 5ABDE 4G3YH 3VXMB 3ZDYF 3MO1A 5FYKU 4X99A 5DQ9A 4ETQA 3AU1B 3KYOA 2X4RA 2C7UA 4N1HB 5IB3A 1I1FB 1S9KC 3ARGB 4DVRL 3BGFC 1SJVA 1ZSDB 4MNHB 2QR0B 4XT1C 4PG9B 3DECA 5B39A 5C0ND 3E6FB 3VH8A 2AQ1A 1ETZA 2V5SA 3KPSA 1MWAL 3FAWA 4NJ9L 1U91A 2EZ0C 4X5WB 1DBBH 2ZOLA 3RVWC 4L8SA 4QRPE 5C6TH 1A6ZA 5CJOH 1AQDA 4S1QL 4Z7VF 3HFML 1S7SA 3BYYA 3V4VH 5C09E 3TBYA 3TJEH 5IKCB 4P99A 2GCYB 1UKTA 4ODWA 4JHBA 5I1GH 5TF1H 2R0WH 2GT9A 3ILQD 4P0DA 5J4MA 3RPIA 3FMGL 1KJ3L 5FYLE 2EDBA 3I02B 3IKKA 1F4AA 3ZKMD 5HHOB 5M7QA 3O6LL 4JFXB 1NGZA 3GJFB 3LQAL 4YDLB 2MNUA 4ZTPL 4Y16A 1JMXA 1QFWL 1SYVA 2Z9TA 4P46B 5JDJA 4NQTA 4E42A 1XR8B 4MWFB 3PL6B 1S7TB 3FB5A 1UVQB 1MF2H 4ZUTA 1R3IH 5GGUA 5HHOD 3E2HC 1CF8L 1MAMH 2K9UA 4M6OH 4MX7A 1MFDH 4HKBB 4X7TB 1OB1A 1JPST 2XWBB 4FRWA 1SEQL 2H2PC 2I9TB 2AABH 1F4WL 3UROR 4KROC 2AK4B 3LVEA 3RA7L 3KYKH 1IGIH 2NXYB 4YXLL 1NLBL 1DBKL 5IJVA 1RVFH 1MQKL 3GBML 5IGXL 2X05A 5KAQF 1XCTA 3T3PE 5KG9B 5C07B 3V5KB 3IAPA 5D2NB 1JV5B 3QULA 4XBEL 1FPTL 4BK5A 4K3JL 3V4UH 4ORGA 1JE6A 5I1IH 5LXGH 1JGLL 1TENA 4N0UA 4RMVA 4XVUD 2XFXA 3WLWC 5E5UB 2UVFA 1CD1B 1PYWA 4JM2C 3VRLF 4IOFD 4Y0GA 4FQJL 3SDDB 4FXGA 1QFUL 3O6KH 2A9MH 2APBA 1OGAA 2E5EA 3O3AB 4LASH 4XWOC 4OI7A 4K9EH 2HKFL 4HUKB 2DIBA 2EC8A 5AZ2H 2JIXD 4KK8D 4DCQB 1ZS8A 2WINB 1UJ3C 3L3KB 3KS0J 1FLTX 1S7SB 1JZ7A 3WJJC 4JQVC 1RULL 4O4YH 4M61A 2X70A 2A6IB 5IMLA 3QFJD 3FQWB 4AMKL 4HHAA 2Q7NA 1RZKH 2ORBH 2VSDA 3RWIA 4M6OL 5TH2B 1XGYH 3C5ZA 3FOLB 2VH5L 3KPMB 1XCQB 3HE6C 5F44A 1SHMA 3OKLA 4MSWA 1A14L 4NGHH 4P4KD 2YKLL 3ETBF 5HHPA 1MCBA 4GFTB 4I1NB 5EBLB 2XPGA 2P24A 5I1JH 3LHPH 2P44B 1N26A 1P69B 4WHCA 4Q6IB 1I3GH 2YD9A 2J4WL 3CSGA 1D5BA 3QI9C 4OZGB 3UTTD 1JNNL 3BPLB 4FQXD 1LK2A 1ULVA 2M1KA 4RZCB 4XC3L 1T0PB 1NFIB 3BWAA 4JFFA 2F53A 3QI9A 2F5AH 3EYOB 5E99H 1FNEA 3T4YB 4LCIL 4HH9A 5IW3A 4P2OB 4Q2ZA 1F45A 3AMLA 4PRAA 1RZFL 5CILH 5CGYD 3WJLA 4XB8A 4MMXC 3RI5K 5IFAH 3ARFC 1Q9KB 1U58A 2AVGA 2IALB 4KQ3H 3OWEA 1RUPH 3H42H 5SWSE 4S1QH 3LPFA 1ES0A 4N5UA 2XKSA 5DMJB 2ILLA 3WHXA 5IVXB 1K85A 4Z77B 2GJ6D 3KG5A 4OFPA 1UJ3B 2XRAL 5T1LD 5F1KC 3M45A 4FP8H 1H3GA 5FGBA 3S5LA 2DWDB 2YBRA 3NZHH 1KG0B 2VXSH 3PHQB 4FQLL 5EUOE 2FO4B 4HBCL 1Q0YH 1NL0L 4PTUB 4RMUA 4KKNA 1FZMA 4P49A 5EO0B 1U95B 5DJDB 4PLKD 2R8SH 5T1LB 1I7ZA 3A6CL 2DL2A 3P77B 3L5HA 3U4BL 3RIFF 3MV7D 3HC4H 1U8PB 3QQ9C 3BVNA 1IAII 2ESVB 5EBLA 2OLDA 2O26U 3FCTB 3MV9B 4PG2A 3B5TA 2GSIB 5E5MA 2ID5A 4MNGA 4YDKH 1I7UA 4FTVE 3WLBB 5J12B 3N50A 2GSIA 4KK9D 5E5MB 1N8ZA 5HHNA 2A73A 3VFTA 5CHNA 3WO4B 1JN6A 2R0KL 3MV8E 4I18C 1XIWA 1MCRA 5I76B 3LV3A 5TE6L 2EH7L 1TJIH 1HQRB 4WNQB 2EH8L 3EDJA 1I7TB 2ZOKA 1XEDA 5D7JD 1WFTA 4KJYB 5F3HA 4F80A 4UUJB 3V0WH 3QQNA 3ARFB 2YMXL 4OFIA 3RUGF 1EUUA 1T1XA 5DQJA 1OAQL 4HV8B 4WCYL 4PJCE 3ALPA 2O5XH 5IF0A 2EO1A 3FQXB 4JPWL 3P4NB 3ARSA 5FYLD 5CMAB 3SY0A 5DD3H 3WUZA 2W0FA 2FH6A 3KGRA 1UA6H 2JJTA 5ELIA 3RIAF 4FXLA 4JREC 2CUHA 5CKAA 1E27A 1VDGA 3V8CA 3T4AA 4PGBB 2I24N 4MA8L 3H9HA 1DQJB 5I6XC 1NDMA 4HS3B 2PYFA 4OCSL 2OJEA 4G7VL 3P4MB 4JHAL 4ELMB 3BRFA 5D9SA 3HR5A 3QIUA 1I9JL 3OAYH 3LKOB 4WTZG 1K4DA 2Z92A 4PJDB 4G6KH 1SYSB 4LCUB 5BS0E 1FJ1A 5C1MB 3IJSA 3CXHJ 3S37X 4XBGB 2C5DC 4JRYE 1QRKA 1CZ8H 5DMIL 2IF7A 5MEQA 4JM2B 2R9HC 4KTDH 3VD7A 2DQDH 3LN9A 4UTBL 1C12A 1DJSA 4OTXL 2P7TA 1MCCA 2FO4A 1LILA 3BZ4B 1QA9B 1DLHB 1MHCB 4AEHL 4NNPL 1MRCL 3GK8H 1C08A 2I07A 4JPVL 3OJMB 4E5XA 3P9WB 4DZ8A 3JBG7 1MRDL 4NQDA 2VR9A 2EIDA 2XFXB 2DQEH 1H3PH 4AZ8A 2BVPA 3OR7B 4MD5A 1U8HB 1AD0B 4TTGA 3P0VL 1SJHB 4AIZB 2V2XA 5IESL 2DYPD 4JO3L 2JCCE 3QEGL 3EKCA 5IB4A 3JWOH 5EOCL 4LPXA 5F9WC 4N0CC 1AP2B 1X5XA 1BWMA 2NR6C 3FB8A 4ELMF 4UT6L 3QUXD 1Z9OA 3HI1B 5LJYH 1R24A 3X14B 3BKJL 1GGYA 2BNQE 3CVHA 3ZE0F 3IGAA 3QI9B 4EI6B 4G8FA 4CUCA 4NDMB 1YQ2A 4FXKB 1IGCH 2VITB 1HEZA 4OJFH 5LBSL 5F7HA 5D72H 1KPVA 1YEFL 2EDWA 3WDJA 4KTDL 3GHBL 3QUXB 4K07A 3VXNA 4EN3C 4YDKL 4K8RH 2R2CA 5DK0B 2BC4B 1KIQB 2R0ZL 1PZUB 3VWKB 2OX5A 4ODSL 1KIPA 3UPRB 2KUTA 4TQEL 2HG5A 1HKLL 2NLJA 5CP7A 2BOBB 2O5ZL 4QY8B 4K71C 4H0IA 3TCXA 4YZFF 3I6KA 4MAUL 3VRJA 1IM3B 1K6QH 3T0ED 4M5YH 3D18A 4LGSB 5GS1A 2HKHH 5D70H 4ODVH 1MHPL 4Y5VA 4K9EC 4D9RD 3ORJA 3DV6A 1OTUD 4OZHE 2EZ0D 5D1XC 5CEXA 3DX6B 3O4LD 4XMLL 3HN3A 3CLEL 4Y7MA 5SX4H 2NW2B 1YYLL 1QFWM 3BRGC 4HUNB 1A02N 1S7RB 4Y4FB 1RU9H 5DJ6B 1CDYA 3HZYA 1D5ZA 2EC9U 5K59E 4YK4B 1OWRM 3X3GL 3GMOA 4P5KB 5IHLB 1KNOB 2Z8RA 1YYMH 3CUPB 4Y4KD 1INDL 2AXHA 2AGJH 5DC9B 3VXMA 2AV7A 3MLSH 5CJXC 4OFYA 1RK0A 4LLYA 1E28B 3LEXB 3FO0H 1ZA3B 4RIRB 4JZOB 3O2DH 4QHLA 3GMMA 2Y5TA 2WK2A 1FDLH 2M8XA 1MI5A 4QXUH 2AV1A 4JFZL 3H7BB 5C9KA 5D6CB 1WEJH 4PGEB 3FONA 1BAFH 3UBXA 3C8HA 4GG6A 2ZG2A 3FRPA 2EIEA 5E8OB 5KVEH 4HJJH 4U6HB 5JORB 4M1DH 2QQLL 4U1SB 2NZ9C 2P5EB 4J3SA 4L4JA 4HPYL 3ZYJA 5DZNA 1RV6X 2XA3A 3QULB 3RWJB 4BFIA 5L2JA 3MFFA 3HI1A 4XNZC 1H5BC 2MPAH 5JXEC 3T2NH 4Y16C 4NQVB 3DBXA 4JB9L 1NBVL 1EFXB 1NC2A 2BNRA 1XGPA 3ABZA 3GIVA 5B3NA 1EEUA 2X7LA 3U0WH 1DP0A 4Y1AB 5D7LD 3T0EE 1KPVB 3L1OH 4Z7UA 4YXHL 1T80A 1RD6A 4QRSB 1ZLVH 4BSWB 2AEWA 1CN4A 3C09B 3FRPG 4O2FA 2ZOLB 4S1SH 2GSGB 5D93C 2IANE 3DXAB 3BSZL 1CK0H 4R3SA 2FEDD 3TJHC 2A9NH 4OLYH 1DSFL 4HULB 5KSVB 3GMOB 5E8OA 2NY2B 5FYKH 2Y7QA 1RZJL 5EO9B 4L1DA 2EYTA 4RAHA 4E41B 1IAKA 3I9GH 2ZUUA 4PG9A 1RY7B 3LB6C 5D1ZB 2J8OA 1KELL 5FUZL 5L7XH 3BDYL 4LCYB 1IKNC 3UAJC 2ZZUT 5FM5M 3FJTA 1UB5A 4QHLB 3PDOB 1UCBL 1FVEA 3KYOB 4KDWA 3R0NA 1FQ9C 3LD8B 1UM5H 3QUZD 4NKOB 3SGDH 3H0TB 1U0QA 1D9KB 1JF1B 4XVSL 1RJYA 4JY6A 4F9LC 2IQAA 5FEBA 4ALAH 4CDGC 2BRQA 4IRSA 2ZPKH 1XT5A 4RRPA 4DKEH 2I60L 4YDVA 3SE3C 5JUEL 2NTSP 3LKSA 1MCJA 3U46B 4UU9B 3OMZA 2PXYA 5F7EH 1GHFL 2FDBP 1G7HA 3PABA 4JKPL 5TQ2H 1K3IA 2EDEA 1MCKA 1U8NB 4R90L 1TXKA 1ZHNA 2BVQB 4K2UL 3QPXL 4N5ED 4WHTB 2BNUB 3LS4L 1ZEAH 1TQCC 3U4BH 1RJZA 1KBGL 5FKAA 2RIKA 1OD7A 3ARBD 1CFSB 2BMKA 3KWWA 1NBYB 1VFAB 4WO4A 3UTOA 2CXKA 4ZYKA 3DX9A 4N8VB 4OCNC 3H9SA 3DI3B 5HVHC 3DROA 1RULH 1DEEA 2YA1A 2A9NL 2FEDC 1K2DA 5TFSL 4MJIB 5ACMA 4IHOB 4LEOB 5LQBL 1T21B 4RA3A 1VGEL 3PWPB 2R1XA 3NFSH 5E2VL 1BQSA 4KVCH 1OP5H 4NUGL 5IMMB 3FN3A 1DLFL 3NA9L 3CH8A 3FB6A 3LZFL 3X14A 3UXFA 5FYJL 4OGYL 1ERNA 1KNOA 1BX2B 4X9IA 1FYTA 4X5LA 5DRXA 4FG6C 1TZHB 4APQD 1FIEA 4ZNEA 4LVOB 3TVMB 4KK9C 1XR9B 3SHSA 4AIXA 4OFKA 3ET9F 2NXZD 3SKMA 4D0DB 4LK4A 3VFOB 2VAAA 3CXDL 3PGCB 3EYVA 3FOMB 4TYUA 3MBEB 4NOFA 2Y1VA 2X41A 4AK1A 4G6FD 1RMFL 5ID0A 1A3LH 4APQB 3LH2H 5B38G 1D5IH 3D9AL 2QTEA 3N06B 3EAKA 4X4XA 2JE8A 4YEFA 5KSAC 3MJ9H 2BOCA 4GRLD 1CFQA 1Q0XL 1S8DB 1KJ2L 3EDEA 3QEQE 4OZIA 4NUJB 4G6FB 3HZKA 2W59A 3QNXB 2BJML 3QZWG 3QG6B 1F4HA 4PLJC 1X5FA 1NCCH 1I1CA 3V6FB 2IG2L 2EE9A 4IIQB 1NLDL 2VRAA 3MLYL 1CXIA 4LLQA 3SO3C 2LAAA 4UIMB 4TUKL 2VITA 3DARA 2AGJL 1G0YR 2FGWH 3HPJB 5EUOB 3GDBA 2HN7B 1JBJA 1VB9A 3Q2CA 4LGPB 4LVHB 1FZJB 3NN8B 5TGBA 2YUVA 4L1HA 4WUUD 5JZ7C 3NFSL 2NY6C 2VXVH 2GEEA 3TBSB 4RRPG 2PTTB 1JCKA 2XN9B 1G7JB 1JGUH 4NN7C 1EZVY 1PSKH 5CZKA 3TVMC 1QSFB 5BW7C 2YWYA 2F53E 1HIMH 3BZFB 4D8PB 3OXSB 4NWTL 3SJVB 5FYLL 4HIJA 2VWEE 4Y1AE 4QRPB 5L8JB 5F1NB 4RMTA 2VDKL 4JGUA 3L5IA 2BXYA 4NZTL 2HH0L 4HJGB 5EN2B 1YEIL 3NPSB 2RHEA 1YECL 4CU8A 3HAEA 3VRIB 5J6HA 1EVUA 3W11C 1C5BH 4NZUL 5FXCH 1ZT7A 4IRZL 3F7VA 4AG4L 4UT9H 2ATPB 3VWJC 2GJZB 3F5WB 2C1OB 4POZC 4HUVA 4OLWL 5CEZL 4Y19E 4XMKH 1IGCL 2BVOA 1AHWC 1NAMH 4KAQL 4G9DA 5D1QB 1ZANH 2KQMA 5D1ZC 2IANB 2D9QB 5DVMA 5HXMA 4KZDL 4X6CF 3HR5B 3KVQA 4PRNA 4WWKD 2DS4A 4PLJD 4QKXB 4Y4KA 3DGCR 3TA3D 2X1QA 3BVNB 3VXMD 5IMLB 3EO1A 2OXGA 4PJBA 5T1KD 4MXQC 5D1QD 2VZOA 1EK3A 1YYML 1WZKA 5F9WB 1N5YL 1YNTA 1LVEA 5EBMB 1FZOA 1KPUB 5F93C 1FORL 1VFMA 3EYUH 3VMPA 5HI5C 3PP4H 2G9HB 3MUJA 4M7KL 1P4LB 1OARL 4HGWA 3U9UA 5JPNA 3TBTB 3L5XL 1KCUH 1TNNA 2FWOB 1H8OA 4HGWB 2YD2A 4LCCB 3TO2A 3DUUA 5HHME 3U9UB 4YNYA 2XZZA 3EO0A 1AGFB 3WIIH 3WHXB 2DKUA 2BOCB 2WUCL 1OCWL 3L7EB 2VLMD 1QBAA 3H3PH 3WXVH 5DZLA 2WBJA 2MKLC 1CT8B 1CZ8L 3TNNA 1M7XA 4KK6C 3O9WD 3T04D 4HWZB 3KPPB 4JM4L 1U8JB 4FFZH 1UFUA 2DI8A 4UU9A 4JFPA 5I1CH 4X5XA 4DVBB 4D0DA 4OV6F 4ZFGH 2AXGA 5F9JB 4WGVB 3DRTB 2R69H 4CN6A 4KVNL 5T5FL 1Y6KR 1IQWH 3MLUH 4Y4HB 1CGWA 2H45A 3O45B 3IXAA 3S36L 2APFA 1HSAA 4XPHL 2R2BB 5C0BA 4BQCA 3HZMB 2DMBA 2BNRE 4CBPA 4HUVB 5MERB 4JG1L 4NQSA 3IKCB 1FVEB 4OCRH 1UH3A 3ULSB 2OK0H 5E8EB 4AEFA 2W0LA 2LU7A 4KK5D 1A6PA 1QTYT 1Y0LB 1OP3K 3WV0A 3B8SA 5EFIB 5I19H 3NTCH 4TULL 2W9EH 5SX5H 4ZUSB 1HXMA 2WP3O 1A6TA 1KCKA 4Z18A 5CINH 5BVPL 4QRQB 3IB4A 4QF1A 4D8PA 4MXWH 5IMMA 1PY4A 3VGAC 4JDVA 1J8HE 3JV0A 3TV3H 4Z7NF 4LAQL 4LCCC 1KGCE 2EYRA 3GFUA 5C70A 2XZAH 3MJ8A 4EXKA 5KSUA 5IFHH 5HYJB 3NTCL 4K3EH 2F54E 1H3VA 4WW2C 2BOBA 5FO7B 1DVFC 3JTSB 4YX2H 2EH8H 3MX0A 5K93A 3VU2A 2J3SA 2VZVA 3PP3H 5FGCE 2DIAA 2OM5A 4X4ZA 1NUNB 2D7PA 4OCYL 4NKIH 3UPAA 4QOKA 3T8XA 4FQQB 4XNZB 1VPOL 4PJ5A 3RWEB 5F3BB 2VDKH 4PLKC 1P5VA 5IQ9A 4M5ZL 1PGRB 3DRQB 4Y5YB 4P4KA 3VFWB 3CC5A 2RQ8A 3EYQC 3UBXB 1KPRB 4AYFA 3OL2A 3RPIB 2NNAA 4LVHC 5KZCB 1BD2B 1WFNA 3VGFA 2LV4A 2DLIA 3TT3H 1RZJC 5D72L 1UGNA 1A7QH 2AV7B 1D5MB 3EOBB 1W72B 3E8UL 5EU3A 2IFGA 3SQOH 3ZKND 2IPTH 5FYKE 3S5LG 5FUCC 3DVIA 1JPTH 1Q9WA 2CKBA 3PGCA 3S98A 3MRDA 2RJMA 1L9NA 2ZUYA 2LVCA 5ADOH 4P3DB 3LDBC 3QCVH 3S96A 4HLZG 5F7LB 2BY1A 4R4FH 5C09A 4MXWL 3WNLA 2EDNA 4NO3A 1CLCA 1MFBL 4C56E 3DX6A 3I85A 2E7CA 5MERA 3IJSB 4FQ1H 4JFQA 2Z31D 3VXPB 3HCVA 2IPKA 4BFIB 3P11H 5L2JB 4QHNA 5L8LB 3IVKB 2CK2A 4KXZH 4P2YA 2NPLX 4W4OA 1UWEH 1JV5A 4WFHE 4KV5F 4Z8FH 4NZRL 4OIAA 4PLNC 4HIXL 1F3DJ 4LLVB 5ICYB 1XGPB 2AI0H 5F7UA 1TITA 4I3RL 3DBXB 5JMRA 4LCWD 3FFDB 4XMKL 5JHDE 4MS8D 3N9GL 5JO5A 1IEBB 4O5LH 2EDHA 4KFZC 4P2RD 5J3HD 3VFSB 5AWNH 1WBYA 1MI5B 4Z0BL 4JQXA 4YUEH 5F1IA 3QQ3B 3VXME 5L6YH 5E6YA 5F1IB 4ZXBD 4LCWB 1QSVA 1KCVH 1NGXA 3DUUB 1QFOA 1FO0H 4PYGA 4GKOA 3A6CH 3S35L 3VXTB 1J0YA 5IK3A 2PNDA 3U46A 5AYUH 1CDGA 3AB0C 3MJGX 5J56B 3VXOB 5C9JA 4ZDHB 5C0CA 3PL6C 4ZXBB 2PO6B 1LK3L 1FYHB 1RIHH 3HUJB 1HYSC 1HNGA 1TTUA 3NACH 1A3QA 3IFPB 3Q5TA 4U1KB 4HKJA 5I1IL 5LXGL 1D9KA 1YEEH 1H3UA 1MPAL 3SPVA 3SEPA 1M7DB 4LRNH 4XVJH 5I30L 3VI4E 5DRZB 4X6CE 4RFNB 3VGEA 4LLMA 2DLFH 5HHMD 4PRIE 1NCBL 1JPSL 5F1OB 4HKZB 5FOBB 1II4E 1S7XB 4IRJD 3ARDA 3S34H 4WEMB 1IAOB 1CDBA 2VLRA 1U9KA 3TZVD 4CMMB 3TPUA 4FABH 3H6JA 1DBAL 4WW1B 4RFEA 2K7QA 1Z9MA 4HWZA 3MLTB 1ACZA 5DJDA 4OCXH 1YMMD 1SJEB 1MVUA 3IU4H 3GNML 3HLAB 2BSTB 2GW5A 5FECA 1NFDA 1UJTA 4OLXH 4IOIA 5ANME 4EVNA 3EIFA 3CDCA 4GQPH 4G6JH 3B2VH 1D6EB 3MLVH 3B6SA 3MRPB 2G9HA 4EIZC 2FD6H 1RFDL 2F8OA 2JCCA 5B38A 3IJHA 5T1KA 2QJDA 4EXPX 4PJXE 5IUSA 4L9DA 1BMGA 2IAMC 1FAKT 2IALA 2EIBA 3QNZB 5GGTH 2R8SL 2FO1A 2ORBL 5CZVL 2A6KB 2OTWA 5FUCE 1J0IA 3NA9H 1FFPA 2AJXL 3B3IB 1MJJA 5GGRA 4JO4H 4J4PD 4NKMA 3T3ME 2WUBL 3WKML 1V3LA 3HPJA 4ODTH 5EUOA 1OAZH 4ODHH 4XCFH 2VLJA 1Z0MA 2IANA 2P4AB 3C8KA 4NQDD 3SCMB 3RUGB 1A9BB 4RFNC 4K3JH 1GOHA 4R2GD 2J8UF 5J89A 3MYJA 4QHUB 3ARXA 3O9WA 1L6ZA 3F7VB 4AH2A 3MJ9A 3OZ9L 4ISVB 4Q9RL 4MDJA 3HAEB 3QFDB 4XP9H 4NQDB 4I0KA 1EDQA 1KIRB 1OLLA 1CGVA 3D69A 2Q20A 1PW3A 3B2VL 4S10A 3MNVB 3MV8B 3H8NA 4X6EA 5SWQA 1HHGB 5L6YL 2IC2A 1A8JH 1LEKA 3SDXA 4QTHA 3WFBL 4NN5B 4Z7QE 3BN3B 5DT1H 1F8TL 2NZ9D 4GRWH 3MGAA 4AIOA 4CU6A 3THML 1FVDB 4ZPVA 3LAFA 2R2BA 1NCUA 4NHCH 1IC4H 2BRRH 5I1JL 3FO9B 4HPYH 4MCYB 1T66C 3NN8A 1AI1L 5F1NA 4PJ8D 4LAQH 2OJZL 5EORH 3ZDZE 4PPTA 3N1GC 1R5VB 1EXUA 3K1KC 1WWAX 3R06B 2HG5B 3ZTJH 1X5ZA 5IFJB 4XX1E 4Q74A 3RWDB 2XKNA 4KKAC 1A4KB 1WT5A 2HVJA 3Q5YA 2CGRL 5TDNB 4PY8J 1KCRL 2ZP0T 2ZG3A 3MROB 3VFVB 2X40A 1REIA 1HHKB 4MVBD 3ROOB 1WT5C 1HHKA 43C9A 2JCCF 5DK2A 3WEXA 4X7FC 2CSPA 3U0PB 4HT1L 5KTEH 5EIQA 4WI2A 5FO9B 2HFGH 3GJFK 5B39G 2ESVA 1I7TA 2XA8L 4AIZA 2MQCA 4U1JB 4U1LB 2QADD 2R1YB 4IDJL 2BERA 3OR7A 2EXYD 3OR6B 3I02A 2CDEB 2CD0A 5DVOA 3MTRA 4BZ2H 1HHGA 1I3VA 3ULUD 2X4SB 5HY9B 1F02I 3QHFL 1F90H 1FCGA 4G7YL 4Y5XB 5HGBB 3TFKC 5D7KE 1BM3L 2IQAB 1HILA 2QADB 5FK9A 3JWNC 1AR1D 2J8UA 4ZPVB 3RWGA 3WIIL 5DJAA 4M4PA 2A1WL 2X4NB 1LEGB 3BEWB 2I60H 4YHMH 3TYFB 1FP5A 5K33A 5I1AB 3CFIC 1U8QA 2J8UE 2QQLH 3O3UN 4OKVA 3KPNB 4JHWL 2ARJA 4HFUH 5IIEA 2ED9A 3PIQA 2OZ4A 4HLJA 3MQIA 2ADJA 5EU6D 5C6PB 3TJEL 3B9KA 3VFUB 3VXSB 3L6FA 5DHYB 1U6AL 4Y2DB 3A67L 4TSCL 1ZA6A 2XTLA 4JFEB 1MJ7L 3MROA 2XT1B 1NFIA 4MJ5B 3S97C 3OAZK 2HVJB 5GISH 4G42A 4OZ4A 1TPXC 2VLME 2JTDA 2W07A 2YOCA 5HYSA 1EA9C 3B2UC 5IG7B 1IGFL 3VXSD 5GXBB 3VD4A 2CLRA 4F7MA 3SCMA 4N8VA 3Q0HA 5GIRA 4PJ9B 4YDJB 3L95B 3KPSD 4UAOB 1NCWH 1OTTD 1UYWH 4XCYB 4E0RA 1PKQA 3QNXA 3GSVB 3PGFH 3RUGE 4CVXA 2CR6A 5GGVY 2VXTL 4LKCB 4X98A 4KJQC 3MMEB 4M48H 1Z3GH 3B3IA 3QDMB 3JVGA 1HQ4A 1N2RB 1NGYA 2APXA 1XF2B 3A6BH 1CXFA 1IFHL 4HK3N 4LLQB 2EC9T 3MXWL 4RGNE 5J57B 1WVZA 4XCCL 4JGMA 1PG7W 4OF6A 4K8RL 2PYEE 2BXZA 4O2CA 4YWGH 5BW7A 3SKMB 3RWGB 5JW5A 1VADB 1VSCA 5C0CD 3C5ZC 3CU1A 4N0UE 4YBQD 4IMKC 2EE2A 2WBWB 5KN5A 3TBVB 2CLVA 1T22A 4LLMB 4M6MH 5LBSH 5IR1B 4HG4K 4Y88A 3TV3L 5BMFL 4D94A 3BKYH 4PJ5E 4GW5B 1HHIA 2A74B 2VQ1B 1KFAH 1XZ0B 3RU8L 1RZGA 4GRWB 5H35A 5CD3A 4CMMA 4CGTA 1P4BL 3C5JA 5DI8B 2VABA 1RUKL 3DURB 1ZLSL 3LKNB 3REVB 5KVGL 5F96H 4JPWH 3X13A 1I1FA 4TSCH 1IBGL 1TZGH 3D85D 3VJ6A 3BAEH 3T1FA 3NPZB 3EJYD 4HUUB 4R26L 2C9AA 1JGEB 2ED7A 4MS8C 2XI9A 4MXVE 3TO4C 3D1MC 1G9EA 4UAOC 3IDIA 3CFDB 3QDHA 2AJYL 5F97E 2DJ4A 3WIFB 3PL6A 4JFYB 3QQ4A 4OD3L 2VSCA 4G43B 3OAZH 5L9DH 2GJ6B 4JO2H 3ALXA 3QWRD 5IW6A 1U58B 2DQGL 1QLEH 4U6HA 3X12A 1EPFA 1LO2L 5KJRL 1MLBA 3ARUA 4H1LG 4M9OA 3HNSH 5T3ZD 2YD5A 3QFJA 4OZFG 2HAZA 1YPZE 3SE8H 3FB7B 2JELH 4P5TA 3QISA 4CNIB 5SWSD 1ZHKA 3P2TA 1HYSD 4JN2B 3MFGB 3M1BA 1BFTA 1TZIA 4Z7UF 1RJYB 4JY6B 1T89A 4P46A 5IMOB 5D96B 5T5NF 1AXIB 4LSQL 1R3KA 4V2CB 1MCPH 4WUKH 4MNQD 4PY8I 2FH8A 1UA6L 3AAZA 4LVEA 4GBXC 4UV4L 3OF6A 1XF4B 4XWGL 4PJBE 1B0RB 3INUL 3GEWB 4M43H 1AD0A 1Y6MR 1OTSC 4RIRA 1FN4A 1QEWB 3AY4C 2CJUL 3MCKB 3RWFA 3Q1SH 4GSDL 1NAMB 2W9LA 1NKOA 4WRLA 1IEAB 1RURL 2X4QA 3DVFA 2B5IC 4P3DA 3GGWB 1JYXA 3MLXL 2GHWB 4AT6A 3LMJH 5I73C 4PBWD 4TNWF 1VERA 3MLVL 2OL3L 4OGZA 3HRPA 5SWZD 1C5DB 5E2TL 5CEXB 3EGSB 1WJ3A 1EJOL 3CMGA 5TPWH 4P3CH 1NCCL 3VXNB 4O2FB 4HUWA 4GKZA 4MZ3A 4ORGB 1GYAA 3WN5B 3W9DB 2NZIA 2DJSA 2DTML 4QRPD 3VD9A 5EZJA 1XF3B 5SWZB 1C5CL 3VRJB 1F8TH 3QNZA 3LSOB 3O41A 4HK0B 3LIZL 4LCCA 2HWZL 2APVA 4U05A 1BGXH 3BO8A 15C8H 3CSBA 1VCAA 2AJVL 3WO4C 2XTJC 4NM8H 3RBSA 2FYYA 1LDPL 3W0WA 3HZVA 4XCEB 4EOWH 5FUOH 2H6PB 3ARWA 3QIUC 5DDHB 4XPAH 4M03A 4GH7B 3FQUB 4LBEB 3V6ZB 3EO1B 4GBXA 4JRWA 4TTDD 4XNYH 2V7HA 1RHFA 4MQ7B 5D6DC 3O6KL 3O0RH 3VFUA 4DZ8B 4OZIE 3FTGA 3BDBA 4GAYA 3QDME 2BFVH 4NRYB 2NY5C 4CVZA 3TPUB 4KK5C 2HLAB 2EICA 3T0EC 4TSBH 2VDRL 3G6AA 5B3JE 2X9WA 4YPJA 3PWVB 4QXWA 2APWA 5DZOA 1P7HL 4XPAL 3DSNA 3WE6A 1B2WL 5CD3B 1OTUC 5AZEL 4JQIH 2B5IB 2NW2A 1Q94B 3P73B 1AE6H 2NY0B 3JV4B 4YHLL 2DYPB 1Y18B 4XC3H 4TUKH 4FHBD 3PV6A 1ETZB 4G8IB 1A64A 4FFWC 1INQA 1U36A 1ND0A 1QRND 3ULVH 2BVYA 5E24E 1IGIL 2H32H 2H32A 2JK5B 3WIHL 4PJ8C 1BEYL 4IS6A 3QHZL 1S7RA 2R0KH 5IHBA 3NCCB 3HNTH 3CD4A 3O9WB 1NCAH 4UT7L 4F8QA 1U95A 3BHBA 4PIRF 2XTJB 2Z91A 2WBJB 1FNAA 5E4IA 1T0MB 3RNKA 3FHQA 3RDTA 1K8DA 4Z7WE 3TO4D 3OKOB 5C0AB 5JUEH 5MI0B 4R96A 5D8JH 1J1PL 5J8OA 3D3VB 2LFGA 3QDGD 1W2KT