4X6BA

Bk6 tcr apo structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
201
structure length
196
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TCR alpha
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 196
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA02
4PJ8D 1MJ7L 4YBLB 4F9LA 1RJYB 2DKUA 1CGXA 1HSBB 4NQDD 4RWYL 4I18C 1BFSA 2P48B 3QUZA 3P77B 5E99H 3O3BB 1AY1L 2NY2B 3W11D 4G6MH 4X6CA 2IAMB 4ZXBA 1DQQA 3TVMA 3MLTB 3WFCL 2OM5A 3K46A 3AU1A 5C0CE 1XR8A 3CZFA 1IGML 3CC5A 3U9UA 1RZ8A 1JYXA 1D5IH 4IOIB 4P2OB 4LCCB 1HH6B 1CGUA 5IQ9A 3RGVC 4EDXA 3MRIB 3T0WA 2VDMH 3MGOA 3KR3H 1BHGA 1FDLH 3QQ9C 4WVRA 3TPUA 3SO3B 2O93L 4OQTH 4OZHA 2F15A 1AC0A 5K9KA 5GRVK 1KIQB 3ZYZA 3HC0A 3K7UA 5EZOL 1X4ZA 2F19H 4M93B 3X11A 1IGYB 4E41E 5IW1B 3S88H 1XIWD 3E6HA 3NMEA 4M7KL 5JOPE 4HFWA 1IGCL 1EK3A 5JXED 5IBTL 3UBXG 1M71B 3WE6A 3MODH 5H2BA 1JYVA 1S7QB 3QI9C 2D7TL 2APXA 3UO1H 4Z9KB 2WUBL 3FT4B 5T33L 4LPUA 4XC1L 1NAML 2OMNA 1A6TA 1QSFE 2N7BA 3C8KA 4N0YL 1OP3K 2BHZA 3O8XD 3O6KH 4JB9H 4RA3A 4LIQL 1S5IL 3T77A 1CQKA 3EYSL 3PUCA 5D7IF 2BCKA 4JN1H 4Z7QF 1S78D 3PWPA 3RDTD 2K7PA 5I8EA 3VG0L 4EJ1C 3I2CH 4TUOB 4ZFGH 2EDFA 2X4OA 4JM2D 1U58A 4KRPB 2XN9B 3DO7B 1W0WB 1FPTH 5HBBA 3I6LD 1JTOA 3OJVC 4NQXA 4QYOB 1DQLH 1W72H 1RZJH 3EYOA 5DJDA 1T7ZA 1CE6A 4Y5YA 3QWOA 4JRWA 5ISZB 4IRJB 5IFJA 2ADGA 5D1XD 2HLFD 4IMLA 3V5HB 4PYGA 3LKQA 3G6JF 4MX7A 3LY6A 4M43H 5ADPL 2P8MA 1B2WL 3U7YL 1BX2B 1NSNL 2P5WB 4WO4B 5HPOA 3VFTB 3EJZC 1JN6A 5DJ2B 3MA9L 5JUEH 4JGUA 1NLBL 1UCTA 3N1QC 4Y8AA 3RGVA 4YPGA 1U8QB 1EO7A 1QQDB 3BO8B 3LKSA 5D2NC 4L9LA 4JRXE 3ZYJA 1RVFL 4G80A 5DJCA 1L0XA 1Z3GH 4O02H 5I76B 2X40A 1P7QB 2D7QA 3C5ZA 2DYPD 2C3VB 3DRTB 1FRGL 2DBLH 4Q9RL 4C54A 1AXSB 1N5AB 1TQCB 3QHFL 4K7PL 1W72A 4MWFA 4HUVB 1IEHA 4PRHD 3HG1E 3VXME 4JKWA 1WISA 2ICES 5F3BB 4GQ9L 4BH7A 1KLGA 4R97B 3CDGB 3MV7E 5KS9E 1IQWH 4R7NB 3PGFL 1G0DA 5D1QA 5MHSD 1DEEB 3QPXH 2FLBT 1CLYL 5LG1A 3V6OE 3ZE1E 2NY6B 3DOSA 2OJZH 5IQ7L 2A74B 1HINH 4XCYB 4RGOL 4GG8A 3EOAA 2YHGA 3GBML 4JFEB 2UWEE 3PHQA 2DLGA 2MKLC 4YH6A 1B4RA 5E8DH 5DQJB 5FOBA 2JJUA 3GSVB 3MUJA 4YDIL 3ZYOA 3FO2B 3CVHH 3W5MA 3GMPA 3DIFB 3G04B 3MLUL 2X6MA 3PWNB 3H9SB 4QWWC 1HH9A 5FHAL 3RWGA 3DTXB 2I9LB 3HZMB 3WFBL 4XBGB 4Y2DC 2O5YH 1RZIB 3GKWH 1N0XL 4WHYG 3VGEA 1Z6JT 3KLAB 3BESR 4FQIL 1RHHA 4D9QE 3VE0B 2DI9A 4XNQB 4YC2C 3V52L 1SMOA 4WI2A 3WUZA 3M07A 4QNPE 1IEBB 2V17H 3GSUA 5EBGA 4E5XA 3GIZH 3ZDZF 4YHPA 4HF5H 5HXMA 1BLNB 5F7KC 3ILPB 3KYNA 4NC0B 5D7IA 1EEZA 5IW6B 2CRYA 3RZCA 1QFOA 3P0GB 3EDEA 4AEFA 5C3TA 4Y19A 1JHKL 5DF0A 4BFIB 4XP6H 3ULVL 4HUNB 2FSEA 4LSQL 5E2TL 4HZLB 2AEQL 2IH1A 2VSDA 3CVHA 4DTGH 2KKQA 4DAGH 5HHOD 3NABH 3QNZB 1JNHB 4DUWA 2XY1A 4RDQG 3E1F1 4LVNC 3P4MA 5HHMD 1KB9J 3O4LD 5DHXB 1IGFL 3NCCB 1HEZA 3AREB 5C6TL 5I1JL 3LQAL 1CD0A 4CN6A 1JZ2A 3TO4B 3FCTA 4C59B 4ODTL 5HGDA 4N0FA 4EI5A 1ACYL 5IG7A 1E4KC 5GJTH 1A1OB 3G6JA 3KS0H 2YRLA 1S5HB 4FFYH 4JFZH 4Z7VB 1Y18B 4QGYA 2IBBA 3EOTL 5JMOC 4U2YA 4EDWL 2FGWL 1B0RB 2XZAH 2GITA 2OSLA 2ZWLT 4EIZC 4HUUB 1SY6L 5L8JB 1RAMA 2PTTB 2GQHA 2XFXB 3OXRB 3P9MA 1TTFA 5ID0A 5IJVA 4QRUA 1RPQA 2VQTA 3WIFB 1T3FA 2HRPL 4L4TB 1YDPB 4G43A 3PNWA 5CMAB 4I77H 4UUJB 5IMKA 5EUOA 2NLJA 4QRRD 2QQKH 1OGAB 1KGCD 1YNTA 2OTPA 5C92A 1R6VA 4O58L 1WAAF 4HIXL 1RZFL 1FFOB 3SE9H 1S9WA 5JW5B 2X4RA 1U8HA 1DQJA 1NUGA 1YYLL 3R8BB 2BDNH 3NZ8B 1T1YA 4IMKC 2G60L 5TQ0L 3QEHB 3WFEL 4POUB 5DS8B 4MZ3A 4IJ3C 1D6EB 1ZT7A 3T0EA 2FO4B 2YR3A 1SJHA 4NC2B 3NFNB 4W6WB 2JB6A 3TO2B 3TESA 4HK3N 4LVHC 5T1KD 1REIA 3UAJD 3ARDC 4LAJH 1UH2A 1AD0A 1D5BB 4J8RB 2YPVL 3ZO0A 5FYLL 2Y7QA 3KPQB 4OGAC 4DGVL 1EXUB 3VXPA 1CTOA 4ZUTB 5DUMH 5GZOC 2LV4A 1CZ8L 3I3BA 2FLRT 1XGRB 4E42A 2X7LB 3VH8G 4S1SH 1OTTC 4K9EC 1ZXQA 3ARGD 1EMTH 1F45A 1MHPH 3ARBC 5BOPA 3SDCB 2PKDA 2F5AL 1E28B 2DQGL 1E4KA 1GIGH 1MHCB 2P5EE 3PL6D 3MJ9A 1PX3A 1D3CA 1MWAL 1FYHB 4L29A 2EIEA 4K7FB 4Z77A 3ZTNL 3NCMA 5JIIA 1J1OH 1N3NB 3GHBH 1K2DB 3G6DH 3MRKA 5CEZL 4MNQA 2OLDA 3MMEA 3BGMA 3MUGB 3GB7B 3ORJA 5BVJB 5GRWA 3WFDH 3PXHA 1ORSA 1DBKH 3I6LE 5A2LH 2GJJA 1CVRA 3D85A 1ZA3B 1UZ8B 4IOFD 5E6IB 5IMOA 3D39B 3SEPA 5EC2A 4FNLH 2NY1B 2FX9H 3KPSD 1F2XK 2VLRA 2QADD 2JLLA 3MV8B 4J1UB 5E9DD 4DZBB 3GJFK 1U42A 4N1HB 3MLVH 2DQDL 1AC6A 1CGSL 3O9WD 4KJQD 4AJ0A 4PJHF 3DXAD 1VHPA 4KFZC 4KVCL 2ADJA 1B90A 2F74B 4MMXC 4IIQB 3NFSH 1BEYL 3G5YB 5TJWK 4NNYA 3KLHC 1KCVH 3MLZL 4LEOA 4BK4A 3GBNH 2QLVB 1KUMA 3EO0B 1LNUB 3C6LC 2GJZB 3B6SB 3C09C 1JF1A 1QFWI 3BAEH 4PRHE 4AY0A 3QJFB 3Q0HA 5IBLD 1KJMB 1IC7H 2OCFD 2YUWA 4L3EE 4JZJA 1QRNB 3EIFA 1A14L 1CU4L 1OAUH 1RUPH 3V95A 3DX9A 2E7LA 1HN1A 1CFNB 1BPVA 3OKEA 3VFSA 3O41B 5ICYB 5A16B 3MXVL 1JHTB 1IM3B 1ETZB 1G9NH 1B0WA 1U8OA 3D18A 1UH4A 4FQ2H 3S3PA 5IEKA 1WAAA 1KCUL 2RQ8A 1MLCB 5IVXE 4WI8A 1KG0B 4NN7C 2R2CA 2WMPA 4FQXC 1LE5A 3ECBB 1FL5B 5FOJA 4YK4C 2YMXL 1RSFA 4LQFH 4WY7L 4NKIH 5CP3H 3QUYD 5JNYB 5JZ7D 3CFCL 4YHNA 5JMRA 4OSUH 1MJUH 1ZHKA 3D6GA 1LWRA 2IGFL 2MSPA 5BZDB 2PYFA 5J12B 3DUUB 1NDMB 3BHBA 4OFVA 5IB3A 1X5KA 3BH9A 4TTDC 4H8WL 5IHLB 4JG0H 5H37G 2R4RL 3U1SL 1U92A 4RZCA 1XGTA 3DVGA 5KVFL 4B5EA 4YHKH 3H8NA 1L0YA 4UT7L 5EBLA 3FO0H 3VA6A 1ZGLB 1UA6L 5FDWB 1ORQB 3HKFA 1J8HA 2KH2B 3SDDB 4X6EB 4KQ4H 3V0AC 1YQVH 4LSPL 2OJEA 5E4IA 2F54E 4HCRH 5D5ME 5J1SC 4P0DA 2R0LH 3R1GL 2BRRL 2RFXA 5EOCJ 5KSBF 2CKBH 4HIIB 5CP3A 1XGPA 2CH8A 5DD6A 2E27L 2ZSVB 4JRYB 5L6YL 1MCHA 5HHOE 5BS0A 3OKKB 3SCMB 1DL7H 3V0VB 1KLUA 4UIKH 4OKVA 1FSKC 3B43A 1Z9SA 3QIBD 4DOHE 1K6QH 3O4LE 2EDDA 4XH2A 1VB9A 4JFXA 3FB5A 1N7MH 4PJCF 3THMH 1U8NA 4HS3B 4Y1AD 4XT1C 2C7UA 4X5XA 1NEZA 4M00A 1NFIB 1NLDH 3DRQA 3BW9B 1I7ZB 2P8PB 4KTDH 3MLSL 3KXFB 3GSWA 4ONOA 4MDIB 3TBYB 4KJWC 4J3OC 4PJHA 5HYQA 1R3IL 5D7KD 1TVBA 2PO6C 3LN5B 5F7FA 4ONFL 2CKBA 1MIEH 2A1WH 4M6AA 3SJVD 3TF7C 5CIPH 2X4PA 3FJTA 1BFVH 5IBUB 4MJIB 4U1LA 2NXZC 4UOW1 3BGFB 4WW2B 4Q6YA 5HSFA 4HXBH 2CUMA 3RUGB 3ZKXC 1OAQL 3PP4L 4QRRE 2ITCB 4ELME 2YD9A 5HI4C 1KGCE 2OTWA 2VH5H 3MV9D 3LPFA 3REWA 5F88A 4Y16D 1NKRA 4P2YA 4PLKC 3ABZA 2VAAB 5D7LD 2DWEB 5MERB 3JXAA 2A6KA 4GKSB 1FVCA 2BSRB 2OX5A 2CR6A 5JIKA 4HW6A 5FV1L 3BPOC 1F4AA 3AB0C 4PRAA 4I2XA 5TE4H 1T21A 3HCVB 4WIQA 2VUYA 5F7UA 4HEME 5CD5C 3D3VE 3QRGH 1OD7A 4XWGH 3VD5A 4J3UA 5DMIL 1RJZA 2CRMA 5HDOA 3VXRB 3L3HB 5CIPA 4MD0B 5HI3D 3KGRA 4RFNC 3M1BA 1F4HA 4P23A 1R3KA 4P57A 1NMBH 5L88L 1X7QB 4V1DD 3BPNB 2C1PB 5D4QA 5CCKH 4HWUA 2G9HA 2FJFA 4OZFH 1WTLA 3VD9A 3U6RA 1QLEL 2EYRA 4U0QB 3WNOA 5D1ZD 1BM3H 1Q9WB 4FZ8H 1OAXL 3QG7L 5TGBA 2VLJD 4M7ZC 1EHLL 3I85A 1E6JH 4XRCB 1INDH 2B2XL 4S1QL 5I6XC 1GPOH 5JW3H 3DV6A 4U7KA 4Y4KD 3B2VH 3EOBB 1CICD 4XNMA 1NBVH 4Y4HA 3VCLA 5ALBH 1KJVA 4LSTH 3IDUA 1PQZB 4OV5A 2PNDA 1D5ZB 4GKNA 4OAWA 2FIRT 5GSVB 3I02A 2PYEA 1JHLH 1QSEA 1R5WA 2EYSB 5I1IH 5E2WL 2IWGA 3HNTL 3UCRA 4EBQH 3MRCB 4ZS6C 5D70H 1YMMA 1JTTA 4PGDB 5KSBA 1JGUH 1IAOB 5JQ6L 3EJYD 1CD1B 5D96C 3W9EB 4N8VG 3WIIH 4PBWD 5DXWA 4HV8A 3X13B 3T2NH 4Y4FB 5HGAA 4YFLI 5MEND 5ECJE 3KPSE 1CE1H 2FB4L 2CDGB 3FT3B 4K3DL 3DI2B 4Z0BL 1N2RA 4UB0L 3VXOA 5JQHC 3DV4B 3QWQB 4DN3L 4UAOC 4JKKA 4QXTA 3FFCD 5E08L 1U8IB 2W9LA 4W81A 3RWHA 1DBMH 4XHJD 5DZNA 5HVHC 5GS0C 3O6LL 1LP9B 4LPWA 1A22B 1OW0A 1MCJA 4Z7WB 1K8IA 3RI5F 2DQIL 1NDGA 1SEBA 2Q6WA 2C9AA 1CDCA 1Q9KB 1Z0MA 4PJDB 5SWQB 1I85A 5D72L 2VL4A 4TOYH 3CH1B 3LKRB 2L7JA 5T3XE 1H3PH 1G7JB 5AYUL 1O5DT 1NCNA 3KPPA 3I6GA 3U0WL 3SDAB 4K94L 3W2DH 3NPSC 2AJYH 3O2DH 3HAEG 4C83B 2FECI 3TV3L 4WTWA 3RY5A 3HI6H 1G7IB 3OGOE 4HK0B 3WHE0 1FFPB 3BQUD 3QUZD 4GW5A 2OXGA 5A2JH 3Q6GL 3ZE0F 4MQ7A 1I1RA 1I4FA 3L5XL 4K2UH 5F7WC 4FQHB 5BV7L 2X42A 4ZXBD 1MIMH 1ZGLP 5DJ8B 1A9EA 1PY9A 1IAMA 4P46B 3AS0A 4PJFF 1OM3H 5DEGB 2V5TA 1H3XA 3QFJB 1AFVH 4EN3A 4ENEC 2MQ3A 3TIDA 2FNBA 2PTUA 3VXUA 4PJ5B 3SKOB 3LVEA 3IFPB 1IBGL 2P49B 2YSSB 5INCA 4CN4A 1H0DB 4RGMC 1ULVA 4TUJB 4ORZC 4U05A 4JHWH 5HD8C 3CVIH 3FT2A 3UDWA 3HLAA 4G6KL 5GRJH 2IANA 3Q5OA 1CF8H 4I5BA 5KN5A 2C4FU 1O7VA 5EZJB 4CNIA 4MJ2A 3DECA 2HG5B 2IADB 2XNAA 4XVTH 4DK3A 1N64L 4Z7UF 3KPOA 1DBBH 4LPXA 3QZWA 3UTOA 3DX7B 1MFDL 3HI1A 1XCQA 3OR6B 1UM6L 5KSUA 4ZAKB 1MFBL 1EJOH 1FE8L 4FABL 1BQLL 1ZVYA 2CKNA 2YD8A 4L4VA 4C56B 2F5BL 1XMWA 3VXSB 2X41A 1A7RH 1KBGH 3BEWA 5CBAB 1NAKH 1UWGH 2VDNH 3IDIA 4KMLB 4XP5L 3DWTA 2CDEB 4XAWH 4FZEL 1H5BC 1AXTH 3LQZB 4OLXL 2J8UE 1SBBA 1YEIH 4LBEA 1E4XI 2EDJA 2O61B 1GAFL 1GRWA 2JCCE 3QIWA 3P4OB 4B0MM 1HHJB 1T80A 4PB0H 5JW4Q 1TVDA 1NC2A 3MYJB 1A5FH 4OF8A 5C0DA 5JDSB 5BXFB 4Y1AE 1BZ7A 1BOGB 3O4OC 4OTXH 4U1MB 2OR9H 1A47A 3RL2B 1WC7B 5FA4B 2YA0A 2H1PH 3IAQA 5K9QG 2F58L 1RUQL 5I30H 2ZSWB 4ZFOA 4XB8A 1INEL 3VGHA 3UYPA 3UTZB 1OQOA 4ODXA 1IILE 5DVKA 1CD9B 4W4OC 1IFHL 5D7KE 3V5DB 4JO4L 3U2SA 1B6DA 3DGGB 3MUZ1 2KZ1B 2EE3A 5B39G 2X05A 3SJVE 1J0IA 5DRZB 1HSAB 3RGVD 1UKSA 3BP5B 3QEUA 4PJFE 2NTFB 4P5MB 3QQ9D 1MCWW 3O6MH 5AZ2H 3O0RL 1OCWL 1BVLA 3KAAA 3DPBA 2E9JA 3QEQB 2E9IA 4KPHL 5JXAH 1WV7T 1EO8H 2PXYB 5ALCH 1YPZA 1RK0A 5FYJH 1PG7H 3TBWA 1HWHB 2DWDA 2XPGB 5HJ3A 5CUSL 4YDLB 1UM4L 1C16A 1MAMH 4GBXC 2HLAB 3MPCA 4KKCC 4XPAL 5D7LE 1S7RB 2JF1A 2H2PC 3UYRL 3K8LA 5SWSB 1ZHBA 4HWBH 1NBZB 1ZWIA 4TRPL 2DRUA 4TNVF 4UU9A 4GT7A 1IM9D 1TQBB 1D5MA 3BP6B 1D5XA 3KG5A 4IHOB 1MUJB 1YEGL 1MCIA 3MXWH 5KOVC 3IJYA 1BGXL 3KS0J 4HAFA 5T5FH 1MEXH 5IB5A 3QCTL 3RNKB 4HULB 1KEMH 1KN2L 4S1RL 5FO7A 2DLFH 3OF6D 2DQTH 2XA3A 1ZSDB 5CJQH 2ZCKL 5CHNA 4NHUA 3WD5H 4NQCB 4GXUN 3P3YA 2CRZA 4ODVH 4MS8D 5E0QA 4J23A 1U0QA 1F8TL 4QXGL 4PJGE 4PTTA 4RAVB 2E7HA 1A6WL 4D0DA 3C60C 1QTYT 3GM8A 2AV7B 5AUMB 1WGOA 1QLFA 4I0PB 4OCWH 3CIQA 1NMAL 2X10A 4Z7UA 1DLHB 3BVNA 4FP8L 4HWBA 3O2WH 1DQDL 5DQ9B 3RU8H 3TN0C 4UTAL 4PUBH 2PN5A 5ACZA 3ZZ1A 1F6AA 1QO3A 3Q5YA 1G0XA 3OR7B 4MD4A 1G7MB 2UVFA 4OBSA 3V4PH 1YEDB 3IKCB 5JHLH 3NCEB 4XMPL 3FRUA 4MMZC 5I8OH 5DJ6A 3UTSB 5C3LD 1HNGA 3L95B 2RAMA 1EEYB 1KIRB 2H45A 2A73A 1XZ0B 2MOVA 5EBWA 1CXIA 5KJRH 3QEGL 3TVMB 4F7TA 1RULH 3W39A 4LRNL 5MENE 5JHDB 3RKDD 1J1PL 2FCBA 5ITFA 3BN3B 4YXKL 3CZFB 3CC5B 1U3HC 1RZ8B 3C8HA 5LXGL 3AM8A 3HFML 1RK1B 5F96L 1XF4A 4P9HL 1S9XA 2J5LC 3FFCE 4HMCA 2EDNA 4GRLC 4LPVA 2JK5A 4M6OH 3OKNB 2M8XA 1WT5C 4HPYH 4EI5D 1TPXC 1P4IL 4JG1L 1FG9C 1K9TA 4P2RA 4F58H 3CLEH 43C9A 1RHFA 2QSTA 4XNXL 3X11B 3VW3H 5F3HA 3I3DA 35C8L 3E6HB 1CDUA 3G08A 5EWIH 5HYJA 2LU3A 4UT9L 5E4EC 4NJ9L 3VRJA 2X4UA 3MJ6A 5FGBA 4Q6IB 4YAQA 1P84K 2VDKH 1F3DH 5E2UL 2WINB 5I16A 4WCYH 3CFKA 2Z8VC 3IT8D 3IYLW 1F5WA 5T1LA 4G42A 5IV2A 5TDPA 3GSOB 1T89C 4AH2B 2XQBL 5F7EH 2XG5A 5ERWA 4LLWB 3O3AA 3ILQC 4GH7B 2YBRA 4F7MA 2LVEA 1ZVSB 3F7VB 4Y2DD 5DFTA 2BCKB 1QFWL 1EJ6A 3IDXL 3QYCA 3K1DA 4HKZA 4OCSL 1JF6A 3S35L 3C08L 4P9ML 4U31A 1JUFA 3K2UL 3QAZC 1GOGA 3HMXL 5I8KH 2FATL 4LOUC 4AIZB 2ICCA 2AEIT 1OGTB 4EQ3A 1M05A 1QSFB 1T66C 4RBPH 1U3ZA 2YPLD 3DYOA 5ESVB 1TZGH 1I1AC 5IUSA 4DVBA 3T0ED 3CXHK 3HR5B 1P9MA 4EKXA 2XACC 3QWOB 3GK8L 1WCBA 5HI5C 1VPOH 4JCLA 2JELH 2R1YA 4H0IA 4ZUWA 3LRHA 2JJTA 2J88L 2GUOB 2O26U 4O51B 1UZ6F 4GG6A 2AV1A 2VDPL 2HT4D 1CDJA 3RFZC 2O5ZH 3KJ4C 2ZPKH 2X4QA 1AR2A 3WBDA 9CGTA 2BOBB 1RY7B 1MFAH 2AXFA 4CVUA 4HG4J 2WZPD 5L2KA 3O2VL 5DJCB 3LHPH 3HPJA 5KG9A 5F1NA 4YZFF 3C5ZB 4TSBH 4Y5XC 1J8KA 1OL0A 1NBQA 1UCBH 2GTWA 4APQA 2VWEE 1GGBL 1W8OA 3LIZL 2AVGA 4JLRA 4OFKA 4MWFB 4UDUB 4DKEH 4L1HA 2R2HA 4O5LL 4XC3H 2YZ1A 1UKQA 3CK0L 3T4AB 1OOAA 5HHXH 4MNQD 4C58B 2GHWB 2C3GA 8FABA 1Q9OA 2IH3A 3HNSL 4R7DB 5DA0B 2NY4D 3RBGA 4IRSA 3QHZL 3D85D 3E8UL 1PG7X 3WXVL 3T4YB 1XGUB 5ESQA 4K8RH 5HVFB 3OAUL 5DSCB 2CGRL 3OAZH 4ONGH 5E7BA 1AHWC 2EC8A 2DQUL 2VLRD 1I9IL 3BP4A 1EO5A 4D8PB 4WWKC 4NO0A 3WS3A 3HG1B 1AIFB 1NGZA 1PKQE 5IK3B 4MB3A 4PTUA 2R8SL 3JV4B 3PDOA 3MOAH 4OD2B 5KSAB 4WEMB 1P84J 1CLCA 2CIIA 4LPTA 4HIEB 1KTLB 1R3HA 2DQHH 3VXQB 1VFOA 4QXWA 1TZHA 4PPTA 1SBSL 2UWEB 4ZD3L 1TTGA 3ARDD 5GSRB 4OFIA 2GCYB 4E5XB 1FQ9C 2ORBL 5E8PA 2R4SH 3GIVA 3IXTA 1HDMA 1NUFA 1VEOA 2A38A 3DYPA 1T7VA 1A8JH 4GS7B 4KROB 2FHCA 4KY1L 4ZFZB 2NY3B 1A3RL 3D2UD 4MJ6A 3X3FH 2PW2B 5DRWB 4Y5VC 1A6UH 4GW1B 4HQQL 3IDGA 1UZ6E 1OTTD 1CIDA 1MPAH 5IIEA 2D3VA 4KUCD 1HXMB 3CXHJ 1QBMH 2A6IB 4FQ1L 2E6QA 1OAKH 1DBAL 1R3LA 5L9DL 3MNVB 4WNQA 1J10A 1QZ1A 3VJ6B 1HEZB 1C5CH 3S3JA 3B3IB 5I1DB 1GH7A 2XI9A 4KJPC 5JA9A 5H35A 4NZUH 5JOFA 2B39A 1YY9C 1IKFL 4ONHA 1HZHL 4K3HA 4NNXB 2E7MA 1CFBA 2Y72A 3OB0H 5CJOH 4NYLA 2VITB 3FB6A 4LSDA 2W59A 5L7XH 5J13B 4YR6A 3V6BR 4X6DA 1RMFL 1UYWL 3PV6A 3BN9C 1X5HA 2V6HA 1AHWA 4JVWA 1VERA 3JZ7A 3ULVC 3VWJA 2EECA 2XWTB 5KVGH 3SBWA 1J8HD 2DM2A 3LEVH 5IJVB 5BRZA 4MAYC 3IRPX 4PJIF 2WW8A 3B9KB 2ATKB 2Z4QA 4WEBL 3L1OH 4ZYKB 1B88A 3T3MF 1UEMA 2X4TB 3PNWB 4UT6L 3X3GL 5D2NE 3KDMA 3VI3E 3WDIA 5FGSA 1OAZH 1F6LL 2VXTL 5I1AA 3NPZB 5C8JA 1L7IH 3LQAC 3BUYB 5BS0D 4CADB 3KLHD 5FM4A 2ZP0T 1IC4L 4WUUA 1QA9A 1OPGL 3C6LD 4YHOH 3VG9C 2NTSP 3VI4E 2IF7A 4D9RE 1T04B 4O4YL 2CQVA 1OB1B 1OF2A 5FUZL 1PFCA 2ZUSA 2VL5A 2B0SH 3S3SA 1TJIH 4X8XA 3C5JA 5SV3A 2GFBA 3TYGL 4DGYH 2P8LB 3PWVB 3VRIA 2DKMA 1U6AL 2NW3A 2JB6B 1PZ5A 3ALWA 5E5MA 1Q1JH 1S7SB 4K3EH 3MOBL 4JKPL 4ACPA 4JE4B 4EXPX 1CGTA 1P1ZA 2IFFH 4OZIF 3CJJA 3S97C 1UACH 4H5SB 5JLZA 5J56B 3MFFA 2R9HD 1KB5B 2Y7QB 3L3OA 2BVQB 3Q3GB 2X9YA 4GRWF 4LCWA 1EBPA 3VXPB 5GRYA 3FQXB 2L7UA 5DUBA 5C0AA 5IOPB 4ISVA 3TA3A 2YXFA 1AGDA 3QG6B 4RWHA 5MEPA 1UT9A 1INQA 3PJSB 4CRPA 4YHIB 1F3JA 1T2QH 4ZOBA 1C5BL 2JB5L 3QHTC 4N90D 1NFDF 5L8LB 4N0UA 4R0LC 2FECL 1OSPH 5GRUH 1NH6A 4RMUA 1WFTA 4JY5H 3WO4C 4LARH 4UBDC 1LO2H 2QKIB 1J05A 4JREC 2YPLE 2OI9B 4CJ1A 3LN4A 3QCUL 3O8XB 2MMXA 4WU7A 4Q0XL 2H32H 4M6NH 3MJ8A 2MHAB 5DD1L 3OG4B 3F7YB 1QLRA 4XPTL 2OQJB 4F7EA 5DJXA 1T83A 1Q8MA 1PX4A 3RDTB 5L2JB 2YC1A 2P5EB 5AWNL 3OAYK 4P23D 3C5SB 2ATPA 3VFMA 1F4WL 2XG4A 4PJIE 1ZLSH 3P73B 3A67L 4ZO7A 3U30B 1DUZA 4QTHB 1J0ZA 1UQSB 1BIIB 1A7OL 3QSKB 1YY8A 1T2XA 4ZDHB 1WUNT 4M5YL 1ZLWK 5JW4N 4OLZL 3HS0B 5A2IH 1KNOA 2R1XA 5LGJB 3GNML 3EZ8A 3ZYIA 4Y4HD 1JF1B 1GC1L 5FKPA 3WO3B 2SEBB 3L3JB 4HT1H 5MI0C 1OARH 2H32A 4WRLA 1PKOA 1QSED 3ZT7A 2VLKD 1ROWA 1T7XA 3IDNA 4WFHD 3RTQB 4RFOL 2NQCA 2YD2A 4G6JL 4JN2B 4MJ5A 1S8DA 1YMMD 3QCVH 3WYRA 5GS3A 4X8JA 1ZEAH 1GGIH 3WUWA 1EA9C 2EKJA 1J0YA 1QYGH 4GRWH 5FK9B 5TDOA 1U8OB 1L9NA 1HHIB 5IEKB 4OZIE 4LAQL 5LBSH 3D5OF 5CINH 3T0AA 1E4XL 4ODWA 2CXGA 15C8L 4FQJL 1URLA 3TBTA 1MY7A 1G9MH 1N8ZB 2HJLA 5HI4D 4MXWH 1ZKAA 4PRHB 3M8OH 4AG4H 2B1AL 3C6SB 3QUMH 4L3EB 3JTSB 1TJHH 1JMZA 1UENA 2P4AB 2WIIB 4YXHL 2D7OA 3ZL4L 2GAZB 3PWJB 3S4SG 3S37H 4LSVL 4TNWF 1VFUA 5IHZA 3PQYA 2UV3A 2NYYC 4OM1H 4UNVA 1UJ3A 3DX6B 1KJ2H 2XRAL 5IB3B 5CD5D 5IVXB 1V3LA 3REVB 4ZUSB 1TFHA 1MVFA 4NRXA 3WN5B 2AJXH 3QUKA 3GMLA 5FM8A 4L4JA 1GVIA 4RZCB 4X4XB 3DUSA 2EXYC 3MRGA 1J1XH 2D0GA 2H3NB 1T0MA 4RA0C 1X5FA 2V2XB 3QNYB 2VXVL 3RRQA 5MP6H 1ZLUH 1DCLA 2B5IC 4Z7NE 4IEFB 4AENA 5TE6L 1T22A 3GSRA 2OJEB 4UQ2B 3QUMA 1NFDA 5EULV 4RAUB 1YNLH 3KYMB 3PIQA 1UB5A 1YN6B 3HRPA 1A0QL 4KUZH 3VXUD 1TCMA 4MLIA 4NCDA 3NTCL 2GT9A 4AM0B 1LO4H 3SDXE 3TCLA 2BNQA 3AAZA 2Z92B 1KJ2A 3G5VA 3V7AG 5IFAL 4Y7MA 5CLTA 5K9JH 5TPWH 1CQYA 4H8WC 3V4UH 4M1GL 1MAKA 2IAND 1KC5H 4HJ0D 4KDTA 3VWKA 4ODUA 3BYTA 4ZS6D 1KFAL 4X7FC 1NEZB 2D0FA 3STZA 3T65A 3MBEA 1QBLH 1LK2B 3RY4A 2F54B 4R90L 1SYVB 5D8JL 3S5LA 3ZKMC 3DRQB 3FOMB 3HPLB 1DP0A 3EAKA 3K8KA 3VD4A 4Z5RB 3T0BA 3E6FB 2AEPH 32C2A 4WI4A 3BOVA 2YKLH 4M61A 4WDIB 4DW2L 1AO7E 1CXKA 4LVOC 4OLYL 1FFQA 3O81A 2XTJD 3O4LB 4DOHB 3U9PL 2CKBB 4L4VD 3LRSB 5FDYA 1MVUA 1A9BA 1EH9A 5CD3B 2XWBA 2GJ6E 4LLYA 5CEYA 4DEPC 1DQMH 3V6FA 5GS0D 2X89A 4HWZA 3FO1B 4U1JB 3CMOH 5I66A 2J6EH 5IHUH 4EVNA 2I5YH 4KHTL 4NUGH 4MXVF 3QUXC 4P4RA 3REWB 5F88B 5IROC 1T0NB 1JK8B 3QIWD 4MNGA 2MFNA 4FRWA 1VGKB 3V4VH 5D71L 3OGCA 5F9WB 4MLSA 3VFWA 1CG9A 4YO0B 1FGNH 1TJGL 1VKXA 3QDGD 1L7TL 3IXAA 5DJYB 5DMJB 3CLFL 3TYFB 5I1HH 2VZTA 4NUJA 2VKWA 1I8MA 1HYSC 1RZ7L 2V7HA 1YEKL 3E2HB 4P59L 1AGCB 3HNVL 4YFDB 1EFXD 3BZ4B 4QRRB 3UXFA 1JNLL 1AE6L 4HAGA 4ENED 3MUY1 2L0DA 1HNFA 2J6EA 2XWJA 1QEWA 1E27A 5J9PA 1LILA 3CFEA 2FEDC 4LGPB 3U6RB 1I1FB 3FQUA 2V2WB 3MLXL 4MQXD 2EDLA 2VIRA 4LLUA 3D3VB 4HS8H 4V2CB 4PP1C 1FFRA 2I26N 5FYKH 4GMSH 3HUJA 4J6RH 1JPTH 1HKLL 3P9WB 5E99L 4UOJA 4N90E 4PP2A 5M7QA 4G6ML 2BMKA 2AGJL 2NY7H 3QH3A 5FCSH 4HKBA 1D5IL 5F7MC 2UZXB 4P2OC 4HLZH 3TBVB 1MHHB 2YD4A 2VDML 4Q74A 4HIJA 2Z31C 3KR3L 1E0OB 3EO9H 5DR5H 4ZUVA 1FDLL 3RPIA 4AT6A 3ARGB 2ARJA 5FEBA 1ZHLB 3SGDH 1G7HB 4OZFB 4XTRD 4P5TC 1F3DJ 2F19L 2HFTA 3S88L 1FYTA 5DC0A 4XVUC 1RQ5A 3VXOB 4PJCB 4X6FA 3UTQB 5FYJD 2KZWA 1HILA 2EC9T 2VXUH 4NFCA 1TLKA 4ZODA 3KPNA 3RL1A 3UO1L 5L0QC 5C0EA 4MXVE 2D0HA 4NN6B 3TNMA 4UI2A 3BKCH 1HHHA 2C4FT 3DMMC 3S98A 1SEBB 1PYWB 3MR9A 3EHBC 4FA8A 1XF2B 3O6KL 4JB9L 3L9RB 2CIKB 4TPRH 2P45B 5DEFA 1H8OA 1C5DB 1NMCB 5C0BB 5I74B 5CJ5A 4JN1L 5T3ZE 2VLKE 4MQSB 3S37X 4FTVE 4UZGA 1KCRH 4EEEA 5I1EH 2HH0H 4YUEH 5TF0A 3I2CL 4XNZB 1I75A 4MHHG 4QRSA 4ZFGL 3L5WB 2AQ1A 1IJ9A 1BJ8A 1EEUA 1QR4A 4GW5B 1NEUA 2VRAA 3FQTB 1WBYA 3IAPA 3OKMA 5DGQA 1P53A 4PY7B 4PJAE 1P7HL 1FPTL 1IAIM 1N0LA 3W0WA 1DQLL 1W72L 2BP3A 1RZJL 1S7WB 4XI5C 1RJYA 1EPFA 3DYMA 1PZUB 2AXHA 2UUDH 4GW4B 1H15B 3O3BA 4KKCD 2I9TB 1VFMA 1LO5B 4GBXD 2P43B 4NN5B 2H2PD 2IAMA 4DCQB 3QXUA 3MLTA 3SQOH 4E0RB 4M43L 3TGXA 5CEXB 1BD2E 1GGYA 1BQHB 4P2RD 3ZT5A 4ELKB 4QRPA 4U0RC 4IOIA 4I5BB 3RWCB 1DSFH 4LCCA 7FABH 1HH6A 3VD3A 3IDMB 4CNIB 2JJSA 5JUEL 4K94C 2RB8A 5HYJD 1QVOB 4G6FB 2LAGB 1CFVH 3N50A 2ED8A 3SE4C 1Z3GL 4O02L 2EDYA 3C9NB 4KDVA 1WIUA 1P4BH 1A6PA 1CDHA 1KIQA 1T1ZB 5BV7C 2DBLL 3CDCA 2F53A 5T1LD 1TQCC 5IW1A 4M62H 2CRIA 1EIBA 4G9FD 2G75A 4X9GA 1M71A 3C60D 2EH7H 1S7QA 2BVEA 4KHXH 2HT2D 4N0RA 3BEWB 4YX2H 2YRZA 3EYUH 1IQWL 2AABH 2IFGA 4XXCC 3F58H 3WIHH 4ZUUA 1MOEA 3QPXL 3MZGB 4CMHB 3WSQL 4LRIA 1TNNA 2PW1B 3IGAB 2NY6C 2OJZL 2FDBP 4LBEB 1HINL 1K3IA 3KPMA 5FECA 2ZUWA 1OY3B 4C4KO 2XQYG 1NC2B 2X5PA 5E8DL 3B2UC 2ADFL 4YXLH 4PGZA 5D7SH 5JIPA 2A6JA 2IANE 3VDCA 2HT3C 4NO3B 4TUOA 3CVHL 4MQTB 5E5UB 1JPGB 2XN9A 1G7PB 4PV9A 1EDQA 1CLOH 1CL7H 3TM6A 2O5YL 4AIXA 2MPAH 3TBSB 3DO7A 1W0WA 2V5RA 3FTGA 4UINH 3LDBC 1A6VH 4XPFH 4QYOA 4H25A 3N06B 1U3HD 2ZCLH 5CGMA 3EO1B 3K4AA 3KJ6H 4IRJA 3WIHA 4X4ZA 3RVTC 3V5HA 5F1IB 4GSDH 2V17L 4O9HH 3S36H 4TULH 3GIZL 4HF5L 2JKXA 3MQIA 1BX2A 2P5WA 4WO4A 4X4MA 5DJ2A 2X4SB 4XP6L 1U8QA 1DR9A 3W11C 5DVMA 3BO8A 4KKBD 2EZ0D 4DTGL 3D48R 4RMWA 4DAGL 5I76A 3NABL 1P7QA 2C3VA 3QDGE 3DRTA 5TDNB 4CL7A 4PJFB 2HMID 1AXSA 1N5AA 2VR9A 3SE8H 4HUVA 1BFOA 1KXTB 3GFUA 2Y4SA 1JZ5A 3QP3A 3TO4C 1M7DB 4YHYC 5F3BA 4I48B 3CDGA 4R4NC 4LHQB 5GJTL 1FO0B 5HYSG 4R7NA 4NO0D 4FFYL 5GIRB 4C4KT 3QRFM 5HDBF 4JFZL 3VGDA 3DROB 1DEEA 5LAXA 1XIWC 3O45B 3RY6C 4BKLB 1AH1A 4PYHA 5IP4A 2P46B 1RFDH 4D0DB 5JXEC 2A74A 4XCYA 2XZAL 3KPRE 4LOUD 5KZCD 2OYPA 3CFJB 4JFEA 3HE6C 2M26A 3DJ9A 2EH8H 4NC1C 3LN9A 1T66D 2N56A 3QDMA 5DQJA 3PDDA 1YPZE 3BVNB 1I1AD 3GSVA 1L6XA 5BZWB 1ZV5A 1VGEH 1BVKB 3FO2A 2V9QA 4QT5B 3DIFA 4I77L 3G04A 4BELD 3WS6C 5HI5D 5CP7B 3RHWF 4X5WB 3PWNA 3H9SA 3PV7A 2AP2A 4KV5F 3DTXA 2I9LA 3HZMA 2QQKL 4XBGA 1RZIA 1KIPB 1GL4B 3FHQA 1S78C 4PJGB 5AAMA 3KLAA 5ID1B 1C08B 4NNPH 3SE9L 4BK5A 3QBTB 4X7EC 3VE0A 5DRXA 4JM2C 3MCLH 3GM0A 4R3SB 4XNQA 3QISA 2WAHA 4RDQF 5EBWB 2BDNL 5GXBB 1IEBA 5E6ZA 4F7TB 3W39B 4X0KB 4P4KB 1DN0B 1PJ9A 1BLNA 3ILPA 4DKAA 5ANMA 5GGTH 5IW6A 1XF1A 2I25N 4NBXB 5D1XC 1JRHH 3U7WH 4BFIA 1KLFA 5F8QC 4HZLA 4C57C 4K3GA 1D7FA 3WL9B 4LDEB 5AEAA 4I8DA 4Q2ZB 5EOTB 2VOTA 4LNRA 1JNHA 2EDKA 5DUML 5C0FB 2FGZA 4CDHA 1FAKT 2A9MH 3AREA 5CZKA 4S1SL 3K4ZA 1EMTL 3V6ZB 3TO4A 1MHPL 3SDCC 2VSCA 1GIGL 2V5MA 1A1OA 3FFCB 4U33A 4JFFA 3P11H 2OBGA 5BRZD 2YN5A 4Z7VA 4WHYH 5IV2B 1Y18A 2BZDA 2ITDA 3GHBL 5E03A 3G6DL 5ERWB 1I3RA 3ZLQC 5GGTA 1B0RA 1RIVH 2ESVA 3WFDL 4P9HC 1DBKL 3V7MA 4RIRB 3UTTD 1K8DB 4L8SB 5DZLA 4HKZB 4QXUH 2PTTA 1ZAGA 2XFXA 3HE7B 3OXRA 4G8GE 4PY8J 2BY2A 2Q3AA 4XAKD 1XCTB 3U4EA 5E6IC 4L4TA 4KRMB 4FNLL 5CSGA 5ITBH 1YDPA 1ZANH 3SE3A 4JJ5B 1RI8A 3N9GH 4UUJA 4X9IA 4RAHA 4Y2OA 1OGAA 4NOFA 3BQUB 2NXYD 4P2RE 3MLVL 5I15H 4DVBB 5EUKB 4PRID 5FM5O 5J0BA 1FFOA 4G5ZH 4NBYB 3ZE2F 4NGHH 5JW5A 5IM7B 5C7XH 1U93A 4KK8C 3NZ8A 1KCVL 3GBNL 5DS8A 1A4JB 2Z8SA 3KWWB 2YOCA 4OLVH 2AV1B 1D6EA 2FO4A 2HP4A 4GKOA 1CLZL 4UV7H 2JTDA 3BAEL 4LCWD 4RQQB 3TO2A 3RVWD 3BKYH 2EEDA 5HHPB 1IC7L 5HHVH 1LO0H 4G9FE 4PBVC 1OAUL 3NN8B 4QLRA 1RUPL 2DQEH 4KJPD 5L2KB 3HPJB 3FQNB 1D5BA 1YY9D 1H9VA 4J8RA 1P69B 3JV6B 3L3IB 5KOMC 2HA1A 4K07A 3KPQA 1G9NL 4FQ2L 1EXUA 1U8MB 3HMWH 4L8CA 4ZUTA 4KTEL 3TEUA 2VMFA 3QWRA 1NGPL 1QPPA 3MCG1 4KI5C 1PSKH 1XGRA 4M9PA 2X7LA 3S36X 1DLFH 5K59E 1T2JA 3BN9D 8FABB 2X9XA 3RJDA 2IH3B 1E28A 2HKFH 5ENWB 1MHCA 4IDJH 4LQFL 2QSCH 2RCSH 4NKIL 2WK2A 2DICA 4WI9A 4LLQB 3FB7B 1ERNA 4OSUL 1MJUL 1A6ZB 1NCWH 3AMKA 1K2DA 2OS7A 4JR9H 5EB9A 3MUGA 5J12C 2OL3B 2Y36H 3GB7A 3P0VH 5BVPH 1HXYA 2ENYA 1KELH 1EGJA 4L5FH 5BVJA 1IC5H 4O2FB 4X6BB 3T1WA 3VFGH 2AI0L 3O6FC 4G6AC 4Z18A 1D9KC 3N1PC 4JG0L 3E3QC 2WUCH 4NM8H 2MCPL 3TH3T 3AGVA 1ZA3A 3O3EB 2VAJA 1NGZB 3MSPA 4PTUB 4YHKL 2VC2H 1BFTA 2AEWA 4PJXF 1JNNH 4DGIH 3FO0L 5HYFA 3ZDYF 3MV8A 4J1UA 3BT2H 2CR3A 4DZBA 3WXWH 43CAB 4KAQH 4D94A 1YUHB 4JFYB 1E4JA 4KQ4L 2YZ8A 1YQVL 3U7AA 1LEIB 2R0LL 3KNBB 2CKBL 3BH8A 3O11A 2F74A 2IMNA 3WNKA 4NQVB 4F33B 4IIQA 4PLJC 3HA0A 5JPNB 4P49A 1PKQB 4ZOEA 3RIAK 3EO0A 2EDEA 2P24B 4UIKL 2GJZA 1FVDB 3B6SA 5C0RH 4WW2F 1K6QL 4HKJB 3RUGF 1N7ML 3WV0A 3QJFA 3THML 1KJMA 2DTMH 5B38B 1QRNA 1JTPA 3IDGB 4GKZA 4PJ7F 5EZOH 3SKUD 5J06A 1CFNA 5JIHA 3O41A 5ETUB 1NLDL 4B53A 5ICYA 5IT2L 3PWLB 2Q8BH 4D9LH 5A16A 4JQVA 1IM3A 1ETZA 4XB7A 2EDWA 4OLUH 3QI9B 1MLCA 1IM9B 1KG0A 4K3JH 3UAJC 1X5JA 4IS6B 3AS3A 3PDGA 5H35B 2WUBH 3ECBA 3R0MA 1FL5A 5JOFB 4UBDD 4XPBH 1MIEL 2A1WL 5FUCC 3WJJC 4MA8L 1BFVL 3MRFB 1ZGLM 2QV2A 3T0VA 5JNYA 3FB6B 1PBYA 1Z5LB 4HXBL 1H3UA 4EUPB 5GGVY 5SX4H 1JPFA 5BZDA 5I1GH 3IU3B 1A64A 4KKAC 2IBGA 4MYWB 1TIUA 2W91A 1C1EH 4LIQE 1V7NH 3PL6C 5DEZA 5GGSB 3ZKNC 5IW3A 4RMSA 3LSOB 3NACH 4TUKH 3MNZB 3I75B 4I13B 5TE4L 3MRMB 4M7LH 1EAJA 4KMTL 3T2PA 5FXCH 4D0CB 5I1AB 2XT1B 1SQ2N 3FRPA 2EDRA 2X2YA 3QRGL 4XWGL 1ZGLA 4Z8FL 5C2BH 4WUUB 2BNQD 5CEZD 5FDWA 3GMMA 5F71A 2Q7NA 5E2JA 3SDDA 4X6EA 1FNLA 3QXWA 5DTFA 4PJXE 5F70A 4LU5H 4GRMB 5J3HC 1RUML 2QEJA 1BBJB 2H6PA 1TVHB 5CGTA 2ZSVA 5EN2B 1NMBL 2QADC 4JRYA 1QFPA 1YYML 2GFBB 3BPNC 5CCKL 3OKKA 2YWZA 5K9OB 1MI5D 3SCMA 1OP3H 3V0VA 5IGXH 3O9WC 3ULVF 4ODHL 4OCNC 5D2NB 2FYYB 5GPRA 5DHYA 1BM3L 4YQXH 5E5MB 4FZ8L 4Q9BA 5LQBH 5C6WH 1RJLB 4X6DE 1E6JL 1CTNA 1INDL 2R56H 1P1ZB 1GPOL 4IM8A 5D6DC 5JW3L 4Q9RH 4XGZB 3B2VL 3B9EA 2YK1H 1NBVL 1NFIA 4OF0A 1LP9F 4LSTL 3VGGA 5IF0B 3BW9A 1I7ZA 2P8PA 2KDGA 1JHLL 3KXFA 2V7NB 1IQDB 5A2KH 5IBLC 1DFBH 3ARFC 5BW7A 5I1IL 5DUBB 4PJ7E 1RZKH 4MDIA 4WFFD 4PJEE 3TBYA 5D70L 3TA3B 3ROOB 3TIEB 3UTTE 1V05A 5GJSH 3LN5A 1JGUL 2NYYD 1LO3L 4DWHA 1R5VB 3S34H 3WIIL 4RMTA 3HTLX 4N0UB 4NM4H 1AI1H 4MJIA 3T2NL 1JZ7A 4OQ1A 3A6BL 4WW2A 4XMKH 2EXYD 4BZ2H 1CE1L 1GZQB 1JVKA 3RUGA 2AQ3A 1FCGA 4M48H 2ITCA 4HS6B 3LN4B 4S0TD 4HPOH 2VAAA 4PRIE 5AG9A 1B4JH 2DWEA 5MERA 1CT8B 1DBML 4GKSA 1QLRB 3QUYC 1NL0H 2BSRA 5JZ7C 1CGWA 4Y2DB 4NJAH 4F7EB 4UILH 5C07D 3LOWA 2F9BT 5SWZD 3HCVA 3ULUF 3B9DA 4FXGB 3ZDXE 5D7JB 3VFMB 1FZKB 3V2AR 3M17B 4YEFA 3HRZB 2OZ4H 4YC2B 2HTLD 5C9JB 2BXYA 1H3PL 3AUVA 3AY4C 3VXRA 4LF3B 3L3HA 1FBIH 2YPLB 3Q6FB 1C12A 2GSGA 3W2DL 2AJYL 2DDQH 3KLSA 3BDXA 3HI5H 3OJ2C 4YDJA 2X1OA 3HI6L 1OP9A 5DYOB 2C1PA 4NWUH 4K2UL 4OJFH 1MF2H 3AS2A 1FH5H 2CLVB 3ULVH 1MIML 2XYCA 3PP3K 5E2TH 3UTPD 4F8QA 5DK2B 3MLRH 3OKYA 1Q9WA 5CFHA 2FBJH 5DURB 4JFQB 3U36B 1AFVL 4PJIB 3R06B 2FO1A 5GQBA 4XRCA 5E8NB 4U7SA 2COQA 3QIUC 1IARB 4NQTA 4RMRA 2VQ1B 4LVNB 4PY8I 3H3PH 4X8JB 5GS0L 3UJIH 3EOBA 5ADOH 1VDGA 4JHWL 3WUWB 1F58L 1JV5A 4YWGH 3CVIL 4BSWA 1PQZA 5GSVA 1D5ZA 2Z9TA 3SOBH 3TWCH 2OZ4A 2EYSA 5GRJL 1CF8L 4MXQC 1U8LA 1G6RH 1IKNA 5A3IC 3MRCA 3TBTB 1DVFA 2FH6A 5D2LF 3INUH 3QNXA 1S7VB 3L5JA 3QUXD 4XVTL 1IAOA 4YLQT 1EAPB 5E2VH 3NCBB 3W9EA 1DBBL 4YHLL 1A3QA 4AEHH 1CFSB 4NDMB 2DLIA 5HGHB 3X13A 4Y4FA 2H2SD 1GC1C 2QBWA 2OMBA 4ZFOL 5IHZB 4QCIA 1EJOL 3FT3A 4MD5B 5I8CB 1P6AB 4BQ6A 1QUNA 2DL2A 5IEHB 4L9DA 2P7TB 4OZIB 1A7RL 3HB3C 5JDJA 4B50A 1KBGL 1U8IA 1HYSD 3L7FA 4N5ED 5TH2B 3GSNH 4KRLB 1LP9A 1UWGL 2VDNL 4H20H 4Z7WA 1S9YB 4ORGB 3CCHA 4XAWL 3D69B 3ULUH 4JPVL 4O58H 2DLTA 2I27N 1YEIL 4Y16C 4JHBA 4A6YB 1GZPB 1Q9KA 4PJDA 5SWQA 3LEYH 2J4WH 1IAKB 3CH1A 5FO8A 4PB0L 3LKRA 2FEDD 1A5FL 2GK2A 1G7JA 2D9QB 3W0WD 3WFEH 1BJ1H 3SDAA 4OTXL 2OR9L 4IJ3B 4PP1D 1NEZG 4NKQB 4C83A 1WZKA 2H8PB 5C09D 2H1PL 3QDHA 1KULA 4HK0A 1YN7A 5I30L 1FFPA 4LVHB 3AAZB 2NY2D 2DI8A 3ARDB 3G9AB 1HWGB 4FQHA 3G5VB 2FH8A 3OJMB 2WBJC 3FO9B 4P46A 5DEGA 4R9HA 3QFJA 3GSNA 4ODUB 2AERT 4P2OD 4PJ5A 1I9JL 2QTEA 3SKOA 3IFPA 3MBEB 2YSSA 1H0DA 1CZ8H 2Z31D 4GAYB 5AZ2L 4QHMB 3K8MA 5D1ZC 2BNUB 5FYLE 2G5BB 5JXAL 3LEXA 3ARBB 4U1NB 1N6QH 3MA7B 3SDXB 5ALCL 5FYJL 1PG7L 1ZK9A 4OIIH 3SHSA 4Y4KC 2CLZB 1U3JA 1VESA 1CICC 1LVEA 4BSVB 1MAML 2HG5A 2IADA 1A9BB 4KRNA 3GGWA 4HWBL 1J0KA 2P1YA 5GGVH 5AYQA 5CEYB 1TQBC 1LE9B 4AEIL 2CUIA 4KVNH 3V6FB 4TVPD 4HWZB 1MY5A 1MCNA 4EVNB 4JQIH 3OR6A 4ZAKA 3MXWL 3DMMD 5EZLB 5T5FL 1MEXL 3EHBD 4P4RB 1ED3B 4XCEA 3EJYC 2XV6B 3T2QA 4C56A 5CEZE 3MO1B 1KEML 3VXSA 3JSSA 3GO1H 4QOKD 2DLFL 3ZSTA 4P2QB 2Y9RT 2DQTL 1NPUA 1AO7B 5E24E 2AK4D 5CJQL 1P5UA 3OKLB 3WD5L 2FWOB 4ODVL 4BJLA 5FF6B 3WJLC 1CDGA 3EBAA 3IXAB 5LJYH 3LQZA 2GJ6B 1YC7A 1N6VA 1WWWX 1MI5E 2W9EH 2HWZH 4DKDC 2O61A 2E5EA 4KRPD 2XN9D 3P4OA 1XF3A 3MJ7A 4OCWL 3MYJA 1UWXK 1MNUL 5BXFA 5B8CC 3O2WL 1BOGA 3RL2A 4GMTH 1T5WB 5FA4A 4PUBL 5ISZD 2Q86A 4ZFFB 1UWEH 2GKIA 2APTA 2ZSWA 3MRJB 1CU4H 4P5KB 5EOCH 1YMHB 3UTZA 5I8OL 4TQEH 4WFFE 1AGFA 4F9LC 3V5DA 5DD0H 3DGGA 3KHOA 1B0GA 3QUZC 1R3JB 3MRPB 4XVJH 5DRZA 5EU6E 1HSAA 2XY2A 3BP5A 4NN7B 4PP2B 4ZXBC 2NTFA 4P5MA 3TVMC 1RULL 4FQXB 3QEQA 1P7QD 2DM4A 1TZIB 3SO5A 4YK4B 2VDOH 4XWOC 3K0WA 5FCUH 2PXYA 3GJFH 5EBMB 1FIEA 2XPGA 3CFCH 2HLAA 4MJ4A 3GSXA 1S7RA 4M6OL 1A7NH 5SWSA 4HPYL 3SKJH 1NBZA 4Q58C 5C07E 4QHKJ 4ZSOE 4JFDD 3BP6A 5SWZE 4F58L 3CLEL 5AD0B 4IHOA 3VW3L 1MUJA 4HK3J 5EWIL 3VD7A 1SYSB 1H3WM 2NY6D 3O3DB 3T3PF 3RNKA 2J3SA 3PF2A 2VDKL 4PLNC 2RR3A 4BQ8A 3FAXA 1I9EA 2FZ3B 3NIGE 4JFPB 4WCYL 1ZSDA 1X44A 4NQCA 3HUJE 4LVEA 2W65A 4HZAA 4RAVA 5F7EL 2J1KA 3GJFA 3U4AA 1MREH 3H9SD 2AV7A 2BRRH 5IFHH 1QSVA 3UTPE 3U46B 1JPSH 3BRGC 4I0PA 4WGWB 2I60H 1DTUA 4P48A 4QEGA 1DLHA 4J12A 4KH2A 3SGDI 4OZGE 5DO2C 4KXZH 1FSKB 5GS2H 3LMJH 1X5XA 4F2MA 3OR7A 4H0HB 4EQ2A 1G7MA 2BSSB 3IFOB 3OKMB 1FL6B 4V2BA 4X99B 2VN4A 3RVTD 4LSSH 1YEDA 3IKCA 2DIJA 3F65A 1TZGL 3UTSA 4U1GC 4OFDA 3JV5A 3L95A 1EEYA 4Y5YC 3N1MC 1KIRA 1CN4A 4W68A 2FX7H 2N7AA 1XZ0A 1VPOL 1U2HA 1WSST 2VLKB 3W9DB 1FV1B 4FTVB 2JELL 3T2OA 3WHXB 1WICA 1QKZL 3KPTA 3QZWG 1X6NA 4GAGH 5JHDA 2PO6B 3ZKQD 2QR0B 4QRPB 3UC0H 1QG3A 1XR9B 1Z2KA 2O5ZL 1PGRB 2VDQH 2ZPKL 1RK1A 2AW2A 1V8HA 1IT9H 5DFVC 4PJAB 2R29H 4M3KB 2NXZB 2VABA 3ARED 1MFAL 4L9LC 4LLVA 5EPMB 1EEQA 3ZT6A 3H6JA 3B8SA 3EW3B 3LHPL 1K5NB 4MA7L 3OKNA 3TO4D 3ZKXB 3PP4H 3BISA 3C5ZC 5T1DH 4TSBL 3LKNB 1UCBL 4R4ND 4U1KA 3IDJB 2F53B 5KS9F 2D7PA 1RZJC 4DKEL 4XC3L 3NFPB 1BD2B 2VB5A 1W0YT 3BPOB 5HHXL 5C0CA 2G75B 3AB0B 3D0LB 4KI1A 4Q6IA 3ZE1F 5FHBH 1V3MA 2D03H 3W0WE 2WINA 1ND0B 3HE6D 5D1QC 1I9RL 5C08D 2UWEF 4ZUUB 4R2GB 5C09E 3T3PE 4K8RL 2VZSA 2HAZA 3GSOA 4AH2A 4N8CL 1ZHNA 2EIBA 4ETYA 4YFEA 4ONGL 4LLWA 5FECB 3KPMB 4TSCH 1YZZA 1TTUA 3LRGA 4LHUB 4E41A 5EA0H 1ZVSA 1OGAD 3F7VA 5I19H 2A6JB 4DVRH 5CWSA 4OQTA 4MS8C 2IC2A 3FFDB 2CK0H 1OHQA 1UM5H 5AZEH 3MOAL 3LZFH 4LP5A 4AIZA 1OGTA 3MLYH 4PV9B 1AKJA 4M7ZB 3K80A 4J3SA 5I6XB 1QSFA 3FTGB 5F1KC 4QNPF 2DQHL 3MACH 5ESVA 4H25B 3HR5A 3NOIA 4LSUL 1CBVH 3OWEA 3IKKA 3NAAH 2LU4A 5DRNB 1OP5K 1A7PH 3VXTA 2EDTA 3QO1B 4TVPE 2R4SL 2GUOA 4O51A 5K93A 5F7YC 2VDRH 4PGEB 3MRLB 4LCIH 1U91A 3RZCC 4UIMB 4LP4A 4LKXB 4PD4K 5D96B 4HC1H 2BFVH 3X3FL 3JVGA 3BWAB 2BOBA 1A6UL 4QOKE 3EGSB 5I17B 1KT2B 2GIYA 1JF5A 3DSFH 1LDPH 2AK4E 1JWUB 3TJHD 1MPAL 3RKDC 3KYKH 1CL7I 2H9GB 3I9GH 4M8VA 3SDCD 4UAOB 1QBML 2VZ1A 1OAKL 3JWOL 2A0LC 4GO6B 1MCEA 3LPGA 5HVHB 1C5CL 4UDUA 1BFOB 3QDJE 5GGQH 1NUDA 1I3UA 3T4AA 1TCRB 4NZUL 5EU3A 3TT1L 4OUUB 4PS4H 3G5XB 4EI5C 1RD6A 4R7DA 5C0JB 4QGTA 5CJOL 5LAXB 5ISZE 3T4YA 1XGUA 1GGTA 1MJ8L 4PJ9B 5EO9B 3PG2A 5E6ID 5J13C 3F6IA 3D39D 4G8IB 5DSCA 5L7XL 4CU7A 3U0WH 3QDGB 5LGHH 1C7TA 1MCLA 3NPSB 4HC1A 2D31B 3RVXD 1FCCA 4YIQB 1BF8A 3MV8D 4D8PA 5KVGL 3LEVL 2UZIH 3QDMB 3HG1A 1AIFA 3VXMA 3B9KC 1ADQH 3L1OL 5IK3A 2FRGP 4MVBC 2EDOA 4XMLH 2DD8L 3JV4A 5KS9A 4OD2A 5KSAA 1OAZL 4Z95H 1L7IL 4ZG1A 4KK8D 1Z0NA 4HIEA 1KTLA 5EH1A 3V6OA 2X70B 1X5AA 1FG2A 4I3RH 3VXQA 3PXJA 4YHOL 3D25B 3IF1B 3KPRB 4RGMB 1V7MH 4OB5H 4XPHH 4DQOH 2UWEA 5DRXB 4QHUB 2FEEI 3T0XA 1F4YH 1TJIL 3RZWA 4DGYL 5GSRA 5CZVH 2GCYA 4JFDE 4LCUA 4AL8H 3T0EC 3MNWB 5IHBA 5ANMB 1N64H 2K7QA 1Q1JL 4K3EL 1U8JB 1NC4A 4ZFZA 4JY6A 2PW2A 5DRWA 1ADQA 2IFFL 4GW1A 4KI5D 4CVZB 4J4PA 5CJXA 3H9HB 5C0IB 1T20A 1UACL 4JZOB 1HYRC 4JFOB 1KTKE 4QY8B 4FABH 3VGBA 2QJDA 1KPRB 2HT4C 4LNRB 2QHLA 1HXMA 1A1MB 2A6IA 4WJ5B 1A7QH 5E5RB 3GBLA 2D9CA 3MNVA 1EVUA 3VJ6A 3GMRB 1GCFA 3B3IA 3VFRB 5I1DA 4ZS7H 3CU1A 4JM2F 3BYYA 2JIXD 4K71C 4KDWA 1H5BB 4QTIH 5F6HJ 3EKCA 3O6FD 4G6AD 1YA5A 4NNXA 2UY7A 4JPIB 4JFFB 1D9KD 1Q0XH 3F5WB 4U6VH 4CAGA 2ITDB 3I50L 3OZ9H 2VITA 1OSPL 3CZJA 4EOWH 1MCCA 5GRUL 5IVZB 1I3RB 3B5GA 4JY5L 3OMZA 4LARL 3BIAX 2EE6A 2ESVB 1LO2L 1SHMA 3MRBB 4JANA 4ZPTA 4M6NL 1BZQK 2NY4C 2XWTA 2NX5B 3FHAA 5ICZA 4NQDE 3P9LB 3U4EB 3B9KA 2ATKA 4B7LA 4ZYKA 1J87A 2X4TA 4X7CC 2YN3A 4OI7A 2DAVA 1KB5H 5IMMB 5DUPH 4JRYD 4WV1A 1ZLSL 3BUYA 3SY0B 5M94B 4CADA 4PLJD 3SCMD 3CFIC 4QHNB 2CLRB 3TZVA 1JMXA 3NIDE 3PABB 1T04A 1OB1A 5DGRA 4KPHH 3IJHB 2FX8H 4PJ8A 4G8GB 1U93B 4JDTL 4CN1A 4M6MH 3DETD 3U0PA 4NSKA 2P8LA 2QSQA 1AR1C 3PWVA 5CUSH 4J3VA 1UM4H 1CFTB 2WQ8A 4D2NA 4HT1L 4G7YH 1IZJA 1H3VA 5IWLA 3KXFD 3T04D 1S7SA 4YGAB 4TVSa 4JZJC 4HDIB 3RTQC 2D4FA 3QXVA 4Z7OE 2E7LC 2DOCA 5IVXF 3QCVL 4A2MA 3MREB 1SVZA 4NRYB 4H5SA 1ZEAL 1GGIL 4NC1E 5C08E 1KB5A 5E7FA 4QRQB 1QYGL 2BVQA 1KN2H 2DLHA 3UMTA 4L8CB 3Q3GA 5EU4B 1KPVB 1DBJH 4MJID 3FQXA 4YE4L 5LBSL 3VGFA 4L1DA 5CINL 5IOPA 1QNZH 2AQ2A 4XCNB 1DDHB 5BOZG 2XXCB 1S9VB 1G9ML 2NY0B 3QG6A 1OGAE 1TNMA 4R6UA 4KKAD 4MXWL 5JW4M 2OR7A 3M8OL 3PJSA 4YHIA 4N5UA 3QUML 2CXKA 1OTSC 5ILTH 3C60B 3ZKND 4NPYB 5FUOH 3BZFB 2K3TA 3ARSA 3ESVF 3U83A 3CSYB 3U4BH 1UXSB 3S37L 3BEVA 4M7LT 3VGAC 2DI7A 3HZYB 4OM1L 5LKNA 1HXYB 1LD9B 4ERSH 1KJ2L 2QKIA 3TN0B 1EERB 3WLWC 3O8XA 2MHAA 2AJXL 3F7YA 4ZNEE 2P42B 5DHVB 5T5NF 1V5JA 1J1XL 2OQJA 3SGEH 1G9NC 3EFDH 3FZUD 5L2JA 3RDTA 4L3CB 2P5EA 5J3HD 2B20A 5D5MF 3C5SA 5GZND 1BJ1J 3SKMB 3JTTB 3P73A 4QTHA 3CGTA 1UQSA 2BVPB 3K74B 1BIIA 1E4WH 1YNLL 4ZDHA 3BH8B 1DQTA 4KUZL 3O11B 1U3HB 5B3JE 4UOW0 4GXVH 3HS0A 1LO4L 5LGJA 4F8TA 3UJTH 3ELAT 4HBCH 4GLRH 4PRPD 5I1LA 5K9JL 4GRLB 2SEBA 3L3JA 2ZNWA 5TPWL 4YDKH 1II4E 2WM0A 4FN0A 3V4UL 1JGVH 1KC5L 1TPXB 3ARFD 4JG1H 1IZKA 3RTQA 2XKUA 5IESL 4GKZB 4JN2A 1S7UB 2DF3A 3DBXB 3ARWA 1QBLL 2ARJQ 1NGWB 4JKMA 5E4EB 4LNVA 5MHSE 2YD3A 3L6FB 5FK9A 5EDXA 1JGDB 2BVOB 5DMGD 2AEPL 3B9VA 1HHIA 1NGQH 3D39E 2R0ZH 4Y4FD 2YKLL 2IQAB 1R5IA 3C2SA 4OD3H 4H1LH 4HXAH 3MX0A 1N8ZA 2R9HC 3CDYA 4PRHA 4S11A 4ELMF 3C6SA 4F57H 4L3EA 1NKOA 3JTSA 2L4OA 3EYVA 1XT5A 2WIIA 1NQBA 2OP4H 2APBA 1DQML 3VH8B 5HPMB 3HC3H 3CMOL 5BCAA 5CSBA 2GAZA 2W0KA 3PWJA 3P4LA 2J6EL 1F4XH 1DN2A 3OJDB 2I5YL 5IHUL 4NUGL 3L3DB 4JVUA 2ZCHL 1JPFB 1AJ7H 5E1AB 3S35H 5JR1H 3GEWB 2QSVA 3DX6A 2YA1A 5IVXA 3K2UH 3MRRB 3DSNA 3NCYS 3QAZB 3REVA 3SGJC 4ZUSA 1TENA 1QFWM 5F9WC 3WN5A 1HHGB 2ED9A 5BQ7A 4B7IA 1FGNL 4X4XA 1SJXA 2H3NA 3SDAD 1I7RA 2V2XA 1I1AB 3F12B 3QNYA 1B6UA 4XCFH 2IPKA 5CJBA 4M1CC 4H1LA 3GMMB 1NAMB 3RWEB 3LKOB 3UROR 4NQED 1MFCH 1J18A 1JGLH 2QHRH 5DTFB 4P46D 1Q0YH 2W38A 3QPQC 4NT6B 4OZ4A 4UQ2A 4U1HB 4RAUA 4KI5E 1ZT1B 3QFJD 3KYMA 2H6PB 1YN6A 4P23C 3V8OA 5DA4A 1LMKA 4PJ5D 5SX4I 3KJ4B 4AM0A 3QIUD 2HJKA 2Z92A 2V5YA 4KK6C 5HHME 5DHYB 4HH9A 4HS8L 4OT1L 3RWIB 4BFBD 5B22A 5FYKL 4GMSL 4J6RL 1JPTL 4MXQD 3ARXA 5A3ID 2R2BB 1GGBH 2IPTL 4OLWH 4PJXB 1LK2A 1I3VA 3U48A 2F54A 4Y4HC 1SYVA 5D5MA 4N1EA 5FGCE 4ZPVA 3E3QE 3FOMA 3HPLA 1FVEB 1PW3A 1E6OL 4Z5RA 3E6FA 2NY7L 5B4MD 4ETQA 5GRZA 4WDIA 5FA3B 1B9ZA 2NZ9D 2NCMA 4HCRA 1N5YH 3IVKB 3EO9L 3O4LA 4YEEA 4C56D 3LRSA 3VXSD 5CD3A 2EIZA 3HB3D 3CSGA 2YXMA 2BNRD 1AQDA 4PR5B 3BIKB 3FO1A 4U1JA 4WWKB 4NHCH 2EDQA 3Q48A 1OLLA 3MRQA 5J1AA 2EDBA 4NCC1 2EEBA 1T0NA 1JK8A 4PJ7B 5DJAB 3SGJA 4HX1A 2VXUL 4PJEB 1VGKA 4BH8A 3TFKD 3UTTB 1OW0C 4YO0A 4NN6C 4Q9CA 4XP9H 3BKCL 2BX5A 5DJYA 3TYFA 1ACZA 3GMQB 1I85C 4AMKH 1T1WB 1MCOL 4TPRL 2BSED 1D6VH 2XKNB 4U6YB 1BOYA 1AGCA 3G9VA 4L8BB 4QHLA 3KXFE 2PF6A 3BZ4A 4QRRA 3V7AE 5KVEH 2WBJD 1KCRL 5I1EL 1C12B 2GSGB 2HH0L 4YUEL 4TTGA 4YDJB 4YFLF 1K4CB 1Q94B 1AGBB 1P2CB 4HUWB 5FUCE 3RNQA 1I1FA 3EDDA 2V2WA 4X4YB 5I73C 4XBPB 2NY5H 3D3VA 3QEQD 4GOSA 4LMQI 4EN3C 3S7GA 2PXYD 3MROB 5HHQB 1I8IB 3H9YA 5DT1H 4ALAH 1DBAH 4FHBD 5C70A 3RBSA 4TVPL 2KL6A 4JQXA 1Y6NR 2X1QA 1JV5B 4BSWB 1EV2E 3SQOL 5SWSD 3UDWC 3BJ91 4FQQB 4MNHB 1Q9LB 2NZIA 4HJ0C 5F97E 2APWA 5JOEA 1HZHH 1U8LB 4U6TA 1DSFL 3BDYH 7FABL 1DVFB 3TBVA 5C0GA 3QNXB 1MHHA 1FAIH 4MA1C 4BZYA 1CFVL 3EDFA 3P4NB 3ARGA 4WUKH 1ZHLA 1P4BL 1G7HA 1JZ3A 4OZFA 4ZNCD 1MCPH 4NQCD 3N85H 4QCIB 4RGNC 4M62L 5F7DB 2XTJC 4MAYB 4PJCA 5E9DE 3UTQA 1LEKB 2BJMH 2EH7L 2J8UF 3L7FB 4KHXL 2KQMA 4YX2L 3MTRA 3EYUL 4I0PD 3DXAE 2AABL 2JCCF 3F58L 3WIHL 5T3XH 3BKJH 3CCHB 2R69H 2X1XR 1PYWA 4CU8A 1XF2A 3TJEH 1G6RB 3QIWC 3L9RA 3UPRB 2CIKA 5FO8B 2WNGA 3KPSA 4WFED 4PRPE 1MRFL 1C5DA 5C0BA 2ZUTA 3ZTJH 4YXLL 5D7SL 4G9DB 1ZT4A 1ZA6B 2P44B 2ZUUA 3S35X 4MCYB 2J2ZA 2AK1H 4J2XA 3L5WA 3DUHA 1YN7B 3S5LG 5BMFH 1BF2A 1NCTA 5C86A 2FL5B 3FQTA 1CL7L 2AKRB 2G5RA 1JGEB 2MPAL 4J3TA 5I75C 4PY7A 4NO2B 3TVMD 4UINL 2Z0BA 5HY9B 1A6VL 4XPFL 4HUMB 5JHDD 2IMMA 3F62A 3GSNB 1S7WA 5A40E 2ZCLL 4XWOD 2AXGB 1IVLA 3KJ6L 1IGIH 5J4MA 3P0YH 3F6LA 3VFPB 4GW4A 1MELA 1H15A 4GSDL 3R4DA 4O9HL 3S36L 4I3GA 1LO5A 4MQXC 2I9TA 3V5KB 4S1DD 4DCQA 4E0RA 5CEXA 3BMVA 4Z7WE 3LEXB 1CS6A 1BQHA 2GSIB 4ELKA 3RWCA 1C5BH 2JB5H 3GI9H 3IDMA 4RMQA 1A4KB 4G8FA 4G7VH 5TE7H 1QVOA 4R0LB 3O2DA 4WI3A 2FD6H 2ICWB 3GGWB 3X12B 3WO4B 3C9NA 1X4XA 2E7CA 4JREB 1T1ZA 1A3LH 1CYGA 2ZJSH 1NCDH 4OM0H 1AXIB 1BZ9B 3SE8L 4N8VB 2E7BA 1SMAA 4XCEB 1BQSA 4NQEE 1FJ1B 1JPST 1NCUA 1PD6A 4PJGF 1RJCA 2A9NH 2AJUH 4F80A 4WFGD 3A6CL 1NFKA 2DJUA 3TNNB 4XTRC 1KCSH 1ZTXH 5DC4B 2VXSL 3PWPD 1BREA 2FEEL 5TQ2H 1C8PA 5IR1B 4U1IB 1TETL 2PW1A 3IGAA 1RFDL 3JV0A 2VE6B 5DO2D 3F8UB 1DEDA 4UTBH 5BO1H 4XPGH 1BAFH 5D2LB 1XF3B 1MWAB 4WI6A 3MJ7B 2B4CH 3QB7C 2EH8L 1P4LA 1M7IB 4PIRF 4JDVB 3TLRA 1KJ3H 3TCXA 4UMGA 1VGEL 4NO3A 1GC1H 1FNGB 1JPGA 2Q86B 1MLBA 4ZTOL 3CX5K 1G7PA 2C3XA 4HHAA 3TBSA 1WEJH 4F7PB 4G6JH 3CFBA 3HAEB 1A6AB 3D0VB 4HFUH 1J5OH 1MI5B 3OV6A 3WLBB 4NNPL 1AGFB 2B1HH 4OGXH 5HTSA 5EFIB 4JPKL 2DM3A 1B0GB 3QIBA 3EO1A 3MCLL 5DFVD 5I0ZA 5F1IA 1FO0H 2BNRE 2AXJA 3ARUA 4JZNB 4LDLB 4URTB 3H42H 3OAYH 1PY4A 1JWSB 3C5ZD 1J86A 3AM8C 3LD8B 1U41A 4MDJA 5GGTL 3MV9E 2ICEB 1T03H 2V2TB 2X4SA 3U7WL 5MEOB 3GJEB 3GSXB 2CK2A 1SJEB 1ZLWH 4W70A 2YUZA 1HQ4B 1YEFH 5I18H 2NNAB 4F9PC 4YBQC 5GGSY 5EU6B 3ALPA 5TDNA 4O2EB 5D1QD 3V0WH 4PJFA 2AJ3B 4CJ0A 2R2EB 1ES0B 4HLZG 2A9ML 3BZDA 4PB9H 1DANU 5FGBC 4XP1H 3HZKB 4O00A 1A1NB 1M7DA 3AVEA 4I48A 4PG9B 4X6CF 5EZIL 1FO0A 3DHMA 3L3KB 5GIRA 3HG1D 3P11L 5D7LA 3DROA 2B5IB 2VR5A 3O45A 5AAWA 5TE6H 4BKLA 5E00B 3LQMA 2W65B 4V1DE 3H7BB 3GJFB 4ZSOB 1FC2D 1RIVL 5SWZB 1MHEB 5KSAD 1OLZA 2LAAA 2HT2C 5F7HA 5DK0B 3CFJA 2XA8H 5BJTB 3QEQE 1NCAH 2VLJE 4QXUL 4YHZL 4J7RA 1P6FA 2HJFB 3H3BC 3BPLC 1MCRA 5BZWA 1BVKA 4F2MB 5ITBL 4QT5A 1N4XH 5DDHB 3N9GL 2BC4A 5CP7A 4X5WA 3VRLE 4KZEH 5SWSE 1QR1B 4H26B 1CFQB 2RJMA 2VKXA 1KIPA 12E8L 4PJGA 5I15L 3PWUA 5ID1A 1S9KC 1C08A 1P9MC 5IB2B 4CVXB 4G5ZL 5E95B 3RZCD 4LLMB 4PJBE 4KROD 4R3SA 2NY3D 3ARZA 4Y19D 4J4PD 4D9QD 6FABL 2JJTC 4OZGB 5HHNB 4X0KA 4LVOB 5EIVA 4P4KA 1DN0A 3TH4T 4OLVL 2DIBA 5I0DA 5B39B 3P2TA 1H3GA 1MFEH 3GSQB 4UV7L 4D0BA 2XICA 1OQXA 1NGYB 3BKYL 3WFHB 5DD5H 3CMGA 2A0LD 1EGJL 5HHVL 4DEPB 1WWBX 4XNYH 1KSRA 2NW2B 2VABB 1IMHC 2DQEL 4LLVB 3RA7H 4F3FB 4PRNB 3WL9A 4Q2ZA 5EOTA 2ILLA 3QO0B 4F9PA 4APQC 4U1KB 3HMWL 1A21A 5C0FA 1Q72H 1I8LA 1QHPA 1W0VB 3IETB 1PSKL 4WFEE 5C0CB 4KKBC 2EZ0C 4QO1A 2BERA 1PLGH 5IJKA 1DLFL 3V6ZA 3F7RA 2NMSA 3MZTA 2HKFL 2YUXA 4IRSC 4IDJL 4HMDA 3FFCA 1I1YB 4POZC 1FGVH 2QSCL 2RCSL 3LH2H 3VFUB 4CMMA 2HMIC 2DQCH 3B9KD 1NCWL 1ZHNB 2ERJB 3H0TB 3JWDH 1KTRL 4JR9L 4M1DH 4MVBD 4PFEA 3U79A 3P0VL 1T1XA 4P99A 5BVPL 2Z35B 4X6CE 1KELL 1Z9OA 4L5FL 3VFGL 4RIRA 4E41B 1K8DA 4L8SA 1XH3B 3HE7A 5CWSB 2WUCL 1FFNB 1HK6A 2H26A 1XCTA 1JIBA 4JGMA 3EZJB 3L7EB 2VC2L 2VDLH 4JJ5A 2PR4H 1JNNL 1AKJB 3OPZL 4OZHE 4PRDB 4DGIL 2Y6SC 1JI1A 5C09B 1HKLH 1T7YA 5HVGB 4P3DB 3BT2L 3WXWL 3BQUA 5CBEB 1H3TA 4KAQL 3SGKA 4MCZB 2N1KA 3RAJH 3QXAB 3KLDA 5EUKA 5F7NC 2ZG1A 3ARPA 5EIIA 2AGJH 3K4DA 4GUPA 4QF1B 5IM7A 2AJSH 4L8DB 1YEHH 4K8RC 1QFUH 1FN4A 2A77H 3CPLB 2CMRH 2O5XH 3LKPB 4NRZB 3VXTB 1A4JA 1JFQH 4Q9QH 5DJZB 3KWWA 5F6IC 4OF6A 2Z31B 5C0RL 1U91B 3WDJA 1VA9A 4RQQA 2OL3H 5EO1B 4D3CH 5HHPA 2DTML 3NN8A 2BSTB 3LV3A 4P5TB 4HSQA 4WFGE 2HFEB 3DNKA 3FQNA 4M8QB 2Q8BL 3JV6A 3L3IA 3PWPE 4D9LL 5I9QC 2WWMD 4X7TB 1U8MA 4OLUL 2DQJH 3IDYB 5F72S 2Q3ZA 4K3JL 1UFUA 5L0QB 5FGRA 2VUOA 5J6GB 5EU3B 3QQ4A 4MAUH 2UZYB 2E9BA 3DMMB 4U49A 4FFZL 4XPBL 3Q1SH 2PTVA 1LEGB 5ENWA 4KQ3H 1SEQH 4QOKB 5FV2A 3OB8A 1IEAB 4JRXB 4B41A 2AK4B 4LLQA 3FB7A 5DI8B 5K33A 3VFOA 3HZVB 1A6ZA 5I1GL 3K81A 2P5ED 2OL3A 4XHQA 4O2FA 4X6BA 3VWJC 1C1EL 3HC4H 1V7NL 3VI3F 4P3CH 1X5YA 3SBWC 4RX4A 1WWAX 3QDJB 3VXMB 3NACL 3QULB 4TUKL 3O3EA 1DUYB 1P7KB 3BP7B 5GRVL 3MV7B 1MQKH 4JO2H 4M7LL 5KS9B 3JWOC 3VI4F 3MCKA 2F8XC 2APFA 1HI6A 4Z76B 5C2BL 1KB9K 1GJIA 4I18A 1ZLVK 1FG2B 1S3KH 3GRWH 3IFNL 4JJHA 43CAA 1AR1D 1IGJB 1YUHA 4JFYA 4JM4H 4MGXA 2ID5A 4OF3A 4UV4H 1LEIA 4LU5L 1FNEB 1ZS8B 3KNBA 3FQWB 4KZDH 5EOQH 3RTQD 4NQVA 2N4IA 4U0RB 4F33A 1U8PB 3DGCR 2NXYC 1CK0H 5JPNA 1A2YB 1HIMH 1PKQA 3I6KA 4LCUB 3KPLB 5IGXL 2P24A 4NKDB 4JHAH 1FVDA 4EUPH 4HKJA 4YQXL 4Z78B 5LQBL 1NC4B 5SX5K 4JY6B 2R56L 4L3AA 5B38A 2IPUK 5BV7B 1GOFA 1T20B 2YK1L 4PGCA 4ZO6A 5EUOF 3EFFB 1KPUB 5ETUA 3PWLA 2WLYA 4L3ED 1OTSD 2DMBA 3RVWC 3VFVB 3X14A 1DFBL 3WFZA 3QI9A 3GRWA 1IM9A 1RZKL 4Y0GA 4JFDB 4IS6A 3TA3C 1EFQA 2PETA 5GJSL 3WSQH 3S34L 3WLWD 3S96B 1YEJH 4NM4L 3MRFA 1AI1L 4NZTH 1KN4H 1MJJA 1LK3H 5CILH 4JKLA 3OF6A 2RIKA 4XMKL 2YRPA 1Z5LA 2ADFH 4HD9A 4BZ2L 4EUPA 2LU7A 4HGKC 4M48L 3IU3A 4FFVD 1F02I 3UYOD 5J11C 4JANB 4ZPTB 3ARTA 1FORH 3ES6B 1WBZA 1ZMYA 4AZ8A 5HDQH 4HPOL 1GGUA 2MCG1 5GGSA 3UZVB 1B4JL 1MRDH 4ZMAT 3CFDB 3LSOA 5D7IE 3IFLH 5ICZB 4Z7QE 1NL0L 4KGJA 3GUTB 5F9AC 3MNZA 3I75A 4NJAL 4R96B 4UILL 4Y19E 5F93C 2IEPA 1T83C 4PRBB 3MRMA 3LDBB 1I1CA 5D7JC 1RIUH 3NH7H 4D0CA 3D1MC 4WV1B 2ZUYA 4HUXA 2OZ4L 1W8NA 2WSKA 4R8WH 5E6YA 1XGYH 3RWJB 3TZVB 2E8YA 1G84A 4NO5A 1FBIL 4IRZH 2DDQL 4OD1H 5H94B 2EE2A 3MV01 4GRMA 3HI5L 4HLJA 1BBJA 4PJ8B 4LQ1A 1TVHA 1VADA 2FHFA 5GRXG 5EN2A 4NQDB 5ABDE 4HGWB 4NWUL 3U0PB 4WWID 3G6JE 4NSKB 5K9OA 2F54D 4OJFL 1MF2L 3P40A 1FH5L 4DJMA 1QRKA 5D2NA 2FYYA 2KUTA 3J7HA 1GGCL 3MLRL 4JCMA 2EE9A 2FBJL 1T5XB 3RPKA 2EYTA 1RJLA 3MRDA 4M7JH 4XGZA 3H3PL 4FG6C 5F9OH 3UJIL 5ADOL 4YWGL 5IF0A 3SOBL 3TWCL 2OK0H 4FQLH 4YHYB 2V7NA 1IQDA 3KYOB 3EUUA 1Z9LA 1G6RL 2DJ4A 1CR9H 2M2DA 5EUOE 2DMKA 3INUL 3ROOA 1JP5A 1UKTA 3TIEA 1M7XA 1XIWB 3NGBC 5J57B 2GI7A 1WFNA 4OIBA 5E2VL 1R5VA 1F90L 3RWFB 4X9BA 4R26L 4AEHL 4NKOB 1TITA 3HE6B 4OCMC 5JORB 3BEVB 5C08B 3OBAA 1GZQA 1RIHH 5J8OA 2WBWB 4ODBD 1UJ3C 1WZ1H 2VJXA 1GXEA 4HJJH 4HS6A 4WHTA 2ZOKA 5FFLA 1XF5B 3T0EE 4M1CD 6CGTA 3GSNL 1CT8A 5CAYB 4H20L 5E8OB 4Z7NF 4Y2DA 3ULUL 3QJHB 5EC1B 3QPQD 1X5ZA 4FXGA 1MCKA 5D7JA 2X44D 3LEYL 2W1NA 2J4WL 1FZKA 1FZJA 3GMNB 3M17A 4PREB 1W2KT 4JM2B 3HRZA 1G9MC 1KEGH 5C9JA 1GOHA 4NZRH 4KJYB 4KUCF 3SDXF 3MJ9H 1RU9H 4KK6D 4LF3A 3D3VD 1JCKA 2YPLA 3ARQA 3Q6FA 4RISH 2J8HA 2Q8AH 3ARVA 4OLEA 5DYOA 2XQYK 5D1XB 4KGLA 1AP2B 1PAMA 2CLVA 3ZDZE 3C87A 5I1LB 5JTWA 5DK2A 3FL7A 2OTUB 2PYED 5GISH 2ADIB 4JFQA 3U36A 4MNQE 1UXWB 4PJIA 4KDTC 3VWKC 3R06A 3SGEI 3UJJH 5E8NA 25C8H 3MBEC 4N0CC 2VQ1A 5D6CB 5C6PB 1J12A 4K23H 2LFGA 3ROLB 4LSRH 1N6QL 1G1CA 2DYPB 4A6YH 1R5IB 1QFHA 5KSVA 1CXHA 4OIIL 2VLRE 3L3GB 2V5SA 4MZ2A 5FB8B 3SDYH 1S7VA 5FO9B 1WZMA 4I3SH 3RIFK 1EAPA 4LKCB 4H88H 3EYVB 5GGVL 1L0QA 1CFSA 4KVNL 4NDMA 5FKAB 2R0KH 4F7CB 5HGHA 4GLRI 4X9HA 4A2LA 5IVOA 4HEPG 3DURA 5TFSH 1YECH 4JQIL 5J1TC 3FRPG 4MD5A 5I8CA 4NFBA 5IEHA 4EI6B 2FIKA 2P7TA 2QQNH 2X4NA 2R1WB 3NCYP 4WEUD 4OZIA 3GO1L 2UYLA 2VISB 5TH2A 5C0BD 5BQ7B 4IBLT 1KCKA 4XXDB 3FMGH 1S9YA 4ORGA 3D69A 3DARA 1I7RB 3IU4H 4A6YA 1GZPA 2W9EL 2HWZL 2IPKB 1YJDL 4LLDB 5B3NA 1Y0LB 1IAKA 4K9EH