4X6BA

Bk6 tcr apo structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
201
structure length
196
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR alpha
total genus 40
structure length 196
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA02
3FN0L 4XVTL 5E2JA 1FLTX 1I3GH 4P2RE 3B83A 1EHLL 5GZOD 1CR9H 1JYNA 4HV8A 4ERSL 5FHBL 1EV2E 3BW9B 4XWOD 2F53D 3O3AB 2ITCB 3QQ3B 4OIAA 2Y6SC 3D39A 1GPOL 1K6QH 3NGBC 1JFQH 4ONGH 1IM3B 2BP3A 4AQ1B 1LE9B 5D2LE 3C5SB 3I6KB 4MA3B 1LP9B 4NM4L 3FRUA 2BJML 4OQTL 4GRLB 3ROOB 3HI5L 4J3WA 1NMBL 1G7IA 1NLBH 3S35X 5BO1L 1WBXA 5AYQA 4ZMAT 4PJDA 1H8NA 2A6DA 4H0HB 4OJFH 5D7IB 3PGCB 3T3PF 3WNMA 3GSVB 3L5IA 4NRYB 3X14A 1AGCB 3WUWG 2OZ4H 3EFFB 3WKNA 5F3BB 4XT1C 3SDDD 3T0ED 4Q0XL 4Y5YA 3FN0H 4XVTH 1CXFA 3EJZD 1QSEE 5T1LB 1EFXB 5AZ2L 5TFSH 2Q6WA 3T0VA 5C0BE 3NFPA 3KPOB 2O5YL 1K3ZA 1PG7W 1JP5A 3OG6B 4FQXA 4MAUH 4Q58C 2DQHH 1A7OH 2AEIT 1T03L 3QXUA 5D8JH 5D9SB 5C2BL 2EO1A 2X7LA 1CN4A 2WBJB 3MUY1 3BPLB 1LEKA 1T5XB 4BZ1H 4OLUH 4WU5B 2BVTA 2CK0L 4QY8B 3VFRA 5BS0A 1TTFA 4JFOB 1WWAX 3BKCH 2H45A 4DKEL 2KQMA 3I50H 1UZ8B 5KJRH 2E6QA 3C08L 4P4KB 5H37H 3PUCA 1C1EH 1I1FA 9CGTA 5E9DA 3DRTA 3MV7E 3VXNA 4XH2A 3QDGE 2YA2A 4F7PA 5AYUH 1YC7A 3WLBB 3NABL 1FCCA 1G6RA 2AABH 5ALBH 5CGTA 1CD8A 2ZKHL 3RL2B 4UTAL 1GH7A 4FQ1L 3VXRE 1KXQE 4OCSL 5C0BD 2OP4L 2Y1VA 2IALA 5IEKB 1RZJL 1CTNA 4ONOA 1RHHA 4PJFA 1TVBA 5SWZA 1N8ZA 1IEBB 3LKRB 4M3KB 3QDGB 5E6YA 5GRZA 1RUAH 4KTEH 5JOPE 4BZ2H 4MX7B 2RIKA 4JN1L 2YPKA 3FB5B 3CVHA 3V5HA 1YN7B 8FABB 3M17A 4U1LA 5HI4D 5DGRA 2DN7A 1ZLSL 5TGBB 4PJGF 4NDMB 1OW0A 4KKLC 4M7LH 4RGMC 3TBTA 5FYJD 5CHNA 5JQ6L 2DICA 4JQVC 4ZO9A 5DRWB 1AGCA 5GGRB 4XVJH 4DEPC 3IU3A 4J3SA 3ARED 4GG8A 3D3VB 4Y89A 1F90L 3T77A 4HUXB 4R0LB 1NUNB 2IANE 3ARGD 5F8RC 2A6DB 1QPXA 2B4CH 1IC7H 5IT2H 3D6GA 1MHHB 1UWEH 2BSSB 1L4IA 2VH5L 4I18B 2FX9L 4P5TA 1DUYB 1KTRL 1CL7I 3CFCL 1KPUB 2GKIA 1WZKA 4AT6B 3ZHDA 3WKMH 1ZHKA 4ZTPH 4NRXA 1GXEA 4ZPTA 3T04D 4ZDHB 1KUMA 5DTFA 2Q3AA 2NY5C 1OTUC 1A6ZA 3MROB 1MIMH 5GGRA 5CEZH 4WFED 2VDRL 1HHIB 5C3LD 2YBRA 4YJZL 1CLOL 1ZSDB 3LQAC 2VXQL 3VFSB 2X2YA 2X44D 3HI6L 1I7RB 1VSCA 1YNKL 3C6LB 3W2DL 3OB0H 1IEBA 1S9YA 4FQCL 1IARB 4PGDB 5E2UL 7FABH 2HMIC 1ZLWK 5J9PA 3PABA 3NMEA 1MOEA 1TPXB 3OF6A 3EZ8A 5C7XL 1LVEA 3KNBB 3WFDH 2Q76A 1RFDH 3QFJE 1KPRB 3WLWC 5CCKH 4ZFOA 3JV4A 4I8DA 2VDQL 2V7NA 4X5LA 5MEND 2AJXH 3VFOA 1WIOA 1ZMYA 5T5NG 5E1AA 3FO1A 2MCPH 1U9KA 4RNRA 3EHBC 1HE7A 4NN5C 2BHYA 3BI9X 4KI5D 1EJOH 5HYQB 4LCWE 1DLHA 1VEPA 1FZJA 4OB5L 4EDWL 4IBLT 1PKOA 1K9TA 4I13B 2FEDD 4LCCB 5I1AA 5F9OL 1SY6L 2VUYA 1FV1A 2VQUA 4POZC 4KWUA 5BV7L 2N7BA 5L6YH 5FKPB 4PJ9B 4NZTL 3AB0C 4JPKL 4FXKA 5EBLA 1LD9B 1JGEB 3VRLF 4OCXH 4NQCA 4LRIA 4OZFG 4J8RA 3TYGL 3ZSTA 5TF0A 4IRZL 4G3YL 4B7LA 3CPLA 3TJHD 4LP5A 2QKIA 2QSCH 4S10A 2FX8L 4YHYC 4LPUA 3SDCA 2JJVA 2H2SD 3BGMA 1S7XA 2AK4A 3HFMH 1JFQL 3L9RA 2N56A 4E5XA 3O3BB 1Q9KA 4NP4L 2H32B 4PJAE 1GIGH 4WUUB 3B5HA 3C09C 5KSBF 3RWEA 1CFQB 3BIAX 5LG1A 1NL0L 4MJ5A 1CG9A 3TBVB 4OCRH 3DVNA 3HMXL 4FFYL 3RVWC 3BKYL 1MFBH 2VXUH 3KPSD 3K81A 3RBGA 1OAUH 4XMKL 1MPAL 5IW1A 1J18A 2FH6A 1XGTA 5HI4C 5CEZD 5A1AA 4JR9H 1F4XH 5CKAA 1FZOA 1NLDL 4L8BA 3BESR 4NQDD 3KR3H 5L88H 2XQYK 4TSCL 4Y2DD 1JI1A 4LNRB 5GS0D 4DAGH 1MAML 4Y1AB 3IS0X 3LB6C 3BJLA 3QQNA 5E56A 4Z7WE 1MCOH 1OD7A 5FGRA 2P5EA 2R0ZH 4ISVA 4YHNA 4MAUL 3GMPA 2Z31A 4TUJB 3O9WA 3C9NB 1HDMB 3BFOA 4G6KH 2R0WL 4UI2A 5EB9A 5K59E 5DGQA 5DJZB 1BM3L 4JY5L 1UQSB 2D03H 3FONA 3V6ZB 1HXYA 2YD6A 25C8L 5IROC 4P5MB 2AJVH 1T1ZB 4OZHF 4WI2A 4Y4FC 5AD0B 2R29L 5GGVL 2BCKB 2DJSA 4N0FB 2B2XH 1S7RB 2BC4B 3U1SH 2EXYC 4X80L 4V1DD 5IBLC 1MCNA 1NEZA 4HUNB 4N68A 2WBJD 3HZVA 1OCWL 2V7HB 3EKCA 3WHE1 1RIHL 3LV3B 4AM0B 4KKCD 1VERA 2YA0A 4OLXL 1J8HE 1DBBL 2NY6B 4DW2H 3D69B 3TNMB 3LEXA 3ZYZA 1FC2D 4LLDB 2R2EA 1PAMA 1QR4A 3M17B 1ORQB 4BH8A 1T1YA 4MHHI 1BZ9B 1S3KL 4JPVH 3VE0A 5IF0B 3U0WL 1S7TA 1QFWI 4P5TC 5L7XL 1DQMH 2NY5H 2ADIA 3EO1B 4LLAA 4Y4KD 4MZ2A 3GJFK 5HHOD 2MFNA 1MY7A 3V0VB 1SYVA 1CL7H 1HHKA 3MRFB 4YPGB 1RU9L 4KHXH 1G7HB 3W0WA 5GS1B 2GCYA 5JA9A 5DYOB 3FOLA 4F7TB 1YEHL 1YN6B 3U4EA 4D0CB 3EJYD 1A1OA 2BXZA 3P77A 4YHLH 3RWGA 2PW1B 5GGTH 3KPSE 3SKOB 1MREL 3TLRA 2APFA 3BP5A 4MXVF 3RU8L 2JCCA 1FL5B 4LQ1A 1F11B 1ZWIA 3G6JE 3KAAA 3VJ6A 4U3HA 1KTKE 2FRGP 4LRNL 1JHKH 1T04B 1F3DJ 2HYMA 4K3DH 4S0TD 1B2WL 4PY8I 3FJTA 2VDLL 5FYJH 3OSKA 4P48A 4JFQB 1KNOB 5IVXA 3OXRA 3THMH 1H8OA 3IDXH 2FJHB 5ICYB 1F6LL 1TQBC 1QUNA 4JHBA 1I7UA 1M05A 2JIXD 5E2WH 3L3KB 4JZJC 1WBXB 3CC5B 3DPBA 4M8VA 4WV1C 3O4LE 1PZUB 3VA6A 1CVSC 2GHWB 5F1NA 5FIEA 2IC2A 4PY7B 2P43B 4ODXB 1SY6H 5TDOA 3P2TA 2VH5H 3E6HA 1BZ7B 1FYHB 4KROC 3RL1A 4OGAD 2VLKA 3QWQB 2MMXA 2VUOA 3BKML 1FFNB 4ZOEA 2ADJB 2VLMD 3CJJA 3DMMC 3NFNB 2V5RA 4UU9A 4MXQC 1MJJA 4NQCD 1IM3A 1A1NA 3HI5H 4NQED 5IJVB 3PDGA 1AD9B 3WFEL 4XCYA 1GOGA 5K59F 5J3HD 1EO8H 3MA7A 3C6LC 1FVEB 4POUB 2IEPA 3V5DA 3DO7A 2PYFA 2XACC 4WW2B 2DMKA 4XNMB 4PGCB 2HG5A 3EFDH 5FGCE 2YD8A 1C8PA 5EN2A 1IQWH 4ZSOB 5C0FB 3OX8A 4TNVK 4XP6L 3S9DB 2DB8A 3AGVA 1CFTA 5ISZE 3ULVH 1ZKAA 2A6JA 4WW2F 4F2MA 1B4RA 4RAHA 1HSAB 2YUVA 1U3HC 4FQ1H 1OSPL 3BW9A 3OAUL 4XPGL 4ZS7H 3X13A 3QHFL 5IJKA 1DFBH 1LO2L 2YZ1A 4IOFC 5FYKU 4GUPA 4JRXE 3CH1A 3UMTA 4RWHA 1Z9OA 4W6YB 4OI9A 1IGFH 1EHAA 1A6AB 5DLML 4TULH 5IG7B 5JDJA 1FO0H 4OLEA 3MLXL 4WI6A 3Q1SL 2E9BA 1QBMH 2JJUA 3DVFA 3ILQC 3RWCA 3C60C 3DV4B 5HHQB 3T65A 2ICEA 4Z8FL 3QUKB 3HHRB 1I85C 1E4WL 4IOFD 3AM8C 4U1GB 4GKZA 2EIZB 3ROLB 3S96A 3EAKA 3PWJB 3VI3F 1WZ1H 1QSFD 3MGTB 3QZWA 3GMLB 4C83A 3IF1B 3DRQA 2NY6C 4G8FB 2FO1A 3QNXA 2DQDH 4NKOA 3B3IA 1KIQB 1IRAY 5JTWA 2GEEA 2WW8A 4ACPA 2VISA 1A6UH 2BNQA 2KZ1B 3ARDA 1Q9WB 2B39A 4MQ7B 1XH3A 2B0SH 5DD6B 1A14L 4JM2F 3QEUA 3DVNB 3CFJA 1HZHH 5DC4B 5HGHA 2J8UB 4Z9KB 2PW2B 4KV5E 3OB0K 3MUGB 1ZT7B 3GK8H 1WICA 3BIBX 2C3VB 1A4KA 3P9LA 1H15B 1P84J 1WBZB 3A6OA 4ELMB 1KULA 5A40E 3F58L 2VR4A 3P9WB 3RAJH 3CCHB 3F7RA 1PYWA 1Z2KA 1QRNB 1QEWA 2Q7YB 3AY4C 2J8UF 5C0JA 1JRHL 3VGAC 5BW7A 2OTPA 1Z5LA 1CDUA 4LPTA 1CXHA 1SVZA 1D5ZB 1TCMA 2ZP0T 4JY4A 1AO7B 1PD6A 5E9DE 4UUJB 3RZCC 3UBXB 3MV7A 1KXVC 5EU3A 3ULUE 5ID1B 5GJSH 4W4OC 4EXPX 2UZYB 3O8XB 3NH7L 1CXIA 4ODSH 1T03H 5FYJU 3O6KH 4JDZB 3S7GA 4ZDHA 1N5AB 4WIQA 3WL9A 2HJFA 5GJTL 5TE4H 2NY0C 5KJRL 1F00I 1FNHA 2E7CA 5F7YC 5B21A 1BF2A 3WJLA 5EZLB 4YHML 4CADA 2YEZA 1HEZB 3HE7A 4RQQA 2GTZB 5ANMA 4XMLL 2R1XA 4YE4H 3STLA 1QSED 2B1AH 3QFJA 1WISA 2IGFH 4LLWA 4BJLA 3ULUC 3ZTJG 2PTUA 1T1WB 1MF2L 3RY4A 4HKBB 1QFWL 1HIML 1XZ0B 5CIPB 2HT2C 1ZV5A 4XGZB 1TZIB 1NGZA 4IRZH 4NBYB 1EGJL 1KG0B 1JE6A 1DANU 1UG9A 4BFEA 4HG4K 4FXLA 5DK2A 2DQGL 1N8ZB 4PBXA 4JPVL 4HKBA 4P3WA 5C86A 4Y5XA 2BNRA 4DGYL 1I75A 2C4FT 2JKXA 5CD3B 1QSFB 3K8MA 5HYSG 2CSPA 3C8KA 5C9KA 1WITA 2B20A 3KPMB 1U58A 2BDNH 1J12A 1J1OL 1KEML 5C92A 3QCVL 1ZANH 2EYSA 1P84K 2BVUA 4PY7A 1VCAA 3V8OA 3DSNA 3B8YA 2R8SH 3PXHA 4KK6C 2QSQA 3AS0A 4JRXA 3QDMB 2R23B 4YXLL 4NT6A 4ELKA 1J0IA 5DF0A 4YBLC 4HS8L 4M5ZL 5HPMA 4NQCB 1OTTD 3NCBB 3KYMB 4N8CL 3D18A 5CD5D 2VDMH 1KIQA 1QFOA 1T21A 3D9AL 2YUWA 2XRAH 2Z9TA 3F5WA 4QY8A 3FCTB 3VFRB 4LEOB 1MCCA 4KXZI 3TJEH 2NXZC 3EDEA 2A1WL 1KXTB 1RK1A 1PLGH 4DFIA 4OV5A 5KVFH 1CD1A 1DBML 5E1HB 3SY0A 4LCWD 3ARWA 2IQAB 5ISZB 3O4LD 2ITDA 5J4MA 4UT7H 2UY7A 1MI5E 2CKBB 3OBAA 4RMSA 5BOPA 4HCRL 1S5HB 4WUKH 4N9OB 5C71A 2ARWA 6FABL 4O2CA 3QEQD 3SGEH 2RFXA 3K4AA 1BJ8A 4YZFE 5DEFB 5C08A 2EICA 2ZCKH 4FABL 4MJIA 1VFBB 1CGYA 4X7FC 5HYJB 5E2VH 5IQ9A 1MI5D 2V2WA 4PG9B 3RUGB 3I2CL 2QHRH 3QSKB 4M03A 4LSQH 2QQKH 4R4BB 5IF0A 3TV3H 2OJEB 3RX5A 3P0VL 2YA1A 4G6JL 4KQ3H 3S88H 3P4NA 4S1SH 1F90H 3HUJF 2HFFA 5HHVH 3VD5A 1BWMA 1TMCB 3VXPB 1A3RH 5C0FA 4JFHD 1MCSA 2DKUA 1JPSL 1UADC 3QZWG 4KU1A 3D0VA 2GTZA 4MA1B 3S96B 3TJEL 3ARBC 1T7ZA 1OGAD 4PGBA 4FQXB 1U3HB 2DD8L 1HHJB 2DJ4A 4XI5C 5INDB 4R96B 5HGBA 1U8HB 2ICWA 4GW5A 5H37G 1WWBX 4FFVD 2JB5L 3GMNB 3RAJL 3L3DB 3Q48A 1YYMH 4I2XB 1U93B 3LD8B 4URTB 4JFEA 2ATKB 2EZ0C 5F3BA 4P49A 1YEGL 4OCMC 1RZ8A 4Y0GA 4L4VE 4FQHA 2NTSP 5T3ZL 2FH8A 5TE6H 4F3FA 1FFPA 4FMKA 4EI5D 3MLYL 3VXQB 1EAJA 1FZKA 1DLFH 5FUZH 5HGAB 2V5MA 2ZG1A 3GSUB 3NPZB 3VDCA 3MCG1 1ACYL 5E2VL 4PRPA 2XQBL 3LH2H 1AGBA 3HAEH 4GG6F 4BSVA 4X98A 4CVZB 4P57A 3B9DA 2C9AA 2R2HA 3U6RA 4L8DA 3NIFF 3V0VA 2VAAA 3S34L 1T0NB 4KRPD 4F37F 1NGWA 4TUKL 5FK9B 5EDXA 2HVKB 1RZGA 4NKIL 4JZJB 3K7UA 4MCZA 3LKNB 1DBMH 2D7PA 1MCPL 3QDJD 2V5YA 1P5UA 4NM8H 2A74B 3LEVH 2BMKB 1I8IB 1SBSH 4L3ED 3VWJC 3U6RB 2R1WB 5MP6H 1N4XH 5ECJE 4HIXH 2AEWA 3HTLX 4S1RH 5I18L 4G9DA 2XOTA 3CLFL 4I0PA 5DO2C 3BXNB 3UX9B 4K7PY 5IB3A 3H2WA 2EIEA 1G9MH 1FN4A 1QVOB 4X99B 3WKML 2RGSA 4NC2B 1QBAA 4PRBA 4M7JH 2JIXA 5E5RB 4ONHB 3VCLA 3JUYA 1VFMA 3G5ZA 2WLZA 3W82A 5I76B 2EDRA 2ICWB 1FPTH 3KHQA 3VWKB 5TE6L 4WRLA 3B9EA 4Y5VB 1FNGA 3QUXA 1YEGH 2COQA 1IBGH 1T4KA 4CADB 5B8CB 1V8HA 1YEDB 4QRRD 4ERSH 1S9KC 1HYRC 3UPAA 1XEDA 2ZJSH 3TPUA 5J1AA 3SKUD 3GSNA 1EPFA 4GSDH 1DL7L 1YNLL 4F58H 1KJ2H 3HZYB 5DD3H 2W65A 1QFHA 2O5ZH 1LO4L 4OCLC 1BBDH 4ETYA 2ZZUT 1MHCB 4W70A 5D2LF 4HJJL 4LVNB 4GXVH 4IS6A 1VHPA 3UTSD 1P4LA 5IWLA 1WWCA 5HJ3A 1NAML 1TZIA 1QD0A 4JPWL 4X6EB 3QPQD 1V3LA 4Q74A 4YHKL 4FTVA 5FYLH 3WO3B 4RGMB 4MAYD 35C8L 4WUKL 3RL1B 1H15A 4XX1E 1W0WB 1Z9LA 1FG9C 5FUCE 3I2CH 3ZYIA 4N0RA 4U1HB 5M95B 3FB6B 5IM7B 3QEGL 4PJ7B 3U2SB 3CPLB 4MD0A 4MB5A 2ORBH 1I7UB 1M05B 3CFEA 5DDHA 2V2TA 3GRWH 3NCCB 2FBJH 2FJHA 2BNQB 5ICYA 2H32H 3IXAA 3JV5A 1QO3A 5BRZB 3IU3B 4PRHB 4G7VH 2DM2A 3D85A 3SE4A 4M5ZH 2C1PB 5H35B 1CDGA 1P7QD 4OD3L 2BVOA 4QHNA 4C83B 3KPRB 1GIGL 2ESVE 3L3JB 4UNVA 2WNGA 3L7EB 5ALCH 1JL8A 5GGRY 5IBUB 1PLGL 1YEFL 2CK2A 3G6AB 4NQEE 2OSLB 2IFFL 3QIUA 5L9DH 2HMID 4P23D 3MRKB 3MRIA 1U92B 4HIEA 4YUEH 4OCWL 4KVCH 4U1MB 4NWUL 5IIEA 2IPUG 1EHNA 4C56E 4WNQA 2HKHH 4P0DA 3FT4B 3T2QA 1QSEB 1GGIH 4JQVA 4UILH 1A6AA 4Y1AE 3KPRE 4F7MA 4PJIA 5IHUL 4FXGA 1UM6H 3IKCA 5BV7H 5EOTA 4KJWD 4XPHH 1ZLUH 5F7MC 3D3VD 5EUOB 3C2AL 1HSAA 2AI0L 4I5BB 2IGFL 2DWEB 5K9OA 4NO3B 4ZFFB 2EYSB 5DZOA 1JPFB 4HMEA 2NY4B 3ESVF 4N8VG 4RFNC 1FGVL 3IDNA 5EA0H 5SV4A 2YS4A 3QBTB 1TJHH 1C5DA 1LDPL 2CDGA 4L9LB 4NQSA 1J0KA 1DCLA 5D6CA 3VFPA 1QFWH 1RZKC 1ZHLB 2WUCL 4LDLB 4AG4L 4AT6A 3OGCA 1BP3B 2F54D 3JVGA 4YIQA 5EUOE 4NOBA 3HI1A 3BMVA 4FQXC 4ZFZA 1KCUH 4APQB 3VFSA 5T3ZD 4M1DH 3BP6A 1JWMB 1OT1A 2APXA 4IIQA 4ZODA 1FFOA 3QFDA 3LS4H 1KJVB 3ECBA 3QH3B 1LEGB 1WTLA 1MFEL 4PB0H 1D9KA 1NGPL 3ULVD 1L7TL 3BWUC 3VG9C 3F7VA 3QDJB 3E6HB 1SYSB 2N4IA 4WEMB 5E2TL 4D9RD 5BCAA 2DKMA 3DX6A 3NIGE 1OP5H 4BK5A 4L3EB 3ARXA 1D5ZA 5DI8B 2W91A 1E27B 4MDJB 3UPCA 3VRIA 1GC1H 6FABH 5B8CA 5C0GA 2WM0A 1NBVH 2A73B 3RPIB 2C5DC 2VDPH 5F1IA 1HSBA 1JWSB 4OIBA 1KPRA 3O8XC 3QG7L 3K4DA 43CAB 3PWNB 1LK3H 3TVMC 2HRLA 5JW4R 3DX9A 3T8XB 4Q6IA 3MOBH 3PWPE 2ID5A 5KW9H 4NWUH 4WEUD 4E0RB 5TGBA 4JY6B 2HG5B 4IOIB 1UXWB 1QKZH 4LRIC 4M3JA 4X4ME 4NQTA 2JCCB 1F3JB 3BPCA 3L1OL 4JDVA 1D6EA 2CMRL 3QA3A 1MCBA 3WS6A 2QSCL 5GGSB 2XZCL 1DBKH 3O9WD 4POZD 5L2JB 4JAMB 3NCMA 1QRNA 2GT9B 4HKXA 3K8KA 3DMMB 4X7TA 5SWSE 4XAWH 2GJ6B 5JPMB 5DJXA 5I16B 1F3DH 5CLTA 3L9RB 2R1WA 3SCMD 1BF8A 1SBBA 3KLHD 5DD5L 5GS2D 4AJ0A 4NQDA 2GK0B 3MRIB 5JHLH 1UACL 4XP9L 3W39B 5KG9A 1M4KA 1HI6A 2UWEA 5E94B 1Q0YL 1A22B 3MV11 2G9HA 2QSVA 12E8L 3RKPA 2ZPKH 4IRJC 2BNUB 5AYUL 3BWAA 1FVCA 2X4NA 4P9MH 1O7VA 4OAWA 3VXSA 4MSWA 1ZLVH 1OGTB 4Z95H 1YEJH 3D69A 2D0GA 4LVHC 1UEMA 3RA7H 1FZMA 1S9XA 3ELAT 1KPVB 5IB5B 1P7KB 3WIHL 4YDIL 1T6WA 4G9FA 3OKMB 4LSPL 1VENA 4XMPH 1W72L 4PJ9D 1YJDC 2ARJQ 2OR9L 4XAKE 1MLCA 3ZKSD 5C6TH 5E1AB 5HGAA 3S37L 5ICZA 3P73B 4QRSB 4HC1A 1S7RA 4U1NB 4PB9H 1A7NL 1F58H 3TBYA 5IGXL 4Z0XB 5ISZD 4YHMH 2X41A 4Y5XC 1G6VK 5HDBF 3B9KA 5L2KE 1CICC 1XIWA 4J12A 4I2XA 3BGFB 3IT8D 4MXWL 2IJ0C 1JZ4A 3HPLB 5IEKA 2DBJA 4RFOL 4Z7NE 2WIMA 1Q72L 4HKZB 4AYFA 5HGBB 5FA4A 2VC2L 3W11C 4LPCA 1ONQA 4HIHB 3VFVA 3LMJH 1SJEB 4DUVA 4FZEH 3O6FD 2GTWB 2YPLA 3MRRA 4L4TD 1U8KA 2D9CA 3ARDD 3IU4H 3VXUE 3G6DL 3IDIB 3QCVH 1ZA3B 4KKLD 2HJKA 1TQBB 5D7JA 3ET9F 2NW3B 5BS0D 4HKZA 5EC2A 1UCBH 1I8LA 3CDCA 5DMYA 3VA2C 1IGYB 3BRDA 3SJVB 1JV5A 1IEAB 5HYIA 3H0TB 4X6DA 4JE4B 4R4NC 1JNJA 4IRJB 2ZUQC 1WVZA 3A6CL 3LV3A 3Q5OA 2UZIL 2NZ9C 4NUGH 3EDJA 2BJMH 5TE7L 5GRVL 5L8LB 3EOTL 1CDIA 4WJ5B 4OCWH 1MAMH 1EUUA 4OLZL 3RUGE 3WDHA 2R9HD 2Y7QB 1B2WH 3RWIA 1IC4H 5I18H 3WNPA 5F70A 3BEWA 3U7AA 3GMMB 3JWOH 3OJDB 2ZCLL 1AJ7L 3MACL 5DJCA 1OL0A 2V9TA 43C9B 2CKNA 1CICB 2WP3T 4JO1L 4OZIE 5GGTL 4NRYA 2AK4B 5CCKL 1RZFH 1PQZB 2K7PA 3GMRB 1U8LB 1EK3A 1HHJA 3TC9A 3NABH 4U6HB 1MFDL 2ZUTA 2J8HA 4PGBB 5TDPB 4LPWA 1EVTC 4C58B 4M9OA 2KBGA 4LU5L 2DS4A 2JK5A 3JTTA 5D6DA 3GBLA 1OAZL 1WBYB 5C09E 5EU6B 3MXVH 3ROOA 1XR8A 4ZFGL 5E6IA 5KSAB 4HAGA 5TQ0L 4P2OD 3GSXA 2XFXA 5EBMB 3OJVC 5I1IH 4GAJL 2FX8H 4MCZB 3RHWK 2IQ9L 5T1DL 3MJ8A 4BFGA 3WJLC 4NNYB 3FQXA 5JORB 4WV1A 1X4ZA 1A7OL 4K8RD 4L4VB 5DUBB 3VFUB 1YY8B 4XMKH 2XY2A 4CJ0A 1SJEA 3S5LG 4HUWB 1NAMH 1WC7A 1PFCA 4KQ4H 1X4YA 3IFNL 5HVFB 5I66B 3KS0H 5DQ9B 4M93B 4JKMA 1KGCD 1PKQA 4Z7UA 4ZYKB 3RWDA 2Z8WC 4BSVB 1XGPB 4PJAF 3GUTB 5DUPL 1J86A 5SWZD 3DSFL 5CD3A 3RNKB 2VZUA 3IAGC 4JDTH 5EO0A 2X70A 3IXTB 4X7SL 3QWOB 4Y4HD 3C6LA 4OLZH 4JEGB 3MLVL 2B4CC 5IKCB 4HS3B 1T1YB 3V0AC 4K3EH 4Z7VE 1OARL 2C1OA 4X6DE 1H0DA 5I1DB 4ODWB 4E0RA 2VKXA 4NO0A 1A6WL 2AJ3B 1G7MB 3JSSA 4X80H 5FB8A 2VB5A 2EEAA 4X9IA 4JHWL 1RV6X 1TZGL 2NY4C 2FHBA 1WAAE 3CAFA 4NHUA 4WWID 1OAYL 1AY1H 4BSWA 2X4TB 3EYSH 3FFCA 2QQNL 3BH9B 5DI8A 1YMMD 3CU7A 4HJGB 5HHMB 3IFNH 3TZVD 1ITBB 3HR6A 2GI7A 3MBED 1KCRL 3QDHA 1EEYB 3BGFC 3OKOA 3QIBD 1JV5B 2MJWA 5BVJB 5JHDD 2EDKA 1MH5B 3CVIL 3LS5L 2DL2A 4ORGB 1ZGLA 1WQVT 3IFOA 2NNAA 3M45A 3O3AA 3QQ3A 4MX7A 1I85A 1NLDH 4BUHA 2Q8AH 5IOPA 2GFBB 4PJXF 4H25A 3EOBA 3UBXG 3I6LD 3NFSL 1YYLL 4I77L 2DDQH 1HINL 3PGDB 4DUXA 2XNAA 5CWSA 1A6WH 1KENL 2NY2B 1ED3A 3BUTA 2H32A 2NY4D 2WUCH 1JF6A 4NFDA 2DTML 3FB8B 3TYFB 5ESQA 1ETZB 5I71B 5L2KB 4KDTA 4YFDB 3TBYB 1K8IA 4U7KA 4QF1B 5E99L 4H25B 4NCC2 2PTTA 4EI5A 4NNPH 3B4NA 4HH9B 2IPTH 4JVPA 5I74C 3BKJL 4FG6D 1CL7L 4I18A 5CJOH 5F9JB 1AP2B 4K9EC 4O51A 3RPKA 1YDPB 2AI0H 2YPLD 3RWJA 3IKCB 2H41A 3D39D 5IB4A 1VKXA 3B3IB 5IB5A 1NCCH 32C2A 1SJVA 3VI4F 3I3DA 4LVOC 1KCKA 4YHIB 3F5WB 1OGTA 1XR8B 4G3YH 5ILTH 3O41A 1FZJB 3LMJL 4QHKI 1QBLL 1IC5L 2VABB 1IE5A 5JIIA 2HFGL 4MJ6B 3SJVD 3PWJA 1U92A 2VLLB 1JF1A 5EORH 1DZBA 4PJHA 1OQOA 4ZUVA 4YR6B 5TQ2L 4ZXBC 4BM7A 1RHFA 1UM4H 4J8RB 4OB5H 3V4PL 5FO9B 4UQ3B 4NWTL 4FXKB 1JWUA 3O41B 5KSAC 3DROA 5I73B 3HRPA 1IKFH 2NY2C 1G7PA 3MOBL 1PKQE 2P24B 3NCYS 4Z7UE 1E28B 3HNVH 4WW2C 3OKNA 1L9NA 2J8UA 4HKJA 4H0GA 1EO5A 1LDSA 2P8MA 2PKDA 3GB7A 4XH2B 4F7PB 2I07B 3VDBA 1CXKA 3BP7B 1YEHH 2NNAB 4OUOA 4QF1A 5CEZL 3ESUF 4Z7NF 5GS0H 4K2UL 3S35L 2EO9A 4LPXA 4U1HA 5C08E 3FO2B 3N9GL 1KOAA 4WU7A 5SV3A 2VLRD 3FTGA 1ULVA 3DMMD 2NXZB 5C8JA 2NYYD 4GRLA 1PKQB 4Z7UB 3RWDB 4ZYKA 1VA9A 1N6VA 2D0FA 4HZAA 4M7KH 1HQ4A 5GRVK 4YHPA 4L3AA 1BFOA 5IT2L 2YKLH 4XTRD 4LHUD 4MNQD 3EOBB 5DJ6B 4L8SB 1S7UA 1JRHH 4WCYH 2JJTC 1D3CA 1G0XA 1M7XA 2NW2B 4ZOBA 1B0GA 3PDOB 1I8MB 3OG4B 4M48L 2HP4A 4M7LL 5HHQA 2F74A 1N2RB 3GSXB 4KFZC 2CKBL 4DZ8B 4C55A 3ARPA 5IQ7H 1NANH 3BQUD 4HWZB 2K3TA 3B5TA 3GJFA 4XVUC 3X12A 2FJFB 1ZHNA 1GPOH 1K6QL 2R15A 4HC1L 4D8PB 5HVWA 5T33L 4LSDA 3VXME 3UTZB 1S7SB 1ZGLM 4J3TA 4I0CC 3V5KB 4YHOH 2XXMB 5CSZB 1U8LA 3GI8L 4HAFA 1KIRA 4Z77B 4Z78B 1VFUA 5EU5A 5GGUA 1E6OH 2EE2A 4ZFOL 4HX1B 4OZHB 4QHLA 2XZCH 1UM6L 2XN9D 3VWKC 4R7NB 5KSBB 5IMKA 5BZWB 2BNRE 4OD1L 3FO9B 5E08L 3UYPA 2XTJE 2ED8A 3TYGH 3GM8A 1LK2B 1V7MH 4IRSB 4G8EA 1U41A 4GBXD 1M6OA 4XNYL 2BOCB 1AR1D 3ZE1E 5IEHB 5GISL 2R1YA 5IP4A 4LIQE 2IG2H 3PHOA 5DJAB 4L4VA 5DUBA 3CDYA 4XNXH 5FHAH 4RDQF 1NC2D 2QADB 3G5XB 5DJ8B 4M1GH 1ITCA 5EO9A 1BVKA 5KN5A 2R4RH 5J57B 1CIDA 3ZE2E 5KANG 3GBML 4JM4L 3L3OA 1FVDA 1GSMA 5FGBC 4J7RA 4AG4H 2DAVA 1NJ9B 1RUKL 2Y25A 4ZAKD 5C1MB 2PXYC 3EO1A 2HJLB 3AAZB 4K8RH 4XMLH 4QOKD 2FATL 3MCLH 1BFTA 1U8KB 1YEDA 2CK0H 1G7JB 2RCSH 3O0RH 1BOGB 5IFJB 3E2HB 5ID0A 2AW2A 4JQXA 4XVSH 2J5LB 4X6BB 3RJDA 4FQPA 4YGVB 5GRWA 5C2BH 4MAYC 5DA4A 2FO4A 4GRMB 1CD9B 4PRIB 4NN7B 3OJDA 4Q6IC 4TN9A 5DK3A 4EN3A 3PWNA 1SQ2N 3ZZ1A 5IMKB 1RU9H 2EYRB 4ODTL 4GUPB 4ZXBD 3VJ6B 1IM9B 1QHPA 1BJ1H 1Z9SA 1G1YA 5F6IB 1AGFB 2HT3C 3C8DA 3ZKXC 4OCYL 5LWYH 1S7SA 4PJ5A 1U8PB 3IRPX 5D72L 5I8OL 1FQ9C 5D4QA 4QRQB 2EYRA 1JNHB 1OM3H 1J88A 4PJ8B 2VDOL 3M8OH 4RGOL 1KB5A 3B2UD 1I1AA 4XNYH 2VIRA 5DD3L 1B6DA 5BQ7A 2C26A 1U2CA 1KLGB 4QEGA 2D4DA 3P4OB 1JNNL 1CGSH 4JLRB 4LKCA 2IPTL 4FG6C 4HLJA 4PJGE 1I8MA 4R4FL 1JZ3A 2A38A 4P5KB 5F97E 1ZLSH 5F96H 1S7UB 1BVZA 4D0DB 4DEPB 3W39A 3TT3L 4OZIF 5E2TH 2AXFA 4NQDB 5GSVB 1INEH 4WGVB 2FBJL 4WO4A 5GRJH 3WO4B 4N90D 2ESVB 2FBOJ 2J5LC 5C8JB 1NFKA 1R5VA 2F8XC 5CUSL 5ALCL 4O2CB 2DQUL 4FFZL 3LEYH 3KJ4B 1H3GA 3KPLA 4NC1E 4OD3H 1NGYB 1IGIL 1AC6A 4Q7DA 3OF6D 4ZPVA 2OL3B 3GSRA 1UJ3C 2YPLB 5EOCH 3LKQA 3PE9A 3HCVA 1BD2D 5GIRB 1P7QA 2JE8A 2CRMA 5CJXA 3JV6A 2CO7B 2IWGA 4N1CA 3V6OA 3PQYE 4M7KL 1ZA6B 4CN1A 1X5XA 1DE4B 2CLZB 4K3JH 1MJ8L 4HGMA 3CXDL 3VH8A 3X3FH 3EGSA 3SGKC 2NMSA 3N0PB 5IV2A 3QWRA 2GAZB 3K4ZA 2Q86B 3U0WH 1FORL 4HXAL 1TZGH 4JZOA 5IVOA 3UTSE 5T3ZH 1A2YA 2FSEA 2KDGA 2QKIB 5EUKB 4I3RH 4JRXB 4PJHB 3EHBD 4MB3A 2CXGA 4QRRA 4D0CA 4UZGA 1IQDB 4O5LL 2PYED 4NQCE 4GW1B 1BQHA 4M6AA 1P7KA 4JCLA 4WI5A 1TVDA 2AXGB 1E4XI 2I9TB 3C8KB 4QXGH 3R0MA 1IBGL 3C8HA 5E0QA 3ARBA 3HB3C 3D39E 1KB5H 4UNUA 3U7WL 5IW6A 5DHVB 3LKNA 4JANA 3UTSB 2F53A 1KIUA 4MLIA 5I8KH 5F3HB 3OKDB 1S7TB 4M8QB 1JGVL 4MD4B 4YC2C 3CZJA 3KLAA 3AB0B 3C6LD 3HMWH 1U6AL 3WFBH 3MGAA 1W8NA 2VL5A 2V2XB 1CE6B 5EG6C 4NYLB 2NY7H 3TVMA 3RY5A 2H1PL 1GGBL 3V7MA 4X98B 4PS4H 1K4CB 4JJ5B 2MQ3A 3HZVB 5KSBE 2E7HA 2YD7A 3G08B 3MNVA 4TOYL 3ME0A 2DIAA 1J8HB 4AENB 1NC4D 2KL6A 2FZ3A 4XXCC 2X4RA 3TZVC 3GSNL 3VXOA 2YD2A 4P2YA 5JDSB 1CE1H 1KG0A 4HHAB 4R7DB 1UVQB 3CXDH 2YKLL 4IS6B 2EEBA 1HH9B 1MH5A 3LS4L 2ZSWA 5KTEH 1T22B 3MRGA 1ZT1A 2WWMD 3QO1A 35C8H 2IADA 4Q6IB 5E6IC 3TBSB 3THML 1LEGA 3JBG7 3MROA 5C3TA 1D5XA 1RJYB 1CDCA 3DGCR 4OF7A 3FRPA 3O4OB 2H2PD 3V7AE 1N7ML 3RTQC 4YE4L 5AZEH 4F33B 3NPSC 2X4QB 3TV3L 5CEXA 2YD3A 1MVUB 1CIUA 2RCSL 1HYSD 1A9EB 1P4BL 2DF3A 5FUCC 4R3SB 1T1XB 4YHIA 1Y0LB 4G8GE 3G5ZB 2AJ3A 3WN5C 4QTHA 5EIVA 3F6IA 5FGSA 1MVFA 2H8PB 5T1KD 2AKRB 3HLAA 4NKMA 4ZS6D 3IJHA 4EI6B 3O11A 5EIIB 3IDJA 4Q2ZB 1KACB 3OAYH 5F3HA 2UWEF 1S7VB 5C9JA 4L8CA 3BQUB 4I9WE 4LCYB 2X1PA 5EO0B 4OQTH 3SQOL 4D9QD 1CE1L 4JGUA 1E6JL 3ZDZF 3PV7A 5SWZE 4G7YL 1A9BA 5DFTA 5KVFL 1MRDH 4S1DC 1O0VA 2IPUK 4LLMB 4M6ML 4ENEC 3B6SA 1ZK9A 3PL6C 4F7EB 2ICES 3U36B 4L8CB 1D6VL 3WLBA 3HR5B 2EIZA 3STBA 4P3CH 1YY8A 3DWTA 3MLVH 3SDAD 1IAIM 5LQBL 3TT1H 4QYOB 4K7PX 3P11L 5DJ2A 2JJWA 4ZUWB 4UV7L 1UEYA 4CVZA 5BJTB 3DV6B 3NN8B 1D5BB 2OR7A 4JREB 4PRPB 5FXCH 4HIEB 4L4JA 5F9JA 1GGYA 3FQTB 5HGDB 4U1GC 4X4MA 4K7FA 3FT3B 4U0RB 3FB6A 5IM7A 1AXTH 3RWFB 3REWB 2A6JB 2IQ9H 3LQZB 4FQHB 4GRWB 3U30B 3H9SD 3MRCB 3UROR 1A5FL 3BKCL 1DSFL 2E27L 3LKSB 3PP4H 3D85B 3LKPA 1NKRA 1WGOA 4S1RL 1F8TL 3OJMB 2K1MA 2LE9A 1EBAA 5ELIA 3GSVA 5GGQH 4GXVL 2DQUH 4FFZH 4J3XA 1UC6A 3MRLA 1JPTL 2Y36H 3MA7B 4GQ9L 4XAKD 2YD5A 4G42B 1XGRB 4YBLB 3LPWA 3X11B 5DJ0A 1NCWH 4A2MA 4I0PB 1J0HA 4X5WB 3CH8A 5IB1B 4UT7L 5IR1B 4JFYB 4XXDA 5LQBH 3KLDA 2AK4E 5KSUA 1ZEAH 3JWOL 1QYGL 4LIQH 1C5BH 4HWEH 5I8EB 4NP4H 4QRPB 5D9SA 4X4YA 4PLKC 3HE6A 4KTEL 3CSYA 3BJ91 4ZQKA 4HW6A 3BAEH 2KZWA 1FPTL 4RGNB 2QV2A 5TPWL 3WNLA 5B3NA 4HV8B 2MCG1 4KI1A 5T1MB 4OV6F 4YDLB 2VXTH 4WWKA 2V17L 5E6IB 3BPNC 5ERWA 4LLUB 5C08B 3KPQA 3SDAA 4PGEB 1CZ8H 5I1DA 4LGPB 5ID1A 1J8KA 1GGBH 4ONFH 3MX0A 5DMGC 3MNWB 2FEDC 2JB5H 4QCIB 5D1QB 4PY8J 3WE6A 1C7SA 2EE9A 5EUKA 3UJJL 1QVOA 3D2UB 4APQC 1AGFA 2DLTA 4HJ0D 2VXSH 1F8TH 4ZOAA 2EDYA 2YD4A 4GFTB 4JJ5A 4OTXL 4YQXL 1T66D 5HBBA 1DSFH 2X1WL 1Q9LB 5CS7A 2YMXH 2YR3A 1EO7A 2NX5B 1VEMA 2AJZB 4PJAA 5GPRA 2D31A 3NOIA 4XPGH 4NQEA 4JM4H 4QYOA 1BAFH 3PNWA 4WHDA 3LOWA 1NGXB 3O2DL 5F6HI 4Q9RH 4YO0B 1ZVHA 3VRLE 4PJDF 3S37H 2ZUXA 5DHXB 3VXMB 3OKEB 1TJHL 3T0XA 1B0RA 1BECA 1EEZB 3C60B 2VMFA 1W72A 1CDYA 4YXKH 2FIKB 3MLTA 4EEEA 3KYNA 2EDTA 5DUMH 1D9KC 1XGQA 2VDML 4FOMA 2DQTH 4JFYA 1FNEA 1N59B 2LABA 4G80A 2HFFB 3SCMB 1MIML 2HKFH 2XY1A 1AFVH 4OD2A 5TDPA 2W9EH 1EMTL 3M07A 2OQJB 2BZDA 3NH7H 2VE6B 4JFPA 4J4PA 4X4XA 4M61A 5ENWB 3UTZA 3P40A 2F5BL 1AKJA 3EO9L 2H8PA 3A6CH 4R2GB 4V2BA 3IDGB 3E1F1 3SOBL 5FO7B 2BVYA 4HK3N 1F5WA 4AK1A 4WWKB 1L9MA 2B0SL 5BZWA 1G7QA 1JNHA 4HC1H 4K9EL 4UT9L 1CFSB 1RURH 4GAFB 3VXSE 1F11A 1ZWIB 3TCLA 4P59L 2X89D 5JR1H 3TH4T 3FQTA 5HGDA 2XKSA 2XWBA 1P9MA 1U8OB 3C5ZD 4FQXD 4KRMB 2VDLH 3BD5A 1MF2H 2CGRL 1JHTB 1EEUA 5H94A 2NR6D 2PYEB 2Y5TA 3LKOA 5J0BA 3AUVA 3UO1L 5HDQH 5D93B 3G6JF 1SEBB 1FYTB 1TNMA 1YPZB 3S36H 4AEHH 1TVHB 1KJ3H 2FX7L 2OJEA 3QRFM 3QUMA 2QR0A 4N0CC 1SMOA 3AAZA 3ZTJH 2A9NH 1S8DA 4G43A 4MNQE 2BRRL 1A5FH 4JO3L 4QRUA 4MD5B 5JZ7C 5D6CB 1JPGA 5T3XD 3TNMA 5C0AE 5BQ7B 4XCEA 4GAJH 1HIMH 3UCRA 2BK8A 4FQQB 1XIWB 4N5EC 4LLVB 4ZAKA 1X9QA 4P2RB 4XPBL 4JFFD 4M43L 1I3RB 5IESH 2NX5D 2F8VA 3U0TB 3QIUD 1NGQL 1NPUA 3MRPA 1IAKB 4P4RA 4ZUVB 5K9QG 4MD4A 1FDLL 3M1BA 5C0DB 4XGZA 3BPCB 2BC4A 3W11D 5D5MB 5CBAA 2A1WH 1X7QB 4D9LH 1K5NB 4BQ8A 2FATH 4JANB 3UTSA 5I6XB 4U6XB 3ZE1F 5D1XA 1U91A 3OKMA 3LY6A 3OAUH 1SM3H 1W0VB 2Z31D 1L7IL 4EIZC 1ZVYA 3EJJX 4GRLC 3TT1L 1Q9LA 3HZMB 2NTFB 5CJQH 4WHCA 3ZDXE 2OR8A 1WCBB 2ZUVA 1TCRB 5ILTL 4HFWA 5BXFA 4KVNL 2NY5L 4X6CB 3QDMA 2KH2B 4OJFL 2WINA 5C6PB 3JUZA 3HAEB 3MZTA 3QCUH 4KKCC 4HUVA 4WUUD 2OCFD 1ZLVK 1S78D 1T83A 1KELL 4PJEA 1C12A 1NAMB 1NCDH 3W81A 4FZ8H 1LMKA 1QR1B 5CBEA 5IK3A 5I71C 1Y18A 3MOAL 1RIUH 2CRYA 1H9VA 2XWTA 5I1GH 5E03A 1OWRM 3PQYB 4JG1L 4I2XE 3A0OA 1PGRB 4OZFB 5LCVH 3ARQA 4LDEB 3KJ6L 5T1KB 3L7FA 5DHVH 1DVFD 3IDJB 3MRMB 2XYCA 5FV2A 5I15L 4WHYG 1WZMA 1UXSA 4HT1L 3ZT6A 3FO0H 2G5RA 2DM4A 5EU6E 4FP8H 4F7EA 1NFDA 1A7BA 3NACH 3Q0HA 5ESQB 4ODHH 2E9JA 4H88H 1VESA 4EVNA 4Y19B 3PG2A 2BHUA 3O4LA 3L3IA 3QYCA 1FRGH 1BIHA 2J6EA 3DI3B 3MBEB 4N8VA 1BZQK 1S7XB 5KS9F 2PYFB 5EU7C 1UXSB 1FYTD 4HEME 4LSSL 3VRIB 1J5OL 4MMXC 5JHDB 3V6FA 3SGJA 3GMOB 1BFVL 3H9HB 1MFCL 4R8WH 3GBNH 5DMKA 2R56H 3K1DA 1PZ5A 5I73C 4XNQB 2PXYB 5EWIL 5BMFH 5C0CD 4DZ8A 1UQSA 2UUDH 1C12B 1NAMA 1YC8A 3IF1A 4KH2A 3TNNB 3VMNA 1JNLH 5EU4A 2HTLD 3RWFA 3SBWA 4YFLF 4AEFA 3EYUL 1OP5K 2P8PB 3IFLH 4QHUB 1T3FA 2DL9A 5C0IB 3VFNA 1EA9C 5SX5K 4JHZA 1DJSA 2VXUL 1A7PH 4A6YH 5JXAH 3WCYA 5CILL 1HWHB 1TENA 3DV4A 3L3JA 4I3SH 2QQNH 5K93A 4M6OH 4M00A 4U1IA 1VGKB 2B4CL 1LO4H 2C3VA 2X09A 1G7MA 2IADB 5IW3A 5HD8C 4JZNB 2YD9A 3RDTC 1I7TB 1IGJB 4AIOA 4TPRH 5BZDB 2XZAH 5I66A 2QSTA 1JGUH 2M26A 3VWJD 4U4BA 4Y88A 1I3UA 4IEFB 5HHOB 4LSUH 2ZSVB 3ARFD 1E4KA 1T2JA 4PLKD 4O58L 5HHME 2Y07L 4P2QA 4KJYA 5TDNB 1HCFX 4U3XA 1Q38A 4NZJA 3DUSA 1WFOA 2R0WH 3EYOB 1MY5A 3QULA 3MLSL 3S37X 4IMKA 4I77H 3GIVB 4G6AD 5CZKA 2UZXB 3JWDH 4KZDL 5LXGL 4Z8FH 4WW2A 1YEKL 3ZLQC 3MOQA 3L3HB 3KWWA 4OQTA 3EDFA 4QXUL 3LRGA 4QNPF 4MHHG 1RZGB 4MYWB 4ORGA 4BH8B 2W60B 1RUML 2DLHA 1Z0MA 2GITB 4HUXA 3ARFA 5DJYA 4NKOB 5H35A 1M6OB 1JUFB 3C6SB 4M7ZC 12E8H 1RY7B 2ZUWA 2OTUB 2A77H 1K85A 4GKSA 4YEFA 3GO1L 4NQUA 5MERB 4XPAH 4OSUL 2XZZA 4HS6B 4XP9H 4OM1H 1N6UA 1FGNL 2DI8A 5ITFB 5CP3A 2E7MA 4PJDB 2BSTB 3CC5A 5DD5H 3BE1L 3EO0B 4U3CA 2XICA 2FECI 3TIEB 1TETH 1FJ1B 3E8UL 2HT4C 2NXYB 4IIQC 4YX2L 3S3PA 3U0TA 5GSRA 2Z0BA 1IAOA 4NQVA 3O6MH 2BVQA 3CVIH 3LS5H 4WTXA 1UM4L 4QXTB 2EE3A 3T3MF 4X6DB 5ERWB 5DJCB 1NFDE 3DHMA 2D7TH 5IROA 5GS3A 4X6DF 5J9PB 3MUHL 3UTQB 3CZFB 5BRZD 1UYWL 1YZZA 3GI8H 2JJSA 4GMTL 3HCVB 5KBNC 1UVQA 4OGXL 1CDHA 1VPOH 4QOKA 3ZKND 3CVHH 5C0ND 4PTTA 1EJ6A 1G0DA 1XF5B 1FNLA 2I26N 1X6LA 3UDWA 3GKWH 3LRHA 1OP3H 4L8BB 5TE7H 5I1GL 3IJSB 1GRWA 1LP9A 5J6HB 1CE6A 1G6RL 1T0MB 2UZIH 4NUGL 2V17H 4ODXA 4R90H 3TPUB 1CF8L 4KK5D 4E42B 5F1NB 2ZUUA 3MYZA 3HUJB 4OFPA 1MRFH 3GIZL 3AS2A 6CGTA 3ZDYE 2OJZH 5DUML 1RUAL 1KENH 2XTJC 2R9HC 5L88L 5F93C 1QLFA 4ZFGH 4PRID 4GXUM 2Q8BL 2AQ3A 2M1KA 4JR9L 1D7FA 2AXGA 4IDLA 4MS8C 2ZNXA 2FYYB 3EFFA 1R0AL 3O0RL 1DN0B 5TF1L 1U8NA 2OP4H 4PLOB 4Z77A 4RRPG 3VFMB 1VADB 1F4YL 1BIIA 1FRGL 1OF2A 1TTGA 2VE6A 4OCRL 3TFKC 5MENA 1PX4A 4XCCL 1MNUL 5T3XL 3WXWL 2BSTA 3RVUC 4HWBA 4TYUA 5A43C 4JFFE 3DXAE 3GMQA 4AH2A 3SN6N 3MRNA 2FLBT 3H6JA 1RJCA 3O6FC 5DZNA 4OF8A 4PBWD 1QA9B 1JK8B 4AEHL 1REIA 3QIWB 2BMKA 3RQ3A 4PRIA 4XB8A 4X7DC 4RBPH 1S5IH 2OJZL 1PEZA 2EH7H 1AQDB 5KZCB 2A0LC 3WYRA 5I6XC 2Z93A 3FB7B 4FQLH 5HPMB 4L9DA 1ZT4A 2I5YL 1A02N 3DO3A 4XVJL 2BRRH 4JO3H 3P30H 5D1XD 2GJ6D 2ZSVA 2FDBP 3H3BC 2Z8SA 3I02A 4KTYA 1UA6H 4Y1AA 3ULUL 4M9PA 2H2SC 3DXAB 1LNUA 3RFZC 2H3NB 2XFXB 1K8IB 3B9VA 1UB6A 4F7CA 2NXYD 4QGTA 2JF1A 1A3QA 5HY9B 5CSGA 4WI3A 4L9LC 1IFHL 3MO1A 3BAEL 4NSKB 4PJ9C 4U31A 4HF5L 5FYJE 3DMMA 3PABB 1GZQB 3IU4L 1U0QA 4X5XB 3D0LB 3RIFF 1QYGH 4HS8H 5DUPH 2V5SA 4PJ7F 2P5WB 3UTTA 1KB5L 5CEYB 5ACMA 2YC1A 4N0FA 3FQRB 3EOAA 4DGVL 2CKBH 5HYJA 4J4PD 4JZNA 5FOJA 3T4AA 1D9KB 4E41B 2VZVA 3MV9E 5DFWH 1SEQH 1A6ZB 3PIQA 3NGBB 5INDA 4I3RL 2CD0A 4P23A 3TO2A 2Q8AL 5KSVB 2EKJA 2A73A 1KIRB 4CRPA 1G7LA 1I9EA 2VZTA 4LHUA 4M43H 1D5IL 4MNQA 4QHUA 4NPYB 4F8TA 5CZXD 4OLUL 4M1DL 4PJ8C 2HKFL 3RVUD 1GOFA 1HXYB 3W9EA 5E4EB 3VFGL 4Z76A 4M6NL 3JTSA 5A16A 4GRMA 3I50L 1DVFA 4HCRA 5IB1A 4CBPA 4WFGD 2QADC 2E6PA 3MV01 4I4WB 1T2XA 1YN7A 3UBXA 3QIBC 2ZG2A 5FKAB 4QRTA 4HPOH 3QWOA 1GL4B 1OLLA 3NACL 1OTSD 4ODVL 1CFNB 3U9UB 4F80A 1EZVY 3O2WH 1E28A 4YHPB 5EBGA 2CDFB 4DVRH 4MNGE 5BOZG 2XTJD 5I16A 1C16A 2XN9E 1QSFA 1CLZL 4PJGB 3O3DB 2X9YA 5IFAH 2AP2A 1INDL 5IVZB 3O2VL 1A6VL 3SPVB 3H3PL 2YHGA 1XZ0A 3W9DA 2BVPA 4LP4A 5FUZL 5KW9L 4KJPD 3TEUA 1I9JH 4W81A 3U7YH 4MNGB 1ADQL 2YBRB 1J1OH 1KEMH 4TOYH 4B0MM 1HHIA 1HNGA 1BEYL 1S9XB 1Y6KR 3I6GB 3PJSB 3QQ9D 3MBXH 1QA9A 4YDKL 4N1EA 5C0AB 2MCPL 3GMLA 2V9RA 1RZ7H 1IAIL 3WS3A 5E99H 1NMAH 1FNAA 1I3GL 1NBQA 4NFCA 1EHLH 2HWZL 2KPNA 5DK0A 4OF3A 2EDEA 2BSSA 3S3SA 5JMRA 1HKFA 2FNBA 5KG9B 1HOCB 5AAWA 5KSAD 4AL8H 4L4TE 1I8KB 5C7XH 4MJ6A 1JN6B 3ALWA 4CVUA 1SBSL 4N1HB 4HGKC 1JJUA 1EERB 3T0AA 4DVRL 3PIQB 2AJUH 5JXED 5F7DA 2Y5EA 1ZA6A 1HILA 1MWAB 2ARJA 1PY4A 1FE8L 5CZVH 3JV6B 1Y6NR 2G2RA 1KJ2A 1J1PH 3Q3GB 5JW4M 1P7HL 5EU3B 3MMEA 3HI6H 1BD2B 3O6FB 3T08A 2CR3A 4FRWA 3G9AB 3PP4L 2VN7A 1Q94A 3QAZC 4LQFH 5GGSA 1DN2A 2W07A 4PREB 5FM8A 1NGZB 2J6EH 2CH8A 3GNML 3SQBA 4NKMB 5DEGA 5H2BA 3RA7L 1GGUA 1QEWB 2EDFA 5IBTL 3VMOA 1JPTH 5F1SA 1R3HB 1DVFB 3KPNA 3MSPA 1J1XH 3HPJA 1WBZA 3R8QA 3IJSA 2DQEL 1DQLH 4OGYH 1FLRH 4JCMA 2IALB 2R4SH 4R3SA 4TULL 2A2QT 2YUZA 1P2CA 2R2BA 1QNZH 1KBGL 3A6BL 2X4PB 3LHPH 3QJHA 1X5JA 1S3KH 4LSRH 1RSFA 4NC1C 2ITCA 5DC9B 4NZDA 2GTWA 3MREB 4N9GB 2X4SB 3MPCA 4J3VA 1AQDA 3T1FB 3CZFA 4KY1L 1AR2A 1NCDL 3V2AR 4HUUA 4AQOA 4L5FH 1R3LA 2BRQA 3G5VB 5GS2H 5ESVA 1GJIA 2O26U 4LNVA 2E6JA 5LVEA 2WBJC 2ED7A 5TDOB 4AMKH 1WIPA 1KC5H 2CIIA 5CMAA 5LBSL 5D2LA 3TZVB 5JLZB 3UAJC 3UYRL 4FZEL 3GSQA 5MENB 1NDMA 1AI1H 1P53A 3F7PC 5E95B 5IB2B 1MHHA 5F96L 5BRZE 2HN7A 2Q20A 5D2NB 5DD1H 1MCRA 3DYPA 4MJIE 4R4FH 1QRND 4OZ4B 4UTAH 1QSVA 3BHBB 1ODAA 1JPST 4O2EA 4KDVA 4RDQG 1P1ZA 1U95B 3TBTB 4WFFE 3D5OF 5IVXF 4ODWA 4RMVA 2J4WH 4ONHA 4Y16D 5C0AD 5DHYA 4M62H 4JKWA 2R4SL 4TTDD 4K3GA 2Q87A 2HN7B 2BERA 2YN5A 4GW4A 3EYFB 3RZCA 1BOGA 1MJ8H 4JFPB 3OR7A 5IFJA 5GS0C 2D4FA 3R1GH 1AH1A 1JMZA 1I9RH 1OP3K 1G7IB 3NZ8A 2DWDB 4XBGB 5E2WL 1NDGA 1H3PL 1BBJA 3PL6B 3FQUA 5D93C 5F9DC 3GNMH 1CGXA 1CR9L 5IFHL 4G8FA 2HTKD 1KCUL 3R8BB 3V52L 2PNDA 1MFNA 4LRNH 5EO9B 2X5PA 1U8MA 3MRKA 4JAMA 4WDIB 3SKNB 3ABZA 1JYVA 2L4OA 4LHJB 3GRWL 3P0YL 3BDYL 2SEBA 4NM8L 5JXEC 5FA3B 3Q6GH 4HIHA 3C87A 3VFVB 1ZGLB 4HSQA 1T7WA 3NFPB 1GGCH 1NGWB 3QHZH 4C4KO 2D7MA 3T09A 5DT1H 2ADFL 4FP8L 3AS3A 4E41D 2F5AH 2R2BB 3K80A 1I1AD 4M62L 2AJZA 4UIMA 3MRJB 4PV8A 4Y4HA 2RR3A 4TSBH 4TUKH 4NWTH 4PRHA 3HRZB 3WN5A 3PDDA 5D1XB 4U1IB 1YNTA 4XPHL 5A2JH 4JFXA 4OLVH 5F72S 5A3ID 4BH7B 4HWBL 5BVPL 2H1PH 3QXDB 4LHUB 4MNQB 3NVQA 2HFGH 1PJ9A 4JQIL 1K3IA 4R90L 3L3KA 3LQAH 3K2MC 4NZTH 4UDTA 3O9WC 4E42A 1CD0A 2AERT 4GG6A 4P4KC 4GKSB 2DQCL 1SJXA 2VDKH 3MLUL 4OCYH 5LWYL 3L3DA 4XC1L 4W4NA 2BXYA 4PS4L 5ACZB 2P7TB 1N2RA 1CFBA 3EZJB 2NY7L 2OS7A 4BQ6A 4YHNB 1E6OL 3PGFL 3SKOA 1MI5B 1KCSH 3GMOA 4F9PC 3CLFH 4XX1G 3FMGL 4YXHL 1RFDL 1LO5A 5FYKD 4TVSa 1DQDL 4RSVA 1L0XA 1NUFA 2RJMA 3WS3B 5FYJL 3OAZH 3BX7C 3D2UD 3GUTA 1JHLH 4YK4C 4I48B 4G6ML 4K3DL 4XZUA 3MNZA 4HWUA 3T0DA 2DQDL 4YPGA 1DBAH 2GT9A 2GJZA 1MWAH 4DKFH 4ZFFA 3O3EA 4M5YL 1ZA3A 3RX8A 4G6KL 4KK5C 4NQXB 1INQB 4WTZG 4XPBH 5CGYC 3SPVA 3MFFB 4LF3A 2R2CA 2UWEE 2A77L 5ESAA 4BH7A 3D85D 5F1OB 2FJGB 3SY0B 1BD2A 4YHKH 3O81A 2EC8A 4Z7QF 3MBEC 3R1GL 1P69B 4O2FB 3BHBA 3TO4D 4EUPG 3LQZA 5GSRB 3CXHK 2D7NA 2LV4A 1YEKH 4UOW0 4J4PC 4K7PL 1FAIH 2PETA 1IKNA 5ADPL 1XCTB 1KTDA 3EYVB 4MAYA 4U2ZA 2I25N 4DZBA 4F15C 4NN6B 3VI4E 3PGFH 3QUYB 4CL7A 2OTUA 1AGDA 2NZIA 5LAXA 5F1KC 5JPMA 3ZE2F 5J11C 4RMUA 5D2NC 4LCCA 3OR6A 4HFUL 3EYOA 5I19L 3E6FB 2XKNB 1FH5L 3QRGL 5L9DL 5I8KL 2XQBH 3ISWA 3LH2L 1QG3A 4N9GA 2R0KH 1AD0A 4JZJA 2VZ1A 2H26A 2W0KA 3OXSB 5D96C 1ACYH 4GW4B 3WJJA 1B90A 1OPGH 2VLKD 4DCQA 1UWXK 4HXBH 3RIFK 3RY6C 4P23B 3ARVA 4IOIA 4HIJA 1BVLA 1DUZA 2AV7B 1QBLH 5CFHA 2NCMA 1ORSB 1I1AC 3B2VH 3QIWC 3P3YA 4Y4KC 3RIAF 3GKZA 2BNRB 2J12B 4PJFF 4P3DA 5JOPD 2BY0A 2ZUYA 4R4BA 4TNVF 5DSCB 1V05A 3QCTH 1E4KC 4Q2ZA 5HJ3B 2BNQD 4OBRA 1F4WL 2YXMA 3VDAA 4U1SA 3MNWA 3CDGB 1IC1A 3JWOC 4PRAA 4PGEA 4P5MA 3HE7C 3L3GA 2FR4B 1T1WA 4S1DD 4R8WL 5CJ5A 5HDOA 3SDXB 3CMOH 3PL6D 5CP7B 3V52H 1FFQA 3AFLA 4D3CH 4KJPC 1XGYL 1U3HA 2E7LC 3L95A 3G6AA 3MJGX 4P9HC 3WIHA 5IJKC 3CSYB 3EJZC 2IQAA 1F02I 1BWWA 1ZHLA 4GT7A 4AZ8A 3NCEB 3O8XD 1QPPA 3CSPA 4LSVH 5FYLE 4XHJD 4AIZA 4L8SC 1XF2A 1RK1B 1K4CA 2R69H 2E8YA 2HT2D 5FB8B 4GBXB 1T80A 5CGMA 4XXDB 4XHJC 4E41A 4ZTOL 1U8QA 2PF6A 3U0PA 1KTLA 4Z7VF 1FFOB 2CDEA 2JTDA 4MNGA 4OUUB 1EX0A 1YMHA 4MLSA 3ULUD 2Z91A 1RZ7L 3EUUA 3U9PL 1JWMA 1K5NA 2EDNA 1M7IB 3BP6B 4ESKA 1N6QL 2NY3B 2VNCA 4BKLB 1RVFH 4OCXL 5DS8B 5L7XH 4JRYD 5I9QC 4OQ1A 3LIZL 4J6RH 4RMRA 3PWPA 4NKDB 1HZHL 1BOYA 3AVEA 1OPGL 2AJSH 2FYYA 4LEXH 3FT4A 1G9EA 3ES6A 2RBLA 3DUSB 3BO8A 2XXCB 1S7VA 5C9JB 4BZYA 4ELME 4YEEA 3IJYA 5IOPB 5I8CB 4PRNB 4ZUTA 4QRTB 4KY1H 2HT3D 1NGXA 3EDDA 5T1KA 5C0EB 4ZTOH 1JGEA 4LKXA 4ZO6A 1NCTA 2I5YH 1XGUB 3VH8B 1YJDH 4Y16B 4G6JH 4KQ3L 1NCAL 4NQDE 3RU8H 1MAJA 1RULL 4AIZB 1RZJH 4AH2B 4JGMA 4NIKB 4B5EA 3GFUA 3RWJB 2L7JA 5AG9A 1T89C 1X4XA 3FFCD 5LGKA 4Y2DA 2DQGH 4YDVB 2ADGB 1WAAA 1XR9B 4OM0H 1FNSL 4P4RB 3GBMH 4U6HA 2BNQE 2E27H 4F8QA 2Q86A 2HFEB 1FFPB 5HYSB 4D94A 4FQLL 2J6EL 1S7WA 5EZJB 3UZEA 2FIRT 5DA0B 1CTOA 4KRPC 3KR3L 1BHGA 1HN1A 3AS1A 3VRJA 3EBAA 3X14B 2WSKA 1C08A 1PG7X 3ULVL 3GSNH 3V7AG 2DQIL 5T5FL 3OMZA 5B8CC 1MHPH 2Y6SD 1DBBH 4LL9A 3ZKXB 4DW2L 3NCFB 2IAMB 3L3IB 1OB1B 3WFHA 3JWDC 1KTLB 3KPRD 4WTZA 1A6TA 1J10A 3MJ9H 5AAMA 1ORSA 1K8DB 1G6RH 1GAFH 1A9EA 2R8SL 1J9CT 3RNQB 1EEZA 1TJIL 2EZ0D 1GC1C 3QIUC 1IQWL 3LN5A 2N7AA 3HFML 2R29H 1FVEA 3L7FB 1J0JA 5J6GB 1T83C 3V4UH 1AD9A 1XT5A 5IQ7L 4N8PA 4WI7A 4Y5VA 4OFYA 2X1XR 5I8OH 2WIIB 5IQ9B 5JXAL 2VITA 3UJIH 4HG4J 5BS0B 4Y19E 4HBQA 4TVPD 5IVNA 5MHSD 3BSZL 4PJBF 5ANME 3P4LA 4JPKH 2PYEA 3OKLB 2G5BA 4HWBH 4WCYL 4CN6A 2HTLC 4PYHA 5FDYA 3IFPA 3T2NH 3QJFB 4Z7WF 2XWJA 2R39A 4KJYB 5TDNA 4W6XB 1HCVA 2MPAH 3CUPA 2L0DA 3QDMD 3GMRA 1FG2B 4YDJA 1L7TH 5DHYB 3MNVB 3QWRD 2NR6C 2C3GA 3QUYD 3QXAB 3FHAA 5BZDA 1MFEH 4HPOL 3VMPA 1Q0XL 5T3XH 2E8ZA 4LSTH 3QI9D 1XGQB 4OM1L 3S4SG 3W0WB 5E8NB 3WXWH 5GS1A 1MEXH 1KPVA 4WFEE 3E3QE 3DIFA 4D3CL 1QRKA 5KS9A 4LQFL 1BAFL 4YX2H 4KRLB 1FG2A 1CXEA 4WV1B 3WD5H 2R4RL 5I74B 1A7QH 1RPQA 3SO3C 3L5WA 3T0BA 2Z93B 3NIDF 1U8MB 1FC1A 2W1NA 1OSZA 5T5NF 1CT8B 5JUEL 1LK2A 4IRSA 2VDKL 1ZVSB 2VWEE 3MLUH 4XZUB 4EJ1C 1RUPH 3HG1A 1JZ6A 1Q9OB 5B3JF 4KRNA 4Q9BA 1NAKH 2WBJA 2IH1B 4RAUB 1SYVB 2PO6B 1SEQL 2E9WA 1B0RB 4P9ML 3KPSA 5DO2D 1IC5H 3F58H 3MRRB 1D6VH 1Q0YH 3EYFA 1RIHH 1DR9A 3RZCB 1YECH 2FX9H 4HK0B 3RKDC 2OL3H 4UAOB 2VAAB 3UTQA 4HMDA 3RGHA 1ZTXL 4LHUG 3WIIH 3GMNA 4D0BA 5J1AB 2IFGA 1KC5L 4GG6B 4GMTH 4Z0XA 2F74B 3O9WB 5I1HL 1IFHH 3QXVA 3MJ9L 1XCQA 2YK1L 2AQ1A 4OCNC 3IDMB 4EBQH 2LTQC 4LHQB 3C5ZA 4YDVA 3GJEA 1FIGH 3QDGD 1BM3H 1QZ1A 2GJZB 4QRPA 4X4YB 5KVDH 1G7QB 2R0ZL 1HQ4B 3BISA 3F7VB 3GJFB 3O2WL 2G75B 4ZSOA 3T0WA 1LO3L 3W2DH 3FTGB 5GGVH 4XNQA 4KMQA 5DJYB 5JW5B 1WIUA 25C8H 3P4NB 5B4MC 5ENWA 1FAKT 1XGRA 3SDYH 1WLHA 3WHE0 5EUOF 3C5JA 4UBDC 3FAXA 3RWGB 2P8MB 4LASH 4H5SA 4F9LA 5KS9E 5DR5L 3ARFC 4U33A 2HJLA 2GSGA 1MFCH 1MJJB 3ALPA 1KLGA 1WK0A 3ZE0F 1ZE3C 4P9HL 4NHCL 5HI3D 2VIRB 2ZNWA 2F19H 5FOBA 4XI5D 4EDXA 2D7OA 1H3PH 2C3HA 1AQKH 2VLRE 2BVQB 3T0EE 1MCKA 4O4YL 5DJ8A 2Z92B 2BNRD 1OVZA 2E9IA 5KVEH 1KJMA 5IMLB 3RZWA 1QOKA 5HHOA 5I8CA 3LDBB 3ARRA 2A6KB 2XI9A 3A67H 2CDEB 4JG0L 2WMPA 1FIGL 4H1LB 1U95A 1OARH 5D1QD 3PP3H 1BPVA 2ERJC 5K9QI 4NUJA 1XCTA 5FM5O 3MBXL 3BH8A 4WFHE 4YR6A 1I3VA 3HE7D 4XB7A 4MGXA 3KWWB 3QXWA 2I9LA 4YFLI 5CMAB 2AJVL 3RKDD 2V7NB 2VDNL 3HS0B 4YLQT 5EIQA 3H3PH 4X9HA 1GAFL 4FQ2H 2X4OB 5DD0L 4P2QD 3GHBH 3U9PH 1BVKB 4M48H 4P46A 5HHNA 3RI5F 2ATPA 1WFNA 4EUPB 5IB4B 1VKXB 2Y06L 4JFEE 5DK2B 4NNXB 5FYKL 5C09A 1UCBL 4WFHD 2OX5A 4YUEL 2EH7L 1X7QA 4JG0H 5C08D 4FFWC 5JHDA 5F9AC 1MCJA 1RZIB 1X5IA 3O6ML 2FZ3B 4FFWD 4YBQD 3ARZA 1KYOJ 3HG1E 5T5FH 4LGSB 3JV4B 2EIBA 3QFJD 3RVXC 1K8DA 4R26L 3Q5TA 1V3KA 1C5CH 2DBLH 5DRZA 4BFIA 3HPJB 1MPAH 3MV9A 4XPTH 1NFDB 4K8RL 1GVIA 4MD5A 1IEHA 1PVHA 4EN3D 1UENA 4UT6L 5D2NE 1RJLA 4LLQB 3PWUA 3QI9C 1NCBH 1OY3B 1F58L 1TTUA 1MCOL 3IVKA 2NLJB 3IJHB 1LQSR 4XPFL 3OKNB 3MLWH 2P24A 2LU3A 4GG8B 4XNUL 2VXVH 5M7QA 3J8F7 3K0WA 5T3XE 1W72H 5KVMC 1TPXC 4DZBB 2FD6L 5A2FA 3KYNB 2X1OA 5FYKE 5DMKB 3GIZH 2OBGA 4EQ3A 5FYKH 3BGMB 4C57C 2YPKB 1EEQA 3FT3A 3L5WB 4I0PD 1U8OA 3FFCB 2ADGA 1X5AA 5D1ZB 3QDGA 1T4KB 2VXTL 2DLEA 1AD0B 3TCLB 3I75B 1FL3B 5HD8D 1CD1B 1R5IA 4NJAL 3B43A 4X9GA 1H3UA 3UTPE 3FRPG 3SDXA 3JWNC 4HK3J 2AAVA 4ONGL 5SWSD 4WENB 4UQ2B 2WBKA 5HI3C 1MAKA 1A4JA 3BIKB 3BD3A 4YGVA 3BT2H 2ZJSL 4KK8C 4D9QE 2VC2H 2LU7A 4JY4B 3MFFA 3M1BB 4N0UA 3AU1B 5C0DA 4X7CC 3VXSD 5IMLA 1K2DA 3PHQB 4V1DE 3MGOB 4QCIA 5I2IA 4LMQE 4PJGA 3QJFA 4G9DB 3CFDA 4ZAKB 4ZOCA 5KSAA 1Q9OA 4PB9L 4G8IA 2XA8H 3UC0L 5KN5B 4LSRL 1FO0A 2ZCHH 3QQ4A 3QUXC 3P0VH 4UNTA 5FUOL 4L29A 4HXAH 1S9YB 1CXLA 2GFBA 4YHLL 1SJHA 1OGAB 1F4XL 3ZDXF 4KKAD 5DMJB 4M6NH 4U0QB 2VABA 1UWXH 1I1YA 1BLNB 1XMWA 2YSSA 2BVOB 1HNFA 5ACZA 3WFCH 1FFNA 3MODL 1ND0A 4PJBA 3QHFH 4HZLB 5J89A 2I27N 1OB1A 3R06A 1MRCL 2GSGB 4R26H 5SWQA 4PTUA 1PBYA 2CJUL 2IBZY 3LEYL 3SGJC 1IM9A 1A0QL 3MRLB 2XA8L 3MUJA 3T77B 4P5TD 4HT1H 1QFWM 4EKXA 3G6JB 4RZCB 2PO6D 2YXFA 3CD4A 4BQ9A 4DN3H 3BZEB 4QHMA 3CSGA 4G6AC 3PGDA 5CSBA 1B4JH 3UTPD 2WIIA 1F97A 5GIRA 4UT9H 3V5DB 2VQ1B 1JZ8A 1MRDL 1UM5H 4NJ9H 3R4DA 1XR9A 3N1GC 4J1UB 2NY1C 4KVCL 5CAYB 2ICWI 3BXNA 4CMHB 2A6IA 3UJTL 3FFDB 4NRZB 1GZQA 4RAUA 1T7VA 4JQIH 2Q7NA 3VGFA 1MJUH 4HFUH 4I48A 4LIQL 3SJVA 3KPTA 5J12B 5DQ9A 1ZT7A 1QACA 1UT9A 3CDFA 3EYQD 1G6RB 4XCCH 5IW1B 5C09D 4ZXBA 5T1DH 4UIKL 1MCHA 5ICZB 3BP7A 4HJ0C 4KTDH 2VLJA 5J13B 2B1HH 3PHSA 4HBCH 2I60L 5F7FA 1Q9WA 2WBWB 2IFFH 3BOVA 1YPZF 3DECA 4P2OA 5C07B 4J23A 4RX4D 3DOSA 3QQ4B 4FQCH 4LLMA 4DWHA 5D7LE 2G60L 1KV3A 3HG1B 1FZMB 1ZEAL 4V2CB 3LKSA 1RJZA 3N9GH 4MCYB 3BZEA 1H0DB 2OR9H 4JRXD 1UB5B 2JIXB 3FB5A 4UQ3A 2OLDA 4N0CD 4GQPH 3NZ8B 5C0NC 3WO4C 3BD4A 5ALBL 5CSZA 4HIIB 1KB9J 1ZHBA 4OD2B 5FCUH 5H8DA 2HH0H 5L0QC 3WV0A 1NJ9A 5I17B 4HS6A 4OM0L 4PJ8D 5AD0A 1RMFH 3O45B 2HVJA 3OKLA 3KPQB 2VR9A 1JYXA 1T20B 1R3LB 8CGTA 4CMHC 2VDNH 5MI0B 3V9FA 5LKNA 1RIVL 1MUJB 1EVUA 3I3BA 1XF2B 2LU4A 3ORJA 3OJ2C 1VFAA 4WUUE 4PP1D 3OB8A 4RAVB 2UV3A 4YDJB 5EH1A 4ELKB 4P46D 4JDVB 1HHGB 1SJHB 3BSZH 3LN5B 4ZXBB 3HE6B 2ENYA 2YRPA 4FZ8L 3VH8G 5J7CC 2CRZA 3LEXB 3N1MC 3OX8B 4KAQL 3VXRA 3FT2B 4S2SB 5DURB 3E0GA 1U58B 4KZEL 1GHFL 3H0TA 1LP9F 4U6VH 4WO4D 4AM0A 5EPMA 4W4OA 3TWCH 4Y5XB 5MEQB 4OLYL 1EBPA 3ARUA 4PGDA 5C2UB 3EJYC 3BE1H 2X4SA 5T33H 1FBIL 5KVEL 4HF5H 2I07A 4CJ1A 5CJQL 5EU7E 3PWUB 1A1NB 2C4XA 5D1QA 4HGWB 3BEVB 3QG6B 4G7VL 4PUBH 5GRXG 1U3ZA 4UQ2A 4NHCH 5FECA 3ETBF 3RDTA 1KCLA 3W9EB 1MHPL 1FIEA 2CLVB 3LHPL 3SGEI 1YYLH 1U8HA 3I6LE 4R7NA 2DRUA 1EGJA 3C9NA 3BRGC 1JN6A 5I1IL 1VEOA 3CNKA 4RQQB 2Y23A 4JHAH 1L0YA 4DCQB 2I24N 3LPGA 3VGDA 4X6CF 2UYLA 4Z6AT 4XRCA 5E8PA 3UZVB 1EGJH 4NHUB 5EC1A 4KMTL 4OT1H 3V0WL 5HHXL 5KSVA 3U4BH 1DEEA 1P6FA 4NZUL 3GBNL 4PJBE 1XGYH 2DOCA 2QL1A 5FM5M 1AXTL 1T1ZA 1FZOB 1TQCC 3PJSA 3VFTB 4L3EE 2X4OA 1T04A 3WEXB 2PXYA 3SDDB 4HPYL 4DKFL 1TJGH 1S7WB 1DFBL 2ZSWB 2Y4SA 3WBDA 2W60A 1DLHB 3CVHB 3V5HB 1AP2A 4XCFL 3OPZL 4H88L 4RNRB 4H20H 2PW1A 2QJDA 4MJ4A 5JXEA 4MDIB 4NKIH 4K94L 3MV9D 1PYWB 1WCQA 3QIBB 1G7PB 3GIVA 2W0LA 3KDMB 3DYMA 1H5BA 1IAIH 4OBSA 1YUHB 1F4AA 2DMCA 4WFFD 4ZNEE 3VXRB 3LDBC 2VWEC 1JNNH 4I3SL 2YRZA 3B9AA 4P99A 1FJ1A 3MV8E 3ZT5A 4NO3A 1CFNA 1VACA 2M8XA 3F62A 1HYSC 3STZA 3F12A 3GHBL 1H3VA 1WT5C 3IFLL 1RZIA 3C5ZC 1JTOA 2L7UA 4P4KD 5EZOH 4P4KA 1BX2A 4XC3L 4L4VD 4NNXA 5DHVA 3U82B 3O3DA 4G9FB 5EBMA 5CP3H 2WQ8A 3NBNA 4Z18A 5ADOL 3ARTA 1QSEA 3MNZB 4EDXB 3ARDC 5CILH 1TJIH 1XF3A 1JWSA 4HX1A 4OLVL 4OZHA 4QHLB 2ZUSA 3IXAB 2VLJE 5C0CE 1FL3A 1Q8MA 4TVPL 2C3WA 3RPIA 1R5WA 2JK5B 3JTTB 1DUYA 2YEZB 4NKQB 2UWEB 5E94A 4F9PA 1L7IH 2F5AL 1WF5A 2R69L 5ITBL 2P5WD 3QIWD 3S88L 2P44B 3MRBB 4JRYA 2AEQH 4RX4A 3ARGA 1HINH 3RWCB 3U7WH 2P7TA 1QBBA 4QT5B 3BDYH 3HZMA 4Y5YB 3KXFD 5LGJB 1WZLA 3S98A 5C07E 4XP4H 1D9KD 2X05A 1KLUA 3VFWB 4LU5H 2X4UA 3GMPB 5DWUH 4O5LH 4OSUH 5IBTH 4P2QB 5HHVL 4XCNA 4ETQA 2E7LA 4ORZC 5K9JH 2F54A 5F6IC 4KKAC 4PJ7A 4JG1H 2VDRH 4U1KB 3MJ7A 3VFPB 1RIUL 2Z92A 5I75C 1RUMH 4CMMB 5DR5H 1F4WH 4GRLD 4IRJD 4WHTA 2VJXA 1AHWB 4L3CB 4LARL 3VXUA 2XNAB 3UC0H 4LCWA 4QO1A 1ZHKB 3T0EC 4DK3A 4RGNC 3H3KA 4RBPK 2ED9A 4H5SB 3GGWB 2DQFB 4F57H 5KAQF 3SE3C 1N3NA 3NA9H 5HPOA 1VFAB 2O5XH 4QTIH 1NFDF 1MHEA 5DVLA 3FOMA 1TIUA 1HILB 4LCCC 5F89B 3HMWL 5FDWB 3WNNA 3MV8A 3NIGF 4BZ2L 1TZHB 3G04A 4LCUB 5CGYD 3VXUD 1YMMB 1YEFH 2DQCH 4J3OC 3SGDH 2BY3A 4WTWA 3ZDYF 5BV7B 1UJTA 4KGJA 1GZPB 3TVMD 3DX8A 4RGNE 4GKNB 3KPRA 1KSRA 1KFAL 1IT9H 5GXBB 2AJYL 4XWOC 3FZUD 3OR6B 2BSRB 4TQEH 4YFEA 5DRWA 1DE4A 1TQCB 2CLZA 1ND0B 2XG5A 3EW3B 2VL4A 1NBZB 3BRFA 3FO9A 4NYLA 3QXAA 3VD9A 4NCC1 3WUWA 4GKNA 3Q1SH 3N1QC 4HGWA 4PRBB 2B1AL 5C6TL 2WQRA 5GRYA 3LPFA 3AREC 5FA3A 3QHZL 1AC0A 1P5VA 4YHZH 1AE6H 4C56B 2GK0A 3FFCE 2R0LH 5B39B 5DRXB 1UB5A 4BUGA 2VQTA 1LO3H 3Q6FA 2I9TA 4H26A 1N26A 4JFZL 3CU1A 3FT2A 2CDFA 5CJBA 3MA9H 2HA1A 4U49A 1OAUL 4X9FA 3H9SB 1A3LL 2AEPH 3AROA 2H6PA 3D39B 3RVTC 4C56A 4KHTL 3PV6B 3DRTB 4F9LC 1KN4H 5BXFB 2HVKA 4KPHH 4PPTA 3FB7A 4HBCL 1VFOA 4TRPH 1KJ2L 2X4PA 2DM3A 2D31B 2R2EB 3SDDA 3V4VH 4DTGH 4XBPA 5HYFA 4FS0A 4PJEE 2ATKA 5J6HA 3QXTA 2C1PA 4G8EB 1UH3A 1ERNA 5KSUB 4PJCB 3WFEH 3F6LA 4A6YA 1LEKB 4X5WA 1DBKL 3RWIB 4UINL 4I9WD 1IJ9A 2AJYH 4OF5A 4JRYE 1TLKA 1NCCL 3I3EA 3SKMA 2FEEI 3QISA 3D2UA 4YAQA 5HHMD 1XCQB 3MV8D 4MB4A 4X6FB 2CIIB 3QUZC 3PWPD 3VGHA 4DOHE 3QCUL 1W0WA 4J3UA 4XP5H 3LQAL 5C0CA 1MWAA 2ARJB 3MQIA 1XF4B 1EAPB 3VCLB 3VXPA 3I6KA 4Z7OF 1CGWA 1O7SA 5HVHC 1OAXL 1R3JA 4P2OB 1MCWW 1KGCE 5I9QB 4X6FA 4XP1L 2AEPL 2VR5A 1AFVL 3BPOB 1CYGA 4APQA 1QHOA 3CX2A 3NTCH 5DMGD 4Y2OA 1LILA 3BMWA 2P48B 3DI2B 4Q9QL 3BUYB 4LSVL 2EDBA 3U4AA 4K55A 4KPHL 1MRCH 1Q0XH 1CLCA 3IDNB 2MTPA 4PJ5D 2FWOB 2Y36L 4GBXC 2ORBL 3GSNB 1OSZB 4MA3A 4XBPB 1JHTA 5GGQL 1FLRL 3DTXB 3MLXH 5EC2B 1CQYA 1BBJB 4ZUUB 3S6CA 3O6LH 1YNKH 1XF5A 5I1KH 1JTPA 3VXNB 4O51B 4EZMA 4J1UA 4X83A 4XWGL 1IGFL 3TF7C 2H6PB 1Q94B 2EDDA 4UBDD 3TBVA 1YEJL 2E3VA 4DAGL 1DBJL 2VOTA 1EHXA 1HWGB 3E3QC 4PLJD 5JIKA 3QPQC 5I76A 4LLYA 1OTUD 1P1ZB 3AXLB 1N64H 4X0KA 4EUPH 3HNVL 5FO7A 3REVA 1IGIH 5DEFA 1VGKA 5JOFB 4KUZL 3FN9A 5E6ID 1IKFL 1B6UA 3BWAB 1GGTA 3REWA 3QB7C 3HG1D 5I1CL 1I8KA 1KIPA 3N1FC 2QHLA 1K2DB 3PHQA 5ETUA 2OQJA 5INCB 1T3FB 2YN3A 1CFVL 2AK1H 3D9AH 3IGAB 4M4PA 2P8LB 3IFOB 5KOMC 4NUJB 5EBWB 1YN6A 4OUUA 4XTRC 5EORL 1FVDB 4JFED 1UCTA 1TNNA 3RX7A 4RRPA 3JTSB 5A16B 2NQCA 2O5XL 3KPMA 1YY9C 1H3WM 5JIPA 4U6YA 4EN3C 4Y16A 2VITB 3QFDB 1KCVH 1U91B 4OZGB 1QO3B 3P0GB 3H42H 3T2PA 2JJTA 1DQQA 2F53E 1OGAA 4XCFH 1YEIH 2UYLB 4FQJH 4PRNA 4ZUTB 4H0IA 4DGIH 5D2LB 2ENSA 3TZVA 1IGTA 5JLZA 4KUZH 5MENE 1YMMA 3BDXA 5HHPA 2PO6C 1SVCP 1A6VH 3F7YB 2NXZD 2MQ0A 1D5XB 2PUQT 4LOUC 2A9MH 3KDMA 2NY2D 4FMFA 4LPVA 1WTGT 5IMMB 3TN0A 1RUPL 5C70A 3BN3B 3TA3A 1PX3A 3BGAA 1C1EL 4PTTB 5C0GB 4YBHA 2DDQL 2ZG3A 4LARH 3AREA 3V6FB 5D7IE 4HIXL 3VXQA 4WEBH 5FKAA 3V6BR 1C7TA 2XA3A 4LAJH 3N06B 3MLPA 1G9MC 3ZT7A 3OPZH 4HWZA 3WNKA 7CGTA 4PJCF 3GO1H 4NCDA 4R2GD 4LLWB 4HCRH 4E5XB 1T1XA 3NTCL 2CLRB 4QGYA 1YY9D 1R3HA 3IDYB 5H94B 4JFZH 1MCEA 1P4IH 1C5CL 4JO1H 5F71A 1HOCA 4GAYB 4N5UA