4X6BA

Bk6 tcr apo structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
201
structure length
196
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR alpha
total genus 40
structure length 196
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bA02
4XCCH 3QISA 1BVZA 4JPWH 3TFKC 4RA3A 2X4PB 5ID0A 2EYTA 4Y1AE 2D7MA 4P4KD 1BVLB 1KIPB 5EPMB 3UJTL 3MOAH 2VZSA 3KLHC 3BKMH 5GGTA 5GRXG 2VIRB 4FQXA 3WBDA 5B4MC 2XZQL 5I1DA 1MAMH 3DO7A 4JO3L 2ZOKA 5J3HC 5ENWA 5F9AC 3QFJD 4HWBL 3UZVB 5IKCA 1QACA 1WAAE 3ARBB 1UACL 3P9WB 3GBNH 3PXJA 1T2QH 2AXHA 3I2CL 2EH8H 5HYSG 3OZ9H 4RGMB 3B4NA 3KXFE 4X7FC 3WKML 5IFJA 1IM9A 3H3PH 2YRZA 4NWUL 4E5XA 4BUHA 3IAGC 5EUOB 1AGFA 4LLUA 5SX5K 2VERN 3NACH 3QFDA 1X4ZA 2FJGB 5DVMA 1EBAA 4Y4HD 1Q72L 4ODUA 1IRAY 4LAQL 5T1MB 1KFAL 3UTSE 1J1PL 5E2VL 1HOCA 1HYSD 2Z9TA 3MRLB 3NN8B 2ESVB 3VA6A 2Z4QA 1SY6A 1U93A 5E08H 3MV7B 4OQTH 4K8RD 3RWCA 4PBVC 4JFOA 4QRTA 1OWRM 1C5BL 1X4XA 4ALAL 3EJZC 5CP7B 1RJLB 1I1FB 1I8LC 2C7UA 4PY7B 1MCSA 4ONFH 2GY5A 5D96C 2IH3A 3BMWA 1OQOA 1QBBA 4YGAB 2XOTA 3KR3H 4GRWE 1T1WA 1E6OH 4WFFD 3O0RH 4YBHA 3G5ZB 4NC1C 1YEGL 1RHFA 4ENED 4HZAA 5IBLD 4GAJL 3QNXB 1P1ZA 2Y07L 4KKAC 5HHME 3JV6B 2Z91B 1CT8B 1OAUH 3NCMA 4LHJB 2GUOA 1EHAA 3JTTA 4EXKA 1NFIB 4LVEA 3R1GH 1D6VH 4XPAH 2C3VB 4PRNB 1HYSC 2VAAB 3C5SA 1BFVH 2FZ3B 1FIGH 2ADGA 1HWHB 2HKFL 1YEHH 5F3BA 3R0MA 1JRHH 2KPNA 3RI5F 4IRZL 3TA3A 1N8ZB 3TGXA 1DL7H 3DVFA 4BKLB 3WNLA 4LSQH 2CDFA 1PD6A 2P5EE 4PRNA 3EW3B 3H3PL 4TNWF 5DQ9A 3GMLB 4I18A 5A1AA 1WBYA 3P0YH 1QTYT 3WFZA 2C3WA 1YA5A 4L8CB 5IEHB 3CVHL 4X5XA 4GRLA 2DTML 4WNQA 2IADA 2FHCA 3O6FB 3WUWA 4X9HA 2PO6D 1NLBH 4TUJA 1K8IB 5T33L 3ROLB 3PWJA 1MCIA 2DQGL 2FIKA 2IFFL 4M6OH 4MGXA 4RGNE 4NKDB 3TBSB 4M1GH 4NHCL 3PP3H 4XCFH 4J4PA 3NIGF 2IQAA 4U1KA 1FNGA 3MBXH 3MJGX 4U2YA 2A6IB 3W9EA 4O2FA 3X3FH 3ALWA 5CKGA 4YDVA 3D18B 5ALCH 3MUGB 4Q7DA 1S7RB 4PJ5B 5ISZA 4ELMA 2DLIA 3DX9A 2IGFL 4XCYA 1FVDB 4G42A 3L3OA 3J8F7 2V17L 1U58B 2HTLC 3KDMB 5GISH 5D2LB 3GIZH 1DQLL 3V4PL 1QBMH 5F1OB 4UTAH 1MAJA 3KVQA 5EUOE 3GHEH 4YPJA 2XIDA 1IM9B 4K2UL 1NBQA 1XGQB 3FQTA 4FQ1H 5F9OH 4U0RB 3MLYL 4RGNB 1TJGL 4WO4B 1NUFA 5DA4A 5ESVA 1HHHB 2X4QB 5ACLA 2MCPH 4OLWH 3AB0B 3BEVA 5J12C 3DSFL 4R6UA 4RMTA 5ID1B 1FJ1A 2AJXL 3HC3H 1K8DB 2XKNB 2E7MA 3REVA 3ZE0F 4ODHH 1AD0B 1CLOL 2OR9L 4HFWB 3U82B 4S0SD 5C7XH 4LSDA 3O4LA 1UM5H 2I9LB 3VW3L 4PB9L 2R2BA 1INQA 1UB5B 4X5LA 1CS6A 3FQXB 4FTVB 3H9SB 5EPMA 1NLDL 3FZUD 3VFNA 4LSRL 4HH9A 3ARQA 2HTKC 1WBYB 4H0IA 4KKNA 1IQWH 1IC5L 1T04A 3VRLE 4ZFFA 3U0WH 4ZTPH 4L8CA 4JRXA 4M62L 5HJ3A 5BW7C 1BP3B 4OF8A 1FH5H 4RIRB 1ACZA 1E28B 4HKBB 4M43L 4K3HA 3GRWA 4OLZH 1FIEA 4GKOA 2G9HB 4LCIH 2JCCF 4UIKH 4M61B 2PXYA 1NFDB 3X3FL 2BY3A 4H1LA 1IM9D 1BQHB 1JTPA 3C5SB 3KPRD 3ZKQD 4OZHA 3VFGH 1GVIA 1V7ML 2X4OA 3HG1A 4JEGB 5F9JB 4P99A 1NBYA 1W0VA 1GZQA 5C0AA 5HYQA 3BYYA 3E8UH 2XPGB 5IEKA 2B4CH 3ALPA 4GKSA 1CLZL 2EDDA 2GY7B 3MRDA 3HNTL 5DFTA 4G7YL 3V52L 1CDHA 2EZ0D 1C12B 2VDLH 1OGTA 4JCMA 2JCCE 3PGCB 5KAQF 4DOHE 1KT2A 1NC4D 3P3YA 1A2YA 2VLJA 3CAFA 3V5HA 1UXWB 1HKLH 5DJCB 4XNYL 1GXEA 2GK0A 4GMSL 2AJVH 2V7NA 5GGQL 4S1RL 2FH6A 4C56D 1Q8MA 3PP4H 4EI5B 2COQA 3O6FD 5KS9B 1H15A 1CD1B 4U6XA 3QDGA 4PJGE 4WI5A 3CIQA 4P2RA 3S35X 4FABL 3O41B 3KGRA 5HDOA 3HFML 5CILH 4LLVB 4ZOCA 5T1LA 4O2FB 4U6VL 5EU6D 3B9KD 2VXQH 2BSTB 4JO3H 3B6SB 2R23A 3QB7C 4LNRA 5JPNA 5ISZB 4TVPD 2V7NB 4FTVA 2CUMA 5T1MA 2C3XA 1F13A 3QQ9C 4PV8A 5DUMH 5IFJB 4PD4J 5KSBA 1U9KA 4JDTL 1A7PL 2E5EA 1FYTE 1L0XA 1DQMH 2R0WH 3IFPB 1TTGA 3MRGB 4DKFL 1UWGL 3WS6A 1BQLH 3M17A 4BELD 4PJ7F 2L4OA 4GKNB 4BH8B 2GJ6B 1E4XI 3FRPA 3FQWA 2NY6B 4K7PL 3SGDI 2NY0C 4JQVC 1L0YA 3CSYA 4PJGA 1J1PH 1OF2A 5E2VH 4X9FA 1RZGB 3VXUB 2WIIB 1N4XH 2GJ6E 3ZT5A 4X9BA 4I77H 5EU3B 4HKXA 1F90H 4ZFOA 3D9AH 1PG7W 3BRFA 2WBJB 1VFAA 1AR2A 5KW9H 4N9OB 5HI5D 5EIVA 4R0LA 5SWZE 2Z8SA 1YEHL 1KJ2L 1FLRH 1KSRA 5IW6A 3Q2CA 1B2WH 3T8XB 5FO7B 3N85L 2NW2A 2BMKB 3ULVF 4I0KA 5BXFA 3B43A 1K2DB 3H2WA 5DJXA 4DUXA 1F00I 2UWEF 3NIDF 5CBAB 2IMNA 4DGVH 2Z91A 2QBWA 2ZJSL 1WAAA 3GIVA 5EU7C 1JNNL 1HSBB 3LB6D 4I9WE 4J23A 1WK0A 1N2RA 4XVTH 2NW2B 5J57B 1RJZB 4P2QD 4PG2C 4NCDA 3P30H 5TE7L 3DROA 2CQVA 1E6JH 2D7TH 3HA0A 1S9WB 4U05A 4B5EA 3S37H 1OAQH 5JO5B 4D9QD 3HC4H 3CFBB 4IHOA 1S7TA 3QAZB 2R2EA 4HK3J 4K94C 5AAMA 1A1MA 2P8PA 4NP4H 1BF2A 1FORL 4PRPE 4RGNC 1VGEH 1T89A 3B5TA 3UYRH 4J6RH 4G9DA 4TTDC 1KJ3L 5DR5L 4LAQH 1KCUL 1NEZA 5D71L 2VR5A 5D7IE 1B3JA 1EEYB 2H9GA 4N1EA 5JIHA 4UTAL 1I1AC 3MRPB 1EFXD 4LCCB 5FOBB 5IG7B 3BP4B 4S1QL 5E9DD 1RZKH 12E8H 1TZIB 2X4RA 2ZG1A 3MXWL 5GRWA 3RP1A 3G5YA 3IT8D 5C0GB 4QTIL 1SEQL 4NO5B 5SX5H 4OIIH 1MOEA 3HZVB 3QIUC 4N5ED 3L9RB 4I13B 3WXWL 3U0TA 3SO3C 1CICD 3DVIA 4XBEL 3W9EB 5DJYB 3VXQA 5TPWL 1B9ZA 4P2RB 4PJ5A 4RISL 3GUTB 4PJAA 5DD0L 5DD5H 4NCC2 3BP5B 3M45A 3VGAC 1KLUA 1KG0B 1AGDA 3DETC 4L8BA 5FO7A 5E70A 3S34L 1BQSA 3BESR 2V17H 4LSTL 5JHDE 5M7QA 2FX8L 5F3HB 3DUUA 1G9MH 1CIUA 5TGBB 5SV4A 4LSPH 4KK6D 3KPPB 4AT6B 3TBWB 1VHPA 3QDJA 4V2BA 1PX3A 4KKLC 2BXYA 3O4LB 3D0VB 2FHBA 1F58L 3SHSA 1FL6B 2ICEB 1I3VA 1UJ3C 5HSFA 2DBLL 3TO2A 3EJYC 3IDJB 4OZIE 2VLKD 1K85A 2RHEA 2B4CL 1S9KC 4JJHA 4LPUA 1AO7E 1LDSA 5DUBB 1RHHA 3ULVD 4XP5L 4FQQA 1YN7A 2YWZA 3GNMH 4YHZL 4GBXD 2AJSH 3FN0L 5EU5A 5K93A 3WHXB 1RIHL 4WTWA 1XR9B 1MI5B 2YUXA 3IDMA 5D6CA 4DZBA 1FBIH 1BIIA 3ARUA 3V6OE 1N5YL 1I8KA 2VTFA 4G8IA 4HUMB 4WUUD 4NQCD 1OARH 4J1UA 1CU4L 3O9WA 1QVOB 1T04B 4YHLH 4HULB 3KPTA 4WTZA 2DICA 5HJ3B 3KYKL 4WWKD 1I7UA 1DLHA 4M1DH 3KPOA 3QUMH 3QDGB 3PL6B 4HCRA 5BS0A 1MI5D 4HT1H 3SDXE 1JPGA 3PV6B 4NKOA 5FM4A 3WLBB 3QWQB 1P84K 2V7HA 1VEPA 2ZUWA 3L5HA 3RNQB 4RX4A 2EXYD 3K7UA 2VL5A 4P9ML 1P4IL 3B2UD 3OB0H 3PIQA 2LTQB 4ODVH 3F58H 1A6PA 4AG4L 2P24B 1TXKA 4OZFB 5MENA 1QBML 1RJCA 4WHYH 2EE3A 5ESQA 3UZQA 5B38G 1G7MA 1NMBH 5FCSH 4RQQA 1N6UA 4IDJH 1QYGH 4LVNB 4XAKD 5CD5D 4AIXA 5C0AE 5E00A 1FL5B 2KKQA 4I3RL 5FUOL 1RFDH 3PE9A 1N64H 4HXAL 1NJ9A 4MJID 3R8QA 2VN4A 5JIIA 5FYLE 5E4IA 3MBED 5D72L 4Y5YC 1CGXA 5JMOC 3GSNL 4U3XA 3RVWD 5KVDL 3VFWB 4APQC 4AMKL 5E2TL 1I9JH 4K3JH 3JXAA 4QHKJ 3I6GA 2Y25A 1MF2L 2DQTH 4GG8B 4I77L 4MXQD 3HUJB 4Y4FC 4JPKH 4MQTB 3TBTA 1I9RL 1FDLL 1R3LB 3FTGB 1M7DA 2CKNA 3CCHA 1DCLA 5I1LB 4HKZA 1O0VA 2VISA 4PLJC 2RB8A 4H26A 5I1GH 3SDXB 4NUJB 5IBLC 3SDAC 2NNAA 3IJSB 3ROLA 2CRZA 4CUCA 4KRLB 3NCBB 4Z76B 1FH5L 1U91A 2Z8WC 4R3SB 1W0YT 3OBAA 25C8L 4D9LH 5ITBL 3CCHB 4XVJL 5I1LA 3HE7B 3VGFA 3QIUB 2NR6D 5L6YH 1G7PA 4Y8AA 4OQTA 4GUPA 3VJ6A 2B4CC 2BNQD 4OZ4A 1S5HB 2QQKL 4NSKA 3LQZB 3Q6GH 1S9XB 4MB5A 5EOCL 2IALA 4U1GC 4MAYB 1H3VA 1S7SA 4HIXL 5DT1H 1LO2H 4NQEB 3RBSA 3LN9A 32C2A 3WFEL 5FYKL 2HFGH 2KL6A 2VDQL 5TDNB 4ZXBA 5EC1B 5C0EB 4HS6B 3GMQA 2R0ZH 5BVJA 4BUGA 4J6RL 4AEHL 2XT1B 2P5WE 3PQYE 5F7UA 2ITCA 1BD2E 2VDLL 3D2UD 1NGXB 1QSFD 4IRSA 4YHPB 4LCWE 1CD9B 3MLWH 4X6CB 1ZA6B 4ETQA 1YQVH 2LAAA 3VMPA 5I76A 4EUPB 1IAKA 2FYYB 1LP9B 4KK6C 5EFIB 3C5ZC 5FKPA 2NY5L 4ZPTB 1S7TB 3PP4L 3P4LA 3KLAB 5T3ZH 1FGVH 1T2JA 2R4SH 2P8PB 1JNJA 4XHQA 1MIML 4A6YA 1YPZA 1K8IA 3OKOA 2BVOB 3QDAA 5F1IB 4ZD3L 3BPNB 4LSSL 1I8MA 4NKOB 3TVMB 3KPLB 4QRSA 3FHQA 1DBBH 4HQQH 4YIQB 4ZPTA 3UTZA 2RBLA 4YGVA 3BT2H 1Z9LA 1RMFL 4D3CH 1EAPA 1G0XA 3SY0A 5K59E 2QV2A 3SGEH 5D7SH 1FCCA 1U3HD 4KVCL 1HH9A 1YPZF 1YUHB 2IPKB 5TQ0L 1BLNA 5JZ7D 3QFJA 2EXYC 1H0DA 3U9PH 3SJVE 4XNZB 3LS5L 5DD5L 5EWIL 1A6AA 3GJFK 1UWGH 1UB6B 3VFMA 2PF6A 2VLKA 3T1FA 3OKDB 2CDEB 4KTEL 1I7RA 5MHSD 2CRMA 1E27B 3C09C 2OTWB 3OKNB 4RGMC 2IAMB 4TTDD 5FV1L 4NSKB 2JK5B 3BP7A 3UBXA 3W39B 12E8L 1S7SB 2ZOKB 5DJ8B 5C8JA 2HT3D 4P5TC 4S11A 4CU6A 2C1PA 2ARJQ 3L3KA 8FABB 4OCSL 4LEXH 4KVNH 4YHZH 1A4JA 3JUYA 3D2UB 5TGBA 3X3GL 4XHJD 4DJMA 2BERA 2IAMA 1I1RA 2ZG2A 1K5NA 3FFCB 3PGFH 1ZK9A 5EN2A 4CJ0A 1R3HA 2N1KA 1S78D 1KC5L 2DTMH 1AGDB 4PJEB 1I7TB 2YPVH 1NC4B 5J06A 1M71A 4LPTA 3KNBB 3C6LD 3NIDE 3MBEC 3CU1A 2OS7A 5DEFB 1DBKL 1P53A 3WLWD 3G5XA 4MAYD 2BHUA 3QO0B 1KCKA 2I5YL 3PGDA 1CFQB 4ZDHB 3DXAB 1T5WA 5E99L 2WWMC 3W2DL 4HWBA 3OF6A 4JHAL 3HNVH 2HFTA 1MAML 2G60L 2PYED 1KTDA 3ECBA 3HZMA 5DJZA 3SDAB 3GJEA 3SCMB 5IB2A 1U8LB 1WICA 4HMCA 1I8KB 3L5WB 3MCKA 3G5YB 4L8SA 1JCKA 4K7FB 4YFLF 2HKHH 5JXEA 5IQ9B 3EJJX 5I71B 4XT1C 4NQDA 3HZKB 4XPAL 2AJYL 4F2MA 3P77B 3STBA 4NKIL 3NAAL 5GS2D 5CMAA 1CT8A 1PW3A 1JPSH 1N59B 3BO8A 4I2XE 4PP2A 2GJ6A 5I74B 3RDTC 1NDMA 4GKSB 4TVPL 3VFVB 3RHWF 4CMHB 5DJAA 4JANB 3W11D 5HVWA 3QI9C 3WL9A 1RIVH 1NDGB 4HIHA 3KPPA 4QNPE 4HDIA 3MJ8A 3GKZA 4JQIL 2VN7A 5HY9B 4PLNC 4HUUB 3PV6A 4BFIA 4M1CC 4KQ3H 4TPRL 4UOW0 4HMDA 3KWWA 2W9EH 3PWPA 3WNPA 3SDCA 4F7TA 4JFPA 1LGVA 1VGKB 1A6UL 2ESVA 3RKDD 4UQ3A 1CD1A 1JNHB 4R4BA 2AJZB 1NAMH 1YNTB 2ED8A 3K4DA 1IZKA 3HCVA 4MD0A 1IQWL 3D25A 4X7CC 4GAJH 5FO8A 3MUZ1 3CZJA 4OV5B 1J8HE 1C1EH 1WITA 3RPIA 4JFFE 9CGTA 1M71B 4RGND 3WHXA 2VQ1A 3UAJD 5KVEH 1CZ8H 4Q9RH 2MQCA 3QDMB 1P7KA 4PJIF 1LK2B 4L3EB 1YEDA 3UTPE 4FZEL 1WC7A 2J8HA 2VNCA 1HHKA 1IGJB 3CXDL 4O2EB 3FRPG 4DUVA 3BFOA 5E2TH 5A3IC 1NMAL 4B0MM 5A40E 4PBWD 3VFGL 2X9XA 3FO2B 3QEQB 4X4MA 3UDWC 1KGCE 2P1YA 4WFGE 4XNQB 1XGYH 1DR9A 3Q0HA 1RQ5A 3ULUE 3FQUB 4AEHH 4OLYH 3CSYB 1IGML 2ORBH 5C0CD 2C1PB 2EYSB 3ARWA 3O3AB 1PGRB 5D7JA 1ZA6A 4ETQB 4DVRL 3EO1B 5GISL 4QHMA 4MDJB 3WCYA 3O6KH 4UDTA 3DV4B 2FZ3A 4BSVA 4XCCL 3LKQB 4KPHH 2P8LA 4NZUH 3D0LA 2GSGA 1OAZL 3T04D 5C0FA 4PJ8C 4LFHD 2Q3AA 1FO0H 1ZAGA 3MGTA 3B2VL 4NFCA 2V9RA 4OQTL 3SDDB 4BQ8A 1MHPH 4QHKI 5FGSA 1EMTL 1L9NA 1MVUA 1IL1A 1C7TA 5C0DA 2NY6C 4LSSH 4JRXD 2CH8A 3I02B 4O02L 5E94A 1AFVH 1Q9WB 3INUH 3JWNC 3SGKA 2R4SL 4ZAKD 2NXYC 3V7AE 5T1DH 3MJ9L 5H35B 2VRAA 5DMJB 3MA9H 4OGXH 4PTTB 5SWZA 5JTWA 3WKMH 3VXRB 2HVKB 4IOFC 3DX8B 3MUJA 1C12A 5FUOH 4MA3B 4H8WH 3L3IA 4HPOH 4NNPH 3B9KC 5FKPB 5LAXA 1KCLA 2IQ9L 4LSRH 3UTSB 3KLAA 1MCKA 1YMMA 1CFBA 4G6FB 4OCXL 1CICB 3GJFA 5FUZL 4LKCB 5GGSA 3WHE0 3V5DA 4S2SB 3QPQD 1R6VA 4L4VE 3BP7B 3UBXB 5E08L 4FNLL 4G6FD 4WI4A 4ZOEA 5ICXB 4QWWD 2D0GA 1WFOA 4GS7C 3MRMB 1WBZA 3S88L 1G9NC 4ODTH 2DD8H 3SGDH 4TSCH 3T4AB 3L7FA 1CVSC 3OR7B 5J11B 4Z8FH 3SDDC 2BOCB 3KAAA 5LCVH 2BNRA 4PJAE 4IM8A 3OV6A 3VI4E 2ADFH 4YE4H 1DQTA 4I18C 4I0PD 4PRPD 4XRCA 5IB3B 1OM3L 4UQ2B 1T7WA 5IKCB 3O3BB 2X9WA 1N26A 5DRNB 3FAXA 3EDFA 4WW2B 4GH7B 3C08H 4OF7A 5I73B 3MV7D 4UQ3B 5I30H 1VEOA 25C8H 3CVHH 4AT6A 1AGCA 2OSLB 4WHYG 1NGZA 5D7SL 1S3KL 1U8QB 1KJ2B 1JF6A 4APQA 3S96A 1PYWB 1QSVA 4ZO8A 3KPSB 2YUZA 1B0WA 5J1SC 1ZHLB 4P2QB 1KBGL 2P5WA 1G6RA 2MHAB 1PKOA 5FDWA 2EDNA 4ZFOB 3GSXB 4TUOB 5HHMB 3AFLA 2DM4A 4ACPA 5DK0B 4YX2H 3I02A 5E94B 1MJ7H 4IIQB 3TN0D 2O5YL 5C09D 2LU3A 2AXFB 4KDWA 1MH5B 4K7PX 4BSJA 3MRHA 3NZHH 2X4RB 4PTUA 2E9BA 5FUCE 2YUVA 2SEBA 3W5NA 1N0LA 1BQLL 5GJTL 5EIQA 3ZYOA 1U8PA 5IFHL 3CK0L 4IOIA 3P9LA 4RFNB 3MV8A 4KI5C 1EHLL 4MJ6A 1S9VB 1C5CL 1ZOXA 3MMEB 5T33H 3MROA 2VDNH 4K71B 3VG0H 1U3ZA 2R9HD 2A38A 1QKZL 1JUFB 2EZ0C 4JRYD 4RNRB 2R0LH 4KUCF 4Y19A 3GO1L 1D7FA 1A5FL 1T0MA 1JI1A 1TZHB 1FL3B 1IAOA 2OXHA 3F7VB 4ZD3H 1PFCA 4CAGA 4Y2DA 2APTA 4K7PY 5D93B 4G8GB 3UTSD 2B0SH 2B1AL 2PR4H 5KOVC 1G7IB 2EDYA 5GJSH 4L5FL 3VDCA 1WIOA 5E0QA 4RZCB 4FHBD 1DN0A 4NO2A 5IMMA 1HHJB 2XYCA 1LK2A 1PBYA 4L3EA 1YPZE 5IP4A 3S37X 1ZA3B 4FQJL 3WNMA 5MEPA 1XMWA 3BH9A 2Z93B 3ESVF 5D1ZB 5EU6B 1U0QA 3IYLW 1SBSL 1MJ8H 3DVGA 4Z7OE 2NXYD 3M8OH 4DTGL 4EJ1C 2H32B 3RL2A 4MNGA 1ZLUH 2UUDH 2AW2A 4N0FB 5I15H 3OXSA 1KELL 1L4IA 1CDUA 2RR3A 1HNGA 3VXMD 3DSNA 3SOBL 5C0BE 4KRPD 1V3LA 3QEGL 5B22A 4OFPA 3MYJA 3QH3A 4GW4A 4ZSOE 4BK5A 4FTVE 1TETL 5I1AB 2YUWA 2Q8AL 3L7FB 2IBBA 3EZJB 2V2TA 2B5IC 5DR5H 4YQXL 2C3VA 3HUJE 4UDUA 4GJTB 2LU7A 4YPGA 1G7JB 1QRND 2NY1D 1EZVY 4HCRL 1UZ6F 5HD8D 3U36A 4KI1A 4WI2A 5BRZA 1BZ9B 1JP5A 4LCWA 4OZFA 2OXGA 3VFOB 1NCAH 2DWDA 2X05A 3UYPA 3P77A 2YPLD 3U48A 4U3HA 5J6HB 3QDMD 1QD0A 5F1IA 3BZ4B 1AI1L 4MX7B 3VXRA 5GGUA 3MV9A 4KGLA 1IC1A 2A73A 2NY3C 1Q0YL 3CX5J 5HDBE 5FYKU 4X5XB 4P48A 5GS0L 5CP7A 3SE3A 3BKJL 1NKOA 5DF0A 1HHGB 5BMFH 3X14A 5FYJH 5E03A 5I16B 1AQDA 2EH7H 1AIFA 4OAWB 5J13C 4F37K 3FO0H 4CL7A 1C08A 1UH2A 4PJAF 3CU7A 2F53B 1EK3A 1MNUH 4JPIA 5CIPH 3EOBB 3D48R 5DDHB 2J6EA 3BEWA 1ETZB 4A2MA 1HYRC 4D0CB 4AL8H 3O4OB 1OGTB 1J1OL 3VH8B 3TFKD 3P11L 1F8TH 1WFUA 1YEEL 1CE1H 4N5UA 4QXUH 1MF2H 4JKWA 3MZTA 3A6BL 4HIJA 2ICEA 3ARDC 4GAYB 3IFOB 4Q9QL 3IRZA 4IRJC 4P23D 3H42L 4LSQL 1J8KA 1YN6B 2X5PA 2QSCL 1FFOA 1YZZA 4OQ1A 1JYNA 4Y2OA 1YNLL 4YQXH 1WTLA 1JGUL 3TVMD 2VJXA 3NGBC 4JDVB 5ANME 3IVKA 2BCKA 43C9A 4KAQL 3RY5A 1YMHB 4NJAH 4YHLL 4WEUD 2X1PA 6CGTA 2XFXB 1BM3H 3GZKA 5DMYA 2GW5A 1QSEA 4J3VA 2PTTA 3ARTA 3TNMB 1UFUA 4JR9L 3RVUD 1KTLA 2ZKHH 1FBIL 1QVOA 3O81A 4O00A 4YFDB 5FCUH 4J3UA 4NM4H 3L9RA 2EKSA 4ZO6A 3C08L 3ULVH 2C4FU 5F6HI 3NFPA 4P3DB 4GG8A 2W65B 4NT6B 5C0ND 4PGDB 3CJJA 5D5MF 2ID5A 5IJVB 5DT1L 1ZXQA 2NZIA 4GG6B 4OGAD 4DAGL 4ZS6D 4POYA 4MLSA 5H37H 3D9AL 3BGMB 4HKXB 3QEUA 4JFEE 4MA7H 3RI5K 5EO9B 1U8HB 3ZDZF 2Q76A 2AEPL 5CEYB 1NDMB 4OGZA 3UAJC 4M6NH 4POZD 5GHWH 2AABL 3OL2A 2F8XC 3VFVA 4LF3B 3RWGA 3HKFA 5CGTA 2BSSA 1WGOA 2H2SC 1JYWA 3GFUA 1D5BB 3PQYA 3L3IB 5KSBB 1XGQA 5I30L 3CMOL 5KANI 5I66A 4F7CB 4PJFA 1KJMA 3PABA 1A3RH 3QBTB 2WP3T 2YWYA 3VG0L 32C2B 5DC4B 1KYOJ 2ZG3A 1I3RB 2VLRE 4KMQA 1Q94A 5ANMB 3S37L 3MCKB 1U3HB 3NH7H 4DVBB 3NOIA 4XTRC 5FYLH 1Q0XL 1U8OA 1BJ8A 3PGDB 1BIHA 3B83A 1JGLL 2P8MB 3D25B 4KGJA 1T5WB 4ZG1A 5EIIA 5HVGB 4D0BB 4ZMAT 4W6WB 4RIRA 4XC1H 3VXTA 4LPVA 4TVSa 5DURB 4P5MB 1JZ3A 4FQHA 5EO0A 4R3SA 3T8XA 3EYFB 3P4OB 5DJ0B 2H2SD 3QHFH 3RA7H 5GZOD 4KHXL 5D6DC 3TBYB 5HPMA 1UZ6E 2H8PB 5T3XH 1LD9A 2AJUL 4XNXL 5JOEA 2EDTA 1UJ3A 2YS4A 1F58H 4XNQA 1GC1L 2DB8A 4JFXA 1A5FH 5EOCH 2ERJC 5BV7C 4Y19E 4HX1A 5FFLA 5GZOC 1JRHL 3QEGH 5H2BA 3WFEH 3MRGA 5HVHB 4LVOC 2DQUL 3RU8L 3TT3L 3T2OA 3WEXB 4Z7WE 4M6NL 1TETH 2VLME 1IKFL 2VLRB 4PYHA 5KSAD 3QWOA 3L3JA 1JK8A 3OWEA 1IT9H 4FQJH 3ARFB 4DW2H 2NY1B 4FXKB 5I74C 5C0DB 4P57A 4S1SL 1MCFA 2XZAL 3WO3B 1S7QA 3OKLB 2RFXB 5IM7B 4IBLT 2D03L 3FMGL 4NC1E 1UWEL 3Q6GL 4I4WA 2BVOA 2Q86B 5A2KH 5C6PB 2DQEH 2XG4A 1I8MB 1ZKAA 3A67L 3MLVL 2OL3H 5HI4D 1CFNB 2HFFA 3C2SA 5D1QB 3O3AA 3TBVB 4LLWB 4QHMB 2MKLC 3LCYA 3VFTA 4P49A 2DAVA 5MERA 2VXTL 1J12A 1TJGH 4CRPA 1QLFA 1IC7H 5FA3A 4E9LA 5L2KD 1K6QL 1VESA 1OARL 4PP1D 1MRFL 2MQ3A 5GGVL 3O4LD 4JAMA 1LP9F 3TCLB 3ELAT 1F8TL 4ERSH 1IGIH 3GMMA 4HCRH 1XIWA 1UH4A 4L3CA 1JYXA 1IGCL 4WU7B 2AK1H 5IMOA 3WIFA 1MCHA 1ZVYA 2L7UA 3ARED 5F7NC 5FIEA 5B38B 5F8QC 3A6BH 4HS6A 4NKMA 4Z7QE 3BWAB 4PREB 5TDOA 4M7JL 4GLRI 3SKOA 5I16A 5MP6L 3LPGA 3ZTJH 1FVDA 3BRDA 3IDYB 3KDMA 1NLDH 5L2KB 1RI8A 1G7LB 3H3BC 3K80A 2ARJB 2OJZL 1ACYH 4WY7H 5HGHA 2GCYB 4J3XA 5HDBF 2CKBB 2E7BA 2DYPD 1DBJH 1EIBA 2EECA 4XCEB 5D1QD 1JYVA 4M43H 3K2MC 1U92B 3HR6A 5FYJL 1RJYB 3TP4A 4FRWA 1DLFL 5KZCD 1IVLA 1GL4B 4QTHA 3K3QA 4TUJB 1LE5B 1XH3A 5D2LF 4IOSD 5DLML 4ODBD 5CSBA 2VZ3A 3WL9B 4WWKB 2CLRB 3KYMA 3TEUA 4HLJA 4XGZB 5C0CE 3LDBC 2XN9E 5ADOH 4LHUD 3SGEI 3ULUD 4WUUB 1JBJA 3MV01 2NXZB 4ELME 1X5JA 4YWGH 2VKWA 1MJJA 4MJ2A 3HI1B 4KQ4L 3QI9B 4R96B 4IOIB 4P0DA 1Y0LA 3C60C 4NQDB 3MMEA 3NA9H 1ZWIA 1LO3L 5IESL 4Z7VF 2EO1A 3TIEB 2IG2H 1PZ5A 4ORGA 4JM2D 1ZHNA 1YEKH 1O7SA 2EEAA 1V7NL 3QWRA 4U7KA 1PSKL 1P84J 1FL5A 1OCWL 1U8MB 4TULL 5B3JE 5KTEL 3TYGL 4LVHC 5FKAA 4AENB 1DP0A 4QT5A 2VDMH 2ZP0T 1UCBL 4U1MA 2FIRT 3MJ8B 4M03A 2I9TB 4RZCA 1T66C 3GI9L 3U4EB 4CW1B 3S7GA 2EC9U 2H1PL 4P2QA 3PJSB 3F65A 3BQUD 3K1DA 2WBJD 4H1LH 2A74B 1K8DA 2XKNA 2PW2A 4KMTL 5E2WH 2MWCA 5SX4H 2HT2C 1VADB 3H7LA 2GFBA 5MI0C 3VXUD 1IQDB 1D9KA 1QFWL 2BK8A 2HH0L 4XRCB 2XN9A 2DMKA 4OD2B 3QO1A 2PCPA 3WE6B 4MXWH 2AEQL 1PX4A 3BQUC 5J1AB 4M8QA 4L4VB 2D7PA 2XWJB 4PJXE 3SDCC 3X13A 3BIKB 4M61A 2F5BH 3LQAH 2X70B 3LD8B 2YEZB 4H1LB 3I75A 3UJJL 4PJXB 1NANH 4ZUWA 2DWEB 5DJ2B 4HKBA 4HUXA 4QOKD 5C0IA 5CP3H 2A9MH 1NJ9B 3SE8L 1NCWH 2CKBL 3GMOA 1KTKE 1JIBA 4X4YB 4OLYL 5HHQA 2WUBL 2H26B 3SDDD 1ZA3A 4HWZB 4JO4H 2P5WB 1L9MA 3H0TA 1HINL 4DN4H 4FQXB 1ZEAH 1N0XL 3B9VA 1F42A 2DKUA 1JNNH 4XXCC 1C1EL 3H9SA 3MUY1 1CL7L 2WZPD 1CICC 1UYWL 2FBJL 4LARH 1HHJA 3DRQA 3VWJD 2DJ4A 4KJPD 2H26A 1AFVL 4QHUB 4BZ2L 2OZ4A 3IDYC 3ZE2E 3KJ4B 3TPUB 3FOLB 1FHGA 3CFDB 2AS5M 5IB5B 5EFIA 3NIGE 3LEXA 2J8UB 3OKKB 2VUOA 3MFFA 3QCTH 2AJ3A 5H37G 3IU4L 3QA3A 4Z7QF 2C4FT 4JE4B 5E6ID 5HHOD 5B38A 1A4KB 3SDYH 4NQDE 5C0BD 3EFFA 3BPLB 5I8KL 3VFWA 3RUGE 3T0EA 3GHBL 3GSNH 4QWWC 5C07D 1KB9J 4E41B 3MFFB 5DUBA 3V4UL 2NX5E 4KRPC 1JPSL 5ILTH 4LKCA 3SKMA 1V3JA 3PWVA 5E00B 1S5HA 1FZJB 4QTIH 1I1AA 4OZFG 1BOGA 4KRNA 4MZ3A 2EXWD 3CUPA 4JZJB 1T1ZB 5IFAH 1HSAA 1A7QH 3UPRA 2ERJB 1AXSA 5D1ZA 2D03H 1MRDL 4QTHB 1J0ZA 3RVWC 4JDZB 4PJ8B 4OCWL 4JFQB 1XGRA 2EXWC 1LO5A 1BAFL 5CGMA 1LP9A 4X6FA 3NFSL 4A2LA 4F7MA 2ZCHL 3LSOA 1VFMA 4X4YA 5DHYB 1XGPB 3HZYA 4M48H 3IF1A 3UTOA 4Z0XB 2WUCL 2VC2H 3NABL 3CFEA 1T66D 1RIUH 4HWUA 4N68A 4XAWH 4N0UB 4HV8B 1H8NA 4LLMB 3I84A 4EI5C 4ZOBA 3ROOB 1PEZA 3U7WH 4C56B 3T2NH 3G6DH 4F33B 2V2TB 2QQKH 1AC0A 2V5RA 1MRCL 4XBGB 4X99A 5JORA 4JB9L 3QCUL 1K3IA 1T2QL 4LCYA 5ERWB 3T77B 1GPOH 1OAKH 3JBG7 3EO1A 5IMOB 3V8OA 1JHLH 3U83A 1RAMA 3X13B 5GQBA 3VD9A 4PG9B 3CH1B 3EOAA 3IU4H 4HDIB 3WN5A 4TVPE 4C56A 4BSWB 1CE6B 5IV2A 1G0YR 4GKZA 1FSKC 4OIAA 3RGVD 5IGXH 2C4XA 3AXLB 4HF5H 4OCNC 5A2JH 3I3DA 3DMMA 4YO0B 5I8KH 3BVNA 5EU6A 4U0QB 4C56E 2Q20A 4G5ZL 1P4LA 1CQYA 2BVYA 4RAVB 3H6JA 2JJWA 5CSZA 4F2MB 2IFFH 2EIEA 4G6JL 1CVRA 4U1MB 1DEEA 3O2DL 1B0RA 1IARB 3EYOB 1U2HA 2J4WL 3OJMB 5C0NC 5GRYA 1GC1C 3L3OB 5BZDA 1WISA 5CAYB 2YD5A 4IRJA 1UWXH 4NBZB 4XBEH 4YXHL 4TSBH 4ZS7L 4UV4L 2PXYC 4JHBA 3VFSA 2VZVA 5KBNC 1XZ0A 1E0OB 4PREA 2V5MA 4H25B 2O26U 1YJDH 3VXRE 4QRRA 4PJ8D 3IDMB 3BJLA 5E2JA 5FK9A 4M5YH 3MJ7A 1HIMH 1KCVH 4NYLB 2YD2A 3STZA 3CDFA 1ZLSL 1JWUB 3WFHA 2GAZB 3DUHA 4LP4A 3G08A 4KY1H 2BCKB 43C9B 1JGDA 5DMKA 3BZFA 5JW4R 5KS9E 4YBQD 1A6WH 2YPLE 4OGYL 5ALBH 1MSPA 1Q9KA 1DFBH 1RV6X 4E41D 4CMMB 1PY4A 4H88H 5EZLB 5L2JB 4LSVL 4OCSH 2G5BB 5ITFA 4PLOB 2FR4B 2QSCH 2AQ1A 5CJQL 5F3BB 1I3GH 1YDPA 1DSFL 1MEXL 1NGZB 2IAND 4NN5B 4PGDA 5KN5A 4K9EL 1XGUB 5ICZB 2DQDL 1A7RL 2BNUA 3VFPA 1FG9C 2X4PA 5B21A 3M07A 3VXTB 4JGUA 3PV7A 4OCLC 5H35A 4L4TE 4EI6B 1CFSB 4MMXC 4PR5B 5C09B 3U0TB 4D9LL 3IJYB 3LS4L 4KMTH 4FFWC 4KV5F 5J1TC 3MOBL 4H5SB 5BV7L 2KQMA 1XR8A 2HVJB 1VB9A 3M8OL 1RK1B 1U6AL 2PUQT 1SJVA 3QUML 4DTGH 4ZUWB 3B5GA 4PJEA 2Y5TB 2DQIH 4LCIL 3I6LD 5AZ2H 3FQXA 3OAZH 1R3JB 5BQ7B 5TFSH 1GOFA 3KJ6H 3AUVA 3MBXL 1F3RB 3G6JF 4OJFH 3QI9D 2P49B 3EYSL 3T0ED 2D7OA 4HXBL 5D7IA 1FZKB 4LMQI 2QL1A 1BWMA 3TH2T 1C7SA 3TBWA 3ARBD 1W72B 3WO4B 5FA3B 1N59A 2DOCA 3RNKA 2UWEA 3O6MH 2VITA 4QOKB 3RPKA 3O8XD 3MGOA 3JV0A 3UCRA 2R69L 3EFDL 3K81A 5SWZB 3TJEH 1CG9B 1H3WM 1VFOA 2Y5EA 4HZLB 1CLOH 3O2DA 3QZWG 4WRLA 1CK0L 4KJQD 5D9SB 4D0CA 2CDGB 4NRYA 5F9JA 4HUKB 5I1EH 4PJDB 1I9JL 5DHVA 2B7DT 5IM7A 5KZCB 2F54E 5EIIB 2ED7A 2Z92A 1R5WB 4BM7A 2X4SA 1A1NA 3V6BR 1QLRA 2WWMD 4QXUL 1JHTA 3QQNA 4X9GA 4XWGL 2YD9A 1HK6A 5LJYH 3MREB 3LV3B 4L8DA 3LEXB 4L9LA 2IQAB 4U1KB 3TT1L 2F58L 3QJHB 3U9UB 1QFUL 3NBNA 4AH2A 1OSPL 2B1HH 1A6TB 2XRAL 5CS7A 2UV3A 4G6KL 2R1XA 1CXIA 5D72H 4ZOAA 4NHUA 4PP1C 2W0FB 3AREB 3E3QE 3HE7C 4WUKL 5F6HJ 5EH1A 2CLVA 5JHLL 5EZOL 3N50A 1D5ZA 4YEEA 3FO9A 1PQZB 1RZGA 4LU5L 2GITB 3CPLB 3QCVH 4EVNB 1UM4H 5FDYA 4NOBA 4GKZB 2QHRL 1IE5A 3OX8B 4JREB 3O2VL 1OT1A 4JPKL 2YPKA 3TYFA 4C59B 3CH1A 3EOAB 3WN5B 1BZ7B 3ZSSA 5TH2A 2EDKA 1I8LA 4Z7VB 2GSIB 2FCBA 4X4XB 2APXA 4YAQA 4WO4C 1IGJA 1NFDA 4HS8L 4UILL 4K23L 4ZUSA 2IPUG 4HF5L 5D8JH 3PQYD 4RFEB 3RL1B 4OZIF 1ETZA 4H20H 2CSPA 1G84A 2KH2B 3WFDH 2C5DC 4Y4FA 5I18H 2DI9A 5MEOB 2CRIA 5HYFA 2YA1A 3CMOH 1D9KC 3Q48A 4IRJB 2WINB 3SDCD 5DRZA 4EDWL 3SDCB 5BZWB 4F7TB 2R4RL 3K1KC 3O2DH 2IJ0C 3CFEB 2Z93A 1VGKA 5I71C 4Q9CA 3O11A 5CEXB 3D18A 3QXAB 3OKYA 1FAIL 5F7KC 1G1CA 5KSAB 1KELH 5AYUH 2FDBP 2G5RA 5DS8B 1LHZA 1H3PL 3BUTA 3O4OC 3KPSE 1RULH 3OXRA 3SDXA 1UXWA 3BDBA 3VGHA 1QHOA 3OKOB 2XTJC 1QNZL 5T1DL 1F4XH 4Z5RA 1DQQA 2J3SA 1A7PH 5JOFA 1I4FA 3CDGB 1IZJA 4YFEA 3BDXA 5J89A 1L7IL 3KS0J 3S8WA 3HE6D 2Z31B 4MA8L 4W6YB 4YEFA 1NBYB 2HKHL 3QUXA 1MCBA 1PZ5B 4WUKH 5M94B 1ZHNB 2VZUA 2YKLH 5D71H 5HGDB 4G8IB 4HG4K 3ARPA 2O61A 5I1KL 2AJYH 1HQ4B 5J0BA 2QHLA 3E1F1 3C60A 4NKIH 5IQ7L 3TZVC 4DKFH 15C8H 3VFSB 3P11H 4ZQKA 5JHDB 1JPFB 3GKWH 4JQVA 2AXFA 4PGCB 5DURD 4HBQA 4P5TB 5I1IH 4KZDL 5E9DA 2AJUH 4XNXH 4XCYB 4GAFB 1IGYA 2MFNA 4NO3B 2XY2A 4KJPC 2ZWLT 2YXFA 3TZVD 3UBXG 4OIBA 2NXZC 3WFDL 4QXGH 2M2DA 4NDMB 4ZS7H 3ULUC 5CUSH 2FD6L 1OT2A 3MRNA 1FZMB 1RZJL 4IOFD 1T0NA 3RU8H 3TT3H 1EFXB 5LQBL 4PJCB 3KPSA 3QNZB 5T5FL 5JUEL 3P30L 4A6YB 3FB7A 5TDPA 2B8OT 5EZLA 1FAIH 4J7RA 1A4JB 1SY6H 5F89B 1G7IA 5DLMH 3GSQA 2XQYK 3OKMB 1R0AH 2DQEL 1P7QA 4LOUC 1GZQB 5C0AB 4PRIA 4Y2DB 3TVMC 1GGIH 5JR1H 3UTQA 5TE4H 1A6WL 4QRUB 3IXTB 5JPMB 4HUXB 5L2KA 1A6ZA 3P4MB 3WIHL 1MUJB 3ULVC 5ACZB 3BHBA 3VDAA 2YD1A 2E7CA 3H7BB 3JV4A 4XX1G 2KZWA 3G6JA 3V2AR 3I50L 2CXGA 3CFCL 4YBLC 5C1MB 2D9CA 2VH5L 1TQCC 2VLLB 2DMCA 4S10A 5DXWA 3B8SA 5C0RH 2AGJH 4KHTH 1S78C 1FLTX 2CJUL 2F53E 3QXVA 1KGCD 5DC9B 3R06B 4CVXB 3BN9C 2DDQH 4PRHB 3ULVL 3LZFL 2NR6C 3RNQA 4XNYH 1IGIL 4EBQH 3RIAF 2VDML 3L5JA 3TCXA 4HUVA 4JKPL 4TSBL 2F9BT 4WVRA 3U7YH 4KI5D 1YY9C 3X12B 4N0YH 1HSBA 3MLZH 4Y4HC 1OW0A 2EYTB 3RBGA 1M05A 1MCEA 1RJZA 5JW4N 3QUZA 3PF2A 1BZ9A 4LCWB 2J1KA 1WLHA 2KDGA 1AP2B 4WHDA 1A9EA 3GBMH 3L5XL 2C9AA 4XWGH 2NTFB 2HJFA 2GCYA 4JPWL 5C08E 1NGPH 5C0IB 1V5JA 4ZXBC 4EIGB 4LK4A 4UBDD 1HQRA 5CJ5A 4UNTA 3V4VL 3TESA 2J8UE 5HVHC 3AY4A 4I5BB 1DQML 2R0WL 2FEDD 2HRPL 3GSOB 4MCYB 4EI6A 2NY1C 3RWFB 3MXVL 1GCFA 4GRMA 2APFA 2LVCA 5KSUA 1JJUA 1GIGL 3C6LA 3DGGA 2HFEB 2IWGA 2YD3A 3IDIB 1Z6JT 3E3QC 5FF6A 5D8JL 1I7ZA 4JRYA 1TTFA 4Y19D 4GG6E 2D7QA 1KENL 3VFRB 1KUMA 1WT5C 1T03L 1SJEA 1JZ7A 3KLSA 3LSOB 1E4JA 3UTSA 3AY4C 4EDWH 2CO7B 1KIUA 4WEMB 2R29H 1R5VB 4PGZA 4D0DB 3V6FB 2VQUA 4DN4L 1WEJL 4LASH 4MHHI 3GUTA 4FQIH 4LQFL 5MHSE 5ADPL 3QUZC 5I1HH 2EDFA 1YEKL 4R4BB 1U8MA 3GSUA 3WDHA 4AENA 3HI6L 1S3KH 2LV4A 1AD9A 3SKMB 4OUUB 3AMLA 1U95B 3G9AB 4WFFE 4MNQA 3IAPA 1UWXK 3EDEA 5INCA 2N56A 3U1SL 3A0OA 4Z7WA 1R3IL 3ORJA 2GK0B 3GBML 3L5XH 5D2NE 5D1XD 4YX2L 4U7SA 5GIRB 1J8HA 2BRRL 2JB6B 3Q5YA 2H9GB 1FVCA 3DYPA 4FZ8H 3TZVB 1TVBB 4QYOA 5I75B 4LIQL 4XPGH 1OB1A 5CLTA 3FQUA 4PJEF 1VERA 4P2OB 4PJIA 3ULUH 4Q6YA 3T0WA 1WT5A 4JFFB 2HWZH 3QUYB 4NBXB 2JB6A 2R2HA 1KB5B 5JHDD 1DQQB 2CMRL 3TZVA 4L8SC 1BGXH 2YN5A 1U92A 4X6BA 4M4RA 1RY7B 1OTTD 3P0VH 5FEBA 1YEGH 2XA8H 1MCRA 4LCUA 3BZDA 3GDBA 3GJEB 2Z31D 4HIEA 4UOJA 1KNOB 1MFEH 4KTYA 3IJYA 3SGJA 3ZDXF 4NQVA 3LKSB 5EBLA 1A6VH 1NEUA 1MWAB 3NCJH 4C57C 3G9VA 1X5YA 2D31B 3IGAA 1U42A 2CIKA 1R5VA 1QFOA 4LCUB 5F6IC 3UXFA 3FN3A 4ERSL 1RZJH 1MJJB 4KWUA 3IDJA 1ORQB 1CLYL 3C60B 5A2LH 4JM2F 1FL6A 3PL6D 2LQRA 2ZCLH 2J5LB 5C0BA 3RZCD 1EEYA 4WHCA 2NY3B 4XH2B 2DBLH 3MRFB 5CFHA 1E4KC 1E4WL 4PD4K 1F3JA 3L3DB 2VAJA 5FUCC 5F72S 3RX8A 3DI2B 5GGRA 1MFAL 1CICA 4L4TA 1TJIH 1QA9A 3P4OA 1IAMA 5GIRA 2VH5H 2NYYC 1RIHH 3EDKA 4W4OA 2BC4B 4U6TA 4X6CF 1VKXA 1LO3H 4RMUA 4BK4A 2UZYB 2AK4A 2F74A 3JWOC 3REWB 1JWSB 4DQOH 3VXMB 4MB4A 3RWHA 2WW8A 3V4UH 1C5BH 3V9FA 5DUPL 4H25A 5DVLA 5LG1A 1J0HA 1PLGL 3P4MA 4UTBL 3RWJA 4MXVF 4YK4B 5BS0E 2YMXH 4LRNL 1IL1B 2NTFA 5CJOL 4NZTH 5EBMB 5F96H 3HS0A 3DBXA 3GSNA 4M1GL 4NHCH 3VWJC 3ZDYE 4PRIB 4LNVA 4OKVA 4F3FB 1FE8H 5C9KA 1LDPL 1C5DB 4OI8A 5D7JC 1DVFA 3CVIL 1FGNH 2CK0L 4J3OC 3WEXA 1CF8L 3BP4A 4HJGA 3MRIA 3HMWH 3VCLB 2Z8VC 3MJ6A 3OR6B 2G2RB 4U1HA 5E8PA 3ABZA 4DZ8A 4ZSOA 4L4VD 3X17A 1AO7A 5CWSB 4NM8L 4M6AA 5CCKL 3D69A 4I3RH 2ENSA 2ZNXA 5IVXB 5DD1H 2A6JA 3ISWA 3HC3L 4KHXH 2F8VA 4PRAB 3FO0L 5DJ6B 3ILPB 3EYUH 5HYQB 5IVXE 2DLFH 3W11C 1U8NB 2XPGA 3OHXA 5IEKB 4JCLA 1UKQA 1F2XK 1BX2A 1LE9B 4CDHA 5AUMB 3RDTD 1FPTH 3GBLA 4ISVB 4LBEB 4R7NA 3QPXH 4ZFZB 3UTTB 1YEJL 2W9EL 3CXHK 4M3KB 2FLRT 1KN4H 5FK9B 1P9MA 4XVSL 3RPIB 4EXPX 4PJFF 3KG5A 1W0WB 4PRIE 4XP6H 3VXME 3S5LG 1S8DA 5B39A 5EG6C 4KH2A 1E4XH 1J5OH 4OV6F 4Q0XL 4Y4HB 5F1KC 3VRJA 2WANA 3QDME 1GHFH 2EIDA 4DKAA 1S5IH 3QQ4A 2AVGA 5D93C 2YR3A 4GRLC 4K94H 4NZTL 3MLRH 4HZLA 4LQFH 4XPTL 5FAAA 4BH7A 3R06A 4M5ZH 2Y6SD 2NXZD 3FFDA 4D9RE 4MJIE 3HLAB 3PHOB 3T4YB 3AS3A 2IH1B 3TBYA 5C3LD 3F6LA 4LHUB 5HPMB 3VXPA 4JVWA 3ZO0A 3SE8H 1F3JB 3L3DA 4BFBD 3B9AA 4Y5YB 3KPMB 4WFHE 3MRLA 3TNNB 1CFNA 1JPTH 2R1WB 1U8PB 3QIBC 5GGVH 5L7XL 5JQHC 1ZLSH 1S9VA 1IMHC 4L3ED 2MOVA 3TJEL 1FO0A 4FQPA 1UYWH 4F58L 4EUPH 3MLXH 2O5ZH 3X14B 1SEQH 3W0WA 5E1AB 2DLGA 3C5JA 5T1LB 1S7XB 1V8HA 4X6EB 5L2KE 2X1QA 1FZOB 1CGVA 1AY1L 1U3YA 4R4FL 3C8KA 1UM5L 2L0DA 4Z5RB 1KCRL 3CFDA 5D1XC 3G5XB 3TWCL 5D2LE 3UBXI 3QCTL 4YXHH 5IB4A 1A3RL 1B0GA 1TITA 3CSGA 2R0KH 5GS1B 4KUZL 2P8LB 4RAVA 2DQCH 5IMLB 4JZNA 5KN5B 2P5EB 2AKRA 3UP1A 4WW1A 4JO1L 5KVFH 2ATKA 1F45A 1A8JH 5DVNA 4M48L 3RTQA 4EUPA 5H8DA 4Z7NF 3RVXD 4FOMA 1JZ8A 2OK0H 3FTGA 5F7HA 1F02I 1MCWW 5TFSL 1NC2B 3C5ZA 5C8JB 1KCSH 2W0PA 1YC8A 1AH1A 4PJBB 1MRCH 2CD0A 3VXNA 1MUJA 3BEWB 4QRPB 3RA7L 1CR9H 4QRRE 1IC4L 4ODXA 5DEGA 3O6KL 4G7VH 5AUMA 4N90D 3MV9D 5D1QC 3JWOH 1T6WA 4YDIL 4OZGA 3SDAD 3VXOB 4NZUL 1FFNB 2VMFA 2ZSVA 1CU4H 4JG1L 3FCTB 3IDGA 1KJ2H 4MWFA 1HXYA 4F7MB 2E7LC 4YC2C 1MHCA 3O6ML 1D5ZB 4Z0XA 3ZKMC 2VXVH 1MELA 4WHTB 4Y8DC 2A6KB 1DANT 1ZS8A 3DHMA 1IKFH 3CNKA 5I1HL 2R69H 3EFDH 5C07E 4PRDA 4XWOC 2EC8A 3ARDB 4P5KB 1T6VN 3LRGA 3QNYA 2ATPA 2FX7H 2XV6B 3EHBD 4IHOB 1EEUA 4P2QE 2R56L 4BQ9A 5EOCJ 1JL8A 4PGEA 4APQD 3WXWH 2JE8A 2VLMD 3LQMA 5E99H 5ELIA 3MODL 1ROWA 3NIFE 2Q1EA 1I1AB 5FKAB 4WHTA 1ADQH 1DTUA 1ZT1B 3QHTC 3MLPA 5IW1B 4K8RC 1CXLA 1LO0H 1P69B 4H5SA 2OTUB 1TZIA 1CE6A 5IV2B 5JHLH 1AR1C 5BV7B 1YJDL 3DMMC 4MXVE 4UU9A 4X4ME 1P7HL 3RWHB 1A0QH 1TCMA 4OF6A 2HH0H 4UT6H 1JHKH 3D85B 1CF8H 4IMKA 4F7PA 3HI5L 3WMSA 2DTSA 3BUYA 5DO2D 4GRMB 5DRXA 3HI1A 2EE6A 4L1DA 4RWYH 3H9HA 3S98A 1YDPB 4K3DL 3OJDA 3NVQA 1SQ2N 5LGJB 1MRFH 2A9NH 2P48B 4OD2A 4UT7L 1MCOH 1VPOH 5HGAB 1G7QB 5KVGH 2HJKB 3NH7L 5DUPH 2IC2A 1RIVL 3OAYK 2GUOB 4XX1E 3I9GL 4X9IA 3LMJH 2AV7A 3OB0K 5GGUB 4NKDA 3TBSA 3QNZA 2OJZH 1KN4L 2V7HB 5JO5A 5C07B 4Z7OF 5DJ0A 4F9LA 4GRWF 4JRWA 5MEPB 5C0BB 1AHWB 4O51A 3O3DA 1NUNB 1ZV5A 3L1OL 4DEPB 5KSVB 3RVTC 4NUJA 1RUML 2W59A 5LXGL 4WV1B 1TNMA 3SN6N 1N0XH 1N6VA 1EO8H 4Y4HA 5DD0H 2MNUA 4KKLD 4RAUB 5FGBC 3DXAD 2GK2A 3IDNA 4KY1L 4FFVC 1VENA 3CUPB 4P59L 3ZHDA 2WSKA 5CSGA 1DE4B 5I15L 1KF9B 1P2CA 1UADC 3EO9L 2VZ1A 5C08B 3DX7A 4YXKH 4I3GA 2X9YA 4GO6B 4KMLB 2DL9A 1OTUC 1BQUA 4NO5A 1F6AA 1E4WH 3C6SB 1ZTXH 3MLTA 4PJBA 2ITDB 3RWFA 3A6OA 3L6FB 2XWJA 4FQCH 2ZCKL 1EHNA 3DV4A 3I2CH 3FOMB 4G3YH 1WBZB 4GXUM 5D7LB 2DQDH 2C3HA 4F9PC 3FB5A 5TF0A 5HYSA 1L7IH 4KJWD 4URTB 3LB6C 1RUAH 2BHYA 1RUPL 1K4DA 3A6CL 4GKNA 4F58H 4U1HB 4DW2L 4GRLD 3EYQD 5IBUB 4Q97A 2ED9A 3CDCA 3UPRB 3CLFH 3QJHA 1ZS8B 3VRJB 2FO4A 1FDLH 1NFDE 1G6RL 1NUGA 4Y4KD 1AGCB 5JPNB 1S5IL 1U95A 2BOBB 1KULA 3E2HB 1U8QA 3QDMA 4MJ5A 4CN1A 5K9OA 4TNWK 4PJGF 3U36B 4P23B 4GMTL 4KU1A 5I1CL 4D8PA 5DSCB 3HAEB 3Q6FB 1UC6A 3WJJA 3TT1H 3CZFA 3U9PL 1DEEB 4Z7UF 1OLLA 8CGTA 3AC0A 5E6ZA 1XR9A 3O6LL 3NTCL 5IIEA 5KSBF 1RUKH 3ARBC 4MVBC 2DF3A 2W1NA 2AXGB 4KI5E 3EYUL 3O8XC 2F53D 4OKDA 3KLHD 2ZNWA 5F7LB 4MDJA 4FA8A 2VQTA 4Z7UB 3MBEB 1UQSA 1QFWH 5FO9A 1YECL 2ICES 5KG9B 3KYMB 4GOSA 2LVEA 1EJ6A 1TMCB 2DRUA 2A9ML 1IGFH 4NN6C 4U1NB 3VXUE 2L7JA 5IOPB 1LEIA 3L3KB 5EOQL 5ICYA 2BX5A 2NY7L 2PN5A 4J3SA 3BIBX 4WGVB 5F7EL 1S7UB 5JQ6H 5DK3A 2A74A 4Z7UA 2DLHA 3FONB 4NZRL 3MACH 3STZB 2ADFL 1BFTA 1QFWM 1WC7B 4KKBC 2DQGH 2OP4H 1BQHA 4MS8D 1DLFH 2DQCL 4Q2ZA 2JJTA 1VEMA 3NFPB 3BD4A 4NQED 2R23B 5D5ME 4Z7WB 2AJXH 4PGBB 4U2ZA 3QQ3B 1EGJA 3KYKH 4Z7UE 4N8CH 1WTGT 3RAJH 4TYUA 4WFED 1B90A 5I9QC 1FNHA 3HE7D 2YEZA 3TM6A 4N9GA 3OMZA 4I48A 1FO0B 1NBVH 3BXNA 4PGBA 3TIEA 4NKQB 4HUVB 2M26A 4R97B 3AB0C 4GW5A 5CZVH 1KT2B 2CLZA 2YC1B 2O61B 4MA7L 2WV3A 2IGFH 2PW1B 3V4VH 2DM3A 3OPZL 1KB9K 4Z9KB 3C8HA 2VXUL 1EJOL 5K9JH 2BDNH 1UJTA 4MZ2A 5IVXA 5I19L 2FYYA 4G7VL 5A16A 1VADA 1OGAD 2QLVB 2Q3ZA 2E3VA 4ESKA 3EUUA 2CK2A 5ISZE 4WENB 4WO4A 5HYSB 4CW1A 3VXSE 3JUZA 5D1ZD 1BOYA 1XGTA 2CDFB 1EBPA 1G6RB 2MHAA 5FDWB 4U4BA 1N7ML 4ODSL 3N06B 5CEXA 1H3PH 4QGTA 5HVFB 5K9KB 2RFXA 2OTUA 2OR9H 2F15A 4MAYA 1I3GL 3GSRA 4KZDH 2CIKB 2FECI 1L7TL 2HRLA 3NCCB 3DVNA 3ARGB 1X9QA 4P2RD 3NFSH 2Q7NA 4NZRH 3IKCA 2HN7B 3DUSB 4PR5A 1E6OL 1MCJA 2R29L 1CFTA 4OFDA 1X5LA 2UUDK 4JHWH 1MRDH 3CC5A 1IAIH 2QQLL 3MNZA 2BSRA 2BNUB 1HHIA 2DBJA 2BNRB 4N8CL 4U6YB 1A21A 3PJSA 4Q6IC 4YDLC 2I5YH 1UZ8B 1KB5A 2ZSWA 5GGRB 2OJEB 1CGSL 4NQCA 2E6QA 3VE0A 1T1ZA 4M93C 2F5AL 4M6MH 2YHGA 4WTXA 5HHPA 4KUCD 3O6FC 4EQ2A 2AQ3A 1T83A 1HWGB 2ZUVA 3BZFB 5F93C 2V9QA 3BX7C 3S3PA 5T3ZD 4PP2B 4ODWA 3QUKB 4DCQB 1T0MB 4MQ7A 2VLRD 1YNKL 2W60A 4MCYA 1B6UA 3BPLC 4OF0A 5J1AA 1C5DA 2BNRE 1TPXB 4CJ1A 2WWKO 1BJMA 2EDLA 3V79C 4XB7A 5LXGH 1H0DB 5CD3A 2VDPL 2CRYA 3QA3B 5DA0B 1IT9L 1TCRB 4BZ2H 3BDYL 5F9DC 1KLFA 1M05B 3RVTD 5HD8C 3DTXB 3FAWA 4JHAH 2X4SB 4YHMH 4AM0B 1RD6A 2BNQA 1JNLH 4MD4B 5I8CA 4J2XA 1CFVL 1H8SA 2CDGA 4G9FA 4NRYB 2PYFA 4OI9A 4H0HB 4KQ3L 4PRBA 1F11B 1X7QB 4GMTH 4ETYA 1ZVSB 4JJ5B 4X4ZA 3SQOH 4OZIB 3GI8H 2VLJB 3A67H 3TA3D 1V3MA 1H8OA 5C2UB 1F6FB 5JA9A 1T22B 3L95B 5ID0B 1NGWB 4ZNEA 1IAOB 4N1HB 4I18B 2A6DB 3QIWA 2WINA 4XP9H 3CC5B 4EDXA 4K2UH 4W68A 4UIKL 2RCSL 4LRIC 1UEYA 3W82A 1FZKA 1QRKA 4OCMC 2HT4D 5FF6B 4OGYH 2ZPKH 2FLBT 2Q7YB 4GXVH 4HPYH 3BGFC 4NO0A 4Y16C 4LDOB 1OAQL 2DLFL 3O8XA 2DD8L 1NAMA 2BJML 3BE1H 4YDKH 3QRFM 5KVGL 5BW7A 4M7JH 1YYLH 5FYLD 2VLJE 5EC1A 1NCTA 1IFHH 1IEBA 3OR7A 1DE4A 4UBDC 3MLSL 1S7RA 2YPKB 2Y4SA 5ISZD 3ROOA 1X44A 3UTQB 4N0FA 5L88L 4Q2ZB 2YK1H 3TV3L 3MLUL 1ODAA 5KAQG 2XFXA 4YNYB 4YZFE 5GGTH 1R5IB 3PP3K 1U3HA 3WIIH 4KK9C 3EDDA 3DIFA 4G80B 4O4YL 5GPRA 1U3JA 4R90H 4K3GA 2X42A 4PJ9C 3VGDA 3O6LH 1U8IB 4K8RL 1HHIB 3T1WA 4GW1A 3OXRB 2Y1VA 3TO4B 5C08D 2W91A 4MNHA 5HGGS 1OAKL 3B2UC 4HIJB 3WD5L 1FJ1B 1FVEA 1YEFH 4OM0L 4RISH 1EV2E 5CJBA 1ES0B 5JOPD 3HI6H 3HS0B 3GMRA 4NQSB 1FC2D 5E1AA 4OFVA 3U4AA 3T0EE 2A1WH 3FO1A 1J7VR 1LP9E 3I6GB 3U0PB 5LGKA 1JZ5A 5EBGA 1RZJC 4JGMA 5EO9A 1K6QH 3VI3E 3D85A 4B53A 1BQHG 4XPHL 3KPRB 5IVXF 2EIZA 4S1QH 3V52H 1J1XH 2D0HA 4E5XB 1BD2B 4PY8I 3WN5C 1BECA 1MREL 5ETUB 3RJQB 5D7IF 3U0PA 2H6PB 4FNLH 4WUUA 2GYSA 2P24A 3GB7A 4YHYB 1I3RA 1HNFA 4XZUA 1W8NA 4DFIA 3GMNA 3QPXL 5L0QB 4LGRB 2BHZA 2HWZL 2JLLA 4BH7B 4OSUL 2DQJH 1T5XB 5C86A 4V1DA 1U8JB 1MHHB 2E9IA 4JN2B 4P4RA 3RTQB 3ES6A 4JFHD 3L5IA 1RZ7H 3PWUB 1DBMH 2APWA 2OM5A 4FTVD 2PYFB 1LDPH 1SHMA 1KN2L 4CVWA 4GW5B 1FZMA 3S35L 1EFQA 4IRSC 2BSRB 1NAML 3JSSA 3N1PC 4JFDD 4L8BB 2HG5A 4R97C 4V1DB 4HKJA 4ZUTB 1TPXC 2DKMA 5KVFL 1GYAA 1CDGA 5DUML 4Z77A 1Z0MA 1IAIM 4X98A 1NANI 1NAKL 4RGOL 1DANU 1ZSDA 2OL3A 1QEWB 1ITBB 5CIPA 1FFNA 3L3HA 2UWEE 5AYQA 1AJ7L 3V0VB 5BS0D 1AGFB 4LLUB 5FGCE 3OJ2C 4Q6IA 2P44B 1ZGLM 3CH8A 3CFIC 4YH6A 1NCBL 4Y5XC 4NP4L 4CNIB 1ZVHA 1LEKB 4X8XA 3VFUB 4OJFL 1QEWA 1HQ4A 3TCLA 3U6RA 1T83C 1P7QB 4GRWB 5I66B 3IKKA 3IRPX 4NJ9H 1G7MB 5HYIA 1Q9KB 3D0VA 3JVGC 2D2OA 5INDB 1IKNA 4OD1L 4WEBH 2JIXA 3RGVB 2HJFB 1X5HA 1NKRA 2OYPA 4X7TB 4WV1A 1LMKA 4H1LG 1N5AB 3RNKB 2DL2A 3O45A 4X6FB 5KTEH 5HYJD 5DZOA 2WP3O 3IFPA 5I1EL 4M7ZB 5E6IC 3OTTA 3JWDC 4QY8B 4R7DB 3OAZK 5BS0B 3UEZA 1T1XB 1KTDB 1YC7A 5DJZB 4XZUB 4FQLH 3VGGA 3MNVA 4F8TA 1X5AA 2R0KL 4GFTB 1NC2D 1QO3A 4HT1L 2YMXL 3MLRL 2ZCLL 4OF3A 3P73B 5DSCA 4D8PB 1XR8B 4JFPB 5GJSL 4PJCF 2NPLX 3MROB 3LH2H 2WAHA 1UACH 3D5OF 2ZUSA 4Y4FB 5MEOA 3MNVB 3RKPA 1QBLH 1WFNA 2P5ED 4OAWA 3PABB 1ZLWH 5IF0B 3GMMB 3V6FA 2EYRB 2NZ9C 3UO1H 1EVUA 2XKUA 5IUSA 3QXTA 3D2UA 3LVEA 4I8DA 1BBJB 3NMEA 3FFDB 5EO1A 4JRYE 1CR9L 4XMKH 1N7MH 1IGCH 4MXWL 4HG4J 1T7VA 1NUDA 2KUTA 3V5DB 1I7ZB 4JRYB 1F4WH 1W0VB 4LCWD 1BD2D 2FH8A 1MCOL 1QSFE 1UM6L 4Y0GA 5GZNC 3DIFB 3U6RB 5CINH 5F9WC 4PV9B 2FBOJ 1FYTB 1TQCB 5JW3L 4ONFL 1HINH 1I7RB 2YRPA 1YEJH 3VDBA 2XRAH 1D5IL 5HGHB 1P2CB 1ZE3C 1OP3H 3KR3L 4MDIB 5L6YL 4LARL 4ALAH 4C55A 1JHTB 4JO1H 1RZ8B 5CEZE 1NQBA 4MQXC 4HJJH 5C0CA 1MFDL 5EZJA 4MYWB 2YSSB 1RZIB 3MREA 3TN0B 4RA0C 1UM4L 5DFVD 5F7DB 1UXSB 1XFPA 4KK8C 5I2IA 2X89D 5E7FA 5GRVL 1WWAX 5D7LD 5BXFB 1RVFH 2UZIH 4CGTA 2HA1A 1KEGL 3VWJB 4EN3A 1JPFA 2FEEL 5HGBA 2XACC 2J88H 5FOBA 1PAMA 5D4QA 4JDZA 2FL5A 5DGRA 2W0LA 3BISA 1Q0YH 2I07B 2XQBL 3ZL4L 2LE9A 3S5LB 4N8VG 1SM3H 1LEIB 1OD7A 1BVKA 1FNSH 1G6VK 3BKJH 3V7AG 1LO2L 4WU7A 3OZ9L 1FFPB 4PUBL 1ZHKA 1YNKH 5T3XE 3R1GL 5C09E 1WCQA 4NWUH 3RGHA 1DUYA 4YWGL 3CDGA 5E7BA 5IROA 3M17B 1S7VA 3RWDB 2Y36H 1Y6NR 2Q76B 3W0WE 5J7CC 4MS8C 1EGJH 3FQWB 2IFGA 3MA7B 3UO1L 3D1MC 2JIXB 3RGVA 1WWBX 4YDLB 2UVFA 4XXDA 3O3EA 3UTTD 2PETA 2ICWA 3HG1E 4MQXD 5FM5O 3T0EC 2G2RA 2XI9A 4XPHH 5E8PB 4DZ8B 4L29A 4K7FA 3GMQB 2DM2A 1WCBB 3RUGF 1UH3A 1JTOA 15C8L 1AQDB 1OL0A 2BVPA 1RK0A 4KRMB 1P5VA 1RJYA 1CDIA 4JQXA 2X40A 4RX4D 4ELMB 2XWTA 1ULVA 4RNRA 1LK3L 5JDSB 1V05A 1CFTB 2Y23A 2NLJB 1NBZB 5DRWA 1ES0A 4NQVB 4Y89A 3NA4A 4KAQH 5IVNA 1A7BA 4JKPH 1D5XA 3AMKA 1ZWIB 2FX9L 3T65B 4XCFL 1CDCA 4PJDE 4P59H 2X4TA 2IBZY 4HUUA 1YY9D 1R3HB 5FCUL 3MV8D 3ZKNC 1OPGL 5DD3L 3WKNA 2GQHA 3WFCH 1S9YA 4KXZH 3S36L 2QR0A 5CGYC 1JHLL 4JN2A 1A1MB 4DGIL 3UPCA 1BBJA 3ARFC 1DFBL 4AL8L 1MQKL 5E2UL 2ZSVB 4FQCL 4DGYH 1IFHL 4BH8A 3JWDL 1VACB 4ELKA 3X3GH 4H88L 1GOGA 3JTSA 4Y1AB 4NJ9L 5DJ2A 4L3AA 3LMJL 5CJQH 1R24B 5FYJU 4DK3A 3V5KA 4D2NA 1X3DA 3HZKA 3WJLA 4Q9QH 4RDQG 4OLWL 2MCPL 3T3ME 5EORH 2ADGB 4L9LB 3L3HB 3RVUC 5GGTL 5I1GL 3MRCB 3CXHJ 5FHBL 3V0VA 4R2GD 2WUBH 3GM0A 2EKSB 4WFGD 1MFBH 4JRXE 5JW5A 1AIFB 3ULSB 5T3ZL 4P46A 3LS4H 2EE9A 4MDIA 3ARZA 4AIOA 3EOYG 3QEQD 4YR6B 1Q94B 2PW2B 3ARFA 3RZCB 3BH8B 4JQIH 3ZKXB 4BJLA 5DHYA 1WCBA 3B9EA 2PO6C 4GQ9L 3MRNB 3REWA 3EO9H 2I9LA 5KOMC 1J8HD 4NQUA 3CLFL 3LPFA 3LKQA 2IEPA 1MCWM 4ZTPL 5GS0H 5DQDH 3N1FC 3LEVH 2GTZB 5J8OA 3HRZA 3BH8A 1M6OB 1T4KB 3VD7A 1MLCB 1T5XA 3LRHA 2FX9H 1CYGA 4FFYH 4KJYA 3C8KB 2W07A 4CMHC 5MENE 1TZGL 4XH2A 4HC1H 1F6LL 5B39B 5MERB 5I1CH 3PWVB 3EAKA 3V8CA 5IBTH 4CBPA 1CLZH 4MNGE 1HILA 4U1IB 1KTRL 3QR2A 1AGEA 4UIMB 1JHKL 3FJTA 3GMPA 4L8SB 1HI6B 3LRSB 2IPUK 1F6AB 5D2LA 4DGIH 4BFGA 4K55A 5F70A 4Z0BL 2M1KA 5BRZE 7CGTA 5CIPB 4JFFD 3UPAA 3O41A 5E8OA 1RU9H 4XMPH 1J0JA 3GRWH 5FHAL 3T4YA 1INDH 5B8CA 3VXMA 1RZIA 4OCRL 3HZYB 1A3LH 3QWOB 3KNBA 4LLAA 5DO2C 4G8EA 4TNVK 3S4SA 2ZSWB 5IMKB 2X89A 3GSXA 3H8NA 1ZHBB 1PQZA 3F7RA 3PGCA 2B2XL 5GRVK 3X12A 1EFXA 3FHAA 3NABH 4UT6L 1MFEL 4P3WA 1INQB 1UB5A 4WW2F 5DMIL 3VGBA 2VR4A 4WJ5A 2R2HB 1NGYB 2VSDA 3LN4A 2D7NA 3MV7E 4OZFH 3MRJA 1ITCA 1OF2B 1I75A 2OI9B 4P2OC 5H94B 4WW2A 1MCNA 5CEZD 1MVUB 3MA9L 1WIPA 1TCRA 1WJ3A 1PKQE 3FQTB 3H9ZA 1KENH 3D3VA 5HHNB 3EZ8A 4M7KL 4YHKH 2XZCH 1FYHB 1Z2KA 5INCB 4YHOH 1I9IL 2AK4D 7FABL 5JA8B 4PV8B 4L3CB 4D9QE 4K7PH 2P8MA 1FAKT 1RUMH 2AABH 4DWHA 1QFHA 4BQBA 4M3JA 3ZMRA 2BFVL 1CXFA 4OUUA 4ZNEE 3JV6A 4ENEC 5T1KA 4POZC 3QG6A 2VZOA 2NX5D 1J88A 4LLQB 2ADJA 4KPHL 5K9OB 3GJFB 1WF5A 5CKAA 1SMAA 4R2GC 1JNLL 2DI8A 3TN0C 4ZFOL 3ME0A 2J4WH 1S9WA 4QLRA 3MOQA 3VD3A 5ESAB 2WQRA 1MHPL 2HFFB 1FYTD 4S1DC 2IANB 1BZQK 2VO5A 5DFWH 4JDVA 2QADB 3SEPA 2Y6SC 1B4RA 1JGLH 2C1OA 2XQYG 4X6CA 5EU6E 1T3FA 3QT2A 5FUZH 4I0CC 3NN8A 4FZ8L 4G8GE 4LU5H 2NY6D 4WW2C 1EJOH 3MV7A 3W5MA 2GJ6D 2UVEA 5I1AA 1OSPH 1ZANL 3MV11 4NN6B 4R9HA 4U3CA 3S3JA 5HDLA 4Z6AT 1B4JL 1YMME 4ODTL 5HI5C 2NY0B 1Z3GL 1CLCA 3OB8A 3QHFL 1H3GA 4CNIA 3SKOB 3OSKA 1OAXL 4M8QB 1HEZA 1M7XA 5DI8B 4Y1AA 3WUWG 4EEEA 3BJ91 4N0CC 1NCCL 3JWDH 4CN4A 4Y4FD 4PRHD 2H45A 5DD3H 4JM2A 3DRTB 2O5YH 4TN9A 5DTFA 4JZOB 1YYLL 1QR1B 3OX8A 2B39A 2XTJD 3DVGB 4HV8A 4XP5H 5DK0A 4HIIB 5I8EA 2DQFA 3RL2B 1L7TH 4F7EB 3WO4C 5JW4M 1FNLA 1DBJL 4PJIB 4LFHG 3TNMA 4DKEH 3T3PF 2N7AA 5E6YA 1S9YB 2R4RH 2VKXA 1BFOB 4P9HL 4LHQB 2IBGA 5CBEA 4P4RB 3SE9H 1Y18A 3BDYH 3H0TB 3KXFA 5SWQA 5CGYD 1J0IA 4NRZB 4H26B 1ACYL 5AZEL 4OLEA 5T5FH 3IJSA 2DQFB 1A47A 1EMTH 4WCYH 1KEML 3MOBH 5FHBH 5JLZA 3LQAC 1INEH 1NMCB 3FL7A 3DVNB 1G9NL 4BKLA 3QUMB 5HGAA 3RAJL 3SQOL 2BNQB 5ID1A 1KOAA 1YECH 3D39D 4EOWH 1IEBB 2QSQA 4LIQE 1MCCA 1FL3A 2R39A 2H6PA 1GHFL 4FXKA 5HHOE 4WI8A 3G6JB 2BVPB 3C60D 3HC0B 3STLB 3GMPB 4A6YL 5GRJH 4ONHA 2G75A 1EHLH 3K8LA 1YY8A 3GSWA 1IGMH 3ZZ1A 1YUHA 3MRHB 1JPTL 5C0EA 3VA2C 3GGWB 5IW3A 4YAQB 3T08A 4NWTH 3MRDB 2Z0BA 1OCWH 2OMNA 4EIZC 3OXSB 3QRGL 5IFHH 1WFTA 3JZ7A 4LVNC 2AK1L 2P47B 1T21B 2DJSA 4XP1L 4X7SL 5CJOH 2D0FA 4NFBA 5D5MA 3K8MA 4GXVL 4UNUA 5DJ8A 5IQ7H 1GGYA 3U7AA 4M1DL 1F4HA 1X4YA 3DRTA 5I73C 3R4DA 4YHNB 2VSCA 3MLXL 5JXAH 2AERT 2BJMH 4YDKL 4G8FA 4ZAKA 5HYJE 1RZ7L 2YZ1A 3BXNB 3EYVB 3U30B 4XP4H 1Z9OA 5E5RB 3P40A 4F57L 5CD3B 1IGYB 4I5BA 3LHPL 4P2CG 1Z5LB 4OCYL 5K9QI 1UA6H 4ODVL 2OK0L 1DQJA 1OAUL 3CFKA 3QO0A 1CDBA 4HJ0C 4XNZC 4DOHB 1DVFC 3H9YA 3I75B 4JY5H 3ARDD 3IJHB 5ICZA 2KQNA 3QZWA 3QCVL 2WBKA 4B7IA 4PB0H 1XF3B 4YXKL 4FP8L 4K8RH 2H2PD 1BZ7A 3EBAA 4HLZG 2VAAA 1R0AL 1B6DA 1Q9LA 2GSIA 1JGEB 5F89A 4PJGB 4I1NB 1ZMYA 1NCWL 3MRFA 2A6DA 2XTJE 1U8KA 3NZHL 2GTWB 1ZT7B 2WK2A 2EDEA 1WWCA 3W39A 3VFTB 3S4SG 1I9RH 2FJHA 2ADJB 2NQCA 2Q8AH 4KHTL 1FSKB 4F37F 5ABDE 2ATKB 5JW4Q 3GM8A 4NWTL 3D87B 2IG2L 5L7XH 3H7BA 5IVZB 4KRPB 5D2NB 5I6XC 3U9UA 4D0BA 3HR5B 3BSZH 5C7XL 4N0UA 3SJVD 1A14H 3UJTH 4NGHH 2B0SL 3QXAA 1CWVA 5HHNA 1CGSH 4KROB 1Q1JH 4JFDA 2NXYB 2AJ3B 1VA9A 1PVHA 4FXLA 3O0RL 4L5FH 1KN2H 4P23A 3TN0A 1J87A 2GJJA 3AU1A 3O9WB 4O9HH 1GSMA 3GSVB 3QUMA 3ZTNL 3UZEA 4P9MH 3FRUB 2RAMA 1HH6B 3UX9B 3PHSA 3IU3A 2CIIB 4YUEH 2R56H 3F7PC 5I1JL 5LBSH 4ZS6C 3VMOA 1TDQA 3WJLC 3QQ9D 5DHVB 4XVJH 4KZEH 5IJKC 5E2WL 4JY4B 4PJFB 1PJ9A 3BZ4A 4MX7A 1OAYL 2QJDA 2N4IA 4LCCC 3JV5A 4HXAH 1OTTC 2VLKE 1G9MC 3EYQC 2AEIT 4QRQA 5DYOA 1LO0L 3PHOA 1YEIH 2JCCA 5EU3A 1G7HB 2ICWJ 3CK0H 1DDHA 2RCSH 3NCEB 2CR3A 4WWKA 2X1WL 2VDQH 2PXYD 4W81A 3FB5B 2ARWA 3C09B 3BW9B 4Z0BH 1AJ7H 2OR7A 2AXGA 4U6YA 3VWKA 1IGFL 4P5TA 3EO0A 4YBLB 3UMTA 3ZLQC 3BE1L 35C8L 2Y7QA 5E4EB 4FMFA 5C6TH 2I25N 2VWEE 4Z78B 5BVJB 1SVCP 3KXFD 4U7MA 3DX6B 1NCCH 2X70A 4JKMA 4XCEA 3DXAA 5GGSY 2EICA 3ZE2F 2GJZB 3F8UB 1HH9B 2IPKA 4JY6B 5F7MC 3MRQA 4MJ5B 2P7TA 1W72L 1QSEB 2VB5A 3JTTB 3PDDA 5BV7H 5GS3A 4YFLI 4QHLA 3QIWB 3MGTB 4E0RA 3GK8H 4O4YH 1KJMB 3PWPE 1GPOL 1RIUL 2FX7L 1MJUH 3QULB 4R7DA 1YMHA 2NNAB 5F97E 5CILL 1WZKA 4R0LB 4CADB 2JTDA 4HEME 3EJZD 4F7CA 1RMFH 5J13B 4JZNB 1BBDH 4Q74A 1KEMH 3MA7A 4YK4C 2R2CA 2FECL 4HAGA 3GMLA 4JAMB 1YEFL 2GI7A 4OM0H 4XXDB 3GIZL 3W0WD 2AQ2A 1QBLL 1JMXA 3QHZL 4Y2DD 5GS2H 2NZ9D 1MNUL 4P2RE 3U2SB 1U8HA 3SE4C 1EO7A 4NUGH 2EDWA 3MFGB 1GH7A 1KPRB 2BVUA 2AAVA 4KVNL 3VXSB 5JW5B 3MJ9A 1KG0A 2D4DA 2DMBA 2VWEC 2BVTA 2JKXA 1JN6B 1URLA 4OGAC 4I4WB 3VFMB 5GHWL 2HP4A 5SWSD 5ILTL 4JVPA 3DGCR 1N4XL 3BPOB 5BJTA 3P9MA 3WS3A 3T0XA 4W4NA 4DK6A 1RUAL 4EDXB 4UAOC 4ZDHA 4DCQA 4X80H 3K2UL 2AEWA 4OV5A 4S1RH 4YDVB 1A9BA 2YA2A 4EBQL 4KJWC 4K3EH 2HTLD 4OBRA 5GSRB 1A7OH 1QUNA 3DJ9A 1HE7A 4TSAL 1KIRB 1F97A 1FE8L 4PLKD 2EEBA 2LU4A 2PO6A 1BWWA 2FATH 1KTLB 5SX4I 5EC2B 2QR0B 1BAFH 5EN2B 1QSEE 1AHWA 5C2BH 3G5VB 4Y88A 4UB0H 1EX0A 2VABA 5D2NC 2ZUQB 5HHOA 5I6XB 3ARDA 2QQLH 4P5KA 4EKXA 4YDJA 4AM0A 4M4PA 5L2JA 5CCKH 3BN3B 1J18A 1CGWA 4RWYL 5GS0C 4HGMA 3HE6B 4HFWA 1DJSA 1NFDF 5F1SA 2OLDA 3S36H 4G8GA 4GSDH 1OGAA 3QUXC 4EI5D 5DJYA 3VXQB 3RWEA 4TVPH 2XWTB 5A2FA 3DGGB 5EA0H 1N6QH 2M8XA 3AROA 4X6DA 4QRPA 5GRUH 1JTTA 1HI6A 3LRSA 3PWLB 1CXEA 5IF0A 5FOJA 3T77A 2JJSC 1ONQB 1XGTB 3ZYIA 4OI7A 3IB4A 4TOYL 4F7PB 3P9LB 5HHXH 3D3VE 1VCAA 1DQDH 5E24E 1ZLVK 3RWEB 3DURB 3OKMA 4FQ2L 1EH9A 1J86A 2X6MA 4M62H 2K7PA 1UVQA 2JB5H 3QUZB 4GAGH 1QOKA 3HRZB 4YHML 4LPYA 3PIQB 4JFEA 2F19L 5C07A 4XPFL 5T5NG 3RTQC 4PRBB 1HSAB 3HMXH 1TLKA 5DS8A 1OP9A 1ZVSA 2CIIA 2EDJA 4JJ5A 3UTPD 2XNAB 3OKEB 2I27N 3EOTL 1C16A 1KXQE 3OAYH 3QAZC 3VMNA 3GB7B 4KK9D 4UV4H 5AZ2L 1K4DB 4OFYA 3SKJL 5DEZA 3GMNB 1SJEB 3Q1SL 1I85A 1G1YA 4JN1L 2R1YA 5ECJE 5T5NF 2APVA 2LABA 4HGWB 3CSBA 1FVCB 1TZGH 5IR1B 3MLTB 4ORZC 3QQ3A 1FNEB 2P42B 3CXDH 5HXMA 1CFSA 1M1SA 4QRRB 4V1DE 5AWNH 3SCMA 2GSGB 5DI8A 1NMCC 4PTUB 4F33A 1I8IB 4LDEB 4LIQH 3HG1D 1VFUA 4GW4B 4HX1B 3EO0B 1NEZB 4L9LC 3WFCL 4HFUH 5GGVY 3SKNB 5KW9L 2IH1A 4GS7B 4X98B 1RZKL 3GEWB 4TUKL 4X7DC 1UKTA 1X5GA 2CGRL 2FSEA 3VI3F 5IHUL 4FG6D 5GSVA 4AEFA 2DLTA 2HLAB 3B9KA 2DQUH 3RFZC 4JM4L 4UILH 3LN4B 4ZODA 4OB5L 1I7TA 1XGPA 4QHUA 1EERB 1ZHLA 1DQDL 1BREA 1QBAA 4F57H 5CINL 3DROB 2I60L 5AEAA 1NSNL 2DWDB 2VXSL 4NRZA 3H3KA 4Q0XH 4NDMA 3QULA 5HGBB 3RY4A 5EC2A 4QHLB 4EQ3A 3FB8B 3GIVB 4ZPVA 4GRLB 5INDA 1KLUB 3ARYA 1UEMA 3QIBD 2EDXA 3L3GA 3MRBA 5EULV 2KBGA 5J3HD 2D7TL 3FT3B 4GAYA 3TBTB 1KACB 5JR1L 2V5YA 1A02N 1RPQA 2OTWA 4LLDA 1JNHA 3DX6A 4NPYB 3T0EB 5E8OB 3MLVH 4OD3H 3OKDA 3GBNL 4HS8H 5JHDA 2Z92B 2NY7H 3MRPA 1JN6A 4ZAKC 4S0TD 2QTEA 3FFCD 3NA9L 3RVVC 2XXMB 4UINH 5LGHL 1LVEA 2V2WB 4L29B 3QJFB 3OPZH 35C8H 2BXZA 3MO1B 2W0KA 3GMRB 2BVQA 2C26A 4YGVB 4QXTA 1H9VA 4OLUH 3SGKC 3DHJA 1JV5B 3VXPB 4LOUD 5GGSB 3E6HA 1FNFA