2EXWD

Crystal structure of a ecclc-fab complex in the absence of bound ions
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwD01
1NGXA 3QFJE 5L2KE 3T65B 4XP9L 3F5WA 3B9KC 2XTJB 4Q2ZB 5DJZB 5EU3A 5HXMA 2A9MH 3DV4A 5DHYB 4CMMA 4ZUSB 1CL7I 3QB7C 4L3EB 4NZJA 3VD5A 1JGDA 2X44D 3MOBL 1RUAL 2D31A 3RA7L 1IKFL 2X1PA 1JYNA 4IRZH 4F7CB 3MRDB 2J3SA 4K9EL 3UMTA 4OZ4B 3KLHD 4HH8A 5DA4A 3DBXB 3C60A 1A6WH 3EO9H 4ZUVA 3MV7A 5F7WC 5DHVH 3ARFD 1LO2H 4NDMA 1IGYA 4PGCB 4X7SL 3DI3B 5GZNC 4JHWH 4ZAKD 4IIQA 3PG2A 3VGBA 2BK8A 4R96B 4R2GC 1CFTB 2V17L 2J6EA 4PJIF 4JKPL 1ZANH 4HIHB 5SV4A 1MCPL 3D0VB 2MHAB 4Q6IC 4TOYH 3H0TA 3RJQB 5LGJA 1U9KA 3V6BR 2I9TB 3DMMA 2OP4L 3VFWB 3IDUA 1GGBH 1TIUA 3N1PC 4X6BB 1KTLA 1XIWB 3S3SA 3DV6B 4TTDD 2H8PA 4JFFE 1UA6L 2A73B 4JLRB 1U2HA 2PO6C 4OLEA 4OM0L 3S98A 4O9HH 12E8L 2P5WA 2VZOA 1ORSB 5TH2A 2E6PA 5ANMB 2A6IA 2QSTA 5GRVK 1AD9B 4Q2ZA 4P99A 5D5MF 4K8RC 2MMXA 5HJ3B 1F4YH 2XPGB 4FQIH 4L3EA 1DN2A 3RTQC 2DD8H 1AQDB 4HIXL 5BVJB 3FN0H 3GZKA 2X4SA 1G7LB 3W11D 5AD0B 4QXTB 2F53A 4O4YH 5JO5B 4F8TA 3ZKMD 4RMSA 2VLJB 1H3TA 3C6LA 4KXZH 3MRDA 4PJEA 2VL5B 3ULUE 5IBLD 4LIQH 3QEHB 2XKSA 4AM0A 5D2LB 3BFOA 4EN3D 3QCUH 5LWYH 4LLDB 5A3ID 4WCYH 1U6AH 4PV8B 1CXIA 2ADIB 5C07A 1K2DB 1BBJA 2VITA 2DJSA 1TNNA 4K2UH 1Y6KR 5ACLA 3FQNA 1PX3A 1ODAA 3Q1SH 3D0VA 1KCRH 3EJJX 3KJ6L 4MAUL 3F65A 3VFWA 1TQBB 5F6IB 3C5ZB 4OAWB 4Q9RL 1QHPA 3A6CL 2B5IC 1UZ8B 2VC2H 3FKUS 1XIWA 4BKLB 1ZT4A 5I8EA 4JCMA 3VXRB 5EUKB 3KLHC 2A73A 4JLRA 1AY1H 2XXCB 2VDKL 1F3JB 1G9EA 2DMBA 1ORSA 1UM6L 3BHBB 1L0YA 3OBAA 5DMIH 2AJZA 1PSKH 1MSPA 1A6TB 1GZQA 2Q6WB 1CZ8L 2BNRA 3T04D 3OJ2C 2GHWB 3EHBC 4P9HH 3U0WH 4UT6L 15C8H 4N0RA 3NIGE 1T0NA 5I6XC 2GUOB 5B21A 2WINB 5FYKH 5BVJA 2UUDK 1BF2A 1G7LA 5AD0A 2ZSWA 4QXTA 1JN6A 5J6GA 4M5ZL 4UTAH 3MCLH 4GQ9H 4KRNA 4TTDC 1KELL 3VI4E 3QEHA 3HFMH 2FIRT 3MACH 4G5ZH 1YQ2A 5D2LA 3GMOB 2F15A 6CGTA 3PHOA 4WWKB 4CMHC 4PV8A 2ADIA 1N0XL 2FX9H 1NPUA 4OZHF 1K2DA 2IPTH 1DBAL 2M26A 5D6DC 4UOW0 1F6LL 3EBAA 4K55A 5HI5D 4HV8B 1KCUL 1ERNA 4YX2H 5GXBB 4IMKC 4TULL 4G8IB 1JPSL 2DOCA 1Z0NA 3NAAL 3TGXA 3BUTA 4XNYL 3D5OF 1NCBH 1FBIL 3ZKMC 3C5ZA 4OAWA 3VGHA 4FQ1H 2G60H 2NY6B 3BPOC 4NQEA 4JANB 4Z78B 3GI9L 3MROA 5C0EB 3PGDB 1F3JA 5JQ6L 1GOHA 1UKSA 1DQLH 1B6UA 1XF1A 3RAJL 2VLRB 5E7FA 4CVXA 5DT1L 4ODVH 5I1DB 3X17A 5K9QG 5I74B 1A6TA 2W07A 5J57B 1YDPA 3NABL 3UYPA 1CK0L 3FRPA 3MO1A 4AEFA 4PJ8D 4ETYA 4K07A 2NY4C 2ZPKH 1W8OA 3TNNB 2IQ9L 3VXUE 3MBEA 2E3VA 3CZFB 2GUOA 3I6LD 3MNZA 4GUPA 5ERWA 1S7RA 1T1ZA 1E4KC 1A3RL 4M43L 4UT9L 1JJUA 5C92A 1S9XA 1PQZB 1FZMA 4I9WE 1MJ7H 2A77H 2E7MA 2ZZUT 3B6SA 1ZA6B 2BX5A 3F58L 1FJ1B 1G7MA 3GIVB 1K6QH 5DMKA 3V8OA 2VAJA 1L7TH 5KVEL 5DUPH 3QUZC 4WWKA 2Y9RT 4LAQL 5E5UB 5MENE 4OGYL 1LO4L 2DQCH 1U3YA 3T1WA 4WV1C 4HV8A 2PXYD 2D7NA 1F5WA 1JZ6A 4I1NB 4DEPB 4KV5F 4G6KL 1GYAA 4YHKL 3ARZA 3BEWB 4G8IA 2RHEA 4PRPB 4WUUB 3RI5K 5LVEA 5IWLA 1N4XL 1OGAB 1VADA 3MMEB 4ZOBA 3X13A 1S5IL 4N0YL 5LBSH 2HFTA 1U8NB 3CX5K 3LS4H 2R0ZL 4S1DD 2VXUL 3LY6A 4X7FC 4JANA 5FYKD 3BW9B 3ULVL 5C0EA 3PGDA 4FQHB 3DXAE 4WTZG 5TF0A 4WTWA 3B2VH 1Q72L 1YYLH 4DCQB 5IQ7H 1VGEL 1WZKA 3QDGD 3KPOB 3SDDC 5C0ND 1E4XL 4OKDA 5DC4B 2N7AA 5HGDB 3H9SE 3MLXH 5CJXA 1QKZH 3TNNA 1QNZL 5DD1L 3KPRE 1R0AH 1LP9F 2COQA 1T2XA 3TBWA 5A43C 3V6ZB 2QR0B 1OTUD 3ZT6A 1FYHB 3WEXA 2YD4A 5D7KE 1JWUB 3HAEH 1ES0A 4F8QA 1TXKA 1NUDA 2VE6A 3QUYA 3LKQB 1T1XA 2QQNH 4WUKH 5EU7C 1SBSL 1Y18A 1MHPH 1XCTB 1J0HA 1WTGT 1ZA6A 1FJ1A 5ICYA 3GIVA 4C55A 4YFLI 5IW1B 4OKVA 3RQ3A 5TQ0L 1RZIA 1EFXB 5FHBL 1YEJL 1RV6X 4QCIB 4PB9L 5CMAB 5HDBE 3RL1A 3E8UH 1JV5A 5CCKH 4P2QA 3CH1B 1G6RH 3QRFM 4JPIB 1U8KA 3MFFA 3QBTB 4WUUA 4MX7B 1KLUB 1OGAA 4GRMB 4KK6C 4Y0GA 4F9PC 1UCBH 1CFBA 4XPGH 1N59A 1MY7A 5IESL 1U8NA 1KIQB 4OCRH 3VWKD 1ETZA 4GQPH 2FBOJ 5D7JD 4DGVL 2MQ3A 4C83A 2YD1A 1FDLH 3NCEB 2OCFD 4NQDA 4ORGA 1EGJH 4YZFE 3WL9B 3MRPB 2FD6H 3OMZA 2OR8A 2OQJB 3JUYA 3STZB 1AHWA 1UQSB 4GBXA 3QO1A 4HHAB 1XZ0B 1RJYA 2PXYC 4ZUWB 3QWRD 3UTPD 3EFDL 3BESR 3ZSTA 2QQKH 4ZFFB 2EECA 3KLAA 4H5SB 4JHAL 3H7LA 4NJAH 4R3SB 2AXJA 4QRRB 4XB7A 1KN2H 3FRPG 1BQHG 3VXOB 4N90E 4F7EB 3P9MB 1XCTA 3BGFC 3S9DB 4KTEH 4WEBH 4I3RL 1EFXA 4N0UE 3MV8E 3SQBA 1BJ8A 1CLYL 1A7RL 3ZYZA 5DHXB 4HGWB 3VXTB 5E6IA 4PJHF 5TQ2L 3CH1A 3IFPA 5DQ9B 3VGGA 1OTUC 2P45B 3BZEB 2Q3AA 3MGAA 3IDGB 2AKRB 3W0WE 3QG6A 4EDWL 4JM2A 1CQKA 1S5HB 4I5BB 3UPRA 1D5ZB 3QZWB 4XCNA 2ZCHH 1JYWA 4OFDA 1NDGB 3TIDA 2XZAH 4FTVE 5GJTH 3WL9A 4ENEC 1OQOA 3LKNB 1J1PL 1JGLL 3MRPA 4M93C 3GSNL 3STZA 1TJGH 4OZGB 4JR9H 4NNPH 5FK9A 2AAVA 4PJ7B 4HHAA 1XZ0A 4D2NA 1CE1L 5ADPL 1JTTA 1SJVA 5B22A 1A6VL 2DQTL 4KMQA 2N7BA 4G8EB 1JNNL 1BVLB 2CR3A 2N4IA 4C57C 2H1PL 1OARH 2JJUA 3EJYD 4ZS7H 1I1AB 4R3SA 4NBZB 2HFFB 1CICB 4QRRA 3ARYA 4DN3L 3TVMB 3VWKC 5HYFA 1BVKB 3VXOA 2CLVB 2NY2B 2NXYB 2ZUWA 3EO0B 4ODUB 4MA8H 1AE6L 4L9LA 4PRHE 1HXYB 4H26A 3D2UD 4OLWH 3QPXH 4FQPA 5LKNA 2QLVB 3L5XL 3FOMB 1Q9WA 4JY5H 3QEUA 1WITA 2M1KA 4HFUH 4LCWB 2BSSB 1D7FA 5F8RC 3BZEA 2BP3A 2WNGA 4QOKE 1MJJA 4U33A 5EU6A 3FRUA 3QIBC 4L5FL 4K7FB 5E03A 4RMTA 2ZG2A 1VKXB 1WF5A 1PEZA 1S5HA 3VFRB 1RK0A 1RULH 5F3BB 5KW9L 3OPZH 3QZWA 4OLXL 1NDGA 3HS0B 4JRXE 5TE6L 1FFNA 5CZVL 3U79A 1QLFA 5DUML 4I2XB 3EIFA 2CRYA 4I77H 5AEAA 2BOCA 4I0PD 2AJYH 4ZD3L 1QEWB 5E00A 3U4BL 1X5YA 2Z92B 4NQUA 4YBQC 5C0JA 4OFYD 2HTLD 3S4SA 4XPBL 1BVLA 4Z7VF 2YEZB 3QQ3A 1I1AA 1GGCH 3HHRB 3QPQD 2MKLC 1XFPA 1CICA 2QQLH 4ZMAT 4ZOEA 1MJUL 4I3SL 1TTGA 3RZCB 3GIZL 4Y1AE 2IG2L 1CE6A 1CGYA 3QIWB 2GK0B 5FXCH 2HVJB 2YRZA 1YY9C 5D7IB 1CL7L 5SWSB 1EO8H 3P4MB 3T3ME 4ODUA 4I4WB 2FYYA 5CP3H 2FBJL 4XPTL 5GGSY 5EBMA 5M7QA 1A7OH 3K8KA 4AYFA 1ZHNB 3C8DA 2FECI 4JY4B 4RDQF 2D4DA 3THML 2CKBH 2DB8A 3LKRB 5F8QC 4CU7A 2BSSA 4LHUD 1CI5A 2WBKA 2YRLA 3NPSB 2RQ8A 1I9JL 1KJVB 1NAKH 3TV3H 4M7LL 1KV3A 4ISVB 3VFRA 5AG9A 2PTVA 1N64H 1RD6A 1NFDF 1ZLWK 4LBEA 1ZT1B 5E1HB 35C8H 5BV7L 5CEXB 3NA9H 1C12B 4I2XA 1HI6A 2WUCL 4GRLA 4YHNA 2D9QB 5ENWB 1FRGL 4WEUD 4UB0H 1H3WM 1QEWA 3RVTC 1H3UA 3G9AB 3GSUA 1BX2A 3GSNB 4AEHL 4HXAL 4BFGA 1RU9L 4JGUA 3NH7L 1CXKA 3U7YH 4PJ9D 3TJEH 5E9DD 2KPNA 4YO0A 1AR2A 1S9YB 2DYPD 1HQ4B 3MODH 2NY5H 3JWOC 2JCCB 5EDXA 2ZCLL 3K1KC 3TCXA 3RZCA 3AB0B 4CADB 1FVEB 1MREL 3QDMD 5D1XA 3QIWA 2GK0A 3C87A 5GGUB 4ZFZA 1QFHA 3B9DA 4OM1L 5D7IA 3QSKB 3P4MA 4EZMA 4W81A 4KRPD 5DVLA 4MJIB 5EU5B 5HYJD 5E0QA 3O3BA 3ZDZF 1R6VA 3BZDA 2FDBP 5E8EA 2YD7A 5F1NB 4M62H 3LKRA 5C0RL 5HHOD 3Q2CA 4KU1A 4NBXB 1MFEH 3ECBB 4G7YL 2CRIA 1IEBA 1RZJL 4G7VL 3QPQC 2Z4QB 2XA8H 3MNWB 4TVSa 1I8LC 1IGMH 4UUJA 5I1CH 2X4OA 4ISVA 1YN7B 2AJXL 5KN5B 3BP5A 1G7QB 1Q94B 5EU7E 4MQXD 3VRJA 4LLMA 5IM7A 4PG2C 3FT4B 1C12A 3Q6GH 2PKDA 2XWBB 2F5AH 5ENWA 1GRWA 4X98B 4ZUUB 5BCAA 1EPFA 2HKFH 4F33B 4M6MH 2EIBA 1AJ7L 7CGTA 5CWSB 1LK3L 3BPCB 4LIQE 1Y0LA 3MXWL 3ZTNL 1PG7H 2XRAH 4C56D 5GZOC 43CAA 1H3XA 5DWUH 1UZ6F 3G6JA 1S9YA 3VFVB 5IFJA 1F8TL 4P23B 5EH1A 2YOCA 1FYTD 1P7QA 4MNGB 5I1AB 1EHLL 5FM8A 2WQRA 3ZE2E 2R8SL 3GMPB 1LVEA 2JJWA 5HGAA 5D1ZB 3S4SG 5GGUA 3KXFA 5CILL 2J8HA 3FQXB 4RMRA 4N5UA 4NP4L 4MJIA 1K5NB 4KPHH 5EU5A 2ZP0T 4NCC2 3TT1L 3Q5OA 5IB4A 1WAAF 4K3GA 1NCAH 5F1NA 3P40A 3PP4H 1DBMH 2IH3A 1A6AA 4WRLA 3PHQB 4PJ9C 2DQJH 4GW1B 4ODHL 4C54A 5JXED 3D3VE 3MNWA 4J4PC 4PGZA 2W0PA 4P2RD 1YN7A 2O61A 4HWBH 1QSEB 5IMOB 3X11B 5KN5A 4YXHL 5E1AA 1Q94A 3QRGL 4P5TD 4PRIB 3I75B 5DQDL 2W9LA 1KN4H 1RZFL 5GGSA 1MFAL 4HUNB 3AFLA 3TH4T 2NY7H 2XWBA 3PGFL 5FYKE 4KRPC 4X98A 1S9WA 2NCMA 5DQJB 4F33A 3MREA 5I18H 1GC1H 5E99L 1JCKA 1TETL 5CWSA 4N0FB 4HWNA 3TBVB 5I8KL 4PJAB 1ZT7B 1A02N 4OV5A 2PUQT 2BZDA 4ELKB 3SCMC 5GJSL 4Y4FC 3L3DB 4X6CE 2QSVA 3VFVA 1KC5H 5BO1L 5KAQF 3IXAB 3TT3H 4LDOB 2YPLA 4L8BA 1HXMB 4WFGD 2OL3L 1J05A 3BWUC 5I1AA 3LQZB 2Y23A 3GMPA 3IDYC 5D1ZA 5D8JH 5IEHB 3MLPA 1HILA 2I24N 3TO4B 3D48R 3ORJA 5IVXA 3FQXA 3QXAB 3MRGB 4FQ2L 1FLRH 3BPNB 5J56B 2EYRB 4NRZB 4JPKH 1T7XA 3HNTL 2FCBA 4KQ3L 1WK0A 1T1WA 3T0VA 3VH8G 3OJDA 1CDHA 5FIEA 2DLFL 5MI0C 5I17B 1DN0B 4HXBH 3LS5H 3PHQA 1AO7D 3BPLB 4GW1A 4NNXB 4YXLH 3SGDI 4RFOH 4XT1C 4AMKL 3VXNB 3VXQB 1OT1A 2BVQB 5E2WH 4YUEL 4L9DA 2V5TA 1RIUH 2R2BA 4PRIA 3UYRH 4PJXB 5MEQB 4XWOD 3KPLB 3VXSA 1OSZB 4JB9H 2DDQH 3T2OA 1QSZA 4LCUB 2EDYA 5B3JE 5I9QB 1UWXK 1KB9K 1VERA 1CCZA 5IT2L 1SMAA 5CINL 5F1SA 4YHML 3WE6A 3RL2B 5TGBB 4ZODA 1FVDA 2IANE 4LNRB 2IFGA 5ISZE 2J6EH 4ELKA 3UP1A 4J2XA 1KJMB 3UTPE 1UH2A 1FLTX 1I1FB 4ONFH 1NFIA 1PLGH 3DHMA 4KJYB 4HLZH 1MRDH 3HC3H 3U6RB 4BFIB 4DGYH 3LQZA 1IAOB 2DQFA 2X4TA 5DF0A 3VRLE 3GBNH 3BYYA 4Y19D 3ZKSD 1GHFL 4BQ9A 5EOCH 3QXAA 3MRGA 4QEGA 1J18A 3LN4B 4BSVB 4JFDB 3C2AH 4PJIA 3BRGC 1IT9H 2EYRA 4LDLB 1IC5H 1Q1JH 4FFYL 3RHWK 3DLQR 1YPZE 1RIVH 2Q87A 1E4JA 4DTGL 5E8NA 3IFLH 3MGTB 5GHWL 1B0RA 3RBGA 1RMFH 2BNUB 5EZIL 4R7DB 4GO6B 3SKJH 4NNXA 5E08L 3SDXE 1ITBB 5INDB 4HMCA 2YA1A 4XTRD 4UILH 3KJ4B 5FF6B 4BZYA 3DRTB 5AYUL 4LASH 5C0FB 3IU4H 4PJXA 4YE4L 5MEQA 4HMEA 5F9DC 3BGMB 1OSZA 3D39D 5FDWB 5CHNB 5D5MA 5C7XL 1NMAL 1ORQB 4LCUA 1J5OH 1CU4H 2H6PA 3GHBH 3RHWF 4MDJB 2Y06L 4XHQA 3PWUA 4I13B 3LSOB 2W60B 4JFXB 1I8IA 1OPGL 3T2PA 1EEYB 3FO0H 3RL2A 4EI5D 4NIKB 1M7IB 3QXVA 3E6HB 3PDOB 4JQVA 5IFHH 3KAAA 3AVEA 4YBLC 4LMQE 3SDYH 4ZSOB 3D85A 1I1FA 1I3GH 4Z7NF 2D2OA 3CVHL 1ZGLA 1Q0YL 3CMOL 4BFIA 5CD5D 1IAOA 4QF1B 3QH3B 4Y5XB 2LTQC 4L8CB 3IDIA 1DBKH 3GKWL 4TQEH 3S3JA 4G8GB 4IHOA 3CDGB 1J8HE 4JFDA 2OL3B 3RY6C 3TESA 1FL3B 4PGDB 3FOLA 4X6FB 2D0HA 1JIBA 2Z35B 4KHXH 4KZDL 4PJBB 3BKYH 5IF0A 3S36X 4RAVA 2VZ1A 3MRBB 2BNUA 2YZ1A 1ZVSB 1QRNA 1JYXA 1EO5A 1FNHA 5FO8B 3VD3A 5I0DA 1R3LB 1CDCA 5FF6A 4V1DA 3JV6B 3QDJA 4PLOB 3BGMA 1YEDB 1URLA 1ORQA 5D71L 3DMMD 4IRSD 3O3UN 4IOIB 2OLDA 4MDJA 5BRZA 2X42A 3NIFF 3EYQD 1MELA 4OCYH 1P9MA 5HDQH 4WW1B 3LSOA 4WY7L 4JFXA 1LO0H 2OZ4H 3OF6A 3RVUC 2P5WD 4Y89A 3TFKD 1NGPL 3EYVB 1M7IA 4HKXB 3E6HA 1FFOB 1AGCB 5ILTL 1GC1C 2FB4H 2Y5TB 2DIJA 4ZSOA 3G6AB 3MJGX 3I2CL 1DQJA 2CD0A 4NO2B 1TPXB 1FG9C 1IEAA 4L3ED 3CMGA 4LVNB 1WUNT 4R9HA 1NEUA 2MWCA 3HUJB 3PWNB 5D7LB 4G8GA 4XVTL 3FB6A 3CDGA 4K3DH 1RVFH 1XGTB 5KSBE 4HAFA 2BHUA 1I1RA 1NCTA 3SO5A 4IRJC 1F4WH 2VXVH 1WT5C 4LVEA 3P30H 4X6FA 4DN4L 4EI5C 1OWRM 2Z35A 1G7PB 2B0SH 5BQ7B 2FZ3B 1J1XL 4PJBA 5F96L 3WKML 4GG6E 1LDPL 2JB6A 4RMQA 4U1JB 3REVB 1LEIA 3S6CA 1ZVSA 2V7NB 2LAGB 2A83B 3LKPB 4JHZA 4WW2B 5JDJA 5HYQA 1R3LA 2AABH 3T1FB 1BMGA 2OI9C 1RIHL 3K4AA 4P48A 1S7UA 5BVPL 4HK0A 5E2VH 1NBYA 3BQUB 3MOBH 3BP6A 3H7BB 2QADC 4WI6A 4YHZH 1XIWD 1TMCB 4BUHA 4MS8D 3HR5B 3C60C 4NO0B 4J3UA 5EUOE 2DRUA 4MD4B 5E8PA 2EXWD 3FAWA 5HHQB 2VDPL 5F7DA 1FFOA 1AGCA 4IIQC 2H2PC 5GGRY 2O93L 1PAMA 4CDHA 3UEZA 2Y5TA 3N06B 3MOAH 2CUHA 5ICXB 2WWKO 4XBPB 3F8UB 4XNQB 1AI1H 4FQJL 5E9DE 2FGWL 2B1HL 3HI6L 3HUJA 5ID1A 2AXHA 4N5ED 5D7LA 4HG4K 1MF2L 2P4AB 1D5XB 4FNLL 3CVHB 5IB5A 2QQQA 3PE9A 3QCVH 2BFVH 2ICEB 2P24B 5KG9B 3QDME 2Y25A 4P2OB 1EHNA 4YPGB 1PDKA 3MRQB 4MCZA 4OM0H 3RWIB 1G7PA 12E8H 1XMWA 1YEGL 2BNQE 2P7TA 3LEXB 1RUMH 1O0VA 4U05A 4OFKA 4H0GA 1SEQL 2F8VA 2V7NA 5HPMA 3LKPA 4OF8A 4WW2A 4XXCA 3MRJA 3HG1E 5HHOE 1XR9B 2OJZL 4ZOCA 2RGSA 3FONB 4DKFH 4HIXH 4P59L 3SKUD 4NQCB 1OHQA 1P2CA 2FECL 5IQ9A 2YUXA 3C5ZD 3RVXC 3BKCH 2DQHL 2OTWA 3C6LC 1II4E 1FL6B 2JK5A 5CJ5A 5DLML 1QHOA 1P84K 3FCTB 5DK3A 5IK3B 2QHRH 2W0KA 4TVPH 4MD4A 4JN2B 4OIAA 1KENH 4AENB 5HHQA 4S0SD 4M7JH 3HC0B 1T66C 3L3HA 4NZDA 1ZMYA 3MRLB 3EYFB 4MAYB 2AEWA 3B5HA 2A9NL 4KQ4L 2EE2A 4C56E 4XNQA 2ZCKL 3L3IB 1JHKL 2ZSVB 5I30L 1S7WA 3CLEH 4OZIF 4L3CA 4YBHA 5B38B 4J3OC 1NSNL 5FKPB 4WU7B 2DMKA 2DLTA 1ZLWH 1DBJL 3NGBB 2ICEA 4G80B 5KG9A 5DK0A 2X10A 4YPGA 1I9RL 4Z0XB 4LPUA 3RUGE 1G9MH 3MRQA 4XP1L 1BD2E 2EDNA 4PD4K 5GGRB 2R39A 5EPMB 4X80L 2EXWC 2D03H 4MHHG 1ITCA 4LSVH 3LEXA 2IFFL 4WWKD 5GSVB 1MLBA 2FX8L 4HPYH 3CIQA 4MGXA 4JPWL 4N9GB 3FO9B 4JFZH 3QWQB 1X7QA 3UJJL 3C8HA 4UT6H 3FONA 3CFCL 4XBEL 4WDIB 1PYWA 4NQCA 5I1HL 1FZJA 5E5MB 3VA2C 1MOEA 4MD0B 4P2RE 3LKSB 4M5ZH 2NY6D 3V6OA 4PTTA 2Z31A 3DGGA 5F9OH 1H5BA 4OFVA 4QHMA 5IK3A 1N7ML 1U3HC 5F9AC 3O81A 3LEYL 3ULUL 1BQUA 2YPKB 1YC7A 1TZGL 2VLRD 3JV5A 3NA4A 3ARDC 3NCBB 3MRLA 3EYFA 2HP4A 3RY5A 1JPTH 1NGYA 2EH8L 1TTFA 5HHXL 4R97C 1JFQL 1FAKT 2VXQH 1QUNA 4PRDB 3WFBL 3HZKB 4NQVB 2ZSVA 3LZFH 2RCSH 4OV6F 5B38A 4TULH 5FKPA 3O4LB 4WU7A 3QUXC 1I9EA 2YN3A 3VJ6A 1DLFL 3L95A 5F6IC 3C5ZC 3GBML 4HIJA 4PJHA 4KXZI 4B50A 1BZ9B 3O2WL 4L8DB 3V52L 5TE7L 2BSRB 4Z0XA 1MIMH 4U6TA 5GGRA 3OAZK 4CU8A 5FOBB 5IVOA 2ICWJ 1D5BB 1DANT 1N6UA 5K33A 5GSVA 3RAJH 3TBTB 1SHMA 2BVPB 3C5SB 1TJHH 4PJGE 2NZ9D 4LSUH 4OBRA 5IGXL 3WJJA 4TVPD 2O5XL 4PGBB 1CK0H 3M45A 4ZUTA 4JHBA 5FOJA 5LAXB 3GI8L 1KIRB 2E8YA 4MWFB 4RFEB 4L4VB 4P2QD 3B4NA 2CO6B 3MBEC 4LP4A 2IQ9H 4ONHA 4PRPD 4KK5D 4WUUD 1Z5LA 5L2KB 5EBGA 1OGAD 1X5IA 3CVIH 1IGFL 4OD3L 4MD0A 2IMNA 3CFKB 3QQ9D 1YNKL 3LKSA 4APQB 2A0LD 4NKIH 5AWNL 3S37X 3ZHLA 2B4CC 3VXPB 1FGNH 4RAUB 2VKWA 1T83A 1GSMA 1WZLA 3HI1B 3ALXA 4AH2B 4G6ML 3B2UC 4HW6A 4NQDD 3IYLW 2IJ0C 3V6FA 1WBXA 1MRFH 4WWKC 5KVEH 3EKCA 2UWEE 4HC1L 2PN5A 4GOSA 1K8IB 4D3CL 5DR5H 3O2DL 1LO4H 2DQDH 4XPHL 8CGTA 3OKLB 1C08B 2DQEH 2IQAA 3IDNA 3L9RA 3HZKA 3MC0A 4MD5B 5KSUB 2IAMB 4NM8L 4NQVA 1EERB 4YHKH 3QA3A 3RX8A 5MHSE 3O4LA 1VGKB 4Y5VC 5IWLC 2G2RA 3WIFB 3KS0J 1N4XH 1BAFL 1NDMA 3ARBA 5IP4A 4N0YH 4XNZB 4M7ZC 1QVOB 4K7PL 2BSRA 1ZS8B 4Y2OA 4ZFGL 3X3FL 1UXWA 3P11H 2EDEA 2LABA 2VDNL 2MFNA 1BEYL 1D5BA 2GJZA 2NXZB 2Q8BL 4WO4B 2F19H 1F90L 1EFXD 1Z0MA 2BVPA 3C5SA 1K9TA 1SY6A 1JGUL 4PJCE 4BQ8A 5AZEL 4IS6A 4OGXL 4R7NB 1M6OA 5HHPB 5CJXC 3W9EB 4JFFB 4L4VA 5E6ID 2WWMD 3EOYG 5DD1H 1FSKB 2HT3D 2V7HB 3BXNB 4WIQA 4EXKA 4RFNC 2NR6C 3IVKA 4H8WL 3KYOB 3TZVA 2FATL 4NHCL 3QUYC 1X6NA 4AZ8A 3CFKA 4Z77B 5C70A 4BQBA 3TBYA 3WXWH 2SEBB 5D96C 4U1SA 4JM2D 2FSEB 1WWWX 5HI3C 1JUFA 3VRIB 1IQDA 2UZXB 3HI1A 4AH2A 4Z7VA 1Q9KA 2X7LB 1OP9A 1S7XA 2C3XA 4FQXA 3O6LL 3GSWA 1NBVL 2EYTA 5TQ0H 1SJEB 2XQBL 3DECA 1K8IA 1AP2A 1NQBA 1YEJH 4W6XB 5BXFB 4HJ0D 3OKLA 4Q6YA 5KSUA 4MD5A 1UADC 3E3QC 4DEPC 3W5NA 2V2WB 2IAMA 4KI5C 1UXSB 1ZTXL 2H2SC 5FHAL 1CLCA 3PXHA 1IC1A 1KTDB 1VGKA 3FTGB 3B5GA 1MCSA 3WIFA 4HBCH 3O6ML 4YJZL 4S2SB 2P8PB 3S5LA 4QRRD 2A0LC 3ZDYF 25C8L 3CH8A 3KPQA 4KY1L 1ZS8A 1UWXH 3EYSH 1CFSB 4P9ML 3HMWL 4IOFD 3FB8A 3UZEA 4GXVH 3MV9A 3F7RA 1AHWC 3RWDB 4GBXC 3MV7E 1NCNA 2CXKA 4UIMB 4AIXA 5HHPA 5DEFB 4GMSL 2X70B 5HPOA 1AD0A 4P46B 1VFAA 4QXGL 1IZJA 3LB6D 4OF5A 3GSVA 1X44A 3VFTB 4E5XA 5EU6D 4U1HA 1U3ZA 4Z77A 1F4XH 4R4ND 5L6YH 3ARGC 3LN9A 3VG9C 4HD9A 2BMKB 2X7LA 4ODXB 1FH5L 4IJ3C 3LMJL 4M48L 4S1QL 4TYUA 5C3LD 3S3PA 5I15L 4Z5RB 2JF1A 3EGSA 4ZFOB 5K9KA 3QQNA 2YSSB 4I3RH 1SJEA 3ULVD 5DJ6A 5BXFA 1EEQA 2P5WE 1A7RH 5E6IC 3CSYA 5EA0H 2OK0L 4MXQC 4M5YL 1OD7A 2VDQH 5JTWA 5BW7C 1I1AD 1T0MB 2VB5A 2P8PA 1MEXH 5DK2A 1CICD 4FXKA 3BUYB 3EOAA 3G04B 1J87A 4LSTL 4JM2C 3TVMD 5J6HB 1BP3B 1A7QH 3RGVA 2NY2D 2F53E 4WI9A 3LDBC 2NXYD 3CSBA 3KHOA 3O41B 2B7DT 4PJEE 2Q7YA 4Y4HB 4ZOAA 4LMQI 1J1PH 2XZCL 3NCMA 4ZO8A 2HVKB 2Q76B 3RWDA 1ULVA 3CNKA 1CG9B 2LU4A 1PKQA 2ZUQB 1J1OL 3WFEH 4UIMA 5DEFA 2EDXA 1A64A 4KMLB 1DR9A 2X70A 4BFEA 4N8VA 2M2DA 3EJZC 5C07E 4F15C 1NMBH 1OSPH 4G9FB 4LCWD 3DOSA 1JNNH 2VZUA 3G08B 3UJIL 1BF8A 5T1DL 1FIGL 4J23A 1OCWL 3L3JB 4NCDA 1T7YA 4JO4L 1J0KA 4DN3H 3KYAA 2EDHA 4ODXA 3VXUB 5BOZG 2MQCA 4Z5RA 3MJ9A 4IOFC 4ZFOA 1YEIL 4NC2B 5I75B 1P5UA 4UIKH 1T2QL 3L5HA 4L9LC 3NVQA 1AE6H 4JO3L 3DX6B 5FM4A 3QO0A 3BE1L 2X9YA 2XA3A 4JDTH 3QDHA 4QY8B 3IDJA 5DEGB 5SX5H 1QA9B 1U93B 2BNRE 5FUOL 1NKOA 2ADGB 1QLRB 3O2DA 4L4TA 4QXUH 4JG0L 3WUZA 3R1GL 3TP4A 4K8RL 3G04A 3GJEB 1WAAA 4HGMA 4L5FH 4NWTL 2DAVA 2F5BL 3RZCD 3VFUB 2AGJL 2L0DA 3BKMH 3IKCB 4KRLB 4ALAL 3IDXL 2WBWB 3WNLA 5AUMB 1WCBA 4Y4KA 4EDXB 4XHJC 1T4KB 1BREA 5D1XD 3QIWD 2X4UB 2XNAA 3PWPE 3O41A 5TE6H 2ITCB 3O8XA 5SWSD 4P4KB 2VXTL 3WHXB 1CG9A 1VENA 4JFPB 3O3DB 5DGQA 3SQOH 1P7KB 1EHXA 4RDQG 3DXAB 4G9FA 2IPKB 4FZ8L 5ID0A 1OM3H 4U6YB 4BJLA 1DL7L 1N5YL 1CICC 1MFNA 5E2UL 1RJLB 3R06A 5IMLB 3H9SB 4I3SH 4U1NB 4DZBB 4KTYA 3KPRB 3GIZH 2IG2H 2R69H 1UACL 2DQUL 2V2XB 3VXUA 5JNYB 3IJSB 2ITDA 4NQEE 4K3JL 1FIEA 4QYOA 3G5YB 3MSPA 1CL7H 3Q3GB 2R1XB 2ADFL 3DX6A 2FBJH 4RIRA 4DZ8B 5F3HB 4X4ZA 4QY8A 4BZ2L 4WFFD 3THMH 1QA9A 5I16A 4R4FL 3WDJA 4CNIB 1YNLH 1R3IH 1HOCA 1V7ML 1I9JH 3QIUA 4LFHG 3HE6A 4HF5L 4DQOH 4XNMB 3WS3B 3IKCA 3DX8B 4M7LH 3RKDC 5AUMA 4EDXA 2OMBA 3B9KB 4OQTA 2C1OB 2ITCA 3B9VA 4GRLC 4P4KA 4Z95H 4NKMB 5HHNA 3WHXA 1DE4B 4FOMA 4MJID 4X4MA 4XNXL 1EO7A 4I18C 3O3DA 4X99A 1S7QB 4JQXC 1C5BL 5T1MB 1ZVHA 3QISA 3CGTA 1AXSB 3QJHB 3FFCA 2CIKB 4U4BA 2E7LC 4AEHH 4QRPA 3NH7H 2MQ0A 3N9GH 3QHTC 4X9FA 1QBLH 3QULA 3I6KA 4U1NA 4GFTB 1W8NA 4P3WA 1RK1B 2FNBA 3HI5L 4N8VG 5IEKB 1I3RB 1U8LA 5D1XC 1OL0A 4OCWH 3GJFB 5GSRB 1HCFX 2C9AA 4RGMC 5I73C 4R2GB 3ZE1E 5ESAA 5JOPD 5JR1L 4OD2B 2FEDD 2BRRH 1EUTA 2R0LL 2R1XA 1ZLVK 2QSCH 4GJTB 4P57B 1DQDL 3PWJB 4U3XA 4Q6IB 3PDGA 4DZ8A 5F3HA 1ZSDB 3TWCH 3NN8B 1KJ3L 5D1QB 1JVKA 2P43B 4HS8L 3CDFA 1GGUA 4M00A 1HDMB 4G7VH 2PO6B 3UDWA 4N0UB 2EICA 3MV8B 4P23D 4GLRH 1T03H 4XNMA 2J8UF 3F12A 4Q9QH 3DX8A 4FMKA 1CR9H 3CX5J 3GFUA 1A21A 3MRFB 1SYSA 2AJXH 2A9ML 1W0YT 5D1ZD 4RWHA 4YHIB 5IB1A 1EAJA 2ENSA 1XGQB 3L7FB 3ULUF 4NKMA 5EOCJ 3RTQB 3FO2B 1HHHA 4PRBB 4NKDA 1S7QA 2LU7A 1F97A 5B39B 4G42A 2AQ3A 3KWWB 1MHEA 1EBPA 2VR9A 3I02B 2CIKA 4IRZL 2VZTA 4TVPE 1IKNA 4FTVB 3OR6B 1C7TA 3E3QE 3EO9L 1A6WL 5F1IB 4KI5E 4P2QE 2MNUA 2JTDA 4JHWL 1VFOA 1QSED 4P3DB 4LSQH 4A6YA 4PRID 1ADQA 1ZLUH 4HKZA 3DETD 5KS9F 1F13A 1ZANL 1BOGA 3CUPA 5FYJU 2QKIA 5FGCE 4NQDE 4GRWE 1JZ4A 2OSLB 3DVGB 2V5YA 4MZ3A 4TOYL 3PWJA 1BQSA 4Q6IA 5KTEH 1IM9B 1ZSDA 3BZFA 1NCCH 1GGBL 2QSQA 1WIUA 3QEQB 2B5IB 2DM4A 2O26U 3N1QC 5D1QA 43C9B 5KAQG 5DZNA 4XPFH 2PO6A 1EEUA 2W9EL 2Y5EA 4PRHB 1B9ZA 1MFCL 4DVBA 3OV6A 3QQ4B 4GSDL 4MQTB 3MRFA 1RUQH 3WLWD 4HWUA 1XGPB 2WW8A 4UZGA 4YHIA 4H25B 1A0QH 3LCYA 4QOKB 4CN1A 2FEDC 1XR8B 2YMXH 3S34H 3UAJD 4Q97A 1G9NC 1WICA 3FO2A 5I6XB 2FIKB 3FHQA 1X5FA 4PRBA 2N56A 2XWJB 1R5WB 3KWWA 1TETH 4O4YL 5F9JB 5KSVA 3RJDA 3AAZA 5I8KH 1LMKA 4JRXB 5FA3A 3LEVH 1X9QA 5EIIB 4FTVA 2NZIA 3OR6A 2NPLX 4LIQL 4NN6C 4F37K 5C0DB 5GJSH 3IB4A 4MA3B 1A7NH 4CBPA 1QFUL 4QWWD 3QCUL 5HD8D 5LWYL 2YRPA 5DEZA 4WCYL 4YHLH 3TA3A 1J10A 4MMZC 4CMHB 5E2TH 4CGTA 3ZT5A 1NJ9B 3OAZH 1X5JA 4XPAH 2FJGB 3Q1SL 4IMLA 1MHCB 3DVGA 2MJWA 2V2TA 1KCRL 3OKDB 1IM9A 3GMMA 5SWZA 4Y1AB 4KK9D 3TIEA 5A2KH 3QEQA 5BMFL 2ZUUA 3QYCA 1RPQA 2GAZB 3BP4B 2UZIH 3STBA 4CDGC 1AY1L 5I76B 3LRSB 1EEZB 2RFXB 2DWDB 5MEOA 2XG5A 4U1KA 4YUEH 3WCYA 5EWIH 1PSKL 4PLKD 2VISA 5AYQA 1J0JA 5JIKA 3ESUF 1P4LB 2NY4B 3P4NB 15C8L 4UDUB 2R56L 1OOAA 1XR8A 1NBZA 1TVBB 3I9GL 4JFDD 1GCFA 2FIKA 2NY0C 5FYKL 5A2IH 1H8OA 4GQ9L 4WFEE 4Z7UF 2C4FU 4ACPA 2VLMD 3HFML 5DVKA 5C0DA 3MACL 4G5ZL 3ZHDA 5EFIA 1IAKB 3ZKND 2CQVA 4QHUA 1YYMH 2LU3A 1PD6A 3QUZB 1KPUA 5KVGH 2FX9L 3MUJA 2IPTL 1I7TA 5EU6E 4XCCL 4LU5L 2HFEB 5DJDB 5D6DA 4KJQC 3P0YL 5ESVB 1ZXQA 4WV1B 4YDJA 4YX2L 2FJGA 4PTUB 2MSPA 1BBDL 1A1OB 3UAJC 4BH8B 1I8KA 4NNYA 4IMKA 2AS5M 2PYFB 2WANA 3OKDA 1VSCA 1NCBL 2VABB 5H37G 5LGHH 4JJHA 4FQ1L 3CFJB 3L3OB 5GHWH 5FM5O 4XCYA 1WWBX 5DD3H 1HH6B 1YMME 5I76A 4QXWA 3LRSA 4E41E 5DRWB 1T5WB 1DQLL 1AXTL 1R3KA 4NJ9H 1JMXA 5J0BA 2DWDA 5DJCB 3UTOA 5DVMA 4O5LL 3SDDB 2DLGA 2IC2A 1QD0A 4YE4H 1LHZA 4G8GD 2ZPKL 1P4LA 3P4NA 4JKWA 4OLZH 5C7XH 1X5ZA 1ZV5A 4UDUA 4KMTL 3MFGB 4ZO6A 2Y06H 1VFMA 1OPGH 1UB5A 1JGVH 3HRPA 2GEEA 1E0OB 4EUPG 1MJ7L 2A77L 3F7PC 5F93C 5ICZA 3GKZA 4JQVC 1A9EA 3ARSA 1FE8H 3GB7B 1K6QL 1IAKA 2KZWA 3DVIA 2HN7B 1BIIA 5DJYA 3CVHH 3QUZA 4PLKC 3CMOH 4QTIH 4LRNH 2GT9B 4M6NL 3ZT7A 2DQCL 2HFEA 3GO1H 2Z0BA 2V9QA 1H3VA 3GJFK 5ESVA 5JW5B 1EMTL 5GRZA 1KB5A 1A9BB 1VFUA 3UZQA 3LV3B 4YDKL 1AGEA 1EX0A 5SX4H 3NCFB 1Z2KA 4I2XE 1OAUH 4YZFF 2VABA 3HMXL 5IW6B 1F3DH 2J4WL 3LS4L 2J8OA 1CTOA 4ELMB 1P4IH 4KZDH 3JTTA 3L7EA 1WJ3A 3DNKA 5C08A 4XI5D 3OTTA 3B2VL 5K9QI 1P4BH 1YYLL 5IQ7L 1EHAA 3KJ4C 5IHLB 5DJCA 3HPJB 3RU8H 5FO9B 5GRUL 3H9ZA 1ACZA 4MB4A 1HYRC 1M4KA 1KLGB 5D7LD 1BWWA 3CCHB 4OCLC 1R0AL 1U91B 3ELAT 3D3VB 1EV2E 4I48B 1P9MC 3GEWB 4G8FA 5D7IE 4PGEB 2QQNL 4WUKL 2UV3A 1MHPL 1OLZA 3BGFB 4QNPE 4XVUC 3GB7A 1FZOB 1ZGLM 5HGBB 1YUHB 3I6GA 1FCGA 3QHZL 2Z8WC 1KIUA 4PJDE 2GT9A 4M9OA 5H8DA 2NTFB 3D25B 3U0TB 1A9BA 2E7CA 5CCKL 3E8UL 4YQXH 4X6CB 2PTTA 1G6RL 3A6BH 3O6FB 5EN2B 3LV3A 4O2FB 4F7MA 1MI5A 3VDAA 1UCBL 3PWVA 4F9PA 4DN4H 5IW6A 4LCCA 5I1LB 4F2MA 4OCRL 1J1XH 4LK4A 2XT1B 5IVZB 4ELMA 1NANI 4U6XB 5F96H 1XGRB 2VLLB 4XAWH 2G5RA 3NZHL 1FDLL 1N5AB 4S1SH 1EGJL 2YD6A 3FB7B 1N2RB 5JUEH 3HPJA 1RIHH 5FO9A 4OF7A 1ROWA 3G6JE 4J8RB 1CXFA 1KLGA 5KVFL 2OTUB 3GSQA 3JWOL 1U42A 2QQKL 1Q38A 4RA0C 3D3VA 1U3JA 3WDHA 2RIKA 4P2OD 1OGTB 4DUWA 2Y4SA 4LEOA 3KXFE 3DUHA 4NJAL 4PGEA 4QKXB 4M1DH 4MVBD 1CFNA 2V5MA 1KN2L 3Q6FB 5GIRB 5E94A 1OP3K 2GSGA 2VDPH 1MAML 4L1HA 4JRYE 1K4DA 4XI5C 4MNHB 4N8CL 2AEIT 3QUMA 2E9IA 4KTEL 5HGBA 4WEBL 1YUHA 3T0AA 5CP7B 3GMLA 1IFHL 2IANB 2BJMH 3TNMB 2FGWH 4PY8I 3IXTB 3TPUA 5ISZB 3BT2H 2XOTA 4PG9A 4NQCD 3BH8B 3FQRB 3O6FA 4FNLH 4O2FA 2Z31D 2FWOA 5IHZB 3MV11 1IVLA 5JOPE 1EUUA 3OR7B 4HK3J 3QIBB 1E6JH 5IVZA 4U6XA 1YEGH 1NEZB 4PP1D 4MQ7B 3RWJB 2ZCHL 4MAYD 2AEQL 3CK0H 4XXCC 3L3GA 5GJTL 1HSBB 2OJZH 4H88L 1RHHB 3WUWA 4NNPL 1YPZB 2FJHB 3G5ZB 2YPLE 4P59H 5TDNB 2EIZA 1R24B 3P4OA 3RWGB 4K3HA 3IAQA 3SDXB 1OGTA 1UG9A 1KUMA 2NW2A 1O5DT 1OARL 4HKJB 5DFVD 4KUZH 4X0KB 5IVXE 2XWTB 3GHEL 3IJHA 3WBDA 4RRPA 3W39B 3OB8A 2RAMA 2YA0A 3HPLB 5F21B 5C8JB 2A9NH 2VLKA 3FL7A 4MA8L 2IANA 4JGMA 3TNMA 4TSBL 3UTSA 3IXTA 4OLWL 4BYHA 2WUBL 4HZLA 5IBUG 3IFOA 2BSTB 3FQRA 4HFUL 3KYKL 1AGBA 5J7CC 5IHZA 3VXSE 1FFPB 1N6VA 3IF1A 3OR7A 2DI8A 3QIBA 2X05A 3S96A 1NEZA 5KVMC 1RULL 1UJTA 1INDH 2P8MB 4LLWA 2YA2A 3OGCB 2CDFB 1MH5B 1J8HB 5HVHC 2Z8SA 4LF3A 3IGAB 4JPWH 4XXDA 1HSBA 4X5XB 1RHHA 4I77L 1KGCD 3KPPB 4XMKH 5I8OL 3CFCH 2AJYL 3O4LD 5C0AA 2ZNXA 3RDTA 3K0WA 3P0GB 1IQWH 1R24A 5I1HH 4WHDA 1KPRB 3V6OC 5KOVC 2Z31C 3DUUB 3SDXA 4LPVA 5GGVY 1FG2B 1H5BC 4U7MA 4X0KA 1N7MH 2XWTA 1GGCL 1KB9J 2QQLL 3V5DB 4PJIE 3GMQB 1TZGH 1ZWIB 4PP1C 2XKNB 3HKFA 5J1SC 4KDVA 3RNKA 2QEJA 4XMLL 4QLRA 1LO3H 3EUUA 3HPLA 1FVCB 1GAFL 4KRMB 2AXFB 4L4VD 3SDAC 1EO8L 3SOBH 5FYJE 1F6FB 4OCSH 3EOBA 5L2KD 1SEBB 2Y07L 4JREC 1A7OL 2HFGL 1V3JA 5H94A 3UBXG 1DLFH 2BSTA 2PF6A 3Q5TA 5CGMA 4APQD 3GBMH 3AXLB 2CKBL 4POYA 2ZJSH 5TE7H 5D5ME 1JHTB 1KCLA 1J11A 3T8XA 2YWYA 1NAKL 2V9RA 1CXHA 1MHHA 3TV3L 1P53A 2P8MA 3WJJC 4KJWD 1MH5A 5KSBB 1J8HA 5FA4B 2O5XH 35C8L 2JB5H 1WC7A 3NA9L 2IAMD 2BSED 5IB2B 3KPPA 4AT6B 3SJVA 4UB0L 4GG6B 1NC4B 2NY1D 1SM3H 3MJ9H 4OD3H 2XQYK 3FO1B 1YNKH 3DUUA 4RSVA 1FG2A 1KXTB 1T83C 4OZFG 3U7YL 3TJEL 3AS1A 3WUWG 4N8PA 2H32A 3GMQA 4WO4D 1ZWIA 1MCWM 2P5EB 2YKLL 4HS6B 4QGYA 1LEKA 1FVCA 3KPSA 5T5NF 3O2DH 7FABL 2AXFA 2X5PA 3IS1X 1UENA 2AK1L 5EUOB 1QRNE 2R15A 3H3BC 3U0PA 1H3PH 4YDVB 4R8WH 2FO4B 1AC0A 4UT7H 3LHPL 1BAFH 1F6AB 4V1DE 4U1IB 1MNUH 1Q9LB 1QZ1A 3ARBC 4R4BB 4M62L 3QDJE 1DTUA 4MA1C 5SWQA 4UNVA 1MFEL 5EO1B 2ATKA 4PJ9B 5BRZE 3NZ8B 2VDNH 1BEYH 3VCLB 5L9DH 1CVRA 5I1CL 3FT2B 3MUZ1 4J1UA 1SVCP 1UGNA 5KSBA 4WHYG 2VN4A 3QDMB 3Q6GL 4ODWB 1PX4A 2F5AL 3LIZL 1DQMH 3O3AB 1PFCA 2VAAB 4KRPB 2HKFL 2HLAB 4M6ML 3BD5A 2BNQB 1NC4A 3PIQB 3EFFB 3TM6A 3TZVC 4PUBH 4H8WH 2CGRH 4KKCC 2AV7B 1U92B 3GSOA 5IW3A 4MSWB 1VEPA 4OZHE 3RBSA 4Z7WF 1PG7L 2I60L 2XRAL 3HG1B 3RGVD 2X1XR 3TCLA 3SCMB 4FQXC 4G6AC 4Y4FB 5JHDA 4ETQB 1PZ5B 4Q7DA 3O6LH 2OTPA 4H1LG 2FR4A 2ORBL 2P5EA 2K7QA 1JPGB 2E9JA 4L8SA 4HS6A 2XQBH 4KJWC 1TZIA 1KNOA 4RNRB 3IDYB 4W6WB 1E6OL 5DC9B 5JQHC 1HIMH 5T1LA 1ZTXH 5D70L 4YDVA 3DUSB 2YPVH 2NY1C 1CFQB 3O6MH 5I1IH 4OQTH 1E28B 1GIGH 1HNGA 1Q9LA 3FJTA 4R4BA 1NCAL 1HHIB 4ERSH 3X12A 1RHFA 1DBML 5MI0B 1L9NA 3F7VB 3VI3F 4KY1H 5ACZA 2DQJL 4P9MH 1NC2B 3C2SA 3NZ8A 3EO1A 2HLFC 3WFDH 4HUUA 3IFNH 2CKBB 4PYHA 4YEEA 4IDJH 4GW5B 4HWBL 2V6HA 3OKEA 5C0GB 2VTFA 3GDBA 1KN4L 2W92A 3ZDXF 1VB9A 3QNXA 4FFVC 3RUGB 2NY7L 1BD2B 3O3AA 5LCVH 1PG7X 2ED7A 2EE6A 5I18L 4JJ5B 1GC1L 1HYSC 2KQMA 2WIIA 5J11C 1FQ9C 2AV7A 4M3KB 4MSWA 2NX5B 1MAJA 2GJ6A 2JJSA 4RQQA 3HG1A 2AQ2A 4K23H 4JO2H 3SCMA 3X3GH 2K7PA 1KC5L 4KV5E 5I15H 4S1QH 3TT3L 3O8XD 1MVUB 4DKDC 1OB1A 1BM3H 4P2RB 3BN9C 4PJFB 5D8JL 2YC1A 3DGCR 3HZMB 4LLUB 5F89B 5JA9A 3HB3C 4OGAD 1FLRL 4G9FD 2OK0H 5DDHB 4JPKL 1HWHB 2W0FA 1E28A 2QBWA 4KI1A 4HG4J 1X5XA 4LSTH 2CRMA 1BVZA 4HXBL 4QTHB 3RGVC 3LS5L 2YD5A 3VXUD 4YXLL 4KKNA 4XC1H 4PBXA 1JPST 4UMGA 1JL8A 3VMOA 5CBAA 5E2WL 1LP9E 4J3TA 1C8PA 5DMYA 5DRNB 4GW5A 4HH9B 3FN3A 1TCRB 5C0GA 1RIUL 1AIFB 2DTML 1JWMB 1U8HA 2NMSA 2Q86A 4J3XA 1J1OH 4JZNB 4O58L 2EC8A 4JB9L 2DDQL 4W70A 1BD2A 1KPVB 2H41A 2ZOLB 3O3EB 1AGFB 4C59B 4JJ5A 4YNYA 1FIGH 1RI8A 1ADQH 1ND0A 4GXUM 1XCQB 4AIOA 3K46A 2EDWA 3GJFH 4PJGB 1MCWW 2HT4C 3HE6D 2NX5A 1Y6NR 1JWSA 3C09C 2J6EL 1A47A 5J3HC 1LNUB 4YBLB 3FFDB 1P84J 8FABB 3RNQB 4ONFL 4BSWB 1PLGL 4QRSB 1MVUA 4P4KD 1MRDL 5T5FH 5IKCB 4DGYL 1TNMA 4PJFA 3EYUL 3GBNL 2LFGA 4JO3H 2LTQB 3BE1H 3DXAD 4X6DF 5IB3B 4UQ2A 5CZKA 5DDHA 5KS9A 1OP5K 1TLKA 5CEZH 1R3HB 3GGWB 2UWEB 1EBAA 1IC5L 3C8KA 4M1CC 5FUOH 5A1AA 5INCB 1JHLL 1VEOA 3R1GH 1RIVL 1T89A 1RMFL 4MDIA 3H9SD 1T1YA 2X4RB 2GSIB 2UZYB 4Y4KC 5HVGB 3SKJL 4LPXA 1QFPA 3V6OE 5JORA 3O8XC 5D7KD 4PD4J 3DWTA 2DF3A 5DRNA 4NZTH 1G7HB 1TCRA 4LASL 4V2CB 1AIFA 4JVUA 1JWMA 2FL5B 5K9JH 4JZNA 1CIDA 1Z9SA 2IBBA 2D7TL 4Y16A 3UPAA 4D0DB 2MOVA 1CU4L 2UY7A 3GHBL 4F9LA 3O3EA 4KVNL 1AGFA 4U1MB 4YHPA 1UH4A 4FZ8H 3SKNB 5GS2H 3MLTB 4FMFA 3RX5A 1DL7H 3BYTA 4XAKE 4PJCB 3JSSA 1A7BA 2V9TA 1G1CA 2XY1A 5TDOB 2HRPH 5IFHL 1N8ZB 1JF6A 4OI8A 2DQUH 4PJHE 3RNQA 3V0WH 1I3GL 3B5TA 5F6HJ 2YBRB 4QRSA 5I75C 2ICWI 4WHCA 1QTYT 1KACB 4FS0A 2CDEB 3ZL4H 4GG6F 3P9LB 3DTXB 5IB3A 2BXZA 1U8PA 5DMGD 1MCJA 3RY6A 5KSAC 5IMMA 1R3HA 1UB6A 4IRJB 3QIUC 1N3NA 1V7MH 2EDRA 2YD2A 4EI5B 4KHXL 3HE6C 4FP8H 2OXGA 1NGXB 1I1YA 3ILQC 3GMRB 2X4RA 4JZOA 2GSIA 5GZND 3BO8B 2H45A 1YJDH 3F5WB 3T4YB 5EU3B 4NZUL 2DM2A 3PL6A 3DV4B 1BWMA 4R2GD 4CMMB 1SJXA 3OKKA 4P4KC 1Q9OA 2OI9B 1JNLL 5IJVB 3PQYA 4YR6A 3LD8C 1JGDB 1Z9LA 2P42B 1FNFA 3DVNA 2D31B 3O6KL 2QADB 4OCYL 4TUOA 3M17B 4U1MA 2L7JA 5D1QD 1F02I 3UO1H 2AV1A 5HDQL 3MLTA 1LO0L 2PO6D 1UJ3A 4PJCA 1D9KC 3C60B 3RGHA 1QSVA 4KAQL 3MV7B 4UNTA 2XN9A 4TNVK 1IGYB 2ARJA 5TDOA 4Z7UA 4YGVA 1N8ZA 4IIQB 3UTQA 4GH7B 1XGUA 3HI5H 1J9CT 2XZZA 3E6FA 5DD5H 3RZWA 5JR1H 5EBLA 4L29A 3RTQD 5DS8B 3OXSB 4MB5A 5JW3H 2X89A 2CSPA 1H0DA 3H0TB 1C16A 5MEPA 5HI4C 5EO9B 2IBZY 1RVFL 1BECA 4PBVC 3M1BA 1KTLB 4FTVD 4TNVF 3DJ9A 5HGHB 3P30L 2HMIC 1JK8B 4JAMA 2O5ZH 4WI5A 3WJLA 4AQOA 5C0IB 3GMRA 3TA3D 5GS2D 2A6IB 3BO8A 1S78C 4NN5C 3V7AG 4KDTA 1ZHBA 3T4YA 2AABL 3BJ91 2FHBA 4B5EA 5DD6A 4Z7VE 3RX7A 5FECA 5DRZA 4TRPL 3IU3A 5IJVA 5KANG 2CMRH 5E2VL 3T0DA 1IM9D 2X4SB 4ZTPH 3QAZC 2F53B 3QEQD 4YHZL 3C6LB 5DMGC 3M17A 1IKNC 2ZKHH 4PJEB 2UVFA 3OKYA 2R0KL 3B83A 4OD1H 4ODTL 4Z0BH 3GSRB 4AM0B 1PGRB 3WIHA 4PRHD 1KB5H 4HS3B 1HINL 3K8MA 3ETBF 5C07B 2EDDA 2IEPA 4HULB 4KKAD 4CJ0A 1BBJB 2VITB 3MOAL 3T4AB 3W9DA 4N9OB 4QOKD 4MXVF 3EHBD 1U58A 5DI8A 1TQCC 1HWGB 1AI1L 3FQNB 3RP1A 1CS6A 5J1AB 2GTWA 2C7UB 1J86A 4R26L 3JTSB 5DS8A 3OXSA 3MV9E 3U36B 5EO9A 3CFBA 4JRXD 3QCVL 2BFVL 1BPVA 2DBLL 1HKFA 1ZT4B 5D1QC 3MYJB 1UWEH 1LD9B 5I8EB 2GITB 5F7LB 3NFNB 5HGHA 1JK8A 2YUZA 2W9EH 4GS7C 3ZYIA 1MFCH 5C0IA 3VXME 1NKRA 1RUML 4UV4L 2AJZB 3JV0A 4GSDH 2I26N 1GZQB 3QFDB 4U31A 2R9HD 2BNRB 4U6VH 3T0BA 4EQ2A 2HT2C 1ACYH 3TF7C 4NSKA 2QV2A 2HA1A 4TPRH 2G5BA 1T0NB 1S9VA 4DKFL 2DQIH 3ZTJG 1HN1A 4Y1AD 3CFEA 2ZSWB 1EA9C 3DARA 1JN6B 3BKCL 5J6GB 4JDVB 1SVZA 3OX8B 3PWPB 1I1CA 3EOTH 4G6FB 2QHRL 3GSRA 4XZUA 4TVPL 1BLNA 1U3HB 1YQVH 5HYSA 5JMOC 4HGKC 1P6AB 1KENL 1QFUH 1DZBA 1U41A 4GLRI 4HS3A 4M7JL 1M05B 5IIEA 3PHOB 4PRNA 3TA3C 1T7WA 3LPFA 3ARDB 3ZDZE 1B2WH 3CZJA 4OUUB 3QI9A 4GAFB 4JN1L 4R97B 3T4AA 2W38A 2NY4D 3EDKA 1C7SA 1R5VB 4WTZA 5J1AA 5GGQH 1MAKA 1DQQA 3CLEL 1MWAA 2C7UA 2DIBA 4LL9A 3OL2A 1NGZA 3JTSA 3NCCB 4Y8AA 1AFVH 2YXMA 3MBXH 2QTEA 32C2A 3QUXB 3U36A 2CXGA 1N0LA 2ESVA 1OAQL 3OKOA 4XCEB 4QRTA 1PKQE 4NQEB 5BMFH 2ADJB 3MYJA 1LD9A 2GITA 3NFNA 5A2JH 1G9ML 1UKQA 1WFUA 2YK1H 3MROB 2D03L 3EDDA 4LSPH 4LSVL 4YC2C 2DLIA 4NHUA 2CDGA 3QUZD 4CVXB 4HPYL 4WU5A 4M6AA 2IALB 4KKAC 3QWOA 3QFDA 1YDPB 3MO1B 3IRPX 2AI0L 3DROA 4JFZL 5IR1A 1Z9MA 3FZUC 4NQXA 2A6DA 2R56H 1UZ6E 3I9GH 3MBEB 4GUPB 1YJDC 3MNZB 5ERWB 3U7WH 1X4XA 1S7RB 4FHBD 5CJOL 1T1ZB 2I9LA 3MCKB 2FO1A 2BDNH 4JDVA 4LKCB 1DSFH 1S9XB 3OX8A 3PWPA 5CD3B 5F9OL 1FZMB 5LQBL 5C08D 4NFBA 4V2BA 4Z8FH 5JXAL 1U3HA 3B6SB 1G7MB 5DMKB 1OVZA 1M05A 1HH9A 4YDIL 4L4TE 3ARDA 3SDDD 1JPTL 4OUUA 3T3PF 4HJJH 4KK8D 4XCCH 1IRAY 1WAAE 4LU5H 4MXWH 5FCUH 3SE3C 2R9HC 2OR9H 2VXQL 2YUWA 3P0YH 2BVTA 5I71C 4POUB 5B4MC 1B0GA 3MLVH 1R5VA 3LZFL 3VFNA 2RCSL 4LRIA 1BBDH 1CT8A 4Y5VB 3QUXA 1BFVH 2GJJA 5DJ2A 1VADB 4Z7OF 2AXGA 4MLSA 5FUCC 3D6GA 4XCEA 3X13B 2ADJA 4M7ZB 5F72S 3K2UL 4MHHI 1HHJA 1MIML 2DKSA 4G9FE 4Y2DC 4U6HA 1TVHA 4K3EH 4L4JA 1AXTH 5L8JB 3G6DL 1M71A 1CFVH 1TJHL 4XNUH 4LSUL 2IALA 4O5LH 3PNWB 4WTXA 2J88H 1BQHA 3SPVB 3PP3K 2A74A 2AEPL 1NCWH 2WAHA 3DO7A 4KMTH 3TBWB 3R8BB 5C9JA 3WEXB 2H3NB 4RFNB 1CD1B 1ES0B 3CVIL 4KK6D 3MCKA 3RPKA 4CRPA 2VE6B 3QUYB 4LKCA 1T1XB 1UM4H 4NKIL 5CD3A 5D96B 1FGNL 2EYSB 1CIUA 1DVFC 1Y18B 4HIIA 1NCDH 4L3AA 3LQMA 4LPYA 4JG1H 5ICYB 1MRFL 4OKVB 4DKEH 3PWLA 1RZIB 2BY0A 3D18A 5DR5L 2DQDL 4M6NH 2DQEL 3S36H 1EMTH 5JLZB 3RL1B 1JV5B 4P2QB 5HYSG 1FORH 3D3VD 5CUSH 4WGWB 4YDKH 1U8KB 3MFFB 1JGEA 3F62A 4Y5VA 2P46B 4EIZC 1AC6A 3HLAB 3HMXH 1N59B 3VWJC 4X4ME 2J4WH 1ETZB 1T80A 1HHKB 2N1KA 4C83B 4J6RL 3P11L 1A6ZB 5FGCB 5GS1A 5IV2A 1YEEL 3FFCE 4GRWB 4NQDB 4ORGB 4DW2H 1Y6MR 2AJ3A 2F19L 4QRPE 1R5IA 4HCRL 1AHWB 4OGZA 5GRUH 3PNWA 4KK8C 4MJ5B 4GBXB 3QO1B 3SPVA 4OF6A 2BVOA 5F97E 1RJYB 3RI5F 4LSRH 4Q9CA 1X5GA 3O6FD 2PR4H 3LAFA 1A4JB 3NTCL 4TUKH 3KLAB 3HNVH 2H3NA 1CD1A 2HJKA 1FNSL 5C0CB 3WXWL 3WNOA 5CSBA 1U0QA 5I1EH 2EO1A 2D4FA 2EYSA 3ARGB 3N0PB 4FABL 3VG9B 3UTZA 1OT2A 3S35L 2FH8A 4IJ3B 3TYFB 4ENED 4QO1A 5EC1B 3QHZH 3HC4H 4X83A 4M6OH 1EJOH 5JLZA 2GYSA 5E6IB 3C9NA 4EVNB 2BY2A 3IFPB 2XYCA 4HBCL 1LEGA 1IMHC 3TEUA 5KJRH 4LCCC 3HLAA 4P3CH 3QG6B 5FV1L 4X4YB 4JM2B 3EYSL 2E8ZA 3GRWA 1HHKA 3DX9B 3K80A 3UPRB 3NZHH 5C2UB 4ZXBC 1A6ZA 4D9LH 4XCNB 3LDBB 3TIDB 4GXVL 2VLKD 1CD0A 3VFMA 2IAND 3H3PL 3BX7C 5FK9B 3UTSD 5ISZD 4MJ5A 2R1YA 4M4PA 5KVFH 4KROD 4JFQA 2H32H 1A4JA 4LAJH 4F15B 3JWOH 5SX4I 4LLYB 3CX2A 2OBGA 5L8KB 4PLNC 1NBQA 3NIDE 1DBBH 4LCIL 4Z7NE 1F4XL 3CPLA 5C0CA 3QIBD 5L6YL 1M7DA 3ARGA 2W1NA 1OP5H 1MAMH 3SKOA 4CJ1A 1RUKL 4N8CH 4M03A 4LARH 3TYFA 5EC1A 4NM4H 1IFHH 1MFDH 2EDFA 5C0AD 1INEH 4L9LB 4RISL 4KJPD 4H26B 3SE8L 2ZUXA 5DD0H 4PB0L 4P5KA 5FUZH 5FFLA 1Q9WB 5EA0L 3QEUB 1QFWM 3O6FC 4YBQD 5CEZE 4EVNA 1W0VA 2VDQL 3OG4B 1LWRA 4UI2A 1MQKH 3VDBA 3MNVA 2ZUTA 1MJJB 3IRZA 2UVEA 1MEXL 1WVZA 4G43A 5BW7A 2XFXB 1IARB 4R0LC 5EU6B 1TVDA 3FRUB 2IMMA 1D3CA 1IJ9A 1OTSD 1NMCC 5D2LF 2JKXA 4X4YA 1A7QL 3V0AC 3DX9A 1RK0B 4LVOC 4FN0A 1RZKH 1RFDL 2AEQH 5CSGA 1FFNB 3NIFE 4NT6A 4W68A 1QLFB 4NCC1 3GUTB 1YY9D 4H88H 3WFZA 2BOCB 1FCCA 3UC0H 3WFEL 3QDGA 3AY4A 3QXTA 5E00B 1YMMB 4FXGB 1Z6JT 1NMBL 1OSPL 4E41B 5C0JB 3S4SB 4LLYA 3PF2A 5JPMA 2EC9U 5FGSA 3QQ3B 3GHEH 3T0EC 1GGIH 4Z7WA 2VDRH 5SWZE 1CE6B 1J8HD 2C5DC 4LLQA 5GGVH 1JBJA 5EC2A 1O7VA 2X4PA 1RZ7H 3QEQE 1C5DA 4UIKL 5F7HA 2FYYB 3WIIL 3MV01 4TSBH 3HNSL 3AROA 5DUBB 2WUBH 5EBMB 5I8CA 4ZTOL 4JDTL 3RVTD 4KROC 5J13C 3KYKH 4WJ5B 2VDOL 1H9VA 3CLFH 4JM4H 4QXUL 1EK3A 2XFXA 4PIRF 5ELIA 3FT3B 3CD4A 1MCHA 1MUJA 3RWCA 3BKML 4XMPH 3BSZL 2YHGA 1G9NL 4M02A 3KPSD 1CN4A 4LBEB 5D7JA 3MLYH 3WLBA 3GUTA 5I66B 1HI6B 4GRLB 4YHNB 4Y5YA 5I8OH 4KJPC 3SQOL 3RDTC 4I18B 5IBTH 1YMMA 4FXGA 5JA8B 5GPRA 3GSUB 4E41A 1BX2B 1FC1A 4GXUN 4HCRA 1OM3L 4TSAH 3FB5A 3QWRA 3W82A 3L6FB 4YO0B 1ZEAL 3IT8D 5T33H 5MERB 4C58B 5HTSA 1MRCL 1OTSC 3RIFK 3VMPA 3WFHA 4BH7A 3VH8B 3BH9B 5MP6L 2HJLB 2DI9A 2R69L 4XMLH 2FGZA 5FUCE 4ONGL 5D1XB 4JDZA 1GAFH 5TFSL 4RGMB 4ZFZB 5I73B 4CAGA 1QOKA 5I1JL 5C1MB 5K59E 3HR6A 4ORZC 1NC4D 5DUBA 3O3BB 2Y07H 2HFGH 2I5YL 4K71C 4AL8H 3TBSB 4UAOC 1IC4L 5E8EB 4WJ5A 4UOJA 5JW4N 2ZG3A 4OSUL 1HSAA 3RIFF 1YNLL 5GZOD 3BI9X 1R3IL 1IEBB 1KBGH 4ZO9A 4PJDB 3FT3A 1AXIB 1ONQB 4DQOL 4UUJB 3WV0A 2P5ED 2VOTA 2X4OB 5T5NG 2CKNA 1ZAGA 3BP5B 3BD4A 3MLZH 2EC9T 5E5RB 3S37H 3VRJB 4LLMB 2ZOKA 5BZDB 5IM7B 5I66A 2XQYG 5C2BH 4Z95L 5FYLH 4W4OA 4RX4A 3FQUB 4LPWA 4I18A 4JQXA 5GS0C 3IJYB 4DAGH 1P7HL 4OCXH 1Y0LB 2E7LA 3N9GL 43CAB 3L6FA 5BZWA 4A2LA 1QBLL 3G6JB 5MERA 5IFJB 4ZQKB 4J4PD 1NUFA 2KH2B 4OZIE 2LVEA 2XTLA 3VH8A 3BH9A 2YKLH 2HJLA 1P7QB 4OCWL 5HGAB 4R90H 7FABH 5CKGA 4X7CC 3KXFB 5C08E 5I1GH 2BRRL 1D5IH 1QR1B 2AK1H 2QSCL 5DXWA 2BNQD 5FYJL 3JXAA 4JQIH 3O9WA 4ZDHB 3LHPH 4JRYB 3TWCL 3TBSA 5IB4B 3D2UA 1ZOXA 3DRQA 3HG1D 3MQIA 1U95B 5EOQH 3SCMD 2IH3B 1A6AB 3H9HB 3WXVL 1I7UB 4Y4FD 5EIQA 4PJDA 1Z3GH 2Y6SD 1ONQA 1T03L 5IROA 4Q9QL 1CR9L 2DBJA 4P2YA 3HE7A 2O61B 5E1AB 3I85A 2DWEA 5GGSB 5BZDA 3I50L 4AG4H 3A0OA 1IE5A 2APTA 1QBBA 3LIZH 2CLZA 1S9WB 2L7UA 1RZKC 3FQUA 3MREB 5JZ7C 4HDIA 4FZEH 3IJYA 4HUVA 4I0PA 2ICWA 4JCLA 4OV5B 2J12B 1R3JB 2GQHA 3ZO0A 2I60H 4Q74A 2A38A 4B7IA 4NN6B 1DEEA 3HRZB 4JKMA 4LVHC 4OFYA 1NC2D 3SE9H 3AU1B 5I0ZA 4ZQKA 2YPLB 2APXA 1MI5E 2ORBH 4L8BB 3QJFA 3U2SA 2PW2A 4L8SC 1J05B 4LSQL 1K85A 3VFOA 3ZZ1A 4ELME 4D8PB 1KXVC 1HILB 5HSFA 1E6OH 2E6JA 1BD2D 3TN0C 3ZTJH 5IVXB 2OXHA 2LE9A 5E6YA 5F7FA 3DSFH 3PV6B 1QR1A 5D70H 1N6QH 1V7NL 5KTEL 2IADA 4ZDHA 4JRYA 2EO9A 1NCCL 1T1WB 3OJDB 2NX5D 4OLVH 5FYLD 1L6ZA 1U95A 1QQDB 2H9GB 1INQA 3H9HA 1I7UA 4S11A 1KCKA 4XPFL 4LSDA 4LHUA 1OD9A 3BP7A 5CAYB 4E0RB 1DFBH 2OM5A 4MJ4A 4FQQA 3BISA 3B43A 3O11A 5J1TC 4HIEB 1JRHI 1RUQL 2R2BB 3VXSB 3P9WB 1A0QL 5D6CB 3S7GA 2KKQA 1CWVA 2YMXL 3S34L 2P8LB 2NY0B 4U7SA 2A2QT 3WE6B 4QRQA 1FVDB 5DFWH 1VPOL 3DI2B 4HSQA 4TNWK 3LEVL 2LV4A 2P1YA 1T3FB 2JJSC 4QHNA 2WP3T 4YGAB 9CGTA 1R3JA 3HRZA 5HGGS 3HAEG 3ARPA 3AU1A 1S7TB 1G7IA 5EG6C 1A7NL 2Y6SC 2VQUA 2OJEA 4YXKH 4Z6AT 1NFIB 1KG0A 4YHLL 5E2TL 1I8MA 1CVSC 2CK2A 2DQFB 2X4TB 4OZGF 3U4EA 3ROLA 1G84A 4D8PA 2YN5A 3ULVF 4XPAL 1MJ8L 4PJ7F 2I25N 2IWGA 3PV6A 2W0LA 4PJIB 4NYLA 2E7BA 3O2VH 4O2EB 1L7IH 3TO2A 5DJXA 3PP3H 4X7TB 3MJ8A 3IKKA 3SDCC 1YEKH 2CH8A 2MPAH 5E8NB 1DUZB 4G9DB 1B0RB 2YWZA 1QQDA 5CGYC 2H9GA 2UZIL 4XH2A 4GT7A 1GGTA 1T0PB 2APVA 4E0RA 4YWGL 1JNJA 5EWIL 3VFGH 1UKTA 4HIEA 3V7MA 1I3UA 2HJFB 2DTMH 1Z9OA 3T0EE 2NYYD 4O58H 5D6CA 1E4XI 2HG5B 5D5MB 3WIHH 3MJ7B 4CU6A 1AQKL 2Q7NA 3SY0A 4CKVX 2VH5L 2H6PB 2P8LA 2D3VA 5GGTL 5E56A 3PWUB 4QHLB 3MLSL 1I8IB 2VLKE 4W4NA 4HFWA 4GKNA 2HH0H 5T1KB 3UTSE 1T3FA 2CLRA 5F88A 1F4HA 4EOWL 1S7TA 3PL6D 4BUGA 3D85B 5MHSD 4MLIA 1YYML 1ZGLB 3L3KA 4OBSA 2EEBA 5KVGL 1FNAA 4LDEB 3EYUH 3IDIB 3ZDYE 3V79C 1WZ1H 4IHOB 3IDMB 1LE5B 1HEZA 1Q0XL 4C4KT 2QL1A 4OLUH 3PXJA 4O2EA 2Z91B 3FOLB 4X7TA 5LGHL 1JHLH 3RVUD 1T89C 2GW5A 2X9XA 5C0AE 1DUZA 1BFOA 4G9DA 5DD3L 5IF0B 1J7VR 4RAVB 4Z7QF 3UROR 1QRNB 2DJUA 5ADOH 3OKNB 4NJ9L 2AP2A 2VSDA 3EDFA 4UDTB 4OCNC 4V1DB 1H15A 5JXEA 4U3HA 2HJFA 5D7IF 3QDJB 2HWZL 4Y16C 2HG5A 4OLYH 2D7TH 5ALCH 3MJ7A 4OLZL 5IMKB 2HTKC 4F9LC 5BRZB 4KVNH 2JJTC 4LHUG 4IRJD 4QHLA 1JGVL 4E42A 2EXYC 5T1KA 2GKIA 4JPVL 1CGWA 1NANH 2YS4A 4JFEA 1MWAH 1S8DA 1FE8L 4WI4A 2J5LC 5EZOH 3HCVA 1C5CH 1IM3A 5C6TL 4NN7B 1DQJB 5TE4H 4U0RC 2EEDA 2WBJB 1QYGH 4NQSB 1IEAB 4QTIL 4LRNL 3GO1L 4NUGL 4OZHB 5D4QA 5F7UA 2NYYC 5IFAH 3MRCA 4DOHE 3FB6B 3IDMA 2B1AH 2QADD 1LE5A 1T5XA 1AR1C 1JI2A 3TJHC 1U2CA 1OAUL 2Z91A 4KKBD 3C60D 1X5LA 4ZNCD 3MV7D 1A1MA 3SJVE 1P4IL 1WV7T 4AIZB 2JB6B 5KZCB 2H2PD 2JCCF 1KT2A 1LEIB 3F7YA 4JFOA 3PL6C 1P4BL 4NZUH 1T2JA 3OKNA 3KR3L 4I3GA 5DRXA 5HYQB 4UDTA 3RU8L 1QSFB 5SX5K 1S7UB 3BKJH 1ZGLP 3BZ4B 1JNLH 4HK0B 1MCFA 1NBYB 3VU2A 4U49A 5IMKA 3BP6B 3O6KH 3KPSE 3L1OH 5GRJH 4LPTA 1UJ3C 4D0CA 3AREC 4KAQH 5E8PB 3J8F7 4S10A 2DMCA 4Z76B 5F7DB 3OJMB 1FO0A 1NUGA 4LLVA 4ODSH 4GAYA 1OTTD 4MNQE 1L0XA 4AJ0A 3OKMA 1IAIM 2WBJA 2C3GA 4NQSA 3MCG1 5IG7A 5L88L 4K94C 4LGSB 4OZHA 2BCKB 1IL1B 4YK4C 5ID1B 4QRUA 5J9PB 2CR6A 2F53D 4YQXL 3RVXD 3A6BL 5IB5B 3C6LD 3QCTH 1EJ6A 3BDYH 3OZ9H 4MCZB 4ZPTA 3ZKQD 3WJLC 1CGSH 5C86A 2P7TB 4AIZA 2VN7A 1T66D 4J3WA 4XAWL 5C07D 4KDTC 5HPMB 4S1SL 1WGOA 1A2YB 3MRJB 5JUEL 2B2XH 3VFSA 4U3CA 1QSFA 4PLJC 1KTKE 5JHDE 3BZ4A 1F3RB 2B4CH 4TRPH 1BFTA 2HRLA 3VGAC 3MRIA 2P5EE 4X9IA 1P2CB 5IQ9B 3RWFA 2OTWB 5ACMA 3D39A 2JK5B 1LE9B 3IS0X 1LP9B 3F6IA 2R0KH 4ODTH 4KKBC 5JPNB 1OAXL 4M1DL 2K3TA 4Z76A 1SYVB 5FO7B 1HCVA 2MKWA 1HINH 3L3HB 3H8NA 1OLLA 3JVGA 2C3HA 5GGTA 3QEGL 4JKLA 1IBGH 2C1PA 2BNRD 3BJLA 4HUKB 5JMRA 4PV9B 2BJML 1S7WB 2MTPA 4L3CB 2BCKA 1IL1A 2HKHH 3BT2L 2GI7A 4R26H 4NKOA 3K3QA 2Y36L 5J9PA 1QBML 5DURB 1L9MA 5E4EC 3PWPD 3BMVA 4KKLC 5BS0E 2DBLH 4G6FD 5DK0B 4PJAF 1SY6L 5FB8B 1U3HD 3T2NL 2PYEB 1E6JL 5HVFB 3RKPA 3UTTA 3UX9B 3K1DA 1MLBB 3ARDD 4UV4H 4PRAA 1OTTC 1PEWA 4KC3B 3BWAA 4KFZC 3CK0L 1A2YA 2GJ6E 4GKZA 5HVHB 1X7QB 1P1ZA 5L0QC 3ZYJA 4RGNC 1FFQA 1PYWB 3QUXD 4J3SA 2WIMA 1FZJB 3MLWH 1DP0A 1DANU 1T7VA 3D69A 4YIQB 4NQED 4PTTB 2Z31B 3DGGB 1LE9A 1LP9A 1H5BB 4IRSA 2MCPL 1SBBA 1LDSA 4KUZL 4QHMB 1CDGA 3NFSH 5JPNA 2BHYA 2NQCA 1NGWA 1BJ1H 2NY3C 2CK0L 1EVTC 4AQ1B 1SYVA 3KYMA 3T2QA 5FO7A 3AGVA 4EI6A 1UH3A 3HZVB 4X9BA 3QI9C 5FV2A 1NGYB 1QP1A 4NPYB 4X5WB 3T65A 4EQ3A 4JN1H 4PJXF 5DJZA 3SDAB 5DHYA 4PV9A 4EBQH 4NKQB 3MBED 2GK2A 1D6EB 3GRWH 4ZUSA 4KVCH 3ZKXC 4YAQB 1J0IA 3RIAK 4JREB 3VJ6B 3BIBX 2J8UE 2X9WA 3L95B 4GRWH 3LOWA 3OJVC 1OAQH 4HUWB 4HIJB 4PJHB 4PJ5B 3STLB 1J0YA 2GTZB 2LVCA 1ZLUK 5FB8A 2PYEA 4N0CC 4F7CA 3B2UD 2J1KA 4NUJB 4OZ4A 3DBXA 2IH1B 3TC9A 1INDL 4PGCA 5CS7A 4FFZL 1NFKA 4ZUTB 2NX5E 5FYLE 1JPFB 2AI0H 3RIAF 4J3VA 4R96A 4XMKL 3MRKB 1P5VA 3QP3A 4ONHB 1CFTA 3VG0H 1Z5LB 1IQWL 4HIHA 5CJOH 3CFDB 2MHAA 4YIQA 4PJFE 4U0QB 3U9PH 2I9TA 1FNEB 5LQBH 4WFHD 3V7AE 4N68A 4X6BA 5JXAH 2BHZA 2X1WL 3DV6A 3V6FB 5KS9E 1QG3A 1WBXB 5DA0B 5CIPB 2F8OA 4YDIH 3HZVA 3ARFC 1LO3L 4PP2B 5BJTB 4NPYA 1XGYH 4X5WA 4OTXL 5ITBH 5ANMA 4CVZB 1BGXH 1K3ZA 1KCVL 4ZAKC 1AD9A 2IQAB 3G5XB 1HZHH 3IDNB 3L9RB 3SOBL 3SDAA 3IAPA 4LRIC 2VDMH 1D6EA 3S8WA 4OCSL 2D7MA 3QA3B 5HJ3A 3NCYS 2XPGA 3W2DH 2J2ZA 2G2RB 2NR6D 4YAQA 4NWUH 3ZSSA 4HEME 1NDMB 1AQDA 3QUYD 3KDMB 2VWEC 3ARBB 4HUWA 4PJ5A 3STLA 2XACC 2GTZA 5HI3D 4MA1B 2ZJSL 5JO5A 5CGTA 2VLJA 3K2UH 5LJYH 1UXWB 4NUJA 2VL5A 5E8DH 2GJZB 2IH1A 4ESKA 3G6DH 4BQ6A 1QFWI 4XC3L 4POZD 1U8MB 2Z9TA 4F7TB 5D72L 4IS6B 4LLDA 1NLBL 1DJSA 1ZA3B 1M6OB 2JB5L 1JPFA 2AEPH 2D7QA 4KI5D 4JY6B 5F6HI 2H2SD 2OZ4A 3MRKA 2Z8RA 2YR3A 3FAXA 3WHE1 3QG7H 1H3GA 1SM3L 3IVKB 1ZK9A 3TZVB 3CFDA 3MJ9L 1JNHB 1GZPB 4ZFOL 3TBYB 5HDLA 2Y1VA 4U1SB 3W11C 1FNEA 1JUFB 4PJBF 1LILA 3EYOB 1IQDB 1UZ8A 4Z7VB 4BKLA 1Q9KB 5B3NA 5B8CB 1S7XB 4FQXB 3VXRA 5EUKA 3N85H 5IBLC 3GSWB 4XP5H 4JFYB 5CIPA 1CGXA 2EYTB 4UBDD 1B3JA 1JRHL 4ZNEA 4LEXH 3BHBA 4PP2A 4EN3C 5BJTA 1AP2B 4GBXD 2FRGP 4CVZA 5A3IC 4NZRH 2D0GA 3G5XA 2Q6WA 5D93C 3UBXI 4BQCA 4HLZG 1H3PL 3MA9H 1BOYA 4R8WL 1NL0H 2JELL 4UT7L 5M94B 2IF7A 5FYKU 1MNUL 2NY1B 3KDMA 5C0CD 2XY2A 2WINA 1YA5A 1UM5H 3S5LB 1KFAH 3O0RL 3PQYE 3ARGD 4JZJC 1FN4B 3KPQB 2X40A 1A4KB 2PCPB 4F58H 4J6RH 5GS1C 1NUNB 1YEEH 5L9DL 3FB8B 3MTRA 2OR7A 3GMOA 3MV9B 1U8MA 4IBLT 4HCRH 4F7TA 4MJ6B 2DLEA 2XN9E 1ZA3A 1NFDB 4Z7UE 3HUJF 1AD0B 1DQML 1UYWH 1VFAB 2BRQA 4JY6A 1JF5A 4FQLH 4MXQD 3OQ3B 4BK5A 3NTCH 3SBWA 4W6YB 5AZ2L 4MMXC 3VXMB 3GSVB 4PUBL 3MXVH 2CGRL 2OX5A 2C3WA 4E5XB 5J11B 4U1HB 1JNHA 1GZPA 1FNSH 5F1OB 3Q0HA 4X8XA 4WENB 3U83A 4FABH 3EYOA 3U4AA 3S35H 5B8CA 1PW3A 5C09B 3A67L 5FAAA 4Z78A 1OQXA 3EGSB 4JFYA 5K9KB 4WW2F 3JWDH 4POZC 3GNMH 2WZPD 3ALWA 4WNQB 3ZE0F 4DGIH 2VLRA 5DJ6B 5I1DA 3EJZD 1HIML 3CSYB 4YFLF 4AEIL 2FX7H 5HI5C 2C3VB 4K7PX 4M4RA 2YPVL 4X5LA 2R2HB 5I1IL 3BN3B 4OQTL 1GIGL 3CZFA 4Z18A 1IGIL 4JGJA 5DK2B 4FXKB 5F7EL 3EOAB 4ERSL 3V95A 3U1SL 4GAGH 1FN4A 3V2AR 1GPOL 1A4KA 2PCPA 2R23B 4GG8B 3RGVB 1PQZA 5TF1H 1Q8MA 3WFDL 4S0TD 3IFNL 2Q7YB 4IDJL 1JZ5A 1FV1B 4UBDC 4X4XB 2VZ3A 3H3PH 3DPBA 4WFED 4MJ6A 1PKQB 5C71A 1NFDA 4N8VB 2B39A 3E2HC 5LCVL 3LPGA 4PJ8C 2EH7H 1A7PL 5E95B 3VXMA 4LCIH 5F44A 3BEWA 4PRPA 2BOBB 3MMEA 2EDTA 3C09B 4K23L 2BVYA 1MCKA 4JO2L 3X3GL 4XHJD 1RUKH 5A2FA 5C09A 3BW9A 4FQHA 3CXDL 2ID5A 1WWCA 3WNKA 1BM3L 1GOFA 3W81A 4DCQA 4WNQA 4TUJB 1BFSA 4RISH 3KPOA 3QO0B 3SE8H 1YMMD 1HE7A 4PB0H 3R8QA 5HGDA 4E41D 3IDJB 2UY6A 2C3VA 2R2HA 4L4TB 3V6ZA 4KGLA 2QR0A 2IBGA 3IAGC 4RGNE 1D6VH 1JWUA 1IAMA 4P9HC 3LKQA 2R23A 4GG8A 1V3MA 1T6WA 1WCBB 4Y4KB 4XC1L 3CXHK 5GISH 4S1DC 2XNAB 1RFDH 3NOIA 3LVEA 3O8XB 1FV1A 3M8OH 4X4XA 5IW1A 4U2ZA 3VMNA 5IVNA 3AY4C 4GKOA 5C0NC 4LQ1A 3OB0H 1XAUA 4QCIA 3RRQA 5CMAA 1V3KA 5ID0B 1OW0C 1JMZA 4CVWA 3AM8C 4A6YL 4MA7H 1ADQL 1QBAA 4JPIA 3WD5H 4MX7A 5IHUL 1KLUA