5H35B

Crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DIVMTQTPLSLPVSLGDQASISCRSSQFIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Crystal structures of the TRIC trimeric intracellular cation channel orthologues
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/membrane protein
total genus 49
structure length 217
sequence length 217
chains with identical sequence G, I
ec nomenclature
pdb deposition date 2016-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35B01
2VSDA 1P6FA 5FGBC 4CNIB 1RPQA 5JR1L 5I8OH 4PRIA 1Q1JH 1QEWB 3REWA 4HHAB 2CDEA 2DYPA 4PRHE 4B50A 5CHNB 3EUUA 1IGIL 3TIDA 4JY6B 2YMXL 5T1KA 5J12C 1K4DB 5CBEA 2HAZA 4NKMA 2CK0H 5DZOA 1ZLUK 4JKMA 2IQAB 1DQQB 1T0MA 4X4ZA 2OBGA 2XTJE 1MCSA 1LO2L 5JDJA 2EH7L 4LNRB 1CZ8H 2GQHA 5D71L 3TFKD 1QRND 3O45A 1XCQA 3CK0H 5D7SH 3HE7A 2WIMA 4QHLA 2H6PA 4X7SH 4GJTB 1OF2B 2IALB 3RPIB 1JFQH 4N0RA 2WINA 1FH5H 4JGUA 3D9AH 4GAYA 5F9WC 3QQNA 5BOPA 3HI1A 5DJ0B 3QFJE 3DV4B 1QSFD 1XGTA 4MB3A 5GGUB 1Q9WB 3O2DA 5DQDL 4UT6L 3MRJA 2GJ6B 1WIPA 4WW2A 2ZJSH 1EJOH 4ZXBA 5AZEL 3MLUH 1BD2E 3L7FA 5TE7H 4V2CB 2CO7B 3IDYB 3U4BL 3KR3L 3PL6B 3GIZL 4O9HH 3O4LE 3D39A 3O9WB 5HDLA 3KPOB 3VFSB 3EZ8A 3ARDB 4ZUTA 1NFDF 4RA0C 4KUZH 4U1IB 3V4PH 3GDBA 4R26H 3V4UL 3IS1X 2Z8RA 3IDGB 1GC1H 1S7QA 1CBVL 2BNRD 2HP4A 3QFDB 1IFHL 2ZPKL 5IJKA 1E4WH 1ES0B 3QH3B 5D2LA 4P23B 4FQIH 5J7CC 3RHWF 4PBXA 1S9VB 3MLTA 2Z31A 3GUTA 5HDBF 1MFAL 4U1NB 1HILB 1MCRA 3O6FA 4URTB 1CE6A 3C60D 4PJBA 1XF4A 5GZND 1UWXK 2EYTB 3DMMA 3SDCB 5F8RC 3U4AA 2VYRE 3DVNB 3SY0B 2EE9A 2IANE 4XNXH 4FA8A 2H32B 3CGTA 3MR9A 3NIDE 5E9DD 5IF0B 2ZUVA 3HE7D 3SE3C 4PYGA 5JPMA 1JUFB 4R3SB 1ZHLB 4WU5B 5J3HD 2AV1A 3FHQA 3MV7B 5ALCL 4RQQB 2X4UB 3UTSA 3ZDYF 4WI8A 5EC1B 1INEH 2BY3A 4HGWB 4HWBH 4PJDB 4GRWH 3FCTA 1VDGA 4P9HL 4K7PY 3NPSB 5AD0A 5DJZB 1VEOA 1Y6KR 4WI9A 3TN0A 1P2CB 3FB8B 2VL4A 4Y5XA 1Z3GL 2X4PA 3ZL4L 4DVRH 1H3VA 4QCIB 4XVSH 2R2EB 4HXBH 3MJ7B 4O2FB 4ZOAA 1I7ZB 2XN9B 3MV8B 2CO6B 3GSNB 1DQJA 4LEOA 5H2BA 4WW2F 4TTDC 4XH2A 4P3DA 3OQ3B 3WE6B 5IMMB 3O3BB 4O5LH 1AXIB 1CU4H 5CKGA 1VERA 3KPMB 1ZA3A 4S1DC 4EDWH 1V7NL 1ADQA 2Y5TA 3QEHB 1OL0A 3RWGB 4Y19E 4AEIH 3IDXH 2JCCE 1TFHA 5I9QB 3O6FD 3PHOA 4KQ3H 4L8DA 4MA8L 1FGNH 4DKAA 4YHYB 2EDWA 3WJJC 3O4OB 1EXUB 2Q8AH 2NR6C 1FAIH 2X1WL 1Q38A 3AU1A 1HYSC 5MERA 4TNWK 5E8DL 4JQVC 1T2QL 1NC2B 1W72L 4FQXD 3VGDA 3BQUC 4QOKB 2M2DA 1U6AH 1UYWL 2W60A 1HHJB 3EO1B 5B38B 4HIHA 4O00A 1FRGL 4NJAL 4KKCD 4OJFH 4PB0H 1CR9H 4AEEA 1AGDB 4V1DB 4PJBF 5K33A 3UTSD 3O3DA 3FOMB 3CVIH 3B8YA 1U92A 5JORA 1FFQA 1B4RA 5DUPL 4YH6A 1KB9K 2BP3A 1JNHA 1DEDA 4IOIA 4P3CH 4HKXA 3UBXA 2K3TA 2QQKL 1OHQA 3GMQB 4DK3A 4PTTB 1BAFL 3RZCC 3H3PL 3SE9H 1OTSC 3SJVB 5FOBA 3BO8B 2E7LA 2B1AL 3VH8A 2VKXA 1CDCA 4Z8FL 4YX2L 2XG5A 2OX5A 5D7JB 3K81A 3B9EA 5E4EC 4XPBL 1NGQL 4OF5A 5CZXC 2UWEA 3X3FL 4HIJB 4PJ5B 3BEWA 5EU7C 4JN2B 3WFZA 4LASH 1MWAA 4K23H 2JIXD 1SMAA 3CFEB 5CD3A 1FFOB 4KRPC 2F8OA 2Y07L 1FFPA 3ZHKA 1MFCH 4UNTA 3WLWC 3C5ZA 2OJZL 5GIRA 3TA3D 43CAA 3BGAA 1B3JA 4FG6D 3HUJE 2W9EH 1ACYL 2WIIB 4IMKC 2D4DA 2EIZB 4TRPL 5CIPH 1AO7E 4HT1L 4UU9B 5DJ6A 5SWQA 4AMKH 3ALWA 4D0DA 2YEZA 1CICC 2FIRT 4UIKH 4NKDA 4F9LA 3OG6B 4ZUWA 2GFBB 5CEZL 2XY2A 4GRLC 5HGGS 3RVUC 1CGSH 1FCGA 1FL6B 4FQJL 4F2MA 3GBNH 1LMKA 4Q9QL 2HG5A 4YDKH 4AK1A 1S5HA 4EI5A 1RY7B 2FIKA 3ARRA 3CH1B 4IJ3C 4HS3A 1MFDH 2IAMA 3LKPB 3VRIA 1RIVL 3WEXB 4M7JL 1PZ5A 1YY8B 4JZOB 3N0PB 4KHXH 4NO5A 4WWKC 3QIBD 1EEQA 3WL9B 1JNNL 3BIKB 2DQGH 1IEHA 2NX5B 2VN4A 4E41B 1MHCB 4HIIA 5ICYA 4YPGB 2C7UA 3W39A 3P4LA 2A9NL 3GMPB 3RL2B 1PY9A 1S7SA 4BFIB 2PXYC 4OUUB 4GKZB 4RMUA 3OXSB 3VG0L 1H3TA 2C26A 2B20A 1QBLH 4JFED 4K55A 5I19L 3DX8B 1VFOA 5KS9B 2AJ3B 1N3NA 4Q2ZA 1IGJB 3BT2H 5GSVA 2UYLA 5C0FB 1CLYH 4EQ3A 3PV6B 3VXRD 2OR9L 5I8KH 2XQBH 5FUCC 3KVQA 1IEBA 1MHPL 4OQTH 4X8JB 1U41A 4ODVH 4W70A 3MJ6A 3NABH 3KPNA 4JG1H 1HZHL 3WN5A 2I60L 1EX0A 1VFMA 4LHJB 1ZHBA 1PG7W 1PEZA 2UWEF 1MCWM 1S7UB 3JUYA 1MFBH 4K3JH 4LSVH 1SQ2N 2HN7B 3NFSL 4MX7B 1R5IA 1V7ML 5FM5O 2Y36H 5DA0B 1YQ2A 4OM0L 1E28B 3I9GL 1IBGH 4LQFL 5IB5A 3WIHL 5D1ZD 2EICA 1XGRB 5FUOL 1UJ3B 4Q9RH 2Z93B 4RGMB 3PABB 2XV6B 5J4MA 4LLYB 1I85A 3VXOA 3A6OA 5EIIA 5FYKH 1QFOA 1OAKL 4P2RA 4P9MH 4NJ9H 3K46A 2LE9A 1IM9D 1U8HB 3QUZC 1KB9J 4U1JB 1YECH 1NBQA 2IH3A 2Z35A 3X3GH 4GMTH 4Z7WE 3B9VA 4N5ED 3GRWL 4MWFA 4B53A 4WENB 3VXMB 3U1SL 5EZJA 4GG6A 2VXUL 4ZUUB 3TV3H 3F7QA 3T08A 3D85A 3MLXH 2AK1L 3LMJL 1X5AA 4AIZA 4EIGB 2OXHA 4OM1H 3ILPA 4UV7H 2OTWA 5MEPA 4M43L 4PJHA 4R0LC 1A14L 4UQ2B 3DX7B 3R06A 3SKMB 1HINL 4MJ6A 1IQWL 1MAKA 4JFOA 2F53B 1OB1A 4UT7L 2AJZB 2BY1A 5D2NB 2FX9H 2VZ3A 5DF0A 4HZLB 1XT5A 5DD3L 3BD5A 1VACB 3MLWL 2KUTA 3NMEA 1YY9D 2D03L 1X5GA 4D0BA 1I8KB 5FO9A 3HRZB 2L4OA 4HMCA 4ZG1A 1MJ7L 32C2A 1RFDL 4J3UA 1HHIB 2ICEA 2MCG1 1KXTB 4EQ2A 2J88H 4RWYH 4TOYL 4NQCB 3V52L 1I3GL 1UM4L 5H8DA 4XNZB 4GBXC 3L5WA 4G6KL 5C0DB 3TP4A 3GMLA 4MNQE 2FATL 5IV2B 2R56H 5C0ND 4BZ2L 3CFKA 1K8DA 3V0VA 5BXFA 3EJZD 4U1MB 2X4OB 3ALXA 3BN9D 4RZCA 4F57L 5I75B 4JPIA 4P2RD 3IFOA 1MSPA 3V6OE 3V8OA 1NLDH 4JGMA 5F7KC 2R2HB 4ODWB 5EIQA 1T83C 4HBCH 4CN4A 3Q6GH 3ZMRA 5I2IB 3RGHA 5D7KD 1QFHA 1RUKH 2W07A 3UTZA 5BJTA 1ONQB 4YZFF 1CT8B 1TJIH 1QFUL 4OKVA 3ZE2F 5DYOB 5KZCB 4XXCC 1SJEB 1I9RH 1W72B 4GRWB 4S0TD 5A16B 4R96A 1W2KT 4Y88A 3DV6B 2FO1A 1BHGA 5LAXB 4J3OC 3D85D 1BEYL 2ID5A 4RFOH 1A2YA 2AW2A 3MA9L 4X5WB 4N90E 3ZTJH 1B9ZA 2NY1D 1OP5H 2DDQL 2EE3A 4UINL 3KPSA 3OAZK 5F44A 2XKSA 3OX8B 4M62H 4ZUSA 3DRQB 5BO1H 1IAKB 2NY0B 1UACL 3LQZB 5CGMA 1RK1B 2IPUK 2VWEE 5IMOB 1OM3H 4NFBA 2E3VA 4GG6F 5T5FL 2J1KA 1OAUL 1K2DB 1OD9A 1PKQA 1JPGA 4PV9A 3GSOB 2V2WB 1PX4A 1M71A 2ED7A 1YEHH 2EDBA 3IETB 3RPKA 1CQYA 5I1GL 5BRZD 5FHBH 1JWMA 3RA7L 3X13A 4PJHF 4KKLD 1NMCC 4IOFD 3M8OH 3PQYD 3ZSTA 5CCKL 4PLOB 2YRPA 2ICWB 5JIIA 1S7XA 3E8UH 4ONGH 4HDIB 4M5YH 1CFQB 1E4JA 2HTLC 4EOWL 4GKSA 4UB0L 4TSBL 5GGVL 3UJTH 4F33A 3JTTA 5D1XA 3QDME 5EH1A 2RIKA 3OPZH 1JGVH 3UTQA 3HS0B 1F4YL 1Z9LA 4JFQB 5KVEL 4MJ5B 3AGVA 3BSZH 3SDYL 1E4XI 1S7WB 1INDL 2Y6SC 1XIWB 3PGFL 2Q8BH 5MENA 1X6NA 5A2FA 3FB7B 5FKAA 2UZYB 4JO4H 4Q6IB 3TVMD 4QWWC 1T4KA 3MUHL 4JQXC 5E94A 1A6TA 1AGBA 5TQ2L 3QCUL 4RFNC 4XRCA 3U7AA 5DK2A 3ARED 2CIKB 4FZEH 4K8RD 4F7CB 4DW2H 2Q86B 5IGXH 5I66A 1F2XK 4DGIL 1KB5L 2DF3A 3BDXA 1OAQL 3O2VL 1F3JB 2PR4L 4GUPA 4ZUVA 3LHPH 5KJRL 2IMMA 1DZBA 2AXJA 4QRQB 5KSBB 2PKDA 4POZC 4ENEC 4PJEF 5EC2A 5ADOL 4WFEE 3HNVH 3NFNB 1KJ3H 1ZTXL 4WFGE 3ORJA 4G9FB 4IIQC 1QYGH 4TUKH 5AG8A 4YAQB 4MJ4A 1JRHH 3BGMA 4LBEB 2ZOLB 5F89B 3LN5A 1EUUA 4ZOCA 3RNQA 3F65A 2AJVH 2GCYA 5I76A 2EEBA 4HG4K 3WHXA 3RBSA 3CSGA 4Q0XH 2F8XC 2NY3B 4P2OA 1DN2A 4Y4HA 2W0FA 1RUPH 3P9MB 3UDWC 1MFEL 3L3OA 1MY5A 4YO0A 5A1AA 2R9HC 1HDMB 1WV7T 4QRRE 3JV6B 4XPHL 3HNSL 5CFHA 3P40A 1LO4H 4FTVE 4GKNA 1GGCH 4QTHA 1PBYA 4YBLC 1ROWA 1IC4L 4MXWL 5MEND 3C08H 2EXYD 4MS8D 2KZWA 4J4PA 1A6WH 1L0YA 5KOVC 5D1QA 3DGGA 4CJ1A 2GSGA 3QA3B 3O41B 4LSDA 2PTTB 4FFVC 4LSRL 4MD5B 1EO8L 4PGCA 5CWSA 3ZSSA 5I71B 2DKMA 5D7IE 4PRDA 2X70A 3Q3GA 5E56A 5DRWB 3DURA 4JHAH 5C0BA 3RUGA 4XI5D 1KC5L 5HVWA 5GSRA 1J0JA 5I30H 5F21B 3T65B 4JFDE 2ZCKL 5L8JB 2EIDA 1KPUA 5FM5M 3VGGA 1C5BL 2I07B 3EO0B 1U93B 4L3CB 3D3VD 5E2TH 1MCPL 2VUYA 5MP6H 1BWWA 1FVEB 1NGWA 3NN8A 3AY4A 3QUYC 1XF2B 4OZIE 3BRDA 5TFSL 5C0EB 3H9SA 1CD8A 1MJ8H 5DC9B 1FYTA 2J8UE 4NHCL 4EBQH 1I8IB 3NCFB 3B9KC 2NY7L 3BP6B 4P2OD 5E5RB 3A6CH 4KKBC 3ILQD 3QCVH 4WV1C 4HQQH 1QLEH 1QRKA 2YPLE 4Y5VC 3U0TA 4K9EC 3JWOL 3ARGD 1JHLH 1AFVH 4FXGB 5KSAA 4LVHB 3MUJA 5I1HL 1HN1A 1M6OA 3EYQC 4NM8L 2FEEL 5ISZA 1V5JA 3ZTJG 4P2YA 5FF6A 2A73A 1OTTD 2VXSL 2R23B 3GJFB 3OR7B 4X7EC 4KWUA 2ERJC 2FJFB 5EU3A 3VE0A 3S35X 2NCMA 2EDJA 4O51A 3IVKA 2IG2H 1CE1L 4R4ND 3BP7B 3TT3L 2G60L 4XTRD 4HPYH 5T1LD 2E6JA 2WUCH 5J1AA 2V9TA 5I1KH 4Y1AE 3RU8L 2VDRL 4XBPB 3QWOB 1IC5L 4DN3H 5F1NA 4U0QB 4JPWL 5C0BD 1BF2A 4LL9A 4NRZA 4ODBD 3ZT7A 3O2WL 3CNKA 5CINL 4IRZL 2P7TA 1KULA 2QLVB 3AC0A 5HTSA 1RD6A 5K9KB 1PEWA 1KN2L 4PP1D 1R3HB 1JZ3A 4NC2B 2AGJH 4M48L 2XKNA 4AZ8A 1KEGH 2C3XA 2DI9A 4U1SB 4P57B 1G6RL 5EO1B 4TNVF 1QP1A 2VLKB 2E7BA 3RUGF 4RMRA 5IFAL 3JWNC 1EHLH 2HVKA 3U7WL 4LMQE 1KCUL 1JZ8A 2BVTA 1KJVA 1WWWX 4HKBA 5BVJB 3QI9D 4TUJA 3MJ8A 5EO0A 1DBJH 2AI0L 5KVGL 4K2UH 3DXAB 3I50L 3IJSA 5C08D 4HG4J 2OS7A 4Z78A 4KROB 4NFCA 5T3XL 3HAEH 4NC1E 1RUML 4NN7C 5I1IH 5E5UB 3FRUB 4MDJB 3AM8C 4X7TB 4ZAKA 4YHNB 3VXSD 3UYPA 2YWYA 5ETUB 3K4AA 1SYVB 3F6IA 3BKCL 3ARBA 1HYRC 2D7TL 1TJHL 5HHQA 1HEZA 3ROOB 1B6DA 4PJ8A 4M8QA 4OGAC 3QO0B 5HYSA 3ZT5A 1GAFL 2VR4A 4PJCA 4WIQA 3DX9A 4MNGB 3MRQB 1A6PA 3HPJA 1EJ6A 3CFDB 1I7TB 3TFKC 3FO2B 5GJTL 4P0DA 2P44B 1MREL 3P3YA 5HYEA 5DS8B 1QA9B 1U42A 3S6CA 5TDOA 5E8EB 1NANH 4F7TA 1AP2B 1S7VA 1Q9OB 4FS0A 4QGYA 1NFKA 4HH9A 1CF8H 1YDPB 4NQDD 2VR5A 4DOHB 3ZKNC 4PGJA 4XVTH 4NNYB 1BBDL 5JLZA 3MMEA 5KTEL 2QSVA 4FRWA 3C6SA 4NZUH 1CL7H 5HI4D 4JPVL 4H1LH 5JHDD 2D31A 5F9OL 4KK5C 4HK0A 4OB5H 3QQ9C 1BBJB 5A2JH 1U8PA 3SPVB 4OLVH 2DTML 4O58H 5CS7A 4FQLH 3FQRB 3G5XA 1LO0L 3BKYL 3CXHK 4HXAL 3VCLB 4HPOH 4I0KA 3QUML 4YHPA 3NVQA 3TO4D 3H7LA 4G6ML 4X5LA 5LGJA 3WNMA 1F6FB 3VFWB 3GEWB 5E6IA 2D7OA 4ZAKD 3RVXD 1JGLL 4JJ5B 1DTUA 4FQ1H 4Y16D 5FHAL 4JRXA 4NWTH 3QZWA 4JY5H 4KZDL 1Q94B 1P69B 4I5BA 1P4BH 1P4IH 4EXKA 3UMTA 2ICWI 3QNXA 4HKJB 1KJ2H 3FFCA 5B8CB 3PWNA 1MJJB 1WVZA 3MBED 3VDAA 4ZFFA 2ZKHL 5ALBL 1RAMA 1Q9LB 3HE7C 1JPTH 3MCKB 1DBKL 1ACZA 1OY3B 5J3HC 2DLEA 2Q1EA 1WF5A 3HG1E 5KW9L 5D7LD 1MFNA 2R0KH 1GOHA 4I4WA 3TBVB 3DROB 4P2QB 1U58A 5GGRB 5K9JL 2IBBA 2ZG2A 3DRTB 2H2SC 1ZWIB 4PJCF 1BQSA 4PJ7B 3DIFB 4X5XA 4XC1H 5KSVB 3MFGB 2PF6A 3U30B 1XGPB 4NPYB 4NQEA 4ZXBC 3CC5A 3S5LG 3QEQB 5C3LD 2EH8H 5KVMC 3LV3A 4R4FL 3VMOA 4GMSL 1AH1A 4C55A 3SKJL 4L8SA 4HUKB 1T66C 3HZKB 4P4KB 1CFSB 2QV2A 4ZOBA 1BJMA 3FT3A 1MJUH 1I3VA 2DQDL 2EZ0D 4L4JA 1JF6A 5IJKC 2YWZA 5FCUL 5KAQG 2EKJA 3IFLL 2ZNXA 5KN5B 4MXQC 5DMKA 4NT6A 4ETQA 4K7PH 4KHTL 3X11B 5E8OA 3CCHB 5FYLH 1RZIA 2GITB 3O6FC 1CXHA 4C83A 4QRPA 4I3RL 5DWUL 1E6JL 4WWKB 2ADFH 3DMMC 1U3HA 1NLBH 4EN3B 4S1SH 1BM3H 3ARQA 4JO3L 3KXFD 5B3JF 3VI3F 3FFCD 5F70A 3STBA 4KV5E 3OKDA 4G6FD 2DMKA 3HZYA 1BZ9A 4OCSL 4H5SB 1BJ1J 1F4WL 2BVOA 3N85L 3SDXB 3LKRA 3QFJB 3WJLA 4MQ7B 3BZDA 4OZHE 1KLFA 4G6AD 5JNYB 3D2UD 3EOAA 3NPZB 3WXWH 5EUOE 1VA9A 2IADB 2AK4B 3HAEG 1M05A 3ES6B 3IDNA 3TPUA 3TN0C 5BV7L 5C0GB 4Y5XC 1J1XL 4Y2DB 1A47A 4IHOA 5BVPH 3OKYA 5L9DH 2UUDH 4IM8A 4K9EH 2XNAA 1MCKA 2W91A 4QY8A 5J6HB 1F58L 4Y4KA 5DJ8A 2B39A 1FAKT 3VXUA 1KTLA 3VI4F 3S37X 1X5JA 2GT9B 3F12B 3OTTA 2DWEB 3P4NB 3OXRB 4PJFA 2AXGB 5GRYA 4IMLB 4UAOC 4G8FB 3QIUB 3CXHJ 5CMAB 4ZTOL 5HYJE 4D9QE 4KGLA 5D72L 4NYLB 5B3NA 1P4LB 2DICA 1BIIA 1CS6A 1UJTA 5EU7E 4JANB 4PREB 5AYQA 4FQPA 1U3HD 3TA3C 3CD4A 3MYJA 3UPRB 2CK2A 4FG6C 5D6DA 5CP3A 1PQZB 4PD4K 3QR2A 4BYHA 2XFXB 1G6RB 2R2CA 3S5LB 3G9AB 1ZT4B 4C59B 1D5BB 3BUTA 1UB5B 4QKXB 3UTOA 3R8BB 4H1LG 2Y06L 3K0WA 3I6KA 3MREB 1FNEA 4K71B 2MMXA 1MCJA 3JZ7A 3VRJA 5IESL 1NUFA 2IF7A 5AZ2H 1XR9A 4M6MH 4HCRL 1PW3A 3ZKSD 1CIDA 4KTDH 5GISL 4JAMB 1J8HA 4XPGH 5F71A 1RZJC 1KCVH 1CK0H 4LQ1A 3VWJA 5JHLH 3LKQA 4R0LB 5INCA 1XGYH 3SE8H 4X6DA 2R69L 5DMIL 5C6TL 3MV9B 5ELIA 4M6OH 5FA4A 3AUVA 3MXWH 2R15A 3LEYH 2R4SL 2E7LC 4OLZL 3VD4A 4DEPC 4OSUL 3S4SB 3HFMH 1T2JA 5DUMH 2AEQH 2XZQL 3MO1B 4PJ9A 2VDQH 1D5ZA 3DETD 3EYFB 4OCYH 2R0WH 1K9TA 4PGEB 2OYPA 8FABB 4MCZB 1WQVT 2GUOB 1YUHA 1A3RH 1BQLH 4OZ4B 3WCYA 4CVXB 5DD5H 4BSJA 3O3AB 2VLRE 4I3GA 1OARL 2XACC 1R3LA 3STZB 1HCVA 4JM2B 1YPZE 2QADD 1T89C 3C5ZC 1ND0B 2CIIB 1OAZL 1MI5B 5FUCE 1CI5A 1OQOA 3BEVA 3OWEA 4PJFF 2X9XA 4R8WL 4X6FA 3V7AG 2DOCA 4R2GB 1TNNA 5M95B 3HMXA 4F9LC 1AR2A 1FL5A 4YGVA 4FN0A 1RVFH 3UJIH 3L95A 1P5VA 2VL5A 3L6FA 3OGOE 2DJ4A 4CADA 2X4NB 1JHTA 4F7EB 2LTQB 1CZ8L 5D1ZC 3OKEA 3GBMH 3JVGA 4PUBH 1J8HD 5HHNA 2BNQE 5GZOD 3GFUA 2IAMC 2FYYA 4BFBD 4DKEL 4I2XE 3QUMB 3T77A 3T0EA 4IRSA 3QJFA 3QNYB 2UZXB 4WHTB 3WFCL 1NGPH 3ZZ1A 2P48B 3B2VL 4X4YB 5T1DH 2HKHH 5DJCA 5IMKB 4LCUB 4XHJD 3HR6A 4JFPB 4CVZA 4CNIA 4MZ3A 4NQVB 4LCCB 4RAVA 2G5BB 2IBGA 1JGDB 5FM4A 5CHNA 2HLAB 2ESVB 4JDZB 3AS3A 1HIML 4X6DF 3JV4B 1NMCB 4KUZL 4MMZC 3GHEH 2H1PH 4NNPH 1OLLA 4H1LB 4PV8B 3KJ4C 1ORQB 3NGBB 3PP4H 3S8WA 1UWGH 1CLOL 3ARXA 4JDVA 3O6ML 3HUJB 3I75A 3V2AR 4O2CA 5C1MB 4OD1L 2IALA 3RPIA 2NTFA 3WN5C 4GAFB 4U1KA 5JOFB 4BM7A 4WO4A 5C0RH 4NRYB 1T7VA 5CEXB 1YEKL 3Q1SH 4LSSL 5DT1H 5B4MD 5GS3A 2JTDA 3R1GL 4PD4J 4XNXL 3KPRA 5SWZB 3WNNA 5H94A 5CD5D 4HUWB 3PL6A 5IB3A 4APQD 3LD8B 3S96B 3TM6A 1LEIA 4M1CD 3KPOA 4PJIB 4W81A 4JR9H 1IAIM 1OTUD 5C0NC 1I85C 3T0DA 3RNKB 4U1IA 3EJZC 5GRVL 3BN9C 1T1ZB 5I18H 2GIYA 5EU4B 2JJTA 2DQHH 5BS0E 2VQTA 1X4XA 1YEFL 3FO0H 3QH3A 1T7WA 4YDJA 4LHQB 1S9VA 4G5ZL 5IT2H 3UXFA 4DVRL 5FB8B 4U1NA 1HILA 4M7LT 1YQVL 3B5GA 4DGVH 4QHUB 5J56B 1A9BA 1V3JA 4YHMH 3ET9F 2A0LC 4PR5B 2EYTA 2W59A 3SDCA 3DVNA 7FABL 2W65B 2NY1C 2QTEA 3K4DA 3SY0A 4LEXH 3ALPA 4L3EB 4OF6A 2P5EE 4IDJL 2B2XH 1ZGLA 1N6UA 2Q76A 1G7PB 3BJLA 1CU4L 1Z9OA 3C9NA 5IF0A 2BNUA 3FRPA 4M5ZH 1JUFA 2P47B 1ZHNA 1NEZG 5D8JL 2VC2L 1ZHLA 4WU5A 1IKNC 1OSZB 2JJVA 4XWGH 1G7HB 3Q6FB 5B39G 4RQQA 1KEMH 1GSMA 5BV7B 3RI5F 2EDNA 4HGWA 2ADIB 4PJDA 2GJ6D 4GXVL 1MHHB 1PAMA 5DJZA 4IOFC 1QBMH 1I1AA 1IGYB 3FB8A 1FNGB 1UH3A 3O9WD 2O61B 5EWIH 2E5EA 2BERA 4NNXA 4QCIA 3ZYOA 3MJ7A 2GY5A 3ARWA 3ARDD 2WW8A 2FWOB 4Z7NE 1DP0A 5KVDH 1AQDA 3CVIL 4OFIA 5FFLA 4R90H 4YGAB 7CGTA 3WE6A 3O3BA 3FTGA 4TSCL 4BQ8A 1HOCB 3KPMA 4P23D 2GTWB 3GKWH 5L6YH 3QEHA 5C07E 5SX4I 3RWGA 3FN0L 1F90H 1AE6H 1CGVA 2F54E 2X7LB 4L5FH 3QDGE 3AREC 4ZOEA 2X44D 1ADQH 4K8RC 1EXUA 3TBSB 1CWVA 2Z91B 5DK0B 5J89A 1ZT1B 3NCYS 3ULVD 4Z7OE 2FEDD 3QHFL 1KELH 2R8SL 1ZLSH 4WV1B 1NC2A 4UBDC 4BSVB 4KMLB 1HHJA 3EO1A 3S35H 5B38A 4NQXA 5ACMA 1UGNA 3GGWB 1E6OH 4H8WC 4S1RH 2ZCHH 1NKOA 1CFBA 1N0XH 3MLVH 3MV7D 1AGDA 3O81A 3K2UL 2AP2A 1Q72H 2PYEB 4U1LB 4OI9A 3SN6N 1A4JB 4ELME 2WMPA 4M9OA 4LCIH 3NA9H 2X4RA 3W5MA 4LOUC 1JHKH 3EKCA 1U8NB 1ZVSB 4YLQT 3V7AE 1MVFA 1RZJH 1FZMB 4PTTA 4XP9L 5D1XC 4NZTH 3SJVA 4L4TE 5E8NB 5L2KB 2XN9D 1TENA 3MV8D 4MXVF 3PV7A 3KNBB 4PJDF 5K9OB 1CFVL 5D70H 5D7JA 5IW1B 1S5IH 3NCYP 1FC2D 4RBPH 3UJJH 2R0ZL 1FLRH 2OQJA 2BC4B 4M7ZB 2EXYC 3F7VB 3FZUC 4MS8C 1S78D 3U2SA 3W11C 1KCSH 3CFEA 1I3RB 4LHUA 1FFOA 1DE4B 1CGXA 4M61B 2N1KA 3PF2A 1U95A 3FT4B 4YDLB 5DD1H 1MWAH 1F3DH 3QULB 1GCFA 2EIZA 1NC2D 3KLHC 4Z7QE 4QOKD 5GS1A 2CRZA 3EYSL 3FHAA 2PO6B 2AJUL 1WZ1H 1N5AB 3KYMA 1J87A 1G9NC 1HXYB 2NY4B 2GFBA 3PWPE 3TNNA 3HCVA 5H37H 1FL6A 1G9MC 4UTBL 3IRZA 4JCMA 4V1DD 5EIVA 3V6ZB 1VFBA 4JFFE 1FCCA 1T1WB 4X6CB 2VDOL 1NMAL 2VLJB 3HMWH 3LKPA 5F6IC 1YY8A 1S7RA 3ARTA 5KBNC 4N0FB 3WL9A 2V9RA 4ZFZB 3WIFB 2X4QB 4P2OC 1I9IH 2NX5A 4JFYA 4E41A 4HF5L 2IJ0C 4HH8A 4NZDA 4AY0A 5DMGD 4XCCH 4Y4HC 1TZGH 4HC1H 2DKUA 3RL2A 3BZEA 5DMJB 1WISA 1G7IA 1EZVX 5J0BA 4UOW0 4OUUA 4GKZA 5DTFB 1OP5K 3OXSA 1N4XL 1DANU 2JELH 3WUWB 4JB9H 1L7IH 4PS4L 1I7UA 1KLGB 3ULUD 2FX7H 4NM4H 3SBWA 1NFDB 2HT3C 3U36B 3BKJH 3QCTL 4YXHL 1IGJA 3BRGC 3GO1H 2I24N 5FEBA 3BDYH 4J4PC 3MACL 4PJ5D 6FABL 1M7IA 1G7LB 5D1QC 4F58H 5C0FA 5DJXB 5HGAA 4R4NC 4U4BA 3TLRA 1W0YT 4X8JA 1YEEL 1HE7A 4J6RH 3IDUA 1B4JL 3NH7L 4S11A 2VH5H 4HK3J 1UKQA 4LVOB 4MCYA 4ZO8A 3ULUF 4KFZC 1BVKA 1R3IH 4BKLB 1JPSH 2W9DH 3VA2C 1S7UA 3STLA 1MAML 2HN7A 2ZUXA 4MX7A 4PJXE 4ETYA 2R1XA 2DQIH 1NANI 2WK2A 3WXVL 4PP1C 5HGDB 4AT6B 5CJBA 2J4WH 3REWB 2CDEB 4JVUA 2DYPB 3TBWA 4EEEA 2EIBA 5C7XL 3T4YB 5T3ZD 3AY4C 1IZJA 5T1KB 5BZDB 3TF7C 3QWRD 2Y25A 4CVUA 2ATKB 2FX9L 2NY2B 1CL7I 5GRWA 4LRNL 3ARVA 2IPKA 4OFDA 2YD6A 4OFPA 4E41D 1T0MB 3QI9C 4J2XA 1FN4B 5F96H 4F15B 1CXKA 3W82A 2ORBH 4U1JA 3NIFE 2CRYA 4FTVB 1KN4L 3O45B 1XCQB 5KSAC 1AQKH 3VXMA 4AQOA 3WFBH 4WI6A 4ZUUA 2YUWA 4MNQD 5DJDB 5ESVB 4A6YH 4ZNEA 1XGTB 2IBZY 1WAAE 3LIZL 4WUKH 4WW2B 3DUHA 3GI9L 1WEJL 3RVWC 5F3HB 5D7IB 4UQ2A 3DX7A 1UKSA 2DLHA 4LARH 5IG7B 3MROB 3SKMA 2D7NA 5HHVL 3FB5A 2FH8A 3TESA 4MQSB 2F53A 1LO5A 4O4YH 2AJZA 2EKSB 5L2JB 5CBAB 4HZLA 5KS9F 1U36A 1VACA 4ZUTB 1AGCB 1HKLH 5DJAA 4GXUN 5DZLA 1I8KA 4PJGA 3HRZA 4L1HA 2HKFH 4A2MA 1S7QB 1U3JA 3D0LA 1AR1D 3WHE0 4YHLH 1QRNE 1UKTA 4UI2A 4NQCA 4JDTL 4KAQH 1VGEH 1P53A 3RBGA 5D2LB 5L0QC 2YD4A 3UBXG 1QSEA 5C0DA 2VIRB 3VFRB 1MAJA 3F7RA 3MLTB 2Z31B 4HIXL 1RIHL 4UIMB 4XAKD 5CJXA 3GSXB 1QSFE 1T80A 4U1MA 4OT1L 1CE6B 1LP9B 3QDJD 1RMFH 3VH8G 1CTOA 4FZ8H 5FHBL 2R2HA 3G6AA 4U0RC 3T3MF 4KDTA 2VSCA 1FNSH 5JDSB 1MRFH 2J6EL 1PGRB 4XMLL 3QHZL 3MR9B 5HDBE 1CT8A 2CKBL 4U1GC 5JPMB 5DYOA 4RISH 3G04A 1SJEA 2XWBA 1W72A 2BNRE 1KYOK 3UJTL 2QQLL 5IP4A 3DV6A 3DO7A 5LAXA 4DQOL 4ZAKC 2APWA 3K80A 3A6BH 4JQIH 4X5WA 2A83A 2ZSVA 2F5AL 3LPGA 2XZAH 4BUGA 4YK4C 1G1YA 3T1WA 1IGML 3GJEA 1OSPH 5EOCL 1IAKA 3TN0B 1U8IB 2QSCH 4M6NH 4PJ8C 4RNRA 2X4PB 4NSKA 3DSFH 3RJDA 3ZDYE 2FGZA 2FGWH 1ZV5A 4GAGH 4JREC 2HJLA 2V2WA 3OZ9L 5DXWA 1A7RH 1F4XL 4PJAB 1R0AL 3IETA 1HH6B 3MRHA 1X9QA 5FYJH 1DQJB 4LEOB 5H2BB 2VISB 5SWSA 4XH2B 5E9DE 4P3DB 4I18A 2VITB 3ZYJA 4U6XA 2ICWA 4LF3B 2LU3A 4HDIA 2HH0H 3GMMB 1DSFH 1PSKL 1AY1L 5C0AB 3K1DA 3PHOB 4FQCH 1FO0L 4KKNA 4PJGF 5I1AB 5EZIL 1KG0B 1YNLL 5GRUL 3WFEH 1QYGL 3HS0A 4M03A 3AU1B 4JFQA 1Z5LB 4L4VA 1FZOB 5EOCJ 3SO5A 3QPXL 1S7WA 3H42H 1LEGA 3DI3B 3S37L 4QF1A 2WANA 4ZS7L 1EEYB 3FB7A 5JW3H 5EULV 3H3KA 4Q6IA 4MA7L 5KZCD 2FZ3B 3SQOH 1H9VA 4H20H 4KY1H 3BYTA 1NCDH 4TN9A 1B2WH 1FE8H 5TPWL 4F7CA 1IM3A 3O3DB 2Q86A 5E6IC 5JQ6L 2XRAL 4OLWH 1U92B 2D0GA 4UT9L 1F3JA 1JNHB 3QBTB 1ETZA 4WJ5A 2XXMB 4QRQA 5KSBA 1J1OL 3UBXB 4KK8D 5EB9A 1HCFX 1C8PA 1Q8MA 3MLZL 4YC2B 4PJBE 3NFNA 1IAIL 1HKFA 1DLFL 4NQSA 2G2RA 4G9FA 5FOBB 1P6AB 4G8EB 4PRAA 4YAQA 3VH8B 2MTPA 4MJIB 1PG7X 4LPVA 3FO1B 1VKXB 1G9MH 2ZOLA 3VD9A 4UTAH 2VAAA 3E3QE 5MI0B 4P5TA 3U4EB 1NSNH 4YHOL 2UWEB 4G6AC 4ODHH 1NDGA 5E1AB 2P49B 5I30L 3BEWB 3UTSE 4NGHL 4PFEA 1T22B 4UDUB 3VGBA 3WIIL 2PUQT 3B2UC 2MPAH 4CGTA 1X5HA 1HDMA 4DN4H 1YJDC 3JV6A 5GIRB 2ZUTA 3KGRA 4A2LA 3UAJD 2FX8H 1LEKB 1VEMA 4V2BA 4KZEH 3TH4T 1XIWD 2YEZB 4RGOH 1QFWI 5IR1B 4NKDB 3BGFB 4K94L 4HMEA 2Q3AA 5EBLB 4ZUWB 5FDWA 5EU5B 4GH7B 4ZFGL 3QA3A 4Z7VA 3O41A 2PTTA 4MNHB 4P99A 4F2MB 5IROA 3I3EA 5IFHL 2HG5B 2Q87A 1U8QA 5BQ7B 5IQ7L 2FBJL 3S9DB 4OGXH 4EI5B 1TMCB 2FIKB 1A7PH 1A5FL 2IAMB 1Y6MR 4NRXB 3VRIB 4XP4H 2E27L 1O5DT 1KYOJ 1RJZA 1S9WB 5HVHC 4NO5B 3WIHA 1U3HC 2B1HH 2VQUA 1XR8B 3T65A 1REIA 1GPOH 3QWQB 3S36X 2RAMA 4NN5B 4JKKA 2C7UB 5CKAA 1RULL 3EO0A 1U93A 1BVZA 4L3CA 4G9FD 3RRQA 1S7SB 1RU9L 3LCYA 3HG1B 4QNPF 4PGDA 1IGFH 1XF2A 2DJUA 5C0EA 1MCCA 4Y1AD 3WJLC 5KSBF 1CLZL 1MPAL 3BUYB 3KWWB 5HHPB 1N3NB 4Z9KB 3BP6A 2NY3D 3GRWA 2QHRL 3U0WH 5GSVB 3CSBA 3ZKQD 1IEBB 1JF5A 4CDGC 2P46B 3FO9A 2NZ9C 3N1FC 1NBZA 4FXGA 2QHLA 5TE6L 3BH9B 3NTCH 3RWEA 4W6WB 2R23A 4Y4KC 5H35B 3GJFA 5C0CA 3BP4B 3GIVA 4XGZA 1R5IB 1ZANL 5JXAH 4KPHL 3DETC 4JO1H 1XGUB 1EAJA 2EC8A 1KCRH 1MCNA 1B0RB 1JWUA 1OCWH 4JFEE 4MAYA 4QHKJ 3DECA 4XBPA 4M1DL 1GL4B 1MEXL 2F5BL 1IILE 5M7QA 5DHXB 1FSKC 2HWZL 3VXOB 1HQ4B 3VXRE 1SYSA 2GSIA 5GPRA 1I1YB 4ODTH 5D6DC 5F3BB 3ISWA 1QTYT 2ZSWB 4Z7VF 5ILTL 5T33L 4OCMC 3G08B 1R3HA 1BFVH 4ZO7A 4RMSA 1JYVA 1MQKH 4WDIB 2J7LA 4H26B 4LLQA 15C8L 2YR3A 4U1SA 4P5KB 5EORH 1DQLL 5EU6A 4AM0A 2JK5A 1ZLWH 5EZJB 1S9YA 1U9KA 1S7TA 5IVXB 4B5EA 3V5KA 1NBVL 4BFEA 2DD8L 2CKBB 1XEDA 5BVJA 4AIZB 3LS5L 1GRWA 5GZOC 2E9WA 3KYNA 2OTWB 4KVCH 5MEPB 5F7HA 4LCWA 3VWJC 3CLEL 3DXAA 1UB6B 5JIHA 1EPFA 1OGAB 5L8KB 5JIKA 4IS6B 3MPCA 1OB1B 2LABA 2C4FU 4XHJC 5C9JB 2KBGA 4MQXC 2NXZB 4MVBC 3FRUA 1FYHB 2I27N 3C5SA 1LDPL 5IQ9B 4DKDC 4EZMA 32C2B 4PJ9C 5DC0A 4IRJB 1UCTA 4HFWB 3UCRA 5LGHH 2A6IB 5ETUA 1UZ8A 2FR4B 1SYVA 4O58L 2ZWLT 1L0QA 4BA8A 5FGRA 1XH3B 2EDHA 2VDLH 3ROOA 3MGAA 5FYKD 3QO0A 4I0CC 3CDCA 3EDKA 1GZQB 2ZZUT 3V5DB 1MH5A 4MNGA 1PLGH 3AMLA 3CFDA 1HNGA 1K8DB 3CFKB 3R0MA 3QXAA 5EZOH 4RZCB 5DS8A 4JPIB 1U8JA 3IFOB 4DTGH 4F37K 1AP2A 5SV4A 3NACL 1S9KC 1MLBB 1Q9OA 3UP1A 3QYCA 4FFZH 3QIWB 4DZBB 3VGFA 1FO0B 3UTTB 1DVFB 2IFFL 5BJTB 3WLBB 4NNYA 5E03A 4DUWA 1FV1B 2UUDK 1YNKL 5F1IA 5FO7B 4KK6C 2VLKD 1YEGL 5HI5D 4R96B 4M02A 2HFGL 1OPGH 3T4AA 3ZE1F 3JVGC 1BBJA 1A2YB 4M1CC 3WO4C 1TVDA 4GFTB 4IRSC 4JZNB 4YZFE 2BOCA 4WCYH 3DXAD 3KPSB 5LXGL 5JTWA 1P7QB 1A7OH 2YBRA 4ZUSB 4KROD 5AEAA 3VCLA 1KB5A 2A9MH 1AKJA 2DQEH 4P2RE 2MHAB 3AROA 5HHOA 3KYAA 1LK3H 1EAPA 4PV9B 3VFWA 2EC9T 1GGTA 1M71B 3RTQB 2Y5EA 5D7KE 4MDIB 3BZFB 3SDDB 3X13B 5J11B 2OL3L 1Q94A 4QHNB 3EBAA 1SEQH 1MCQA 1GHFH 1DQDL 4HKJA 1S7XB 3L3HB 4JRYA 3FOLB 2VXQH 1YPZB 5I8EB 4B41A 2EO1A 5E4IA 3WNKA 3DUUB 5FO8A 2WUBH 2AEWA 3MCKA 4PJHE 5DURB 3UTQB 1HH9A 4J8RB 2A77L 5M94B 3TBVA 3MTRA 3DROA 5GGRA 4YHZH 3N9GH 1Q0XH 3DRTA 1ZWIA 1SJXA 3DIFA 4HBQA 1BP3B 5FYJU 1T4KB 1W8NA 4XC3L 3ESUF 1XGPA 2CLVA 4NPYA 1A6TB 1D6VL 5BRZE 3IDYC 5DK2B 4HUUB 4XZUB 3PL6C 3QEQA 5HHMB 3RWDB 3L1OH 2GY7B 3PQYE 4X80H 3DNKA 1HYSD 3BQUD 4XPFL 4AL8L 4P4KA 3LSOB 3EGSA 1Q0YL 1YC7A 4M7KL 3UBXI 4ELKA 2JJTC 3DYOA 3LQMA 3MFFA 5EC2B 4PRHA 5LVEA 4RDQF 4LSUH 4P23C 3NCJL 1NCWL 3X11A 3PDDA 3WUZA 4DGYH 1A1MB 1RUQH 2EEAA 3B6SB 4UILH 1R3KA 3LN5B 3RNQB 3RVTD 2X6MA 2GCYB 4LIQE 3EFFA 1CDUA 5I76B 4PJEE 3SDCC 1G7JB 3WHXB 2LAAA 4EN3A 2XA8L 4YE4H 2R0LH 5E2UH 1KBGH 2DIJA 3MGTB 4XMKH 5GGQL 3RDTB 2MKLC 3QAZB 4D9LL 1OTSD 4YO0B 1SY6H 1O7SA 2DM3A 4DFHA 4H5SA 1ZEAL 3G6JE 3B9AA 4XVJL 2UV3A 4D8PB 3BZ4A 2EXWD 3EFDL 3RHWK 1DJSA 3QFJA 5HYJD 4MQ7A 3RWJA 4HEME 5FYJE 4P2QD 4GO6B 2NY5L 1PKQE 1BD2A 5FA3A 5D1QB 3CDGB 3DGGB 3NPSC 2IADA 4KJPD 4OCXH 2AK4A 1RZFH 3O4LA 1CDGA 3WFDL 2P5WB 3HR5B 4GXUM 5CWSB 1OP3H 5HPMB 4PRDB 3Q3GB 4Q6YA 4QEGA 4H25A 4LAQH 4P4KD 1NL0L 1IT9H 5J6GB 1OT2A 3FFDB 3RUGB 1IC1A 5GSRB 4U3CA 5C09B 2PYFA 4GRLD 2DBJA 4ONFH 4XPGL 2VLMD 1EBPA 1UA6H 1Z0MA 2DWEA 3OXRA 3RVUD 1PX3A 2AXGA 3E2HB 4PIRF 3VD3A 4IMLA 1TJGH 3MLPA 4MJ2A 2PETA 2VDMH 3EYOB 3QIUA 5CMAA 1M7DB 3NN8B 4ACPA 5HYSG 5F9DC 25C8L 3CH8A 5MENE 4NYLA 4YHYC 5I9QC 1P4LA 4RMWA 4JANA 1FYTB 4PREA 3O4OC 4WWKD 4K3DH 4EN3D 2IANA 3UPRA 3RGVA 5E8PB 1A6UL 2P8PA 3SCMA 1G6RA 3HNTL 1UM5H 1ZT4A 1T0NA 4X7FC 1D5BA 2PXYD 1UB5A 5CP3H 1KUMA 1IC7H 4UZGA 2A74B 2QKIA 3MREA 1NFIB 1OAYH 3F7YB 1NUDA 1M6OB 5ISZB 3MODH 5FF6B 2A73B 2FRGP 1VPOL 5EU3B 3D3VE 4OLUH 4D3CH 5LJYH 2WBKA 3IVKB 1YMMD 5JA9A 2OK0L 2P43B 3WO3B 3LQAL 2NLJA 3QUXA 4Y2DD 1I9JL 5J1AB 1Z6JT 1CG9A 5E2WL 3DLQR 5F1NB 4OKDA 3OAUL 2HRPL 3S3PA 3S4SA 3O0RH 3MO1A 1J8KA 5D7JC 4NP4H 3NFPA 3ULUC 3QZWG 1QNZH 2BNQD 4Y19A 1CDYA 2JCCA 3QDHA 2I5YL 3QIUD 2F54B 2XKNB 1HWGB 4OZ4A 2WWMD 4XP5L 4ZSOE 3O3AA 3TT1H 12E8L 3MCLL 3STZA 2HVKB 1ND0A 3P0VH 2CIIA 3MRBB 1J5OH 4TUJB 4OIIH 1A1NB 2FJHA 4LPUA 5EO0B 5FUZH 4BZYA 3QUZD 2VZ1A 5DHVA 1T5XB 5GS0L 3GHBH 3IJSB 4NNPL 3VU2A 1JNJA 5C0BE 5C2BH 3RIAF 5JPNB 1NGYA 2BY2A 5CGYD 3O6LH 5DJYB 3HMXH 4F7EA 2EDQA 5IWLA 5MHSE 3MSPA 3PWVB 2DQUL 4FNLL 4QXUH 5T3XD 1NAMH 3QUMA 1WFUA 4DAGL 1U91A 3J7HA 4OGYH 4PY8I 3ARBB 5HHQB 4W6YB 1KF9B 5HYSB 5IMKA 4L4TB 1HHKB 3LH2H 3MV9D 3V95A 4JFPA 1FNFA 3V8CA 4CVWA 1GIGL 1MCIA 1WLHA 5LWYL 2YK1H 1T20A 1QVOB 1T2XA 1RZ7L 3LKNB 2OL3B 4LK4A 4LCCA 5KVFL 1DBAH 2VR9A 2VXTH 4Z5RA 1S9XA 2EO9A 2ESVA 5C08E 1HSAA 2BVQB 3GNML 1S7VB 4JDZA 1N64H 1L7TH 2WM0A 3JV4A 1NBYA 5AYUH 4JFZL 3SBWC 1D9KA 4ZD3H 3ZDXE 4GBXD 5GGVY 1NAKH 4G7YH 3C5JA 1ORQA 3PDGA 2OI9C 3MLRL 4U2ZA 2YRLA 5K59F 2YC1A 3VXSE 4NWUL 1ZLVH 3HUJA 1RV6X 4JM2D 4WUUD 3CMOL 2V5RA 4H88H 3I84A 1CXEA 3CXDL 1AO7A 4NKQB 2UVEA 4I0PB 4WEMB 1MI5D 4Q7DA 3L5JA 1JE6A 1C12B 3KAAA 1JNLH 2JCCF 4Q74A 5CEXA 1G7QA 5ENWB 1AR1C 4U6YB 2K7QA 2NMSA 3U79A 5I1EL 3IU3A 1DL7L 1FPTH 4JKPL 3U9UA 5SWZA 5E6IB 4RBPK 4RGMC 3LDBB 4BQCA 2BFVL 4NQDE 1WCBA 1PG7H 4JRXB 1IAII 4LDEB 3RNKA 3QZWB 4NUGH 4MAUH 1AJ7L 3N1MC 2JB5H 1Y18B 2B4CL 5EU4A 1CD1A 2A6JB 3QNXB 3BIAX 3KJ6H 2QL1A 5IBTL 2P4AB 3PWNB 1T1YA 4ZQKB 4G7VH 4OF0A 2W0PA 1V3KA 3VMNA 4ZFFB 1BGXH 2R4RL 2NW2B 2XT1B 1ZVHA 1TZIB 2F58L 1L9NA 1UC6A 1K3IA 2VXVH 4PR5A 4WTZA 1U58B 2ZCLH 4NUJB 2OP4H 2W65A 2AJXH 4X5XB 2HTLD 5EZLB 2ENYA 4ZTPH 2F8VA 1A21A 5GGRY 4QXGL 4HFUL 3KLDA 4JFHD 1G7PA 4U6VL 2N56A 3B83A 3ARYA 4Y5YB 3CFCH 2LV4A 1NCCH 5DVMA 2NNAB 1OSZA 1MIMH 3KLAA 4P9HC 2H32H 1AE6L 4L8SB 2Y6SD 4PJCE 2OM5A 1GJIA 1C5DB 2ADIA 4XP1H 3PUCA 2CMRH 1MHHA 4GW4A 1ZT7B 5SWZD 3S36H 3HUJF 4XNZC 2WV3A 4ODSL 3P0YH 5E6YA 3SDAA 3ZE0E 1E6OL 1UZ6F 5D7LE 1FC1A 1MF2H 3SGJA 1LD9B 2IQ9H 3P2TA 1V3LA 1RZIB 5CJXC 1N5YH 1NMBL 2FWOA 3LZFL 5I75C 4QRPB 4CDHA 4TVSa 2L7UA 3C6LB 4NOFA 5JOEA 4J23A 3S88L 2CD0A 1CGWA 4XPAL 1FIGL 4LCIL 4ENED 2O5XH 4KDTC 4HS8H 3OJDA 4MD4B 1J1PH 4X83A 4CU6A 2VN7A 1IRAY 3Q48A 1HOCA 3U82B 3HC3L 1BZ9B 4X0KB 4PJIF 1KTKE 4HWNA 2DLFL 2NY6B 1MUJA 2W9LA 3LKRB 4YQXL 3T04D 3GSQB 1SM3L 3VI3E 5DK0A 3P73B 2RR3A 1ZT1A 2A6KB 1F97A 3BDBA 2CLRB 3BE1L 3IJYA 1YYML 3WDJA 2VDPL 5CJQL 4L3ED 5D70L 3NCEB 4BSVA 1DUYB 1IAMA 2IGFH 1S5IL 3BX7C 2R9HD 3TPUB 2NY0C 4OD3H 4HCRA 4U1HA 3G9VA 5T5NF 1MRCH 2JF1A 1FGVL 1UM6H 1WZMA 1I8MA 3AXLA 5DD0H 1E4XH 3W0WD 3KXFE 1KXQE 3MGOA 2HVJB 4QY8B 3FFCE 4ORZC 4Y4KB 2YPVH 2PYEA 4U1LA 3DVGB 5CSGA 5DJ8B 1C5CH 1A4JA 4GQ9L 3VXUB 4YWGL 1I9EA 5FYLD 1QKZH 4P46A 4X4ME 3AFLA 4I18C 1YMHA 4PJFB 2GK0B 1HHHA 1QLFB 1WZ1L 4ALAL 5ADPH 1BLNA 1MCFA 2SEBB 2MCPH 5IJVB 4FQHA 3KPQB 3V6OA 4CMHB 4TPRH 1P9MA 5E8NA 4F7PB 1FSKB 5JZ7D 1DQMH 2FHBA 3WNPA 2FD6H 4TULL 1EERB 5L7XL 3ZYZA 1BFOA 2DKSA 3MYJB 3ABZA 3U7YL 3UAJC 3BKMH 1XIWC 2H3NB 4QT5B 5FXCH 1XZ0B 1MELA 2BC4A 4OAWA 3MUY1 4ODUB 4XP6L 4Q6IC 3U9PH 1GGBL 3EYUL 3LEVH 4XCCL 3QUYD 1TZGL 1WBZB 3ULUH 1T5WA 2DL9A 3DPBA 3VRJB 1E4KA 5ESQA 4FQ2L 1F3DJ 3FT4A 3ARUA 1A3LL 1A6VL 2JELL 2O5YL 3CLFL 3SOBL 2PO6A 3VWJB 2CSPA 3RKDC 5INCB 3MCG1 4NM4L 2MWCA 4X6DB 3VRLE 3C60B 5DO2D 1PZUB 1IVLA 1HXMB 2W0KA 3P0GB 3C8HA 3EYQD 5DR5L 5FA4B 3UX9B 3V6ZA 2PYED 2X4TB 5JOPD 4X6CA 5JXED 4LPYA 5E08L 4O02H 5ANME 1BF8A 1K5NA 4OLXL 1KFAH 4JO2L 3WIFA 1S3KL 2NY3C 1A7QH 4NC0B 2BOBB 4TQEL 5FIEA 5JR1H 5L2KD 5HPOA 1R24A 3F58L 2DJSA 2DMCA 2J4WL 4BZ1L 1JF1A 5DTFA 5EOQH 4YDVB 3VFGL 1IGIH 3WUWA 2YMXH 1K8IA 1KLGA 1XCTB 4N68A 4X6FB 2FB4L 4PLJC 4OIBA 1FL5B 1TQBB 1JZ6A 1G7LA 3L6FB 5TGBB 2RHEA 2BRRL 2YSSB 3MOBL 3ESVF 1LO2H 4QYOB 5DJXA 1RZKL 2EH7H 4LSTL 5AUMA 5IROC 2CJUL 5D71H 4CADB 1JHTB 5I71C 2PNDA 2ZUUA 4LU5L 3FRPG 1CYGA 5HHNB 3WO4B 5ABDE 1YNTB 3T0EB 5ITBH 4OFKA 3KPLB 4LPTA 4TSAL 4RIRA 4S10A 3VFUB 2X2YA 2CR6A 2NY4D 3KYOB 4ZODA 4AEFA 5DQDH 5DJCB 4LSQL 4UT6H 4A6YL 4RA3A 5I1LA 4CVZB 5TJWK 5HGDA 5AZEH 4AT6A 3KR3H 3CVHL 3GIZH 4RAVB 4K3EH 3SKOA 4ZPTA 3AAZB 3T4YA 2VLJD 3VWKB 5BZDA 2ATKA 4FHBD 4I13B 1ZGLP 3V4UH 2HT2C 4I8DA 1JYNA 2VKWA 1IFHH 4OGAD 1FN4A 2ZPKH 3RY5A 4B7IA 1IGTB 3M45A 1J8HE 4JDVB 3BH8A 1NUNB 2B0SL 4FTVA 3I75B 1FJ1A 2Z4QB 4X6CF 4O2CB 3EDDA 1MFAH 4LVHC 2NTFB 1RZGB 4HV8B 1VGKA 4U1KB 5HJ3B 1OWWA 1ZXQA 4WO4B 5DJDA 2XICA 4YDIH 3ZKND 5ESVA 3JTSB 2ADJA 4RGNB 4YEFA 3VXNB 1L6ZA 5F3HA 5D7IA 5D5ME 5IG7A 1FVCB 3KPRB 3MROA 4MAYC 5B38G 5H94B 1LE9B 4KK5D 5IB3B 3Q5YA 4WTXA 3DGCR 1LEIB 2EKSA 3QQ9D 5L2JA 4WFHE 5CBAA 4TVPD 4Z76A 2LAGB 5ALCH 2KZ1B 1AGCA 4OF7A 4JFDA 1WIUA 2VUOA 5I17B 3FN3A 4C56D 2X9YA 4ZYKA 4LIQL 1FDLL 3UPAA 4P9HH 1H8OA 2BHUA 4G9DB 3RX8A 4KXZI 4G8GB 4PRID 2ZOKA 4K8RL 1Z3GH 4OZIA 1ZS8B 3ZL4H 2DYPD 2VIRA 4XNMB 4YDJB 3VFRA 1SVZA 3QPQD 1VFAA 1ITCA 2J8UA 5FOJA 5T1KD 4UIMA 3GSXA 3G5YB 5HI5C 1LP9A 4GAGL 1A9BB 3TZVA 2YPLA 3JWDL 4R6UA 4MZ2A 4H8WL 3VFOA 5GGTL 2NPLX 4HW6A 2HJKA 4LKCA 5CSZB 1ZGLB 3DWTA 5JDSA 5EFIB 1ZVYA 2Q76B 3HI6L 3QIBB 1V7NH 3C9NB 1XGQA 3MRLB 3KLSA 4KROC 2BNUB 4OLYL 1ZHNB 3T2QA 3LKOB 4MA8H 4ODXA 3BPNB 5DI8B 2AXHA 3U6RB 4X7DC 2IH1A 4LHUG 3NIGF 5D9SA 4YXLH 4LGRB 3NAAH 4TNVK 2AEIT 4M93B 5E8DH 1J0ZA 1W72H 2H2SD 4LKXB 1IKFL 3OR6B 5ESAA 4KMTL 4M8VA 1FRGH 4ZXBD 1I1AB 4NJAH 1CXLA 1U8IA 4J7RA 4XNUL 2M8XA 3THML 3D39D 4NNXB 3VXRB 2CQVA 1TETH 5CIPA 1CGYA 1T66D 5I73B 2V6HA 4PJAA 1J0YA 1AQDB 3CFJA 1HH6A 5DUPH 2C1PA 2VISA 3OKLA 3IU4L 5D7IF 5D4QA 4EI6A 1ZSDA 3FTGB 2VITA 4MXQD 2I9LB 4I3SH 2QQKH 4LF3A 2AS5M 1LK2B 3GMMA 2RQ8A 5TE4L 1BAFH 2Z31D 3EOBA 4KDWA 4CKVX 2UZIL 4NBYB 5C0AA 1F3RB 3AB0B 5I1AA 1KG0A 1G9NL 2GJ6E 2P8LA 4Z8FH 3DMMD 4YX2H 3I02B 1KOAA 1Z5LA 4OTXL 4U31A 1FZOA 2RFXB 4AEHL 3VD7A 5D2LF 5I6XB 1NGQH 1GGUA 4NHUB 4NQXB 4OZIF 3X3FH 4L8CA 1EEYA 4HSQA 4I77H 2J8UF 1S8DB 2CXKA 4EIZC 2FZ3A 3FONA 5D6CA 1A6ZB 1GVIA 5FGBA 3HE6B 1WBYB 1LP9F 2Y07H 1X6LA 3NZ8B 4Z7UB 4DN4L 2OJZH 1MHEB 4KJWC 5F1KC 4FMFA 2M1KA 1ACYH 5DDHB 2EDFA 4TRPH 2X4RB 4HT1H 3VFPA 4OGZA 3RVTC 3TN0D 5CEZH 1ZLWK 2EDRA 3CX5K 5B8CC 4FQJH 2Y23A 3S7GA 3IT8D 3ULVE 4Q9QH 1H5BA 5D96B 4G8EA 2YD2A 4XWOC 3K3QA 4LSPL 4MJIA 5FK9A 1QHOA 3FO1A 4JM4L 1RZ8B 1VKXA 2EXWC 3P30L 4AENA 4ZNCD 1RIVH 4M7JH 4XXDA 4YUEL 3U4EA 1JNNH 5I8CA 2OQJB 4JHWL 5EA0L 3MV7E 4WGVB 5E1AA 3MOAL 5DRXA 4LDLB 3K74B 1T22A 4UDUA 2A9NH 4KJPC 5C0AD 3U30C 3U2SB 4MXVE 3HLAA 1WT5A 3MUGB 4LHUB 4PJAF 4PYHA 3VG0H 1U95B 2B7DT 3PG2A 5IB1A 1V05A 2WBJA 1QBAA 1LEKA 5I19H 4P4KC 3OV6A 5GS1B 1OT1A 3G6DL 2ITDB 5IR1A 3KYMB 4X8XA 5C9KA 5EBLA 5EU5A 3TNNB 2XN9E 3CJJA 3HCVB 2OR9H 2BRQA 3MV8E 4MNHA 1MHPH 1WGOA 2V17L 4HWEL 1VFBB 3PWJB 4OCLC 3QQ3B 3MNWB 3T2NL 1HZHH 4XBEL 4NRXA 2I60H 2YD8A 2MNUA 4DZ8B 1HK6A 4S1QH 1S7RB 1S9WA 3NFSH 5FV2A 4EN3C 1DDHA 1V7MH 1XR8A 2YA2A 3RVVD 5EBGA 4JFYB 3QRGL 4OM0H 3I9GH 4CBPA 4LQFH 2OZ4L 5CJ5A 4HJ0D 3S34L 4NCC2 3BZEB 3WIHH 3P11L 1A7BA 2VQ1A 5F6HJ 1G7IB 4QOKE 5FUOH 3HG1A 1YEIL 3L3KA 4MJID 3BMVA 5FECA 3IF1A 5E99L 3HI5L 2O5ZL 1I7UB 3BUYA 3JWOC 3KWWA 2BDNL 35C8L 5HHPA 1BOGB 1UCBL 4V1DE 5BRZB 3GK8H 1M7IB 5KANI 5CZVL 2OI9B 2DS4A 5HGAB 1RURL 2V7NB 1F8TL 3W5NA 2PW1B 2NXYB 2E9BA 3L5HA 3PQYB 3CFBB 4Y2DC 3RWIB 3GRWH 4N0UB 3C5ZD 1AD0A 4MCYB 3BH9A 3U1SH 4FFYL 1BVKB 4JE4B 4X9IA 5H35A 2AK1H 3LMJH 3BP4A 5DA4A 5CP7B 3STLB 1DBML 1EGJL 2R1XB 2DQJL 4M43H 1XGUA 3SHSA 1A14H 3MRPA 3GJFH 3N1GC 1B0RA 1K4CB 1HINH 1IQWH 1H3PL 3QIUC 3TJEL 4EI5D 4UT7H 4EKXA 3ULUE 3TBWB 2WWMC 3TVMB 2FBOJ 1QSZA 2IAMD 5DD3H 5EO9A 2D03H 2FLBT 4PJ5E 3UPCA 1MCBA 2IPKB 1HQ4A 1N6QL 1MJ7H 4P59L 5C70A 1RFDH 1BOYA 1I1YA 5F3BA 3QEGH 1EHXA 4HULB 5HXMA 4ZO6A 2ZSWA 4TOYH 3V52H 1I3GH 1UM4H 4LFHG 4EXPX 3G08A 3KHOA 3NCBB 2CKNA 2E7MA 4G6KH 4OUOA 3ZDZF 4NN6B 4WDIA 1JN6B 4H26A 2FATH 4K71C 5CGYC 4P5KA 4BZ2H 4OZHA 4L29B 4PGZA 5IVXA 4F57H 4DKFL 3LN4B 1AXTL 2J6EA 2A1WL 4YFDB 5EUOA 2CKBA 3W2DL 2Z92B 4DTGL 3GM8A 3OKOA 1WWAX 5T3ZE 1UB6A 1JGEA 3KYKL 4KQ4L 4UUJA 1L6XA 1OGAA 1QFUH 3FB5B 4IS6A 3PDOA 4GG8B 1LO5B 5CILH 3WFHA 5C9JA 5CAYB 4ESKA 5HDQH 5IEHA 3RZCA 2W38A 4E41E 4U05A 1R3JB 5DJAB 1BEYH 2GTZB 4M3KB 4PJGB 5IQ9A 1OPGL 3MA9H 4J3TA 3D0LB 4IRJA 2DLGA 2C3VA 4HFWA 2DDQH 2A6IA 4UINH 1G1CA 2IFGA 1OOAA 2FR4A 1XH3A 1UACH 5KS9E 1QSEB 1GZQA 3V5DA 5T5FH 1NEUA 3QXWA 2RCSL 2VE6A 4KVNL 3IS0X 3IKCB 4JM2C 3GM0A 1SHMA 4XX1G 2AAVA 3TIEB 4L8BA 3T1FB 2HT4C 5I1GH 3RA7H 1FBIL 3IRPX 1MLBA 4M1GL 2FSEA 3G6AB 5JW4M 3QIWA 4R2GC 1OP3K 4DZBA 4PLKD 5CCKH 1MCDA 1FO0A 1CICA 4RWHA 4GAJL 3UTTA 1DVFA 3WLBA 1FV1A 4PB9L 4Y7MA 4EOWH 4UB0H 4TSBH 3EO9L 3B4NA 2J3SA 5GGVH 3G04B 2VXQL 2XWBB 3PWUA 5FO7A 2C9AA 3NZHH 2LTQC 2AVGA 3V0WL 3DO7B 3VDBA 2A0LD 2YD1A 4XMPL 3ZTNL 1F4YH 5KVEH 1T6VN 1FNLA 2A83B 2ZSVB 3M17B 2V5YA 2YA0A 4WY7L 3SDYH 1INDH 4JZNA 4P5MB 2CLZB 4U6TA 3PGFH 4XPTH 4XCFL 3GJEB 1P7QA 1W0VB 3IAQA 1BZ7B 1A7NL 4XAKE 4RNRB 1KT2B 4NSKB 3QDJE 4Z0BL 2MHAA 2NXZD 5TQ2H 3QCUH 5IVXF 4WEBL 4ZO9A 4LCCC 1A0QL 3OHXA 5ITFA 3ARGB 4XAWL 2HJLB 2X09A 4DGIH 3RTQA 1OAQH 4G6JL 4MDIA 3BZFA 4BK5A 3MRHB 3SDDA 1I4FB 3O2VH 2PR4H 1UXSB 5SWSB 2VLLB 1MCOL 4QHNA 4I18B 5KJRH 4N9GA 4ZSOB 3VXME 1YJDL 2VLRA 3WS6A 4U6XB 3U48A 5TQ0L 2JB6B 3NGBC 3L3HA 3FOLA 1EH9A 5ADOH 1YPZA 2BCKB 1ZTXH 5I8EA 5IOPA 4ZNEE 3DUUA 1W0WA 1X4YA 2AJYL 3BISA 1MVUB 1DLHB 1NKRA 2CRMA 3MJ9L 4OV5A 4J8RA 4L4VB 4AG4L 1LEGB 3UTTD 3IDMA 1DVFD 4QF1B 5D2NE 4ZMAT 2R0LL 1LDSA 2DMBA 3EJYD 1MFEH 1ED3B 4HUUA 4XZUA 3RWDA 4GLRI 4I2XA 4XPHH 1IM3B 5DC4B 3LD8C 3HNSH 1RJCA 4JY4B 4FP8L 1XF5B 3RWCB 3U0PA 3MRMB 5BW7A 1IC4H 4UBDD 3LSOA 1SJVA 3KPSD 1TPXB 3MXVH 1ETZB 1GXEA 1SBSL 1DBBL 3GZKA 4MXWH 3O3UN 4WJ5B 5J8OA 3K8LA 2DBLL 4GSDH 3VJ6B 1I75A 1MIEL 5FYJD 1DEEA 4LSRH 5E2VL 1EO8H 1NCBL 3EOYG 4NQSB 2G2RB 5DHYA 4PRAB 3RTQD 1QBBA 4LDOB 4QRTB 3SDDD 1A1MA 3B6SA 1JYWA 4LOUD 5E6ZA 2VAAB 1KC5H 5HY9A 1FORH 4P5TB 4F9PA 1G7JA 3ARSA 3RP1A 4GRWE 4HUXB 1NDGB 2ZCKH 3LS4L 4EUPA 4BELD 2XZZA 4OI8A 3MGTA 1C5BH 4ONFL 3RDTA 1UA6L 5JW5B 1MCPH 4GKOA 5D1XD 1J9CT 5IW6B 2XQYK 3GMRA 3VXTB 2VDML 2RJMA 4D8PA 5L88L 1TCRB 2O93L 3K7UA 5TFSH 3I6GA 5CGTA 4LP5A 4ZDHA 4K3HA 3UYRL 4NHCH 2YD3A 5BV7C 2NY7H 2I25N 5SX4H 5J1SC 1AHWB 1HSBA 3FZUD 1YPZF 1EVUA 4KTEL 5FDWB 3CDGA 3KPPB 4Z7VB 3QQ4B 3UYOD 3W11D 3JWOH 2C1OA 2X1XR 2BMKB 5HHMD 2VDKL 2J2ZA 4NQDB 2P5WA 3HR5A 3S97C 1U8QB 3SDAC 8CGTA 5HPMA 4UV4L 4HUVB 5I1HH 4NM8H 3KLHD 1MCLA 2VXSH 2D7MA 3FFDA 5J6GA 5JZ7C 5JHDB 1RJZB 5BS0A 1QOKA 2J12B 3JV0A 2F19L 3H9ZA 5C09A 1ZLVK 5J57B 1CE1H 1LQSR 2BHZA 1PYWB 1T83A 4YIQA 5DUBB 4X98B 2G60H 3TT3H 3RI5K 1AC6A 3DUSB 3FT2A 3IJHA 3EYOA 3RU8H 1M7DA 2VDRH 3INUL 4PGDB 3RIFF 2HA1A 4XCEB 1IC5H 3ARFA 4XXCA 4OCNC 3TO4B 4JPWH 3DVFA 4D9RD 1LVEA 3O2WH 5CINH 4JZJB 4IRZH 2P5EA 3F6LA 5I1DA 5E8PA 1T1XB 3O3EB 4Y4HD 4Y16B 3V0AC 3RDTD 1KN2H 5DVKA 1LHZA 5CEZE 3T0VA 3IFNL 3RAJL 4M48H 3VFVB 5DO2C 3GSVB 2ARJA 1TQCB 3BPCB 5BMFL 3HB3D 3FO9B 4NBZB 1NBZB 2A74A 1T03L 4LLMA 1G6RH 1NFIA 3F7YA 4UQ3A 5IFAH 2Q6WB 3DARA 3BHBA 3RWEB 3U7WH 2P24B 3MBEB 4RDQG 1KENH 1KCUH 2EYRA 2HT3D 5IHZA 5C0CB 5JXEC 3GIVB 2BSTA 2FCBA 4XGZB 2L7JA 4G9FE 4J4PD 3MRKB 4XX1E 3DYPA 2AI0H 4KJYB 4P46C 5D1QD 2XPGB 3MLSL 3I50H 4W68A 4YBHA 1HI6B 2LVEA 6CGTA 2P5WD 1ITBB 1JWUB 4MAYB 1HHGA 3ECBB 4LCYB 5T3XH 2YUXA 1RUMH 3BD3A 1RIUL 5A2KH 3WKML 5GRJL 2FHFA 3O6LL 3REVB 1P9MC 4GS7B 4MA1B 2OXGA 3H3BC 3E6FB 2X89A 2YOCA 2P45B 1SYSB 2A6DB 2GSIB 5C09D 3I2CL 1J88A 2DQCL 3EDEA 2YKLL 3P9LB 4QXUL 1KTRL 5MHSD 3S3JA 3BKCH 1AI1L 2D7TH 1TJHH 1DFBL 4M7ZC 4OGYL 4MB4A 2F54A 3O6KL 1KPVB 1GAFH 4LLQB 4FABL 3LH2L 1LO3L 1MRDL 3H9SD 4IOSD 5EU6B 4AM0B 2JK5B 1S9YB 5IFJA 5GJTH 1S7TB 1FYTD 2C3WA 3V5KB 3MRBA 4YDLC 2VZOA 1DBAL 3G5VB 2MQ0A 4E5XB 1A1NA 3KYNB 5CEYA 4LCWB 2PO6C 5GRZA 2VWEC 1T5XA 5DFVC 1BBDH 2BXYA 2NY4C 5KTEH 1JCKA 5FYKU 3TYGL 5JPNA 4KU1A 5KSAD 1N7MH 2X1QA 3DTXA 5DHVH 4G6FB 5DJYA 5ISZD 4ELMA 1UVQB 4JPVH 1JGUL 5F9OH 3TWCL 3C5SB 4IIQA 4H88L 3PWVA 3MA7B 2DTMH 5IEKB 1UZ8B 3A67L 3RVWD 1LO0H 3BKYH 1V8HA 5JO5B 4HXAH 4XCNB 2AJSL 2L0DA 4L4TA 1HHKA 2GAZA 3IAPA 3QUMH 3D2UB 4G43A 1MH5B 4G6MH 1QVOA 3LKNA 2OL3A 3L9RB 2Q7NA 3V4VL 3QXAB 2BZDA 2XWJB 1JGLH 2QQNL 1U8JB 4G42B 2BSRB 3VXQB 5FHAH 4QTIL 4BH7B 4UMGA 4P48A 2BVQA 5LQBL 4HWUA 3I3DA 4KZDH 4G8IB 4JG0L 2BVPB 3JSSA 3OSKA 5LCVL 4J3VA 1UEYA 4Q97A 4PRPB 5F1IB 2ZKHH 5ALBH 4K7FB 4WEUD 3T4AB 4I0PA 1XF1A 4NKIL 4LVOC 1U3ZA 5EDXA 5KW9H 1N2RA 1C12A 1QQDB 5I15L 5FYKE 3PWPA 2BOCB 3GSUB 2VO5A 4BQ6A 1BFSA 5K9JH 2YBRB 1B6UA 5ENWA 1YC8A 4Y4FB 4U6YA 1KB5B 1JL8A 1AKJB 3MYZA 4JFFA 4P4RB 3C2SA 5HHOB 4ZS6D 1OAXH 2AEPL 1EAPB 2BJML 1CDJA 4U3HA 5ANMB 3ULVL 4GMSH 3N1QC 3QPQC 5F7FA 1EEUA 5TH2A 5GXBB 2FLRT 3SKJH 5A2LH 1TTFA 1NCCL 3I3BA 2NY2C 2FHCA 3ARBD 5F7EL 1Y18A 3B9KA 2DQDH 3MBXL 4OFVA 2VLKE 1F45A 1UWEL 2A6JA 4PJ8D 4F15C 4JRYB 5FCUH 1FFRA 3IFLH 2UY7A 5MEOB 4ZQKA 3PP3H 2BXZA 4KHTH 2GW5A 5E1HB 5FO8B 3GBLA 1FL3A 3H7BA 2YXFA 3D0VA 3DXAE 4KJQD 1G7MB 2NW2A 4ZPVA 3K1KC 1HH9B 3EHBD 1TZIA 4ONOA 2IQ9L 2O26U 4I3RH 5EUKB 1E6JH 3LN9A 1D5IL 1CGTA 2H9GB 2QR0B 4JO3H 4HIEB 4NUJA 2CGRL 5DLML 1CGUA 3BESR 4OFYA 2DQTL 5EZLA 4WW2C 2CLVB 4OCSH 3VGHA 1J1PL 3ZKMC 3OJMB 1MLCA 3GSNL 4Y5YA 4ERSL 1F4WH 1MNUL 4BH8B 3N85H 1FZJB 2NNAA 4XNQB 5AG9A 1T3FA 1DN0A 1P7KB 3EGSB 2QADB 3O8XA 1TLKA 1C5DA 4ELKB 1KXVC 1ZT7A 3W9EA 3MFFB 4PRHB 5HI3C 5BV7H 4FFWD 4Z7QF 1J1XH 1YYLL 2WQ8A 4OD3L 5E6ID 2IPTL 2Z31C 4L9LB 1LD9A 4DOHE 4JRXD 3IDJB 1R3KB 3VFNB 1T21A 1F58H 4GT7A 1Y0LB 5IHUL 3EFFB 2VDNL 2FNBA 1NC4B 1TCMA 3EDFA 2XTJB 3C6LA 3S4SG 2WWKT 4OCRL 4RX4A 5KSUA 1WC7A 5BOZG 4KK9D 5I1CL 1L4IA 2XY1A 1QKZL 4MD4A 4X0KA 1H15A 5CJ8A 3V5HA 3QUKA 3BZ4B 5D72H 5HYFA 2D3VA 1TTGA 1GGIL 2CUMA 3GSQA 1B88A 1WAAA 3RWJB 3P73A 2A6KA 4HMDA 3QDAA 2CLRA 1JVKA 4OZGE 1BD2B 5FA3B 1DUYA 2V5TA 3B2UD 5ICZB 4F7MA 3O4LB 4NQED 1II4E 2P8MA 2Y06H 5HHXL 5DSCB 4OCWL 5MEQA 3SO3B 4UNUA 4H25B 4OZFA 4JPKH 2HVJA 4HCRH 5GISH 5JMRA 3DVGA 4N0YL 3CPLB 2HFFA 2LQRA 2PYFB 1D3CA 3U83A 2OTUB 3TJHC 2JJSA 2GK0A 1QLFA 1C1EL 2R69H 4W4OA 2SEBA 2CDFA 3FQXA 1QSFA 5C6TH 5IKCA 3B8SA 5HYQA 2H2PC 3FMGL 5IJVA 4P2QE 2XZCL 2WAHA 3CFIC 3KPQA 2Z8SA 1FFNA 2R4SH 4OLZH 4F7PA 4PJ7E 4QRPD 4OSUH 3ETBF 3VGEA 3FJTA 3C6LD 5F8QC 2XZQH 4APQB 2IANB 3RGVB 3HC0B 2P8PB 5F9JA 2H3NA 4QT5A 3SCMB 1XZ0A 3C09B 4RMQA 5AWNL 4HJJL 4OLEA 1DQTA 4NZRH 1T0NB 4MD0A 4ODUA 3CDYA 5T3ZL 1OARH 1R6VA 2AERT 2QKIB 2NY6D 4HLJA 1WBZA 3IAGC 2LVCA 1P7HL 3L5XH 3BPOB 2D4FA 5BZWB 2VLME 1OAZH 5DEFB 3NIFF 3QG7L 4HX1B 2AQ3A 1UQSB 2WWKO 5EOQL 4BUHA 3EW3B 1G6VK 3QJHA 5GJSL 5I1JL 4R8WH 1G9EA 1GGYA 3B9DA 3C60A 5JUEL 1TZHA 2NLJB 3QUXB 3RVVC 1K6QL 5F7WC 2NZ9D 4JN1L 4YC2C 1EMTL 1CG9B 2R2BB 1HXMA 1PDKA 3BWUC 1QFWH 4HJ0C 1H5BC 1WAAF 5FV1L 4Y4KD 2X4TA 5E9DA 3VXUD 3VW3L 5GHWL 4I9WD 2WZPD 4DKEH 2ICCA 3GI8L 5MI0C 1F42A 3HC4L 3TO2B 4DVBA 3NFPB 4XBGA 2D7PA 3E6HB 5ITBL 5TF1L 3WFCH 4Y19B 3SDXE 2JCCB 4LLVA 3B2VH 4CW1A 5IB2B 2BOBA 1UENA 3C2AL 4F80A 2HRLA 4KRLB 3BAEH 1WT5C 4KGJA 1VSCA 5I8OL 1Q1JL 1YMME 2AK4E 4K3EL 4YDVA 2WBJC 3OGCA 3P77B 5T5NG 3ULSA 1YEJH 1HIMH 5AAMA 2FJHB 1XCTA 3JV5A 3OJ2C 2E8YA 2YN5A 2CK0L 1BWMA 5DHVB 5IUSA 3TPKA 3BGFC 4Y0GA 1GYAA 4WTZG 1CDIA 1KIQA 4RSVA 5TGBA 2YSSA 1NGYB 1D7FA 2MSPA 1CLOH 4QYOA 2ZP0T 3O6MH 3T0BA 4R4BB 4M6AA 4YR6A 5GS0D 3CK0L 5D7SL 4OD1H 4EI5C 1WBXA 4C58B 4WFFE 3LOWA 4X7SL 1ZE3C 1JFQL 1YNTA 3FQWB 3VWJD 3KPLA 1FH5L 3PGDA 1U91B 3D9AL 2ZUYA 1YEKH 3VFUA 3KYOA 3OKMA 4YDIL 4LSSH 4CU7A 4TVPH 4NN5C 4LPXA 4FQXA 4MQXD 3R1GH 3H2WA 1T20B 4MVBD 2ZJSL 1JWSA 2P42B 2BHYA 1EJOL 2X10A 3MLUL 5TE7L 1SBBA 3PHQA 3AAZA 4O9HL 3HPLB 4OD2B 1CQKA 4Z5RB 1S9XB 3BI9X 4PJ9D 3VWKA 1HSAB 2YUVA 1NBYB 2YUZA 3V4PL 4WFHD 4R26L 1D9KB 1U8LA 5GS2D 1GC1L 4LGPB 3C5JB 4JGJA 1IGTA 1D6EB 1YEFH 3B3IA 4WW1B 2YC1B 1D5MB 1E4WL 5T3XE 1T04B 2Z4QA 1RJYB 4FQIL 1AO7B 4G5ZH 4L1DA 1J0IA 2OLDA 1RZGA 1WFOA 1YQVH 4HV8A 4NKOB 5HJ3A 1G84A 3MV9E 4EDXB 1T7YA 3JTSA 7FABH 1G7QB 3EYVB 5K59E 3VXNA 2PN5A 3GMOA 4IDJH 5F88B 3IU3B 4KK6D 1FVCA 2ZUWA 3U9UB 1LE9A 5D8JH 2VC2H 3O2DH 5HDOA 1OVZA 2JIXA 1WCBB 3T0ED 4IRSD 4FQQB 5I17A 3TA3A 3WNLA 4F3FB 4YXLL 1CD1B 1INEL 3NAAL 1JBJA 4GXVH 1NGZA 4WUUE 4HWBL 1X7QA 4G9DA 1EHNA 2DLIA 1MI5E 4PLKC 4G8GA 1T1YB 5IBLC 2KL6A 4HJGA 1ZS8A 4XNMA 5IB4A 3T2OA 3VWKD 5J13B 3JBG7 4XVSL 4LPWA 3SGKA 3G5YA 3OG4B 4HXBL 4Z95H 1TETL 2J5LB 1U8MA 1DANT 5CSZA 4XVUC 3WV0A 2VABB 4TSCH 3RKPA 5EFIA 4G3YH 4O5LL 3QIBA 3MRLA 2DM7A 3FN9A 3MRRB 4I3SL 4EDWL 3FN0H 4LLDB 3LKOA 5C2UB 2NXZC 3IDXL 3KLAB 4AEIL 2OCFD 1J11A 5DI8A 4KQ3L 3U6RA 1FGNL 2GK2A 4WO4D 2Q8AL 3QHFH 4RGND 1FAIL 2R8SH 4IRJC 4LKXA 4YFLI 4JFEA 1JPFB 3OR6A 4GW4B 3MRDB 4DFIA 1U6AL 3KPRD 1I7RA 1KIPA 1EZVY 2ESVE 4O2EB 3PL6D 3SDAB 2E9JA 4Z77B 3PXHA 4OJFL 4I77L 3NA4A 1SJHA 4PB0L 1B0WA 1CR9L 4R7DB 3VXRA 3K2UH 3OMZA 1QO3B 1T89A 2WP3T 3Q5OA 4JFHE 1NDMB 2OTPA 4Z7WB 3QIWC 3L5IA 2I26N 4WNQA 1UZ6E 5EG6C 4G8GD 3OJDB 2I9LA 3WDHA 2APFA 1DVFC 1ZHKA 4P3CL 2ATPA 1LK2A 4XP9H 2YPKB 3EJYC 4PRNA 1MUJB 2ICWJ 1BVLA 3SE9L 1LNUA 3IDIB 5D1ZA 3BP5B 4NCDA 3SDCD 1CFVH 3I02A 5SWZE 3HA0A 3HZVB 3GJFK 3IJYB 3WUWG 2RFXA 4HC1A 3L7EB 2R0ZH 3CU1A 2FEEI 4PJIE 4NHUA 2KPNA 1IMHC 3MX0A 1WK0A 4U1HB 1S8DA 2NW3A 2XI9A 3IXTB 1IM9A 43C9B 1IJ9A 1A6ZA 3AXLB 3EOTH 1I8MB 4K7PX 4LASL 3HE6A 1WBYA 4K23L 3MGOB 3NZ8A 4Z7UA 1MHEA 1RHHA 2V2TA 3RTQC 1MFCL 3OKKB 1I3UA 5DDHA 3SDDC 3WBDA 2HJFB 5J11C 2W9EL 1A8JH 4NCC1 3EYSH 4P46B 4DCQA 2AJUH 1YMHB 2H41A 1I1AD 1HHHB 4AMKL 3WS6C 4MNQB 2BX5A 4UIKL 5IM7B 1BLNB 5DK3A 4UTBH 1H3XA 5FGCE 4FQHB 1CGSL 1VFUA 2VJXA 3GBNL 4J12A 1WSST 4L3EE 1J7VR 2R29H 4YDKL 5DRZB 2VDOH 1RZ8A 1BFOB 1NMAH 2VNCA 1CLCA 1MFDL 2DRUA 3CAFA 2UVFA 4S1QL 4HS6A 1NJ9A 3QG6A 4KHXL 4OAWB 2NQCA 4NOBA 4HF5H 4EVNA 3W0WE 1I1FA 2DQGL 1JTOA 1OW0A 4XNYH 2BSED 2HMID 1T5WB 3MUGA 5FYLE 3QO1B 5ESQB 2WP3O 4K94C 1N4XH 5BW7C 4HK3N 4KC3B 1EV2E 1QBLL 4PS4H 3QCTH 4YXHH 2ITDA 3QDJB 4KI5D 3MACH 6FABH 3VDCA 5E0QA 3BT2L 3GK8L 1CLYL 3HE6D 1YEEH 5I8KL 2XQBL 4OQTL 4KMQA 1B4JH 3U46B 4E0RA 3PWJA 3NH7H 4GRMA 3QQ3A 4ODVL 3MNWA 3T0AA 3NABL 5I74B 4A6YA 2LU4A 4JG1L 4DZ8A 3MRFA 3LPFA 1K5NB 4P49A 4F9PC 2EYSB 1X5KA 4KI5F 3CVHA 1MAMH 1CN4A 3ZKXB 3IFPB 4LSVL 1MFBL 4K3JL 4X6BB 4XB8A 5EN2B 1EDQA 5INDA 3MRIA 3QDMB 3WXVH 2Y36L 3RDTC 3QAZC 3RWFA 4Z7UF 3SJVD 1IBGL 3GSWA 1R24B 3HB3C 1AIFA 1XF3A 1JF1B 5C7XH 3CIQA 4BFGA 4Q9RL 1K8IB 5D7JD 1IKNA 3W9DB 1ODAA 2Y7QB 4LRNH 3LVEA 5FYKL 1ORSB 4NO3A 1BOGA 5BRZA 4P9ML 4NJ9L 3QEGL 4N0CC 2PYEE 2V7NA 5JOPE 2PW1A 5AUMB 4D0CA 1KN4H 4LHUD 1YECL 3PQYA 3CFBA 3RWIA 4GW1A 4N0UA 4GMTL 3X3GL 5EBWB 1X5YA 3SKNB 1C08A 1N8ZA 3M1BA 3D69B 4PP2A 4RIRB 1IL1B 5CP7A 1QACA 3TV3L 4N1CA 3HZMA 3PIQB 3MLXL 2F74A 3LIZH 5L2KE 4OM1L 1Y6NR 4UV7L 3GI9H 1WEJH 5I1LB 3E2HC 3H9HB 1AGFB 5C0JB 1YA5A 3MRGA 1K4CA 5HHVH 1RSFA 3SKOB 4ZPTB 5D93B 4C4KT 4HAGA 3TVMA 3ARFC 5CILL