5H35B

Crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DIVMTQTPLSLPVSLGDQASISCRSSQFIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Crystal structures of the TRIC trimeric intracellular cation channel orthologues
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/membrane protein
total genus 49
structure length 217
sequence length 217
chains with identical sequence G, I
ec nomenclature
pdb deposition date 2016-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35B01
2G5RA 3P4NA 5DVOA 4E41D 3CGTA 1RVFL 2Z4QA 3VG0L 2A1WL 3IXAB 1UXSB 4LLWB 1P84K 4RFEA 2XA3A 1QLRB 5IOPA 4HS8L 3KPOB 4WW2C 2BDNH 1LMKA 3O0RL 1MJ7L 2JF1A 3PQYE 5F1NB 1CICA 1DDHB 3V0WH 1QPXA 4R4FL 1X5KA 4QRSB 5KVMC 1PAMA 2ZCKH 3QFJE 4ZTPH 4YJZL 1J11A 1CFVL 3A67H 3SY0B 5JXED 2CGRH 3CLFL 4FTVB 1YECL 2YWZA 1MLBA 1A1NA 1KOAA 4TQEL 5KVEL 5E00A 2EDEA 2CJUL 3RNKA 5C0IA 1S7XA 4C56A 5DQ9A 3ULVH 3L6FA 1ZOXA 2OI9C 3DBXA 2R23B 4MD4A 1JGLH 2ESVB 4PJIA 3NCFB 1KCSL 3D39A 1S7WA 4BFGA 5D71L 4D9RE 1IKFL 1B9ZA 3EBAA 1UGNA 1NCWL 4MAYA 5IB5A 5EULV 2GI7A 3VXQA 4KJYA 2A9NH 3H3KA 4XMKH 3NZ8B 5D5MB 3S96B 5HDQL 2BCKA 1OAYH 3NPZB 3D87B 5JZ7C 1CZ8H 4MJ4A 3CFJA 2EO9A 1VPOL 1BJ8A 2FCBA 2CKBA 3B8SA 3P0VH 4JN2B 5I16B 5EC1B 1R3LA 2GJ6A 3IAQA 1F3DJ 1JWMB 3Q1SH 3D69B 4JM2A 4OSUL 2G75A 2PUQT 1T1XB 2Y36L 4P3DA 4NQCA 5BRZD 3BJLA 2WLYA 3C5JA 1E27A 4P23A 3TBSA 1RJZA 1NMCC 3R8QA 1CGSL 3B5TA 4QKXB 3VFMB 4JQXC 2BXZA 1E6OL 3UZVB 1S78D 2IFFL 1U8IA 5AAMA 4LDEB 4LRNL 1VFAA 3NIFF 4IJ3B 4D0CB 1YEFH 3WDIA 5GJTL 1A9BB 4TOYH 1KSRA 5HHNB 5I66B 4QRPE 2DYPD 1YY8B 4WW1B 2F8OA 1IGFL 5IB2B 3DUSA 4MZ3A 4Y4FA 4JVPA 4M1CC 2D7QA 3NFNB 1XEDA 4HWEH 2VITB 4M5YL 3GI8L 1I1CA 4MD5B 3ZTNL 1U8MB 4K3JH 1NC2D 3BPOC 4CADA 3RP1A 3LMJH 4H5SB 4I48B 3RPIB 5E2WL 3BH9A 5H8DA 5C9JA 4XI5C 3WUZA 1JN6B 4KQ3L 4XTRD 1RZ7L 1JGDB 1NGZA 2Z92B 4R90H 1OPGL 3CH1A 5E94A 3OJVC 5EZLB 2P4AB 1I9RH 1JYWA 3C8DA 3PGFH 1AHWB 1EHAA 3KPQB 1BVKA 1ZA3A 4PLKD 3E6HA 4E0RB 1J10A 3S98A 5ICZB 3W5MA 4LCUA 1INQA 2HFGL 4CU7A 3IF1B 1PEZA 4ZUWA 5EO1A 4PJCA 2ZOLB 3I9GH 3L5IA 4EIGB 3MRNB 3C2AH 1MHPH 5EWIL 2AK4A 3WFZA 3IDIA 4GRWE 1ZSDA 3KPMA 1JPGB 1BZ7A 5D7IA 2EXWD 3X3GH 3TV3L 5JXEC 4KKBD 4L8CB 1IQDB 3O9WA 4S1SL 1SBBA 1ZHLA 2XOTA 3QUMB 4JHAL 5DO2C 3RAJL 4HKXB 4UQ2B 1DCLA 5H2BA 3VFSB 1G0YR 4ALAL 3V8OA 3QA3B 3OR7A 3ZE0E 3ARBA 4FXLA 1OAZL 5IR1A 4KRPB 3UJIH 5HGBB 1XGYH 1N5YL 1BQUA 2QQQA 1M6OA 1YMMB 5B39G 4F58H 2VDKL 2FEDD 3BUYB 1OSZA 1YMMD 1MLCA 1PGRB 4HIXH 3VWJB 2MQ3A 3SGDI 4FQPA 3GGWB 2FWOA 4FQLH 2IBGA 4UB0L 1MFBH 2DF3A 1F3JA 4JG1L 4JY5L 4X9FA 3VWJD 2ED9A 3FOLB 1A5FL 3BX7C 3RWDA 2F54B 2MCPL 1SVZA 3V6OE 1J1OH 5DC0A 5IEKA 4QYOA 3FO1A 4YHNB 1HINL 4DN4L 3C60A 2XNAB 5HD8D 1ADQA 2G9HB 1VENA 3QUZA 4NP4H 4ELKB 2W65A 3BP6A 4OCWH 1DLFH 1UWEH 1KTKE 5HHOE 3P2TA 1U6AH 1R3HA 4RCAA 4AENB 3TFKD 4V2CB 4PUBH 1QLEH 3UYPA 1CU4L 2IJ0C 3BP7B 1EGJH 3IFLH 4M1DH 2OXGA 5ESVB 3QQNA 5GRVK 1PFCA 2ATKB 2P24A 2VLLA 1N59B 2Y07L 1GZQB 4HT1L 1KJ2H 4XVSL 3BWAB 1FVCB 1QKZH 1S78C 4MX7A 3TBVA 2L7JA 3MRIB 1HEZA 4LLVB 2VL4A 3U9UB 2Q87A 1J8HD 4LBEB 1W0WA 3L3OB 3BAEH 3WFDH 3OKLB 2CD0A 3SBWC 4IJ3C 3QHFL 3HLAA 4RRPA 5C0DB 3QUKB 1WT5C 1FNFA 4X99B 1NKOA 2AEPH 4AL8H 3FB7B 1O5DT 1SVCP 1I7RB 2J88H 3RTQB 1G7LB 4RSVA 4X6CB 1OHQA 3M45A 4U1LA 2VQ1A 1OY3B 1UB5A 3IDNA 4GKSB 5BMFL 1Q9KA 1D7FA 3DRTB 4K8RD 3DXAE 4F57L 2D4FA 4LGPB 1VFUA 1UG9A 1RHHA 2IAMB 4O2CA 3T09A 4H0IA 5GZNC 1EFXB 4K55A 2VLRE 4K8RL 1C5BL 5HHQA 1PEWA 3D18A 2Y6SC 2IAMD 3Q5TA 4OZHA 3HZVB 4WWKD 2YPLA 5DI8B 3VGHA 1L6ZA 4RRPG 4IIQA 4NZJA 4QNPE 2R69L 4QHUB 1RUAH 3F7YB 1QFWI 4MA8H 4XX1E 5I19H 1S3KH 1CFQA 2AGJH 2NPLX 3BDYL 1T04B 3ESUF 2VQUA 1G1CA 3IB4A 4HIJA 4P57A 5IB3A 5F8RC 4Z95L 5FGCE 3TIEA 1YMHB 3L3DB 3QCVL 1AHWC 1MCCA 2DQDH 4PLJC 2CO7B 1EV2E 3DV6A 4ZO8A 5CEZD 1LO3L 3IDYB 2R2BA 2BNQE 4KDWA 4CVXA 5D9SB 1W0VB 2FIRT 1F5WA 3O41A 2ARJA 1IBGL 4PY7B 3ARDB 3PG2A 3IFNH 5E8PA 1MFEL 4DZ8A 4O4YH 3BEVB 3IJSA 3DURA 1MFDL 4PB9L 4X4MA 1PKQB 1QLFA 5F1IA 4P4RB 5JUEL 2XKSA 1OSPL 1MCKA 3DX6A 1WBYA 1JCKA 3QIUD 2C3GA 2LVCA 3BO8B 1K6QH 2OR8A 1DQQA 1P4LA 4QRPA 1EXUA 3ZE1F 4PJAF 4WHDA 3RY4A 5KTEH 4LSPL 3RZWA 3T8XB 3SDCA 3VGEA 4KRPC 2Z8WC 3TO2B 4X7DC 3V6ZB 1TCMA 4PTTA 4L3CB 5FB8A 1S5IH 2DQTL 5ERWB 1TETH 3EJZC 4JY4A 1UWGL 3DPBA 3HMXH 1N0XH 4AH2B 5MEPA 3O3UN 3UC0L 5FDWB 3V95A 3VWJC 4I9WE 1CYGA 3CVIH 1ZLWH 5HYJE 4FNLH 1FCCA 5T3ZE 1FG2B 1XF4B 2BP3A 2X2YA 2DQGH 4G9FA 3C8KA 1XIWD 3LKRA 2I60H 1GC1C 3MV8B 5KSBF 3BIKB 4RGNB 5BOZG 4PRHA 3MV8D 5B3NA 4RGND 2JJUA 3J7HA 1WSST 3TFKC 3GO1L 1BM3H 1WFUA 4U3XA 4JKPL 4D0BA 1YN6A 3G5XB 1DN2A 3GMMA 5C0EB 3LEYL 1IZKA 4QOKE 4YR6B 1AGEA 1GPOH 4Q9RH 5J3HC 1U42A 3H3PL 4UV7L 3GSUA 2DM3A 1SEBA 3OJMB 3MLXL 2JJSA 4IOSD 4OI7A 3QHTC 3UTTA 2XTJE 3OGOE 3SOBL 2AKRB 1BQHB 2JB5H 4OQ1A 5FCUL 2LAGB 1MAJA 2DMBA 2C3HA 5T3XH 4KUCD 2HKFH 1WAAF 1I7UA 2A6DA 3ARFB 1FNAA 2JCCE 3RTQC 3HCVB 1WZ1L 3PNWA 1KIQB 4ZFGH 2APBA 4K8RC 2AXGA 1NMBH 5T1KD 4XNQB 4LSDA 1CFTB 4R7DA 1FGVL 2BFVL 1I1AA 4JO3L 2IAMC 1BIIB 4H88H 5FK9A 1QR1B 4IS6A 1YEJL 1WTLA 5D7SH 2C7UB 3WFCH 3TPKA 3Q0HA 5DEFA 3QEQD 2BNRD 5IFHH 1MCDA 1IAOA 4X83A 4LFHG 2O61B 1R3JA 1QYGH 4MJIE 4XHQA 3RGVB 1FVDA 2E7CA 3BW9B 2HTLC 4BH7A 4U6YA 2UWEA 1TNMA 6FABL 4HUUB 2CDGB 1TCRA 4F7TA 1AQKH 1I9JL 3F6IA 1A4JB 2ZUQB 4GBXB 2IANA 4KMQA 1K2DA 4I5BA 3QYCA 4ZYKB 2OMNA 4NFDA 4IOIB 2FL5A 3U0PB 1KN4L 3WIHA 3N0PB 4XT1C 2OR9L 3GSRB 5C6TH 2BVOB 3E6FB 2DIBA 3IDYC 1IMHC 4CN4A 2AV7A 1T89A 1QNZH 2EE2A 1OP3K 3RPKA 1UJTA 4YDJA 3ARDC 4ZQKA 2QQNL 4ONOA 2KKQA 5KVDH 4XP9H 1CFNB 1M05A 4ONHB 3MV7A 5IT2L 1TFHA 4Y16D 3D25B 4GG6F 4GAGH 3MLRH 3FFCA 4BQBA 1ZLUH 1T22A 4FFZL 5JW5B 2FX9H 1L7TL 4KHXL 5I1LA 4OGXL 2BSRA 1LE5A 1CLYH 1JL8A 5I1HH 2VH5L 1LO0L 1MHCA 5C0RH 3EFDL 4XCYA 4U1JA 3FQNB 4M4RA 5DGRA 4KZEH 3BH8B 4MSWB 1FIGH 2VRAA 2NYYD 2YA2A 4EUPA 3T0XA 4NQDE 5IBTH 4DZBB 3GSQA 1YN7A 1LD9B 1FV1A 2H2SD 3S97C 3FT2A 2A2QT 4U1IA 2Y1VA 2CR6A 1EO5A 2FIKB 1ORSA 1XF5A 1RIUL 2VLJA 2WLZA 1JZ3A 2XICA 4YXKL 1GOFA 3LRSB 5ALBH 2X70B 4PGCB 3DGGB 1LE9B 1IQWH 3NA4A 4Z7OF 3QXDB 2D9CA 5EU7C 1OD7A 3OXRA 2VR5A 1FO0B 35C8H 4DW2L 2VDNL 2A74A 4UTAL 4OLYH 4RBPK 4RGNC 3G6JA 4P4KB 3MA7A 2D7TH 1BMGA 2R9HD 1IJ9A 5F89B 4EUPG 1J0KA 2IBZY 1FO0L 1MIEL 5BXFA 4QHNA 2Q8BL 2YC1A 3UX9B 5SWZB 43CAB 3O3EA 4N68A 4DGIL 4NRXA 3ROLB 5D70H 1D9KB 4R8WH 2W59A 1MI5E 1FCGA 1IFHL 3BYYA 5C2UB 4CL7A 4JFYB 3EYUL 5IEHA 1D9KD 1V3LA 2DQUH 1UA6H 5JORA 3X13B 4MNQB 5CILL 3S7GA 4AQ1B 4YXLH 5C0BB 5T33H 3MNWA 4Q6IB 2ZPKL 4HZAA 4M48H 5C0BD 4C4KT 3V7AE 2CRZA 3V6FB 5KS9A 3QJFB 1REIA 4JPIA 1RUPH 4NQXA 4RWYL 3O8XB 3QRGH 5IHLB 4G43B 3WNLA 4HJGA 2YUVA 2H41A 4O2FA 2P7TB 3ARFC 1CD0A 2AJUL 3O8XD 2BVUA 1NGPH 3C9NB 4JFXA 4WEBL 5LXGH 1Z5LA 1SJVA 5GHWL 4NYLB 5C6PB 2OSLA 3NTCL 4OKVA 4YC2B 2BOBA 1I85A 1GH7A 1FLRL 3DARA 4XPAH 5D6CB 4L4VB 3H9HB 3ZT7A 2ED7A 2YXFA 5JPNB 4X4YB 2EDXA 5IW6B 5ABDE 3OPZL 4L4VD 5DVNA 3UTSB 1UM4H 2IADB 2WBJB 3BWUC 4JKKA 4Y5XA 3VRJB 4ZMAT 5DTFB 1ZLVK 3RGVC 4PJXF 3OAUL 3UTSD 3WSQH 4MB5A 1CVRA 3H6JA 5FYJU 5HHVH 4NZTL 4PJGA 3X11A 3BOVA 3MBED 1R3KB 2R1YA 4OD3L 4EQ2A 1JMXA 1RU9H 2ZUQC 3Q3GA 4GBXC 3DRQB 3MRCA 2YD7A 2BHZA 4MJ5B 4F80A 1WBXB 1TJGL 1I1YA 3MRRB 1OAUL 2ADJA 3QO1B 4FZ8L 1HHIB 4XCEB 1KPUB 2J8UF 2XQBH 3OB8A 3BKYH 3B9KB 1FZKB 2H32A 2KZ1B 5FAAA 2VLKA 2VOTA 1TVHB 3GUTA 3BEWB 3T1FA 2B2XL 2PCPB 4QTIL 9CGTA 5FO9B 5JW3H 1B2WL 1IEAA 3QCUH 1L9NA 4D8PB 1T4KB 4K07A 1FNSL 1NFDE 1GGTA 3UDWA 3VW3H 1S7QB 4MYWB 1LP9E 3O4LE 4H26B 5CIPA 3RIAF 3O4OB 4GMTH 2OP4L 3SDDA 2PYED 3H0TB 2NYYC 4PP1D 3N1FC 3L3JA 3LKNA 2AERT 4AM0B 4I2XE 4J1UA 4JQIH 4KJPD 5CCKH 2LAAA 4HHAB 1RIVL 4K7PH 1T21B 1CS6A 3U36A 5C8JB 2R2EB 5JR1L 1SQ2N 5H35B 4Q2ZB 4ZUUB 1JF1B 1VDGA 1WWAX 5E6ID 4HWBA 1T20B 3V0WL 3ZYJA 3HZMA 3TH3T 3ZYZA 1MCPH 1NAMH 3VWKA 3B3IA 3HUJF 2ZCKL 4P3CL 3SE3A 4ZTPL 4BH8B 1BJ1J 3LKOB 4PIRF 5C0GA 5KJRH 2CGRL 3O3AB 3C87A 2R9HC 2NY6B 4PRBA 4P4KC 3LB6D 1G6RB 1WBZA 1FZJB 1CDCA 5D1QD 3ULVD 2NY6D 4M6AA 1CDIA 4OGAD 3G04A 3IVKA 3OHXA 1AR1D 3JTSA 1XF3A 1D9KC 1U36A 2MKLC 4QF1A 4NT6B 3HFMH 5D72H 2BK8A 5L2KA 1NKRA 3TPUA 3PWNB 1QRNA 2D0GA 1JGUH 5D7KD 2Y72A 1G7QA 2OYPA 3R0MA 1U8KB 4A2MA 4XC1H 5HGAA 5FUZH 2AXHA 4ZUTB 1KACB 4K94C 4JO4H 1NGXB 4Q6IC 8FABA 2DQEH 5DHYA 2A9NL 2BVPA 3STLA 1T1ZB 4WI8A 4XMKL 1QFUH 1RK0B 4X8JB 3TJEL 1CLOH 1S7TB 1OAYL 5FM8A 1CZ8L 1T83A 3MLTA 5C0ND 5L0QB 4NCDA 3O8XC 4NQEE 3VFUA 1BVLA 2XXMB 3W2DH 3TT1L 3Q1SL 4P9MH 4Z0XA 5INCB 2IFGA 3BMWA 3LHPH 3DMMB 4YC2C 2QSCH 4MLIA 1KEML 4ZSOB 5F9OH 4Y8DC 5C0AD 5F7LB 1ACYH 1CGWA 3M07A 2D2OA 5D2LF 4LCYA 4PJHE 3REVB 1F2XK 3FO2A 3DVNB 4NO5A 4QXGH 2WBJC 1YEFL 4PV9A 5E8EA 4G6JL 2AEQH 4C4KO 4Y4HB 1GIGH 2CIKB 4OCNC 1U0QA 1EERB 3KDMA 1EZVY 2H6PA 3MRPB 4TOYL 4Y4HD 4ZPVA 4YH6A 5I6XB 3FT4A 1K8DA 5I76A 3QEHB 2CQVA 5ITBH 1NMAH 4BK4A 2KQMA 2C3WA 2ZUYA 1RJLA 2AXJA 5F7HA 5HGDA 3QIWA 4X9GA 3PWPB 4HWEL 5IB4B 2NY1D 1HQ4B 3EOTH 3F7QA 2P8PA 1EEUA 4K3JL 1KPRB 3KVQA 4ZFOB 4L9LB 3LMJL 1S7RB 3C6LA 3B9KC 2FBOJ 4X4XA 2HKHH 2WIMA 2NW2A 1H9VA 2DQHH 4M7LH 5JIHA 1LEGA 1I7TB 3WNKA 5JOFB 5J11B 2VDMH 3UPCA 3ARVA 3S37H 3QXUA 1OP5K 4KRMB 4LLYA 3U0WL 1XCQB 5I1IH 3TCXA 5C9KA 5A16B 4R90L 2IH3A 4QRRB 1SJHA 4ZO9A 5KG9A 1NEUA 5D6DA 1I8MA 1I9RL 2A9MH 3DVGB 1AGFA 3QQ9D 4PP1C 4MDJB 3JTTB 4MZ2A 3O4OC 1NCAH 3O2WH 1G0XA 2P8MB 3AU1B 4LVEA 2GEEA 5CZKA 3ET9F 4DK6A 3Q6GH 3H9SA 1G7JB 4OIIH 1ZHBA 4N0CD 4DCQB 5F3BB 3GJEB 1R24A 1I9IL 4HC1H 3I9GL 4U1HA 1TNNA 3C2AL 1MHPL 2EIBA 1BD2E 1PKOA 1A7QH 3CFKB 4GQ9H 4ODVH 1QP1A 3C5SB 4ZDHA 4Q9QH 3X3GL 4NNYA 1JZ7A 1X5XA 1QEWB 4QTHA 2DIAA 2HT4D 2XXCB 3GEWB 3MC0A 3O45A 4PJ5B 3DHJA 4MB3A 2NY6C 5FA3B 1C08A 3IS0X 4XP5L 2C3VA 3P0YH 1TVBB 1AR1C 2YBRA 3KPSB 1QHOA 1XGYL 4HUNB 5EZOH 1IM3B 4PGBA 3SKMA 1EBPA 4WY7H 4NC0B 4F58L 4YUEH 5HDLA 1A9EB 4Z5RA 3GB7B 2X44D 1MNUH 3W9DA 2X4PB 4PJ7F 4Q7DA 3ZO0A 1FYTA 4HIXL 1EEYA 2MQ0A 3OMZA 5IVNA 4XXDB 1MFBL 3F58H 3GSXB 1AR2A 2R39A 3SCMB 3VRLF 2WIIB 3O3DA 3PF2A 1ZGLA 3W11C 5C0NC 4DVRH 1DL7H 1WFTA 1AH1A 4NP4L 5L0QC 1JYXA 4LCWE 4OCWL 3SDYH 1V05A 1DLFL 3FQRA 5GS1A 2BRRL 2FO4A 1CGYA 1T2XA 4JO2H 4GG6B 1LDSA 1JGEB 2GHWB 1MCLA 5I17A 4J4PD 5CD3A 1ZS8A 3KNBA 3BXNA 5JIPA 4PUBL 1EGJL 1P6AB 3IFLL 3DMMC 4I2XA 5AD0A 2ZNWA 2UUDK 2X7LB 3OG6B 4XPBL 2YZ8A 1QKZL 3Q48A 4OI8A 3I02A 3S35H 1X5IA 3TIDA 4LARH 4XVTH 3T0VA 1A7BA 4KI1A 2PO6B 4YFEA 3MNZA 3DYMA 4QXUH 3T4AA 2Y7QB 2Y25A 4BK5A 2DTMH 3RKDC 3V4VH 4G6FB 3BAEL 3WFDL 1HSAB 1DBMH 4QGYA 2B7DT 2G5BA 2GSIB 3FCTA 1JNHA 4M7ZB 4DAGH 5DWUH 4G6FD 3DTXB 4Y4HC 2AEPL 4AL8L 4DWHA 4PJAA 2YUWA 4LLDB 5FM5M 2J88L 4NKOB 5I6XC 1KEGH 5DJZB 5J9PA 1NGYA 4JDVA 3DX7B 5EBMA 1UACH 4D9QE 1PY4A 4JQVC 2UZYB 5DZLA 1A6PA 3CUPB 4GOSA 4Z7UF 1EAPB 4FTVE 1PY9A 5JXAH 3IFOA 2VAJA 4ZO6A 4G8IB 1WFOA 3DROB 3EYQD 1KB5B 4LHUB 2IH1B 5ISZA 1I8IA 5BZWB 2YRLA 4N0UA 4L9LC 2AQ3A 4ONGH 5JNYB 4QGTA 3CZFB 2CDFB 4Q0XH 1WZKA 2ESVE 5KSBA 5J11C 3V79C 1ED3A 1HXMA 1KB5L 4Y5YB 4U05A 1RUAL 3CSBA 1NCBH 3VXSA 1B6DA 1S3KL 3F7PC 3QQ9C 2AGJL 5L9DH 4G8FB 3ZDYF 4WCYL 5J1AB 5IVZB 3CFEB 5D5ME 1YUHB 2HMIC 3UJTL 1JBJA 2DQDL 2EC8A 4PB0H 2V2XB 1HH6A 4JFHD 1S7UB 3H9ZA 1MCJA 4N0CC 4NKMA 4Z7WF 4JFFB 1JWUA 4KUCF 4L3EA 4NN6B 1TIUA 3MJGX 4UNTA 3IFNL 2IPTH 3AS3A 5KVFH 3GNMH 2H3NA 2VZTA 3SE4C 1OW0C 3ULUF 1HH9B 3BIBX 4CVZB 1SM3H 4WUUA 4JDZB 4PJFA 4QO1A 3REWB 3RIAK 1AGBA 4QXTB 2NNAA 4L5FH 3W5NA 4L4TD 3P77A 2HT4C 1ETZB 3CVHH 4FQXB 1M7DA 4JRXE 4PJBF 3ZKQD 3U4BH 4Z77A 4U1KB 1UXWA 4OFIA 4FQXD 3T0ED 2BVQA 2VDRH 1NCUA 1OGTA 2IGFH 3F5WB 5KTEL 1B0GB 2RJMA 1AO7B 1X4YA 3ZKMC 3I75A 5DK0A 3KPNB 4Z7VE 1S5IL 3QEUB 1AO7D 1TQBB 1TETL 3L3KB 4YBQC 1AJ7H 3L3HA 3HMXL 1N0XL 3TESA 4Q9CA 1UCTA 1F4AA 1ES0A 1BJMA 2E7LA 4KVCH 3MGOB 2YHGA 1LO5A 4LDLB 3SCMC 2DQGL 3WLBA 3WJJC 5ENWA 2I60L 1RQ5A 5I1JL 1RZKC 4HXBH 5DJDA 1NUGA 3TBYA 4PRPB 2A6IA 3L9RA 5F7WC 1OB1B 3HA0A 4J4PC 1J87A 3TZVB 4PRPD 2MQCA 4HIIA 2XN9A 5J6GA 3WLWC 1KYOJ 4PJ8B 4MMXC 1KCRH 2YA1A 1DFBH 5K9OA 4YDVA 2CR3A 3ZSSA 5IMOA 3CK0H 5DMIH 1UT9A 1GPOL 4NKDB 1YEGH 3QI9B 4Q9RL 2SEBB 5TDPA 4GKNA 4G6AD 1KV3A 3O2VH 4KK8D 3R4DA 4MQ7B 3FO0H 1JUFA 2IWGA 3HHRB 4FOMA 1P69B 2PO6C 2W07A 2HYMA 1IEBA 2JB5L 4M7ZC 2PXYB 3HC4L 4QRQB 5B4MC 1K4CA 3T77A 3NZHH 3HAEA 2PXYD 4JPWH 4PD4J 5T1LB 1PX3A 4GRWH 6CGTA 4LHQB 1NMBL 3HUJB 2GQHA 5T1LD 2VL5A 5K9KA 4MCZB 5DUMH 2A6KB 2GTWA 1N5AB 4KQ4H 3WYRA 1T0NB 5F7DB 3SKOA 4H88L 3R06A 5DRXB 3EKCA 3NOIA 5D7SL 3WFCL 5I1EH 5DJ8A 3QB7C 2H8PB 3RIFK 5F7KC 2HH0H 5IFHL 1YMME 1OGAA 2W0PA 3RDTB 3F8UB 1FRGH 3JWDL 5EOTB 1QYGL 4BQ6A 4Y5YC 3RDTD 3HAEG 4CW1B 5CLTA 1UENA 1KLUA 2BY3A 3GMQA 3ZDZE 4HW6A 3DIFA 2F54E 1AQKL 4APQB 4AMKL 5DYOA 5F7UA 3FQTB 4LSUH 5GGTA 1N64H 3IETA 4U4BA 2CIIA 4XPGH 3FB5A 5C6TL 1LO4H 4HKZB 3MLYH 3VFPB 1J9CT 1EUUA 1QNZL 5FECB 4E41A 5J6HA 1KBGH 4NBYB 3MRQA 3FQXB 4NN6C 1B0WA 5DMKB 3KYOA 5D1XD 4JPKH 4ZXBB 4X0KB 4NSKB 3IXAA 5KVDL 4QY8A 1UXSA 4XP9L 4ZOBA 1XGPB 3ZDXF 3UJJL 2DLFH 4GAGL 1N26A 3VD7A 4X8XA 4DFIA 5H37H 4HIEB 3ZT5A 1C5CH 2FX9L 3D3VB 4FQXC 3G6AA 5F1NA 2OK0H 4ODBD 1QRKA 4HUWA 1DDHA 4J3XA 1CLYL 3GJFB 3D3VD 3MR9B 2K7QA 1MWAH 4GAYB 1MJUL 1FC2D 4KZEL 3KWWB 1FIGL 4BKLB 1T66C 5ETUA 4X6CE 4ZOAA 3HPLA 4LSRH 1TQBC 3QO0A 2N4IA 3MO1A 4DKAA 1JJUA 1A22B 1Z9LA 4OBRA 5DURB 1V3JA 4X5XB 4YHZL 3BT2H 4PJXA 5ALBL 2FX8H 3O6ML 2ZUXA 5DURD 2R23A 5SX4I 4W68A 4PJ9B 4R7NB 3MRLB 35C8L 5BVPL 4PJ9D 3QNZB 5IMLA 1U8NB 4OLYL 1I4FA 4UOW1 2ATPB 2D7TL 2NX5B 4NO0B 5JW4N 5I0DA 3KS0H 4RNRB 3TZVC 4W4NA 3PXJA 4FQHB 5EO0A 2DI9A 3O2DH 2J8UA 1H0DB 3PP3H 4NM4H 4MDIB 5HGGS 4PJ8C 4F7EA 4R8WL 5HPMB 4OT1H 3EYFB 4JN2A 3TO4B 5I16A 1L6XA 1XZ0A 4G6AC 5JQ6H 3QI9C 5FKAB 3TF7C 4J2XA 2DQUL 3PHSA 3D69A 5BRZA 1L9MA 2Q1EA 2APWA 5DVKA 1FNLA 3VFWA 4YXLL 1T1XA 5T33L 5ID0B 2ICEB 2YS4A 1MY7A 1N6VA 2FJFB 1CDHA 3V5KA 3PIQA 3ARPA 3KYNB 2X4QA 4UIMA 3VFMA 2PXYC 1CIDA 1RUPL 2F53B 2IPUK 3VFVB 1HZHH 1GOHA 1NBVH 3QRGL 5C0FA 1U3HB 2XA8H 2X89A 5AG8A 2MPAH 1LEKA 1MREH 2WWKT 4WENB 4D0CA 5IMMA 1NGPL 1IZJA 1BWMA 5LXGL 1KTLB 2DYPA 3T65A 1UKQA 3RY6A 3S5LG 3M8OH 5HHNA 5I66A 4BQ9A 1MJJB 1WIOA 1AP2A 4WDIA 2V6HA 2I07A 3JWDC 2VDQL 5DR5H 4FABH 1JHTA 4XPAL 5I1AB 4JFDB 1EHXA 3ULVF 2YXMA 3U46B 2Z0BA 3UTOA 5F88B 3IAPA 3QDME 1NC2A 2ZUWA 3JUYA 4L8BA 5J56B 2VITA 1UM4L 3A0OA 3IU4H 1KCUL 3RDTC 4MA3A 4MD5A 1YDPA 3HZYA 5E70A 5IG7B 4U3CA 3GMNA 4I48A 5HHVL 4BZ2H 4PJ7B 4L29B 5EU7E 2GW5A 4N90E 4AT6A 1TZHA 2E6PA 3SPVB 1O7SA 3B5GA 1RU9L 4APQC 1T5XB 4RWHA 1JGDA 5T3ZH 5AUMB 2MWCA 2Z92A 3QWRD 4M03A 2CK2A 5KSVA 5GS0H 5FF6A 1CL7I 1T2QH 1V5JA 5EC2B 1A1OA 3NFSH 4K3GA 4X7TB 2FSEB 1W72B 4NPYB 3F65A 2WUCL 2XQBL 4P46B 4QRUA 5JMRA 3BKYL 5EBGA 4BFBD 3KPQA 3UTZB 1EPFA 3QWOA 4B7IA 3DV4B 1A21A 4JANB 4XVJH 2GK0A 2VDOH 5LGHH 4ZXBC 3QZWG 3GDBA 5DC4B 3QCUL 1W72L 4ZFZA 5EO9A 3VW3L 4GKOA 5IMKB 5L8JB 4ZPTB 3VXPA 4GMTL 4X6BB 2OTPA 1ZXQA 2DLHA 4BQCA 1DP0A 5CCKL 4HPOH 4JQIL 4UQ2A 5D2LA 3VFSA 4K7PL 1Y18B 5EU5B 2EYTB 1M7XA 4Z7UB 3QXWA 4Z18A 2P48B 3TLRA 5BS0B 1MCPL 1CG9B 3DSNA 3UBXA 2WINA 1INDH 1HHHB 2DLTA 4PJ9C 4PY8J 4XWGH 3WHE1 4K7FA 1F8TH 1XR8B 4JG0H 5KJRL 5DJYA 3VWJA 3RX5A 2GJZB 3CMOH 1CR9H 4HD9A 4I18B 3FOLA 3HE6B 4QXWA 4RX4D 5A2KH 5FO8B 4JO1H 5IUSA 5B8CB 3HE6D 4YHNA 5F7YC 4PLNC 2G9HA 2DLGA 3HFML 3TO4C 5D72L 4Y2OA 2UY6A 2Q86B 4AEEA 2X4SA 2HLFD 5DHVB 2BC4B 3UBXG 4NZUH 5E8NB 1JWSA 3LS4H 5FUZL 5EUKB 4Y4KB 5HVFB 4JO4L 3RI5F 4YDKH 2DQEL 4Z7WB 2AEWA 1P9MC 3KYKH 1CDUA 3SDXA 1N59A 1QFUL 1CLOL 3BWAA 1FVCA 4G8GD 4YHLH 1J8HA 3WEXB 3AB0B 1HI6B 3MRIA 5MENB 4LLVA 3DETC 3HC3L 1U3HC 5MEND 3OKLA 3W2DL 4P5TA 4F9LC 4P9ML 1K4DB 4XB8A 4O02H 2DL9A 3ILQD 4M61B 1U41A 2E9BA 3FB7A 2DKUA 3LHPL 3I3BA 2VUYA 3BQUB 2WBWB 1H3XA 3QH3B 3TVMB 1I7RA 4XBGA 3NIFE 1OAXH 2IQ9H 5DS8B 2QSCL 3BQUD 3TVMD 1ND0A 4OFDA 1ACYL 3JUZA 4XBPA 3FOMB 4LASH 4AEHH 4Y2DB 4QXGL 3GHEH 4WFHD 2Q7NA 2E9WA 4WWKA 2AEQL 5IP4A 1PYWA 3HZVA 5DI8A 4JDTH 1N8ZB 3P3YA 5ITBL 1NMAL 1ZAGA 2DMCA 4ZFFA 4XNUH 4NCC2 5HJ3B 1EHLH 2GCYB 3AMLA 1BFOA 4XCFH 1T04A 3EOTL 4LIQL 5SWZE 5LWYH 3MUGB 4P46C 4Z8FL 4WFED 3RZCB 3LN4B 1XT5A 4NQSA 2HKHL 1OT2A 2DQHL 4M7LL 4OZFA 3QXAB 2VDML 3S37L 1U95B 4WNQA 3G5ZA 5L2JB 5I1IL 4MNQE 5DEGA 2LE9A 5C0BE 2GITB 2P1YA 4PD4K 1JP5A 5EU6D 4MQXD 3S4SB 3BEVA 2A9ML 2ENSA 3VXME 5HHMD 2CXKA 1F00I 1NCAL 1PKQA 3O2WL 4M7KH 1ZT1B 4HG4K 4P4RA 4UT7H 5AZEL 3EO1B 1GOGA 2OTUA 3QIUA 1Q9WA 4UINH 4BZYA 3ZT6A 1IM9D 5IV2A 5CAYB 2YD6A 4OIIL 1A6ZB 2HRPH 4GAJH 4OZFG 3DUHA 1MUJB 1DTUA 4HC1L 5T5FH 3P4OB 2OZ4A 3TO2A 1CXEA 2PR4H 1C5DA 2EE6A 4X7SH 5TF1H 1A7QL 4L3CA 5E9DB 3VXUB 5DJCA 3RY5A 4GQ9L 4ODVL 5LGKA 4L4VE 4OGZA 5E9DD 3HC0A 1CIUA 3RWHB 3Q6FB 5A43C 1GHFH 1GGBL 2R2HB 5FKPA 4WI7A 5FDWA 2VXTH 2IPUG 4LLAA 3TT3H 3FT3B 1XIWA 3DO7B 2EO1A 3TNMA 1A3LH 4I18C 1KLGA 4LCCB 4UBDC 3HE6C 3HRZA 3MV8A 4GUPB 4JFOB 5FDYA 4BUGA 3AAZB 5EZOL 4BUHA 5B8CC 1HILB 2R4SH 4HUVA 4WY7L 1JV5A 4YUEL 1DBJH 3IDXH 5GIRA 1MNUL 1S5HA 2AQ2A 3LPWA 2CLRB 3U4AA 1EEZB 4WU5B 4GW4A 3OG4B 4K3DH 1B0RB 3OKEA 4P2RD 2PTVA 3PWJB 3DI3B 2FJHA 4DGVH 4NC2B 3SKNA 4Y4KC 4YR6A 3LQZB 5CWSA 1LK2B 1NCCL 1OWRM 4KV5E 2HVKB 2DQCH 5CLWA 1DL7L 1DN0B 3AB0C 4HLZH 1XH3B 4JHZA 1JK8A 3PUCA 3SDYL 3ULUC 5F9AC 1GAFH 2AKRA 4JO2L 3ILQC 2OL3B 3QR2A 4CNIA 1U92A 3JBG7 2X4NA 5CJXC 5IROA 5GZOD 1YPZB 3MJ6A 5CP7B 4FQ1H 4N8VA 4F33A 1U8LB 2EYRA 2H2PC 3BQUC 2NMSA 4HS6A 3TVMC 4UILH 1CT8A 5T1KA 4OB5L 4M4PA 4UU9B 3HCVA 3K1KC 2OL3L 3OXSB 4UNVA 4X5WB 2R1XA 3KPPB 3S35L 3JV0A 1D6EB 4LARL 4XNQA 4XVTL 2OS7A 4HGWB 3RVVD 1YNTB 1JNNH 4O2EB 4QXUL 2PN5A 1CWVA 1MH5B 2DTML 4JFZH 3IJYB 2P49B 3QEQA 2BNRA 2YWYA 4KDVA 3PQYD 5DWUL 2C7UA 2WUBH 1I8LC 4FXGA 1XF2A 2A6JA 1KEGL 1DUYB 2FECI 3EOYG 4ODXB 4N8VG 1UACL 3QFJD 1Y0LA 1A2YA 1A1MB 5HYSB 1VGKA 1CTOA 4HK3N 2GUOB 4OZ4B 2CDGA 5B38A 3SJVB 1PLGH 3ZHDA 3HMWH 1QSEA 3V8CA 3CX2A 3NFPA 5I1KH 4ONGL 4MNGA 3RZCC 5C7XH 2B1HH 1N3NA 3MROB 5C6WH 3GSRA 3LSOB 4Q0XL 3EIFA 4KU1A 5ESAB 3L7EA 2EDFA 3WFHA 5DDHB 2YR3A 3B6SA 4MQXC 1NCBL 3IDJA 2W0KA 1U8QB 4Y16A 5L9DL 4TNWF 3WS3A 3ECBA 1RULL 4FXKA 4CU6A 3MRDA 1FH5H 1ZMYA 3OJDA 5I8OH 4CMMB 5B38G 4YHIA 2M1KA 4PB0L 3GMRB 3BESR 4XP6H 2B1AL 5JW5A 3BVNA 5F7FA 4H1LA 3T3PE 4JLRB 3UMTA 3RVXC 3RWEB 2ZUVA 3HNVH 4TVPE 3FQNA 5B3JF 2IPTL 1GVIA 3GNML 1WCQA 1E4KC 2EEAA 1SM3L 3QDJB 2DM7A 5MEQA 5J06A 4L5FL 3B83A 2FLRT 3ZE1E 3IDUA 1IKNC 1PDKA 3QDJD 2ZG2A 4PJEB 3C5ZD 3CVHL 1AY1H 4BELD 1J0YA 4DTGH 2AI0H 1KULA 3X14B 3U4BL 5JLZB 1WZMA 3P40A 2VDRL 1JI1A 3LKQB 2IGFL 3FMGH 3EOAA 3BP5A 4H1LG 4LCCC 4V1DB 1FO0A 3HG1B 3CPLB 2I24N 2J3SA 3GBNL 2HN7B 3ABZA 4X6DF 2E3VA 1IAIM 5ACZB 3C08H 2C4FT 2VB5A 1AJ7L 2HVJB 5E8OB 4OJFH 3TBTA 1OT1A 4PV8A 3PWPE 2A73A 4OM1H 1JHKH 2EZ0C 4HCRH 4KVCL 3WL9B 1X5AA 2F5AH 1D9KA 3AXLB 4ELMB 2P44B 3EOBB 1QFHA 4ZNEE 2F19H 3N1PC 4WJ5A 1NDGB 1MPAH 2C1OB 3WMSA 3ZYOA 4HXBL 3WKNA 1DQJB 4WHYH 4ODUA 4KI5D 4QEGA 5L8LB 5GZOC 1CK0L 4QRRE 5ELIA 4UV4H 3RA7H 1PZ5B 3U7AA 3MRMA 2JJTC 3V6FA 5CMAB 3W82A 1EX0A 3MRKB 1KCRL 1DFBL 4FG6C 3O8XA 3CK0L 4MGXA 7CGTA 5I15H 1AGDB 2I26N 1YEGL 5A2FA 3K4ZA 1RFDH 4N9GB 3HS0B 3JV4B 5CHNB 2KPNA 4R3SB 3O2VL 1MAMH 3RVVC 1LEIA 5MP6L 1MJ8H 3FO0L 4NYLA 4D2NA 4IRJB 1CDGA 5FFLA 1WAAE 4NJ9H 1RZGA 4X6FB 3ZKND 3CD4A 2EYSB 1IGTA 2GAZB 5K59F 3S9DB 1ACZA 4PRDB 4LK4A 4GRWB 1UEYA 2X4RB 3EZ8A 1U91A 2G2RB 3VRIA 3NZHL 5JPNA 2XFXB 1BOGB 4X4YA 4L1HA 4JPWL 1I3RA 5AYUH 1CXHA 4GG8B 3UTSA 1C16B 2IADA 1EMTL 5HY9A 4OZGF 1NUDA 5C08E 3KPLB 2J12B 1T5WA 5CS7A 4PJ5E 1GGIH 3FRUB 4OLZH 4LMQE 3MLSH 2HJFA 3MBEA 3OX8B 2Q6WA 3G5YA 2VIRA 4JZNA 1OAQL 5L7XH 4OCMC 1A7OL 4KQ4L 3CFBB 1FSKB 1R3KA 3FN0H 1SJEB 3KPSE 4TPRH 4QRTB 5I1EL 1F4XH 3DRQA 5E1AB 3QNYB 2EH7L 4XAWH 1UCBH 1DUZA 1XGTB 2HH0L 2ITDB 1IAIL 5DXWA 3I2CH 1KT2B 4WGVB 3MMEB 1FRGL 3IXTB 2MCG1 5EA0H 1A8JH 3P30H 5FYKE 4HV8A 1FZKA 2EDQA 2K7PA 4XWOC 3QUXD 1E6JH 3IRPX 5KSAD 3CFIC 3QJHB 2XRAH 4P49A 1LDPL 1GJIA 5FO9A 4CAGA 4D8PA 1T4KA 4LSUL 3QEGH 4XPGL 3DO3A 1CDJA 3NCCB 3VFTA 2PTTB 1LO4L 3MLYL 2PYEA 2IPKA 5HHOD 4GG6E 2CRYA 1WJ3A 1OAKH 2X4OB 1IAKA 1KBGL 5BZDA 2B4CC 3SGDH 3H42H 2JJWA 2R0LH 5EIQA 3BRFA 1QO3B 2DTSA 2Z91B 1FJ1B 1D5BB 2A1WH 4LF3B 5DJAA 1ZANL 3U48A 1NBYA 4JHWH 1P7QD 1F97A 2DLFL 5IBUG 1WQVT 3UAJC 5DJXA 5E6IA 3BI9X 5INDA 3O0RH 5C8JA 1C5CL 3RWFA 2EDYA 3RWIB 5H35A 2AW2A 1T20A 4R4FH 3V7MA 4YEFA 3DSFH 4JB9H 5E1HB 5C07B 4LKCB 4URTB 1DQLH 3CLFH 5D1QA 2GT9B 3SGKA 4LCIH 4LSRL 4Z7OE 3D0VB 5IHUH 5J12B 2V7NB 1HYRC 4TQEH 3IDMB 3U7WH 3SO3B 1IVLA 1V7MH 4FS0A 3UPRB 3JSSA 3V4UH 3DECA 2VLRD 3DHMA 3U82B 2MHAB 3KLSA 1T80A 3LN5B 2QHRH 1NEZB 3A6CH 1Z0MA 2W0FB 4K3HA 4KI5C 1UVQB 2Q7YA 3UCRA 1NGXA 4CVUA 3TJHD 5IVXB 3K0WA 4WHCA 5HDQH 4X8JA 3O2DL 5M94B 3PL6D 1X5YA 1S8DB 5F71A 4ZAKB 5J8OA 2BNUA 5JQ6L 1FDLH 2BNQB 4ZAKD 4GRLB 3MV9A 5D7JB 2GFBB 2BNQD 4JFFE 4O5LH 3NIDF 3ZKNC 4OLWH 4N5ED 4IRJC 3K80A 5GGSA 5C0AA 2X4UA 2I9TB 1ZT4A 1QFWH 3MCKB 5DQDH 3X12B 1CXKA 1E4XI 4ZSOA 2VAAB 3RVTD 1F4YH 3FKUS 1KJ3H 1HZHL 1J0ZA 1NBVL 1BIHA 2XA8L 3DVNA 4PBWD 2MPAL 5IJVB 1HHKB 2YD4A 3WS6A 1MREL 1T1WA 2VERN 5TDOA 2NCMA 4Y4HA 1S7SB 3VI3E 1MELA 3MRPA 3M8OL 3WE6A 1DSFH 5JHDB 3O6FD 2LV4A 1FSKC 1RIHH 5DR5L 4LLUB 2Y5TB 4K7PX 1O7VA 1ZLWK 2A38A 4FHBD 3LY6A 3RHWK 1PQZA 4YPGB 4YHPB 1ZT7B 3I6KA 4U1NB 4PBVC 3CC5A 2EDNA 3IU4L 1M71A 1HQ4A 3RWGB 1NJ9B 5IFJA 4Z78B 3AS1A 4L9LA 4BZ2L 5HYJD 4B53A 4U1MB 4JPVH 5T3ZD 3V6OC 1I7TA 4KQ3H 2OBGA 2WP3T 1JNLH 3A6OA 3ARED 3GSWA 5GS0D 4K71B 4UNUA 5BQ7A 4WU7A 3L7FA 1G9EA 5JO5B 4QHMB 5A16A 5GS0L 1T2QL 4YBLB 3NFSL 3DVGA 3VD3A 2QR0B 4MDJA 3JTTA 1FORH 4QOKB 3E0GA 5HYQA 4XVJL 2VDOL 5LGHL 4QOKD 4L9DA 2NXYB 1NCTA 2P43B 3CSYA 5F3BA 2NXYD 5EN2B 3GJEA 2XTJB 1ZHKB 2NZIA 3UZEA 2XTJD 5IGXH 5IM7B 2YD9A 3CFKA 1B4RA 4XPFH 4OZIB 3WNPA 3C5SA 5FHBL 1P4IH 1R5VA 3TV3H 4BSJA 7FABH 4F8QA 1QEWA 4HPOL 5IVOA 1P7HL 4Y19B 4TN9A 1WGOA 4A6YH 3HUJE 1ZA6A 3BHBB 5FA3A 5J12C 4PTUA 1HXYB 1U93B 1BP3B 5HPOA 5CZVH 1G9NH 3QDGE 1IILE 5EOCJ 3SO3C 3QUMH 5DFVD 3T2OA 5JTWA 1X3DA 2XWJA 4XWGL 3WUWA 1F8TL 4MA1B 3OAYH 3OGCB 4TUJB 4M8QB 1FZMB 3CMOL 1Z9SA 1G9MH 3VI4F 5SWSB 2DQFB 4C59B 4UB0H 1MCQA 2E27H 2OXHA 3WJJA 4Y1AB 4GKZA 1DBKH 1QQDA 2Z35B 5GSRA 3AM8C 4JO1L 5JIKA 5F70A 5IWLA 1HINH 4ZAKC 1PVHA 1EGJA 3QPXH 1K3ZA 5EBLA 4J4PA 4OTXL 3GBLA 1BX2A 1GC1H 4GRLC 1KJ2A 1UB6B 3MFFA 4OF8A 5D7JC 4NZUL 2ICWB 3LS4L 2R15A 5J1TC 3WUWG 1T7XA 5F6IB 3I3EA 5D8JH 1ZLUK 5EZJB 4YDKL 3S37X 1FQ9C 3KYKL 3MLVH 2QQLH 3RVTC 3EDFA 3PWLA 4L8SB 3I3DA 1BFTA 1Q38A 3VD9A 2AV1B 2C1PA 3KXFB 2P5WB 1UZ8B 2ZOKA 4PJCF 3G08B 1R5WB 1JVKA 4NQTA 3KXFD 2P5WD 3WHE0 3D3VE 1AD0B 2ZCHH 4N9OB 4O02L 3DTXA 2XZZA 5A1AA 1NBZB 1P53A 1IC5H 1OAXL 2EH8H 1PBYA 2IQ9L 1WC7A 4RMTA 4HBCH 2XI9A 5IQ7H 4NQDD 3CFCL 2F15A 4JJ5A 2W91A 4LASL 4F3FA 4G8IA 1TJIH 3L3GB 4Z0BL 1P84J 4M9OA 2O5YH 4I3GA 1ITCA 2WNGA 5DJ0B 5D7LB 3VA6A 5JNYA 4OCRL 1G7IB 3CZFA 5FEBA 1I1FA 3AREC 5GS0C 1D5XB 4HFWA 4XNUL 4Y5YA 4K71C 1SMAA 4XXCC 2YD1A 2NY2B 2NX5E 2HP4A 1NCNA 4MCYB 4XPHH 4ZS7H 4DVBB 4YBLC 5IVZA 5HDOA 2V7HB 1UM6L 1YUHA 2Q20A 3CCHB 4Z95H 1MI5B 5LWYL 1KELH 3QCVH 5C0CB 2V2XA 3VXOA 1WISA 1MI5D 4U2YA 2PKDA 1ZHNA 4OLUH 3QIBD 1MVUB 2NXYC 2HTKC 1VFBA 3EHBC 4PRNB 1VSCA 4OUUB 1HWHB 2XTJC 3MBXH 3VH8B 1IC4H 2HJLA 3VDCA 4KDTA 5CUSH 1MFEH 1HH9A 3D6GA 5JHLH 3M1BB 4L4TA 2AJYH 4QXTA 5FUOH 3MTRA 4J8RA 2EXYC 4M7KL 3OKKA 1OTUC 5ITFA 2DBLH 5DD0H 2F53E 1RK1A 4I0PB 1ETZA 5JUEH 4QCIB 4FQXA 3T0EA 4FFYL 4UINL 5TDNB 2F8VA 1G7MA 2I9LB 1Z3GH 4FQQA 4I0PD 4U1KA 1D3CA 3LPGA 4PG9A 4YFLI 3NABL 4GAJL 1BREA 3CXHJ 5T5FL 5D93B 4OZGB 3HMXA 1AO7A 4LSPH 1M7IA 3S35X 2PR4L 2VXVH 4X7SL 5TF1L 4GFTB 4HIHB 1H8SA 1FL6A 3MX0A 3QEUA 1EO7A 4NO2B 4JFDE 5L6YH 1CGVA 1GHFL 3V0VA 4MA1C 2FD6H 4PRIE 4O51B 2VXTL 2HFFA 3TT3L 3PV7A 5MEOA 4I4WA 2Z31B 3MGOA 5JW4M 5CJQL 5DJ2A 4F7PB 1OF2A 3U83A 1A3LL 1OLZA 4PJ7E 5DFTA 2Z31D 3U30B 1RZIB 2OQJB 1GYAA 3MREB 5EUOB 4EEEA 2XV6B 1EEQA 5HDBF 5KOVC 4PRPA 1FYHB 1OB1A 1DJSA 4XNMB 1DBJL 3IDXL 5CJBA 3C09B 4NHUB 1ODAA 4UDUA 5TGBA 4B0MM 1DVFB 3BZ4B 3SE9H 3GSNB 4K3DL 2QBWA 2XYCA 4HK3J 4IM8A 2V5SA 1DVFD 4DGVL 5F6IC 5EFIB 4NKDA 1F11B 3UPAA 3NIGE 4RA3A 5HVGB 3MRBB 2SEBA 3H3PH 4B41A 3WKMH 4L8SC 5CFHA 5I1DA 2DQCL 1FIEA 1I7ZA 1NFDB 4PGDA 5J89A 3LN9A 3DX9A 4OCSL 5DD3L 1GAFL 4YGVA 1EBAA 4NDMA 3O4LD 4FQ1L 5EB9A 3AS2A 5I1GH 3AY4C 5ALCH 4UILL 5EU3B 4POZD 5T1LA 4R2GB 1NH6A 5GGRB 4EXPX 3PWVA 4R2GD 3KLAA 1WIPA 1ZTXH 1JNNL 2F58H 4JFZL 1N5AA 4I77L 1BLNA 3GKWL 3CXDH 1K5NA 2PW2A 2XKUA 2BMKB 2HLAB 1C1EH 4Z7UE 2D31B 3UYOD 2D3VA 1F90H 1NUFA 2WUBL 5BS0E 4LLQA 3MUJA 4WO4B 1OTSD 2ITCA 3RDTA 3AC0A 1CGTA 3NMEA 4X6DA 4TYUA 3RQ3A 2AXFB 4Z7QE 3VDAA 2NY2C 3S6CA 3MCG1 1BZ9B 1GL4B 2O5ZH 2ICWI 3EYSL 3MRFB 1AQDB 2XWTB 2RR3A 5I1KL 3WJLC 1CXFA 4H8WL 1KN4H 5C7XL 2N7AA 2B1HL 4FZEH 3WO3B 2BVEA 2CMRL 3WD5H 1FL3A 4EI5B 4PJDB 3ZDYE 4F7CB 3PDOB 4RAVB 4P2QA 5D1XA 1IAMA 1U2CA 3BD5A 3G9VA 3FQXA 5DMKA 5FCSH 1MRCH 1J88A 4U31A 4Z7WE 1A6TB 3OJ2C 1G7PB 1FH5L 1WUNT 5I8OL 1P7KA 3P4NB 4NQEB 1F6FB 4XP6L 5K93A 1TTUA 2NY4D 4I0PC 3ULUE 1S9XB 5E2UH 1U8JA 4NQED 1L7TH 2ZP0T 5IOPB 3U0TA 1MF2L 1B88A 3ROOA 3HNVL 1MOEA 4HKJA 2VZVA 1CICB 4PJBE 5D93C 2EKJA 3LRGA 3STZA 3OKYA 4NNPL 1UEMA 2X5PA 5M7QA 2ADFH 1RJCA 3FL7A 1AY1L 4HZLA 4WFHE 1RIUH 3M17A 2AI0L 4DTGL 1P6FA 1EJOH 4BM7A 5EZIH 2XZCL 4YIQB 2Y9RT 1A1NB 3R0NA 2Z31C 4PJ9A 3FMGL 4R7NA 2XKNB 3RNKB 4E5XA 1S7XB 3WXWH 4UDTA 3E3QC 4C56B 5IHBA 5DQ9B 1U8NA 5TH2B 3L6FB 3DBXB 3U30C 2X10A 4LIQE 5BCAA 3C08L 4KKCD 3WN5B 1F3DH 2UWEF 4OJFL 4PJIB 2CKNA 3V5DB 2JB6A 3C09C 2EECA 5CEYA 4OM1L 4JRYB 1DVFC 5I1CH 5T1DL 2EKSA 1JHKL 1JF6A 4HCRL 4NN7B 5IB5B 1JYVA 4JRYD 1YEIL 3VXQB 4KJYB 1RURH 1PG7W 2BCKB 3QG6A 1MPAL 4X9HA 3CFJB 2CKBB 4U3HA 2V2WA 3DYOA 1R3LB 1WV7T 3MOBH 2GJ6B 1VADB 1YEDB 4UV4L 4CU8A 4JM2B 5GGUB 1QZ1A 2DWEA 2G75B 1SY6H 4P3DB 2CKBL 4NQCB 2VN4A 4L8DB 1H3PH 4JM2D 3VFVA 3C5JB 1E27B 5JZ7D 4K94H 5DHXB 5I15L 3TBSB 5F21B 1RJZB 1RFDL 4F9LA 1AGCA 4R2GC 2WMPA 4U7KA 1MAML 3HNSH 1KTLA 5GHWH 3FB8A 1U8IB 1VFAB 1FZOB 2XZQH 2MKWA 4EDWL 3K3QA 2NTFA 1FAKT 5D1ZB 2P5EA 1FLRH 3H3BC 2Y5EA 5E9DE 3VXUE 1OTSC 3EUUA 1IRAY 5D1ZD 2P8LA 4NKIH 4WO4C 5AYUL 4YX2H 3KHQA 4HJ0D 3DUSB 1FPTH 4Y4FB 12E8H 3C6SA 5F9JB 1T1YA 1GGIL 4OFKA 4OLZL 3MLSL 1U8HB 4H8WC 4Y4FD 2I5YH 4UMGA 4EOWL 5BW7C 1QVOA 4CADB 4HBQA 3SPVA 1AKJB 3FN0L 3QWRA 1T5XA 4QNPF 5C9JB 4TPRL 1F4XL 3G6JF 4XAWL 4YHMH 1AKJD 2L7UA 4FQ2H 4XNXH 1KCVH 1TJGH 4WTXA 4YGAB 4EI5C 1TPXB 3I2CL 2NY3B 5EC2A 4M1CD 5EA0L 5DUBB 3P9MA 4PR5B 1NGZB 3P30L 5E5RB 5IESH 2NY3D 3BGAA 4RMRA 4KZDL 2J2ZA 3CH1B 5E94B 4JANA 4KMTH 1E6JL 2AJXH 2D4DA 4HH8A 2XRAL 3B4NA 4XI5D 2EE9A 2KL6A 2AABH 3BGFB 3JXAA 1BVKB 1ZA3B 4FRWA 3QEGL 4LCWB 2VABA 3BGMA 3E6HB 4RQQA 4JGMA 4LCUB 1INQB 4LCWD 2F5BH 1NFKA 3ZDXE 1CXIA 3KPRE 4ZUWB 3CFDA 3LVEA 4ESKA 4N0FB 1Q9LA 1OAKL 3D2UB 1WF5A 1YPZE 3U1SH 5KS9F 4X6BA 5CGYC 2R0ZH 1CGXA 5B39B 1WEJH 2DD8H 4WEMB 2R0LL 4DK3A 3D2UD 1CICC 3IDIB 1ZSDB 3KPMB 5K9QI 4JHWL 1H5BA 1BZ7B 1FL5B 5D7IB 1NAMA 1RIVH 4XH2A 1A6AB 3OAZH 1Y18A 3O9WB 1DZBA 1ZHLB 5JR1H 1O0VA 3O9WD 1CG9A 3BSZL 4QHKI 3DSFL 4JB9L 3OR7B 3ARBB 3GBMH 5IR1B 3LQMA 4GW5A 3TEUA 4P3CH 1ZLVH 3ARBD 4M8VA 4KKCC 1DQLL 1M6OB 2VSCA 4D9QD 4LCIL 3U2SB 1HYSC 1OSZB 5IHUL 2YD8A 4I18A 3HRPA 5DO2D 3WN5C 1MLCB 4FTVD 4PJGF 3HE6A 4EI6A 2DOCA 3SJVE 3U7WL 1V7ML 3THMH 4B50A 3V4UL 1F3JB 3N1MC 4NN7C 3SEPA 3RWDB 1G6RH 4P2OB 1XGUA 1MCOL 2QHRL 5DGQA 1SJXA 3A6CL 4QYOB 5IEKB 2BC4A 3HZKA 4P2OD 3C60B 4D3CH 4KTEL 3QUZB 2ESVD 5HHPB 2W65B 3BP6B 2DM4A 4YZFE 1MCSA 2NTSP 3QUYB 4G8GA 2H9GA 2DIJA 1FNHA 3ZHLA 3QUYD 4JM2C 1MEXH 3TJEH 2MTPA 1ADQL 3MSPA 1UWXH 2COQA 5MENA 2OR7A 3CXHK 3B8YA 2VLLB 5GXBB 5DRZB 1FDLL 1VESA 4MX7B 1VEOA 4U6HB 1TVDA 3D0LA 3TT1H 1K4DA 1HEZB 2YA0A 4GXVL 4X9BA 4MJ6A 3RUGA 4O5LL 4OLWL 4M61A 1KJVB 5IK3A 1RJYA 3L5JA 3BQUA 3TVMA 2JCCF 1QFWL 5DQDL 2LVEA 3HLAB 4YHOH 1KEMH 1S7VA 5D1ZC 1F4YL 1X44A 3KR3H 2XTLA 3QDJE 5E5MA 1KJ3L 4TVPH 1BBDH 1YEEH 4HJ0C 4JRXB 3GRWH 1AFVH 4PJEE 4P0DA 4U1LB 2EDDA 2VQ1B 4R6UA 1UB5B 3IDNB 2VDLL 1Q9KB 4G6JH 1TXKA 4JRXD 1I8LA 4Y4FC 4NHCH 4YNYA 3K1DA 1KG0B 1ZGLP 1RHHB 4O2CB 1DSFL 5IQ9A 4LPCA 5HHQB 4V1DE 1RIHL 3D18B 1Q72H 3HG1E 4Z7VB 3LKSA 2J6EH 4OZHB 4TSAH 1U58A 2UZIH 2GCYA 2MMXA 1N6UA 2QKIA 4LOUC 4D9LH 1J1XH 5GGVY 5ICXB 3RWCA 1TPXC 2NY3C 4XGZA 4LLMB 5GZND 1E4WH 2IQAB 5AYQA 1CFQB 2Y6SD 3OKMA 4ELME 2FH8A 2N56A 4JPVL 1N0LA 2NR6D 4HIJB 5IB3B 1TDQA 2RCSH 4HH9B 1KTDA 1JNLL 4PGJA 4EZMA 3EDJA 3TIEB 3BGFC 5E6YA 4KI5E 3U0WH 5EU6A 3T2NH 3T04D 2Z93A 2R2BB 1HSBA 2NY5H 3VXRE 3MZTA 1RZJL 4NWTH 1I3UA 5F3HA 2V17H 3QRFM 4CN1A 3MLWH 2ARJB 1FORL 2E5EA 5E8PB 3VFRA 1ZT1A 5LKNA 1IM9A 4HC1A 2JJVA 4DZ8B 3IJSB 4PLJD 1J0JA 1QLFB 5F1IB 2MJWA 1A0QH 1I9IH 1A7PH 4FFVC 1JPFA 3O9WC 1E4KA 1WBYB 3H8NA 5IGXL 1SBSH 5E9DA 1P4LB 4XPFL 4A6YB 1EXUB 4BFIA 1P4IL 3ARBC 3SDCB 2WM0A 3Q6FA 3TNNB 7FABL 2DJ4A 4PTTB 5CKGA 5FB8B 3Q5YA 4GLRI 3FT3A 4A6YL 4JY4B 3DO7A 3V5HA 5MEPB 5EDXA 4F15B 5E03A 5CZVL 4XP5H 2KH2B 1G9NL 5CBAB 1J12A 3FB6A 1DANU 4NO3A 4JFOA 4LEXH 1KNOB 3AAZA 3QUML 4KRPD 2AJ3A 3C8KB 3ILPA 4P2OC 4PBXA 3EJZD 3DNKA 4P2RA 3STBA 2BSTB 2CLRA 4QT5A 5FO7A 5DMJB 4PRHB 3F62A 1XGQB 3MJ8B 1B0RA 3C60C 1G9ML 3QUZC 1JGVL 4OD2A 2E27L 3QUYC 1AD9B 4LP4A 1DBKL 4HKBA 5E7BA 2Q76A 4D0BB 1YN6B 1SMOA 2PNDA 3GMMB 5FYKH 3PHQA 2YD2A 2F54D 1AGEB 5HGHA 1NSNH 3QPXL 3GSUB 1HIML 1SEBB 2BRRH 5MERB 4MAUH 1GC1L 1H3GA 4HK0B 4LQ1A 1RZKH 5CP7A 2ZSVA 2UY7A 4Z9KB 3UTTB 3QFDA 5D8JL 5IHZB 3P9WB 2D7PA 3LEXB 5C09E 1N7ML 4XVUD 3MLVL 2QQLL 1IGYA 4OD1L 4XPBH 3PGCB 4HX1A 3HPJA 5J3HD 3MRGA 5D96B 4HGWA 1I7UB 2A6DB 3ISWA 4RMSA 3FTGA 3PQYA 5E7FA 3PNWB 1A4KA 2AXGB 1VCAA 2ZCHL 5DD6A 5DK2A 2KZWA 1F6AB 3QFJA 3QQ3A 1I1AB 4HUXA 5C07E 1IC5L 2EH8L 1VKXB 5FK9B 4G80B 5DUPH 4S2SA 1B4JH 5DEFB 4HBCL 3RTQD 5HYEA 3HI6H 2VXQL 1A1MA 5IQ7L 4C57C 1IAOB 4YBHA 3CSGA 2FEEI 3PABA 1TJIL 1R3JB 3U6RA 1FVDB 4LKXB 2ADGA 3GSVB 3QNXA 4OLVH 4U6YB 5LAXA 4B7LA 2O5YL 4G6ML 1EJ6A 2NR6C 1EFXD 5IB1A 1TCRB 4IRSB 3HI1B 3MROA 4F7TB 1CFSA 3LSOA 2IANB 1RZJC 4LNVA 4I5BB 4IRSD 5ESAA 3PP3K 1KB5H 1H15B 1FN4A 1WIUA 2FL5B 5DJ6A 5DDHA 4KRLB 1R5IA 5JQHC 2EEDA 2VE6B 2HTLD 4XPHL 4ZS7L 5IVXE 4FP8L 4WCYH 4OBSA 1JFQH 4YDJB 3WIHL 1KELL 3UJTH 3GMRA 4HQQH 1UKSA 5H94B 5SX4H 1LP9F 1M05B 5GGVH 4BSWB 2IALB 4OLUL 2XWBB 5IFAH 2DDQH 2FHCA 3FFCB 1MFAH 1WWCA 1T22B 4NQVB 3QAZB 1FFRA 3MBXL 5GRVL 1IC4L 3CVHA 5CUSL 5I1LB 3B9EA 3U79A 4KUZL 1LE5B 3ARDD 5JHLL 1MHCB 5HI5C 4RZCB 2AJYL 5HHXL 3C5ZA 4XCYB 5FUOL 4LPVA 2ORBH 3QWQB 2DBLL 5DD0L 3SDCC 4F37K 5KW9L 4EUPB 3N50A 2FGWL 1G9NC 3GSQB 3LH2H 1YN7B 1Z3GL 1FV1B 3RL2B 3FT2B 4M6NL 1IL1A 1VFMA 2F74A 5K33A 1ORSB 2VLJB 4U6VH 4F15C 3L5XH 3BPCA 5JHDE 1FNEB 1YNKH 2HN7A 2VXVL 2EICA 1HDMA 1Q8MA 4O9HH 5ACZA 1G9MC 5TQ2H 3DOSA 3BKMH 1MRDH 3OXRB 5E8OA 3PWUA 3QDMB 5L6YL 1SYSA 1BPVA 2A74B 5F1SA 4RAHA 4DQOH 2FD6L 3QDMD 1QA9A 1VA9A 3BYTA 4OLEA 3WL9A 3GMPA 1A6UL 3AXLA 4E42A 1BBJA 5BXFB 4QHNB 4X80H 2YC1B 3FN3A 1NDGA 3RNQB 3BP4A 4NRXB 5I1JH 4N90D 1TZIA 4HDIA 3H9YA 1DQJA 3TH4T 2YSSA 1ROWA 2QSVA 1P4BL 5F7MC 3SE9L 1RZFH 1QSFE 2JJSC 3TBWA 3MNWB 3MRKA 3TC9A 5ANME 4XVUC 1EVUA 3KLHC 1E28A 1M4KA 1CN4A 4N9GA 3HS0A 5KS9B 4MXVF 3WKML 5CHNA 5TE7H 4R3SA 3D9AL 5KSUA 3MFGB 1U8OA 4HJGB 5D96C 3UXFA 1K9TA 4W4OC 4X6FA 2EYSA 2GAZA 2YPKB 4PRDA 4JFXB 4IMKA 1Z5LB 4PJFF 1CL7H 1WICA 5I1GL 3HC4H 4PJHF 4WW2F 1KENH 5I2IA 4OZIE 3KG5A 5ALCL 5I71B 1I1AC 5HVWA 2R8SH 4GG8A 2DN7A 2ZSWA 3ARFD 4Y19E 1JRHL 1FNGA 1ZTXL 5CGMA 2F58L 4Y5XB 3CXDL 3GSOA 4BA8A 3ALWA 1SJEA 5T1MA 1C1EL 1RV6X 3RBGA 1UH2A 1F90L 2R29H 4YHKL 2WANA 1XGTA 2QSQA 4IRSC 4NUJA 2R1YB 4JFPB 3Q3GB 3MMEA 1YEHH 3JWDH 3IXTA 3MRCB 4K9EH 4Q58C 3PGDB 2M2DA 4JY6A 3QUXA 3N1GC 5KSAA 2J4WH 5SWSE 3RGVD 3NA9H 1NCDH 3V6OA 4Y1AE 2O5ZL 1BF8A 3TYGL 1T89C 3D85B 4AMKH 1N6QL 3W0WE 5MHSE 1X7QA 2H32B 5CP3H 2VLKB 1KJMB 3GUTB 3D85D 4L3AA 4M5ZH 2XACC 4GBXD 4FZEL 3WD5L 1R6VA 5HHOA 3I6LE 4EQ3A 5I8CB 1IEAB 4MNHA 4TTDD 3MOQA 2GKIA 4XRCB 3MYJA 4K7PY 4CN6A 5DFWH 3QAZC 2RHEA 5IKCA 5LGJA 2DRUA 1MRCL 1FJ1A 1P7QA 5CIPB 1ZVSA 1D5MB 3SDDB 4ODWA 4GXUM 4ZUVA 3UJJH 3VCLA 1FE8H 2BSSA 3L3JB 3VGBA 3PHOA 3SGJC 4KJWD 1MWAA 3O6LH 3ES6A 3KXFE 2P5WE 4J1UB 5E2UL 2KBGA 3ULSB 4R0LA 4YO0A 4OV5A 5EORH 3QQ4B 3GMLA 2WWMD 1TTFA 1MJUH 4LKCA 4ZG1A 3ARTA 2JELL 4I0CC 4W81A 3HZMB 5TPWH 4LP5A 1KCLA 4PGEB 3VWKB 4XNZB 3GJFH 1ERNA 3B3IB 2ADFL 4NUGL 5H37G 3DXAA 4KK9D 3B43A 1IC7H 1PX4A 5C0GB 3IDMA 3B2UD 4LEOA 1QTYT 2VLRA 3VMOA 3RFZC 1EJOL 4PRBB 4YHZH 2ERJB 3FO9B 2H45A 3O6MH 3F12A 4XP4H 3B2VH 4S0TD 5EU4A 5EZIL 3W39A 2MHAA 1FC1A 4PRAB 5D7LE 2FYYA 3K2MC 3G04B 4LSSH 1Q9OA 5CD5D 1NEZA 5BVPH 1CD8A 3WXWL 3LV3A 3IVKB 2W0FA 3O2DA 3VFGL 3AS0A 2BOCA 3IS1X 4QF1B 3QULA 5L2KB 4ODHH 4CJ1A 2X1PA 4KFZC 2YKLH 1QRNB 5HI3D 2UVFA 4P4KD 3PL6A 5I1CL 4H25A 3DX8B 2RFXA 2X09A 4RAUB 1HQRA 1S8DA 8FABB 4ZAKA 4YAQA 5DHYB 5SWZD 5C0CE 2BVPB 3STLB 1SYVA 1RURL 2BNQA 5BJTB 5T5NF 2VKWA 1YEKL 4TNVK 4AK1A 1ZKAA 1T7YA 3ARWA 1QR4A 2AAVA 1D5ZA 3VFUB 1IGJA 4OCXH 1BVLB 4U6TA 3MOBL 3BZEA 4MNQD 2I9TA 2ZG1A 3I6GA 4S10A 4W70A 4Z0XB 3VXMB 1SY6L 4U1GB 2J7LA 2QV2A 4JZOA 4N8CH 1H3PL 5D2NE 3VXMD 5A2JH 4K94L 5I71C 4PPTA 1I85C 1M1SA 1AI1L 3MYZA 4OAWA 3WFBL 3HNSL 1FP5A 2FRGP 1MQ8A 4LCYB 1S7SA 1FG9C 3O6FA 3FO2B 4NO5B 2GIYA 1C7SA 2XZQL 1OTTD 4Y5XC 1IC1A 5E8EB 4OZGE 1A7RL 2VDQH 4LLUA 4KXZI 3KDMB 2H6PB 5I8KH 4IHOA 4ZPVB 5I76B 4NKIL 1JTOA 2IC2A 4YX2L 1RJLB 1KCUH 1FPTL 4KK6C 2KQNA 3RWGA 5HYJA 3IGAA 5HGDB 4Q9BA 4Z78A 3NACH 12E8L 3F7RA 2WBJD 2I5YL 1UFUA 4U1MA 3AREA 3W9EA 5C1MB 2HJKA 2M8XA 2P8PB 4HWUA 2AJSH 2CDEA 4AJ0A 3E3QE 3C6LB 1FFPB 4X4XB 5E2VH 2EIEA 2NW2B 5EUOE 4YHML 1XCTA 5JO5A 1LEGB 4FQ2L 4TTDC 3C6LD 4XNXL 1KCVL 3IRZA 3KYAA 1FBIL 3PJSA 4LLYB 1ZGLM 4ISVB 5D5MF 1T0MA 2WUCH 5IESL 3UDWC 4QOKA 1SJHB 4WI9A 5KG9B 4OZFH 2Z8VC 3GFUA 1R3IH 2E8ZA 4KMTL 3V2AR 2UYLA 2AJXL 3B9KD 4A2LA 5JDJA 4JFEE 1JRHI 2AABL 4KJWC 1W72H 4XAKE 1BZQK 3SDDC 4AIZA 1GGYA 2FJGA 3F7VB 3BKJH 4GJTB 1JPST 2F5BL 4XBEH 1HWGB 2EDBA 1ZHBB 2IBBA 4GQPH 5IM7A 2WWMC 1R24B 3U1SL 4U1HB 2R0ZL 4EN3B 3T0DA 1WEJL 2DD8L 3T3MF 2JCCA 1IGML 3L5WA 1CBVH 5GGQH 4EN3D 1GXEA 1V7NH 4ERSL 5KOMC 4XHJC 4KK9C 3VWKC 4ZDHB 4XNZC 4NNYB 2DQJH 1A6WH 1Z6JT 3B2UC 2BJMH 3SE3C 1LO2H 1JPTH 4JCMA 2ERJC 2QJDA 1UM5H 3KJ4B 1C08B 3HB3D 5CD5C 3GBML 1X5LA 5EBWA 1K85A 3FQWA 4MJIA 1YYMH 4NGHH 4M8QA 4PG2A 2F9BT 1X5ZA 1FZMA 4LPTA 2B39A 1LK3H 5HI3C 2DQFA 4MWFA 4F2MB 4O58H 5IW1B 1UJ3B 1FYTB 1EEYB 5JOEA 3THML 5E0QA 1S9VA 4WGWB 2DICA 1QD0A 3O3DB 1G6RL 1ZGLB 4J6RL 4AG4L 4ORGA 4XMLH 1CE6A 4PJDE 1T83C 2PTUA 4MMZC 4D3CL 5I73B 3FQRB 5GS1B 2FO4B 2JTDA 5E6ZA 5I17B 5CD3B 1INEL 1ZS8B 5DHVH 3KNBB 2BY0A 4L8SA 1CI5A 1MEXL 2YRZA 3BXNB 3NIDE 2UVEA 4HS3B 5CSZA 4U1GC 3WHXA 1HHJB 1T6WA 1X5FA 2AV1A 4HGMA 3W11D 4P59H 3OKDB 1BVZA 1DR9A 3HC3H 3G08A 4CRPA 1I1RA 3RX7A 3IU3A 3I02B 3TIDB 3RBSA 3I85A 1AD0A 3QG7L 1KXQE 3U7YL 4CGTA 1KPVB 1OTTC 3MV11 3ZE2E 3I84A 3T4AB 4G9DA 1HCVA 2R4RL 3ULUH 2ENYA 5TE4H 1NBZA 3FCTB 2G5BB 4TVPD 1JNHB 3UTQA 3VE0B 2VTFA 4NQDA 1RUMH 4YHOL 3RWJA 3DMMD 2GK2A 1ZEAL 1DE4A 3KR3L 1JZ4A 3JWNC 4PJAB 4TVPL 1BBDL 1YEEL 1VACA 1KGCE 2N7BA 3MJ7A 1RSFA 1NGYB 3FONB 4JDVB 5J9PB 5BOPA 4MD0B 3GRWL 1AFVL 1WWBX 3WDJA 3K8KA 3RKDD 3RVWD 5EIVA 3WCYA 4X98B 4NHCL 3EJYD 3RIFF 1G7IA 3EJJX 4NRYA 1Z2KA 2C9AA 3DJ9A 3P9LA 5FYLD 1D5XA 2MOVA 5ISZB 1RAMA 1I8IB 1Q72L 2J6EL 2PYFB 4N0UB 4C56E 4TSAL 1UZ6F 1HE7A 3C6LC 1YY9C 4F9PA 2UZIL 5FYLL 4UTBL 1OOAA 2YRPA 4D9LL 5KSBB 5TF0A 1J1XL 4PJIE 5GRJH 1ED3B 1HXMB 4MCYA 2FZ3B 1C12A 4JAMA 5SV4A 3D39E 4DVBA 4LIQH 3PWPD 2V7HA 4JRYE 4MXQD 1A6VH 1MI5A 1E4WL 3SN6N 4U1SA 4Z8FH 3QIBA 4WI4A 2RCSL 2I27N 1MVUA 5SWQA 1NQBA 4HPYH 1UQSA 4ZFOL 1HH6B 4OUUA 3T2NL 3U9PH 4N0YL 1LNUA 3NCBB 2GJ6E 4ONFH 1FVEA 2NY5L 1ZWIB 4R26L 4G3YH 1JWUB 4NWTL 4WWID 3SDXF 2V17L 2HWZH 4L3EB 4QRRD 3M1BA 3MLWL 4PYGA 3VGFA 5A3IC 1T7ZA 4NQCE 4EN3C 2H3NB 5AZEH 4WUUB 3P4LA 1FFNB 4PJFB 5DSCA 2HMID 4H1LH 4EVNA 2NNAB 4WUUD 4BSVB 4CDGC 1A0QL 2ID5A 4LSQH 4UUJA 1A7PL 4Z77B 1UXWB 2CLZA 4X6CF 1NLDH 3HB3C 1OGTB 1SBSL 1ONQA 2HT3D 3DUUA 3OF6D 4NFCA 3FQUA 3KJ4C 3V7AG 4OI9A 4J3OC 1CGUA 4ZUSA 1GGBH 4WHTA 2X1WL 4R4BA 4OF5A 5C08B 2IG2H 2ZWLT 4CMHB 5E08H 4KC3B 3L3HB 2Z31A 5C08D 4F7PA 4N1EA 1CD9B 4EIZC 4PJ5D 1ES0B 1UJ3C 2APVA 4RISH 2EC9U 2OQJA 4LEXL 3MREA 3ZKMD 1LO5B 5KN5A 5FOJA 2V5MA 3WLBB 3KPSD 2AQ1A 5ENWB 3VU2A 4R4ND 4KKAD 4AEFA 1X4ZA 4NHUA 4YBQD 4OM0H 3GK8H 1JIBA 3T2QA 3EDKA 5DJDB 3TBYB 4OGYH 3E2HB 2A6IB 3L9RB 3ELAT 5I73C 3EYOA 5DT1H 5FYKD 4JCLA 4M62H 3WIFA 5HTSA 2YEZA 4HIIB 2CLVB 2XN9B 3EYVA 4JM4H 1NCCH 3SCMD 5FYKL 2XN9D 1XGRA 5IMOB 3QXTA 1NFDA 1NSNL 4EDXA 4NJAH 5TDPB 1LP9A 3O4LA 4GKNB 4MAUL 2AJVH 3O11B 1RZKL 1JUFB 4H20H 2YPVH 5DQJA 4PLOB 4PJCE 5CSBA 3WLWD 5EU3A 4OB5H 2AK4E 4JREB 3G5VB 2OL3H 4GRMB 5BO1H 1PD6A 3OKOB 3HAEB 5D7IE 5EPMA 1T6VN 3RVWC 4G7VH 2PO6D 3MNVA 3QXVA 2VL5B 3EJYC 1J05A 5K9KB 5DMGC 3D48R 5JPMA 2DL2A 3NN8A 2WQ8A 2A83B 3SKOB 3UROR 5B4MD 3SO5A 4YLQT 4RIRB 3R06B 4V2BA 5DUPL 5DJ8B 1B4JL 1ORQA 1X4XA 4X6EA 3HI6L 3S34L 4OLXH 4MXQC 3T4YA 2P45B 4OLVL 1KLUB 4G42B 3VXNB 3DIFB 4LHUD 1Q1JH 2NY5C 1MHEA 1CD1B 3PDOA 3IETB 1LILA 3CH8A 2CIIB 5EH1A 2GTZB 1UC6A 4J3SA 1VGEL 1RULH 1A6TA 4E41B 3MRQB 5GGTL 3OSKA 3GHBH 2H26B 3KYOB 4DUXA 1JFQL 2DWDB 3EGSA 2YOCA 4NQEA 5CZXD 2B1AH 4QY8B 4HQQL 5I18L 1S9XA 5GGVL 3O3BA 4IOFD 5IFAL 2DDQL 1MFAL 2ZJSH 4JFFD 3G6AB 1Q94B 4HUWB 2HT3C 1YQVL 2VZOA 4KKNA 1AC6A 4NNXB 1RZ8B 4PJHA 4WW2A 2ORBL 2B4CH 4R96B 3DWTA 3K2UH 5ETUB 4FQJH 3LH2L 5JW4R 3HPLB 2FX7L 3QO0B 2Q8AL 4YIQA 4CMHC 3MO1B 5F9DC 5JDSB 4WTZA 1SEQH 4U6VL 2XKNA 3L5XL 2V5TA 4PJXB 3GBNH 1AXSB 1CFBA 1YNKL 2E7LC 5TH2A 4RFNB 4O9HL 4HCRA 4OZHE 4R4NC 4KKAC 1T66D 5TQ2L 1E4XH 3BKML 2DBJA 1MRDL 3WN5A 5ESQA 2YPLE 4ODTL 5CEXB 3AGVA 4U6XA 3V5DA 2E9IA 4DQOL 1U2HA 5IMLB 3T0BA 1I4FB 4KGJA 4M6OH 4JRYA 5FGBC 5HDBE 3E2HC 4BQ8A 3RVUD 3UYRH 4X80L 2WZPD 5EO0B 3BDXA 2J8UB 3KYMA 4XCCL 4IBLT 4F7EB 4WTZG 2VLME 3RJQB 1J1PH 5E4IA 1XZ0B 4F7MA 1VADA 4M7JH 3S5LB 1YEDA 2W9EH 1CK0H 4M43H 3MXWH 5BRZB 4ZOEA 3ZTJH 5GGUA 2XIDA 1KCKA 3VFWB 1RZFL 4CKVX 4HUMB 4QWWD 3QBTB 3CJJA 3TZVD 3MLUH 4L8DA 4AEIH 3KJ6H 3WIIH 3V5KB 3PIQB 4PJ8D 2NY7H 3P4MA 1NFIA 3GIVB 4JREC 2APTA 2X4QB 4UIMB 5TE7L 3LPFA 4WHYG 3QI9D 2ZUSA 4X4ME 5MP6H 5C0FB 4LVNB 3DVIA 1FZOA 1JNJA 1LEKB 1H3UA 1BD2A 4DOHB 5IMMB 2EDLA 2X89D 3VJ6B 2DYPB 3T65B 5D1ZA 5J1SC 1CL7L 5IJKC 1CVSC 4JQXA 4H0GA 1KENL 1BECA 2FHFA 4WUKH 1AP2B 4WDIB 1DEEB 5F96H 2I07B 5DMYA 1BAFL 2R8SL 4Z6AT 1JHTB 5EOQH 1EMTH 4Z76A 1AIFA 1NPUA 5F9JA 1U8HA 1NC2B 43C9A 4L8BB 4HG4J 4NOBA 3WXVH 1OAQH 4MA3B 4JHBA 1YDPB 3HZYB 1A7OH 3OAYK 3QDGB 3GMNB 1AKJA 3QZWB 1X6NA 4I3SL 3GMOB 2JK5A 2R29L 3LIZL 3QDGD 2EH7H 4ZD3L 4G9FE 5FOBB 4AT6B 1TZHB 1IAIH 2RBLA 1YEHL 3OKNA 4G8EA 4K9EL 5DUBA 4PR5A 3VFNB 1KXTB 4PRHE 3I50H 3HKFA 2J4WL 2K9UA 5KSVB 3NA9L 5FF6B 1NCDL 2X05A 1A1OB 1DLHB 3LQAL 1HHGA 1EK3A 1LDPH 1Q0YL 4QRUB 1G7HA 5GJSH 5CZXC 1P2CB 4LCWA 3QWOB 4APQD 2HG5B 2GK0B 4M5ZL 2HRLA 4IOFC 5IIEB 2OTWA 4S1QH 1C7TA 4ZFZB 4P9HH 4N0FA 3D2UA 3EW3B 5EO9B 2VISB 2QEJA 3UTTE 5B39A 3NBNA 3CMGA 4WFGE 1P1ZB 4LLWA 3R1GH 3VXPB 1ZANH 5JMOC 2Y23A 4ZXBD 1FL5A 1QLRA 1TENA 4Z7NE 3KPOA 1FE8L 4JEGB 1A6AA 2R0WH 3O6LL 2D03H 3OQ3B 3QSKB 4P2YA 3K8LA 3QPQD 4DKEH 4GSDH 3EO0B 4O00A 5EORL 5KANG 5D2LB 3VDBA 5AAWA 4QRSA 5T5NG 3U4EB 5JXEA 4JFQB 5TPWL 3SY0A 3UBXB 2WINB 4RFNC 2FBJH 4FTVA 3U2SA 1A64A 4K7FB 3L3IB 1CXLA 1IC7L 2V2TB 5DJYB 5KANI 1F58L 3NCYP 3RVUC 4ZOCA 5HBBA 4XP4L 3B2VL 2YK1H 2UWEE 4WFFE 4P2OA 2X1OA 2ESVA 4KAQH 4LSSL 3MRHB 2IANE 1S9WB 4HLJA 5HHPA 4ODHL 2C5DC 3QUYA 1VEMA 2YKLL 2X4SB 4P99A 5DRWB 1B90A 1BWWA 2LTQB 4QWWC 1MCIA 2NX5D 1JWSB 1MCFA 3NVQA 4NO0D 3CIQA 4KV5F 3NZ8A 5D5MA 3S96A 2GY7B 3QDHA 4ORZC 4DKFH 3JWOH 2X4TB 3HI5H 3SDXB 2BHUA 4NWUL 5EC1A 5DRZA 2AJZB 1Z9OA 3AROA 4RA0C 2XY2A 1JWMA 1J8HB 1KC5H 4U6HA 3TO4D 4YQXH 3MV7E 5GSVB 3P11H 1KJVA 3MOAH 4OCXL 3FFCE 4LVNC 4HULB 4P5TB 1DEDA 3LEVH 1BQLH 1NBQA 4GT7A 1Y6KR 4P5TD 4UZGA 3RY6C 1PSKH 2A77H 4N8CL 4XBGB 1VERA 5DK3A 2ICES 4JRXA 1ND0B 2F53D 4HGKC 3DETD 3SBWA 4XBPB 1U3HD 1VFOA 1WT5A 5FYJH 1A9BA 1KG0A 2VLJE 1ZLSH 1YY8A 4WW1A 3B9VA 4WWKB 4LQFH 4Z7VA 2NXZB 4K9EC 1PYWB 5IB2A 4XTRC 4AYFA 5I8KL 2NXZD 4JFDD 4PRIB 3NFNA 5ICXA 4ZFFB 3LQAC 2AK1H 1U8MA 4XNYL 3G6JE 4LLMA 4PRID 3NACL 4H5SA 3RPIA 2IQAA 1BFOB 1JN6A 1ZE3C 1H8NA 4HH9A 2AJSL 4PLKC 3P73B 2BVYA 4NQSB 5E2VL 4FQCH 1BOYA 2EIZB 2W38A 4OZFB 5E2TH 4PP2B 4WNQB 5EZLA 3G5ZB 5CEZL 5DEGB 4JJHA 1GCFA 1AHWA 4WIQA 5I8EB 3B9DA 2ADIB 2E9JA 1R3IL 1XAUA 2XG5A 1ITBB 4P46D 4E0RA 5ICZA 2EXWC 3T3PF 3ALXA 5E4EB 5KS9E 4KKBC 3IF1A 3QPQC 3NH7L 3BKJL 2OTUB 3QIUB 1Q9WB 2ZOLA 3MRNA 5IV2B 3JV6B 4XBEL 4YXHH 4LSTH 2EDRA 4Q97A 4A6YA 1JPGA 5FHBH 3TNNA 1CBVL 1C5DB 4TSCH 5GGQL 4L8CA 3WBDA 1IQDA 5DJCB 2FEDC 1V7NL 3QUMA 5LQBH 3MQIA 1QBLH 4HKXA 3HC0B 2DQJL 1A6WL 2OZ4L 2IF7A 4XZUB 2BJML 5FKPB 3QA3A 3WFEH 4WV1B 4D0DB 1LO2L 5CBAA 1QUNA 1JPTL 2CUHA 2D0FA 1XIWB 5HGBA 3TNMB 1KNOA 2P42B 1UM5L 1KLGB 1YMMA 5B22A 4PJGE 5BS0D 3BUYA 3HRZB 3CNKA 3H7LA 5HD8C 3N06B 2BSTA 1YC8A 1YYML 3HTLX 4NGHL 1XGQA 3SQOL 3MJ8A 4HUVB 1JV5B 1LK3L 4UIKH 3RJDA 2WK2A 3D1MC 3GGWA 5GIRB 1T7WA 1S5HB 2H1PL 2JKXA 4O58L 1AD9A 1FFQA 1WZLA 2F54A 4GW4B