5H35B

Crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DIVMTQTPLSLPVSLGDQASISCRSSQFIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/membrane protein
molecule keywords Fab Heavy Chain
publication title Crystal structures of the TRIC trimeric intracellular cation channel orthologues
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 217
sequence length 217
chains with identical sequence G, I
ec nomenclature
pdb deposition date 2016-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35B01
4YUEL 3NA9L 5DHVA 1R0AH 2H2PC 5INCB 3ILPB 2VISB 1D5XA 1YN6B 1WTGT 4HUXB 5TE6H 4OLVL 4OD3H 4LSSL 3NBNA 5D93C 5DJ6A 1A7NL 2FNBA 5C0IB 3OAYK 3QIWC 2EIZB 2UY7A 2QKIA 3GMLB 5FYLD 3V4PH 1WUNT 4M4PA 2OQJA 2EE9A 3LKNB 1UVQB 4B7IA 5ITBH 1C16B 4QY8A 1OWRM 4KDTA 1QPPA 5BZDB 4YXHL 5L9DL 1DVFC 1Y6KR 1BQLH 3BKJL 5A1AA 4WCYL 3MLWL 1GGCH 4NWUL 5TFSL 1RULL 2J4WH 3GEWB 3N06B 1KSRA 3D0VA 1WEJL 1C5CL 5C07D 1LO0H 3RY5A 1HEZA 1F6LL 1R5WB 5DJXA 4X4YB 4NO2A 4MCYA 3QDME 1T5WA 1G0YR 5EOTA 1NC4D 2QQNH 1NEUA 5LCVL 4W6WB 3RL2B 3T0EC 3LIZL 1KLUB 3QI9D 4C58B 1XGYL 4KGLA 1DBKH 2CLVA 4KI1A 4XP4L 3AUVA 1OLZA 2GI7A 4J8RB 1KCUL 2ESVA 3PQYE 3FMGL 1UM4H 3GSNH 4JDVB 1HOCB 4M93C 4UQ3B 2BOCA 3DUUB 1SVZA 1TJHH 5MI0C 2A0LD 4ELME 3AROA 3EDFA 3KPSE 1TQBB 3ZTJH 1UXWA 3TJHD 3TO4C 2VAAA 1K8DA 4K7PY 2APBA 1X7QB 4APQA 1CGSH 1FGNH 2ZCKH 4JHWL 1ZLVH 2J3SA 3O11B 1QD0A 4WO4C 1JI1A 3KPLB 1U93A 3L3HA 3BH9B 5IROA 2GCYB 1DANU 5IIEB 1EGJA 2W60B 1P84J 3QDJA 1N5YL 5F70A 3Q6FB 5CZVL 5GGSB 4PJ5D 2P8MB 3T0AA 4L29B 3LH2L 1B90A 4RMSA 1OTUC 2MQCA 3KXFE 4QHUB 3UO1H 5HYFA 1A14L 5ESQA 2PW2B 1RZFH 4JQXC 3MV7E 4HH9B 4XCNB 3BFOA 3IFPB 4NQDB 4LIQL 1RJLB 3VGDA 4FG6D 4YBQD 1Q72H 4PJBB 1PBYA 4NCC2 3D18A 1ZHKA 4RFEA 3GMNB 1B4JL 5BXFA 1D5BA 1KCKA 4JAMA 4GLRH 4JRYD 4Y5YA 5GISL 4BSWB 4E5XA 1YMHA 1EXUA 4XC3L 4ZOBA 2JCCE 2HMID 2YKLH 1W72H 4NGHL 32C2B 3JV4B 1EHLL 4JLRB 5DRWB 1IAOB 5EU5B 1NANH 2Y07H 4NO5B 1KFAH 1KYOJ 3T3ME 4ZO8A 4XVJL 1WZ1L 3UPAA 2XTLA 3WSQL 4XAKD 4X7SH 3PHSA 4JPWH 4V1DA 4X7FC 1LK2B 1A1NA 4S1RH 1CDYA 4Y4HA 3S4SG 2M1KA 4LVOB 1QSZA 5D8JL 5GJSL 4HIHA 3Q6GH 3TGXA 3L3DA 3QDGA 3QIUB 4JM2C 5DD5L 1YJDC 2VQUA 4EQ2A 2G75B 3NFPA 1KB5L 5DTFA 4K23L 2FH6A 3NGBC 1U8HB 1IKNC 4M61A 2R1XA 3QPQC 1S9XA 2AABH 4RAHA 1S9KC 3U2SB 4LSRL 3B8SA 3FFCB 2AK1L 4TSCL 2Z8SA 5SWSA 1NGZB 2EDBA 3V5HB 1U8NA 3VG9B 3K74B 5MENB 1A1MA 3DX8A 4HFWA 5SX4I 3S5LA 2DQFA 4EJ1C 4QRPD 5CSZB 3DYPA 4FP8H 2E9BA 3B9VA 5ALCH 3ZKMC 1FJ1B 3EFDH 1FZMA 3IB4A 1FL3A 3U7WL 1SJXA 1P5UA 1RZKL 1RZGB 3U6RA 4JPVL 1NEZB 3GSQA 4X0KB 1M6OB 5E5MB 3KYMA 4P2RA 1FNSL 1TTUA 3MLYH 5KSUB 1UWXH 3ARYA 3UMTA 1OAXH 1FNEB 3HB3C 2HP4A 3QUYB 4Z7VE 1G6RH 1LDPH 2EICA 1DLFH 1TVBA 3RUGE 4Z7NF 2E9WA 2EC9T 1WAAF 5D2LA 3PWUB 2VDLH 2CIIB 4WWKC 1U3YA 2OP4L 5T3XL 1U95A 5KSAA 4L8SC 3GSXA 1OF2A 1U8QB 3FFDB 1LEKB 4X4XB 3RGVA 3N1MC 1FFNB 2ADJA 3W9DA 3FT4A 1BVLB 4NNPL 4ODBD 4OBSA 5SWQA 3QCUH 1HYRC 4PJXF 2DQDH 2OZ4L 2AKRA 3U0PB 4ZQKA 4KPHL 2Z31A 4HWBH 4JCMA 5IFJA 3E6FB 4QOKD 2AXFA 3MJGX 3HZKA 2OR9L 5C0CA 3NCEB 5C0GB 5KSVA 2G5BB 1ZT4B 1Q0XH 2FHCA 3BT2H 5C8JA 4FXGA 3ULSB 3MROB 4U6VL 1XCQB 1GSMA 1VFBB 1ZVYA 4P2YA 1CN4A 1JE6A 4OI9A 5BS0D 2EXYC 4TOYL 5EU6A 3QJFB 1NAMA 4M8QB 1KPRB 3T0WA 1OP3K 5E08H 1YEHH 3FQRB 3IJHB 3ZT6A 4X83A 5FYKE 2IQ9L 2PW1B 4HS8H 4BQBA 2OTWA 1S9YB 3SGJA 3RWEB 4XPAL 4P23C 4P5TC 4DN3L 3H7BB 5CKAA 5HHQB 5ILTH 5L2KD 3OJMB 1PZUB 5I1JH 4Q74A 3TH4T 2IMNA 3QEQD 3ARQA 1JF1A 3VGAC 2NY4B 1LO5A 5HHPB 5TDNA 4YHLH 1WT5A 3MLUL 4UTAL 5K9JH 4XVTH 1CGUA 3T0DA 1UZ8B 1QRND 3CK0H 4WW2A 5IVXF 3TV3L 3QHTC 1GGIL 3RPKA 3L95A 4BFIB 4HWNA 1UCBL 2GYSA 2X40A 3IDGB 4HJJL 3Q2CA 3VGGA 3WXVL 3BEWA 5J57B 4Z8FL 3IDXL 3W2DL 4QHMB 4U1HB 5DLMH 4ENEC 4GW4A 2FX7H 3VG0H 1HI6B 3BO8A 4OD1H 4JKPL 2JELL 2D7TH 5SX5K 5JXAH 2RCSL 5CMAB 4LSQL 3BYTA 4W4OA 2UWEA 1YEIL 1A6UH 4QWWD 5JXEA 5L0QC 3U9PH 1BMGA 1BM3L 4U31A 4UMGA 1CFQB 2VWEC 3EYFB 4NJAH 5HYJE 3OGCB 4HG4J 43CAB 3V0WH 4P2CG 1RUPH 1J7VR 5GQBA 2Z8RA 3PGDA 4F9PA 4JDTH 1I1FB 2YRPA 4PGCA 3WJJC 3FOMB 4LP5A 2A74B 2YXMA 3NPZB 4HT1L 1MREL 3MV8E 5FGCE 2J12B 2R8SL 4OFPA 4LCWA 3AGVA 1T22A 4DOHB 4R4FH 4LCYB 3HC3L 3V4UL 4X7TA 3T04D 3MRNA 4Y5VA 4MQXD 2BRQA 2PO6C 1QFUL 1VADA 3P4OA 3BP5A 4EUPH 1Q9OA 1E6OH 3G6DH 5EO1A 3ULUH 2BSED 4JVPA 3IDJA 4JGMA 1KBGL 1FE8H 2VLKE 1EO8L 4EI5C 2X4SB 4F15C 3WL9B 1G9ML 5IJVA 4PJEA 3TCLB 5C0BE 5CCKH 3GMOB 2IALB 3S35X 2DQJH 3MMEA 1MCOH 2FO1A 5JQHC 2NYYC 2ZKHL 2FEDD 3AREA 3GSVA 2DQGL 3MPCA 5DSCA 4G6MH 2XY2A 2F54A 2BHUA 3NIDF 4NYLB 4G6KH 1INDH 2GY7B 3FQXB 3SDXF 4ELKA 3FL7A 5JOPE 3S3PA 2ICCA 5B38B 4KKAD 1HK6A 3BGAA 1QLRB 3C8KA 3UBXG 2NY5H 2XKSA 3DSFL 4GUPA 3CSPA 4H88H 5EG6C 4ZSOE 3HC0A 2LVEA 2MHAA 1NBQA 1YYMH 4YXLH 5AAWA 1KG0A 2OSLB 2AJVH 5HSFA 1HYSD 3CX2A 4GG8B 1J5OL 2IH3A 4K94L 3EIFA 4TVPE 2P43B 2FSEA 4NZTH 4OCRH 3WDHA 4XRCB 3RDTA 3D87B 1XF2B 4E9LA 3QUXB 1JGDA 4XNYL 2NY1B 1YPZF 5IFAH 4LLMA 3N1FC 3WFHA 5I30H 2NY2D 3I3DA 3WS6C 3WHXA 1T03H 3BP4B 3H9HB 1S8DB 3IXTB 4XX1E 1T7XA 2F8VA 4MQ7A 4WHCA 4PRIE 1KGCE 4KGJA 1PX3A 1ZWIB 3PWJA 4CMMA 3IDMB 1VDGA 2BNRE 5M94B 1S7WB 2JJTA 3BEVA 3LHPL 3ARGA 4L3EB 1IBGL 1AXTL 4OCYH 3UC0L 2PR4H 1S9VA 4LGPB 3UTZA 1U91B 4MWFA 1NFDF 1MFBH 5FF6B 4OZIE 4KKNA 1P1ZB 4F7CA 2A6KA 2P47B 2IBZY 1FVEA 3IYLW 5DUMH 2VLJB 3MO1A 3D25B 2P7TA 3RWDA 4YR6A 2BY3A 4MX7B 2AXGB 2DWEB 1WBYA 3VDCA 4GRWH 1S7SB 3CAFA 5F7DB 4JFED 3H0TA 2AGJH 4KKCD 2PYFA 4XP5L 1WFUA 4UQ2A 4ZNCD 3CDCA 3KR3H 5IMKB 4H25B 1AE6H 4NKQB 5B39G 4RA0C 1HIML 3D2UA 5JIPA 3RWJA 3FB6A 4N0YH 5EZJB 4YXKH 1B2WL 3LRGA 5KANG 2BNUA 3QRFM 5HGAB 4JFFB 5F89B 2EZ0D 5CZXD 1X5GA 3DMMC 3AFLA 4LSVH 2EDEA 4AQ1B 2GFBB 1XCTB 1M7XA 2YD7A 3KAAA 3S7GA 2A2QT 2VITA 3FAWA 1ES0A 1K6QL 2A6JB 5C0ND 3CCHA 5DWUL 3MJ9A 1YEGH 2UYLB 4P46B 4AIXA 3ULUC 3UPRA 3VE0B 4PJDA 3CDFA 1JZ2A 1MHCB 3RWCA 2W9DH 4KUZH 2ZUXA 3LN9A 4KV5E 4JZJC 3VWJC 3EOYG 1FC1A 4NKMB 4YPGB 4CDGC 3E6HB 2ZSVA 4YE4L 2R15A 3MRIB 1YC7A 2NY3D 1NBZA 1RIHH 1U58A 2CRMA 5C9JB 2CUMA 5EIIA 2ZUQC 3GJFH 3D9AL 1CQKA 4RNRB 4MS8D 3TZVD 2O5YL 4HMEA 3WIHH 2NW2A 2BSSB 5L2JA 4W6YB 3QQ9D 1FBIH 1VGEL 3THMH 4XNMB 5I8OH 3BISA 3O9WA 1IZJA 4UNUA 4XTRC 1RIVH 1IGTA 4EQ3A 1DUYB 4ZXBD 1KT2A 4HGWA 4OJFH 5DJ0B 2NZ9D 3IU4L 3DRTA 4OF6A 2B0SL 5C08B 1YUHA 3S37L 1CBVL 1DBAH 3MODH 3ZLQC 4F8QA 4ERSL 1M7DB 3GSRA 1F4YH 3NZHH 1BJMA 1A21A 3Q5OA 1EUTA 2IAMC 3P77A 5AZ2L 2XT1B 3FZUD 1S3KH 2DQUH 5DF0A 4WFHD 1A3LH 1A4KB 4IRJA 1NBYA 3QH3A 3UPCA 1IEBA 4FQCL 5DD1H 1D9KD 2H9GA 5E9DA 5DJZB 2GSGA 1ZSDB 1WBZB 5F7WC 4U2YA 4YFLI 1QFOA 4K2UL 4NQDE 1MWAL 1F8TL 4MCZB 4HIXH 3GGWB 1HZHH 4PJBE 3VXME 4Y4FA 5GRJL 2PXYD 2VLMD 1KJ2B 4NZRH 5KBNC 2E7LA 1GGYA 1N7MH 4YGAB 1BQSA 2P8LA 1FORL 3L3GB 4JB9H 1BAFH 3DX9A 4YZFE 4AENA 5JOFB 3WIIH 3LS5L 3B2VH 3WJLC 4GRWF 4NPYB 5KSBA 5A2LH 4OAWA 3IAPA 4K3GA 5DJCB 5HY9B 1BECA 4OFKA 1MAKA 2IANA 4XCEB 4FMKA 3NCYS 4MAYA 1EA9C 3C8DA 3WD5H 1YY9C 3IJYB 1I8MB 1NLBL 1MNUH 4DGVH 4JN1L 4I0PC 3S4SA 3TIDA 5HYSA 2HTKD 3MGTB 5LVEA 1MUJB 4LMQI 4ODTL 2DLIA 2ZZUT 1CZ8H 1JGLH 2FZ3A 1PFCA 2HN7B 4F8TA 3SDAC 4HCRL 4I48A 5IMLB 3HI1B 1ZA6A 3ARFA 1C1EL 3OKDB 3LDBC 1OTSC 1MCPL 3TF7C 4MJ6A 5EWIL 2Q87A 3O6FB 4G6JL 4UV4L 2XXMB 1DDHA 4FABH 4ZFZB 3DOSA 4MZ3A 1PEZA 2HYMA 4L4VB 3U36B 1MCEA 2EXWC 3DGCR 3GHEH 3FO9A 4KDVA 3O81A 4ZD3L 4I9WE 3NFSH 4JG1L 1CE6B 4GLRI 1FZKB 4NN6C 5ESAA 3FHAA 4D9QD 3O2DL 1N5AA 1K85A 1X9QA 5K9OA 3RTQD 3QHFH 3BZ4B 3MOQA 1XR8A 3CXHK 3OZ9H 2QQLH 5GS0C 1F5WA 1LEGA 5T1KB 3N1GC 4XXDB 3H9ZA 3TYFB 2P5WA 5DRNA 4OCXH 2J8UB 3M45A 1NCTA 4FFYL 1ADQA 2W0LA 1GHFH 3VXSA 1G9NC 4OCNC 2PTVA 2GAZB 3C09C 1F11A 4C83A 2DQTH 3OKKA 5BVJB 4AJ0A 1FH5L 5EUOA 4Z7UF 1CICB 5FOJA 4JFQA 2Z35B 2H3NB 4HEME 5FHBL 5IBLC 2ENSA 3RWGA 5LQBL 4H8WL 4DW2H 1QFWM 3TP4A 4J4PA 2DQEL 4YDVA 2YD2A 3NZ8B 1H8OA 3MGAA 1ZHLA 4XVSL 5E94A 1YNKH 1RJCA 2VDQL 3QIBD 3RJDA 3TM6A 3W11C 1RU9H 4LVNC 4YHYB 1MJ7H 2DQHL 3G5VA 1P7KA 1YECL 4GAJL 1RHFA 3P0VL 4F57H 5DDHA 1RPQA 1A6VH 2V2XB 1HQ4B 1H8NA 3VFTA 3SJVB 2IFGA 1VPOH 3BP7A 1F4HA 5D1XC 1XF1A 2F53B 1A7PL 5DQ9B 3HAEH 1LO2H 4KRLB 1DE4A 3QIWA 4XCFH 3QNZA 3MLTA 3VD9A 1WTLA 3CH8A 2XWJA 4RGMC 1QLFB 4MDIA 3T77A 1A7OH 5I18H 3BQUC 1DVFA 4M3KB 2VMFA 1GPOH 4P9MH 2DBJA 1SHMA 5E8DL 4JY5H 5ISZB 12E8H 5KVDH 4XWGL 3V79C 5J11C 5JHDA 3QDJD 4XPTH 2ICWB 4YHIA 2FBJH 1MRFL 4JREC 5I76A 1DEEB 1QSFB 4LQFL 1I8IB 3MYJB 4KJQD 4Z0XB 3ZDZE 1BOYA 4OLXH 5INDB 4ISVB 2VXTL 3VMNA 1OARL 3VD5A 3O2VH 5IT2L 4YHOL 3T0EA 4IEFB 2GJZA 5DJAB 4P57A 2ITDB 3E2HC 4M62L 3GSOB 3VH8A 4P4KB 4K7FA 2H6PB 5F96H 5EORH 1DQLH 1F6AA 1JJUA 3T2QA 1GAFL 4C57C 1JZ4A 1A9BB 4HV8B 1REIA 1KN4H 5A16B 4XP6H 3AB0C 4HK0A 4G42B 5LGJA 4O2EB 5HJ3B 3BIKB 3TO4A 4N1EA 3ZKND 1OVZA 2BVTA 2VL5A 4NM4H 2DICA 5ADPH 4PS4L 3PG2A 4WO4A 4YHNB 3GJEA 4ORGA 2QEJA 4V1DD 4QCIB 2B4CH 1IGIH 3LSOB 4Y19B 5KW9H 2FIRT 4DOHE 3MJ7B 4WRLA 3GMMA 3QDGD 2JB5L 2R2CA 1IC7L 4MJ5A 1VGKA 4LSPL 2CUHA 4UV7H 1ZLWK 1QVOB 3EDJA 3NACL 3QAZC 4J3TA 5IOPB 1G84A 4NFBA 2R1YA 4O4YL 1NCCL 3Q0HA 4IOIA 4JQXA 3BPCB 5E8PA 4F33A 1FO0H 3C6SB 3ELAT 1EFXA 35C8H 1U8OB 5SWSD 4U1KB 2L7JA 1V3LA 4MNQA 4XBEH 4RAUB 3NOIA 4HKJA 2X10A 2A38A 1I7TB 1N6VA 4R4NC 1IKFL 5JQ6H 1HKLL 3U0WL 1JMXA 5D9SA 3PF2A 4M03A 1J9CT 3ESVF 3MLPA 5JLZB 1NPUA 1JWUA 1T3FB 3VGFA 5JIKA 2VERN 3QNXB 4YO0A 5IEKB 1GGTA 3AS3A 4FZEL 4NOFA 1JTOA 5IFHH 1PG7L 4XMKH 1FGVH 3LN5A 2F74B 3UBXA 1AJ7L 2HG5B 3UJTH 2V17L 3U0TB 4P2RD 2HFFA 4L4TA 4LP4A 1S7VB 4MSWB 5F7NC 3MRLB 3MRRB 4KUCF 2X4UA 3LKSB 5DJ8A 1F4WH 2EH7H 4O9HH 3VXRA 3HUJF 5GGRA 1W0WA 2CDGA 4AEIH 4R8WH 4JM2A 1BBJB 3B9KC 4A2LA 5GXBB 2WINA 4MXQD 1IAKB 3QISA 5IB5B 4CNIA 3LPFA 1IKNA 2CKBA 3HPJA 1FYTB 3PIQB 5KSAD 1Y18A 3VXPB 5T5NG 3LB6D 4LDEB 1ZT7A 2VDOL 3QT2A 2CR6A 1DQJA 1JNNH 4CN1A 4XMLH 4XGZB 4KI5E 2Z31D 2O5ZH 3QXAB 1KPVA 4LSTH 5JW5B 2C3VB 3O2WH 5FKPB 3S88H 1NBVH 4Z76B 4OV5A 1Z0NA 1IGML 5C07B 5L6YH 2VLRB 4PJHA 2HT2D 4J6RH 4LPYA 1BIHA 2I60H 4ONFH 5DVKA 4I4WA 5H2BB 3DJ9A 3OPZL 1NC4B 4O00A 2ZCHL 2C4XA 4OTXL 2Z92A 2VIRB 1KJVB 5E2UH 3BSZH 5IVOA 5KG9B 4PP1D 2AP2A 3TA3D 1MCQA 4FQQA 3CVHA 2NY7H 4P3CL 1PJ9A 5B3JE 1MCHA 3MRHB 3D1MC 5E70A 2VLJE 3VJ6A 3L5HA 1OD9A 4H5SA 4TYUA 5KS9F 2EE3A 2HT4D 4J3OC 4WWKA 4R0LC 3HHRB 4DAGH 2J88H 3X13A 2AV7B 1QRKA 4L8SA 1U41A 5J1AB 3DV6A 4GW1A 2EDOA 4CVZB 3U4BL 4FQXC 5B39A 5GGTA 4Z77A 3RHWK 3QZWG 3IKCB 4R2GC 5I73B 1IC5L 1T66C 2A9ML 4HJGA 4JFFE 4G5ZH 3ZYIA 3NCJL 4KK8C 3QEUA 2PYEA 2X5PA 2D03H 3SGKC 4DCQA 4JFDB 4TVPH 3MRCA 3V5KA 4P0DA 3IAGC 5AUMA 1MAJA 4A6YA 3MUHL 5CGTA 4GMSL 4XNUL 1GVIA 2I5YH 2RFXB 3VFMA 2F15A 3C08L 5JXED 2Z93A 4N0CC 3BMVA 1JNJA 5F93C 2VAJA 4FFZL 5DFWH 1MCCA 2GHWB 1Q9WB 2EDHA 2R2BA 4P23A 4P5TA 1HHJA 1U3HC 2VABB 3MLZH 1BOGB 1OP5K 1KTDB 5J3HC 4QXUL 4XT1C 3G5YB 3EFFA 3FRUB 1ZGLM 3DGGA 4B50A 3R8QA 3IJSA 4YDLC 3PWLB 5FV1L 4LCWD 1OAYH 4Y8AA 2FEEI 4NHUB 4PREB 3TN0B 4X4ZA 1NQBA 4YDKL 2E27L 3RAJH 4G80B 1CFVH 3IU3A 1FZJA 1DLHB 4GS7B 3X3FL 1VFMA 1VSCA 2LE9A 1FLTX 3MNWA 5EU4B 1H3PL 1GRWA 3RL1A 3CLEL 5CLWA 3O3AA 4DKEL 1HXYB 1N3NB 4L8DA 3CFBA 4DGIL 1SJEA 5BW7C 5FIEA 5GIRA 1I3GH 5C08E 1W8OA 1W0VB 2EDNA 4HC1A 3LKOB 4HW6A 2RQ8A 1UM5L 4OZHF 4JJ5B 5ERWA 3QCVH 4OKVB 3LV3B 4XP1L 1OB1A 1CF8L 2OI9B 1I7UA 3OR6A 1FDLH 3P30H 3ARRA 1TZHA 2R4RL 3FB7A 3VFVA 2R23B 3T2NH 4QXTA 4ZNEE 4RFOL 2F54D 4S1QL 5TGBA 1UZ6E 4QRPB 4R6UA 1YEFL 1WWWX 3JUZA 4Y1AA 1ZGLB 3C5SB 3KYOB 4MJIB 2D0HA 3QUKB 4N8VB 4PBVC 3WJJA 1U42A 4NP4L 4NUGL 4RFNB 2YHGA 4PJAA 4JEGB 3F7YA 4ZMAT 5D7IE 2EIEA 3EJZD 1RUAL 4LHUD 4E42A 3BXNA 1MAMH 2EDLA 1IRAY 2NX5A 3CZFB 3KPQB 2DI8A 1EGJL 1YMMB 4KY1L 2GITB 1GH7A 4YEEA 4PRAA 2E6PA 1S5IH 2EH8L 2PO6A 3QB7C 4DK6A 4HPYL 1EH9A 4Z78B 5AD0B 4Z0BH 3SO3C 4M7JL 3RDTD 2VXVL 3RKPA 4EI5A 2AJXL 3GSWA 5TF1L 1H3TA 1PZ5A 3RX5A 3P3YA 3PDDA 5HI4D 4KVCH 2VQ1A 4EI6B 1FG2A 3MNZA 4WHYG 4AYFA 2E9JA 4PJ7A 5IBTH 5EZOL 4CU6A 5J4MA 4HJ0C 4QOKB 4UILL 4G8EB 2DQCL 4GQPH 1HHGA 4N1HB 4KVNH 3DRQA 4K55A 1ETZA 4LEXL 3T4YB 2YPVL 4NQVB 5KVEL 4QYOB 1G0DA 3ARGD 1AD0B 2VZUA 4AQOA 3NCFB 1V7NH 1DQQA 5E6ZA 5HHOA 5BS0B 3LEXB 4RMWA 1XGRB 3HA0A 3HNSL 4L4VE 3KS0H 2MKLC 4HK3J 2G2RA 2A9NH 4KWUA 4LNVA 5C70A 3BJLA 4U4BA 5L2KB 4XCYB 5JA9A 1J05A 4LQ1A 4NJ9L 2APFA 3QEQB 4KTEL 3KPRA 5CEZD 5IB2A 4P5MA 5D70H 3D2UD 1BEYL 2AK4A 4LLUA 1Z3GL 3NABL 3BW9B 3WS6A 4P2QA 2NY0B 1WBXA 5I1CH 1OWWA 1QRNB 1AHWB 4L9LC 5CHNA 5FEBA 5ICZB 1D6EA 2MQ3A 5F8QC 1AO7A 1FV1B 1SY6H 2J8UE 2NTFB 2VZ3A 3F62A 1A64A 1EX0A 2XQYK 5CUSL 3QQ3B 3ES6B 4XI5C 3RWIB 1G7IA 4MXVF 1U9KA 3ETBF 4FFWD 4HPOL 4NC1E 2IPTL 4QEGA 2DD8L 5IG7B 4JY6B 1PW3A 4NT6A 3CFDA 1G7JA 2XPGB 1BFOB 3SDYL 1GGBH 4U49A 4KTDL 4M6NL 4PY8I 4JO3L 1G7QA 1T1ZA 1A7QH 2EC8A 3ROLB 2FX9L 4X8JA 3R1GL 1GZQB 2ADFL 5DHXB 4UIMA 4JFXA 5I1AA 5ACZB 4XVUD 5F88A 3NMEA 4KTYA 5KVMC 4ZS6C 3LCYA 3RA7L 5FYKU 4KMQA 2ZCLL 5EBGA 1FLRH 3SJVE 3O9WD 2YOCA 2EO9A 4JFYB 2BY0A 2F53E 4P4RA 2E7BA 3DMMA 2XA8L 1D5MB 3V8CA 2Q8BH 1Z5LA 1HXMB 5TJWK 2C7UB 2E6JA 1JN6A 4LPXA 1I9IH 1NAML 4M6MH 4ONGH 3ABZA 3SDCD 4WWID 4HUUB 5EBMA 3KNBA 5ISZE 3EYVA 3VWJA 3GBNL 1N8ZA 3DYMA 3BZEA 5K33A 5EC2B 4G7YH 4Q9QH 3VFWA 3S36L 1X4YA 3QEGH 3IDNB 1QSFE 2E3VA 4IRJD 4PRPA 1CGWA 4EZMA 2DLTA 3OF6A 2FL5B 3OKNA 2CK2A 1AQKL 1UA6H 1S7RA 1TQBC 4CVXA 4LLDA 4WEBL 3UAJD 4H0HB 3CSYB 4Q9RH 1PLGH 3EUUA 4JRXB 1SYVB 1JI2A 5ID1A 1FNAA 3SKNB 4Y4FD 5HDOA 3S34L 4I5BB 3VXOA 1YQVH 5I1EH 3L1OH 1G9EA 2EDJA 2F5AH 1RURL 3BJ91 5HDQL 2YEZA 4BM7A 2XTJD 4QNPF 5IMOA 3HC4H 1TMCB 1CDHA 3BIAX 1IGJB 2BJMH 2HFEA 1C12A 3FN0H 5L7XH 2IAND 4CRPA 5MP6L 1VENA 4J1UA 4MAYD 4F37F 4TSAH 1TJIL 1XGPA 3HKFA 1QKZL 4Z7WA 4PJBF 1IAIL 2HLAA 5GRVL 4F7EA 1JNHA 4PG2A 5F9DC 4XAWH 2BVQA 4Y19E 1FN4B 1KCVH 2E5EA 4TUJB 2ZPKL 3QNYB 2IAMA 3HRPA 3OKEB 5EN2B 4GKZB 5HGHB 5AWNH 4KUCD 4MD0A 4NM8L 5I0DA 1A6AB 3UJJL 4OI7A 3V6FB 3NIGE 3G04B 1OCWH 3ARFD 3A6OA 3UTTD 1WSST 5A43C 2HWZH 4PGDA 3Q3GB 3SE4C 1B0RA 4POZD 2E9IA 3F6LA 4PRDA 2XQBL 2R0ZL 5HI3C 3OJDA 1WF5A 1S78C 2C5DC 4NBXB 2H8PB 3RZCB 2AERT 4AEHH 5FYJH 2P44B 4LVOC 4JE4B 1UQSA 1GYAA 4KHTL 4JO2L 5B4MC 5C2UB 4KZEL 3QCTL 1PYWB 4DN4L 4UNVA 4ZDHB 4DWHA 1NMAH 1U0QA 4N8PA 2M8XA 5GRUL 3QRGH 1UB5B 4JFEB 2EDXA 1KIQB 4LKCA 1JUFA 2A77L 5BO1H 3QA3B 4GAGH 9CGTA 5EBLB 1AD9A 1D7FA 3TBVA 4U6YA 5JORA 1S7UB 3L9RB 5DK0A 2P5WD 4G7VL 1L7TH 3VG9C 5F9JB 1O5DT 1YDPB 1BVKB 1N2RA 3SDAA 2FECL 3PNWA 3KLHC 1J12A 3OG4B 3MZGB 5MHSD 4OM1H 1YC8A 4IRZL 3VXSD 1IFHL 1KJMB 4GW5B 4M7LL 5FCUH 1EAJA 1AI1H 1BFVH 1FYTE 5HHVL 3AM8C 4TULH 4WUUA 5FYLE 4OZGA 1T20B 4MB3A 4UIKL 4Y16D 1EJOL 1ZT1B 3PGCB 3H9YA 5FECA 3IFNH 5FUZH 3HE7C 1M7IA 2VL4A 5IB3A 2Y5TA 3WEXB 2WW8A 4ODXB 4QGTA 1L9MA 3QUYC 4QRRA 2R0LH 1CL7H 5C07E 4J4PD 5I1KH 4XX1G 2VLRE 3ECBA 4RGND 4EVNB 1HHKB 3V9FA 1D6VL 2NY3B 4K3HA 1LP9F 1K2DB 1DL7H 2J6EH 3FRPG 4WFFE 3OV6A 3EOAB 2A6IA 4PR5B 2ZOLA 4ZO6A 3EYOA 3TZVB 1WGOA 3RNKB 3G5ZB 5I71B 4WEMB 3ZHKA 4NFDA 4LARL 5ANMB 1K4DA 1S7QB 2P48B 4K9EL 2DLGA 3WFBH 3QG7H 4ZTPL 4N9OB 1AGCA 1JV5A 1BJ1J 4ZXBB 4O2CB 2FRGP 3ZSSA 1TVHA 3T1WA 1KCRH 2KQMA 1DQDH 3FB8B 2AJYH 5CEXB 1CXIA 2BVPB 2VDPL 4WJ5B 1DVFD 3SGEH 1MFAH 1KELL 1T21A 4JM4H 1EEYA 1NMBH 4HKXA 1V5JA 1YYLL 5JHDD 2X4PA 1MHEA 1KN2H 5DK3A 3MOAL 5BZWB 3EO9L 5T1MB 2GUOA 4QHKI 3I02A 2GTWA 1H0DB 4QO1A 1MJJA 5LWYL 4JFDE 1MQ8A 3CFCH 1SJHA 3PGFL 4LHQB 3V6ZA 5CIPB 2NY6B 4MDJB 2C1PB 3T0ED 4Q9CA 5A2JH 3H3KA 2VH5H 2CK0H 2JF1A 4LBEA 2NTSP 3C60C 5CEZL 1D9KB 2NY4C 4KRNA 1UJ3C 3A0OA 5EIQA 5IHZB 2RAMA 2W9EH 4UINH 3JTTA 4AT6A 2R29L 4XHJC 5F1NB 3RGHA 2YUXA 4JR9L 2I9TB 5EPMA 5D1XA 5MEOA 1KCSL 1RK0B 1VFAA 2AV1A 5CD3B 3ZDZF 1LD9B 4NC0B 2C9AA 5CD5C 1JPGA 5F6IC 4HXBL 5GSVB 1RUKH 4QXGH 3IXAA 5MERB 4YQXH 1LQSR 3MA7B 3MJ9L 3V0VA 1HH6B 4KQ4H 3OKYA 4GKSA 1IAMA 3P73A 2EKJA 4WO4D 1X5JA 5CP3H 3BQUA 4L5FH 4CBPA 2WUCH 4O51B 1IQDB 4KQ3L 4QTIH 4TUOA 5HYQB 1NUFA 5FUOH 4BYHA 3RWFA 4H20L 2AQ3A 1B6UA 2P42B 3PQYA 4NZJA 4HWEL 3MRQB 4JFHE 1PY9A 3RU8H 5TDOA 4L3AA 1QLEH 4G6AC 1FL5B 1AY1L 5KVFH 4ELMA 3REVB 5IEHA 1SM3L 2XXCB 3GSNB 1T1YA 2GT9A 4EIGB 4FNLH 1T0PB 3B5HA 1EFXD 2HJLB 3GKWL 4FQLH 3KWWA 5KOVC 2AJSL 3GIVB 3ROOB 5LXGH 4OZFA 4CADB 1YEKH 2XN9A 5C6WH 2FGWH 4YDIL 1MLBA 3HMXA 4MNQD 5F3BB 3ULVH 3PHOB 2VXUH 2XNAB 2VC2H 3VU2A 4XCCH 4RQQB 1K8IB 4GJTB 2YA1A 4QHLA 3W5NA 3NN8A 2YBRB 1ZA3A 5T3ZH 1NFIA 1R3LA 2A83A 4U1IA 2CPCA 3O4OB 5I1IH 4PJXB 5DUBA 4TNVK 2CIKB 1AGEA 3VXQB 4MJIE 1RZJC 4UB0L 3CSBA 3F7QA 1HHHA 4NNYB 3TWCL 1RZIA 1ZLVK 1ZGLP 3RTQB 3REWA 5HPOA 3MV7A 4IS6A 4OCWL 5I8CB 2DLFH 2DOCA 4JO1L 3VXRD 4JQIH 1KCLA 1JTPA 1YMME 3U30B 5CILL 5GS3A 4N0FA 4JM2D 4G3YL 1I9RL 4MB5A 5JPMB 1MQKH 3NTCH 1MPAL 5DJ6B 1C08A 4XBGA 4IM8A 2JCCA 2YPKA 1JHKH 2IEPA 2K1MA 4YWGH 1NGWA 1TQCC 4HQQL 2ERJB 3QPQD 5DEZA 4IDJL 4HX1A 3TCXA 3QWOB 2Q7YA 1OSZA 1FSKB 1SBBA 5E2TL 5F7EL 5D7LE 1FRGL 5F3HA 1DUZA 1UKSA 4XNXH 5T33H 1XIWA 2YK1L 4TRPH 5BOPA 3IFOB 3ET9F 3L5JA 1ND0A 5J6GB 3TBWA 4QOKE 3ZKMD 4DUWA 3QHZL 5IVXB 4MCYB 2J8HA 4CW1B 1T5WB 2DMCA 3V2AR 2R2HB 3SY0A 1P69B 3QIBB 4HKBB 3GHBL 3R4DA 2CLVB 3WNPA 1VEOA 3QUXC 2WM0A 3LKPA 3ARBC 3NA9H 4KJYA 3HB3D 4OBRA 5BS0E 1E27A 3VCLA 4KI5C 1JPTL 4Z7OF 3SN6N 3B9KA 4OLVH 3RY6C 3BPNB 3DTXB 1XGQA 1A7NH 1J1OL 2GJ6B 4WWKD 3QEHB 1UXWB 1X5YA 2FATL 5JA8B 4CN6A 5L2KE 5MEQB 1CFNA 5D7JD 5A3IC 3BUYA 1YEDA 3P0YL 3NFNB 4OQTA 1F4XL 3V5DB 3X3GL 1N0XL 4YXHH 5L9DH 3ZYZA 4ETQA 4KMTL 3OKLA 3BKJH 2YSSA 4WCYH 1U93B 3L3HB 4FS0A 1CLYH 1KJ2H 3UXFA 3LN4B 2DL2A 5TFSH 4C56D 1RULH 3CC5A 3CJJA 5CJ8A 2PYED 1WEJH 4Z7VA 1C5CH 3QDJB 2D3VA 2P24B 4TQEL 3RUGA 4Z5RA 1A6PA 3GBLA 3F12A 2VSCA 1J8HD 5LCVH 3LIZH 3VFUA 2YS4A 4AG4H 5I9QB 4JZNA 3KLAA 2EXYD 3HZMA 2MQ0A 3ULVF 4XP4H 1IC4L 4RFEB 1ZHKB 3JWOC 1KCUH 4EDWL 3FMGH 1CG9A 5BXFB 3K3QA 4P23D 4P5TD 2BY2A 4JAMB 4E5XB 1NUNB 1EXUB 2A73A 1HNFA 3EJJX 2ITCB 1ADQL 3C6LB 3STZA 5HGBA 4PGBB 4R0LA 4WHTA 3QR2A 4XH2A 1N6UA 3JV0A 1RHHA 4FQXA 2MKWA 2X1PA 4JHWH 4P46C 3MRDA 4S2SA 2OJZL 2VQTA 4D3CL 4L1HA 4V1DB 3SDXB 1RZ8A 2NNAA 1A1NB 1IGFL 4LCCC 2FJFB 5GZOC 4U1SB 5GGUA 1MFCL 2ADGA 1N5YH 5CZVH 3QDGB 4ENED 1A2YB 3T1FA 5CBAB 5CLTA 4RWYH 2WBJB 1UB6A 3LH2H 5F71A 2EYRA 1A14H 1R5IB 5GHWH 5C7XL 2Q6WB 3MRJB 3I6LD 1QR1A 4FXKA 2GK0B 5SWSB 4LIQH 1T0NA 3JWNC 4ZFOA 1HHIB 4X98A 3WN5C 2CXKA 5TE7L 1E4XI 1C8PA 1B6DA 2BCKB 2DB8A 5FYJU 1U3HA 5GISH 4LCUB 4XC3H 1YPZB 2VXQL 5EZIL 4EOWL 3GMRB 4NGHH 5DJDA 3HR5A 4M7KL 1EHLH 1NFKA 5ECJE 1GC1C 4NQED 1GGUA 5TQ0L 4XVJH 1WZ1H 4X5LA 4DZBA 4QRSB 3SPVB 3WSQH 4WI8A 4JRXE 4WV1C 4P2RB 5AYQA 1CXHA 2NX5D 2D7PA 3AMKA 5HPMB 1UZ6F 1NJ9A 2PO6D 5EA0L 5D8JH 5GJSH 3BPOB 5HYJA 3I3BA 1SJVA 4FTVE 5DD5H 2QTEA 3ZT7A 4JO4L 5D2LB 3QULA 1CIDA 1KB5H 1NFDB 4K23H 5BW7A 2BVOA 2OTUA 4EI5D 1P2CA 1U95B 5KSAB 3GSXB 4DKFL 5IHLB 4L3CA 4MB4A 3O8XC 5I1HH 4LSRH 1BBDL 2O26U 2AK1H 3L7EA 1H3UA 3SQOH 4WHDA 3BGMA 1E6JL 2NYYD 2AKRB 3TBTA 2W1NA 2XYCA 2WQ8A 3VRLF 4DZ8A 2Z31B 1LGVA 5IFJB 1TZIB 4LNRA 3MUGA 5EOCL 25C8L 4PUBL 4R3SA 2DTML 3DNKA 3T65B 4KRPD 5KSVB 1F58L 1HQRA 2EYTB 3BE1L 4YDJB 5C8JB 4PTUB 3S3JA 1I4FA 3BN9C 1ZHNA 2VLKA 1ZK9A 2VJXA 3TNMA 2XICA 3L5XL 1RZKH 4JPVH 5HHOD 3GMPA 4KJWD 5J12C 3UZVB 5L8JB 3FT2A 4ODSL 1RIUL 4OB5L 2VDKH 3TA3B 5C0BA 4ZUSB 4LLAA 4BA8A 5E8EA 4BFGA 5DGQA 1P4IL 2UUDH 1PSKH 4RMQA 3BX7C 1TNMA 3GO1L 3C2SA 1RQ5A 2OP4H 5T3XH 4NZDA 1JF1B 4EXKA 3KPRD 4D9LL 3CVIL 1EO7A 2NR6C 2V9RA 4P2QD 3FONA 1IM9A 3GIZL 3QDAA 2P5EE 3O6FC 2EEAA 2OZ4H 2YUZA 4QRUA 3HMWL 4ZSOA 3OJVC 3U4EA 1AO7D 4ZAKC 3KPPA 2E6QA 1B0GA 4NQUA 2DLHA 2OR9H 4D9RE 5CGYC 2YPLB 5JDJA 3B5GA 1QNZL 4FMFA 1U8JB 4BH7A 4U1GC 1JZ8A 3KJ6L 3X17A 2NXYD 4U6VH 4PLOB 1UH2A 5CEYA 3RX7A 3CUPA 4TOYH 2YMXL 3OAUL 4L1DA 3CH1A 5C6PB 4U05A 2FJHA 2BSTA 5D1ZB 5IHBA 1A9EA 4YH6A 5IW1A 2IQ9H 5EULV 4M1DH 2J8UF 3FQTA 5B8CB 4PV9A 1YJDL 1T80A 2WIIA 2YD5A 2CKBL 1CVRA 4PRIA 4PB9H 5GRVK 1LK3H 1JPSH 3FRPA 2D0FA 1SMOA 1V8HA 3BYYA 2BNRA 3Q5YA 1INEL 4P49A 3MUY1 4FQ2L 1MLCA 4LCWB 5D7KD 4NC1C 1T22B 3TV3H 5E24E 3KYNA 1MELA 4X7TB 1GGCL 4L9LA 1GGIH 1U3ZA 3DMMD 3MRNB 4DKDC 1CICC 1MHPL 3N9GH 4JG0H 4Y5VB 1QFHA 3KLDA 1UCBH 1RFDL 1T1WA 4HLZH 4HJJH 4OGYH 2HVJA 1AC6A 3WXVH 2JJSC 1YN7A 4F7PA 4Z8FH 1A6WH 5JIIA 1BD2E 2V9TA 3IDXH 4F3FB 1FYHB 1A02N 1F3RB 3W82A 5TDPA 4NQSB 2AI0L 1CXLA 2QQNL 2JELH 1Q1JH 2ZUUA 2RCSH 1MCWW 2CKNA 5DRXA 5IJVB 4PJEB 1BWMA 4GRWB 3VWJD 1OPGL 3AU1A 3JV5A 2EE2A 3ALXA 1BM3H 2DKSA 4JPKL 1M71A 4O2FB 1DJSA 1GZPA 2AEPL 5INCA 3ILPA 3EDEA 3K1DA 3GSVB 4XPGL 1Z9SA 5HGDB 3OF6D 2F54B 5D6CB 4F58H 4ZUTA 2GSIB 3MGOA 5IVNA 5FYLH 2KQNA 5C0IA 4EN3C 1CL7I 3ZE0F 3SE9H 2EIZA 3GMLA 5I8KL 4ACPA 3ZTNH 5GGTL 1QOKA 3RVUC 4ODWB 2ADIA 3S35L 3LKNA 4HT1H 1MREH 3C8KB 3LEYL 4PLKC 1T2QH 2R8SH 1HNGA 2VTFA 1H15B 2ZUVA 3EO1B 5DFVC 1WFOA 2HLFC 4LHUB 3HC3H 3V4UH 3HC0B 4XTRD 2W65B 5C0JA 3WYRA 2R2EB 2VLME 2MHAB 5AEAA 3RQ3A 1QFUH 3UYRH 4A6YL 3M1BB 1R24A 1R5WA 4X4YA 5I15L 1KBGH 3UO1L 4Y2OA 1EO8H 4D0BA 2YXFA 3RL2A 2YD3A 4LL9A 5H37H 4GKNB 1G9MH 2W0FB 4LLMB 2EDRA 3WFHB 1K4CA 4LRNL 1R6VA 5HD8C 3WHXB 4R96A 4J8RA 3GJFB 4X9FA 2QR0B 2VOTA 1HOCA 4UQ3A 2DQGH 1BREA 1MCBA 2D7NA 4G8FA 4EBQL 3DUUA 2DN7A 2FDBP 4MVBC 4FQIH 4K7PX 2J5LB 2YKLL 4GAYB 1LE5A 5AG9A 2PNDA 1EHAA 4CMMB 1P7QA 1X4ZA 4ETYA 3GJFK 3PP3K 3TLRA 2W0KA 2X09A 3IAQA 2C26A 3ARGB 4UUJA 1N0LA 3O11A 1WAAE 5BV7C 2CR3A 3DSFH 4QKXB 4UOW1 2OL3B 5ICYA 1NH6A 3OTTA 4PJCF 5GGSY 1F00I 3BH9A 3MXWL 2A6KB 2GCYA 1FVEB 3BHBA 3F7VB 3GI8L 2EDQA 3MO1B 2W60A 4LMQE 3DLQR 3Q6FA 2P7TB 4PJXE 2E8YA 3RWDB 4Z7UB 3JXAA 2P8MA 1WBYB 1J5OH 5SV4A 2I9LA 4D9QE 1YY9D 4HC1L 2PYFB 3G08A 4PTTB 2PW2A 4XNYH 2QHRL 4YC2B 2AABL 4ZFGL 4NQDA 3RWJB 4S11A 3W0WB 5E2VL 3VXMA 2BNUB 4LHJB 2KZ1B 4JKLA 3GMNA 3MFFA 3SDAD 4BSWA 2VITB 4HWUA 4LFHG 1OTSD 4WUUD 5ALCL 5F7MC 1T6VN 5GGVH 4JFOA 3FO2B 5DRWA 3UPRB 4JPIA 4PJDB 3SE4A 3LHPH 1IBGH 1P6FA 1AXTH 4UU9B 3UC0H 2EXWD 4AY0A 3WDJA 1P5VA 2Z4QB 1LDPL 5HHNB 1G7PA 4ESKA 3HZVB 4HH8A 4KC3B 3O6LH 5IVXE 3MRKA 1NBZB 2G75A 5EIIB 1U8HA 4PB0L 4XP5H 2CH8A 1WFTA 1UGNA 3U1SH 2IC2A 2NW2B 1HWGB 3U2SA 5IUSA 1HIMH 2DLEA 1BZ9A 3QCUL 5IHUL 5L2JB 5EC1B 4WUKL 5DZLA 4P5KB 1IGTB 1LE9A 1IT9L 2FO4A 2HJKA 1MWAA 1T83C 5CSBA 3SEPA 2GJ6E 4UT7L 4POUB 3LZFL 1K6QH 3QWQB 1EFQA 5DWUH 3AM8A 1YUHB 3MA9L 5HHXH 3VXUE 1FJ1A 1I8KB 2VLLA 4U6XB 5FM5M 8CGTA 3AVEA 1WIUA 3GSRB 2EEDA 3DVNA 3HE7A 4HD9A 5EFIB 4X0KA 3SDCB 5F7UA 4RX4A 1M6OA 5E5MA 2VKWA 4X6CF 4X99A 5E08L 1YEHL 4UI2A 3CLFL 4WIQA 5KSUA 1FNEA 3QUYA 3DVFA 5SX4H 1FIGL 4BFBD 1WWBX 5KZCD 4XPBL 1Z9OA 3GI9H 4QRQA 5CBEB 3GB7B 3W11D 4IRJB 5DYOA 1NBYB 2X4QB 5F9WB 3QH3B 2F58L 2A0LC 3PWUA 1OQOA 1IEBB 4YHPA 1WQVT 3D69A 3C5ZC 3WNLA 4BQ6A 3D9AH 2H41A 2GSGB 3R0NA 3FFDA 3QPXL 4HCRA 1LEKA 2O5YH 4HUWA 4LAQH 1J0KA 2Q3ZA 3CK0L 1VGEH 1PG7W 5DZNA 2JTDA 1IARB 5I73C 2P8LB 1DSFH 4K3DL 3E6FA 4BZ1L 3UTSE 2XTJB 3DX9B 1J88A 4AENB 5C0GA 1PQZA 1WWAX 5MEPB 5KSBB 5C0FB 3IU4H 4OAWB 3VG0L 5K9QG 3QSKB 3BQUD 2B0SH 2IANB 3S37H 4MAYB 4OD1L 3MROA 5SWZB 5JDSA 2D7TL 4Q6YA 2XOTA 1XCQA 1DZBA 4O58L 3NIDE 3O2DA 1MCIA 1OLLA 3SDXE 2WUBL 2J1KA 1I3RA 3MV11 3QJFA 1L7IL 2V2WB 5LJYH 4KROD 4Y4KD 2GY5A 4J3XA 5AZ2H 4MZ2A 4NJAL 1NGXA 3RWEA 3L3OA 3QDGE 4F7MA 1GIGL 3H7BA 4WGWB 3V6BR 2XZAL 3HS0A 4M48L 5CJXC 3PE9A 2QQKL 4WVRA 5HI5C 1WWCA 4JDTL 4D94A 3MV9A 1MCLA 3C60A 2GJJA 3UTTB 4MJ6B 2XN9D 4HIEA 5HHPA 3TT1H 1UJ3A 4AMKH 3VXNA 4E0RB 2HFTA 3HFML 1F8TH 1DDHB 1F02I 1YEEL 2MOVA 4KDWA 3TN0C 1I9JL 1AP2B 2X42A 3TC9A 1FORH 2AJUL 4GS7C 1BQUA 1YPZE 2LQRA 2O61B 1F3JA 3JVGC 5ESAB 3LS5H 4QHMA 3ZKXB 1E6OL 5F44A 3ULUL 5J9PA 3O6KL 4BZ2L 1HI6A 3JZ7A 1FE8L 3ZZ1A 2MNUA 3DX7B 3W9EA 1LO3L 1XR8B 3F8UB 5CMAA 2FB4L 4DTGH 4JN1H 3WHE1 3VDBA 5IW3A 1BIIA 1DBBL 4DK3A 1QUNA 4ODTH 4LSUL 2P5WB 1CFQA 3LKQA 3VMPA 5DRNB 3SCMB 4RZCA 3PWVA 5F1IB 3OGCA 4G6ML 2SEBB 1NFDE 1I1AD 4JDZB 1C1EH 4Q6IB 1I1FA 1MCPH 5J6HA 2A74A 4RFNC 3VFOB 4Y16B 5EWIH 4G6JH 4UV4H 1ORSB 5C0AB 3OKKB 5KS9B 4UTBH 2G60L 4R9HA 3DXAE 3OG6B 3PXJA 4R4ND 1XIWD 5FKAA 1H8SA 5KOMC 1RVFL 1JPST 1T7YA 4LF3B 4ZD3H 1EEQA 4XZUB 1BZ7A 4JG1H 5J1TC 4YXLL 1KV3A 2EDYA 3TBSA 3EKCA 2AJVL 1ZHLB 1H3GA 2NXZC 4R7NA 3GUTB 3BKML 1V7ML 1XF3A 4G9FB 5CP7B 2X4SA 3RVWD 4TN9A 2VB5A 5IFAL 5I1LB 4X7DC 5AAMA 1N6QL 2V5MA 2WAHA 3GMOA 2IALA 3B9KD 5EUKB 1U3JA 4ZFFB 2X1OA 5H94A 4M1CD 4FFYH 4MA7L 1UFUA 1KIRA 4NYLA 3KPOA 3FQXA 4X4MA 3LQAC 3T0BA 4DVRL 1U6AL 2X4TB 3T77B 2BSRB 1DVFB 2HJFB 4NQCE 3OMZA 4NO0B 4AIZB 1QLRA 1FH5H 4OCYL 2PR4L 4JHZA 1OTTC 3RZWA 5JHDB 2D7QA 4M5ZL 4YHIB 5I76B 5FHBH 2Q8AH 2OX5A 4H8WH 3QG6A 4J3WA 1YA5A 2DQEH 2YPLE 2VYRE 3WFEL 4XVSH 2WSKA 3T0EB 2GJZB 4RDQG 2XZQL 4XRCA 4GRLD 1XF2A 1YECH 3QUXA 4GAJH 3X12B 3P0VH 4IOFC 3ARBA 4K7FB 1TCRB 3KR3L 3FTGA 3CFJA 1JYXA 4YXKL 2NY0C 4M93B 1A7PH 1JZ6A 1BGXL 4PY7B 3RY6A 4HK0B 1G7HA 1M05B 2K3TA 1S8DA 3JWDH 5LGJB 2ED7A 4DVBA 3D85A 1MCRA 1U8MA 5FDYA 1L4IA 4FQXD 2VL5B 4PJ9B 3IDMA 1F4AA 4FHBD 3NCCB 4WO4B 3GJEB 1S7WA 2PKDA 3MXVL 2W9DL 4R2GD 4ZTOL 4L8BA 4LLWA 4LCWE 5E8DH 2FWOB 4IMKC 3EW3B 2G5RA 3EYQD 3VFNA 2IBZX 4PJFF 5FYKD 4XWGH 1U91A 4KK8D 4QWWC 5CFHA 5FF6A 1MRFH 5K9KB 4LKXA 4BK4A 5EBWA 2FJGA 3D25A 4NBZB 2VXTH 1OARH 2AXGA 3I6KB 5IT2H 5I0ZA 3LKRB 1S7SA 5E8PB 2VN7A 1UM6L 5GS0L 4M62H 2ZSWA 4N0CD 3LEVH 4MHHG 2R9HD 5E6IB 4PJEE 1HH9B 5IMKA 5DRZB 4GRWE 2WQRA 4MNQB 5DS8B 3KVQA 4HKJB 1GAFH 1U3HD 4OUUA 4K8RC 3QYCA 4M3JA 5HGAA 4JFFA 5I8OL 4PLJD 5D9SB 4U3HA 5F89A 1SYSA 1ODAA 5J3HD 4JANA 1MVUB 2APWA 2F54E 4OM0H 1G9NL 4DEPC 1NGPL 1H3WM 3KPMB 4PGEB 1QSED 2FD6H 3SKUD 2JB6A 3HPLA 1KPUB 2DL9A 3VE0A 2HFFB 1MHCA 3MODL 4JKWA 2X4UB 4YBLC 4KZDL 4LCCA 3UJIL 3D0LA 3NZHL 5DJ8B 3DROA 5GGRB 2X1QA 3VRJB 5HYJD 4P9HH 4JM2B 5DMIL 2BRRL 5IMMB 4LSPH 4WENB 3MBEB 2J2ZA 4GFTB 2V2TB 1Q0YL 3NACH 3NGBB 4CNIB 3TVMB 2CKBB 3MRIA 3HPJB 4R97C 2XRAH 1BP3B 1NCCH 4O4YH 1XF5B 1FL6A 2CDEB 3QFJE 3DO7A 2Z91B 4RNRA 4PD4K 5E95B 3WN5A 4PJGF 4GSDL 2BSSA 3AAZB 2C3XA 3K4AA 1JCKA 4BUHA 1KPVB 1HKLH 2HKHL 3U0WH 5FDWB 5IKCB 4PJHB 5LAXB 1LNUA 4PV8B 5I17A 3B2VL 1CD1B 2DIJA 2VLKD 2CQVA 4FZEH 5HTSA 4P99A 3MR9B 3PL6B 3MRFB 1KULA 1AJ7H 2QSCL 3WD5L 1NGQL 4WV1A 4OLWL 1EIBA 3RVXD 5C0BD 2VZ1A 1M7DA 3CVHB 3O3DB 3OHXB 1IGYA 5LGHL 1JFQH 4X9IA 4CVWA 3QUMA 5CIPH 1T04A 4Z7UE 4JFPA 4WWKB 4X6EB 1QACA 2BXZA 5DUPL 1ERNA 5JOPD 3BN3B 5T5FH 2FBOJ 3BD4A 1B3JA 3UTQA 3O8XA 5D7JB 4N8VG 1CD8A 5EB9A 3HMXL 5I1DB 2VDOH 1IM9D 5DJZA 5JR1L 1ZSDA 5D7IA 4G6FD 3WE6B 4ONOA 3W0WE 3GGWA 1WCBB 2R4SL 4C56B 3QEUB 3RZCC 1IGMH 2BVYA 3FOLA 1BX2A 4DCQB 2CRZA 3L3GA 2PETA 2OR7A 4MA8L 5JOFA 4NZUL 3OPZH 1J8HB 5DJCA 5HY9A 3VFMB 1LVEA 3QWRA 2ZCHH 4XCEA 4OTXH 4PJDE 4Z9KB 3QHFL 3T08A 2Z93B 3IJYA 1DBML 4KKCC 2AW2A 5C09B 4DQOL 3TYGL 3HNVL 4TVSa 4XB8A 4P3CH 1P4LB 4Y2DD 2QL1A 3MGTA 2NLJA 4IBLT 2OCFD 5GS1B 2R2BB 1KEML 4G43B 4MAUL 4HWZA 1RMFH 2AJZA 1G7MA 2Y7QA 4WI5A 5C71A 4NHCL 3VGAB 2BNRD 5DJ2B 5ETUA 3HI1A 2R1WA 2IADA 5C0NC 3KJ4B 3U4BH 1QBAA 3O6FA 5EU3B 4NN7C 1IC5H 1VKXA 1MRDH 1VACA 3WV0A 2A9MH 1DANT 3IU3B 3P9WB 4L4VA 2FIKB 3P9LA 4ZAKA 4PBXA 1KNOA 2IGFH 3NCJH 5IQ9B 2FLRT 1DR9A 4XI5D 4P9HC 4L8DB 3CFBB 1FZKA 2QBWA 4I0KA 5FB8B 3K8KA 4GMSH 4XNUH 2NY3C 3C08H 1J0JA 2DRUA 4M7ZB 1XGUB 5ERWB 3ORJA 5J0BA 1JYWA 5DHVH 1UWGL 1WFNA 5EO0B 1NC2A 5I71C 2XQYG 4FFZH 5T1KA 5DD3L 1BJ8A 4QXTB 4PY8J 5IM7B 3TYFA 4HZLB 5FA4B 2OJEA 5TGBB 5L88L 1EO5A 3TPUB 3FQNA 4QXUH 5HDBF 4ZXBC 4EDXB 1SBSH 4F37K 4OQTL 4PJAB 4ZS6D 6FABL 3HN3A 4NQEB 3UZQA 4TSBL 2GAZA 3FB5B 5E03A 1A7OL 4PRBA 3UCRA 4E42B 3VI4E 4YDKH 2E27H 1T4KA 1JZ7A 1I75A 2NX5B 1T6WA 4W68A 5J56B 2EYSB 4XNZC 3BDXA 1CICA 5KVDL 3WNOA 2H3NA 3IVKB 3X3FH 2YC1B 4XPTL 3WBDA 2Y5EA 2COQA 4LK4A 1H3PH 5HYSG 5CSGA 1I3VA 5ALBH 4WTXA 4DKEH 4DGIH 1QG3A 2AJ3B 3NZ8A 1I7RB 4EI5B 3N85L 2NY6C 2IANE 1Q38A 1P4BL 3GSWB 3E8UL 5I19L 3T2PA 5SWZE 4Y5XC 5CINL 3V7MA 2QSQA 3VA6A 2AS5M 5D72L 2FHFA 1PEWA 1R3HA 3V7AE 1D9KC 1CF8H 1PZ5B 1V3JA 4QF1A 5F96L 5EORL 1WZKA 3TH3T 2R4RH 2VQ1B 3SJVA 5BQ7B 2F53A 4RFOH 2V9QA 4S1QH 5DQ9A 2R39A 1YEFH 4KRPB 4OFDA 1U36A 2QHLA 5E1HB 1HHGB 4EN3A 1P7QD 4WFEE 3DRQB 4BFEA 4UAOB 1ETZB 3OX8B 3HUJE 4NQXB 4NP4H 4NUGH 1WIPA 2D31A 3UTTE 2ED9A 1QLFA 4NM4L 3K46A 5DD0L 4YFLF 1DQQB 1RUAH 2F5BL 1KENL 4PJIA 3VGHA 3C2AL 5FYKL 5KW9L 4FQJL 1EGJH 1U8KA 4KY1H 1OHQA 5JOEA 1CYGA 4L9DA 4OFVA 2HTKC 5FXCH 3IRZA 4JQVC 1BPVA 1I8LC 1DEEA 4HPYH 2LAAA 2RHEA 1OW0C 3MYJA 4Z0XA 1JHLH 4TTDD 4UV7L 2EECA 4M7JH 5INDA 1J05B 1J0ZA 4GXUN 1F6FB 3LD8C 4FOMA 4I3RL 3BMWA 4GG6F 1W0YT 2AJXH 4TNVF 4K3JH 1A3RL 2RB8A 5IB2B 2ITDA 4ZFOL 2EKSA 1FO0L 2ARWA 5I75C 1Z9LA 4LLUB 4NQDD 1FPTL 5TF1H 3K8LA 4P2QB 3VXMD 1WBXB 2H6PA 1QBLL 5DEGB 3VWKD 1LP9B 5CHNB 3ZKQD 2H26A 4LGSB 2P5WE 5EZOH 4C55A 1CT8A 1D6EB 4HV8A 4UILH 1PD6A 2I07B 4BH8B 1QZ1A 3OSKA 1IEAB 5D2NE 3NCBB 2DQCH 5H35B 5HJ3A 4X6DA 1ZHBA 4LEXH 2YPVH 4OIIL 1D5ZA 5B22A 5KVEH 1JYNA 2DI9A 3HR6A 4H1LG 1NCDL 3MZTA 3EO0B 1H9VA 2NXYB 4OGZA 4P48A 2Z8WC 1FGVL 5AYUH 3UJTL 4U1NA 5HI3D 5C0AE 5KS9E 1S78D 1M4KA 2ID5A 1OAQL 3U7YL 1G7JB 3LSOA 4Y19A 4M1GL 3MJ7A 4O9HL 4YAQA 1K5NA 3T4AA 3SKJH 1QBML 2FYYA 1LWRA 1T1ZB 3OAZH 1KIPB 2HVKB 4GBXC 2ERJC 4UIMB 4NJ9H 5F97E 1DN2A 5I1AB 4U2ZA 4KTEH 3BPCA 1UYWH 4G9FE 5IV2B 1BEYH 1Z3GH 3NABH 1MCSA 1U8OA 2IQAB 3RI5F 1FSKC 3PWNA 2WBWB 1A6TA 3I6GB 1HSBB 1FFPB 4RAUA 3TH2T 4P4RB 2Z0BA 7FABL 3DMMB 1I7TA 3KLHD 4JY4A 1F3DH 4HS3A 4I9WD 3U9UB 1NMCC 1QTYT 3Q1SL 1OAUH 5CUSH 1Z5LB 4GRMB 3SKMA 5JLZA 5JW4R 5L6YL 4W6XB 4J6RL 1J86A 5CGMA 1T3FA 1CU4L 4WU5A 3LRHA 4X5WB 3GNMH 5IEKA 3KDMA 5J89A 4KRMB 1OSPL 3QIBC 4K3EL 3HE7D 2F74A 2DD8H 4RX4D 4PRHB 3BSZL 4N0UE 1S7VA 4MSWA 3EYVB 5FA3B 3MRRA 3MX0A 1KF9B 2NY7L 2KH2B 3BZEB 5EZLB 5DVLA 3SDYH 3LY6A 2P49B 3VH8G 4KTDH 4M6NH 3S96B 2CXGA 1BBJA 4JO3H 4XNQB 3OKNB 2I25N 3L5WB 1XGTA 5D1QB 1IAKA 1S7RB 5JO5B 3R1GH 2ADFH 1M1SA 4XHQA 4Q9BA 1FYTA 4Q2ZB 2FR4B 3DUSB 1QYGH 3BH8B 4I1NB 2F8XC 3RA7H 4PGZA 4X6BB 2ZCLH 1KACB 3VXOB 5CKGA 4XGZA 4MA3A 5IWLC 3JTSB 3MBXL 3PXHA 3QXAA 2HKFL 2YEZB 4G5ZL 5IROC 1T83A 2C3VA 2W91A 4OZHE 1WVZA 4NOBA 2HFEB 2VLRA 1C12B 4TVPL 4ONHB 5E00A 5IR1A 5F8RC 3T2OA 4J1UB 1ULVA 5H2BA 1XGPB 5JNYA 3TO2A 3ZO0A 2W59A 3P9MB 4Z7WB 1NAMH 2ZOKA 4F7EB 4I18A 5I9QC 1JNHB 3DVIA 2VIRA 1KJVA 5KG9A 4ALAL 3GBNH 1H5BB 4QHKJ 4X80L 3VFSA 5IGXL 1FCGA 4AM0B 3BAEH 2ZUYA 3MRHA 4TPRH 2MCPL 3MC0A 3GDBA 1TPXC 5CJOL 3C6LC 2DF3A 4M5YL 4NIKB 3C9NA 3MV9D 1IL1A 4XPHH 5IJKA 2ZNXA 3C60D 2IBGA 3C5ZA 5I74B 4WEBH 3UZEA 4QHNA 2AV7A 5J1AA 2CMRL 5C3LD 4G8GA 4XHJD 4R4BB 1JNLL 1F45A 3S34H 3WUWB 5KAQG 2VDML 3QUZA 3RAJL 3HNTH 3BZFB 1RURH 1L6XA 5M7QA 3VI3F 5HDQH 3VD7A 4X9BA 1UQSB 5FK9A 1KEGH 3WFCL 1EBAA 4I0CC 4JFDA 3GRWA 2WBJC 5MP6H 2DJ4A 3B8YA 1SQ2N 1ZE3C 1NUGA 4RMUA 1TJIH 4YBHA 3MREA 1JUFB 1QKZH 2RFXA 1IAIH 1VEMA 1OOAA 3MRMA 4RIRB 4HKZB 1SMAA 2ZPKH 2OLDA 4OLYL 3SDDD 3P30L 4NKOB 1WISA 2H2SC 4G6AD 5DURB 1Q9WA 3T2NL 3PNWB 5I66B 4MXWL 4NM8H 2VABA 2UVEA 4HUMB 5GGVY 3UJJH 1FFOA 1A8JH 5CJXA 4OSUH 1KTDA 4OLUL 2AEQH 5JPNB 4WUUB 2F8OA 4CJ0A 5F1KC 3RIFF 3PWLA 4CUCA 5FECB 1ONQA 2R0ZH 4CU7A 3F6IA 3TN0A 1I1YB 1M7IB 2VZTA 4N5EC 3D39B 3HLAA 1T1XB 1TIUA 5DFTA 1DLHA 5D2LF 2X05A 4PFEA 4KHTH 3BPOC 3OKMA 3JVGA 3QCTH 4DN4H 5FO8B 4UZGA 1HXYA 2VN4A 1N3NA 2IBBA 5GRUH 4OCSL 5E2JA 2XV6B 3ZMRA 2ZOLB 4MD4B 3ZE1F 3S9DB 3NA4A 2EEBA 4JJ5A 3RWHA 2NMSA 3K2UL 3LV3A 4OKVA 3UDWC 4M4RA 3ZTJG 1K4DB 4G7VH 4MXVE 5HHMB 5C2BL 4QTHA 5DMGC 3MNVA 4HMDA 5IB4A 1CFSA 2R23A 4NFCA 2YR3A 4WI9A 1AGCB 2C3HA 3ZDYF 2K7QA 2XIDA 3PABB 1ZGLA 4M7LH 3C5SA 4MJIA 4KVNL 2PCPB 5D6DC 3MACL 2HT2C 3QUKA 4N8VA 5A2FA 3C09B 4UIKH 5DK2B 3QZWB 4OF3A 3G6JA 2APTA 3BD3A 2QV2A 2X4PB 3SGDH 1ORQA 4JN2B 4PP1C 3TA3C 3KPQA 5A40E 1YMMA 1BF2A 2WV3A 4C56E 1AIFA 5I1GL 2GUOB 3I02B 2GTWB 1MJJB 2A9NL 1JRHL 5KZCB 3DURB 5E2WL 1UXSA 1NAKL 1UKTA 5DD6A 1SJHB 5AD0A 4Z78A 1D6VH 2Q7NA 2AXHA 3MLSL 2BNQB 5CWSA 1JK8A 4D8PA 1J8HE 3HE6C 3QUXD 3UYPA 3ARBD 4WW2F 2Y36L 4R26L 5D70L 4AT6B 3X11A 5C09E 4KI5D 4FQHB 4IMLB 3PP3H 4LARH 5EPMB 5D7LA 2ZWLT 5MEOB 5I1CL 4OGAD 4K9EH 1VFAB 2DTSA 4ZTPH 1FAIH 1JPGB 2HFGL 1XF4B 3QFDA 3LVEA 3D85D 3EOBB 2NY5C 2I27N 5JUEH 4X5XA 3V0VB 1QFPA 1JZ3A 1QO3B 4G8EA 5A3ID 3VD4A 1F2QA 4MLIA 4RGMB 2MCG1 3P73B 2UWEF 3T4YA 5J7CC 1MFNA 4NQVA 2X4OB 1CD0A 1KELH 1X5HA 2X4RB 3AS0A 4TUOB 4LVHC 2EDFA 2BHZA 2CSPA 2OL3H 1XZ0A 4GT7A 1YYLH 5BS0A 4R7DB 3FQUB 4NSKA 1U8LB 5D1ZC 2DWDB 1XGRA 4KROB 3EO9H 4Y4KB 5IW6B 2KKQA 4G8IA 5C0DB 5B8CC 5LWYH 5IEHB 1J1XL 5C92A 2EIBA 4PP2B 2HH0L 3PGFH 1T1YB 4JHBA 1R3IL 4X7CC 4WI4A 4XCYA 2QADD 3QXVA 5CEZH 3KWWB 1CI5A 4QNPE 3H9SD 2XN9B 3KG5A 3RNQB 2R29H 3CXDL 3BW9A 1KB9K 1N59B 2FLBT 3DX6B 1FLRL 1P84K 1KCSH 4QHLB 1ZA3B 3AB0B 1NFIB 1R3LB 5ICZA 3KS0J 5DUBB 2V5YA 1DFBL 2Y1VA 3MJ9H 3OXSB 4IIQB 3CFIC 3QQ3A 1MY7A 3RWIA 4PJAE 3REWB 4PJEF 3BDYH 4IS6B 4NQEE 3O3EA 4KQ3H 2MTPA 3INUL 4E41A 1I9IL 2VSDA 4M6ML 4IMKA 2B5IC 2BOBA 4JY6A 5DQDL 1MI5B 2V7HA 2MPAH 2NX5E 1DQML 4H20H 4HWEH 2XPGA 3V8OA 5GS2D 1AY1H 4XBGB 4GAFB 3QEGL 5KTEL 1SM3H 4OLEA 1BQHG 1L0QA 3GMQB 1P9MC 4NRXA 2BVEA 2IPKA 1I1AB 3GKWH 1GZQA 3A6CL 4UT9L 1RK1B 2AJSH 4L4JA 2Q7YB 5C0RL 5ACZA 1PLGL 5AG8A 4YDIH 2ZUSA 5A2IH 5F6HI 3WS3B 5E8OA 1XIWB 2AEIT 3EOTL 4JFYA 3FFCE 5E4IA 3L1OL 3T0XA 2J7LA 2F5AL 1ND0B 5IBUG 3CPLA 3TBWB 3MCG1 1D5MA 2L7UA 2IFFH 5MENE 1CD9B 2Q1EA 3HC4L 1D5IL 3H3BC 2BJML 1JGUL 5L7XL 1SEBA 3ALWA 5H8DA 3S3SA 3DIFA 2VDNH 4RGOL 3LKPB 5TQ2H 1A5FL 4JO1H 2X1WL 4OF7A 4HUUA 1KCVL 2ATPB 2EO1A 5CILH 4G3YH 1I9RH 3X14A 1CFTA 5KN5A 1MPAH 1XGQB 3MCLL 4OQ1A 4RAVB 4F80A 2H1PL 1MF2L 3IDNA 1JL8A 2J5LC 3IETB 3C5JB 3CIQA 3O8XD 4OT1L 4BSJA 1H3XA 3BUYB 1IGCH 1YEDB 4YIQB 5ADOL 4KMLB 4MNHA 2XZZA 3MFGB 4ETQB 1G7LA 3OKLB 1EVUA 1CDIA 2YSSB 3MUJA 5F7EH 3TFKC 4JRXA 1O0VA 1FRGH 3O3BA 3SKNA 3CC5B 4I5BA 1LP9E 2YK1H 3O6MH 4ZOCA 3F58L 2YRZA 1J10A 1MFDH 3GZKA 4QRTB 4LFHD 5F9OL 3HCVB 3RUGB 4Z5RB 1TDQA 3D3VB 3F12B 4FTVA 3BN9D 3RVVC 4D0DB 1IGJA 2JIXB 5K59E 1WIOA 4H1LA 3PV6B 3QWRD 3VFUB 1MH5B 3GHBH 4JZNB 1IQWH 1CGXA 1TLKA 3O4LB 3W39A 4GRLB 3MLRH 1KB5B 3ZSTA 1ZS8B 1TNNA 4YC2C 1OY3B 1Y6NR 1CG9B 4M02A 3QNYA 2C3WA 1JPTH 2A73B 3GSUB 2ESVD 5EN2A 3IF1B 1MHHB 1J1OH 3STZB 5HGBB 3ZL4L 1A6AA 2FATH 1HDMA 1UKQA 4XH2B 1N64L 3BGFC 5FCUL 4PJDF 2NR6D 5DA4A 1AI1L 4YHZL 1RHHB 3P0YH 3SKOB 5C6TH 1F4XH 3MRDB 3O6FD 4OFYA 4S2SB 3X3GH 4APQD 4YK4B 4KMTH 4R2GB 2IH1A 5E5RB 3H7LA 5D7KE 2NW3B 3O45B 5FUZL 1DEDA 4EUPG 1RZ7H 4ZAKD 4J3SA 5ICXB 2ADGB 2OXGA 2H8PA 5GRWA 4NO3A 3RZCA 2ATKA 5CGYD 4TQEH 3T1FB 4JZOB 3AXLB 1RZJL 5JW3H 1LMKA 1UB6B 4HIIB 2DBLH 1PYWA 4YHML 2EYRB 3LQZA 4ZDHA 5BMFL 3P4MB 1D3CA 5FYJE 1XFPA 4FXKB 1MRCL 1UB5A 4YHKL 5DJYA 1KIQA 4WNQA 3ALPA 3ARDC 1IC4H 3QA3A 1NC2D 4PRHE 4PPTA 4X98B 1NKOA 4HBQA 2P5EA 4KJPC 5T1KD 5HVWA 4BJLA 4HF5L 4EDWH 4GQ9L 2BMKB 3L9RA 4XPFL 4KKLC 3QG7L 6CGTA 5F9JA 5K9QI 1TCMA 1T7WA 1ADQH 1BVKA 3ZDXE 2XZCL 2UUDK 2BC4B 4CMHB 1XH3A 5DJDB 3HR5B 1ZLSH 3ARUA 3VFPA 3RFZC 1KCRL 1KJMA 4GW5A 4IHOB 1MCJA 1A1OA 4XMPL 3FCTB 1QSEB 1T20A 5JMRA 5DVMA 1FNHA 1UACL 2OJZH 4ZUUB 1ZT1A 4D3CH 3CMOL 3O0RH 4OZ4B 3G6AA 1CICD 4HBCH 2CO7B 1IGFH 4URTB 1X5AA 1ZTXL 3SDCC 1MFCH 4ODXA 1NDGB 2P46B 4Y4HD 4LDOB 1KTLA 3QULB 4PJCB 5TPWL 3U48A 3E3QE 2BVOB 2OTUB 1P2CB 1LO4L 1HHKA 1WJ3A 3AC0A 5F9WC 5BOZG 5IF0A 5C7XH 1K2DA 3U82B 3VI4F 3EOAA 4GXUM 4ZODA 8FABB 4KKBC 3RNKA 1L0XA 3SJVD 5BRZA 4DZ8B 1S7XB 4LASL 4LNRB 1U2HA 3SBWC 4R3SB 1NGYA 3HG1A 5KSBF 5D96B 4NRYB 1RUKL 4EN3D 1EK3A 1HQRB 1BD2A 4PJ8B 4O2CA 3MJ8B 3OQ3B 3RVUD 1ZHNB 3FB8A 1AGBA 1DN0B 2VLKB 2C1OB 2MJWA 4PLKD 4WFGE 3N1PC 5KVGL 5ENWB 4ZO7A 4L5FL 3GMPB 2HLFD 4MAYC 3FT2B 5IQ7L 1YY8B 5C0BB 3F5WA 5DI8B 2DQIL 5EA0H 1B4RA 3NVQA 2OK0L 4KFZC 5T1MA 4IRSC 1KLGA 4JO4H 3SO3B 4JRWA 4N90E 4MDJA 1JWMB 2C1PA 4DKFH 3VXTA 4Y5XA 1BBDH 5HD8D 3JWOL 1CE1L 5LXGL 3UTPD 1YEKL 3P4NB 3RGVD 4G6FB 1E6JH 2VXUL 1EZVY 4JFZH 4J23A 4QRUB 2I9TA 5EOCH 25C8H 4PUBH 3KPPB 1RK0A 1B0GB 1LD9A 3H6JA 3HZYA 4P2OC 4AL8H 5I1IL 4JKMA 3DVGB 5GSVA 1F58H 4XBPB 3MA7A 5C0CD 1HH6A 4IOSD 1S7TA 3B4NA 1QBBA 4WUUE 2XWBA 4MGXA 4Z7OE 3L5XH 1NDMB 1KXQE 4Y8DC 4WGVB 3CUPB 4O51A 2DLFL 3ARSA 1IQDA 1TXKA 4ODSH 3CH1B 3BD5A 4Y19D 1Q94A 2FJHB 1RIUH 2IPUK 4OB5H 3AMLA 2HTLC 1A9EB 1X5XA 5IW1B 2PTUA 3D39E 1BWWA 3T8XB 3QI9B 5EU6D 5IVZB 4L3EE 4Y2DB 3V95A 2G9HB 4HUVB 3OXRB 4JQVA 1I8LA 1FZOB 3KPNB 1P4IH 3SCMC 5T1LA 5ID0B 1FC2D 1OW0A 2HT3C 2R0KL 15C8L 4X6CB 1JHKL 3REVA 4XP9L 2D7OA 5D2NC 3GSNA 4UT6L 1B88A 2BNRB 4Q6IC 5EUOF 3DETC 4BQ9A 1E28A 1MOEA 3AY4C 1WAAA 3GIZH 4Y16C 4U1JA 4OI8A 3LQMA 3PHOA 4NDMA 3MLXL 3HMWH 3MOBL 4L9LB 1IAII 1T5XB 4RQQA 5HHME 1BLNA 3O41B 2ICEA 3IS0X 2YBRA 4U33A 5T1DL 3N0PB 5DGRA 2WWMC 4F7PB 3ULVE 4U7SA 4PJXA 2B4CC 3HI5H 3LPGA 5HYEA 1GC1L 1WITA 2CIKA 1ZEAL 3V4VL 4N9GA 5TDPB 4HAFA 5T3ZE 3QJHB 3KYKL 4PJ5B 4U0RB 4NNYA 5DRXB 1S5HB 5I8CA 3IDYB 2YMXH 3OAUH 3AS1A 3TESA 3K8MA 1M71B 2BXYA 2CDFB 2LV4A 4I77H 1GZPB 3B9AA 1YJDH 1OGAA 4U1LA 3QUML 5JPMA 2CKBH 4NNXA 4ZUTB 3MGOB 4GBXA 1Y0LA 4RISL 2Q20A 1FYTD 3JSSA 4JRYB 4Q0XL 3MLVL 1GOHA 2BNQE 2ADIB 4U1MB 1INEH 4FQ2H 4KAQH 3QWOA 1W72A 1HWHB 5I2IB 3CFKB 5F7HA 4QT5B 2D2OA 2OBGA 1CLYL 1KJ2L 5C0JB 1MHPH 4XXCC 4NKIH 5HBBA 1RFDH 3IFOA 1YZZA 1OM3L 4I13B 5J6GA 1LILA 2VLRD 1R24B 2XY1A 4GMTL 3DV4A 2FECI 4MHHI 4OGXL 5IVXA 4CW1A 5ITFA 2AI0H 4HDIA 2R2HA 1WV7T 4WFFD 4D0BB 3QIBA 1ZVSA 4HKBA 2DIAA 4AG4L 3I84A 3S97C 3CVHH 4NWTH 5IP4A 1K4CB 5FM8A 1OPGH 2XKNB 4YPJA 4R96B 4JPKH 1NCWL 4M6AA 1T0MA 2AEPH 4HXAL 4OZFG 4XPGH 2NZIA 3CFEA 4G8FB 3SGDI 2GQHA 1E4WL 3DTXA 1LE5B 2GJ6A 2ZUWA 3ARED 3K4ZA 4HHAB 3QEHA 3C5ZD 1P7QB 2NPLX 5I8KH 5MEQA 5GGTH 1UADC 4G8GD 1FVDB 5TH2A 3VXUA 3S35H 3G5XB 2Q76A 4PJ9C 3NFNA 4UUJB 5BVPH 2XN9E 3LEYH 1HILB 3V5DA 1MSPA 4U7MA 3RVTC 5ICYB 3QUZD 4ODVL 5IWLA 4K7PL 1EMTL 5F7KC 3LN4A 1TJGL 3BHBB 1OAZL 1KB9J 1R3KB 5D5MA 3FO1A 1YNLL 2V7NA 5FOBB 3SOBL 2P24A 4A6YH 4JFDD 4GXVL 4RWYL 2XI9A 1L6ZA 4OLZH 5I15H 2I9LB 3VRLE 4KXZH 4LU5L 4ZUVB 1G6RA 1RJYB 5GHWL 3G08B 1U8PB 1LDSA 5C9KA 4MD5B 4YX2L 4HIJA 4LRNH 5E6IC 2K9UA 3VXMB 1MI5E 3EBAA 3VWKB 4I2XB 1X5ZA 3V0AC 3MFFB 4S1SL 1WZLA 4EBQH 2WK2A 3L6FB 3UTSA 2ITCA 3B9EA 1BQHA 3C6LA 1PKQB 5HI5D 4Z6AT 5KAQF 1A4JA 2DDQL 4JFOB 3OB8A 4PGBA 4HWBA 3VRIB 1UJTA 2B1AL 1J1PH 4JPIB 2XFXB 4Z7QF 1QHPA 1A6ZB 3TN0D 2R56H 3WFDL 3VD3A 4NUJA 5K93A 3SDXA 3U46A 3V7AG 3LS4H 4JCLA 1SEQL 3PUCA 1JGEB 4JM2F 3MXWH 4JFHD 4HUNB 3F7RA 4OKDA 2FJFA 3VFRB 4U1SA 3GI8H 1G7PB 1X3DA 4HUKB 3I9GL 2H32B 5CBAA 1A2YA 3IDUA 3KHQA 2WBJA 3MBEC 3MRKB 4RMTA 1I85C 4QLRA 3TVMC 2DAVA 2ZP0T 4HC1H 1P7HL 4IDLA 3EGSB 1R5IA 3STLB 2Q6WA 3MRJA 2QHRH 5JW4Q 3WO4C 3HAEG 4ZFGH 5I1HL 4ORZC 43C9B 1BZ9B 2GK0A 4J12A 3SQOL 1MCWM 5E2VH 2CRYA 2YUWA 1HHIA 1JPFB 5JHLH 1JF6A 3GK8L 4BZYA 1AGFB 5IB1B 1LE9B 2BCKA 2FO4B 2VRAA 4PJHF 2HJKB 1XR9B 1MWAB 3FT3A 4LCUA 4LIQE 4UDUA 5TE4L 3CXHJ 1YPZA 2B20A 4MJID 3GMRA 5C0EB 1FVCA 1CR9L 4ZS7L 2VLLB 5ESVB 1BVZA 3PL6C 4F7TA 4UDTB 5GJTH 3HE7B 3DVNB 5DEFB 2QJDA 4QRSA 4XC1L 3SPVA 3LMJL 4X99B 1NCUA 2VDKL 1YMMD 1E4XH 2CO6B 2BX5A 1QFWL 5HPMA 5F72S 4QRQB 1QHOA 1AXSB 2VZVA 5DYOB 3D3VE 4WU7B 2NXZD 1DBJL 2F19L 1PSKL 3TBYA 4PJFB 3DO3A 4ODHH 2BFVL 1NFDA 1GOFA 3CZJA 3WDIA 2ZJSL 5IESH 4YHPB 1Q9KA 3D69B 4LDLB 4P3DB 4PB0H 2EC9U 2CLRA 3O4LE 2ORBL 4HUWB 5D7JC 3WXWL 2JK5B 3BVNB 4UBDC 5IHUH 5D7LD 3UDWA 3DXAA 1A7RL 4C4KT 5E99L 2VO5A 2DYPA 3PDOB 4WUKH 4R90H 3RPIB 4JHAL 1TETL 2X70A 4AH2A 1TZIA 1IT9H 3NH7H 1CLZL 4YGVB 3HI6H 3T65A 2PTTB 4UT7H 2GTZB 1PQZB 3LZFH 2DMKA 2EYTA 4LLQA 5D6DA 4WDIA 4YDJA 1QQDB 4PTUA 3MA9H 4S0TD 3VMOA 5LBSH 5BV7L 1U8IB 5JDSB 1MEXL 3GBML 4EUPA 3BKCL 1OTTD 1TZGL 1I3RB 1ACYL 3ZE0E 3TA3A 2X89A 2E7MA 3CLFH 2XWTA 1ITCA 1J8KA 4ZUSA 3QO0B 4M1DL 1FIGH 4XWOC 1NGXB 4JZJA 4XPBH 4D0CB 3L3OB 4F7MB 5GS1C 3AS2A 3B6SB 3HS0B 3A67L 2F58H 3NAAL 4PB9L 1DTUA 1LK3L 2UZIH 3MV9B 1JPSL 3C60B 3HE6A 3UYOD 4IOFD 3DHMA 4HIEB 1UJ3B 3VXNB 3QPXH 2UZXB 4X7EC 4B5EA 4NQCA 3KJ4C 1IEHA 5E9DD 3ARWA 2NY0D 3VFGL 4CGTA 3JV6A 5T3XE 4JG0L 3N9GL 2ICWJ 3GM8A 5F6IB 4K3DH 4BZ1H 5IK3A 4NRZB 3FQWB 1F3JB 3FAXA 4OGYL 4PJGB 1A6WL 2VZSA 3P11H 5DHYB 1ZXQA 2YPLA 1ZANL 3OB0K 5J9PB 3H42L 4OD2A 1U8JA 3W9EB 1Q1JL 1QSEE 4E41D 1MCNA 1CLOL 5FM4A 4O58H 4FFVC 4AZ8A 4MNGB 2WUBH 1BIIB 3EYSL 4M7ZC 3OR7A 3P2TA 4IJ3B 1L7IH 1KXVC 5KJRL 5D1ZA 3SDDB 1A47A 3LKQB 1RUML 2ARJA 4RZCB 3PWVB 5B8CA 2NY2B 3DI3B 2EDDA 1GIGH 4X8XA 2XZAH 4F58L 4Z95L 3L3KA 4M48H 4PJCE 4PJAF 1AFVL 2QQKH 5FYLL 2LTQB 3SE9L 3WLWC 3QO1B 4ODUA 3ZTNL 5J6HB 3SE8L 5D5MF 4NKDA 5CJBA 3HFMH 3HTLX 1YEEH 1T2QL 4K8RD 1HINH 1I9JH 5FKAB 1WC7B 2B1HH 3B3IB 3L3IB 4BSVB 2DM4A 1IM3A 4ZYKB 1C5BL 2AJUH 3ILQC 3OWEA 1BZ7B 3UYRL 1NLDL 3TBSB 4F3FA 5HVHB 3O6KH 2EDWA 4R7NB 4BZ2H 4LLYA 5M95B 4NQSA 5GGQH 3PWPA 3RJQB 3WJLA 1XF3B 3IFLL 3QIUC 2X1XR 1LO3H 4U7KA 1MIML 2FB4H 1NSNL 1DBBH 1ZKAA 1AQDB 4PJ7F 4LSUH 4O2FA 4I0PA 4TUKL 5H94B 1UH3A 3NIFE 2I26N 3TNNB 5EOQL 1TQCB 5HGDA 5CAYB 5D6CA 4FQIL 1KIRB 2RGSA 4KRPC 1P9MA 3KPOB 2GSIA 3FN9A 4H26B 4UAOC 2GW5A 2PF6A 4ODWA 1WZMA 4JRXD 2G60H 1LEIB 5I16A 1H15A 3EO1A 3OJ2C 5DXWA 4KJWC 5DC9B 2VUYA 4LHUA 1EEZB 1RVFH 3B2UC 5DT1L 2W65A 5F7FA 5FO9A 2R2EA 4FTVD 4EXPX 3QG6B 2BZDA 3GRWL 1T2XA 3M1BA 2OYPA 4LLVA 3BKMH 1V7MH 3QFJA 5DR5L 1NKRA 3BWAA 2KL6A 2A1WH 3ARBB 2EDKA 4GKNA 5F1SA 3FTGB 2ICES 2W0FA 3CFJB 1WICA 4KK9D 1N6QH 1R3JB 3KHOA 4G9DB 3MRPB 3GJFA 4S10A 2H2PD 2QR0A 1G7HB 5B21A 4WW1B 3WIHA 5K59F