3FB5A

Kcsa potassium channel in the partially open state with 14.5 a opening at t112
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb5A02
3KLAA 4P2QA 3ARYA 5IJVB 3MRCB 3W9DA 4HUMB 5LGJB 3E6HB 4JR9H 2ADGB 1YMMB 3CDYA 3BGMA 3QT2A 3VFGH 2BVTA 5DR5H 5TQ2H 3M17A 1WICA 4LCUA 3BJ91 3EBAA 2NX5E 3EDDA 5FM8A 2CIKB 4ZDHB 1KXVC 1LK2A 3DHJA 4Y5VC 1NFDA 5BW7C 3OB0K 4Z7NF 2OZ4L 2ZPKL 4KROC 5K9JL 1ACYH 4ZUVB 3CAFA 3TO2A 5TE7L 4E0RA 3QEHA 4TNVK 1HQRB 2XWBB 1AI1L 4XNMB 3NOIA 5D7IA 4OM0H 2QV2A 4YGVA 1BJ1J 3QG7L 4IIQA 2UUDK 4U1MA 5EUOB 5F6IB 2NXYD 4XCEA 4LPVA 2R69H 4G8GE 3QFDB 1MY5A 2VLJE 5ISZE 3KPRA 1IAII 4I5BB 3CVHA 3TGXA 4LMQE 4BUGA 2APTA 4KXZI 1S9VB 1CU4L 1YY8A 4PG2A 3TIDB 1IGMH 1WITA 4LVOC 5I1GL 5HGHB 4N9GA 5JZ7D 4PJ5B 3HB3D 1TVBA 1KIQB 2E6JA 1N5AA 1IM9A 3WNKA 2PYEA 1RZKH 5TGBB 4DN4H 3G9VA 5J1TC 4QXGL 4KKAC 3MRDA 5EZJB 3IVKA 1MJJA 3BPCA 1R3KB 2BNQD 4PRBA 4KU1A 2UZIL 3GBLA 1T0MB 4WY7H 2A74A 5HYEA 1FGNH 2HT2C 5I71C 1UADC 4ZUUB 3T08A 1QVOA 3V5DB 1IT9L 3ROOB 3BIAX 2WQ8A 2F54A 3FQUA 4XH2B 3RVWC 1HH6A 4M6NH 4PP2A 4N0YH 3KPSB 1QR1A 1T0NB 2G9HA 3V7AE 4XNYH 1HILA 1ZGLA 3QJFB 3B9AA 4JRXA 5BV7C 3OSKA 5JMOC 2AI0H 3QO0B 4U1KA 5KANG 3BDYH 1IGIL 1KN2H 2EE2A 3QXUA 1OP3K 4GG6B 3DVFA 5J6GA 4EUPG 4IS6B 4MCYA 3KPNB 2GITA 2IBBA 4ZQKB 2VISA 1JWSB 3GSUA 1A4KB 1RZIB 5IEHA 4JAMA 3B4NA 1JHTB 3MGOB 4WEBH 3RDTC 1ITCA 4HIEB 4RQQB 4MS8D 1IQWL 4X7CC 5HHQA 3BVNA 5EZIL 1OWWA 3BP7B 3TBWB 1DQML 3GJFH 4G6FB 4NNXB 1IAIH 1FNAA 3MNZA 1MCOH 5E9DA 1VEPA 4NJ9H 4KXZH 5EO9A 1A7PL 3HZVA 4JM2F 3O3BB 4AIXA 3NCYS 1JRHL 4RA0C 1NBZA 2EO9A 1WWBX 4ODVH 4OGYL 1BP3B 3ULUL 1KULA 4XWGH 3NACL 3QDJB 4P5TB 1TPXB 3GMLB 1TIUA 3PNWB 2RFXA 1MRFH 4ZTPL 3KS0H 5D5MB 3VE0A 1IGJB 5IWLA 3AVEA 1CICB 3DMMD 4QRRD 4JO4H 5J1AA 1HHIA 2Y1VA 4XGZB 3DUHA 5FDWA 2OMNA 4EUPB 1FC1A 4U7SA 1EEYA 5HYJB 2X4SB 3VXRD 2ORBL 3L3IA 1J8HE 5CINH 2OL3L 4Z76A 3DV6A 2VSDA 4BK4A 4R9HA 5L2KE 5J8OA 1RZJC 4RMSA 1NC2A 4JEGB 3CCHB 5KJRH 1BIIA 4GBXA 4PJXA 4YR6A 3KPRD 4FQXC 3O3EB 1X5ZA 4IJ3C 4OB5H 3WE6B 4MXVF 4X6FB 4EEEA 3IDGB 4K23L 1R5VA 5FA3A 2PN5A 4R97C 2APVA 1CFNA 1QBML 3VW3H 1YNKL 4UQ3B 2JJSC 3L3HB 5D2NA 4IMLA 3GSXB 3B9KB 3HI6H 5FF6B 1XGYH 3FFCD 5HGDA 2FJHB 2JELH 2VR4A 3QPQD 1IM9D 5TF1H 1U9KA 4K3JH 4WHTA 2QJDA 2NQCA 5DTFB 3NFPA 4PRIE 3HC4H 2XZCH 3TYGL 4EDXA 5E8EB 3V52L 5EBLA 2AJYL 5F9JB 1KN4H 1EHXA 3JV0A 2XWJA 3UTZB 1V3JA 2EYSA 3BUYB 4J1UB 4XNQB 1MSPA 2G5RA 4OZ4A 2X9WA 2F54D 4HGWB 5D6CB 4GQ9H 1KPUA 1T03H 1D6EA 4LARL 3HLAA 5GGUB 3DURB 4EQ3A 4JRXD 1G9NH 3VXME 4AEFA 3O9WC 4F7MA 1ZGLM 4EN3C 1HINL 3MBEC 1IAIM 1VFMA 1MVUA 1UJ3C 2CLVA 2YPVL 1KPVB 5CP7B 2APXA 3DBXB 1NGXA 1V05A 1L7IH 1BBDL 1U91B 4XPGL 5GIRB 4U1NB 1AR1C 5D2LF 5GRZA 2WWMC 4R2GD 2HLFC 3R0NA 5EU4A 5FM5O 2CSPA 3V6ZB 3TBYA 1Y0LA 4L8CB 4R7NA 3KDMB 3HN3A 2FJFB 2YD6A 2X4PA 3OAZH 2AEPL 5INCB 1JPSL 2XICA 3RNQB 2Q1EA 3CX5K 3D3VB 4IOIB 3F7VA 1HKFA 2OZ4H 2ZPKH 4F7TA 1J9CT 5E9DD 5K9JH 1T6WA 5DJXB 5J13B 5FYLE 2H32B 2YUWA 1MCKA 5TFSH 1D5BA 1W0WA 2JJUA 2XWTB 3U36B 1WAAE 3O11A 4PJIB 5TE7H 2E6QA 4DN3L 3MJ8B 2VZUA 4Y1AD 1AI1H 1V3LA 1IGCL 2YK1L 2DIAA 3IDUA 3NPSB 3TNNA 4MAUL 1RIUL 5EOCJ 4X8JB 3BEWA 1CE6B 5GGVL 4JY4B 3MLTA 4WO4C 2J8OA 1QRNB 2E9IA 4G8FB 4TSAL 3BXNB 3V5KA 4Z7UF 3SDDA 1C12B 1IC1A 1T5WA 2W0LA 1JRHI 2EYRA 1CU4H 3RUGF 5T1KD 5DA4A 4PB9L 5I1GH 3C5SA 1JYXA 4UUJB 1SYVA 2MPAL 2CR6A 2ITCA 1BD2B 5CSGA 2YC1B 3RWIB 4PRDB 3RKDC 4KDVA 3SDCB 1T22B 4QXGH 3ARBD 5T3XE 4ZUSB 1FV1A 4HK0A 4OLUL 2UZIH 1XIWD 4YDLC 2FATL 4MJ4A 4NNPL 4MWFB 1IT9H 4NPYB 1UZ8A 2JE8A 3TO4A 4M43L 3CPLB 1AQDA 1HEZB 5LVEA 2LTQC 3TT1L 5MI0C 1IGIH 1KTDA 3QQ3A 3T09A 1T04A 1YJDL 4QRSA 1U58A 1OL0A 2YUXA 4P2OB 1FL6A 1U8IB 3DV4A 1CGXA 1F00I 5CD3B 4QOKA 3QO1A 3T3PF 1IQWH 3O4LB 3FL7A 4I2XE 3V4UL 5EZIH 1DQMH 1SEBA 1EEZA 1XGQA 2VZ1A 4YPGA 5J4MA 1VDGA 2MWCA 4X6DF 3CDCA 5F71A 1K2DA 1A7PH 1ZAGA 4YPJA 2YA2A 4NO2B 1FYTA 1JRHH 3F58L 2IBZX 3E8UH 5KS9E 1OT2A 2IPKA 2YR3A 4OGYH 2OL3A 1OSPL 2OR7A 5CAYB 2V7HA 1QLFB 1CGWA 3HUJB 4EOWL 2DI7A 3QIWB 4RGOL 4ZTPH 1VADB 3LRSA 5K9QG 3LKPA 3W0WE 1LO2L 4Z8FH 3PWPB 3FB5A 4CAGA 2OXHA 2J8UA 1YEHL 1U3HA 1JWUB 1PQZB 5F6HJ 4KDTC 3QQ9C 4MAYB 4NQXB 3QUXC 4CN4A 2P5WB 1KCRL 4OFPA 3HFML 43CAA 1XGTA 5EN2B 2ORBH 5B38G 5I1JL 1FL5A 1P5VA 2OL3H 1CG9A 5JOPD 4KKNA 4YXHH 1J7VR 4FMFA 4JLRA 3FQTB 3IJSB 3BPLB 4LVNC 3GSQB 4JDZA 1LNUB 2OR9L 3FOMA 4M61A 3FT3B 5IF0A 5EBMA 4YH6A 2ADFL 1KB5B 2OTPA 3RGVC 3RWCA 4YHLL 1KIPA 4NOBA 5KSAB 3ZKSD 5JR1L 3SDDD 2R4RL 2P5ED 4K23H 1YMME 2EC8A 1QBMH 1YNKH 2IH3B 4LK4A 4LDEB 2HLAB 3JBG7 4NC1C 4ONGL 3OXSB 3QCVL 4XCYB 4YHOL 2AEWA 4G9FA 1FIEA 4L8SB 3UO1H 4ENED 1NCBL 4P9HL 1QLEL 5GGSB 5HYQB 5SWZA 1HYSC 1FJ1B 5J56B 1P69B 4WW2F 4JG1L 5I17A 1A6AA 3V52H 1HSAA 1ADQL 2AJYH 3IXTB 1FP5A 1Z0NA 1MWAL 5IVXF 5IBTL 3PHOB 3UROR 4U0QB 1CXIA 5EUOE 2APBA 1LO3L 1Z2KA 3MLUH 5KZCD 4OV5A 1WZ1L 4LARH 2WBWB 2AJZB 3TO4D 1Q94A 3WKML 3FB7B 4MA3B 1XGUA 3T1WA 5GSRA 1J0YA 3MBXL 3LEXB 1PZUB 2VDKL 2A6DB 1HINH 1CVSC 5DD0H 5DD5L 2NW3A 4YHYB 4M5ZL 2YPVH 3GMPA 5MENB 4CRPA 4D9QD 1EFXA 1Z0MA 1J05A 4PJ5E 1BBDH 1A8JH 4MD5B 4XPGH 3BPOC 4LFHG 1INQA 1VCAA 5BVPL 3PGDB 2X5PA 1CF8L 3UMTA 4P3DA 1YN6B 3MR9A 4NM8L 4QOKD 2YSSB 2AEPH 1ND0A 4QHUA 1BF8A 4OZHA 1JPSH 4WRLA 3EYSL 4IRJD 4TQEL 4J6RL 2OQJB 5C0IA 1KUMA 2CUHA 3ORJA 2ATPA 1CICC 3ZO0A 2HTLD 4HGMA 2VZVA 4ELMA 3KPSE 1YEEL 4RAVB 4DN3H 4RMRA 1AGEB 2XNAA 1MUJB 4ZXBD 3VFOA 2LQRA 3AAZA 1IGCH 2YK1H 2E3VA 1QBLL 3LV3B 4ZAKB 4MAUH 1RIUH 1I1AB 5L8LB 1U3HD 5ESVA 5GGVH 4IBLT 4GG6E 3V6OE 2JKXA 1MFDL 2RR3A 3QH3B 2P7TB 2VDLL 4TSAH 3DO3A 4XVUC 2XPGB 5CWSB 4I0KA 4QRPA 3ROLA 4X5WB 3BGAA 2LU7A 2VLMD 4PB9H 1JF1B 2DKMA 3VXUA 3R8QA 1KSRA 1FVEA 4F7PA 2MPAH 3BRGC 1JGUL 4XMLL 2E6PA 2GFBA 2AQ1A 4U1SA 2FIRT 4PJDA 1G7IB 4NCDA 3I6GB 2EDLA 4YHKL 3QDGA 2C1OB 3KWWB 4OLUH 2NY5C 3PUCA 3QDJE 5DQJA 5C6PB 4U4BA 4P2RD 1DQTA 4N1CA 2HT4C 3MXWL 2FATH 4MA8L 1P4LB 4NNPH 2P42B 4S1QL 5D5ME 3X12B 5EPMB 5CSBA 4OFVA 3C5JA 3SKOB 4Q9RL 3UYRL 3BWAB 2IQAA 1IEBA 4CNIB 1ZHNA 5E0QA 1ZT7B 3ARFB 4AM0B 4PJHA 4ZPTA 3GGWA 3VFPB 3K8KA 1EBAA 2GSGB 5HYJE 5ITFB 3TT1H 2YEZA 5IP4A 4PGDA 2OJZL 1A22B 1YJDH 3NIDF 2FB4L 2BMKB 4PJBA 4JFHD 4HMDA 3OXRA 1NMAL 3MRNB 3OQ3B 1EAPB 3K0WA 4ZO8A 3DX7B 2JCCF 3BE1L 3V4UH 3BOVA 1IGYB 5FIEA 4M7ZC 4LGSB 5ADPL 1OF2B 2BVPB 4RIRB 2NXZB 3L6FA 2M8XA 1U8PA 1RUQL 2CDEB 3AMLA 3BH9B 1EHAA 2R23A 3TJHC 1EFXD 3F58H 3E6FA 3RWDB 4OLYL 1OSPH 2Q7NA 3NFSH 5FFLA 1TCMA 4ZNEE 1CK0L 4WNQA 4UMGA 2CLZB 4EOWH 4RGOH 3MODL 1OW0C 4JFQA 4K7PL 5L88L 1LO2H 2RB8A 4G80B 1JE6A 2CLRA 5JIHA 3ZDXE 1YEHH 1S7WB 4K7PX 5GGTL 1XGPB 2G75A 2IALA 4GFTB 3B6SA 3VXSA 4HPOL 3VGGA 2MHAB 3K46A 1KCRH 3HFMH 1DFBL 4PJAF 3ES6B 4LIQL 5D9SA 1BFOB 2W92A 1DUZA 4HWNA 1JF6A 5E8OB 3QISA 2Z4QB 4Z77A 3CU1A 3IKCB 4NKQB 4P49A 4W6XB 3TN0B 1CLZL 1FORH 2OR9H 4F8QA 1E4XL 5IFAL 4MLSA 5F1IB 3CFBA 2ADFH 5AAWA 4AIOA 3S4SG 1Y18B 3NCEB 4YHLH 1ADQA 4RMTA 5JR1H 2R4RH 4QHKI 2DI8A 1BBJA 3C87A 2R1WB 4U6XB 4ONGH 3SKMA 1XMWA 3JZ7A 4TUJA 5EIIA 3QCVH 5J6HB 1Q1JL 4YHOH 4NQSA 5ECJE 2P46B 3D3VE 2YD3A 1NCBH 4P9HH 1QLEH 3KJ6L 4DTGL 5EFIA 5HGBB 5MEQB 3QDGD 3OR6B 4JKMA 2Q76A 3WUWA 4PJIE 4JG1H 1YPZB 1ADQH 1MWAH 4GAGL 1MEXL 5IBTH 1T5XB 4JZNB 1VERA 2VL5B 5L2JB 1LO3H 1WZ1H 4NSKB 3WKMH 4N1EA 2PW2A 1QRNE 4P2OC 4X4ME 5C0AA 3MBXH 1IM3B 1A6TB 4UV7L 2H45A 1JTTA 1M7DB 2VDKH 3S4SB 2DL9A 5DD5H 3MUHL 4M5ZH 4GUPB 5C08B 3EJYC 1A47A 5T3ZL 3ZDZE 1PGRB 1RZ7L 2NXYB 4YK4B 4YEEA 2IWGA 5LAXA 4YZFE 1BD2E 3JWOC 2ITDB 4PLKD 5BVPH 1JCKA 1CF8H 2APFA 1ORQB 1S7SB 3QR2A 2HH0L 2NY4C 5E5UB 5B3JE 4NM8H 2CO7B 4WUUA 4KUCF 3FT4B 1X7QA 4QF1B 1VACA 5CEXB 3EYSH 3SGEI 3QXVA 4MQXD 4TQEH 4J6RH 5MERA 3QIWC 3CH1B 4XNZC 3EYFA 3RHWF 5JQHC 1IARB 4FXGA 4AQOA 3SO5A 5DJCB 3QCUL 4YO0A 5L7XL 2OK0L 2AJVL 3FT2B 4M7LL 1IVLA 32C2A 4MAYC 4JFPB 5C0RH 1YEEH 1N2RA 4G6AC 3EUUA 2BCKB 2MKLC 2DQDL 3Q1SL 5H2BA 5I8OH 4PJGB 1QBLH 1SJXA 4JN2A 3DUSB 4RISL 3GMNB 3H3BC 1LO5B 3VXTB 1MFDH 2FO1A 3VXSD 2VDLH 2FYYA 1DE4B 5D96C 2R0KL 3CFEA 2VZSA 3Q3GA 4U05A 3RWGB 4L4VA 3O4LE 3FMGL 3RWEB 2GCYA 3KPQB 1MFEL 1JGUH 4FHBD 3BW9A 4XMLH 4YX2L 3PWUA 3RZCD 2FEDC 4JJ5A 5TPWL 4LPCA 1R3IL 4YHKH 4L1DA 4LLUA 3VU2A 5JMRA 1T1XB 2EKSA 1B2WL 4L8SC 2IBGA 4ONOA 3S36L 1OB1B 2ATKB 3HUJE 5GS3A 3MXWH 5B39A 4S1QH 3PWPE 5DRWA 5GPRA 3G6AB 3K4DA 3MNVA 1ORSB 3UXFA 4Q9RH 3UYRH 4MMZC 1N4XL 5AG8A 3KLAB 1P7KA 3SGEH 2DAVA 3FB8A 3LQAL 4N0FA 4RFNB 2P5WE 2VOTA 4U2YA 1AC6A 3ARXA 1QBAA 3UAJD 3BGMB 5L0QC 1OPGL 2NY3D 1EIBA 3M17B 3VFNB 2YBRA 3DMMB 4QRRB 5ESQA 5CEZL 4ZOAA 3S37L 35C8H 1LK2B 3TWCL 4QHMA 1YUHA 2I60L 3DWTA 1YMHA 4UBDD 5CGTA 5GRJL 1NFDB 3S37X 4YHYC 4Q58C 2JJTC 3IDMA 1NMAH 3L5XL 1WSST 3VXRB 3TO2B 5GGTA 3BE1H 4KK6D 3QEHB 1J86A 5ADPH 3HI1A 1Q8MA 1KCLA 1E6OL 1HK6A 1RUQH 4U3HA 5J12B 4IIQB 2N7AA 4Q2ZA 1NUFA 4XCEB 1F90H 4J3SA 3CSGA 4OLYH 4F9PA 2V5TA 2F53A 4PGBA 1UCTA 1CK0H 3KPRB 1H5BC 3MODH 4HDIB 1N64L 3HR5A 2P24A 4K7PH 5L88H 3I02A 3L7EA 4XXDA 5GGTH 5HJ3B 3RJQB 2KL6A 2O5YL 2EDDA 3FFCB 4HPOH 2CRZA 2DB8A 2PNDA 1NAML 43C9A 1IM9B 2VABA 4GS7B 1DFBH 4AIZA 4AMKL 2RGSA 1MY7A 4LIQH 1OD7A 3B3IB 3MPCA 4MJ5A 3MRDB 3IVKB 1DEEA 1A5FL 4PRBB 2N4IA 1G7HA 4S1SH 2A74B 5E2WL 2R2EB 3PJSB 4N0CC 4LSQL 2BXYA 3SDAA 5DZLA 1I85C 1CLZH 1QVOB 1UH2A 1E4XH 1KT2A 5MENE 1X5LA 1VFAA 2EH7L 2F54B 1OTTD 1OGTA 1BZ7A 4PP2B 5GGRB 1QR1B 2Q8BL 4CU7A 2G9HB 4NRZB 2HTKD 1ZGLB 4JRXB 2DN7A 3CX2A 3GJFB 2EXYC 4U1KB 1QHPA 2HN7A 4EBQL 3NAAL 4HXBL 3UYPA 5C0FA 4L4VD 2CUMA 3CSPA 1Q1JH 5F1OB 1ZHLA 5J6GB 3MJGX 1FLRL 5KSUA 1X4XA 4R2GB 3KJ6H 4DTGH 2VISB 1I7RA 3GSUB 3L9RA 4JAMB 5DEFA 1F3JA 5IB1A 3GM8A 5JXAL 1U8OA 3TNMA 5HHQB 1WIPA 4GAGH 1HH9B 4JFYA 3V8OA 3MV7A 1JNHA 4N8CL 5FYKE 5E9DB 4Q9QL 2CDFA 4PLJC 4BUHA 1PY4A 5J0BA 1AP2B 4HCRA 2QBWA 1B4JL 3QQ4A 4POZD 1WC7A 2HMIC 4UV7H 4QEGA 2AQ3A 4Y1AB 3N1QC 3U7WL 3VH8G 3HE6C 2ZP0T 3QIBA 4L3ED 5FYJD 2OR8A 1HI6A 4RAUA 5T3ZH 1RZ7H 3GSNL 5J1AB 2VXQL 3WLWC 3UZQA 2NXZC 1E4WL 2P8PA 3FB6A 5FDWB 5JOFB 8CGTA 5FO8B 3IYLW 2F8VA 5EORL 5D7KE 2HH0H 3DPBA 2KZ1B 3FKUS 4GRLA 3GI9L 5T1KB 3IDIB 2NLJB 3B5GA 4CVZB 4Z7OE 3CZFA 4GW5A 5F21B 4J4PA 4Z7WB 5C09A 1G0DA 3I3DA 3QCUH 5L7XH 4E9LA 3TZVD 2OK0H 3OAYK 3FTGB 2AJVH 2EDEA 1ITBB 1M1SA 4M7LH 3ARBB 1BZQK 1K3ZA 2F53D 4YR6B 2F15A 4GOSA 1XIWB 2DQDH 5C8JA 2NY1D 3Q1SH 1I8KA 5FA3B 1M71A 5KSBA 1CFNB 5IBLC 4RISH 1JPFA 1UKTA 5D2NB 3VH8B 2FNBA 5JA9A 2E7CA 4O2CA 1BX2B 5HGDB 3Q6GL 5DD1L 1CXHA 1NEZA 5FO7B 3LN4A 1BHGA 5IK3A 4LDLB 4NGHL 3BD3A 4DEPB 3NFPB 5F7NC 1N3NB 2O26U 3W82A 1D9KA 4HX1A 3RY6A 3FMGH 3T0BA 4OGZA 1MFEH 5EBLB 5ADOL 1KB9J 4C56A 4NN6C 5DVOA 4YX2H 2XWJB 4F9PC 3AC0A 4UQ2B 2EYSB 1ZVYA 5DMIL 1JPGB 5TPWH 4OZ4B 1OY3B 3TYFA 2Z93B 1D6EB 4K94L 1B2WH 3HI5L 3MRMB 1F2QA 4LRIA 1NGWA 3MFFA 4F7MB 4UDUA 1SY6A 4XXCC 3RI5K 3VI3F 1MVUB 2VE6A 1B0GA 2ADIA 5E5MB 3WIHH 1LP9B 3GK8L 2H26B 1N4XH 3SDYL 4GKOA 2O93L 1TDQA 3WDIA 3LQAH 5JOEA 4GMSL 5EU4B 5I6XB 1NGYB 3NCJL 4R7NB 3VRLE 1G1CA 1VFBA 5HI5C 1OPGH 2Q20A 4LSTL 5T1DL 3SDAC 5T3ZD 2X4PB 4HJGA 4NZUL 2NYYD 3EDEA 1KLGB 5CEZH 1VENA 3S37H 3TWCH 5HTSA 2I60H 5GRJH 3FRPA 4KKCC 4Y4KA 3MV7D 2HJFA 4F7TB 1S9KC 1ZLSL 1L7TL 3L5XH 3ZZ1A 4F37K 1UM5L 4YK4C 5J9PA 3KPMA 5I8CA 3O11B 4DOHB 5J1SC 2X4RA 4O2FA 2GAZB 5IHUH 1NAMA 3QIBD 5JXED 3KPLA 3TNNB 3BEWB 5JZ7C 3HB3C 1NPUA 5A2IH 3EHBC 3MLTB 1MAKA 1C7SA 4HHAA 2VR5A 3L3KA 2W91A 1KEGL 3V5KB 1N64H 3SDDB 2P5EB 1CGUA 5B4MC 3OHXB 1T5WB 5JLZA 4GRLD 5M95B 4XP1L 1NGZA 4F9LA 3C5SB 1YPZE 2IJ0C 2DQUL 1CLOL 4R3SA 4J4PD 4WDIA 3K4AA 5C09D 5L8JB 1NAMH 1CDIA 4AMKH 4LKCA 2CD0A 4JQVC 1T1ZA 3QFJA 5E2VL 4HG4K 1ZA3B 1A5FH 5D1QD 1T3FA 2QSVA 1JGEB 2C3XA 5E2WH 3WLBA 2VZ3A 1WTGT 1N26A 4ETQA 3T4AA 4POUB 5C08E 4Y16D 1UZ8B 2MFNA 1PDKA 4DK3A 5KZCB 2Q3ZA 1O7VA 3TO4B 4M00A 4HXAL 4A2LA 1RD6A 4LSUL 3X13B 4GMTL 3H2WA 3NAAH 3OKNA 1D9KD 2BOCA 3QQ3B 3VGDA 1CXFA 1R24A 1T04B 3AREA 1KJ2L 2HVKA 1UJTA 1GRWA 2HRPL 3GDBA 1WFUA 1FLRH 4KPHL 1RULL 1FL6B 1TJIL 4AZ8A 3BKCL 3DV4B 3DI2B 3T2PA 2C3GA 4MJ2A 3LQZA 5JXAH 4QOKB 2IEPA 1LGVA 3GSNA 5CEZD 3QRGH 4IRJB 1EEZB 4PJGE 4YPGB 3KPPA 3MJ9L 4N8CH 5CUSL 4W6WB 4DGIL 1K2DB 5KSVA 3WO3B 3DMMC 3K1KC 4ONFL 3WJLA 2IPKB 1B4JH 4QYOA 2OL3B 1X5XA 4W68A 5ITBL 3W81A 3RVUD 3LD8B 3EIFA 3U7WH 4ZXBB 3ULVC 4GKSB 3LRSB 2HP4A 1RMFL 2HG5B 3FO1A 5K93A 3FB5B 2JK5B 2J8UB 3GSNH 4Z7QF 1H8NA 1U3HB 2VXQH 1NGQL 1S7UA 3OKOB 5J12C 4M62L 4F3FB 5BOPA 3UPRB 5EORH 4R90L 1DANT 4MA1C 4ZS6D 1XGTB 2VN7A 5JHDA 4ACPA 3GI9H 3UZEA 4AYFA 5CLWA 3SBWA 3C09B 2B20A 2MJWA 1IQDB 1FL5B 3AS0A 2IGFL 2BSSA 3AS1A 1CG9B 4QLRA 3T77B 3T2QA 4WWKA 3ARRA 2ZNXA 3NIGE 4EI5A 4JDZB 5IF0B 1TNMA 4X0KA 3A6OA 4LLWA 4U6TA 3QPQC 1FZKA 3RWCB 4PRPA 4P2RB 4Y4HA 1JK8B 3RL2B 5JPMA 4KZEL 1YZZA 4P5KA 2ESVA 2JJVA 4H26A 3O4OB 5ABDE 5E95B 4HMCA 4QRRE 3MJ7A 1IAOB 1HNFA 1CQKA 1XT5A 4NBXB 3C60A 3Q6GH 3U7YH 5DD1H 1NFDE 3QI9A 4YFEA 1ZT4A 2NY2C 1I7UA 4NGHH 1DN0A 3VXRE 1HHHB 5IV2B 5CEYA 4DK6A 4JCMA 3UTOA 5ADOH 1HSAB 2BOBB 3GHBL 4R96A 3ZE2E 1K85A 1I8IA 4QWWD 4XNXL 2P44B 4V2CB 5DMIH 3DO7A 1XF2B 1S9WA 3IDYC 4HWEL 5F7UA 1JV5A 4K94H 2PXYD 1Q94B 1XGUB 4RMQA 2WINA 3KPRE 15C8L 2EDRA 3OJ2C 3BZ4A 2IG2L 5GS0C 1G7MB 1BEYL 1U8KA 1JHLL 4IOFC 1EFXB 1N8ZA 3ARED 1J05B 3GK8H 4OD2A 3SDYH 3FFCE 2IANA 1NUGA 4GMSH 3NCJH 3BO8B 4NP4L 4J8RA 3LHPL 5BO1H 4G6JL 2LABA 4LSTH 5T1DH 4CVXB 3MR9B 4NZUH 1ND0B 5CD5D 3T8XB 3D2UA 1EO7A 4YBQC 2OM5A 3VXOB 2XQBL 1UCBL 1ZLSH 1L7TH 5EU5B 4JZOA 1X4ZA 2ATPB 4F37F 1UM5H 3QIUA 2F54E 1DTUA 1K5NB 1URLA 1EK3A 4GLRI 4CVUA 3C8KB 4NDMB 3FO9B 4JRXE 4YAQA 1B3JA 2XNAB 4MD4A 3RVXC 5EDXA 2OJEA 1T83A 1ZHKA 3UBXG 1RVFL 1UB6B 4PLNC 1K4DB 2BNUA 4JFDE 4HLZH 4RDQF 3W39B 3I6KA 1KEGH 3P11L 4NQTA 4NBYB 4WEMB 5DDHB 3ROLB 3ARBC 5JHDD 4XP1H 3VGBA 1BFVL 2HFFA 1DLFL 3MLYH 4LOUD 3OB0H 2DQUH 4XC1L 1CLOH 1F8TL 1FVEB 3BSZL 1KYOJ 4F7PB 4KK9C 4M9PA 5D93C 3NIFE 2GFBB 3P73A 4HV8B 4EI5D 5E9DE 4PD4J 5C0ND 5K9OA 4DZBB 3N1FC 1LE9B 4JM2C 1XF4A 3QDHA 4MDIA 5E2VH 3QDGB 1CE1L 2EDQA 4YNYB 3CD4A 1KJ2A 1GYAA 4X83A 4KWUA 1PD6A 2UUDH 4Y1AE 4Y4HD 2ZKHL 3D5OF 4XRCB 5EBGA 2ESVD 2QSTA 4GT7A 2MMXA 2MCG1 1CT8A 2MQCA 3VI4E 3UBXB 4HXAH 3WS6C 1KLFA 4LSUH 4ZPTB 1F6AB 3B2UD 3GGWB 4GMTH 4H8WL 3MJ9A 1SVZA 2YEZB 3VCLA 2Z31A 4U6YA 4LHUA 4NQCA 5CZXC 4GLRH 1KJ2H 3EO1B 1OVZA 1ZLVK 3MRKB 3TC9A 4PJBB 2HRPH 4FFWD 4Z7WE 1L4IA 4KPHH 1J5OL 5EU6D 4PREA 1RULH 1NUNB 5J89A 2VUYA 2ZNWA 3BKCH 3DRTA 1X5GA 3QZWA 1X6NA 4DVRL 4KMLB 5LGKA 3V5HA 3X14A 4JFXA 4ZOCA 5I6XC 5DVMA 4AQ1B 3QEUB 3MJ9H 5CUSH 2P48B 4K3GA 3WFBL 2CKBA 4DGIH 1RAMA 1A9BA 1UGNA 5D2NE 4ONFH 3E6FB 3G5ZA 2Q6WA 4YDJB 2Z91A 3CFCL 1WJ3A 4F7EA 5ITBH 1I9RL 3WFEL 4WNQB 4X6DA 5D7JA 4J3UA 1OP3H 3QNZA 4NZRL 1RMFH 2BVEA 4GRMB 4FXLA 5D1XA 2EXWD 2CLRB 4JFFA 2D7MA 1FQ9C 5F7MC 2IALB 2G75B 4YDIL 5IEKB 3MYZA 1F58H 1NGQH 3B6SB 4DFHA 3VXSB 4H5SA 4M62H 2D0GA 5F70A 3DSFL 4R90H 2YD7A 2APWA 5DMJB 2BRRL 4QHNA 3C6LA 2JB6A 1KJ3L 3FCTB 3HPJB 2J5LC 1OAXL 3O45A 4K3EL 4BH8A 1RUAL 5EBWA 9CGTA 5A3ID 5CIPA 3REVB 1NAKH 3G5VB 2GY7B 2IAMA 3LAFA 2IQ9H 1W0VA 2UYLA 3DOSA 4KTYA 4X6CA 4LPYA 1X4YA 3C2AL 5FEBA 3RZCB 1AHWC 3BN9C 3H0TB 1LP9E 4O5LL 5F93C 4KKLD 2X4TA 5DD6A 1MJ7L 5AWNL 3BGFB 1DDHB 1MQKL 3GHEL 1DBML 3MLXL 3EOBA 1MWAB 5FECB 1MHCA 1KG0B 4RCAA 5DFVD 1BWMA 1HSBB 3MROB 3F7YB 5EIIB 3ILPA 3QIUC 2HFEB 3KS0J 3U79A 3E2HB 4U7MA 3A67H 1ZTXL 3MRHA 5EFIB 1CFSB 2VZOA 2NY3B 3Q5OA 1KTKE 3PWNA 4DOHE 5JOPE 3GHBH 4RNRB 1RIHL 4FQ1L 4XNXH 4D0CA 1WAAF 4QTIL 4HWEH 4WW2A 2UY7A 1ZMYA 4OCNC 2C3HA 5DJAA 1I8MB 3F62A 5IVXA 5FM5M 3T1FA 15C8H 1MOEA 3F5WA 3MV8A 2P5EE 5F89A 3FRUA 2IG2H 1DQJB 5J11C 3P9WB 2M1KA 3I75A 2KH2B 1BEYH 2Z31D 3DXAA 2V17L 4LHUD 5IG7A 1GAFL 1JHLH 1S7TA 4GG8B 3VG9C 4IRJC 5LAXB 5C0EA 3MRQA 1NSNL 1XCTA 4NP4H 5DHYA 4P4KD 3QP3A 3LHPH 4G6JH 1R3HA 4PJFB 5E94A 1YYML 1FNEA 1VACB 3WNLA 3GI8L 4LCWD 1GSMA 1P53A 4BQCA 5MERB 5I8EA 2XQBH 3ARDA 3RL1A 1V5JA 1EJOL 3ZKMD 4PY7B 1UCBH 1F4WL 2CH8A 1YEJL 1WZMA 7CGTA 4YO0B 3N1PC 1UT9A 32C2B 4X4XA 2E9WA 5ICZA 4WI5A 1PJ9A 3P4MA 2Z35A 2GTZB 3P4LA 1NQBA 3GMOB 5D7JD 4G43A 5F44A 2LE9A 2XY1A 3C09C 1Q9KA 5D1XD 4Q6IB 1RVFH 5TDPA 4JFFD 2C3WA 2DKUA 4D9QE 3PQYA 4G7VL 4WW1A 4URTB 3VRIB 1UXSB 4WHCA 3EYOA 3P11H 4OCYL 2FYYB 2V5MA 3MYJA 1FSKB 5K9KA 4MQ7A 3C6LD 4WHYH 4XBGB 2QQQA 3KLSA 5IOPA 1BFVH 3Q3GB 1DLFH 4LRNH 1XF5A 1A7NL 4YHML 1O7SA 2XTJD 1MLBA 4L4VB 5D6DA 4XC1H 1F8TH 3BSZH 3BRFA 4I3GA 2IAMD 3VDBA 1HXMB 3PWUB 5JDSA 3O4OC 2NTSP 5DJDA 4QRTA 2FWOA 2PW1B 1BIHA 3RTQC 3QBTB 5GGRY 4LLUB 1CE1H 4B50A 5DMKA 2EKSB 3PV6A 5LBSL 3B9VA 2PO6C 1SMOA 4Z78A 2ZKHH 4Z0XB 1LO0H 5KS9F 3H9HA 2IF7A 2RJMA 5DRWB 2J8UE 3SCMB 3NH7L 3VD5A 4NKMA 2DJUA 3LPWA 3ELAT 1CLCA 2I26N 3FB8B 2K3TA 4U3XA 3H42H 2X1PA 1C5BL 4H8WH 3CSYB 3K8LA 4Y5XB 3QEQD 4U0RC 4L3EB 3ZLQC 2VLME 4WI3A 3LS5L 4H20L 4XZUB 5ESQB 1T89A 2X4UB 5A16A 1J5OH 4QHMB 3IETB 3IU3B 1DSFL 1YMHB 1UG9A 3QXTA 2C1PA 5DFTA 4U33A 4DVRH 1FNSH 3PWLA 5ANMB 4R4NC 4RFEA 4RWHA 4YHZL 4XPAL 3M07A 4B0MM 2GW5A 2FECL 3HI1B 3MV8D 4P2RE 1T2QL 5ALBL 5EC2B 3U7AA 3W5MA 1UWGL 4O51A 4J3WA 2J88L 3WFBH 2R2BA 4XCNA 3DXAD 1EGJH 1Q9LA 5INDA 1ZXQA 4GAYA 1YYLL 2JCCA 1INDL 4HH9B 5FGBA 3TZVB 2EDYA 1TCRB 3T0DA 4KHTL 3CFCH 2F53B 1I9RH 3WFEH 3HZYB 3U4EB 4HEPG 2NY1B 5BVJA 2JTDA 1AY1L 1QACA 3DRQB 2P24B 2QADD 4NZRH 5HI3D 2DQFB 1JNJA 2UWEA 3L7EB 1EZVX 3O2DA 4YDIH 3OKMA 1QSED 3ARDD 5GGQL 3REWA 3DSFH 43C9B 3ARZA 2BRRH 3FQXA 4JFHE 2C7UA 2WAHA 1FIGL 1KJ3H 1YA5A 2ZCHL 4YBLB 1NJ9A 1OAXH 2AAVA 2CRIA 4K3EH 3QWRD 1RUAH 1X9QA 5EUOF 1G7HB 4TNWK 1W72L 2QKIB 4PJAA 4MJID 1CDGA 2OCFD 3NABL 3B5HA 1IKNA 3C2AH 4XX1E 3UCRA 3GSVA 3O41A 1A1MB 4HWBL 4KK8D 4W4NA 3PQYD 4RA3A 5KW9L 5EO0A 1HQ4B 2YN3A 3CMOL 1MJ7H 5AWNH 1NUDA 1BZ7B 1FAKT 1MQKH 3GHEH 1DBMH 3MLXH 1T7WA 4OLWL 3CXHJ 3P3YA 5CGYD 4AENA 5I74C 5DJ8A 3MOQA 5CGMA 2HN7B 4F57L 4V1DA 5C0FB 3L7FB 5IMLB 2VLLB 1CFQB 1QEWB 1ZHLB 4LPUA 1I9IL 3OG4B 1LE5A 1JJUA 5KSUB 3O81A 1ZTXH 4O58L 1I7RB 3G6DL 1YY9C 3L9RB 1T20B 4PGEB 1F3JB 5IMKA 3BZEA 1D3CA 1QYGL 4OI8A 5CJBA 4QCIA 1RIHH 4FQ1H 2X2YA 4P5MA 4JFYB 4BKLA 5DMYA 3MV7B 4QTIH 1MCWM 4GSDL 1QPPA 2FH6A 4MJ6A 4JPVL 2HT3D 4G8EA 4U1HA 5D1ZD 4DQOL 4FQHB 1BFSA 4PRAA 3BZFA 1G7PA 4ORGA 4XHJC 1CCZA 4P99A 2WWKO 4EZMA 1QLRA 3QIBB 1U93A 3T2NL 3VFMA 1IE5A 4P9ML 1NEUA 2V17H 4OF0A 1GAFH 1HI6B 4RAUB 1I7ZA 2YRPA 2PUQT 3CDFA 1A1OB 3UDWC 2P8PB 1NSNH 3OKLA 4YEFA 2QHLA 4XPTL 4GRLB 1YYMH 1LMKA 3QDGE 3VXNA 3EJZD 2ICCA 2OMBA 3GI8H 2FJGA 4WGWB 1UKSA 4GW5B 5I1DB 3JV6A 1EJOH 2P1YA 5C09B 1YEJH 2KQNA 5DC9B 4OZFG 1QFOA 2BFVL 5JPNA 5D1QB 5D5MF 1A3RL 4U31A 4YDVB 5C92A 1I8KB 1M71B 1C16A 1R5WA 4HWZA 5EB9A 4Y16B 4DKDC 4G7VH 4O2CB 4PJBE 1X5FA 2FECI 1KXTB 2PCPA 2PYFA 4OCYH 4KVNL 2ZUVA 1NEZB 1D5ZA 1U95A 1UH4A 3RZCC 3LN4B 1WUNT 1QG3A 2MQ3A 2PTTB 5B22A 1A7NH 2ZG1A 1D9KB 4HX1B 4YHMH 4DWHA 3FRPG 3EOTL 1OD9A 1I4FB 4N5ED 4UNVA 5C2UB 1YDPB 3H9SA 3TYFB 3MRPA 3D48R 1H3VA 3IXAA 1QZ1A 4KJQD 5LBSH 1RPQA 4ELKB 3QHFL 5HYIA 4YDKL 1NGWB 5FAAA 1AQKL 1MAML 3PP4L 4PS4L 3NH7H 1B0GB 4Y4FC 3OJMB 3BIKB 4OTXH 5DEGA 2N7BA 3QDMD 3EYUL 4UBDC 3PDOB 3VXSE 3WXVL 4JFOB 3ZDXF 3SQBA 4LCYA 2GK2A 4O2EA 1C5BH 1XF3B 4F8TA 5K59E 3RKPA 1VFBB 5I0ZA 1IKNC 3LS5H 4H20H 4OGAC 2JIXD 1B0RA 4QGTA 4HC1A 5D71L 5GS1C 1DSFH 4GW1A 4APQA 1N59B 2CGRL 4L1HA 5IR1A 2DIBA 3MSPA 5J9PB 4YHZH 3KPMB 4XPAH 2EE3A 5ALBH 1T2QH 1IC7L 4D8PA 1UWGH 4F15B 4YHNB 4JANA 1WIOA 4KJWC 2FO4B 4MHHG 5SWSA 4OZIB 5CJXA 3AGVA 1LDPL 1YYLH 1INDH 1C1EL 1KACB 2H6PB 1DUYA 3WFHB 5ICYB 4KHTH 3HCVA 1LD9A 3L3KB 1TZGH 1T66C 1CTOA 5KN5B 1AY1H 2WM0A 4HUVA 2DI9A 2A73A 4HWBA 1GGBL 4G9DA 3VFWA 1NGZB 1KCSL 2ENSA 4KRPC 2OTUB 1OOAA 2C5DC 5GGQH 4R3SB 3VRJA 4WDIB 3QJHA 4PJIF 4RRPG 5B8CB 4M9OA 4LKCB 1FIGH 2ZCHH 3D6GA 4E41A 1N0LA 2JB5L 4G8IA 1XGRA 4QY8B 1J0KA 1PKOA 4TNWF 3EO0B 1J1PL 1W72H 3WLBB 3KNBB 3NABH 4WV1A 1ZWIA 4KJPD 1CD1B 4ETQB 4LBEA 3T4AB 4L9LB 1AKJA 1KCKA 5KW9H 3OF6D 3KPTA 5DRNA 1GIGH 3CMOH 5E4EB 3SY0B 1CIDA 2PXYB 3QHZL 4Z7VB 3K4ZA 4TUKL 4OLWH 2RCSL 3ZDZF 1EO5A 3IJHA 3BEVB 3D85A 3SKJL 4YZFF 4PJFE 3OKNB 3GRWH 5L8KB 1R24B 3AREB 4LVHB 3ZKQD 2R0WL 1I9IH 5B3JF 3OBAA 1DQDL 3ARTA 2Z8WC 3FO2B 4O58H 4ZUWA 3SCMC 1CDCA 3G6DH 5D4QA 4FTVA 3RVVC 2D7PA 1F4YL 2AXGA 3G5YB 4GQPH 3S5LA 3LQZB 4MNQD 1UM6L 3GSNB 1QYGH 2Y5TB 1S7XA 4Y5XC 1IFHL 1X5HA 3DTXA 3HAEG 3KR3L 4N0UA 4GSDH 2YHGA 4ZFFA 3B9EA 4YFDB 1BJMA 4JPVH 1QFPA 3NCCB 3Q0HA 4KI5C 4JDVA 4DQOH 4QYOB 1IMHC 2BVQB 2QL1A 4DAGL 1QUNA 4P3CL 3QUKA 3T2NH 2I07A 4P9MH 3RIAF 3STZB 2VO5A 3FO1B 5GGVY 4GKNA 4L4VE 1JYNA 4IRSC 1AD0A 1IAKA 4GRWH 2HFTA 1S7UB 4R0LA 4XPTH 1MVFA 1CFBA 3QA3A 3TZVC 1MQ8A 4LPWA 4Y0GA 5JHDB 1A6ZA 2IC2A 2H2PD 4WVRA 4Y5YA 1IGTA 1U92A 1UZ6E 2ICWA 3T0EA 1T21A 1E27A 5TE4L 3JV5A 8FABA 5T1MA 4LAJH 1K9TA 5SWSD 3LN5A 1Z9SA 4EI5B 4WTXA 3NCMA 2CO6B 1P84K 1D5IH 3HUJF 3P4OA 2FIKA 2BFVH 4N90D 4BSWB 3MGAA 3HS0B 4HSQA 2AK4A 3TH3T 4U1GB 1FZKB 1A3RH 2VDPL 4TVPL 1GZQB 3MREA 1S5HB 4L3EE 5FYJE 5DT1L 3WN5A 1CS6A 2ESVB 5H35B 4H26B 4OF6A 3KYNB 1RJYB 1JIBA 4QT5A 3V0WL 4ZPVA 2ZSWA 4KVNH 1UC6A 3V7MA 4HS3A 3W11D 3VFSA 5DJ2A 4M02A 1DN0B 3NMEA 4E41D 1XF1A 5ANME 1R5IB 5CEYB 3EOTH 5I1AB 4BSJA 4R96B 2ZWLT 2BNRB 4FQQA 2DQGL 4ZO7A 5EU6B 4D0DA 2WP3O 4ZOBA 1AKJD 1H3UA 3OGCA 2ZUUA 4LIQE 4JPKL 3DO7B 3QXDB 2DLFL 1DEDA 1BLNA 3C2SA 2F53E 1G7JB 3QUYC 3QHFH 4YDKH 4UB0L 3IAGC 1T4KA 5IMMB 3D85D 5E4IA 2UV3A 3MRBA 3NZ8B 1IJ9A 3G6JB 1AQKH 1MAMH 1A3QA 2V9QA 3PP4H 4PS4H 4RGMB 3HE7A 1H3PL 1U8KB 1QD0A 1KGCD 4P48A 2Q86B 3IGAB 4K9EC 3O6FA 3ZHKA 4JREB 4OD2B 5CLTA 3JWDC 5DK2A 2XZAL 3EYUH 3SJVA 2IMNA 3OV6A 5H37H 3WXVH 2C3VB 5DRZB 2EYTB 5BZDA 2P8LB 3HC0A 1RUML 4JRYA 4S0TD 3WCYA 2G2RA 2UZXB 3S97C 2E8YA 4HS6B 3OMZA 5D71H 1QBBA 1TZIA 3GUTB 3TPUB 1WWCA 4OAWB 1FZJA 5JXEC 2CGRH 1F4XL 4BK5A 3RZWA 1QNZL 3B43A 4NHCL 2XN9A 5HI4C 1U3YA 1U36A 1EAJA 4CMHB 1IC7H 1WBXB 4YAQB 4C4KO 1QFUL 3GMQB 1ZHKB 4M7JL 4BA8A 1BVLB 3Q6FA 3E1F1 4PJ7B 1C1EH 4Y8AA 1U8JA 3SO3B 5IB3A 3WL9B 1MI5D 1K4CA 3L95A 4M4PA 5MEOA 4M1GL 3SGJC 3TPKA 1MNUL 4HIIB 3HZKA 3WFZA 4XVJH 4OFYD 1GHFL 3V7AG 1ZT1B 1CN4A 2I9LB 4EKXA 1S7VA 1GGBH 2HFFB 2VLKD 5T3ZE 1KCSH 3KHQA 3RWFA 1JWMA 1LO4L 4YE4L 2H1PL 5BOZG 3MV7E 3P73B 2ZOLB 1CGYA 5K9OB 4UDTB 1XF4B 2JB5H 4MDIB 1KEML 2AK4D 1KJ2B 3MRJA 1J1PH 4V2BA 1CDUA 2G5BA 1WF5A 3PHSA 1WLHA 4JRWA 3ARGA 3IDNA 5I75B 5DI8A 1HIML 3ZTJG 4JO3L 1XH3A 2EIZA 3KAAA 4NQUA 2D03L 4TUKH 1P4IL 4X99A 2RCSH 3ZKND 5TE6L 3KJ4B 3SKJH 3IKKA 5I18L 3MXVL 4G5ZL 3L5HA 1QA9A 1FFOB 2VLRA 2Z31B 1QFWL 3VCLB 4U6YB 4LHUB 4LLMA 5ID0A 2XOTA 3BESR 3WIFB 5FA4B 5C09E 4AY0A 4PJ8A 1DQDH 1RZGA 4PREB 2Q8AL 1UXWB 1S9XA 3DRTB 1I8LC 4Z7OF 5C2BL 4P4KB 3CFDB 4NT6A 1EUUA 5F7WC 3X14B 1UM6H 5HHVL 2CRMA 3DHMA 3TCLB 5KVDL 2FBJL 2DYPB 4LCWB 5EOCL 4CDGC 1IFHH 2FHFA 3KR3H 4K8RC 4PRNA 2Z0BA 4X9HA 4GAFB 3HE7D 3STLB 3O6FD 3TA3A 1KTLA 2E5EA 2GTWB 3MLWL 4A6YL 1DN2A 5D7JB 2FRGP 5EUKA 1RK1B 4P3CH 1X44A 3QNZB 5BV7L 4H1LA 4MYWB 4Y2DC 4JFFB 3NCBB 2EDBA 2YPLA 4I0PA 1FE8L 1YNTA 3MV9A 2X9XA 3D39A 1XZ0B 5GHWL 2NCMA 4N8VG 5EOTA 5AZ2L 1B4RA 2R1YA 4UU9A 2OTWA 4RZCB 4J7RA 3C6LB 3K81A 2XN9D 1RK0B 4ODUB 2XFXB 1LEKA 3IAQA 4D3CL 2XTJB 2GEEA 3GB7A 4BH8B 5CEZE 4F80A 3X11B 2IAMB 1W0VB 4NO3B 4X6CB 5E00A 3ETBF 4H1LH 2V5SA 1L0XA 3MACL 1LEIA 3LDBC 3ZT6A 4M6OL 4LLQA 2VDPH 4TVPH 1RU9L 5B8CC 2EEAA 3EOBB 4NRXB 1IAMA 1AIFB 1MHCB 3T3ME 5DT1H 5F7EH 1ERNA 3GEWB 3V0WH 3VGAC 3CFJA 3PL6A 3BP5A 2EC9U 3VRLF 5DK0A 4RBPK 3Q2CA 1INEL 4L9LC 1FN4B 4I18A 3OGOE 1KTRL 4LMQI 4P23A 3MRHB 3QEQB 1HHKB 2BRQA 3BQUA 3MUGA 1S5IL 3CZJA 4MDJA 3X3GL 4M93C 5HVHB 2X7LA 5EZLB 3OAYH 3OJDB 2DQGH 4NBZB 4I48B 3ARGD 4HJ0C 4ZFGL 4HKJB 4OZIE 4HWUA 1RZJL 1BF2A 2DLFH 4PV8A 3PHQA 1I9JL 2J12B 1OGAD 3U9PL 3MV01 5IVXB 3LRHA 3T1FB 4UB0H 4OF7A 1UEMA 4CMMA 1J88A 5HHPA 3MV8B 3O2WL 1QRKA 4XB7A 2IH1A 2VLRD 1H3PH 3DXAB 3QNYB 1FHGA 5IG7B 1KLUA 1SHMA 6FABL 2NY6D 2XZAH 2EIEA 4G8GA 5C0EB 5BXFA 2VLJA 2ZUTA 3PXHA 4MB5A 1RUMH 4K7PY 2BSTA 1S7RA 3TVMC 1SEQL 3DYMA 3SE9L 2QADB 1R3HB 3P0YL 2WW8A 1PY9A 5C07D 2NZ9D 1NC4A 3EYVA 1NDGB 5FYLL 1ES0B 1FNEB 1JFQL 1QSEB 1QSVA 1JF5A 3ARDB 4OFIA 4PGJA 3K2MC 4UNUA 2NTFA 4K2UL 4P46A 1F4XH 1QFWI 2DIJA 3TA3D 4P57B 1QNZH 4NHCH 2LAAA 1TTFA 3SKNA 4Z7VE 2Z35B 3V6FB 3CVHL 1HDMA 1UVQA 5SX5K 5I2IA 1RHFA 1QFUH 3TH2T 1WGOA 3VXQA 3GIZL 4MJIB 1DQLH 4ZFZA 4M7JH 2ZOKA 4Y5VA 4P4RA 5BW7A 4PJ8C 4M1DL 3B2VL 4LOUC 1D5XB 2L7UA 4NNYA 1MJUL 3PQYB 2WMPA 4I0PD 4HIJA 3MV9D 2QHRL 1AXSA 4M1GH 4TVPD 1NCTA 3EYOB 3U46A 1MNUH 2WIMA 1FPTL 4WU5A 5HD8C 5DO2C 5K9KB 1GHFH 4MQ7B 5FK9B 2PTVA 2DQIL 4Z0BL 4OQTH 1YEKL 4X6BA 1MLBB 1U2HA 3BHBA 4HUWB 1LO4H 5FB8A 1C5DB 4YE4H 2H1PH 2EIBA 2O5XL 3NCYP 3VXPA 5DJDB 1YNLH 2ERJB 1KEMH 4PJGF 2YD4A 5DMKB 4JPIA 2AGJL 2EKJA 1P7QB 3PV6B 1MFNA 2WQRA 2LU3A 5IVZA 4L4TD 5TH2A 4XTRD 3M8OL 1HIMH 4EDWL 4RMVA 4JO3H 4HAGA 3PIQA 2B8OT 3PL6D 2D03H 2H41A 4FFWC 5D1ZB 2AV7B 1K8IA 5LWYL 1P4IH 2YD8A 1FG9C 3CDGA 3HNTL 4S2SB 5TE6H 2A83A 2VZTA 4P23D 3OZ9L 3BQUD 5JHDE 3K7UA 4G5ZH 1MRCL 1QFWH 4J3XA 2CQVA 3LB6D 3ILQD 5CHNA 2Q8AH 4WI2A 2VITA 3JTSA 5C2BH 2IMMA 4DUXA 4JREC 3C9NA 5I66B 5HHVH 1OM3L 5IFHL 3N06B 4RFEB 3NIGF 1YEDA 5KVDH 2HYMA 1P1ZB 2FBJH 1J8HA 5GZND 3NVQA 5EOCH 4UIMB 3U1SL 4FFVC 1TMCB 3QDAA 1X5AA 4KZDL 4O51B 2ESVE 4XCNB 2X05A 1Q9LB 3QUZC 4FXKB 4GAYB 5INDB 2D7TL 1B88A 2FGWL 2VDRL 4NHUA 3W2DL 4MCZA 6CGTA 3MLWH 4HBQA 5GRUL 4A6YH 1YN7A 3LKRA 3RDTA 2EECA 2X09A 1S7QA 4I3SL 5BVJB 5C0BD 3G08A 5BV7H 1WVZA 1K8DA 3DGCR 1DVFC 4WFFD 1NFDF 1TJHL 3S9DB 3UJIL 2UWEB 2FEEI 4XBEL 4TRPH 1PEZA 2CIIA 1FE8H 4FG6C 2F58L 4TTDD 2BNRE 2ICEB 5EU6E 5GHWH 3REWB 3VWJA 5AZ2H 3VJ6B 1J1XL 3VFVA 3OR7A 2DQJL 3FQXB 3BPNB 1TFHA 2C7UB 3UEZA 1DBJL 1S78C 3LRGA 3BKJL 3ZE2F 5HGAB 1NJ9B 1JP5A 3O8XA 4NQEA 4DGYL 4IRZL 4D3CH 4U1LA 2XIDA 4W4OC 1X5YA 4PJAB 1Q72L 2BSRA 3LKOA 4NYLA 1DBAL 1NMCB 3G6JE 2AVGA 4PRHD 3O41B 3MACH 4M8QA 4PY8I 2BDNL 4KROD 2NNAA 4M6OH 2ICES 1DR9A 1T1WA 1MCEA 1JVKA 1RU9H 3DLQR 3C6SA 1OQXA 2V2TA 1MLCB 5DJ8B 5AZEL 3VXMA 4TUOB 3U0TB 2A6IB 4QRUB 3VD4A 5J3HD 1FZOA 4P46C 2DTMH 3QDMB 1VGKB 2VXUL 1INEH 1L6ZA 2BXZA 4EVNA 1D5MA 4FQXA 5I73B 1RIVL 2AJXL 1MHPL 1S5IH 5SWQB 4LF3A 3X3GH 2I9TA 4QRQB 5IMKB 2JIXB 2JJSA 4Y19D 1MPAL 3KJ4C 4P5MB 4QHLB 5BRZA 1R6VA 4ZFGH 4BKLB 2VB5A 1W2KT 4PJ7E 1RZJH 5GZOD 1A7QL 4MJ6B 1I9JH 3U9PH 4KKAD 4I77L 4YXKL 4MNGE 1HE7A 1VPOL 3L3DA 1WAAA 1I1FA 3INUL 3BZFB 1G7PB 4ORGB 3O2WH 5B21A 4HIHA 1R3LA 2HT2D 3JV4B 1U93B 3VFMB 4X80L 3DX8B 2X9YA 4JQIL 6FABH 3VWKC 4JVPA 2OSLA 1SEQH 3SE9H 3P0YH 3O9WA 4EN3A 2IPTL 4MQSB 3NIFF 1NDMB 3MBEA 4KAQL 1ZA6A 3LSOB 2EDXA 4WTZG 5JW5A 2UVFA 1UJ3A 1JFQH 1XCQA 2FJGB 2KUTA 5HDOA 5DYOA 3JV6B 3DI3B 5I16A 4K2UH 1BQSA 5DS8B 4YQXH 2GT9A 3P0VL 5JORA 1BQLL 4TYUA 3BI9X 3IFOB 4M1CC 5T1LA 5JPNB 3CVHH 1MCBA 1FAIL 4JZJB 2DDQL 2V9TA 4Q6YA 3GIZH 1QR4A 5CJOL 1OLZA 3VI4F 4HWZB 4M1DH 3B2VH 2EDJA 1MJUH 4EQ2A 3O6ML 1J0HA 4NO5B 1HZHL 2QHRH 2PCPB 3ALPA 1FPTH 1D5ZB 1U95B 1ZVSB 2DQIH 5ENWA 4Z7WF 4Z0BH 4NQED 3DX6A 1F6FB 1YEKH 5E6IC 5CBAA 4NOFA 2VKWA 3FQWB 4LCWE 4LEOB 4MNHA 5BJTA 4WO4A 1NCNA 3VFUA 3WHE0 2O5XH 1OSZB 4FS0A 3EDFA 4HJJL 1NLBL 2VDNH 5D8JL 5EH1A 3MRPB 4OUUA 4MNQB 4ZS7L 3RWHA 2AGJH 3SPVA 4PTUA 4ZSOA 3WIIL 2R2HB 5TDNA 3MCKA 3M8OH 1CFTA 2FSEA 2VSCA 3F7QA 4EDWH 3VWJC 4JFFE 4P2QD 5HHMD 2B1AL 1FNGA 5LWYH 3T65A 2Z92A 3O8XC 3HNTH 1NBVL 4FQXD 4X8XA 5ETUA 5I8KH 3JUYA 1KFAL 3OZ9H 1U8QA 2CK2A 3KVQA 1MRCH 3W0WA 4PJ9A 2H8PA 5HPOA 2XTJE 1B0RB 3O2VH 5BRZD 4X6CE 3P9MB 2BHZA 4NC0B 4PJCF 2D4DA 3L3JB 4PP1C 1OM3H 5IFHH 4HEME 1WEJL 4XB8A 2WNGA 3V0AC 3QRFM 5IW1B 3WEXB 1A2YB 1LP9F 2NY5L 3U1SH 4D8PB 1H3TA 2R2CA 3GO1L 4KZDH 2WUCL 4JANB 3TBSB 4MVBC 1V3MA 2D7TH 4LNVA 2VDRH 5IUSA 3W2DH 5IROA 4FQ2L 5GRUH 1CTNA 1PVHA 2XKUA 5EWIL 2BVOB 3AU1B 3RPIA 1W72B 2FDBP 5D72L 4I3SH 1A21A 4NKIL 7FABL 1A02N 5LGJA 3QEQE 5DZNA 3E6HA 2Z8RA 3BMWA 3MRGA 2ADGA 1YMMA 2N1KA 2ADJA 1ZLVH 4EN3D 1TJHH 5IB4B 3UJIH 3MBED 4MXQC 3LMJH 4XBEH 2GUOB 2HAZA 2PYED 4BQ9A 4MMXC 2F58H 4PJEA 2CIKA 3QJHB 1J1XH 1U0QA 2DQJH 4JPWL 1GXEA 1AR1D 1DBJH 2HLFD 3BKJH 4WFHD 4E41B 2C4FU 4DGYH 4IRZH 5T1LD 2WWKT 4ZUVA 5IVXE 1XGRB 3CK0L 1OLLA 1YQ2A 1KC5L 1PX4A 1Q72H 3MV8E 1JN6A 3P4NA 4HGKC 1DBAH 4KDTA 1HQRA 2XWBA 4JO2L 4B53A 4K71C 3QUXA 1AKJB 2VWEE 3DXAE 2BDNH 2F5AL 5EUOA 5DRNB 4S0SD 4BQ8A 2Z9TA 5I0DA 3ABZA 5AZEH 3D85B 4XC3L 2A6KB 4LCCC 2ERJC 5ACZA 3QAZB 3MRRB 1S9VA 5GJTL 1E0OB 4KRMB 3TIDA 5HYSA 1QSEE 4LNRA 4PJ5A 2VXUH 1OWRM 2EZ0C 4WO4D 4XI5C 3RGVA 4L8DA 1RIVH 2AJXH 5TGBA 3K8MA 1MHPH 2AXGB 1HN1A 3S5LB 5D1ZC 1R3KA 3V6BR 4GRWB 1MPAH 1S7XB 1T0MA 4X5XB 4WEUD 1ETZB 4MJIE 2DMKA 2DQEL 3OWEA 3DTXB 2H2SC 1WFTA 4ZFFB 3F7RA 3V5DA 1A7QH 3PQYE 3ROOA 5HVGB 4ZO9A 4OKVA 3ALXA 4I77H 4YXKH 1BQHG 1TQBC 1KIRB 1VPOH 2EO1A 4MXWL 4OZGB 3INUH 3QG7H 4AEIL 5IHZA 3DROB 1CR9L 2W0FA 3QUKB 3FFDA 4X80H 3NGBC 2X4OA 4JQIH 1UFUA 1JZ4A 4GKNB 4NQVB 3NA9L 2WBJC 3ZTNL 2AS5M 3BD5A 1AD0B 1MI5B 2Q87A 3KYMA 4BFIA 4QTHA 4R0LB 1MAJA 3KPNA 1BVZA 3QA3B 4ZQKA 3AXLB 1IBGL 4MSWB 1A6ZB 3GMRB 2IPTH 1RZIA 4Y5YB 1F97A 1IGTB 4HMEA 2VLKB 5H37G 4KAQH 1T21B 1E27B 3MGOA 2Y6SC 1WK0A 3CJJA 4HIEA 4RQQA 8FABB 1NC2D 2B1HL 3TBWA 5T1MB 4NNXA 3RU8L 5LJYH 3LN5B 4XBPA 4GBXD 3QNXA 1WBZB 3P0VH 1BQLH 1G7QB 3O3BA 1JPST 2FIKB 5DHXB 5F7HA 1FAIH 2DDQH 2AK4B 4PJ9C 2J8UF 4KK5C 3MRFB 3BPNC 4HUKB 3GMLA 5CJOH 1B90A 4C83B 3PNWA 1BQHB 2YN5A 1EV2E 3WN5B 1VFOA 5D5MA 3U4AA 3I6LD 3O6MH 4QT5B 3ZSSA 1CICA 1HZHH 1NMCC 3B5TA 5FOBB 4NWTL 5DJ2B 3JWOL 3NIDE 2CJUL 5DSCA 4EUPA 1GCFA 1HHGB 3WD5L 2AP2A 5HYJA 5AYQA 3KYKL 4E42B 5FUZL 3EGSA 1T7VA 3LKSB 5EOQL 2E7MA 2LFGA 3QQ9D 5IROC 1T7XA 4FQQB 3SE3C 3TBVA 3QUXD 4Z95L 3OGCB 4HJJH 1IILE 1NLBH 3CCHA 5D8JH 2DM2A 4OQ1A 1BLNB 1BMGA 4ZS7H 4OLVL 1QPXA 3GZKA 5FGSA 5I73C 3WIIH 1T4KB 3MRBB 1IZJA 2KDGA 2XI9A 3IDGA 5CMAB 1CZ8L 4OCWL 4U1JA 2GHWB 1TQCB 4TVSa 3HE7B 3NBNA 1N0XL 2NY0B 4WJ5A 3ULUH 2UWEE 4I8DA 3TFKC 1KBGL 2B1AH 3NACH 3O6FB 5HVWA 4PJ5D 5FF6A 1T1YA 1PZ5B 3DVGB 2FJHA 5CBEB 3RGVD 1NBVH 5BZDB 4UAOB 5E6ZA 4ODWA 2B4CC 5JIKA 1ZEAL 3H7BA 3MTRA 1HWHB 1W0YT 1PYWB 1SBSL 4PJAE 5F6IC 1TZIB 4LLVB 2FX9L 4M3JA 4M6ML 5F9JA 1P9MC 3OL2A 1CLYL 3CX5J 4KMQA 1DLHA 3UTZA 3BUYA 2FR4B 4J1UA 2AJ3A 5F97E 1CI5A 4OM1L 4HGWA 3O0RL 5D6CA 3FQNA 2XN9B 1HYSD 1WEJH 3EZJB 1P2CA 3DURA 2NY5H 3GO1H 4QXUL 2X70A 3SGDI 2WUCH 4RAHA 1EDQA 2O5ZL 3DIFA 3QXWA 5F3BB 1MCIA 2R9HC 2BK8A 5JHLL 1U8JB 2LVCA 1KPVA 5CP7A 5A1AA 3DBXA 3VGEA 3QDME 4FQ2H 4HUUA 5ACLA 5EWIH 1JZ5A 1HWGB 5DC4B 3ZE0F 5D72H 4U1NA 4NKIH 4XAKD 2IFGA 4M4RA 4L8CA 4W6YB 1S7VB 3JXAA 3KDMA 4JZJC 2FX8L 3S7GA 3PV7A 1CDYA 2EDWA 3RWFB 5INCA 4BYHA 4TN9A 5C0GB 3RNQA 2K7QA 4I0CC 4KJPC 4IOIA 5J7CC 4JPWH 3DX9B 4U6HA 3RQ3A 3AB0B 3TYGH 3D0LB 3RY4A 3TBTA 1AJ7L 4G42A 4YUEL 1F3DH 1OW0A 4YFLI 4J23A 3CK0H 2XWTA 1KC5H 5L6YL 3MRJB 4PJIA 1H3XA 2FH8A 1A4JB 2G5BB 1HHJB 3QSKB 1JPTL 3IS0X 4JO2H 3V6OC 2HJLA 3ARGB 3IDNB 3HMWL 3ZDYE 2F5AH 5CJ8A 1XH3B 4LAQL 1W8OA 1CE6A 4U1IA 1OGAB 5C0CA 3G04B 4TSCL 4X99B 4G8FA 4XC3H 1GC1C 3WJJC 1M4KA 5HVFB 5C3LD 3RWJA 1C12A 1QA9B 4N0RA 3ULUD 2VLRB 3LOWA 2DLIA 5F88A 1E4JA 2NY6B 2Y06L 1BD2A 3RWIA 3ARPA 4I4WA 4XVUD 3SGDH 3MMEB 3SDCA 5FYKL 4P5TC 1T22A 1TPXC 5C07B 1I3RA 3PGCA 3U0PB 2OX5A 3RHWK 1FBIL 2H9GA 4TTGA 2EDTA 4CL7A 2VYRE 2DQEH 5GXBB 1FYTD 1OTUC 1U8MB 2PKDA 2W0PA 4JGJA 4CN6A 4NPYA 4AG4L 4NZJA 3TA3B 4ZMAT 4MXWH 3B83A 1RQ5A 2D9QB 4AEIH 5GISL 5EUKB 4DZ8B 3IT8D 4PJBF 1UWXK 4JFEA 3F6LA 3VMPA 4H1LB 2DD8L 4X4ZA 2PETA 5DUBB 3DETC 2WP3T 3ZTNH 3ZHLA 2XTLA 2E27L 1REIA 4FNLL 1YNTB 3MV9B 1NCCL 4P2OA 4NQDA 2HRLA 4YHPA 5I1CL 3WNMA 2R1YB 1U8IA 5DUPL 1IBGH 1A6VL 1U8LB 1V3KA 5E7BA 3QXAA 2D0HA 3CC5B 2QR0B 4MNQE 2YRZA 1LEKB 3MX0A 3ULSB 1EEQA 4GAJL 4ZFOL 4JGMA 2GI7A 2VJXA 2B1HH 3Q5YA 3I9GL 3RU8H 5E00B 3B9KC 3IDXL 5IQ9A 3H6JA 2DLGA 3C5ZB 4LSDA 4B5EA 2R8SL 1HCVA 2WV3A 2Y4SA 4LLQB 4Q0XL 2ARJA 4HQQL 4D9LL 2V7NB 3H7LA 5ICXA 5JO5A 1QLFA 4L4TB 3HUJA 3B9DA 3QIWA 1MCDA 1VADA 4M43H 1ACZA 1QSFA 1NFIB 3ARSA 4G9FD 1WCBA 5K9QI 1AXTL 3TJHD 5AD0B 1PQZA 1FZMB 1GVIA 3FOLB 1CQYA 4MAYA 4NWTH 5SWZD 4CU8A 4I18B 3ZYJA 3JWOH 2P5WA 4L3CA 4P23B 2CJUH 1L0QA 4C4KT 5JQ6L 5IJKC 3WD5H 5EN2A 3KYKH 3UJTL 5M7QA 3SKUD 5FUZH 1G6RL 5GJSL 1FFNB 4HZLB 4UT6L 3QYCA 3J7HA 5EOQH 4X98B 1EX0A 2KQMA 4PIRF 3IJSA 1B6DA 4WU7B 4Z95H 2IADB 4LASL 2Z8SA 3QUML 2VAAB 2I27N 3PHQB 3WHXA 1DJSA 4N90E 2X1OA 4X7TA 5C0CD 1OAUL 4PBXA 3UPAA 4CMMB 5HHPB 1GOHA 5KSAA 4NFDA 1CZ8H 4OCWH 2DKSA 2IH1B 1N0XH 5F9DC 1KBGH 2HLAA 3FO0L 3OXSA 3RX5A 5J13C 2BC4B 1ZSDB 5BXFB 3IF1A 4BFBD 2L7JA 4L8SA 2BSTB 5E8DL 4WFGD 2F19L 5GGSA 5C0BB 1F11B 1ZEAH 4E41E 4LKXB 5HYQA 3LH2L 4NKOA 4DCQB 1JGDA 3I84A 2C4XA 3N1MC 3EYVB 4UV4L 1FJ1A 5IESL 1AGCA 1YECL 1SBSH 1IEAA 3NPSC 2AKRA 4M6MH 3T0XA 1IC4L 5B38A 1CLYH 5I1JH 3PHOA 1PKQB 3OKKB 5CSZB 2F74B 3D25A 4OM1H 3O0RH 4FA8A 2A38A 2AJZA 1WWAX 3FB7A 1UVQB 5IIEB 2GIYA 5IW3A 1AGBB 2XZQL 3LEXA 4QXUH 2VMFA 4JFED 1CL7L 2O5ZH 4PRHB 4P4RB 5JHLH 3LKQA 4NNYB 1KGCE 3S8WA 2JJTA 5MENA 5JW3L 4HKXA 1O0VA 3SDCC 4BSVA 4MD5A 4QRPD 4MQTB 4PJFF 5HYFA 4LEXL 3U46B 5HDBE 4NQDD 4WU5B 3VXUD 1MREL 1YN6A 5H94B 2YSSA 4GRWE 3EJYD 5DJZB 3BHBB 2W60B 5DUML 4QXTB 3H3PL 5FXCH 2OQJA 2CKNA 3VXPB 2V2XB 1H5BA 1PG7L 1AJ7H 3CMGA 4YUEH 2NY4D 5FYKU 1PG7X 3JTTB 4JPIB 4OZGE 5L6YH 3AS2A 4Y19B 2D31B 3ET9F 1MCJA 4RAVA 4LVOB 5ERWB 1AGEA 1JPTH 1WBYB 3RX7A 1MUJA 5TH2B 3WUZA 3QIWD 1QSFD 4H25A 3HMWH 3OKEB 3LV3A 4YIQA 4LAQH 1Q9OB 3MOAL 3EYQC 1MI5E 3CLFL 4FFYL 3OKDA 2DMBA 4FQCL 3IJYB 3CDGB 4MAYD 5E24E 3QH3A 1TZHB 2P7TA 4G6AD 4D9RD 5E6YA 3ESVF 3BMVA 4ZODA 2XPGA 4XAWL 5I71B 2X4NB 4X5WA 4DKFL 1I85A 2VLKE 4GW4A 3HNVL 1CD9B 1JF1A 4R6UA 2DQCL 4HFWB 4A6YB 1XR8A 5FUCE 4OIIL 2Y06H 4OSUL 3L3GB 5F7FA 1UZ6F 1BOYA 2NY0C 4HCRL 5HPMB 4BZ1L 1GZPB 1VFUA 5FYKH 5BV7B 3HRPA 1G7IA 1UM4L 3I6GA 2P8MB 1VA9A 2AK4E 2BY0A 1M7IB 2C1OA 2Y5EA 2GSIB 1FBIH 2EH8L 1B6UA 1YC8A 4UINL 5SX4I 3NZHL 4UILL 4JKWA 4IOSD 5E2TL 1OT1A 2E9BA 2BNQB 4AG4H 2FEDD 5C0DA 4MCZB 2FX7L 3D0VB 4RX4A 3RAJL 1YN7B 1TVHB 4ZFOA 3LKRB 1BREA 5GISH 3R06A 1S7QB 3MO1A 1CD0A 5IBUB 3VFPA 5EG6C 4KI5F 1SJEB 1K8DB 2DD8H 2GSGA 2R1XB 4GH7B 4JE4B 3BPLC 5ITFA 5KAQG 1MRDL 5DQDL 5HHXL 4EJ1C 5HHOA 5FO9A 2E27H 4ONHA 4FNLH 2BMKA 1NCCH 4NFCA 5I1CH 1U8HA 3T04D 3VFVB 4N5UA 3GSWB 5DUPH 5TQ0L 1A6VH 2WIIB 5KSAC 3MRNA 2DF3A 1XR9A 3HE6A 3SDXB 2DM3A 4NQEB 4U1LB 4GAJH 1NGPL 4KKBC 1IGYA 2BX5A 3LKOB 3IDXH 4RIRA 3HTLX 2QSQA 2H3NA 1FVDB 2D7OA 2CDEA 3BH9A 4F33B 4BZ2L 1G0YR 1G6RA 2YZ8A 5EO1B 1T1WB 4Q0XH 4NZTL 4HQQH 4MA8H 4D9LH 1KV3A 3S36X 3VMNA 4L8BB 3AB0C 2V2TB 3PWVB 2GJZB 4H88L 4M7LT 2RIKA 3B8YA 4HUXA 4L9DA 3ULVL 3QUMA 4LP5A 1AXTH 4G80A 4P2QB 3GJEA 5HHMB 1FZOB 4W70A 3W9DB 1MFCL 3X3FL 1XGPA 1E4XI 5DEZA 1MCQA 1JYWA 1CL7I 1D5MB 3H9YA 4FQXB 2MHAA 2OJZH 3RBGA 5SX4H 4IJ3B 4LCUB 5JQ6H 2FB4H 2VAJA 2XN9E 3UJTH 2GQHA 1G6RH 5GJSH 4UT6H 1EMTL 3BP6A 1JI1A 4O4YL 1SY6L 3S6CA 5E8OA 5BRZB 4U2ZA 5CS7A 1OP5K 2R4SL 4R4FL 5FYKD 4LASH 3QUMH 5C0AD 2ARJQ 4E0RB 1OAUH 1ODAA 5D7IB 4YGVB 1I1FB 4LU5L 4U1MB 2YWZA 1BM3L 1R3LB 5F7DA 4O00A 1X6LA 4N0CD 2AI0L 4LFHD 4AT6A 2B39A 4L5FL 3FO0H 2E7BA 2J2ZA 5IVNA 5B3NA 5J6HA 3CVHB 3WNOA 5FM4A 2OSLB 4S1RL 4WUUD 3RVTC 1YY8B 1EZVY 2F19H 3HZMA 2F9BT 4N9GB 3LH2H 1TVBB 2EXYD 4UV4H 4EN3B 4XXCA 4ISVA 3MBEB 5IESH 1YECH 1N5AB 1UJ3B 4ZAKC 5SV4A 2PYEB 3BAEL 1I1AC 4DGVL 3GSRA 1I9EA 5DYOB 1IC4H 1T5XA 5I16B 1MJJB 4JZNA 2VDML 3BPCB 4QGYA 4W81A 4EI6A 2VL5A 5DJYA 5L2JA 2GT9B 4NSKA 1OGAE 3WNNA 4RX4D 1N7ML 4LDOB 5DQ9A 1IM3A 2XZQH 1A6TA 3GNML 5IFAH 2RAMA 1CL7H 3FQUB 3S4SA 1LK3L 1HH6B 2VLRE 3MUY1 1T0PB 5C08A 5GS0L 5HHOD 5TDOA 1HILB 4PLJD 1K3IA 1FL3A 2HMID 4NN5B 1TTGA 1ORQA 3C5ZC 1MREH 2J1KA 5ENWB 1MH5A 5C07E 3HE6D 1GL4B 3S96A 5CBAB 3FONA 4MCYB 3FT4A 4QF1A 4ZTOL 2GITB 1FVCA 5DUMH 5CEXA 5BJTB 4YGAB 4WO4B 3WLWD 3CH1A 5IEHB 2NXZD 4Z9KB 5DJCA 1PG7H 4RFOL 3ARFC 3M45A 4WCYL 3FT2A 4OUUB 3BVNB 4Z5RA 1MEXH 4DUWA 2NR6D 3RWHB 1AC0A 4M3KB 4JFPA 3SPVB 3DVIA 4CGTA 3MNZB 5FGCB 1L9MA 2OI9B 5EO9B 4ZSOB 5DRXA 3HZVB 4S1DC 3V0VA 5E70A 1CFTB 1NBZB 1T7YA 4CUCA 3DUSA 3LB6C 3MOAH 3ILQC 3IRPX 3CLFH 1N6QL 4FFYH 2VRAA 2RFXB 3DGGA 3MV9E 4FQCH 4JQVA 5KVGL 3EFFA 5FGRA 5JA8B 3VE0B 4XAWH 1U8QB 5TF1L 2X44D 3MRLA 4DKFH 4YDLB 1HHIB 3HNVH 2N56A 5IBLD 1F5WA 2DQCH 3LEYL 3RWGA 3MUJA 5ALCL 3RWEA 2MQ0A 3KPQA 4OIIH 4OSUH 3HRZA 1EEYB 5FV1L 4HCRH 4BZ1H 1S9YA 3L3IB 3VDAA 1UM4H 4Z76B 3DV6B 4OIAA 2LTQB 1T03L 1Y6NR 5MI0B 4ETYA 1T1XA 5E1HB 2EH8H 1NC2B 4LSVL 3AS3A 4L4TE 4UINH 2ATKA 3NZHH 4UILH 1WT5C 3F7PC 1YEIL 5E2TH 1BIIB 4GBXB 4PJXB 4AJ0A 4ODTL 1OAQL 4OIBA 3T3MF 1ORSA 2FX7H 1ED3A 3RAJH 1R5VB 3RPIB 5F3HA 1N6UA 2J3SA 1IGFL 2LAGB 4IMLB 2ED8A 5HYSG 3MRGB 3VFRA 4Y88A 2ADJB 1OTSC 4LGRB 5L9DL 5C7XL 1MRDH 5DQDH 1F42A 3VFNA 5HHXH 2HKHL 3TN0C 3DMMA 4QRRA 5DVKA 1MFAL 2R0KH 4PJEB 4WHTB 5IGXL 3N0PB 2VC2L 5F8RC 3AY4C 1H8SA 5TQ0H 4EDXB 4CN1A 5T5FL 5HI5D 5TFSL 3VXRA 1G7LA 4OZIF 3SDAD 5GRXG 1NGPH 3P4NB 1JN6B 1R3IH 4NWUL 3CSBA 1KPUB 5DVLA 5I9QB 3MJ6A 5GS2H 1RZFL 3QUXB 4JCLA 4KKCD 3HLAB 5C08D 5J3HC 3S36H 4BZ2H 1CGVA 4NZTH 1EJ6A 3PP3H 2CLVB 5IHLB 3AM8C 4H88H 5C0BE 4HDIA 1NGXB 5ACZB 4LVNB 3ULVH 4WFFE 3CUPA 5LXGL 4P2CG 3X3FH 1MFCH 5HYSB 5HJ3A 4LNRB 3TBYB 1Y0LB 3EHBD 2JLLA 3FFCA 5C9JA 3RGVB 1PKQE 4L8DB 5GZOC 1KOAA 5DGQA 2MCPL 3B3IA 1CXLA 1KPRA 5B4MD 2J8HA 4PTTA 1EMTH 3F7VB 1X5IA 4O4YH 1SY6H 3K1DA 1YC7A 2V6HA 2NXYC 4HBCL 2R2EA 3PJSA 2R4SH 4Z7VF 3UX9B 3GKZA 4PRHE 4R4FH 1D5BB 1W0WB 3FAXA 4X6EA 5F72S 4OKVB 1E6OH 5GGRA 2D9CA 2KBGA 4NRZA 4LU5H 5IHZB 1BM3H 2V5RA 2W0FB 3GJFA 4HKZA 4X4YA 3FFDB 2X4OB 3M1BA 4L5FH 4WGVB 4RBPH 4X7FC 4TPRL 5TJWK 4JFDA 1NFKA 3KYMB 2X4QA 4BFIB 3KGRA 4QTHB 2EYRB 1WIUA 4S1RH 4NJAL 1CBVL 1XEDA 2XRAL 1SYVB 5HSFA 2O5YH 3U83A 3P77A 2ITCB 3UTPD 1G9MC 1JTOA 4Y19E 3BAEH 4DGVH 1R3JA 5E2UL 1LDSA 2Y23A 4QNPE 1HH9A 2VDMH 3BPOB 4KV5E 1MJ8L 4XBPB 2YD5A 2VTFA 2DLHA 5FUOL 3QNXB 1FV1B 4HK0B 4HH8A 2F8XC 1AP2A 2XXCB 2PR4L 1ZLUK 1N7MH 3E8UL 4LSQH 2X1WL 1RJCA 5IFJA 3GNMH 2EH7H 4Y1AA 4MD0A 5GS2D 1LK3H 2DBJA 2Y9RT 3EKCA 3RFZC 1AQDB 2Q8BH 5GS0H 4Z8FL 5DXWA 4EBQH 4HXBH 5JOFA 1FGVL 5FO8A 1KTDB 4MS8C 5DSCB 3ULVD 4QRSB 4C56D 1PSKL 1U58B 5LG1A 2I25N 4ZTOH 5T1KA 5I76A 1N5YL 1AGFA 3EGSB 1EHLL 3IDIA 2NLJA 4CVZA 1AXIB 4HPYL 4YXHL 3RIFF 4Z7WA 3QEGL 3KHOA 3TBVB 2AW2A 4XCCL 4CADA 2I5YL 3QO1B 2BNQE 2Y72A 4RFOH 1NCUA 5SX5H 4RFNC 3FTGA 4WCYH 3QWOA 3ARBA 3Q5TA 1SEBB 1XGQB 1AGDA 3ARUA 4Q9QH 1XIWA 1T80A 3N85L 1FYTB 3WBDA 4U1JB 4TULL 4WJ5B 3EDJA 2VQ1A 2V7HB 3VH8A 1N6QH 5J57B 4JM2A 5KVGH 1BX2A 1T1YB 3LKPB 1P5UA 5IW6A 2R39A 3UO1L 4G6KL 5FO7A 4ODWB 3D1MC 1KXQE 3H7BB 3SDXE 1X5KA 4NQEE 1A7RL 1E4WH 1N3NA 4Y4KD 3LEYH 1RURL 1RZKC 4IIQC 5ALCH 2CKBL 4HLJA 43CAB 2UVEA 3WS6A 1DLHB 4UQ2A 2NY2D 5F9AC 3VD9A 1JPGA 2AJ3B 3MLUL 2Z93A 3G6JF 3FQNB 4JLRB 1P2CB 4N9OB 4PJCA 3MRMA 4LSVH 1JL8A 4PG2C 3FOMB 1G6VK 4M61B 2X70B 4FMKA 5EBMB 3DNKA 1YEIH 2OZ4A 5F1NA 3DIFB 3NFNA 5DD0L 1A1NA 4ODTH 4FOMA 1QSZA 4P2QE 4Y8DC 1OAQH 5EU7C 5HHME 4XX1G 1KIPB 4GS7C 4JFDD 5E5MA 1LP9A 4R7DA 2H26A 4HUUB 1CWVA 1UEYA 4NC2B 1IGFH 5DHVA 5FHBL 5JTWA 1NGYA 4M7ZB 4OD3L 3UTTA 5DVNA 5L9DH 5C7XH 5GS0D 1MFBL 4Q74A 4G9FB 2HKHH 4M5YL 2VQUA 1CD8A 1KF9B 4IOFD 1KLGA 1MFAH 1XAUA 4OFKA 5BRZE 5IGXH 5SWZB 2VC2H 1U3ZA 3NPZB 3QFJD 4U6HB 4MB4A 3VGHA 1T7ZA 3TBTB 5I17B 1A6AB 4G42B 5T5FH 2XQYG 1FH5L 5D7IE 4PJ7F 2BZDA 4HG4J 2IPUK 4NN5C 1H15A 1T2XA 4TNVF 4NWUH 2W9DL 5C1MB 5DHVH 4YBQD 2GAZA 1AO7A 2HJLB 1RZFH 4OJFL 4OV5B 3IU4L 4PV9A 3HI5H 5GSRB 2HWZL 4R2GC 4U1IB 4PB0L 4LL9A 5C0CB 2NW3B 3GMPB 1JNLL 2P5EA 3RVXD 3RWJB 3OHXA 4XVTL 5F88B 5LXGH 1INQB 3U82B 1AHWA 5EU7E 4I1NB 2PYEE 3RX8A 2OI9C 4CJ0A 4FFZL 4X9GA 4P3DB 3CU7A 4LQ1A 4I4WB 5T5NG 3BDBA 3DECA 4QHUB 2MCPH 5D2LA 4OZHB 4WFHE 1I3RB 3PGCB 5C0IB 1ZA3A 1BPVA 1Z9OA 2H9GB 1JGEA 5IWLC 4HBCH 4KK9D 1BWWA 4C59B 5EU3A 3FZUD 1MIEL 4LP4A 4ELMB 1ZHBA 2AXJA 2XKNA 4JM2D 3VFOB 1QHOA 4FZEL 4UOW1 3AAZB 3WNPA 4HULB 2L4OA 1GGIL 2VKXA 5ESVB 2QTEA 4OLXL 1HKLL 4JFEB 4UT9L 3X13A 2P43B 4TPRH 4PYHA 5DWUL 4QRPB 4OLEA 3WXWL 1JTPA 4NQDB 4OF5A 4YHPB 4GBXC 4NJAH 1CBVH 3VXUB 1CXKA 2XRAH 3QXAB 1XIWC 3HC3L 4WWKD 4Z7UA 3RUGA 5FGCE 2FHBA 4U1SB 5E2UH 2DTSA 1ZS8A 5CZXD 4PJDB 5D2NC 4ZSOE 4IRJA 2EEBA 3HR6A 1MJ8H 5IQ9B 5FUOH 1VESA 4I13B 2BHYA 4B7LA 1G9NC 5DQJB 5F9OL 1S3KL 2A1WL 2PR4H 4PRPD 5HDLA 2NY4B 1CXEA 1OQOA 4DEPC 2ARJB 2HVJA 3NFSL 2COQA 4KH2A 5ICXB 5JO5B 2AABL 4ZXBA 3UTTD 3C5JB 4GKSA 4XNZB 3C60D 1QSFB 2ZUWA 1WCBB 1IEBB 2HG5A 2IQAB 1ZHNB 3QI9D 2JK5A 4PJHB 1BVKA 1KELL 5I9QC 1FGVH 3OKOA 4F3FA 3UPRA 4PGDB 4L3CB 1MIML 4HIXL 1PSKH 4X6CF 5FHAL 5BMFL 1N5YH 1IQDA 1EHLH 1F3RB 1TJIH 1FFQA 3T77A 4HPYH 4M7KL 5ACMA 3OXRB 1QTYT 3I3EA 1CDJA 1AO7D 2AJSL 3QEGH 4PY8J 3R8BB 4XCCH 4DVBA 5CKGA 3RRQA 2I5YH 4PJXE 1FORL 1YQVL 2A0LD 5D96B 3C8HA 4WFED 3WHXB 4X7TB 3RBSA 3L6FB 2WK2A 5D7LA 3LZFL 1U8PB 3LKNA 2R23B 3N85H 4P2RA 3RL2A 1JK8A 4TULH 4JFZL 2IAND 3I6LE 3BN9D 1KJMA 4XMPL 1IAOA 2QQLL 3RTQA