The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
219
|
structure length |
219
|
Chain Sequence |
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb |
molecule tags |
Membrane protein/metal transport
|
source organism |
Streptomyces lividans
|
molecule keywords |
antibody Fab fragment heavy chain
|
total genus |
39
|
structure length |
219
|
sequence length |
219
|
ec nomenclature | |
pdb deposition date | 2008-11-18 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |