4BQ8A

Crystal structure of the rgmb-neo1 complex form 3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
201
structure length
195
Chain Sequence
b'MMPPVGVQASILSHDTIRITWADNSLTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 28
structure length 195
sequence length 201
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq8A02
2NNAA 3TZVC 4O02L 3FO0L 1DUZB 4AL8L 5TDNA 3QIUC 5IK3B 1DP0A 1YC7A 3ARVA 3UPRA 1G9NH 3CC5A 3L3IB 3TBWB 4ORZC 4Y4HA 3H9SB 5GRWA 1MCLA 3VU2A 5IESL 1IKFH 2W0PA 4TSBL 2BVOA 1I9IL 1CFNA 4PJEE 3Q3GB 1A8JH 1TNNA 1ADQH 1JNHA 4EZMA 3KJ6L 4PP2A 4ZUWA 4YHNB 2NY4B 3EFFB 3WIFB 4GQ9H 2CKBL 1I8LC 1HILB 5CJXA 4KZEH 5BVPH 4JFZH 4JG0L 3G5ZA 1ZVYA 3IDXL 1N2RB 2XTJB 1BZ9B 4LCWA 5FO9B 3CVHB 5E4EC 1KCKA 3S34H 3PE9A 5HD8C 4GBXC 3T2NL 4DN4H 3D0LB 4PRPE 1LO4L 1VEMA 2AJUL 3MV8D 1DBAH 2W60B 4FQ1H 4JCMA 4X98A 4YQXH 5I1CL 3DRTA 4XZUA 1HDMA 4G7VH 5AZ2H 2HVKB 4PRHD 1I85C 5J1SC 3VFRB 1NFKA 1IGJB 1OTSD 3F7RA 3DUSB 1G7PA 4L4TE 5E6IC 3RU8H 1JUFA 2YMXH 3VWKD 1WVZA 4JHBA 4AEIL 5I1LA 2NPLX 3QISA 2ADIB 5D1ZC 1W0WA 4LLWB 4RFEA 5FGBA 2X89D 3QEUB 3S4SB 3BZ4A 2AK4B 1BLNA 4RAHA 2IH3B 5BV7H 4OF7A 1KTDB 1DBBL 4KK9C 4BFEA 2XICA 3FB8A 1J0KA 2E6QA 4U6XA 3PWJB 2OZ4L 5KSAA 4OB5H 4ZPVB 2EEBA 5DC4B 5FDYA 5I1DA 1TZHA 4UV4L 3O9WB 4NWUH 5EU3A 2OL3B 4NN7B 4KJPC 3VCLB 3RP1A 2R4RH 4F58H 3G6JF 3QUYB 4E5XB 4AJ0A 2DQEH 3TPUB 1ROWA 5E5MA 1TVHA 5GS3A 2IH1B 3OR7A 1NPUA 2D4DA 2V2TA 1AXSA 2PETA 2EIZA 5F9WC 1HEZB 1I7UA 2VSDA 3S37X 1U8JA 1R5VA 1I1AB 1YMMD 2IAND 4FXKA 4HK3N 2NZIA 2J2ZA 4WUUE 2IPKB 1ZHBA 1YQ2A 2FEEI 3SKOA 3M1BB 1RZJC 5BQ7B 4DUVA 4LHUA 2PCPA 1V3LA 1G7JB 4O51A 1I7ZA 1HIMH 1PDKA 2EDTA 4B50A 1JGUH 4NCC2 3QZWG 1MWAA 2F8VA 1J05B 4Y4FA 4WW2A 4K3JH 4O00A 1OAQL 3MLUH 4PRID 1O7VA 3OJDB 4QRTA 1VADA 1A4JA 2ARJQ 1DL7L 5MP6H 3ILQC 4HH9A 4MAYC 4YHLH 3M8OH 3WIIL 3SCMB 1A5FH 1JZ5A 2C4XA 3CZJA 3WE6B 1E4WH 3IFNL 3AROA 2HJLA 3VGDA 1X5HA 3MRMB 3QEQE 4YE4H 4BSJA 1GIGH 4S1QL 2DIJA 4L3ED 1U8HB 2Q7YB 4FFZH 4CNIB 4JZOA 3VRLF 5INDB 3I6KA 5CEZH 4NCDA 3UTOA 3IDGA 4JO2L 3FONA 3EO0A 2R56L 3HUJB 4HS8L 4FMKA 1JYVA 3SHSA 4L8SA 4BQBA 1PY9A 3TEUA 5ADOH 2DLTA 2XN9B 5F1NB 3JWNC 2NY7L 2ID5A 5FA4A 5DJ0A 1U8OB 5SX5H 4JDVA 5DMKB 1YEKH 3O6FB 3KPOB 2FO4A 4JFOB 4N8PA 5EU7C 3ZHKA 3CFKB 2NY0B 1LP9A 3B2VL 4LCYA 3RWHA 3P9LA 4PRNA 1TZGL 1HXMA 2H6PB 3TJHD 5GZOD 1JCKA 2VQ1A 3W39B 5D6CA 4TOYH 5IM7B 1K4DB 1P4IH 5JOPE 2VITA 1QSFD 2A9NH 2YWZA 1B6DA 3E8UH 4N0CC 3GMOB 1YEGL 5C6TH 2FCBA 4UOW1 4OTXL 5L8JB 4PBXA 5B39B 1QSVA 2Q8BL 4HW6A 3LZFH 5DD5H 4D0CA 1MEXH 2H9GA 3ZDZE 1RZKC 3P77B 5ITBL 5K9KA 1AJ7H 1J1OL 4MWFB 4NQCD 5ALCL 4RMTA 1OF2A 5DJCA 5AG8A 2E6JA 4YIQA 4LCWE 1RZ8A 4XBGA 5T5FH 5C6PB 4HEPG 4CDGC 4HK3J 1FBIL 5E56A 4G5ZH 4LLMA 3VG0H 5IUSA 2DQUL 2VDPH 3D48R 3OKNA 2WBJC 3MBEB 4XNYL 4YDJB 4RISL 1CLYH 2WK2A 3BX7C 4WEBL 1X6LA 1KFAL 3NIGE 4HLZH 3MCKA 4P5KA 4TSAL 4UILL 2DLHA 2EYRB 3BKCH 4WUKH 4WWID 2H1PL 5CCKH 5MEOB 2LAAA 2E3VA 2FBJL 2HVJB 4G6KH 1PSKL 3MMEB 5DD1H 4N9OB 3O45B 5EULV 2HKFL 1JWUB 1SJHB 1L0YA 1RVFH 4X4XB 3WFEL 2DJ4A 4XC3H 1JN6A 5FO7A 5L8KB 1AGEB 2MSPA 3ARBA 5CJOH 3HMXH 4Q0XH 3I02B 1N6UA 3T0WA 1XF5B 4R4ND 3MR9B 3KYMA 4E0RB 1A7BA 5GGUB 3FO1B 3DURA 4ZNCD 2E9JA 5GGTH 5EUOF 1NAKH 1JRHL 1XF4A 1S7UB 3SDXA 1FAIL 1AGFA 4OIBA 4NFDA 1UCTA 5F1KC 2IBBA 3GMQB 2DKMA 3S96B 4PLOB 4RA0C 2YSSB 1CD0A 2XY2A 1B0GB 4AM0B 3VFUA 3PWVA 1KB9K 3KDMA 4TTGA 4XP9H 2VWEC 4LKCB 5I8EB 1KGCD 2PYEB 1FFPB 2EKSB 4N8CH 1FGVH 1G1CA 4BKLB 2WMPA 1HH9B 4J2XA 1MREH 4PGDB 5CSZA 3IU3B 5IF0B 1A7NL 4OGXH 1F58L 2Q76B 3D18B 5H37G 5FB8A 2N1KA 2AGJH 1SEBB 5ISZD 4F3FB 3C6LD 2D0HA 43CAB 1S7WB 4P23D 2NR6D 4PJ5B 1N5AA 3I3BA 4L8CB 2YK1H 4L5FL 4HS6B 3BD3A 5FYLH 4PBVC 3P30H 4IRZL 5BJTA 3L3KA 1EUTA 4YHZH 1VFUA 1U6AH 1PQZB 2X6MA 5CJ5A 4ZG1A 3NGBB 1K4CA 3KLHC 3DYMA 2X1QA 4OZGE 2BY3A 4KI1A 1QNZL 4FABH 3MXWH 5HHME 1F3RB 3KPLA 3UX9B 5CP7A 1LK2A 7FABH 4H0GA 5FDWA 4NKDA 2AXFB 1NBYA 3ULVC 3WHE0 4NJAL 2L0DA 1UZ6F 1NLBL 3TIDB 1QR4A 2GAZB 3MBXL 3V5DA 4ZUUA 4O2FB 3C2AH 5I17B 5D5MB 1K3IA 2BY1A 5TDPB 3PWPA 4N0YL 3U46A 1RK0A 5ICYB 5LG1A 5IQ7H 1LP9E 4MJ6A 3RVTC 2R0LL 4O4YH 5A2JH 3K2UH 2BSSA 1MVUA 4P9HH 1FL6A 1U8LB 1UJ3B 4POYA 1NMBL 5JOEA 5D7SH 4I48B 1EEQA 1JK8B 2ESVB 2Z93A 4TTDC 5DUPL 5GRJH 5TQ2L 3LPGA 1U8NA 1CFSB 3JTSB 4OBRA 4QXGH 2VNCA 4ELME 4RMUA 1J8KA 2I9LA 4IMLA 2Y07L 4G9DB 4EDWL 1X7QA 3LRHA 1TQBB 3RX5A 1NLDL 5AZEL 4HGWA 1QPPA 3SDAB 4Z78A 2ZNWA 4JDTL 4ZUTA 2OTUA 5GGSA 4PJIF 4KHTL 3BGAA 3UO1L 3AMLA 3OXSA 1OTTD 4TVSa 3LN5A 1UGNA 3FT2A 3O8XA 4XP4L 2EDEA 2V7HA 3ZKND 5AYQA 4MAUL 2NXZB 1NCWL 3LN4B 1H15B 2P8LB 3QUKB 3LSOB 4AG4L 3ARRA 5DD0L 2B7DT 4GRMA 4FP8H 3IDMA 2DYPD 5HHXL 5EG6C 2AJXL 5IHZB 2NY2C 2K7QA 3VRIB 2OQJB 3KG5A 1FO0L 3X11B 1RUAL 4NSKB 2I27N 3RZCD 2B5IB 1H3PH 1VSCA 4JFDB 4PG9B 5TF1L 3ZHLA 1DQTA 2WINB 3F58L 4OSUH 2CD0A 3K8MA 4LLAA 5B4MD 2R2CA 3EYFA 3B2UC 4KJYA 4RRPG 4M3KB 4OKDA 3TJEL 4YWGL 1XT5A 4KI5D 4LSVL 4X9GA 4FMFA 1HN1A 4TNWK 3SDXE 1YEIH 5CILL 5CINH 2VZTA 5HDQL 2B1HL 4U1SB 1RFDL 5K9QI 1JNLH 2RQ8A 3DSFH 1JTOA 1SEQH 1BECA 3DYOA 2E7MA 1LO2H 2APFA 3SE9H 3VFSA 4GMSH 1FYTB 3GBML 5LGJA 5FEBA 1DBJL 4N90D 2MPAH 5J06A 1OARH 3B8SA 1J8HD 3HUJF 2W9EH 4Z7VA 4AIZB 4ESKA 5H35A 1MF2L 1FNGB 1NMCB 4TQEH 1MIEH 5DUML 1CTNA 1KPVB 1EAPA 4K8RC 5IOPA 5KSVB 3DBXB 1A6UL 2QEJA 3QZWA 4X6FB 1OP3K 4H5SA 5BXFA 1CGWA 4K3GA 3C08H 1YNLH 3WFDH 4NKIH 3QEHB 5E2UL 4NDMB 2C3XA 2F9BT 1QLEH 3GB7B 4OF5A 1PX3A 1T0NB 1WCQA 3KR3H 3QQ4B 4R90H 4G6FB 1TTFA 4JHAL 4POZD 3ZDXF 3KNBB 4NPYA 2AEIT 4ZD3L 1I7RA 1HQRA 4P2OB 5F7EL 4WCYH 4BM7A 3QIWD 4LLQB 4QY8A 1GL4B 5F6IC 3H3PL 5DZLA 4DK3A 32C2A 3KPTA 5TFSH 3EOBA 1M71B 1KN4L 1EO7A 1CIUA 3MOQA 3L7EB 1JPFA 2DQGH 2FJGA 2GUOB 2HT4C 4U4BA 3OPZH 1EO8H 4ONGH 1RULH 2BC4B 1T66D 1S7QA 1NSNH 5KW9L 4I0PB 3O11A 4HUWA 4MSWB 4PJEB 5EU6D 5F96H 3PWPE 5T3XH 4XCFH 4ALAH 4F57L 2B8OT 3PQYA 5LQBL 2MCPH 4APQA 2BZDA 3BRDA 4D8PA 3EAKA 3Q6GL 4ZS6C 25C8L 3N85L 3ARFC 1AD0B 4JFPA 3MREB 2P4AB 1KOAA 5A2FA 1IKNC 2YZ1A 3H9HB 1HYSC 3A6CL 1IC4H 1R3LA 4XBPB 1KEGL 3O6KL 2E8YA 4KV5F 4NQSA 5DEGA 5E99H 4X6CF 3M07A 4R0LB 5D93C 5DHYA 4GXUM 5DGQA 4OCSH 3CH8A 5MI0C 1T2XA 1LE5B 1E6OH 4XNZB 4HUVA 3DSNA 2C4FT 3AY4C 1IEHA 4LGSB 1F4XH 4QRRA 4O02H 3GSNH 5IB5B 4AL8H 1N6VA 1AFVL 4ELKA 4Q9BA 5JOFA 1BZ7A 3ARXA 4L4TB 3QUZC 2D7MA 5IESH 3WXWL 2ZJSL 3CLFL 3P11L 5A2IH 4L9LA 4TSBH 2D7TL 1I9IH 4GW4A 2HRPL 5GRUL 2PUQT 4GLRH 3CDCA 3I84A 5FYKH 1I3RB 3KJ6H 3RDTD 3IDNB 4D94A 1A3QA 3EYOA 1EFXA 3MRGB 5CGYD 1U41A 2AXGB 2CKBH 2IWGA 4YGAB 5IHUH 2IAMB 4JG0H 1F13A 1T3FA 2VLLA 4TUOA 4KDWA 3MLTA 3IDXH 4PBWD 2APTA 3MLXL 3A6BL 4C57C 1N5YL 1ZWIA 2NY5L 3T2NH 3LD8B 1LO4H 3A6OA 2AJUH 2BVQB 2P5EA 1P84K 5I1CH 2R1XA 3LQAL 4Q9QL 4YHPB 2PTUA 4TULL 2VL5A 2B1AL 2X2YA 2VUYA 3SGKC 4AEIH 4PP1D 1CR9L 2DWEA 5I1AB 4MJIA 1CWVA 1X4YA 3HE7A 3VI4E 3X12B 4S0SD 1TLKA 1U93B 1VKXB 1RUMH 1JJUA 1YNTB 1S5HA 1V7ML 3V0WL 2YPKA 2RJMA 2YUZA 2UUDK 2R2HB 5B38B 1KJ2B 1DBBH 3MYJB 4PJ9C 4MYWB 3AS3A 4QO1A 2EIDA 2OZ4H 4Z7VE 4MS8C 4W6YB 4KVNL 1W72B 2HFGH 2N7AA 3HAEG 1WZMA 4I77L 4U1LA 4UV4H 2EH8L 2Q86B 1PEZA 2P49B 5EBLA 5CHNB 5D5MF 4I1NB 5ESQA 5KJRL 1J87A 4TNVF 5D4QA 1IC1A 2WNGA 5BRZD 1HNGA 5K9OB 4GS7C 5D7JB 4PGEB 1S7XB 2VLKA 3RKDD 3QEQB 1UKQA 4DQOL 3QO1B 1B0RB 4JJHA 3D2UB 5KSBA 2FRGP 2K3TA 5IVZA 1MCBA 4KRPB 2P8PB 2YD3A 2WBWB 2PNDA 3SKMB 4YXLL 5HDBE 3STZA 2ADJB 5E8DL 2QR0A 5TDNB 1CDBA 3CC5B 4ENED 5DRXA 4Y4HB 4FXLA 1GZQA 3L3JA 3HCVA 4J1UB 3SE4C 4OD1H 2FDBP 3PWLB 2D0GA 1CFNB 3MNWA 3IFNH 2DTSA 3PQYE 1T1YA 4PP2B 3CSBA 4S1QH 1AGBB 4ZUWB 3T0EA 2VDKL 3MZTA 4NKQB 2XKSA 4JO2H 3VFMA 2R56H 4HS8H 4FFYL 4CVWA 1RUKL 3G5ZB 3SY0A 4CADA 2NY7H 3LS5H 2X70A 4CVZA 4JZJA 4LCWB 5CZKA 4E42A 3VMNA 1KG0B 2ITCA 1XMWA 5T1KA 3B2VH 2YD6A 4HIIB 4ZAKB 2MJWA 1KCSL 4ZFGL 4QRRE 4HFUL 4IRSC 4X98B 2VZOA 4X6DE 3DVNB 4XZUB 1HDMB 1TZGH 4M1CC 4XAWH 1F6AA 1YQVL 2KZ1B 1G7PB 1JUFB 2HFEA 1NFDB 3U0TB 2AABL 1YEGH 2W59A 2I07A 3FQNA 4OTXH 1H3WM 4QEGA 3LB6C 3QWRA 3RX8A 1E6JL 2IADA 3BZ4B 4XCCL 5C0ND 1MFAL 5B3JE 2GSIB 3FB8B 5INCB 1ZT7A 1BQSA 4JEGB 5ITBH 4U6XB 1JZ6A 3E2HB 1ZS8A 2WSKA 4UBDD 5KSAB 2FLRT 4IMKC 1SMOA 4LIQL 1XIWA 1DR9A 3BQUB 4ZOCA 1TZHB 5J11B 2WIIB 1A6AA 5ALCH 5EU3B 4XCYA 4M43L 4L3CA 1HCVA 4RRPA 1T4KA 2V2WB 4PLJC 5E5MB 1TVHB 1AO7D 3D3VE 3OR7B 2RBLA 4RISH 2HKHH 2P5EE 4DGIL 4M8QA 3HG1D 4WEBH 3OKEA 1AXSB 1KFAH 3MO1B 4TSAH 1LMKA 1I7UB 4UILH 3RVUD 3EZ8A 1U8JB 4FXKB 2H1PH 1G7LA 3D1MC 4R8WL 4X9BA 4QLRA 1ZHBB 2FBJH 4LFHD 4MJIE 1PSKH 1T89A 5KBNC 2EC8A 2WBJA 2HKFH 4LHUB 4ODVL 4MNHA 5JR1L 2VR5A 3CDFA 1I7ZB 3QDME 4OFPA 1DQML 1MWAB 4NP4H 1A47A 5SX4H 1CIDA 4XPHH 1OT1A 3O4LA 4IIQC 4UTBL 1CICA 4HK0A 5D1XD 4GFTB 4FA8A 4GMTL 4I5BA 1JRHH 4QRTB 4RFOH 2XZAL 1WWBX 2V9RA 5CKAA 4OZGB 1OCWL 4HH9B 2FECI 1LDSA 2J6EH 4PJEF 5HHMB 2DD8H 3E1F1 2HJLB 2AQ3A 5LAXA 1PAMA 3V4UL 5TGBA 1PZUB 5E8EA 4H20L 3TO4A 3I6KB 4DKDC 3IDGB 5KSBE 2XQBL 3C5ZB 4L8SB 1A7NH 4EUPH 2G75B 3AM8C 1F58H 3RWJA 1PLGH 2GTWA 3C5JA 5EWIH 1RU9L 4Z76B 1JMXA 4ZO9A 1XGQA 5DS8A 5IMKA 4L5FH 1R5WB 4LCYB 1BM3L 4HC1L 1GRWA 2ERJB 3JTTA 4PRNB 2CDGA 4LVNB 1UVQA 5IBLD 5GS0D 1QSEA 2VQ1B 1MLBA 3LDBC 3V6FA 4R2GC 1RD6A 4NHCL 3U30C 3VXOA 4MVBD 4I18C 2IC2A 4NYLA 1WZ1L 4WTZG 5I1EL 2VXVL 4HDIA 4PTTA 1BWWA 4ELMB 5HYJA 5I6XC 1D5BA 3QFDB 1LE9A 4M3JA 2CGRL 4D0CB 2NXYB 2H9GB 1BIIA 3T0EE 2KKQA 4NJAH 2X4TA 4WGWB 5K9KB 4JFFD 2FIRT 1NLBH 4O9HH 2Z91A 4YHOL 4MCYB 4FRWA 4XHJC 5F8QC 2Y1VA 3MBXH 1DDHB 2VLRD 4YPGA 3X17A 3TVMA 5DJCB 1FH5H 4JCLA 2UZIL 2D0FA 2BSRA 2LVCA 4OF6A 4ODXB 4N0YH 2GK0A 4YX2L 4JPIB 1D9KA 3RVXC 3OKNB 2R0LH 5HI5C 2L7JA 5FECB 5DHVA 4NFBA 3MCKB 4Y5XC 4BZ2L 4L29B 3HHRB 3QNYA 2A83A 4YBQD 3T0AA 1SMAA 4NNYA 5EU7E 1TMCB 5TQ2H 4ODWB 2OL3L 2DN7A 3D0VB 5FO7B 4EDWH 2HP4A 1TVBA 2PO6A 1NLDH 5AZEH 4JDTH 2DQDL 3F65A 5EBWA 2NY4D 4KROC 4Q6IA 3UPCA 1ETZA 3MGOA 4LEXL 1PGRB 3SDXB 4GKOA 3VFGL 1FCGA 3MNVA 2WV3A 4MAUH 5T33L 2HT2D 2XTJD 1TJIL 1NCWH 3EO1A 1URLA 4XCNA 4WO4A 3FQWB 5HGGS 3QHFL 1RMFL 3O2VL 4AG4H 5C09A 2XZQL 1T5WB 1DLFH 3MGTA 3KDMB 1KENL 1FSKB 3DI2B 2GK2A 1BFVL 3LVEA 3OAYH 5I1IH 1T7ZA 1FO0H 4FQLL 1RUAH 1K6QL 2GTZA 5TPWL 3RWCA 1G7QA 4KKAC 4P5MA 2FL5B 2ZUUA 3KS0J 5TF1H 5JDJA 1DLHA 1T80A 3F58H 3CFBB 3RBGA 1MJ7L 5A16A 2HT3C 2C3GA 1N5AB 2AK4D 3J8F7 4NN6B 5I1KL 1OP3H 4J4PA 4EVNB 4FFWD 3IGAA 3L3KB 3O4LE 3TJEH 2E27H 3QXDA 4YWGH 4LSVH 1KCRH 4JQXC 4CU7A 4WV1B 2EO9A 2B2XH 1G9ML 5CILH 5C1MB 3O9WD 5HDQH 2FH8A 2B1HH 5MHSE 5E94B 2FB4L 3OB8A 3E3QC 1RFDH 3DRQA 3QIBA 3ZDZF 3QUYD 2ATKA 3EO9L 1MHHB 5FDWB 3RWDB 3GBMH 5T1MA 1DBJH 1N7ML 4RA3A 2XKUA 5J9PA 2ZUQC 3Q0HA 5T3ZL 3MRPA 4F7PA 1I1AD 3TC9A 5FA3A 1UZ8A 3V5DB 1F4HA 1SBSL 2J7LA 2X10A 4RDQF 1FN4A 3T3PE 4OV6F 3PWPB 5FXCH 4S11A 3U46B 1RK0B 4XVTL 4MJ6B 3WD5H 2DDQH 1EEYA 4G6AD 2HG5A 4LLYB 2W0KA 4LP4A 2BSSB 3MUJA 1MVUB 3W9DA 2VDLL 3ZTJH 4G9FD 2ICWI 4HZLB 2P1YA 1BFOA 2I5YH 1PJ9A 4JHAH 1ES0A 1HWGB 4OZ4A 1FHGA 3LKOA 2OSLA 3SCMD 4AQ1B 1EZVX 5HYJE 3BZFA 5CIPH 1Q38A 2I9LB 4IMLB 1X7QB 3H3PH 2AJSL 4Z78B 3QXWA 4HGWB 3MRLA 2J5LC 4M62L 4RMVA 4X7DC 5GGSB 1T04B 2H32A 3VFVA 5F8RC 2ARJB 1BOYA 3LN5B 3QDGA 3FT2B 5JQHC 3O8XB 3FFDB 3ARDA 5E08H 5KW9H 1IAIL 1HKLL 1T7VA 4QHNA 1BAFL 3O6FD 2HMIC 4HCRH 3T1WA 1CG9A 4F57H 5LQBH 3L95A 3SGJA 5CFHA 1P2CB 3RUGB 3N85H 4WENB 2Q7NA 2DJUA 4EXKA 4ZOEA 1A7RL 4QWWC 4H1LH 3OJMB 3O6KH 2VDRL 4ETQA 3FTGA 4CMMA 1ORQA 4MA7L 3NPSC 4RSVA 1J0JA 3SKNA 1LEGA 1HHJA 4WW2F 1CXEA 5HYFA 1K8IA 3NCEB 4DKEL 3RTQC 1IKNA 3HE6A 4KJYB 3RGVC 2QQLL 3Q2CA 2EDRA 2CMRL 1LD9A 3GSXB 1AFVH 5E8PB 3KLDA 5SWZA 2YXFA 5IQ9A 2DLIA 1MCQA 4OQ1A 1FFNB 4ORGA 3BGFC 1UG9A 5F7WC 5KOMC 5J56B 3WXWH 2ZJSH 3CLFH 3P11H 4BH8B 3BP7B 2D7TH 2BNUA 2VDOH 2HRPH 5GRUH 3OZ9L 5HI3D 3LKQA 3VFSB 5C09E 3BDXA 2MNUA 3MBED 3QJFA 5LGJB 1HHGA 4OQTL 3DETC 3KPPA 5H35B 2JJWA 2PYFA 5DK0A 4K7PX 5I1JH 2BXYA 4YXHL 4P3WA 4RGMC 5JDSA 2CUMA 4DN3L 5BXFB 4H5SB 1LP9F 3MLXH 3QXTA 5CJ8A 3G6AA 3VXME 2MWCA 3V52H 4JM2B 5FYJE 4Z95L 3LQAH 2APXA 4TULH 4U1HA 4OD3L 4RX4D 3ZE1E 4HIEA 3AU1A 3PHQA 4YHKL 3CGTA 4NRXA 4DW2H 5K9JL 4NPYB 4KUCD 1I7RB 5KVEL 3OB0H 1HQRB 3MRFA 1INDL 1QQDB 4XGZA 4P4KC 4PD4J 4N0UE 1MRCL 1R3JB 4OUUA 3D9AL 1V7MH 1IGIL 3V0WH 3WYRA 4LASL 4G8IA 5F3BA 4EN3A 2C9AA 32C2B 1E28A 2V5TA 3EOBB 4KVNH 2PYED 3JWOL 4MQTB 4I77H 2EH8H 5IVOA 5B22A 3L5JA 5KJRH 3B4NA 3AREA 2OK0H 1U3HC 2JCCA 1Z9LA 2EDHA 1S7QB 4NC1C 1MAJA 1YDPA 3BE1H 5HDOA 4BH7A 4HUWB 3GKWH 3DTXB 2YPVL 4PJ5D 3PQYB 1FZOA 4YO0A 1OLLA 4PR5A 4D8PB 4A6YA 4NZTL 4WTZA 4JFPB 4GAJH 3SO5A 4XCEA 4R96A 1U2HA 2DIAA 1CL7I 1R3LB 2EO1A 4Z5RA 3SDCD 5DEGB 1P4LB 3KLSA 1S7TA 4TNVK 5DHYB 5IW1A 1HXYA 4KGLA 4D9LL 1IZJA 5D7LA 2FO1A 4YXLH 4Q9RL 3PP4L 3O3UN 4QRRB 5C6WH 4RNRB 5E8DH 5F70A 4PJAF 4X6DB 1MJUL 1KPRA 4ELKB 3FO9B 1YJDL 5I71C 5JOFB 4LGPB 3TO2A 3NIDF 1VA9A 1SHMA 3V79C 4Z7UF 3WFCL 4YR6A 3KPNA 3QI9B 3R8QA 1JGEB 2C4FU 4L9LB 4P57A 5SWSA 1WV7T 3TZVB 4GW4B 5I8OH 3NABH 3WNOA 1TVDA 4PFEA 1YPZE 3TF7C 2VDKH 3NA4A 4XXDA 5FHAH 4MJ4A 1P5UA 3RIAF 4EOWL 3EYOB 4QRQA 1P53A 3DV4B 4HXBL 1IAOA 1TIUA 2VLMD 3QG7L 1RUKH 1NDGA 2VLLB 4TUOB 2ESVD 4AENA 2J88L 3MRBB 3QR2A 5CAYB 3ZDYF 1BZQK 2HA1A 5M7QA 1LHZA 1XH3B 3D3VB 2FJHA 1KCSH 4ZFGH 3C8KB 2P5EB 4HFUH 2R1XB 5E70A 4WHTA 3MJ9L 4ZUVA 5SWZE 2VL5B 1KIPB 3TBTB 1YQVH 1R3HA 3AGVA 2R2BB 2Z4QB 2HRLA 2AABH 4QTIL 3IXTA 1I75A 1A3RH 2NXZD 3I50L 1UH4A 1WCBA 1MUJB 1C5CL 4HXAL 5E4IA 2F8OA 3V4VL 1S5HB 1T2QH 3NZHH 4XCCH 3QDMB 1QG3A 3CJJA 5E6IB 1MFAH 4XWOC 1XF3B 4M6ML 5DVMA 2V5MA 4CMHC 1Q0YL 4LSPH 1U95A 4TRPH 2EDQA 4JRYA 5EBLB 1UWEL 5CEXA 5ESQB 4M43H 5E9DA 5D96B 3ZKSD 4V2BA 4PLKD 3V7MA 1ZHKA 4JFDD 1J0HA 1U8MA 1JHLL 3UAJC 5IMOA 2AEPL 3REWA 4KQ3L 4QRSA 5EZJA 5EIVA 2Y5TB 2NX5A 3IDJB 3RNKA 3ARZA 4JY4A 4UNTA 2HLFD 1HSBA 5KSBB 1C16A 1HHHB 5IVZB 4NM4L 5E6YA 2DQCL 3EHBD 3QUMA 5DSCA 4N5ED 4W68A 3EBAA 1MNUH 5F9WB 5D9SB 1DQMH 3KXFA 5KAQG 1OSPL 3BUYA 1S9WA 4Y1AE 2QR0B 3NAAL 1PYWA 5F7FA 1VACA 1YC8A 4GMTH 2ZG2A 5DRXB 1NUDA 4U7SA 4X99A 3V6OA 3F7VA 4P5TC 1O5DT 1GZQB 2DBJA 3R8BB 1TTGA 3CSYA 4GRWE 2VL4A 1H3TA 1DCLA 4W6XB 1QD0A 3ALPA 3W11D 1IGYA 1MAML 3ZYIA 1T1YB 3T0EB 4HUMB 4NNPL 5JPMA 2YPLB 3V4UH 4S1RH 5HBBA 5D7KD 5J3HD 1MCWW 4IRJA 5FO8B 2PTVA 3H42H 1KSRA 4N0FA 1Q94A 1F42A 3JBG7 3LRSB 1WZKA 3SY0B 5JXEC 1HE7A 2ENSA 1I9JL 1QBLL 1UH3A 2X70B 2IF7A 1CE6A 1RU9H 5D7LE 4H8WC 3NCJL 4CGTA 3WFBL 2UZXB 5T1KB 3KPRD 4BQ9A 1YEFL 3HC4L 3QCUL 4YNYA 1AR1D 2EICA 4HC1H 1IAIM 2NY1C 4XT1C 2WANA 4LCCC 4YBHA 4KKLC 5DFTA 2R9HD 4XBEL 5MENA 4DKAA 5DMIL 3MROA 3OKYA 4M7ZB 5I1EH 2VXVH 2I07B 4WFEE 3FQNB 1K2DA 5SWSE 2VE6A 3OXRA 4I0PD 5ISZA 3C6LA 3DNKA 2GW5A 4P23A 2CGRH 2HLAB 5E0QA 4Z7VF 1S5IL 4OI7A 1BJ8A 2OMNA 1X5AA 1ZS8B 3DV6A 4F9PA 4C83B 3X13A 1XIWB 2O5ZL 4PJ7E 3QQ9C 2E6PA 1Y0LA 5DVNA 3QWQB 1EJOL 2UZIH 4L3CB 3HFML 3MV9A 1YY9C 1SJXA 2X41A 1A6ZA 2JE8A 2ZSVB 4U1IB 2XYCA 3RIFF 4PRPD 1BX2B 3KYAA 3WIHA 3Q6FA 3LEVL 3OKEB 4LMQE 3DECA 4BZ2H 5HGHB 3LEXA 1HQ4A 1LK3H 3QUXC 4L4TD 4OGYL 5JTWA 2ICEA 4V1DB 2R8SL 5L2JB 5JPNA 4ZYKB 4TSCL 2WBJB 4IJ3B 3CUPB 3DJ9A 4MNHB 4S1SL 2R1YB 5DD6A 2DQDH 2DWDA 1CICB 2X44D 1DUYA 4QTHB 3EYSL 1A1MA 1B4JL 2ADFL 3FCTB 3TN0C 3VFGH 3X3GL 2XPGA 3B8YA 4JREC 2IAMD 1MCJA 4JRYE 2BOCA 5T33H 5E9DE 1KXQE 1TJIH 3OF6D 5FOBA 2C1PA 4XH2B 3GJEA 1RMFH 1S8DA 3O2VH 3WNLA 3TH2T 2XZQH 2FEEL 3BRGC 4P9HC 1KENH 2F58L 3TBVA 4MNGA 2NX5E 5TGBB 1BFVH 2NTFA 3TO4B 3DGCR 4DFIA 2YA0A 3ISWA 4CKVX 3LQZA 4FQLH 1ND0A 1KULA 5TPWH 3VA6A 4WUUD 1MFEL 1EVTC 3RWJB 4MLIA 3JV5A 4Y5VC 2GTWB 4Y4KA 1F4WL 3QG6A 2L4OA 2V17H 1MJ7H 3FOMA 2UVFA 1ZT1A 5C0JA 2GKIA 2ED8A 3F7YB 5DS8B 5IMKB 4PJGA 5I1KH 3KXFE 2HFFA 5DEZA 3EDFA 1YN6A 5E2VL 3JTTB 2CDGB 4K55A 1MLBB 4KK6C 3VXOB 3V6OE 1CD1A 2FB4H 1YEDA 1PX4A 1JFQL 4HDIB 4Y5YA 1DVFA 2DQIL 5HYJB 1D5BB 3EO9H 4MA3A 2EZ0D 3VXRB 4Z77A 1LE9B 5B3JF 2VISA 1QZ1A 4UIMB 3T3ME 5C7XL 5IB4A 1BIIB 3QEQD 5DJZB 1N7MH 1M05A 5T3ZH 1GGBH 3QQNA 2Z91B 5IKCA 4Q2ZA 1SBSH 3EGSA 3TVMB 4KRPD 4HKZA 3GJFH 5B8CA 2Z31A 2ZUWA 3HZMA 3QULB 2NTSP 4EI5A 3WFHA 2XRAL 4LFHG 4ONOA 5CGTA 4XVTH 2P24A 1NDMA 3AAZA 5DHVB 5TH2A 1Z0NA 2VDLH 3BFOA 3BJ91 3QNYB 4XNQA 2A83B 2MCG1 4Y4HD 5MENE 5JOPD 4K71C 2X4PA 1AY1L 4NNYB 1JPSL 2XA8L 4OZFB 3NCBB 4P2RA 2UWEE 4XXCA 4HWBA 5AYUH 1D6EB 4D3CH 2Z8VC 1TVBB 1PEWA 2AJSH 2PO6B 1RURL 4HLZG 4MNQA 5L7XH 3P4NA 4HT1L 2DKUA 5FUZH 4M62H 4Q6IB 3ULUF 4W4NA 5DO2D 2PXYC 1ETZB 3MGOB 4WI3A 4PYHA 3DX6A 1E0OB 5JO5A 3MNVB 4U6TA 2XZCL 1MCOL 4LCWD 5IVNA 3G5XB 4X7SL 1HKLH 4JAMB 1ORSA 1VGEL 3MV9E 3EO1B 1BAFH 4XCNB 2QQNL 5ABDE 4S1DD 1H5BC 5C09B 4UINL 1X5JA 4ZAKD 5GSRA 4FZEL 1DANT 3GMRA 5MERA 3VGFA 1NUGA 2VDRH 5I66A 4BQ8A 3AS2A 4MA7H 2FX7L 2F53B 3WKNA 1MPAL 4I4WA 1DLHB 3BKMH 4F9LA 4XNXL 3VXMB 5C8JA 1J0IA 1NGWA 4DKEH 3HAEB 3S98A 3D39A 4HJJL 2QQLH 3IGAB 1MHPH 5IG7B 3QXDB 3N1PC 5KSAD 1ODAA 4GUPA 3DARA 3T4AB 1BVZA 1WFTA 3BQUD 2F5AH 3KJ4C 1JHKL 1U8QB 1OSZA 2ATKB 3GI8L 1SYVA 4KGJA 3BKYL 4N0UB 4X8JA 2PR4L 1XR8A 3IU4L 5T1MB 1CLOL 1BVKA 3PF2A 1QA9A 4OQTH 5J9PB 4MNGE 1OTSC 5I75C 2DM4A 3NTCH 3MRPB 3VWKC 1S7VA 5H94A 3UYOD 5GPRA 4YXHH 1UZ8B 2FHFA 4AT6A 4OM0L 5EZOL 4LHUD 4OFKA 3HPJB 5GS2D 4LPUA 3ROOA 1J1PL 2QKIA 4PJGE 1FLRL 1K3ZA 3RDTA 1EEYB 4FFVC 4Y4FD 5B3NA 5C0EA 2A1WL 5ECJE 1RQ5A 2JJTC 3W9DB 4YHKH 2YKLL 1M4KA 1HSAA 3LEYL 2AJYH 1BFOB 1WC7B 5K9JH 1ONQA 2FLBT 3DXAA 1R24B 2DKSA 5HHMD 3MUHL 4HUUA 2D7PA 2OSLB 4CDHA 2OXHA 1INDH 4RIRA 3BZFB 4YAQA 5AWNL 1MRCH 2WWKO 4ISVA 4ZDHA 1IGIH 3KPQB 1T83A 5FAAA 3SKJH 4DUXA 4LASH 3MRLB 4YXKH 4LOUD 2KQNA 3L3DA 1RZ7L 3VGAB 3MJ7A 2H32B 4G8FA 3VFVB 2XQYK 2F5BH 2WWKT 3VD4A 4KZDL 3C5ZD 3UEZA 5M95B 4LCIL 2CR6A 4Q7DA 2C1OA 5F6IB 4JKWA 3ARDB 4JRWA 3GMLB 4HJGA 4QHNB 3TBYB 2YPVH 1JE6A 1CG9B 1YPZB 3EYVA 4GKSA 4MD4B 3AB0C 4NZTH 2HTLD 4X9HA 3S4SG 1UM4L 3IAQA 3F6LA 1RZKH 4OT1L 5ICZA 5F88A 3JUYA 5C07A 4PJBA 4ODBD 3GEWB 1P7QA 1XAUA 2HJKA 5F21B 4IS6A 1ORQB 1JMZA 1JTTA 5TE6L 3WNPA 5BRZA 3NN8A 4PIRF 5F1SA 2OR8A 2EYSA 4D9LH 4P2RE 4GRLA 1LEGB 3MZGB 1HHJB 3ARFB 4Q9RH 3O41B 3PP4H 4RAVA 1K8IB 1DEEB 4MNQE 3H0TA 1KELL 4JVWA 1MJUH 3C60A 4TVPL 5IV2A 4MX7A 5SWZB 4BJLA 5IQ9B 4KPHH 5D93B 2H2SD 3NOIA 4M4PA 4NGHL 4OZHA 1YYML 3WFCH 4LP5A 35C8L 1P69B 2BNUB 1JV5A 2XOTA 5KSUA 1CDHA 1WBZA 3MRCA 5HGDB 3TJHC 5HGBB 3QUZB 4MDJA 4EOWH 1NMAH 4Y19A 1JYXA 4HXBH 2A74B 5C0BE 4JQVC 3F7QA 4GW5B 3T3PF 3PHSA 3C09B 2J88H 4L4VA 5HVGB 4YEEA 1EHLL 3EOAA 3QRGL 2X1OA 3ARBD 1AE6L 3WO4C 3D39E 4XP6L 2AW2A 4NQVA 4XVJL 4YDVA 3MJ9H 1QRNA 4HIEB 1PG7W 3PHQB 5IFJB 4NRXB 4KDVA 4Z0XB 4QTIH 3I50H 5HVWA 3PJSA 1C5CH 1A1OA 4HXAH 3OHXA 4OUUB 2BDNH 1AXTL 1I9RH 1H3UA 2ENYA 3ZE0E 4Y1AB 1Z0MA 4M6MH 4JN2A 3CCHA 5F3BB 5HXMA 1JWMA 1Q0YH 1H0DA 3U83A 1A02N 4OJFL 1MJJA 2MHAA 3AREB 5EU4A 2GY7B 4GRWB 4KY1L 4DEPC 4X5XB 5FCUL 1OOAA 4BH7B 2XV6B 5HPOA 4L8BB 5KOVC 4R4NC 4Z9KB 2AEPH 3W0WE 5DJ8A 2IGFH 4YO0B 4WWKA 1EH9A 4KHXL 4KKNA 2DQHL 5KTEH 4PR5B 4EQ2A 2FHCA 3ULVH 4XCEB 1CBVH 4R96B 4GS7B 4O2EB 4M7JL 4NM4H 3DXAE 4IHOA 1KACB 1F3JA 1HXYB 1FGNH 1AQDA 5D7LB 4P3CL 2CDFB 3C8DA 1Q8MA 4JKPL 1OSPH 1R5IA 5EC2A 4ZFFB 2ZCKL 1CLZL 1KPRB 3RQ3A 5IEHB 3NAAH 1KCLA 4HV8B 1RIVL 5FYKU 3MLSL 2E9WA 5T1DH 4U05A 3QHTC 2E7HA 2NY6B 1IT9L 4YR6B 3KPNB 3O3AA 3VE0A 2FZ3A 1ZLVK 5SWSB 5I0ZA 2NR6C 2CO7B 3ZTNL 5H8DA 1XGTA 3PWPD 5BZDA 3BUTA 1MAMH 2MQ3A 2HTKC 5A2LH 1YUHA 1DQJB 4NNPH 5J6GA 2UYLB 4Z8FL 2A38A 1CGTA 4QRQB 4AK1A 2VXQL 5DMGC 5C07E 4PJ7B 4PJBE 1NDGB 1DQQB 1GGYA 1WFNA 4AENB 1I9JH 1QBLH 1SYSA 2VZUA 2AQ2A 4QGTA 3NCJH 4P9ML 3WFBH 3QDAA 5F9OL 1LO0H 1YEFH 3HC4H 3QCUH 2FJHB 1D7FA 4O2CA 3T2QA 2OR9L 4OF0A 3ZE1F 3MJ6A 4WHTB 4F33A 2NZ9D 1FZJB 3WUZA 1OAYL 1N4XH 3HPLA 4O58L 3HMXA 4XBEH 1QFUH 2HJFA 3O8XD 4OZHE 4I2XE 1JGLL 1T5XB 3UBXG 4RQQB 3MRNA 3WJJA 4LRIC 4IRSB 2IMMA 3KPSB 3QFJB 3C2SA 3MCLL 4HIHB 4XI5D 4CU8A 5F44A 15C8L 5IFHH 1UENA 3JXAA 4I3RL 3FJTA 4Y19E 1FE8L 4XWGL 5ENWA 3IETB 1T20B 1ZHLA 2A6IB 4JRYB 3P4LA 5E9DB 1EJOH 1TCMA 4L4VE 1S9XB 1ZHKB 1WK0A 2KPNA 4N5UA 5D2LF 1XF2B 4GW1B 1U8MB 4HPYH 3T2OA 5CJQH 1JPTL 4XC1L 5IMOB 3REWB 3R06B 4RGOL 5J0BA 3GK8H 4QRSB 3LEVH 5EZJB 3WHXB 2NX5B 3UC0L 1JGVL 1DEDA 4K3EL 4R3SA 5EZIL 3ZLQC 1QRNE 4OGYH 3MUY1 3ZKNC 1C16B 1TQCC 1A0QL 2ZPKH 1M1SA 1VFMA 4TSCH 4D0DA 3NFNA 1A6TA 3QUMB 5C9JA 4S1SH 4K8RH 3FHAA 1G6RA 3OGCA 3VGHA 3KXFB 1P7KB 1MFCH 3MRKB 5EDXA 3RIFK 1S9WB 1DUZA 2JLLA 1YMHA 4X80L 3B9KC 2ZCHL 3EYSH 4N68A 4X7TB 1B4JH 2ADFH 3L3IA 2DQTL 4PV8B 3X3GH 3RZCC 1MIML 3TBWA 1A7OL 1D6VL 4X99B 4OFIA 4R97C 3S9DB 3H9SA 3JV4A 3CSYB 3S36L 5CEZE 1J10A 4OFDA 1L4IA 3GMNA 5B4MC 4KRNA 1IGYB 4JM2D 2QSCL 4YHNA 2ED9A 3GMMB 5JPMB 3BD5A 3O3DA 4XPTL 1QKZL 3O81A 5ESAA 1RK1A 5LWYH 4N0FB 1Q94B 4J6RL 3LMJL 1MFEH 2AVGA 1E27A 3PDGA 1L9NA 1F4WH 1BZ9A 1N2RA 5FO9A 3CVHA 1CE6B 2Y6SD 1WIPA 1V5JA 4AIXA 1IM3B 3D0LA 4YNYB 3ELAT 2W60A 5L2KE 5DC9B 1CE1L 3EYQD 4RMRA 5E2VH 3W82A 3LKPA 2CLRB 2HVKA 1N26A 4GAFB 3TCXA 1YN7A 1WT5A 2E7LA 3H2WA 3MROB 1T7YA 4HEME 1JFQH 3SDDA 3TNMB 1EEZA 1K2DB 1NBVH 2DQIH 1LO3L 4HJ0D 2UWEB 1LWRA 2YA1A 3B3IB 3S4SA 2APBA 2BRRH 1TCRB 2AK4A 4RBPH 2IH3A 3PQYD 5KZCB 5EOCJ 4R2GB 4APQD 3VI3E 3U30B 3SGDI 3O6ML 4I18B 3PWJA 4XTRD 3DV6B 1R3IL 4ZPVA 5F7LB 3X13B 3VJ6B 5HI4C 3BN3B 2ZCLL 4NFCA 2DMCA 4NC0B 4TUKL 2N4IA 3QIWC 3QUYA 4E5XA 1FC2D 3MV9B 4DK6A 1A6ZB 1MCEA 3TPUA 4QCIA 2XRAH 5IHBA 1RAMA 4CN4A 4QRRD 1WBXA 3IDUA 5EC1A 1CFVL 1JL8A 3BPOC 2C26A 3RKPA 4ZNEE 3T0DA 3BRFA 3MGAA 1I1AA 2GFBA 3NFSL 4PD4K 1MY7A 3FT4A 1T66C 4GAYB 1AY1H 5JPNB 3SBWA 3ULUL 1WFOA 2XA8H 3PXJA 5BQ7A 3TZVD 5F6HI 1M7DA 1NAMH 1A22B 4FQIL 5DRWB 5DFVC 1V3JA 4Y5XB 5C0AB 5DD6B 1J05A 4YC2C 3P4MB 1DUYB 4PJFA 2JCCF 4MA8H 4C56A 2C3WA 1IC5H 2OI9C 2BOCB 3IDYB 4LU5L 4X7SH 3ZYOA 3GJEB 4KROB 2QQNH 1S8DB 3GMPA 1CCZA 3D3VD 3MRMA 1KF9B 2P5ED 3UDWC 2XI9A 1U8HA 3TBVB 4KUZL 4WEMB 4CNIA 2NTFB 2ZUTA 4Q9CA 3LCYA 5BW7C 1VFBA 1PVHA 5LVEA 5FYLE 5IBTL 4ZXBA 4U0RC 2XN9A 4DVBA 4MJID 2FX7H 4JKLA 4WHCA 1U8OA 5L6YL 4XNXH 3S35H 1ZT1B 4JFOA 4UV7L 1QP1A 4PJGB 3QDMD 5EORL 5KN5B 2FECL 4HJJH 3SO3C 5E6ID 4UMGA 2HFFB 5CGYC 1LDPL 4EUPG 3QDHA 4JVUA 4XX1G 4QGYA 5J13B 5IM7A 1K4DA 2YR3A 5F89B 1CD1B 3RY6A 1OGTA 3H9SE 4FXGA 5FGSA 2EXYC 1T1XA 1YEDB 2DMBA 3GMOA 4Y5YB 1DVFB 3GI8H 4KK9D 4Z77B 4MA3B 2VISB 2PR4H 3IU4H 5IB4B 1CLOH 3DX8A 2IQAB 1H9VA 3P77A 4HQQH 4PGZA 4X6BA 3UZEA 4MWFA 3TP4A 5C08A 2V5YA 1E4XL 1UA6H 5GISH 4QHLA 5TDOB 3L5XL 5EZOH 5I76B 5B8CB 3VFOB 3EUUA 3HZMB 4EI5B 1B9ZA 5EU5A 1FLRH 5JIKA 3DO7A 1YEHL 4BUGA 1FFRA 4PJ8C 2VZSA 2ZUYA 3DIFA 3EJJX 4EI6B 3FQXA 2LU4A 2CJUL 2YHGA 2EYRA 4XNQB 3GNML 4OLXH 5MEOA 4R26L 3GSNA 3ARPA 5ACMA 1RZGB 3MMEA 2DM3A 3WBDA 1C5BL 3LIZL 5AWNH 3RKDC 1AGEA 1KC5L 1KN2H 3I02A 5GIRA 4HX1B 4MNQB 3T0ED 3P4NB 4F8TA 1RZ7H 3ILQD 4MA1C 3PIQA 3L3OA 4RX4A 1AHWA 3HKFA 5GGRY 2WUBL 4YHIA 3GMQA 5JA8B 1N64L 4P59L 2NY5C 3QP3A 4X5WB 4LNRA 1ORSB 3LQAC 1YEEL 2R2EB 3K4DA 4KDTC 4AM0A 2ZKHL 5T1KD 4PJHF 5GSRB 1F4YL 3GMRB 4GH7B 5MERB 1UM4H 4N1EA 5I8EA 5I18H 3SDYH 3L5WA 1FFPA 4OT1H 3UBXA 3CH1A 5C0BB 2GY5A 1IGML 3L7FA 5I66B 2XTLA 3Q5OA 3QXAA 3D18A 3QCTL 4I4WB 4A2LA 3QWRD 1DANU 5F1IA 1A6WL 1NGWB 3ARYA 3D39B 1NCBL 1KELH 1L7IL 4TVPH 1PQZA 5L9DL 3NPSB 4PJFE 1XIWD 2AV1B 4C56E 5I9QC 4JB9L 1YYMH 1I9EA 2EC9T 3T3MF 1OSZB 1SYVB 1M7XA 1P9MC 2FH6A 4X8JB 1OAUL 5J12C 4M6NL 1XR8B 4U3HA 1BVKB 3BGFB 2C7UB 2XXMB 1X3DA 5GGVL 1AKJA 5H94B 2DL2A 1JYWA 2GAZA 2LFGA 3IAPA 3QCVL 1X5GA 4OLVH 3VFWB 5CLWA 2XN9E 4AT6B 5I17A 5IW6A 2WBJD 4MXWL 1ZLWH 5C0NC 4JZNA 5EUKB 2RIKA 5TDPA 3VD9A 2X4UB 2QKIB 2VDNH 3QRGH 4JO4L 4PTUA 3W0WB 1AE6H 4OCLC 1CXHA 4UBDC 3WS6C 3O4LD 4XVJH 1CICD 5C0EB 4XB7A 1EVUA 5FM8A 5K59E 3H7BB 1IAII 4R4FL 1ZAGA 3PGFL 1KB5L 1U8LA 1UJ3A 1ONQB 5MHSD 3DXAB 4ODHL 1JK8A 2ESVA 4HUUB 3KPMA 1CGVA 1CFSA 3JTSA 3FT3B 4NHUB 1NC2B 4YAQB 4ISVB 1AC6A 1SBBA 1AXTH 3DWTA 3U82B 2DLFL 1OP5H 3ZTJG 4GLRI 3I3DA 3SDAA 1F97A 2FIKA 2GHWB 3RVUC 3AFLA 2DTMH 3TO4D 3MJ7B 5T3XE 3BDBA 5DR5H 4ZOBA 4JG1H 3RPKA 5JW5B 5JUEL 2R29L 5C08E 4P4KB 4O5LL 4PG2C 2C1OB 4KY1H 1D5ZA 1FFOB 5FCUH 4HJGB 3LN4A 1H15A 3GIVB 3GSWB 2APVA 2P8LA 3LSOA 1I3GL 4GKSB 5IROA 3TWCH 4KHXH 3WO3B 5D1XC 1R0AH 3U0WH 3MA9L 2GQHA 4FG6D 2CKNA 1NEZG 1U3HB 5IHZA 4HGMA 5ICZB 2CRIA 5F88B 2OQJA 5C07B 4PJBB 3X11A 4HMDA 1P7QB 3KS0H 3P9WB 4M7JH 2HJKB 3BYYA 4WU7B 1WITA 2R0KH 4PG9A 3NN8B 2WINA 5HYJD 1IAKA 5HVHC 4GRLB 4P3CH 1TDQA 1UACL 1F00I 1LQSR 4PRBA 2CLVA 1RZFL 2ZCKH 3H0TB 5BZWA 4YEFA 1CLZH 5DT1L 4MX7B 1RIVH 5DDHA 1OM3L 5BV7B 3DVFA 3MLSH 5FYKE 3F6IA 4Z7QE 4OZHB 1IT9H 4I2XB 1CDYA 3TVMD 4U1SA 4XP1L 1T0MA 1JV5B 3IKKA 4MQXD 2QSQA 3HI5L 2DI8A 3MJ8A 5KSUB 4WJ5A 3WV0A 1WBZB 3MRCB 5KS9F 1OQXA 5I71B 1FYTA 5HYIA 3WJLC 1BD2E 5IBLC 5HHNA 4AIZA 2VXQH 4Y19B 4MVBC 1A21A 3FHQA 4LF3A 2Z8WC 1FNGA 1VERA 1G84A 5KSVA 5DRZB 4L4VB 4PJGF 4X6FA 3WEXB 4IBLT 3VXQA 1MRDL 1OY3B 1I1FA 4AH2B 3EOAB 1UM5L 4F7TA 4P9MH 2F19H 3QEHA 1HI6A 2PO6D 5F9OH 5IT2L 5E8NA 2GIYA 3ZSSA 1P6AB 3GB7A 4YDVB 3ZL4H 3PWNA 4JRXB 4OZIF 3MODL 4TTDD 2C3VA 1QRNB 4OLYL 4O58H 3KHOA 3QQ4A 1WF5A 3NBNA 1S9YA 4S10A 5DEFB 3KNBA 1JGLH 3SJVA 5C0RL 1LEIA 3PJSB 4P2OA 1A1OB 2FR4A 2WP3O 1OB1B 4HAFA 4LVOC 5ADPL 5D2NC 3OHXB 5C09D 4OV5A 2J6EA 4Z7WA 4KI5F 3MCLH 3UXFA 4JN2B 4D9QE 1FVDB 5GGRB 1JWMB 4I3RH 1I3UA 4EKXA 6CGTA 3QPXL 4YBQC 2WP3T 1FE8H 5D71L 3OAZK 2MHAB 2GUOA 2K9UA 5IEKA 1BPVA 3VXMD 4LPXA 4XC1H 2BHZA 4CMHB 5FYJD 4EUPA 4U7MA 1JNJA 3D5OF 4WWKB 4J4PD 2WW8A 3UC0H 2XIDA 1GCFA 4K3EH 1AD0A 1CGSL 1QO3B 5EZIH 4F2MB 3H9HA 3JVGC 4XBPA 1A0QH 2XTJC 4D0BB 1ZXQA 5HHPA 1XGUA 4IHOB 1P6FA 4HFWB 1DSFL 3TT3L 5GRZA 5EN2A 1JNNL 2VXTL 2EDWA 4JO1L 4PRAB 2AXHA 4H25A 2JELH 1R5IB 4WFGE 5L2KB 2LAGB 3BJLA 1EEUA 4LNVA 2BXZA 4X80H 2ZCHH 2I9TA 2DQTH 2Y4SA 1MIMH 1D6VH 1E4KA 5D6DC 2VR9A 3VE0B 2FZ3B 1DTUA 3S36H 1Q1JL 1J1XL 3QAZC 1XGTB 1VHPA 3OGOE 2O5XH 1CL7L 5BZDB 4FFWC 1X9QA 2QSCH 4KRMB 1I3RA 4JY5H 3IDNA 1UB6A 3DROA 4P5TB 4KVCH 4U3XA 1IL1B 1WTGT 4DOHE 4X6EB 3O9WC 2BMKA 3GSOB 5KVMC 1WWCA 4J6RH 4NN7C 3UYPA 5LKNA 2X4OA 3LMJH 1WUNT 1FP5A 3VMPA 1SYSB 1F5WA 1QVOB 5F9JA 1S9VB 5FUCC 2BHUA 5ICXB 1MRFL 4O2CB 1UKSA 4YDKL 1MHCA 2BVQA 2IFGA 1CE1H 1GVIA 5SX4I 4F33B 2ZUXA 3GHEL 2EECA 4JN1L 1C08A 4NZDA 5I1AA 3TM6A 1OTUC 1OWRM 3ARDD 2EYTA 3X12A 1L6XA 2X42A 3DUUA 4U7KA 3MRNB 2H2PD 3ZE0F 1VKXA 1D5XB 4JO3H 4CVXB 1FYTE 2Z35B 1JZ8A 5B38A 1KJ2A 3MYJA 3O6MH 1EDQA 5BS0B 3V8OA 4ONFL 1W72A 5ENWB 4JFEB 2F8XC 5KAQF 4M7LH 4JFXB 2Q86A 1KBGL 1F3DH 1LO5B 1QOKA 1TNMA 2ZCLH 5CHNA 3SCMC 1BGXL 5D7JA 4OD2B 3U4EB 1FORL 4JR9L 3ARFD 3U9UA 3FRUA 1S7XA 2Y5EA 5ERWB 1UCBH 4OFYD 3HE6D 1G9MC 4M5ZL 5AD0A 4OI8A 1CFVH 4UQ2B 3QO1A 1B0RA 4R3SB 5SWZD 5AEAA 1CXLA 5JIHA 2WUCH 3D2UA 4FZ8L 5GJTL 4QOKE 4KQ4L 1HYRC 3ZYZA 2I26N 3ULUH 4F7CA 5J6HB 3SJVE 4H26B 5BVJA 5GHWL 4D0DB 3NFNB 3O6FC 1CLCA 2P8PA 5I1GL 4BSWB 4JGMA 4LPCA 4QKXB 1MH5A 5BMFL 1GC1L 4FQIH 3T77A 2YD5A 4W6WB 4Z7WE 3ZMRA 1EV2E 2ADJA 3QUXB 4UNUA 3VXUA 3R0NA 4G8EA 1YMHB 1OAXL 4A6YL 1WWAX 3S6CA 1U0QA 3TIEA 4J1UA 3JV4B 4HUNB 3MOBL 4LU5H 1MFBH 3PWLA 1JWSB 4KMTL 3P0YL 3GGWA 1T2JA 1NJ9B 2EDKA 3GMNB 1F8TL 1TETH 3RVVC 4JPKL 3NA9L 4XX1E 2QHRL 1W8OA 3AMKA 1AGBA 1FRGH 4JREB 1OLZA 3O3DB 4AMKH 1H3GA 5DK3A 5ESAB 1RK1B 5L0QB 1MQKL 5IBTH 5ETUB 5GS1C 2W0FB 1E27B 3RRQA 2JJSA 3MV11 3DVGA 1BJ1H 4UAOB 5HI3C 5SV4A 3O4OB 1A6PA 2O5YL 1GYAA 1KG0A 3MBEC 5EORH 1QYGL 5IFAL 4RMWA 2NMSA 4HIIA 4ZAKA 4Y1AD 2CUHA 2VO5A 2BP3A 3NCYS 3DVNA 5CP3H 4EN3D 3LKPB 3BAEL 4OZHF 4Y5VB 1YN7B 4NO3B 1MCKA 2FJFB 3IT8D 1J9CT 1NFDA 1TJGL 2X09A 1MCCA 1IFHH 3U0TA 2JK5A 3ARED 6FABL 3SDDB 1EEZB 1KLUB 1S7RA 1YYLL 3LKSA 4MS8D 4BK4A 1NEZA 3MLRL 2MQCA 3AS0A 4NO5A 2GSIA 5INCA 1KIRA 1ZLSH 12E8L 2IG2L 4HCRA 1RJCA 4FQPA 3OKMB 5JXAL 5T1LB 3BQUA 1KJVB 1Q9KB 2WIIA 2OJZL 3L5XH 5AAMA 2I25N 5DVKA 1T6VN 3K81A 2D7QA 3QYCA 4NOBA 3VGGA 2V2WA 5D7LD 4U2YA 4JHZA 4BZ1L 4QCIB 4U1MB 5DJ2A 1YEHH 5DJ6A 2XG4A 2MMXA 1OW0A 4E41A 1WBXB 5F3HA 5EC1B 2VJXA 5HHVH 3MO1A 3G5YA 3I75B 5DYOA 4B41A 2EH7L 4HKXA 2GT9B 2GFBB 3FT4B 4F37K 3BO8B 4R26H 5D7IB 3VWJA 2NY6D 5DWUL 2P48B 4OCWL 2YRZA 4WFED 5JQ6L 5SWSD 3NFPA 1C5BH 4RWYL 5DLML 1M7DB 3U1SL 1FL5A 3MOAL 1QEWA 1KC5H 5ACZA 4K71B 4HD9A 4PJFB 3SDCC 4C56B 2E9IA 4OZGA 4MD5B 1N64H 4P59H 4I3SL 5DJDA 1CFBA 4DVRL 3KYOA 3FFCA 1YEEH 1BFTA 2IALA 2RB8A 2ZKHH 3GMPB 2EDYA 1F4YH 3VH8G 3X14A 4FQXC 3X3FL 3RHWK 3KYKH 1VFBB 1NANI 4ZXBB 3C5ZA 2G75A 4DVBB 3EW3B 3TT1L 2VKWA 3QCTH 1H5BB 3H3KA 3IFOB 4LSUH 4IRSD 4Z76A 5LGHL 2PW2A 1A6WH 1B2WL 2AJVL 1C12B 3JWOC 1R5WA 1WIOA 1IEAA 2QADB 1NCBH 3KYNA 1L7IH 3VXUE 5D72H 3TA3A 1UJTA 5L9DH 2WZPD 1KPUA 4JRYD 1OGTB 4FXGB 4TYUA 1T1XB 5JORB 5E9DD 4ELMA 3FZUD 4BZYA 1TQBC 3QFDA 1OAUH 1C7TA 4M6NH 1NGQL 1XEDA 3DX8B 4NJ9L 3THML 4WY7H 1ZVSB 2COQA 5E2WH 2NX5D 3S35X 1HKFA 4X6BB 4ZSOA 1VENA 2VLJA 5EOTB 3KJ4B 3OMZA 2Q6WA 4MCYA 2CXKA 3QCVH 5C08B 4OCYL 4PLJD 4QHLB 4X0KA 1DDHA 2ORBL 1NKOA 2V9QA 3EKCA 2PW1B 3NIFE 4LDLB 2B4CL 4MXWH 4ODXA 5I75B 3GFUA 4JO4H 5EU5B 4JPIA 1YJDC 3DO7B 3KXFD 4MB5A 4OUOA 1K8DA 5FECA 2QSVA 3DIFB 1O7SA 1X5ZA 4S0TD 3FQXB 3FQRA 1UFUA 3BP4A 1CFTA 1MY5A 4L29A 4R4FH 3SE3C 3MA7A 1KB5H 2B5IC 1NFDE 3GSNB 4PLKC 4ODHH 4JQIH 1CK0H 3F12A 2A6DB 4ODWA 3DLQR 3MV7E 3D0VA 5IWLA 4DJMA 5GIRB 5I8CA 4H8WH 5ELIA 1FV1A 3B9VA 3NVQA 3L3OB 3PIQB 3WIHL 1AHWB 4IRJD 2XWJA 5HYSG 1A1NA 5JUEH 2R29H 2XFXA 4YHIB 5D1QA 2J8UA 4O5LH 3EHBC 4KWUA 4YGVA 4N5EC 5C92A 1FL3B 2CKBB 4LNRB 1GGIH 1CXIA 3FQWA 4XPAL 1I3GH 4HIXL 1T5WA 1CVRA 2IMNA 2QHLA 1BD2B 4E41E 3DGGB 4MCZA 3MA9H 1JZ3A 1X5XA 1NMCC 3L5WB 3UBXB 3CH1B 3ZT6A 5MEND 3L7FB 3QXUA 1MCNA 4NCC1 4OCXL 2FL5A 3QXAB 2DL9A 5FFLA 1TZIA 3QBTB 1BBJA 3P2TA 4MMZC 3W11C 3CFBA 4NO2B 5F1IB 3AB0B 1UACH 1PFCA 4R7NA 5KZCD 2CSPA 4R2GD 1NCCH 5J3HC 4EVNA 2FATL 1KLGA 5DT1H 3PP3H 1OM3H 4WV1A 5HPMB 3O2WL 3BH8A 3MRJA 5F7HA 5E94A 2YN5A 2CK0L 1MOEA 4LPWA 4R7DA 3MV9D 3HI5H 3FFCE 4WU5B 1MHHA 1AR1C 3DMMA 3RWDA 5EOCL 4U6VL 4LSQL 4XHJD 1MFNA 4BSVA 4Z7OE 1BQLL 4K94C 3VFTA 2R9HC 3OX8A 3MSPA 1AKJB 4Y2DA 1IQDB 2EC9U 2HN7A 2BNRA 5IP4A 4QXUL 1CT8B 1YNKL 5FHBH 3RJDA 5J4MA 2V5RA 1EHAA 4I0PC 4UDTB 4HGKC 5ITFA 5IW6B 1MRDH 3GUTA 3O2DA 4JZNB 3VD7A 1UM5H 3H7LA 2CRZA 4PTUB 5IT2H 4PGBB 4JM4L 1U58B 4LLYA 5KVGH 3K80A 3O6LL 3MODH 5JLZA 3W81A 4LRNL 2ZOKB 3QQ3A 4HZLA 4ODTH 2BY0A 4DUWA 4R0LC 1NGZB 3G6JE 4J3XA 3KPMB 5C0RH 4XB8A 4XNZC 3WO4B 5ADPH 5K33A 4KROD 3LPWA 4NQCB 1Q9OA 1T03L 2FIKB 3D25B 4XPFL 1FIGH 4M5YH 4ZSOE 1T04A 2R15A 2VLJE 3QPXH 3INUL 5D71H 2ARJA 3LKNA 5I74C 1S7SA 2Z0BA 2AKRA 2LU7A 2D9QB 3FFDA 4Y4KD 4YJZL 1D5ZB 3P0VL 1ZLUH 3I6GA 1IEBA 2VZ1A 5IW3A 2W92A 4HWBL 3GSQB 3ZT7A 2EKJA 1ZOXA 2N7BA 5IJKC 1P2CA 3RUGA 5IGXH 4DOHB 1UC6A 5C0DB 1CGSH 3UZVB 5D8JH 4DEPB 3TH4T 2P5WA 3F7PC 1ZTXL 4HC1A 2AI0L 1VPOL 1DSFH 4FQCL 1XGPB 1DVFD 3GI9L 3TT3H 2BFVL 1IBGL 1IAKB 3NZ8B 4KK5D 2VXTH 2JB5H 4PRBB 2DI7A 2CLVB 3VRLE 3GIZL 4P2QA 5BZWB 2JIXA 3RVWC 3GSXA 5E8PA 2Y25A 4Y16C 3BP6B 4LSSL 5DDHB 1FFNA 5I73C 3I6LE 2J8UE 5IJVA 4BH8A 3BP7A 5E2JA 1T0MB 1Q1JH 1J1XH 2Z31D 3ARGC 4TPRL 2P46B 3MJ8B 1CL7H 2OTWB 3BWUC 3IRPX 4WJ5B 4XMLL 4EI5D 1BIHA 4HIJA 1INEL 1HINL 3ZT5A 2YA2A 4RGNE 5HHNB 4H0IA 4KJWC 4LARH 4LF3B 1YECL 5GGQL 1YZZA 3SGEI 1F6LL 2EZ0C 1U8PB 2Q3AA 5JW4Q 5CLTA 3VXQB 1FNSL 1I1FB 4P2RD 3UTPE 4ZUSB 4F7TB 2EDFA 4PJIA 4JM2A 1HI6B 3B5GA 4YDKH 4K23L 4MNQD 5E8NB 4AEEA 3H6JA 4UB0L 4HPOL 3PWNB 3U4BL 1Z3GL 4HWUA 4P4RA 2C3VB 4JN1H 3FQTA 4QOKB 2GEEA 3RL2B 1AGCB 3IF1A 1S9YB 4KRPC 3HS0B 3LQMA 2Y9RT 3SJVB 5I15L 4XMKH 1LEIB 3PHOA 1HWHB 2VC2L 5DMYA 2FR4B 1A7QL 3VH8A 1QQDA 1R3JA 5CUSL 4OV5B 4Z7WB 1XZ0B 4CVUA 4Y4HC 1IAMA 4MZ2A 3RI5K 4GG8A 4AYFA 5C0BD 2BNRE 4G8GE 2M26A 1KBGH 3U9PL 1CN4A 1CD9B 5IEKB 1N6QL 1BGXH 4NKOB 3DTXA 3J7HA 5JHDA 1FORH 3IXAB 4EUPB 5FKPA 3QRFM 5FGRA 2W9LA 3QNZA 3RAJH 3D39D 5DO2C 5KANG 4URTB 4QWWD 4M5ZH 3P73B 3QDJA 3GRWH 4MJ5A 5CJXC 3OG6B 4FZ8H 5GJTH 4KQ4H 1G0XA 3BPLC 4BYHA 5D70L 4YDIL 5HHPB 1P4LA 1XGUB 3I2CL 4XAKE 2LQRA 3T0VA 1OAKH 1K9TA 1OP9A 1UWXK 5EN2B 1Y18A 3UPAA 5I1GH 4FQJH 4GQ9L 5BMFH 3HLAB 4KZEL 4H25B 1KXVC 4JFZL 3IDIB 4RNRA 3FO0H 4X6DA 5EBMA 3FO9A 4Z7QF 2I9TB 4A6YH 2ITDB 4KUCF 2C5DC 2HAZA 3ARUA 1F2XK 1ZVHA 4DN4L 1QBBA 3QI9A 1JGEA 4YQXL 3AS1A 5FGBC 3DOSA 4W4OA 4KMTH 5T5NF 3TZVA 3P0YH 1F8TH 3B9KB 3DETD 1BBDL 3QIUA 4JPKH 3W0WD 1RZIA 2D31A 3NA9H 3QWOB 3OJ2C 4OZFG 5HDLA 3E2HC 3GJFA 5KSAC 1UB6B 3DROB 1CZ8L 3MFFA 4H88L 3RUGE 5IMMA 3DV4A 5J11C 2BMKB 4MLSA 2DM7A 2P5WE 2X4OB 4NBXB 5BV7L 3DXAD 3LY6A 4B5EA 4XVUD 3MRBA 5F9JB 4PGCB 5GSVA 1HOCA 1YY8A 4HULB 1NC2D 1OHQA 1VFAA 1QYGH 1XH3A 5FYJU 5IFAH 3D3VA 3S36X 5HYSA 2R69L 4NWUL 1I8LA 2LU3A 1MHCB 1ZA6A 2RFXB 3C8KA 4IOFC 4M7LT 3P9MB 4P2QE 3GSVB 3PABA 2P43B 1KIPA 3EJYD 3OKKA 4F58L 3TBTA 5E00A 3WFZA 1C08B 1TJGH 4P4KD 2R2BA 2Z4QA 6FABH 1BHGA 4GBXA 2EYTB 1MUJA 3DUUB 2VXSL 3G9AB 2YUVA 3QHZL 4LPVA 1YYLH 2QTEA 3QDMA 3MLRH 4Y4FC 4WW2C 1I85A 5E6IA 5J57B 3EDKA 1XF3A 1MELA 1JZ7A 12E8H 5E1AA 4BFBD 3DX9A 5JXAH 1U3HD 5D1ZA 1HIML 5C07D 3VG9C 1P7QD 3STLA 3EDEA 3BD4A 2OJZH 1CTOA 3LS4L 2J8HA 4JLRB 2I60L 1FO0B 3HA0A 3MRDB 3PGDB 4GRLD 4LOUC 4PJIE 3FRUB 3U9UB 4ZPTB 5MP6L 1Q9LA 1GGCL 3BISA 4YHLL 1CFQB 5AD0B 3IVKA 3C60D 3WLWD 2Y5TA 4M6AA 3IDJA 1QBML 3CU1A 4AIOA 4L8SC 1BREA 1AI1L 1HHHA 3AVEA 3TYGL 2VN7A 1NCDL 4F7CB 1GIGL 4WI8A 5JQ6H 2IEPA 5BVJB 1UWGL 3U1SH 5J1TC 3MOAH 1MH5B 5CEZL 5DI8B 2EE6A 2XG5A 1G7HB 3BPOB 3T77B 2DMKA 3CFEA 4WHYG 5D9SA 3RPIA 1NH6A 2HTLC 2EDXA 3UJTL 4JE4B 2VXUL 3VXUB 3WL9A 4G8EB 1OAQH 1VEPA 5H2BA 4Y19D 3C9NA 4B7IA 2WBKA 1DL7H 4AEHL 4GKZA 4WDIB 3TIEB 4I3SH 3WIIH 4L4VD 5SWQA 4DVRH 4JFHE 5FV1L 2ARWA 3GGWB 5GJSL 5JHDE 2YZ8A 5TQ0L 1P4IL 5C0FA 3WNNA 1C5DB 1CDJA 2YPLA 2OI9B 5C6TL 3X3FH 3QDJE 1CI5A 5K93A 5M94B 5I16B 4MAYA 1QRND 5FO8A 4OIAA 5A2KH 5A43C 5FIEA 3S5LB 1XGYL 3BP5A 3LRSA 1MI5E 3TT1H 1A4KB 1W2KT 2NLJB 4HSQA 3DVIA 3DVGB 5CZXD 3ECBB 5LGHH 1UM6L 1B2WH 4YK4C 5FKAA 5F7YC 1DFBL 5SX5K 3PV6A 5JNYB 1T1ZB 3UTSA 4N8VG 4LLVA 5CIPB 4ODUA 4K3HA 2OYPA 4U1GB 4FNLL 2VDPL 2JK5B 5TJWK 5T3ZE 1CLYL 3MV7B 5CEZD 1S7RB 1PW3A 3ARBC 3TNNB 2Q8BH 3N0PB 4BELD 3LKSB 1NGQH 1NEZB 4ZQKB 2HLAA 3O0RL 4WWKD 4X7FC 3THMH 4NO5B 4PJCB 1KIRB 1MSPA 1J1OH 1RVFL 4C83A 1EMTL 1IM9B 4XC3L 2Y72A 4KK8C 4TUJB 4OF3A 4OCYH 5CJOL 3HMXL 4Q0XL 5E2TL 3U7AA 3MLPA 3S3JA 4RDQG 2EEAA 4H1LB 1NAKL 2ZSVA 4U1IA 1FBIH 5DJ2B 3FAWA 3TCLA 2DQUH 5DJ6B 1BX2A 4XNYH 1D5MB 4E41B 3N1GC 5L2KD 5F3HB 5CBAA 1KTLA 1MAKA 3G5YB 1KIUA 5DYOB 5HGHA 2W91A 4HKXB 3BZEA 4JFYA 1TXKA 5GS0L 2D2OA 4V1DA 4PY7A 3VWJB 5L2JA 4ZYKA 2VZ3A 5FF6A 1QR1A 3HZKB 3N1QC 3RWIB 3NFPB 3CUPA 4LPTA 1G0YR 3WFEH 4PJ8B 3IFPA 1FL5B 1MHEA 3V0VB 1M7IA 1QEWB 5DXWA 1MREL 1GAFL 1Z6JT 2R1YA 1Y6KR 5ACZB 1QFWM 4P5TD 1J0ZA 3WIHH 2ZG3A 4QTHA 4KRLB 3FCTA 4X6CE 3W2DL 1V3KA 2Q1EA 4C59B 3OG4B 1FAIH 2M1KA 5DJDB 3UTQB 4NRYB 4RFNC 4YHZL 3HC3L 1BWMA 4XH2A 2R39A 3KYOB 3FFCB 3ALWA 2IALB 3WSQL 4HIXH 1Z9MA 1II4E 1G6RL 4NT6B 4U1NB 3X14B 2ATPA 1C8PA 4HUXB 3B5HA 3VD3A 5I2IA 4MHHG 3VFNA 4CBPA 7FABL 4OCXH 5ALBL 4OGZA 4KTYA 1CD8A 3PGCB 1NGPL 3L3HA 2PW2B 3F7YA 4U33A 1IEAB 4IRZH 1E4XI 2DQFA 5F7MC 2FATH 3KYNB 4DWHA 4W70A 4FTVA 2JB6B 3C2AL 3TA3B 3GO1L 3TBSB 1FVEA 3KLAA 2A73A 2V9TA 1KPUB 1WICA 3G6JB 1QNZH 4UU9B 5IQ7L 2CK0H 1W0VB 1I7TA 1U9KA 5GZND 3SKUD 3BWAA 1A2YB 4S2SA 3K2UL 3VXRA 3CVHL 3Q5YA 1RJLA 4UIMA 4F15C 2BERA 4LBEB 5DJZA 4U6VH 4LSQH 4Y88A 1EUUA 2NZ9C 2YPLE 3QQ9D 1PBYA 3LV3B 4ZSOB 3TPKA 2VLJB 3O8XC 1GHFL 2Q6WB 5FYLD 4B0MM 1YNKH 1NCUA 1JZ2A 5J12B 4X0KB 1RY7B 3JSSA 3IAGC 1ZV5A 5TE4L 3QULA 4XI5C 3QUXD 4OLUL 3UTSE 1K8DB 4JM4H 3FQRB 3O6LH 3BP4B 1CFTB 1HH6A 4LRNH 2ADGA 1QHPA 3MA7B 3H9SD 1NMBH 5DUPH 3BT2L 1IZKA 3F12B 1R6VA 4KC3B 4OZFA 1X6NA 2NY3B 2PKDA 5MEPA 4MD0B 4K3DL 2Y07H 2VAJA 3ABZA 1D6EA 1WWWX 2EIBA 3GSUB 5CMAB 1T03H 5I8CB 5EB9A 2OJEA 4KHTH 1FV1B 1H3XA 3UO1H 3INUH 1NUFA 2XWJB 1A1NB 5CEYB 3RWFA 4OSUL 2XFXB 1MVFA 4XP4H 5D1QB 2J8UB 4K7PL 4G80B 1EGJL 4YGVB 1EXUB 1RI8A 4WNQB 2I24N 1BP3B 5EO9A 3HG1B 3P0VH 3G5XA 4JAMA 2ICCA 4J3OC 2B20A 4NKMA 4WI5A 5CINL 1UQSB 5DD0H 5C0IB 4YDLC 3S3SA 4XPGL 5IMLA 3HI1B 4MCZB 3G04A 4RGNB 1Z2KA 3FRPG 5HHXH 5FK9B 1TITA 2AJXH 4NN5B 3K7UA 4CL7A 1SEQL 1LO2L 3SE9L 4V1DE 4OGAD 1ZTXH 2A0LD 2F53A 1VPOH 1TZIB 4FQCH 3SDDD 1BBJB 1BQHG 3GI9H 2AS5M 2BFVH 5D1XB 3ZKMC 1CDUA 2EDBA 4Z6AT 1T1WB 3VXMA 3W5NA 1N0LA 4R7NB 3HAEA 3GIZH 1KLGB 4NRZB 5IG7A 5DJAB 2PN5A 4IDJL 5DJXA 1YNLL 3T4AA 5HJ3B 2X1PA 2XWTA 4BK5A 2QBWA 3BH8B 3MRJB 1H8SA 2YC1B 1DN0A 2Y6SC 3MRHA 1U8QA 5DJYB 4R7DB 4LSDA 4N0UA 4XMLH 4OAWB 3DMMB 1INEH 1A9BA 3EYQC 1OD7A 4Y16A 4FQHB 4BSVB 1SVCP 3VFTB 3OX8B 3JUZA 4Y2DB 2OM5A 2HN7B 2BNRB 4G8GB 4WCYL 4M00A 1MF2H 3U2SB 3NIFF 5DUMH 5CD3A 5EIIA 1AP2A 1A6UH 4HJ0C 5ITFB 2XKNA 4C54A 3GUTB 1QACA 3HPJA 3F5WA 2YWYA 2VWEE 1EJ6A 4APQC 5E2UH 3MLWL 1NKRA 3NIGF 3QPQD 4K23H 5CGMA 4XTRC 5EUOB 4HPOH 4FTVE 1VGKB 1NFDF 5JLZB 1U91B 3QQ3B 4C56D 1WC7A 4XCFL 3OBAA 3HC0A 5T3XL 3OKOA 3S7GA 1UADC 2DB8A 1R24A 4ZD3H 4JFFB 2VC2H 5F7EH 5DMJB 1A7QH 4XP5L 2JTDA 3VXRE 5K9QG 2AAVA 5CUSH 3KPQA 2P8MB 1JTPA 1IC4L 1JHTA 1Q9OB 1FZKA 4G42B 4WI4A 3UTTE 1KN4H 4ZXBD 1CDIA 3LKNB 4L9LC 1S7SB 2Z8SA 1WBYB 3U9PH 5D2NB 1VCAA 2AKRB 2XN9D 2OMBA 1N6QH 1AXIB 4WI9A 3GSNL 1JZ4A 3GMLA 3ULVE 4N8VA 1GSMA 4E9LA 3I6GB 3TBYA 1IEBB 2DI9A 3V5HA 2NY0D 1YPZA 4QRPA 5DRNA 1I1CA 2QADD 3QH3B 3Q6GH 4MD4A 25C8H 4KXZI 3OKLB 3A6CH 5D70H 2P5WB 1KEGH 3I9GL 2WIMA 4YDIH 5FYKL 2V2XA 3I2CH 5CBEA 4R9HA 4M9PA 3ZO0A 4PB9L 5TF0A 2W07A 1SM3L 1ZEAL 3ARFA 3O41A 5IHUL 4OFYA 1DEEA 4P2QB 2FEDC 2JIXB 4WFFE 3SPVA 4OZGF 1ZA3A 3BESR 5T3XD 2MQ0A 5C08D 2YD1A 3HE7C 4YBLC 4U1KA 5IJVB 3AY4A 4UT6L 1TJHL 3RNQA 2F74B 3A67L 4I3GA 3CDYA 1BJMA 2VERN 2VDML 5I0DA 4IDLA 1BBDH 3G9VA 4Z7OF 5HGDA 4HIJB 4PRDA 3VW3L 5HGBA 3MRRB 3QUZA 2AEQL 1CZ8H 4H88H 3ULUC 2UUDH 4L8DB 1RUML 2A74A 3QAZB 4YHYC 1PY4A 3QB7C 5D96C 4GW5A 1SVZA 3V4PL 1M6OA 4F8QA 4KJQD 2F53E 3CVIL 4FFVD 4OCNC 3A6BH 3LAFA 2HFGL 2VN4A 1N5YH 4NBZB 4PJIB 1MCIA 2F54E 2NY5H 1HZHL 2R69H 4Q9QH 2AERT 3OQ3B 1NAMA 5DZNA 1CDCA 4R4BB 2RGSA 4P4RB 2B1AH 3FQTB 5IFJA 4UT7L 5FYKD 3P0GB 3IF1B 1XR9A 4Z0XA 4ELMF 1CR9H 3BYTA 3N1MC 3TH3T 2DICA 3PHOB 2VXSH 3VH8B 3QHZH 1ZSDA 1BOGB 1BD2D 1FG2A 3SGKA 1FLTX 4Y1AA 1XF1A 2LTQB 3MNZA 4GG8B 2IPTL 5JW4N 4KMLB 3MUGA 2BJML 1UH2A 3RL1A 3GSRB 3LS4H 1FJ1A 4J8RB 4X5XA 2M2DA 2I60H 4CW1A 1P1ZB 4PJ9A 1GXEA 1F02I 5KG9B 4L8BA 5JHDB 2JJVA 3T0EC 4G9FB 5FKPB 3QNZB 1G9EA 3OJVC 1GGCH 4DQOH 3QDJB 4OD1L 4MJ5B 1QBMH 1CU4L 1AI1H 3TYGH 4O2EA 2DM2A 1MI5B 1NCDH 4JZJC 1NBQA 1E4JA 5JHLL 1UWGH 1HHKB 3HRZB 1Y18B 3UYRL 2BK8A 2CDFA 3UJTH 3ESVF 2VXUH 4ZFFA 3V6ZA 1FVCA 3SDXF 4D9QD 3L3GA 3LS5L 2OLDA 5EBMB 5IEHA 1DQLL 1AKJD 2J8UF 1QBAA 3CDGB 1P4BL 4HV8A 3D69A 4M7ZC 2XY1A 4AEHH 3H8NA 3NCFB 5DTFA 1ZHNB 5IB2A 3OTTA 1S78C 2VR4A 5HY9A 4XAWL 5GJSH 3QIUB 1RZIB 2D31B 4N1HB 4QRPE 5TQ0H 1LGVA 2FYYA 1DQJA 2UYLA 3GJFB 3MCG1 3MFFB 4ETYA 1UXSB 1XIWC 4I8DA 3SE4A 5IMMB 4NQDA 4GXVL 1T7XA 4FFYH 1SY6A 1XGYH 4PJ7A 2NYYD 1DQQA 5BOPA 1N59A 3CMOL 5DVLA 4HAGA 5MEQA 5GSVB 1HOCB 1YY8B 1UM6H 1VFAB 3HR5B 3GZKA 1DFBH 5HYSB 4WFGD 3SDAD 5GS1B 1ZA6B 4LK4A 2P42B 3PABB 3OKKB 1FZJA 3MRIA 1FZMA 3FOLA 5E00B 2VAAB 5E4EB 4AEFA 4FNLH 1T89C 4IJ3C 1NGYA 4M4RA 1T5XA 2HKHL 4GBXB 3LOWA 4RQQA 2VKXA 2P45B 3HNTL 1G7MB 2ZWLT 4MHHI 1E6JH 4IRSA 3CX2A 3KPSA 3PL6C 3QFJA 2IPUG 3FRPA 1KJMA 3O0RH 1CICC 4HIHA 4YZFE 3CFCL 3RX7A 2E7BA 5E1AB 3DX9B 1EMTH 5D1ZB 4LIQH 3IETA 1BQHA 4X6CB 3EOYG 1T20A 1XGRA 2A6IA 3STLB 4XNUL 4NNXA 4NP4L 5E2TH 3SQOL 1JI1A 2XWBB 2EDLA 1S9XA 2AP2A 3ZSTA 1XF2A 4GW1A 4RAUA 4RFOL 4PJAA 1U8KB 4GKNB 1Q9LB 4IMKA 3R06A 2X9XA 4DGIH 3TO4C 3IVKB 2J6EL 2A6KA 3WHXA 3T4YA 2DD8L 4PREA 2BVTA 3EZJB 4JDZB 1JYNA 4Z7UA 2CIKA 3C8HA 3V2AR 5GS0H 1U2CA 1D5IL 4K94L 4R8WH 3SGDH 3MLZL 3T8XB 1LNUA 3CFIC 4ODVH 1UT9A 5JR1H 3RWEB 3PG2A 1GAFH 3CFEB 3RPIB 1FYTD 3GBLA 1P7KA 4FG6C 3MRKA 1PLGL 4UTBH 3WL9B 1ZE3C 4POUB 4P48A 5EWIL 3B9EA 5H2BB 3IKCA 3OKDB 4X7TA 3C9NB 4PV8A 2W38A 2XZAH 3W2DH 3FB6B 1OCWH 5IR1A 4GKZB 2QSTA 4HH8A 4CRPA 3S97C 2DBLL 2HTKD 3N1FC 3CFDA 3MX0A 3EYUL 3HC3H 5SWQB 1FNHA 4P99A 4OLZL 4IIQA 3BIKA 3WSQH 3RUGF 3EJZD 4XMPL 5DMGD 5C0FB 5DC0A 1G6RH 3H9ZA 3SDCB 1FAKT 3GMMA 3VXNB 2VRAA 2YUXA 4MAYB 3LKRB 1MJ8L 4H20H 3ARQA 4QOKD 2XQBH 4G6FD 4LVHC 3BP5B 1RPQA 4GAGL 3TVMC 3JZ7A 5ALBH 1KT2A 4GQPH 4MQXC 3SJVD 3FO2A 5EO0A 4DZBA 1RHHB 4XPBL 2ZOLA 4P2OD 1NGPH 1D9KC 2P7TA 4O9HL 4FQXB 2BVPB 4LMQI 1IM3A 5DA0B 5FUOL 2R4SL 5FKAB 3PV6B 3UTSB 1BM3H 5DQJA 5ILTL 4LLVB 1NUNB 1Z9OA 1FH5L 4ODUB 3AM8A 4J12A 2CLRA 3GO1H 3NCMA 4NHCH 3VI4F 5HYQB 1WZ1H 3RWGB 1LEKB 3FMGL 3TNMA 2PO6C 2UWEA 3B3IA 3CVHH 2BNQA 1TCRA 3BPNC 1F11A 1G6VK 3ESUF 4Q6IC 1CDGA 1RIHL 1JPGA 4I18A 5DD3L 1GHFH 4QRUA 4YHOH 4NQDE 4QHKI 3VJ6A 4J3SA 1ZGLP 1I1YA 4JJ5A 4HLJA 2LV4A 5I1HL 4WO4C 2FGWL 4JM2F 1ZGLA 5TE4H 4JANA 4YX2H 2GITA 1A9EB 3TCLB 4MB4A 4LAQL 4OLUH 1I4FA 2FWOB 5CBAB 1KJ2L 43C9A 3FQUA 1KTLB 2H26A 4G7YL 1O0VA 5AG9A 4G43A 4LQFL 3BZEB 4IM8A 4JFYB 4WFHE 2PTTA 5DK2B 1W72L 1FIEA 4GAYA 4PY7B 3O3BB 4KKCD 3BT2H 1DLFL 5FF6B 1QR1B 2RCSL 2OL3H 5HDBF 3IFPB 4PJXA 1MHEB 5I1IL 3B9DA 3KPSE 4K3DH 1UEMA 1M7IB 1AC0A 3B9KD 3QFJE 4J4PC 5DRWA 3WN5C 4Y5XA 5C0AA 1T22B 4MXQD 5C0GB