4BQ8A

Crystal structure of the rgmb-neo1 complex form 3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
201
structure length
195
Chain Sequence
MMPPVGVQASILSHDTIRITWADNSLTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 195
sequence length 201
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq8A02
4UV7H 2LAAA 3UTSA 2R4SH 3EIFA 3RDTB 1LD9B 4PREB 5T1KD 3BWUC 1V3LA 3QQ9C 4XNYH 5B21A 3SDAA 4W81A 2ICWI 4PB9L 1YEJH 1MFBH 3JWNC 1H0DA 3VXMA 3BOVA 5TH2B 1KPRA 5D4QA 2IFGA 1OAKL 2X4RB 5K9JH 4HUVB 3QEUB 5GGSY 5ACLA 2Z91B 4HUUA 3STZB 1OGAA 3E2HB 4MX7A 4P23C 4F7TB 4BYHA 4PJXB 3RAJL 3SGDI 3P73B 4E41A 3VFPB 5A40E 2E6JA 1LE5B 5IFJB 4X98A 1V7NH 1JV5B 2FB4H 1O7SA 2RR3A 3C60B 1IAOA 4AMKL 4M1DH 3LQAH 4G43A 1OCWH 5JXED 3CCHA 3W81A 3OPZL 3T4AB 1BFOA 4GUPA 3UO1H 4POZC 3TCLB 3I50H 1K2DA 3I02A 2XICA 4L9LC 4GOSA 4PLKC 5IFAL 3RWIA 4I2XE 3QEHB 1KFAL 5J6HB 3IKKA 4IRJD 4OKDA 1B4RA 2W0LA 1MWAA 2L0DA 3P0YH 4RBPK 5IMLA 1UH3A 5JORB 2J1KA 4HEME 4MAYC 3NIGE 1IKNA 4Y5VC 3RL2A 4RAVB 5B38G 2H6PA 4R7DA 2C4XA 3WUWG 3ZKXC 1D6VH 4JDVB 5GSVA 5MEOA 3K1DA 2ID5A 3VCLA 1ZTXL 3CFBA 5FF6A 4PGJA 2BOCA 4XAKD 5D5MF 1F00I 2JB6A 2M1KA 2YPLD 1J10A 1RD6A 3QR2A 4N0RA 3KDMB 4CBPA 1NQBA 4MXVF 3WE6B 4LK4A 5ICZA 2WWMD 2XQYK 1J8HE 4M1CC 3L3OA 4RFOH 3ELAT 3D2UB 2PYFB 4G7VH 4J1UA 4M93C 1MY5A 1N8ZB 4LBEA 5IEHA 2VC2H 2LV4A 2CDGB 1ZGLM 2VR4A 1K9TA 5D70L 3FKUS 1FYTE 2FWOB 2OTWB 3KYMA 4OSUH 5IB1B 1I8LA 3KXFA 2EXWD 4JO1H 2CO6B 2QLVB 5FGRA 1FQ9C 4FQHA 4U1SB 2EDDA 2HLFD 2UWEE 4Q9BA 4QWWD 1S9WA 5DQ9A 1M1SA 1FBIH 2DRUA 2M26A 4NO5A 2ZUQC 3NA9L 3P0VH 3MRMA 1DL7L 2ED8A 4NIKB 1TZIA 1CTOA 4P4KC 4TULH 2Y5TB 2BRRL 4ZD3L 1DBBH 3NCJL 1SBSL 2HRPH 4OCMC 5HYIA 1DQLL 4FQCL 4JFFB 4NZTL 2BDNH 4K3HA 3G5ZA 4LOUD 1HI6B 1C5CL 3QUMB 4NZDA 4G42A 3ROLB 5KG9A 3B6SA 1IFHH 4L4VA 1AH1A 2CIKA 2AJXH 5LAXB 4MVBC 2IG2L 1S9XA 3D3VD 4WI4A 4MNHB 5E5RB 5SWZE 3ZKNC 5IVNA 4FFYL 2Q3ZA 2HT3C 2CKNA 2EDWA 5DD5H 1A1OB 4M7KH 3CSYB 3MRJA 3QIUA 4IS6A 3WNPA 1KJ2A 3DV4B 3G5XA 4LSQL 1CICA 5CBAB 2HJFB 1WBYB 1RIUH 5B4MC 3WLWD 5B3NA 4NO0A 3WJLC 2A83B 4BZ2L 1FZKA 2DL2A 3RU8H 1YPZF 1G7HB 2YUWA 4GW4B 4U6TA 4K3JH 1PLGL 3QQ9D 4XXDB 4M7JL 3L3GB 2ADFL 4FTVE 2VN7A 4PYGA 4IJ3B 4DKFL 1RFDH 4NQEB 4X5WB 3BMVA 4UB0H 5I9QB 4WI5A 3MBEB 4D9LH 5JHDE 3V6BR 3VXUB 4XP5H 4KKBC 4O5LL 3C5SB 2XI9A 5IQ7L 4GRMB 3DXAA 5DMYA 3QFJD 3GMMA 3D25A 3BE1L 1A6WL 2BX5A 1DDHB 3P77A 4D0BB 3PWLB 1S7SB 3N0PB 4PJ5E 3MJ9L 2P8MA 4FQPA 4UIMB 4ODBD 5D1QA 3TWCL 5GGTA 3GSUB 4MNGB 2DDQL 3QPQC 5GJSL 2XN9E 4N5EC 5HYEA 5KW9L 2JK5B 3M17A 1R0AL 5E2TL 1YC7A 1ITCA 3NZ8B 4PBVC 5B3JE 3C5ZA 3O2DH 1CDUA 4LIQE 3ARPA 4CMHB 3PL6C 1J5OH 3GIZL 1BFVH 2B20A 5E6ZA 5CCKH 1KXVC 4GRLA 3I85A 1GGYA 4G9FE 5TE4H 2AQ1A 4NQUA 5L2KB 1U8MB 4FQJL 5HI5D 1REIA 3TIEA 4Y4KD 2VLKA 3D87B 4U1IA 1ZLSL 3CUPA 4Y19A 1TJHH 3ARFA 3RVWD 4OZHB 4CVZA 4PRPE 4WTXA 4LLAA 3TFKC 2UUDH 4KDTA 4KZDL 1J9CT 4RAHA 4H5SA 5JHLH 1YEGL 2V7HB 2R29H 2R69H 5DQJA 1RZIB 4P9HC 1MI5B 1C5BH 5F3HB 2FX8L 5IW1B 1AXSA 5BXFB 4KRLB 4QXUL 1U8JB 1RURH 4LCYA 1YJDL 4APQC 1YEFL 3EO1B 1ULVA 1CLOL 3MTRA 4OF7A 2A9MH 1X5HA 4M1CD 1E6JL 1UWEL 3IU3A 4K8RL 5KOMC 4I18A 1P6FA 4IEFB 1A3LL 5A16A 4LMQI 5DURD 5F97E 5C9KA 3RFZC 4P9HH 1SJHB 5C3LD 1FH5L 2MHAB 4HK0B 4KK9C 5ALCL 2FHFA 2AI0L 3GRWH 1OSZA 4ODUA 2QV2A 5I8KH 2DOCA 1A4JA 4X99B 5DJ6A 1HIMH 4WFHD 2DMCA 1BBDL 4WHYG 1KTLB 1W72B 5EU4A 4K7PL 4PGEB 1JGUH 3SE3A 2ZCHH 3KYOA 4I77H 4NO3A 5HHXL 5H94A 4XZUA 3F7PC 1W0WA 4ZTPH 4FFWD 4DN4H 3C2AL 2GW5A 3DX6B 3L7FB 1NUDA 2ZUUA 5GGVY 3RBGA 4Z7WE 3S37H 4P4KD 2DWDA 5ESAA 3CDGA 3SDCB 2VLME 2FGWL 3C9NA 2ENSA 3GO1H 5EUOA 1WZMA 1MAKA 1GGBL 4LPCA 1ZK9A 3LOWA 3DURA 3QPXH 3RPKA 4YHNA 1ZT4A 5DMIL 1U58B 3WDHA 4Y1AA 1KB9J 4ODSH 1LP9E 2Y5EA 1FORH 3I3DA 4MVBD 3TVMA 4NT6A 2HKHH 4XVJH 2Z31D 2DTSA 2H32B 3ZKND 4NRZB 3RGVB 2PYED 1OARL 1QKZH 1Z0NA 4JM2F 3RI5K 5EFIB 3X13B 1KIPB 3OB0K 5F7UA 2WBJA 4DEPB 1WZKA 2I60L 4OUUB 1HOCB 3FT2A 3U7YH 2DLTA 1OWWA 5CZXC 5IBUG 4QHMB 3QUYD 5EPMA 5C0JB 3T0ED 2YRZA 5FYJE 5B4MD 3TV3H 1AGFA 3LS4L 3QISA 3BP7B 2A6JB 1TCRA 3FFCA 2EDLA 1LO3H 3RQ3A 1EGJL 4JO4H 1ED3A 1RUPH 1B0RA 4NFCA 1MFCH 4B7IA 3QUMH 5FO8A 4WHYH 5JA9A 4A6YA 1FCCA 5AUMB 4GG8B 5GGVH 4JM4H 5TDOB 4I5BA 3ETBF 2FIKA 4P5TC 3VD4A 2VTFA 1A9EB 3F58H 3RDTD 2R2BB 3QCTL 2HT2D 3MLZL 1F4WL 4N8VA 4TN9A 1BD2E 1MHHB 4UU9A 5B39A 4HWEH 2QSQA 4BH8A 5KVFH 4QOKA 1QO3A 3QPQD 4IRSB 4G8EB 4N5ED 2D0FA 1ZLWH 2R0ZL 1FLRL 4RQQB 4P59H 3IJSB 3Q48A 4A2LA 1HYSC 3Q6GL 5IMKA 3CH1B 5JLZA 4XNZB 2UY7A 4ZPVA 1PD6A 5KSVB 1K4CA 3DMMA 4HMCA 1D5BA 2XPGA 2VDRL 1IAIH 3VFSA 2VZ1A 3RWGA 2PTVA 3FB8A 3QDGD 2Z8RA 1EO7A 3C60D 4TSAH 3BYYA 4LSVH 1F2XK 3RVUD 5ICYB 1FFOA 4YDIL 4GXUM 3TFKD 4IOFC 2V7NB 5KVEH 5DLML 5C09B 4PR5B 4DCQA 4V2BA 3CLFH 3QNYB 3S88L 1H5BA 3A6BH 5K59F 4XP6H 1KUMA 3I75B 1LNUA 4DN3L 2NCMA 3MO1A 3B4NA 1UXWA 4X4YA 3C6LA 7FABL 5LGJA 1R3KA 5IKCA 3VXTA 3ES6A 5D7IE 5FB8A 3K74B 3O4OB 4HH9A 1Z5LB 1IGTA 5CZVL 5CD3A 1Y0LA 2P4AB 2W9DL 2XRAH 1A7OH 4MSWB 3L3KA 1FNEA 1T1WA 1JFQL 2A77H 1AXTL 3FMGH 3O6FA 5LBSH 2BK8A 4PJ8B 3B9KA 3O4LE 1BFTA 2CH8A 1GGCL 2CIIA 5FIEA 5F7EH 5DVLA 3EOAA 3HE7A 2MKLC 4KK9D 3VRJB 1VSCA 1DE4B 5FV2A 4PTUB 3VJ6B 4OI7A 4X4XA 1DANU 2I25N 3GBNH 1QFUL 4QYOB 3PWJB 1A1NA 1G6RL 2YC1B 2C1PA 2EE9A 3S3SA 5DMJB 1MHEA 1AO7A 3FT3B 3CVIH 4KY1L 3GSVB 1YMHB 3VW3H 1OL0A 5I74B 2YD3A 4HEPG 3MFFB 4M5ZL 5AZEH 1OAUH 1N5AA 4XAKE 3SJVA 2YPLE 2OR7A 3D39D 1C5DA 1HKLH 1NLDH 3LMJH 4XVTL 4M6OL 1JGLH 2J8UA 1EEZA 4X5XA 2AK1H 4PBWD 3WHE0 1X5ZA 2ZCKL 1ODAA 2XKSA 3C6SA 1U8KB 5TJWK 3Q6FA 4X80L 2OK0L 3ZDZE 3QDMA 1R24A 2ATPA 2HFTA 4AEEA 5E8OB 5EO9B 3CC5A 3NAAL 3PWPA 4OF0A 4R0LC 4AG4L 4HIEA 2CRMA 4JFFD 5I0DA 3FQTA 2QADB 1A6VL 4JAMB 5IIEB 4NUJB 4OCYH 3IDYC 5CZXD 4NKIH 5FOBB 1OM3L 5EWIL 1W72H 3C2SA 2MKWA 5DS8B 5J11C 1BIHA 1I1AB 4KRMB 2HAZA 3V7AG 4WWKC 3ROOB 5HYJB 5LVEA 3WNNA 1FZOA 4NN6B 5BV7C 4PJGB 1HK6A 4YUEL 5IJVA 2Z8VC 1LEGB 4GMSL 1YPZB 4RGOL 4LRIC 2AP2A 1A6PA 2OSLB 4FQ1L 4JHWH 2AJ3A 3EYOB 2CUIA 1KCVH 4O4YL 2R1XB 3EBAA 5L7XL 2DQDH 1LO2H 1ORSA 3SKOA 4P2QB 2LQRA 1F58H 5CJBA 1HSBB 5I1JH 5D7LB 5GHWH 3VG9B 2APBA 2H32H 3D3VE 4KMTH 3AFLA 3DECA 5E6IB 3I6GB 4LPWA 4HHAA 4NQED 4TSCH 4BFIA 3X11B 1KOAA 1QRNB 1A5FH 3MBED 5DRZA 1GH7A 4LSSL 4Z0XA 3HHRB 1JNNH 4Z9KB 3ULVL 3WNMA 3VXUD 5DJDB 3IJYA 3ZYIA 3IRZA 3PHOB 2AGJL 4YEFA 1HYSD 3MLTB 4MXWH 1KCSL 1P7QB 3L5XL 2EDJA 2F54A 4EDWH 2D4FA 3PIQA 3EAKA 3TEUA 4ZAKA 1T7ZA 4XP1L 3NABH 4WHTA 3BKJH 3FOMB 3ULUF 1WZ1L 1WC7B 1ETZB 1S78D 5D2NC 5CKAA 4XBGA 3I6KB 3EYVB 1JPFB 2VXVH 5EO1A 4WU7B 5C6TH 2VISA 3ARDA 5E4IA 4R96A 1KJ3L 5I66A 4EJ1C 4X7EC 3CJJA 4YHIA 3VFWA 3QFJE 2DIJA 4TNVF 3MODH 3DGCR 4YAQA 4NKQB 4XNZC 4QRUA 1A7BA 5F96H 1CFBA 3W9EA 2DQUL 2BXYA 4XB8A 5L2KD 3JWDC 1U95B 3NN8A 2EDEA 1GC1L 3ECBB 4HXAL 1IJ9A 1P7HL 3CXHJ 2BHUA 5SX4I 1IGMH 4YWGL 2AXGB 3OL2A 4LCCC 5H8DA 3HC0B 3DUSA 3JWOC 2NXYC 1QFOA 2R4RL 1DVFA 1T66D 2O26U 5FO7A 1CQKA 5EZIH 3LKNA 5DUBB 2P5WB 2YPVH 3SE9H 3BP5A 4YNYA 2H26B 4TVPE 2YWZA 5ICXA 1L6XA 1ZWIA 3HI1A 4X7CC 1PG7X 4WUUB 1MI5D 1UWGH 4QXTB 3F5WB 3JWDH 1TVBA 4X6BA 2QHLA 2ZSWA 3BZ4B 5E2JA 5IV2B 3ZDYF 5CHNA 1KN4L 4CDGC 4LEXH 1XR8A 4HC1L 5IVXA 1MCLA 2EDFA 4Q6IC 4MD4B 1H3WM 1BHGA 3CFCL 2CMRH 4U0RB 2DLEA 2VABB 2VLJB 4Y2OA 3KPSB 5DD0L 3MJ7A 1KCRH 2IALA 3VWKC 1PG7H 1FGVH 4JPKH 4S10A 2CK0L 5HXMA 2QSVA 1F3JB 3AREB 2D7OA 3WO4B 1P84K 4XI5D 5CWSA 3NBNA 3MYJA 12E8L 1IQDB 1QFWM 5ABDE 4M9OA 1H3PL 1TTUA 4LRNH 1V05A 4OFIA 3OR7A 4JO2H 3D18A 2BSSA 2IQ9H 2H1PH 5EC1A 4S1DD 3OWEA 1R3HB 3M45A 4XAWL 4YDJA 2D31A 3RKDD 2GCYB 3KLAA 1JF6A 5DK3A 3SDCD 4CL7A 2CLVB 3SGDH 5DFVD 1H8OA 3MGOB 5HGBA 3A67H 5BVJB 4JM2B 2X4OA 3MA9L 1EVTC 4GAFB 4DZBB 4WFHE 5HJ3B 3U9UA 1FE8L 1GSMA 1PZ5B 5GIRB 5JXAH 2WSKA 5FYLH 1WIUA 1FNLA 1AFVH 1AP2A 2V9QA 3PDDA 3JTSB 1ORQA 1ZE3C 2DBLL 1QFWL 3LIZH 3RY4A 3X3FH 4UTAL 5F70A 4XPTH 2QADC 5ESVA 2JE8A 1KENL 5KN5B 2AKRA 3ARYA 1KCUL 4ZUVB 1B90A 1MIEH 1A3QA 1KNOB 5CIPA 2FIRT 5JW5A 4NN6C 2YPKA 1UYWL 3HKFA 3LB6C 3H9ZA 4O2EA 3QDAA 2MCG1 4GAJH 1OP3H 1BVZA 3VWJA 5EUOF 3DV6B 4OCWH 4WGVB 5DGQA 5KJRH 3LKRB 5D72H 2PYEE 2FEDC 1YYML 2F5BH 4EBQH 3EW3B 2B4CH 3BGMB 5E94B 3QG6B 3VRIA 4BSVB 3WIHH 3OF6D 1G7LB 3WNOA 1CXFA 4PS4L 3T0EE 2HFFB 4PJ7E 3VG9C 1WSST 1MFDH 4JN1L 1KIRB 4HJGB 3QUZB 4Z7UA 3RL1B 3VFUB 3W9DA 4HFWB 4UQ3B 1B6DA 3VFNA 3BZEB 4PRNB 2KPNA 5JPNA 4EI5A 4QY8A 4XCEB 4F7CB 5C2BL 4I3SH 3ZL4H 3HN3A 4JDTH 3GI8H 1FL5A 4L3CA 3QA3B 4MCYB 4CJ1A 1HN1A 4IRSD 3ARVA 5SX5K 2GSGA 3HI6L 3P11H 3QEQA 4HDIB 2Q86B 1JGDA 1RUML 4O02H 1FDLL 1EUTA 5E6YA 5IJVB 2C3GA 1UVQB 5DC4B 3F7RA 1IBGL 3UTSB 3OKEA 2WAHA 3ZT7A 1UEMA 1LO4H 1MF2L 4JFOA 3IYLW 3SDAB 1FO0A 3VRLE 3GB7A 4NBYB 4KU1A 4R4NC 3SGEI 1H0DB 2Q8BL 1JWSA 1KPRB 3NIFF 4POYA 1MRDL 4BZ1H 4XCCH 2NXYD 5DQDL 3X3GH 3QXDA 5C09D 1INDL 1Q0XH 2R8SL 3JTTA 3OJ2C 4HUUB 1BGXL 5K9QI 3LEYL 4YHLL 1OGAB 4MX7B 4ODWA 3VD9A 4QRRA 2R0KH 4PJXE 2IFFL 5F72S 2Y6SC 3UDWC 3VFVA 3EJZD 4HAGA 4S1SH 3ZTNL 4X98B 4X9IA 1IAOB 4G43B 3OQ3B 3CCHB 5JMOC 1CS6A 1BFOB 4Y16A 4FP8H 5EUKA 3SDDC 1K2DB 3I02B 4PJ8D 2JJVA 5TF1H 5E00A 1SM3L 4N0YH 4LU5H 1OGTA 5E7FA 3RWIB 2VDNH 5F1NA 3TGXA 3VWKD 4I48A 4PRBA 2WLYA 2BSRA 5JTWA 1MWAB 2DM3A 1PKQA 5GGQL 3UYRH 3LD8C 5IMLB 2C7UA 3RL2B 4FNLL 2DQGL 2R0WL 4NUGH 1IC4L 4F58H 4R7DB 2FBJH 3GMNA 5GSVB 5MEOB 1FAIL 1JN6A 4FZEH 1EPFA 5FYLD 1RIVL 3VCLB 4U0RC 3CFBB 5FF6B 2OR8A 4WCYH 3WSQL 2JB6B 3R4DA 3RY6C 3BH8A 3G04A 1XCQA 4PUBL 1E4WH 3E6HA 3AREC 5GJTL 4Q58C 4O2FA 1PQZA 2Y07L 1B2WL 1UKQA 4L8CA 5F71A 4NRXB 5IB5B 2LABA 3L3OB 3WKML 1ONQA 2XV6B 2D3VA 3RPIA 3NCFB 4LBEB 1JL8A 3RHWK 2IEPA 5IEHB 3ARGC 2LAGB 4JQIH 4IDJH 1K5NA 5L8JB 4RGNB 3UXFA 3KYMB 3SE8H 4WY7L 3T3MF 3DROA 4I3RH 2QADD 1MQKL 3KXFB 3MBXH 4JQVC 4K3EL 1RUAL 4FQHB 1IZJA 1I1AD 3ZHLA 3IFOA 5HYJD 3VFGH 5DQ9B 3UTOA 4HSQA 3MOBH 5EOCL 5IF0A 3WUZA 4NO5B 4RDQG 3V95A 3MRMB 3P2TA 1TZIB 3S4SA 5E2VH 2X70A 2GAZA 1I7ZA 3DYPA 5JMRA 1BQLL 2FEDD 3KLSA 2J8UF 4JFFE 1DBKL 3G5ZB 1HHHA 2ZG2A 4G42B 2HVJA 3B6SB 5KG9B 1J88A 4L4VB 1HNGA 3JBG7 4J3OC 4PRHD 1N0XL 2J6EH 4P2QD 4GMTL 5GS2H 2YSSA 4NP4L 5D7LD 3UPRA 2CR3A 1I85C 1S9XB 1B0GA 4UI2A 3CFIC 3P9LA 5E6ID 3BRDA 3MYZA 1QRND 4ZUSA 1IGIH 4FXGA 2BVQA 2ED9A 3MRJB 3QIUB 4IS6B 4JG0L 1CICB 1JGVL 5LGKA 3GUTB 2O5YH 3CAFA 4NO0B 2P42B 1FZKB 3FCTA 2EZ0C 3D5OF 2EE6A 1NCBH 3D6GA 2EYTA 1MCWM 1OSPL 5TPWL 3WYRA 3K0WA 2Q8AH 5A2FA 1MFAL 3BAEH 1S5HA 4KVCH 4R4ND 1UH2A 4NQEE 4AYFA 5L0QB 1NCWH 3GK8L 3LS5L 5EBWA 4JVPA 5FHBL 4LLQA 3VXUE 3DXAB 3LN5A 4K07A 4MA1B 3GMMB 1S7RA 5IP4A 3D25B 1JHLH 4LF3A 5INDA 4OD1H 3P77B 3BUYA 1T4KA 3TBYA 3FTGA 2HLAA 1H3UA 1BFSA 2NXZB 2P8MB 4X7DC 3V5HA 2OJZL 5D1QB 3MNWA 2Y6SD 4R3SA 3QXUA 4KQ4L 4MNGE 3H6JA 5ANMA 4M1GL 1CK0H 5I1EL 4ZO6A 4KZEH 5BO1L 4NFBA 4DW2L 2P5WD 3C5ZB 2W60A 4PB0L 2IAMC 4GW1A 3TYGH 4FQ2H 1SVZA 4LLYA 4GRLB 4F9LC 2ZNWA 2MPAL 5EU5B 4JB9H 1BVLA 5L2KE 4BUGA 1SQ2N 2VLKB 1OTTC 4U1IB 3UZEA 3CUPB 4Y19B 1AC6A 1J12A 3ARFB 5KANG 3VD7A 4FXKA 3TA3A 4CVZB 2Y36L 4OZHE 5D2LA 3X14A 1MCOL 1MCQA 1EHNA 2EEAA 1I9EA 4H5SB 4WDIA 2CRZA 3SGKC 3HE6C 3N1QC 4K94L 5DQJB 3OSKA 1VFUA 1MI5E 2Z4QA 1WITA 1CL7L 4YDLC 4HKXA 1AXSB 3WL9A 2NY2B 4LCYB 3TCXA 1C1EH 4UT7L 3ARED 5TGBA 1I4FA 4XCFL 4NJAH 5CLTA 5F9DC 2ZUSA 3VFMA 5I18L 2BFVH 2XY2A 1FGNL 1OAXH 2PETA 3CH8A 2NTFA 3IU3B 3ARUA 4KRPC 3DGGA 4WW1A 4HT1L 4MD0A 1IZKA 3U7WL 5A16B 3P4MA 4LARH 1IT9L 5IJKC 2JF1A 3TN0A 2AABH 1BJ1J 1V8HA 3UTQA 2X4TA 3S5LA 1WAAA 3GKZA 5TE7L 1ERNA 1OSZB 4JO3L 4JM2D 3EZJB 1A4JB 5IVXF 3UJTH 1TENA 5DJ6B 5EC2A 3I9GL 2RCSH 4YHKH 1UGNA 2VIRA 3KYOB 4NO3B 1NAKH 1Z2KA 2VJXA 5H94B 4XZUB 5GS2D 3HI5H 1W0WB 1YZZA 2P43B 4XC3L 1WCBA 1MCKA 2XZCL 4YBQD 2RQ8A 1KN2L 3T65A 4LVHC 2NTSP 3TZVA 5D6CA 4RGNC 4G7YH 2DWDB 5ESAB 4RWYH 3CDGB 4YPGA 2UV3A 5GRVL 2VAJA 2AJYH 1ZGLA 1GRWA 3AMKA 5EUOB 2RB8A 1G7QA 1CZ8H 1R3IL 4S1QH 3SKJL 1CGVA 4XGZB 4QHKJ 1DQMH 4GAGH 3DURB 3CK0H 3EYQD 4KKCC 4GLRI 1D5ZA 4XBPA 4YHNB 1ZT4B 1U8PA 4E9LA 4M6MH 1AHWA 2XTJB 3MACL 1AXIB 1KIUA 3TVMB 4NT6B 4R8WH 5C92A 1I1FA 3GSQA 1JP5A 3KLHD 5CJQH 3T2NH 1YNLL 3VFTA 4OGXH 2ORBH 2WBJB 5FUOH 1EXUB 3BEWA 3VXRA 3H7BA 3FT2B 3GJFK 4WW2A 5I1CL 1N0LA 4NC2B 5EPMB 5GGRB 4ERSH 4U1MA 3DX9B 1WEJL 1A9BA 1XIWB 2J4WL 2WUCH 3UYOD 1AGFB 4FQLL 3QUZD 4Z7NF 4OUOA 1TCRB 1NC4A 1QFPA 2X40A 3CGTA 4R26L 4R4FL 5BJTA 1MJUH 4WU5A 5FYKU 3EOYG 4V1DB 4DGVL 5IG7A 2UUDK 3REVA 2DI9A 4JHAL 5DHVA 4OCNC 4QT5A 3SE4A 2CUMA 5FO8B 1XGQA 2ZSVA 1J18A 3MV01 4A6YB 1AQKL 4L1HA 3V7AE 3DTXA 5JDJA 3MJ9A 3UTSD 3BP4A 5IB2A 2FIKB 3O81A 4Y5YC 2XACC 1T22A 1VCAA 4N8VB 5BOPA 4FQIL 3HRZA 4G5ZL 2UZIH 4UU9B 5B39B 1XF5A 4FN0A 4BH8B 3H3PL 5IEKA 4QOKB 3PP4L 1QO3B 3WHXA 4KGJA 1YEEL 2EDRA 3RGHA 2NNAA 2ENYA 4OLZH 3QG7H 3QO0A 4UTBH 4CADA 4Z7UF 5IW6A 2IAMD 2B8OT 5IMKB 3HG1A 3OKLB 5DXWA 5JLZB 2VNCA 2HJKB 2NXZC 3MLXL 4YBHA 4ZPVB 3T09A 1K4CB 3DMMB 5IM7A 1D5BB 2XPGB 3UP1A 1JI1A 1KLFA 1UADC 3VFSB 4OLXH 3RWGB 1KCKA 3FB8B 3AVEA 5SV4A 5DWUH 4GBXC 3F6IA 4KMLB 1FFOB 5LWYH 4XMLL 4DQOH 3C5ZC 1M05A 3JV6A 4JFEA 4DCQB 2HWZH 5C09E 4FZ8H 1H5BB 4XHJC 1LHZA 1P9MC 3KYNA 1QA9A 1LNUB 2AV7A 3VGGA 3H9HA 4N0CD 3MO1B 5GGTH 2DQCL 1UXWB 3PHSA 4X4YB 3BFOA 1DUZA 4KUZH 5LGJB 2OL3L 1R3KB 5IKCB 2ADIA 3VXTB 3ES6B 5FB8B 4RFNC 1P4BL 1IGTB 1Y18A 3C8KA 2I07A 4M9PA 4MXVE 6FABH 1Y0LB 2A9NL 4HPOH 1L0QA 3L3KB 3JUYA 1FNEB 1T1WB 4ONGL 2K3TA 4UV4H 4FABH 3WFBH 1ROWA 1A7RH 4NNPH 5CUSL 4P5KA 2CIIB 1VACA 4KI5F 1I1CA 1WT5A 1MCNA 4KI1A 3EOAB 3HE7B 1YJDC 2NY2C 4YEEA 3BISA 2P47B 1TVHA 1GAFL 3B2UD 1A1NB 3V6OC 4KVNH 1KULA 2V5SA 2C1PB 2CPCA 4UIKL 3N9GH 1MHEB 1AO7B 3IFLH 5FYLE 3Q5YA 1SJVA 4M5YL 3ZDXE 4XNXL 3V4PH 4M7LT 4RGND 1N5AB 3K2UL 1D9KB 1G7IA 3SJVB 4UBDD 4ZO9A 5DVOA 4JG1H 3X12B 4PLOB 5SX4H 2AEQL 3U4BL 3KXFD 1EO5A 4TRPL 4KROC 5C6PB 5C08A 2XIDA 4GXVH 2J8UB 1EEZB 4X5XB 4UUJA 4KKCD 1A7PL 2E9JA 3ZO0A 1JPGA 4AM0A 5GGRY 3OZ9L 5BVPH 3UBXA 3QUXC 2ERJB 3F7VA 3C6SB 3GIVB 3KYKH 1A6TA 1ZLWK 2P24A 3Q6FB 1KEGL 3QDMB 5A2LH 1R24B 4IBLT 2ATPB 3GMRA 5F7DA 3CC5B 3PWPB 4DKDC 3QQ4A 4FMFA 3FQTB 4DUVA 2W0FA 1EA9C 2XFXB 2YD6A 3S36H 1JPSL 2BSED 4L4VD 4KMQA 1ZLVK 1AY1H 4O58L 4PJDA 1CLZH 4CGTA 1A3RL 3MRPA 1IKFH 5HYJE 1I3GH 3IKCA 1RZJH 1FZOB 2W9EL 4K23H 4PJGE 1EGJA 3Q3GA 4N8VG 1JMXA 5AG9A 1ZANH 1YPZE 1YQVL 3O3DA 3OHXB 3QI9A 5B39G 3WV0A 4LCIH 2C4FU 2AJ3B 5CINH 3QIUD 4Q9RH 2WBWB 5D6DA 5MP6H 2EIEA 1CICD 1ORSB 3RX7A 3SKOB 3RJDA 1XIWC 3T3PE 1SEBA 4NO0D 4P2QE 4BM7A 3BGAA 5D7LE 3MRRA 5D1XC 1UWXH 3GJEA 4Q97A 1GOHA 3O41B 3WS3A 5FUZL 3S7GA 3BUTA 5KS9A 4ZUUA 4BFIB 3CZFA 1F3RB 1QRNE 4IOSD 3TESA 2ZZUT 5DRZB 2XOTA 2NX5A 3G6DL 3PHQA 4QNPF 4Z0XB 3GKWL 5HDBF 4OQ1A 3SO3C 1TJIL 1J1OH 3C09C 3OAZH 4MDJA 3DXAD 1F13A 5EU7E 3LKPA 5C1MB 3C08H 3BRGC 1H3GA 2P1YA 4JFHD 2F54B 3WFDH 2IBZX 2NXZD 3PIQB 1IAMA 4WHDA 4ZAKB 2AJUH 5D1QD 4JFZL 1MCFA 4WHTB 4YX2H 3MRIB 2DLFL 5E2WH 1WTGT 4N9GA 2DQJL 1CFNA 4XBGB 3QRFM 3MLRL 4XP9L 1G1CA 1MHPL 4RNRA 4YE4H 5EO1B 5BQ7A 5KSBA 4A6YH 2ARWA 3JXAA 3EKCA 1XGRA 2VISB 3CMOH 4LCUA 3ARDB 4TTGA 3C5ZD 4R96B 5I66B 5ITBH 4YHIB 3VFWB 5FGCB 4N68A 4YAQB 3MNZA 5K9QG 4NC1C 3OKNA 4QRUB 3L1OL 4GRLD 1I9JH 3HZMB 2VDKH 3W9EB 1CE1L 4OTXH 2X41A 3NN8B 4G6JH 3MR9A 2XWTA 5FYJU 5K93A 5HDQL 1YY9C 2VLKD 4Y19D 3NCBB 1S5IH 3QP3A 3ARFD 5DJZA 1NGYB 1EHLL 3F62A 2X09A 1DVFB 4LKXA 5FO7B 3AS1A 3DI2B 1XZ0A 3LKNB 2CK2A 3BKMH 5M95B 2P5WE 5CGMA 3BP5B 4YNYB 4NFDA 1X5FA 5ICXB 1NJ9A 3MRHA 1ZA6A 1ZHKA 1ZWIB 3HI1B 2I27N 4LQFL 4WUUE 2R4SL 5F9OH 4NCC2 1TVBB 4F80A 4F57H 1NCCH 3VDAA 4OCRL 2NY2D 4MXQD 4X6BB 4H0IA 2ZSWB 3GGWA 4XNYL 1EHAA 1KSRA 4NO2A 3LN9A 2ILLA 1RK1A 5CHNB 1MFBL 1PYWB 1XR8B 5IVXB 3KPNA 5F1IA 1URLA 3VGAB 3AY4C 5K9JL 4D8PA 2FEEL 5D7JA 3U82B 1AD9A 4TPRH 1FIGL 5I1DA 2VLJE 1T04A 3KPSE 2IALB 2VDOH 5A2JH 3D85B 3M07A 3MMEA 3BJLA 3BQUC 3DETC 5D2LF 3A6CL 5CWSB 5CD5C 4WV1C 5IHLB 2D9CA 4HPYH 2FB4L 2OM5A 3HC3H 3OR7B 4LPUA 2DQHH 4M1DL 3LQAL 1MCRA 3D18B 1WUNT 1OCWL 2VXTH 2BSSB 4BQCA 5EC1B 1D5XB 1F3DJ 2NZ9C 3UO1L 4JFPA 2VSCA 4YDJB 3I50L 2D31B 1D9KC 2QQNH 3KLAB 3LZFH 1IM9A 3HC4H 3G6JB 5HGBB 1JZ6A 2FLRT 4G8IA 4JKLA 1NEZA 1W0VA 3TBWB 2X4OB 1ES0A 3EYSH 3GM0A 3P0YL 1WICA 4F37K 4CKVX 5C8JA 3U9UB 2Z0BA 1JUFA 2XTJD 1D6VL 4LSTH 1NFIA 1AP2B 1S7WA 3TVMD 2JJSC 4LMQE 1TQCC 3M8OH 3C8HA 1ORQB 1WAAF 4G6KH 3WS6A 3S34H 1QPXA 2BCKA 5J4MA 2WBJD 1JRHI 4U6VH 3U4EA 5ESVB 2Y23A 1I1YA 2GITA 4C4KT 2AKRB 3DWTA 2R56H 1HWGB 2J8OA 2GT9A 2X9WA 1QSFE 1INEH 1TFHA 5J1AA 1GIGH 1XIWD 5CIPB 5JW5B 4AENA 2YPKB 3FAXA 4O2EB 4RFOL 5I71B 5D1XD 3VWJB 4G7VL 4V1DD 1NLBH 3MV8A 1AR1C 2VC2L 5I1KH 1RAMA 3PGDA 3CDCA 4ETQA 4OSUL 4KQ3H 5HGHA 3FO0H 1CD1A 2F9BT 4JO1L 5I6XB 1PGRB 5CEZL 3H0TA 4Z7UB 4D0DB 3W9DB 3OJDB 1FBIL 3KPOA 3VFNB 4Z7QF 5JPNB 4EI5B 4M62H 4PP2A 4QY8B 3W11C 3IF1A 1P7KA 4TULL 4WW2F 5I16A 1FL5B 1JTOA 4L3CB 3FQXA 4QOKD 3ULSA 4MQSB 1DBBL 2GSGB 4NZRH 2HRPL 3QEQB 4R2GB 3HPLA 1JGDB 2X10A 3G5VB 1KJVA 2BDNL 1PX3A 1KYOJ 2CKBL 1Z0MA 3T0DA 5JW4Q 1YEKL 1GGIH 1XR9A 3EOTH 3UTSE 5GSRA 1L7TH 3OKEB 5L8KB 3O3BA 2AJXL 5DT1H 2LFGA 3DMMD 3OAYH 3VGDA 4IRZH 4Y4HA 4NDMA 4JFOB 1FO0B 3PWVA 5K59E 4QEGA 3GB7B 2HT4C 4J4PA 1I9RH 1V7MH 1MELA 5B8CA 1NL0H 1JWSB 5DD5L 4N0UA 5EOQH 2N56A 4FG6C 43CAA 4OCSH 3QXDB 4CVXA 4Y5XC 3JTTB 1RIUL 3C87A 2DQFA 1S3KH 2PXYA 3RWHA 2X4UA 3MRQA 1R5VB 1OGAE 3RU8L 1R3LA 4NNYA 3GDBA 4ODWB 4HZAA 4QRRB 4U6HB 2FYYA 2A0LC 2BNQA 3VFVB 4K3JL 4HD9A 5C0RH 1KCLA 1N4XH 3I3BA 4KPHH 3AGVA 5HYQA 1LE9B 4KXZI 3WXWH 5A43C 1ZA3A 1RFDL 4NQDA 3E3QE 3BGFB 3FL7A 1U42A 3SHSA 4UB0L 3RX5A 4Y16B 4BUHA 4RMWA 4D9LL 1BZ7A 2CDEA 5EUKB 1IGJA 1G9MC 5E00B 3ARBA 1JNJA 2X2YA 3QHFH 1OGTB 4S0TD 3T2QA 5F1NB 4XMKH 3HE7D 4I48B 4PRBB 4GFTB 2BSRB 5I75B 4K2UL 1PKQB 2VQUA 4PRIA 3BQUD 3DRQA 2C7UB 2GJ6D 1UJ3C 1ADQA 4HIHB 3LRHA 5CD5D 1P53A 3GMNB 5E70A 2FZ3A 1JN6B 1OF2A 5DTFA 1AO7D 2F53B 2B39A 2NZ9D 1FHGA 3O2DL 3IETA 4PJFB 4LSRH 4EUPB 1D9KD 2PN5A 4R90H 1FVDA 1TIUA 1HHJA 1J5OL 5FXCH 2FJGA 3G04B 4M3KB 4OZFG 5CCKL 1XCQB 4OM1H 3E6HB 2IPUG 3BPLC 5TE4L 4EOWH 8FABA 4O2FB 1EZVX 1PQZB 3C5JA 1YNTA 4L8CB 2EDQA 2I26N 5J06A 4NHUA 5E99L 4W70A 3U36A 1TJHL 1Z3GH 1X6NA 3RPIB 4L4TA 1OTUC 3I2CH 3OR6A 1S9VA 3IDXH 1M71A 1K5NB 1JZ3A 4HF5H 5JHLL 1BECA 3QDMD 4BQ8A 4RGNE 2R1WA 2R29L 1D5MA 2R69L 3PWPD 3PNWA 3QHTC 3DROB 1C5BL 4ONOA 1A64A 1I8KA 5C0IA 1MJ7H 3KXFE 1M7XA 2FJFB 3RWFB 1G9NC 1NDGB 2VR9A 1RURL 2M2DA 1CGYA 3MJ8A 3IDGA 3ZSSA 2ZUTA 1SY6A 3JVGA 5IF0B 3HAEB 1GGTA 2OS7A 2C4FT 1QYGH 2H45A 4P3WA 1RV6X 5GXBB 1KTDA 3CX5J 2OMBA 3S4SB 1C08A 5IBTH 5DD1H 4EN3A 2GAZB 5CJXC 1I7ZB 3O2WH 4NN5B 5BW7C 3WDIA 1KG0A 4P9HL 1MFNA 4I0PC 5IWLA 4N8CH 3BO8A 5MHSD 2D0HA 1T5XA 1HHHB 1G9NH 3V6FA 2HVJB 4FOMA 2VLRA 3GRWL 4L4VE 5EN2A 5I8KL 2F58H 4NM4H 2YSSB 1HIML 3QIWA 4M7LH 2O5XH 3K46A 1U8HA 4NC0B 1JGUL 2ZCHL 4I77L 1B0GB 4D0CA 1GHFH 4G6AC 3O2VH 3P9LB 4ZTPL 1T2QH 4DN4L 4OZIA 4JZJC 5IR1A 4OZFH 1UH4A 3S37L 3W11D 1MCCA 3LDBB 2DQEL 4KK6C 2X9XA 3MRFA 3MXVH 4PJDF 4JRWA 3L3IA 4ZUSB 4FXGB 3GO1L 2BVQB 4P46A 3INUL 2L7UA 3FRUB 5I6XC 5CIPH 4MLIA 3QPXL 1AJ7H 1KXTB 3OKOA 4DGYH 4G6FB 3MLPA 4LVNB 4ZFZA 2F54D 5D93B 4CDHA 4ODSL 1ZAGA 4OM0H 1FORL 4PIRF 5HPMB 1CXIA 2EYTB 1X4ZA 2FDBP 4L8BA 4ZAKD 2H8PA 4XVJL 2AEPH 2MFNA 4RGMB 3QDJA 2ARJQ 1S5HB 2QQKH 1QKZL 3L5WA 4Q6YA 3TIDA 3R8BB 5EBWB 4GLRH 3REWA 1L0YA 2QQLH 1LK3H 3U7YL 4LLQB 4YIQA 3HS0B 3ARDD 3LN5B 3RP1A 3DXAE 1S7RB 3ZYJA 1HDMB 1ND0A 2DB8A 4LF3B 5INDB 3WLBA 3BUYB 1T4KB 3TBYB 3FTGB 2HLAB 1UC6A 2FECL 4JFHE 4X7SH 5GGUA 5E8EA 1XF3A 5KS9F 3GMOA 4OBRA 4U1KA 3V5HB 3MOAH 3BT2H 3MNWB 1OLLA 2GK2A 5EIQA 1OAQH 3RVTD 5ANMB 1LO3L 4YFLF 1DBJL 4HK3N 3U2SA 4JO4L 1RUPL 4YFEA 3H3KA 2HMIC 2A1WH 5DJCA 1MFCL 4ZPTA 3QUML 4F33B 3FB7A 5I8EA 2W60B 3ZDYE 1CGUA 5GGVL 4GW1B 4FQXA 1IAIM 5AYUH 3ALXA 4LLYB 3F58L 4EUPG 1FFNA 5CBEB 1FO0H 5IBLD 1LEKA 1NGQH 1BVLB 5KSBF 5KBNC 3MROA 1IGFH 1DCLA 3QXWA 1N59A 2VLKE 4HWEL 3BH9A 4Y19E 4MDIA 4FXKB 4Q0XH 3TA3B 4P2YA 3X14B 5D2LB 3GHEH 1DEDA 3BPCA 3UTZA 4H8WH 4WDIB 4P59L 5GS1A 4JHZA 1JNLH 1HYRC 2DLHA 2EE3A 4ZS6C 1HCVA 2Z4QB 3D85D 1BF2A 3OKKA 2BNRA 1RQ5A 4HKXB 4FTVB 3WL9B 2OLDA 4MJIA 2NY7H 1T2JA 5TGBB 1I4FB 4Q7DA 3VFMB 4U1NA 4ZNEA 1IAIL 2A6DA 3VXQA 3ZE2F 2E5EA 2VZSA 2P49B 1I8MA 4TSAL 2NTFB 2VR5A 4LSVL 4YK4B 3DGGB 4WW1B 5FGBA 2PKDA 4F8QA 4MD0B 1CXLA 2AERT 2PO6A 3HAEG 1H15A 2AV1A 2DS4A 3P4MB 4HMEA 3RZCA 2DIAA 4F9PA 3ARSA 5KVEL 3TN0B 3S4SG 3VI3F 4HWNA 2V2XB 2W38A 1UQSA 3CLFL 4Y2DA 3ARQA 4NN7B 5DR5H 3A6BL 3UTTA 4XP6L 4QHNA 3UTQB 2X4TB 3S5LB 1VGEH 4X4MA 3HPJA 2V2WB 3PV7A 5EC2B 3VE0A 2ZJSH 4X6EA 4ZFFA 1Q94A 1XF2A 2VIRB 3JSSA 1WCBB 1HEZA 4K55A 1A7OL 3T65B 3TZVB 1BWMA 4R97C 5D6CB 4EUPH 3FMGL 5LBSL 2P44B 4YPGB 2CGRH 3AROA 1ZGLB 1SBBA 4OZGA 3EYUH 1CCZA 3U48A 1G7QB 5EUOE 5F7EL 2YD5A 3AM8A 4EXPX 3FB5A 1FVCA 4PRPB 3WFEH 5T3XE 5CILH 3STBA 1D5ZB 4XBPB 1JE6A 1U8PB 1CVSC 2YZ1A 3GBNL 1AHWB 1A4KA 2EDXA 4Y1AE 1DQTA 2XTJE 3ZT5A 1I1FB 1FL6A 4NN5C 3CVIL 3GSQB 3VW3L 2EDTA 3H9SA 1SEQH 4X83A 5EBGA 3UTPD 1FRGH 4HBQA 3AS0A 3CPLA 5AZEL 3VFTB 1OAUL 2VUYA 3VXRB 3H7BB 1KB5A 4P2OC 4E42A 2RHEA 4AT6A 1S7XA 3RIAK 4U1MB 1HKLL 1NLDL 4IM8A 3LMJL 1WLHA 4Y8AA 1JGLL 2QSTA 1A9BB 5DJ8A 2YUXA 3HAEH 5DJ2A 2AK1L 5I8OL 1NC4B 2UZYB 4JJ5A 4O2CA 4WU5B 5E8PA 4EI5D 2PCPA 4GS7C 5IB3A 4V1DE 2MJWA 5IG7B 3REVB 3PGCA 2JIXA 4Y4FA 5DHVB 3FONA 4QT5B 3T0AA 3RUGA 1EAPA 2F19L 3QEQD 3P4OA 1MVUA 1XGQB 3BD3A 2ZSVB 2AJSL 4GO6B 1P69B 5K9KA 4OCYL 2W9LA 4NKIL 5T33H 3DTXB 3WFCL 4L5FL 1W72L 4LVNC 3BP4B 3NIFE 5IB2B 1S9YA 4XMPH 3E8UH 4J7RA 1UZ8B 4R9HA 5D93C 1XGYH 3ALWA 3ULVF 1XAUA 1A7NH 3MV9A 3RWJA 4OLUH 3HRZB 1U93A 1XF5B 4RGMC 1AGCB 4BSJA 4AEFA 5IEKB 4MNQD 3WHXB 5FYKH 1KB9K 2EKSA 4QOKE 3ZHKA 2NNAB 4JHWL 1XGPA 4K9EH 2HMID 4NSKB 4KJWC 1KCVL 4CADB 4PFEA 4CVWA 5LQBH 5IW6B 2DQDL 1FFRA 5GRJH 1TZHA 1F58L 4DGIH 2V6HA 3J7HA 2Q76A 5I1JL 5GHWL 1N64L 5BV7L 3UCRA 5IM7B 4QRRD 4MGXA 4RCAA 2C3XA 4KMTL 5IW3A 4PJIA 2ZUVA 1W8OA 1S7VA 4L3AA 4U05A 5SWSA 3ZYOA 1A5FL 4Y16D 1WWWX 1M05B 3CVHH 3JV6B 1JNNL 4JFEB 2A73A 1IEBA 2O93L 1IM3B 1BX2A 1HCFX 3O9WA 2NW2A 3KYNB 2BP3A 4MXWL 1QA9B 5EZJA 1QP1A 2AV7B 5L88H 3DVIA 3H9HB 3VH8A 3OPZH 1HHIA 1DUZB 1HHGA 1AGDA 2ADIB 3NABL 3BKJL 1HILA 4YC2C 1Y18B 3WHE1 2I07B 3C8KB 5BS0A 1UKTA 1MCHA 2D7NA 5C0BD 1QSEA 2VXVL 5K9OA 1IEHA 1HH9A 2F53D 4K94C 4LAJH 5C6TL 3IDIA 4PD4J 4JN2A 4P5KB 1NMCB 1QZ1A 1VACB 4MCZA 3MODL 3OMZA 2V9RA 1FC1A 1F4YH 2PW2B 5F96L 1AI1H 1MIML 1TVHB 4YHYB 4EDXA 4BELD 3IDMA 1IGML 3MCLH 3W5MA 2NY0C 4P5MA 1BJMA 3V7MA 2MQCA 3N50A 2C26A 2E8YA 3TO4C 1AO7E 4TUKL 4XVUC 2YPVL 3SE9L 4ETYA 3PJSA 4OD2A 1MEXH 3QO1A 1G7IB 4CN4A 3SJVE 1UWGL 5TDPA 2BERA 3VA6A 3WN5A 2GFBB 4X9BA 3Q5OA 3JWDL 5C08B 1MRCH 1GPOL 2OCFD 3LRSA 2J8UE 3NVQA 5BZWA 1LEIA 3MCKA 4UUJB 2BY1A 4Z18A 3JWOL 4HGKC 1JPGB 4AM0B 3RVVC 4LEXL 3UBXB 1IRAY 3WEXA 5ID0B 1H3VA 3F7VB 1A6TB 2P24B 3IB4A 2CMRL 4GQPH 3MUGA 3QDME 4G3YH 4YHOL 3GMRB 3ZZ1A 2CLZA 3PWPE 3QQ4B 1GOGA 1KCRL 2VYRE 4M7ZB 4LCWA 2W0FB 1FGVL 4P2OD 4JPKL 1U3HA 1JWMA 4PJDB 2BRRH 2EDOA 1YYLH 4LIQH 5A3IC 3MRPB 3NCCB 3ZE1F 4LRNL 4JO2L 3Q3GB 2RJMA 1VEMA 1Q9WA 1QHPA 2IQ9L 2H1PL 3V0AC 1C5CH 4FS0A 3O3DB 2OI9C 3QI9B 2OP4H 1NBZA 2HYMA 5FYKD 1AC0A 2JJTA 1MREH 2R23A 1G7JA 3HNTH 2IG2H 5F1KC 3A67L 2X4QA 1MCPH 2W07A 3B9AA 1YN7A 4HKJA 1SEBB 4ZYKA 5MENA 4G6FD 4U1HA 4NNXA 3MRRB 5HHMB 5JXAL 3GJEB 5FYLL 5I30H 2LU3A 3RWCB 1AFVL 4HQQH 5C0GA 3WS3B 2CXGA 2IANA 4LSQH 5LGHH 5FO9B 4OLVL 4YZFF 2LTQB 5T3ZH 1T03H 5KS9B 4ZUUB 5C7XH 3CZFB 3LIZL 3X3FL 3KPLA 2NX5B 1CD8A 2P7TA 4PV9A 2B1HH 1LP9A 4MDJB 3TT1H 4U2ZA 3HUJA 3LKPB 1MIEL 4OZIF 2F54E 3PDGA 1DQDH 4IOIB 4J12A 4YHMH 4L8SA 5FK9A 1JRHH 5DHVH 5EBMA 2YKLH 4O5LH 4OCWL 5CS7A 2SEBA 4MQXC 4N9GB 5D72L 5J7CC 3E1F1 4RNRB 1A6WH 2F5BL 2JJUA 4XXCC 4EBQL 5BQ7B 5KSBB 5J1SC 2H2SC 1XGRB 4XB7A 3EYFA 1E27A 4JZNA 3WIHL 4LCUB 3HNVH 3ZYZA 2V5MA 5FGCE 3MNZB 4H20L 3OKNB 2B0SH 5GJSH 3FRPA 3O8XA 5MERA 2Z9TA 5JW3H 4RA0C 3MR9B 2XWTB 5GRZA 5HGAA 4EIGB 4ZOCA 4I3SL 3ZL4L 4IMKA 4KDWA 4JDTL 3GI8L 5DJZB 3TNNA 3LPGA 3TA3D 4LKXB 4JREB 1AQDA 1XZ0B 2VWEE 4XX1G 3P11L 3H42L 2X4PA 4LAQH 5C0ND 3WJJA 4O02L 3K2MC 2AJZA 4YO0A 5AAWA 2VZOA 3WDJA 1F3DH 1NJ9B 3MRHB 3NPZB 5ACMA 1ZA6B 1ZHKB 2E7LA 2BVYA 4FTVD 1LO4L 1HHKB 3B9EA 2VLLA 4OB5H 3PWUA 3GGWB 1MLBA 2R2HA 2DLGA 3NTCH 3O45A 2FX9H 4NO2B 1F11A 1U92A 5E1AA 4U1GB 1RK1B 4Y8DC 1A6ZA 1Q1JH 4LDLB 3TBSA 3KPNB 3B9VA 5HHNA 5F1IB 5IVXE 5J56B 3I84A 4KK5C 4XCCL 1J0IA 4NRYA 4D8PB 4X8JB 2HN7A 1WBXA 4QXUH 5D7JB 1AD9B 2VXQH 4U2YA 5E5UB 5CSZA 3UBXG 3X3GL 1QLFA 5I1DB 1RZ8B 1T04B 3B83A 1CLOH 4K7PX 5IESH 2R39A 3MMEB 3RI5F 2R0KL 3GSXA 5TQ2H 3TM6A 4BA8A 1UWXK 1WFTA 1OPGH 4BFGA 3Q1SL 4NBZB 4S1SL 2Y1VA 5J12C 2X6MA 3NGBB 5ALCH 4PY7A 3RVVD 3IDJA 3CXHK 3V52H 4D2NA 1Q38A 1QHOA 3TZVD 1NUGA 4FP8L 4JFPB 5F8RC 3U6RA 3SBWA 5TF1L 1NUNB 3OAZK 4N0YL 1IM9B 4LU5L 4WTWA 3G6JE 4G8IB 4HKZA 5HVFB 2P48B 2D0GA 1NEZB 1W0VB 4KXZH 1IEAB 5JXEA 1ES0B 1ZT7A 5JA8B 3UYRL 4PRPD 4YXKH 4OIIH 1T3FA 1XF4B 4NUGL 5A3ID 4MD5A 4F58L 1L4IA 1JUFB 4XT1C 2FBJL 4UDUA 1NFIB 1S7WB 4FZEL 2BVPB 4IRJA 4QTIH 2NQCA 4Z7NE 5KSAA 2BCKB 4NCC1 5T3ZD 3U4EB 1OW0A 1WZLA 2GSIA 1I1YB 2GITB 4LHUA 4TUOA 4Z95H 2ZUXA 2GT9B 2IMMA 2R9HD 5J1AB 2DWEA 5JIIA 5F3BB 4J3TA 1NDMA 4AENB 3GM8A 3KPRB 4YH6A 4G8GA 1NC4D 2BY3A 3NIGF 1P4IH 4OZGF 2KH2B 3MV8B 1DQQA 4JQIL 4LLMB 4IDJL 5E4EB 3UTPE 4P3CH 3EOBA 4NCDA 3W0WB 3HMXA 3G6AA 4ETQB 3SE8L 5HGHB 3DLQR 1CD1B 3MBXL 2I9TA 3I3EA 1ZLUK 3P40A 4KTDL 4N90D 1X3DA 2VN4A 2VZVA 3SQOH 2ICEA 1CN4A 3FJTA 3H0TB 4MMZC 3VFGL 2B5IB 4Z7UE 3KPOB 3MOBL 4WNQA 4PP2B 2DQTL 3THMH 1A47A 5SV3A 3HR6A 1N7MH 3IF1B 1P7KB 4Z77B 5E2VL 5HVHB 2R1YB 3FQXB 4JFDA 3CIQA 3ULSB 3FZUD 2JLLA 4J3XA 3Q2CA 2ITCA 4CW1A 3KS0H 2WWMC 3HPLB 3QEQE 4OZ4A 1KJVB 4LNRA 3V0VA 3PF2A 2CR6A 1NKOA 1XR9B 3DX8A 4RRPA 5J13C 5CGYC 5C0BE 3PQYA 3V5DA 3OAUH 5GSRB 2J6EL 3O3BB 3MRGB 4OQTH 3SGJC 3DIFA 3RUGF 3MA7A 4NDMB 3T1WA 4XCYA 1FLRH 3PWVB 2QSCH 5DZLA 2RGSA 4KUCF 1EERB 3BWAA 3QIBA 5B8CB 1I8IA 1JZ8A 1K8IA 4N0UB 2HLFC 1X4YA 1CYGA 1U8QA 4QWWC 1N3NA 1IGIL 43CAB 4PJ9C 2GK0A 4JFED 3QAZC 4CVXB 5I73B 2O5YL 2DQFB 2PXYB 3D9AH 2EDKA 3RWHB 3B43A 4RMQA 3MRQB 1JWUA 2FGZA 1R3LB 4NNYB 3KGRA 2FYYB 4QRRE 5FM4A 4YDIH 1NCBL 4XNQA 4PBXA 4PLNC 5HYQB 3TBVA 2H3NA 2Q8AL 1ZA3B 3ARRA 3BAEL 4JREC 4NQDB 1WWBX 4KVCL 5CP7A 4PP1D 1I3RB 1BZ7B 2CDEB 3IDNA 4KK5D 1IGJB 1YNKH 2XXMB 4F3FA 3ARBB 1FNAA 1CIDA 1JHLL 4PJIF 4OD1L 1JPTH 1BM3H 4M43H 1WV7T 4UILH 2W9DH 4GRWF 1PKQE 4N8PA 4PRIB 3DRQB 4LFHG 1NEZG 1JFQH 2EYRA 5LCVH 3BXNA 1KPVA 3OKMA 4ZFGH 4KHXH 4WWID 4UAOB 1PEZA 4HFUH 3EJYC 3WLWC 2FZ3B 2APFA 4KZEL 1C7SA 1M6OA 1OF2B 4JZOA 3IS0X 4XTRD 2F53E 5F7NC 4P23A 3IETB 2VE6B 5CGTA 2D9QB 4PJFE 4FQ2L 1FVDB 4CUCA 1HHJB 2FJGB 3FB6A 1QACA 3SKMA 4AQ1B 4XPHL 1UXSA 5ITFA 5I76A 8FABB 5C08D 4JB9L 3QNZA 4B50A 3C5JB 3QWOA 1YNTB 3LQAC 1MOEA 2ICCA 4NHUB 1F6LL 3U36B 3RWDA 2VKWA 4L4TB 3OR6B 1HH6A 1S9VB 1AD0A 1W0YT 1KC5H 1M71B 1PAMA 4OIAA 2Q3AA 1D5MB 3PNWB 1UM6H 4MAYA 1I8KB 4Y5VA 3BRFA 5FHAH 4BFEA 3EGSA 4E0RA 4OCXH 3OAYK 3MJ8B 5FV1L 3IDGB 1HINH 4NJAL 2BFVL 4PTTA 4NZUH 1OAXL 3NAAH 4G9DA 2XYCA 4UMGA 4AG4H 3O4LD 4K71C 1KTDB 1C08B 1CLYH 4EN3B 5ESQA 4GXUN 3PXJA 4LARL 1KG0B 3QI9D 1I7UA 1R3JA 4X8XA 4WTZA 5HI5C 5IFHH 4Y4KC 3BO8B 1JZ2A 4QHLA 2R15A 1GL4B 4KC3B 1T5XB 5T5FH 4NQSA 4ODTH 3RVWC 2VLRB 3VA2C 4YUEH 5EN2B 1T6VN 3UJTL 2RCSL 3QIWB 4QNPE 3GSNL 1QR4A 4X6FA 1U8HB 4TVPH 5HDBE 1L6ZA 1NAKL 4JJHA 4D0CB 3HI5L 3DVGA 1PDKA 1DUYA 4OZIB 5IR1B 4MAUH 1MAJA 4TNWK 4IHOA 2OBGA 5L7XH 3UX9B 1AKJD 4G7YL 3TYFA 4RWYL 2CKBA 5B38A 3U7AA 4PG9A 4U49A 3L3IB 4P4RA 2NX5D 5FYKE 1CZ8L 3ZKQD 1DQML 1C7TA 2FD6H 1YDPA 4PJAA 3OKOB 3CK0L 5CGYD 5DUMH 4ZFZB 4DVBB 4HZLA 2B5IC 3LN4A 3MRLB 4P4KA 2IADA 2YOCA 4DUXA 1UG9A 4M6ML 4UQ2A 5CEYA 1TITA 2ZNXA 1X7QA 4L8BB 2H8PB 4R8WL 1BWWA 1J0KA 3WNLA 3SKUD 3ULVH 3S9DB 1BOGA 4YHZH 3QDJB 4TYUA 4Q74A 4QGYA 1EBAA 5CJQL 1IQWH 4OGXL 2ORBL 3REWB 3BW9A 1S7UA 4JQXC 4W6WB 4PJ9D 4ERSL 4FFWC 4HIIA 1ND0B 2F5AH 1F42A 1KBGH 3WLBB 5E24E 1KLUA 3TT3L 2DICA 2WUCL 5GGUB 1F8TH 1XF3B 5E8EB 3GMOB 1E0OB 2ITDA 5C0FA 3L9RA 2BJML 1MJUL 3EFFA 4MLSA 4J4PC 3KLDA 1PY9A 1LP9F 5ANME 3MUHL 4LNVA 3U2SB 3DBXA 1TETH 5DJCB 3HUJF 4ZPTB 5T1DL 3WJLA 4C55A 5DVMA 3KPTA 4A2MA 3FB7B 5I8EB 1FYHB 2MSPA 3L3HA 4FQXB 4I0KA 4IIQC 1E28A 2Z31C 4YWGH 4JY4A 4QCIA 1WWCA 5C71A 1FFNB 2NY4B 1P5UA 3DSNA 1LEKB 3SPVA 4LEOA 1WWAX 4LKCA 2UZIL 4NGHH 1N59B 3BH9B 4LP4A 4MDIB 3QUYC 3T0EC 1LO0H 5D2LE 4J6RH 3BPCB 3UTZB 3EJYD 4OLZL 4KJQC 3QG7L 3GJFA 5GS1B 4HIXH 1H8SA 3LKOB 3MGTA 2ZOLA 3OKKB 2BNRB 1U8NB 2VDQH 3KVQA 4L3EA 3QWRD 1DBAH 4MJIB 4AH2A 4H26A 3PUCA 2A6DB 3DJ9A 3VXQB 4OLXL 4HUWA 4TUJA 1I8MB 3QEUA 5K33A 5DWUL 2YK1H 2Z91A 2IPUK 4M6NH 3PL6A 2PO6B 1H15B 2AV1B 3RDTC 4DQOL 1YECH 2CK0H 3RZCB 2HT2C 4PJXA 5C6WH 4NPYA 2HWZL 1UQSB 4FZ8L 4Y2DB 1R5WA 4KV5F 3VFPA 4JVUA 1IM9D 3OV6A 3QDGA 4QHNB 1D5IH 1JV5A 2N1KA 1T0NA 4LFHD 5DD6B 3F8UB 2VQTA 1UM4H 3HPJB 5JIPA 1ADQH 3VE0B 3WMSA 3T4AA 3L95A 4X6EB 4KUZL 4ZFFB 1KELH 4XAWH 1XF2B 1VESA 2IPKA 2AAVA 6FABL 1AGBB 4TVPD 4HPOL 2BVUA 3U0PA 3E2HC 4FABL 1QBBA 3WFBL 3KYAA 1EFXA 1EHXA 1A7RL 4NNPL 3S96A 2Z93A 5E56A 4OZGB 4AZ8A 1FE8H 4APQA 3S8WA 3C60C 4LLVA 4JDVA 1L9MA 3FB5B 1FVCB 5GRYA 4X6CA 5FA3A 3RVUC 1VKXA 1CTNA 4YQXL 2IWGA 4WI3A 3KPRD 2J7LA 4XP4H 1FFQA 3BX7C 4UZGA 4KVNL 1NCNA 1FL6B 5EULV 2FLBT 1NMAH 1BPVA 3C8DA 3IFLL 2NYYC 3KDMA 3MV8D 3H9SB 1QLRB 3WE6A 2J5LB 2JTDA 3CPLB 4LP5A 3V4PL 3ULVD 4KFZC 3W0WD 5T3ZE 4HLZG 1G1YA 1KB5B 3VXRE 1CDYA 4JG1L 4ZUWB 3VFOA 4AT6B 1S7XB 2NY1B 1SY6H 4LHQB 4PJCA 4OFYA 1FPTL 1N8ZA 5DJ8B 5ENWB 3SCMB 3WIFB 1JYWA 1FNGA 5DJ2B 4DFIA 1WF5A 4AIOA 4JJ5B 1AE6L 4O2CB 5E8PB 1NSNH 2PCPB 3BIBX 2QBWA 2N7AA 5BVPL 4PG2C 2AEWA 3D39A 3EFDL 3PGCB 2JIXB 4Y4FB 4OI8A 1CU4H 4JKWA 3FONB 5EO0A 4RMUA 3RUGB 2ARJB 3P4OB 3RTQA 1MVUB 4RMTA 1E4KC 1CF8L 5K9KB 3S36L 4OAWB 2BHZA 4QTHA 4N90E 1S9YB 3UYPA 1AY1L 3T2OA 2GI7A 1CLZL 2BY0A 3NFPA 3MV9B 3RWJB 4ZDHB 1NMBH 3MLWH 4K23L 3HFMH 2WMPA 5DMKA 2EO9A 4RFEA 3D0VA 5GISL 4J4PD 3V6ZA 1ZANL 3VXOA 4FHBD 1MQ8A 4LCIL 4NQCA 3L6FA 3ARTA 3PABB 1XGPB 5CINL 2JCCB 3MV7A 1R5IA 4Q9RL 5MP6L 1HQ4A 3KPPA 1UA6H 2PXYD 2Q76B 3IXAA 1DLHA 4JPIA 1JTPA 2DL9A 2APVA 1A1OA 2NZIA 4HLZH 4PJIB 1VEPA 2R8SH 4NQDD 4LSPH 4GRWB 2GQHA 2UVEA 1S7VB 5SWSB 4EEEA 3DHJA 4YHLH 4PJHA 4P5TA 1FSKB 2ZKHH 2A73B 1IEBB 4RISH 4KJQD 4JFEE 4JLRA 1J1OL 1BX2B 1X4XA 4WO4B 3ARBD 4QXWA 4TSBH 1EVUA 3O9WB 2NW2B 4BK4A 4TOYH 3RHWF 2IH1A 3GSWA 2NY4C 3C08L 2X7LA 3VH8B 5KZCD 5IOPA 3WFDL 1HHIB 4PRID 2AJUL 1HHGB 1AGDB 1A14H 4YX2L 1HILB 4ODHH 3MLSL 5E2WL 5BS0B 4YE4L 1QSEB 5K9OB 3IFPA 4A6YL 1EJOH 1HH9B 3IDIB 3CMOL 4JN2B 5DGRA 2HJLA 4MCZB 5JW4N 5J89A 3FN3A 3GSUA 5JNYA 1J0YA 2CUHA 1EMTH 1SMAA 1Q9OA 2CRIA 2BVOA 2X44D 4IJ3C 1MVFA 1I9JL 1P2CA 3BHBA 2VDKL 1FNFA 1JPST 1T83C 4OTXL 5I9QC 4HX1A 3LQZA 3MBEC 4G6JL 5KAQG 4EDXB 3IDMB 4WEUD 2E7CA 1MY7A 1S5IL 3WKNA 4XX1E 3VGEA 3WSQH 4F7PA 1PZUB 2Z92A 3N1FC 4L4TD 3KJ4B 3RZCC 1CXKA 2WP3O 3BKML 3OGCA 2BC4B 3V0WH 3PJSB 4OD2B 1U8MA 3QO1B 1NC2A 1YUHA 3FO2A 4J8RB 5TDPB 5F9OL 3WKMH 3WN5B 1UM5H 4XPGH 5C07A 3SO5A 1S78C 4F57L 5C08E 4LGPB 5BZWB 3LRSB 1LEIB 4KGLA 4U3CA 5D96B 3MCKB 3Q0HA 4JANA 5DRWA 3MOQA 5HGDA 3WIIH 4WY7H 1IGYA 4CMHC 1AIFA 2VDMH 1O5DT 4EN3D 5IW1A 1QBML 4P0DA 2NYYD 3MUGB 1KJMA 3BPNB 4TPRL 1YEHH 5D5MB 2VDOL 4YR6A 5I1IL 4M61A 3DARA 5KANI 3SY0A 1T66C 1U3HB 1JWMB 4Z78A 4PJDE 3QIWD 4HPYL 1BQLH 4AEIH 5GRUH 3HC3L 4OV5A 5E08H 1Q9WB 4PJBA 5FECA 1PSKH 1LK2B 2NY6B 3CU7A 1B6UA 4CNIA 2K1MA 2QQNL 1NBZB 5E2UH 4YBLB 3HC4L 4MJ5A 2R23B 1G7JB 3DI3B 2X4QB 3SCMC 4UT9H 1YN7B 4HKJB 4ZYKB 3EYSL 3D2UD 1XFPA 3DX6A 5MENB 3K1KC 3HB3D 2D03H 4U1HB 1FIEA 3PV6A 4NNXB 5DJ0A 5HHME 2OJEB 4KJPC 1CGSH 4KDVA 4YPJA 4LSTL 4R0LA 2P5EB 5C0GB 2IANB 4U4BA 4NM8H 2YD9A 3M8OL 4G6KL 3QDJD 4ORGA 2BOBA 3S34L 1KB5H 1T5WB 5KS9E 5AD0A 5KVGL 3KPLB 3AB0B 4XI5C 3RWEA 4U6VL 4DVRL 4OGYL 2NX5E 4HV8A 2P7TB 4PV9B 4WWKA 2OYPA 1VFBA 4PJEA 2R56L 1WQVT 1INEL 1B4JL 3HUJB 4S1DC 2H32A 2EXYC 3IFNH 3VI4F 1WFOA 3U79A 5D1ZA 1EV2E 3RKDC 3SDCC 5DK0A 1KIPA 3QXTA 4L8SB 4LRIA 1U91A 4L8DA 3VH8G 3U0WH 5F44A 5DFVC 5FK9B 5EBMB 1HOCA 4U7KA 5DC9B 1Q9LA 1WIPA 2WIMA 4CVUA 1NLBL 4DTGH 2SEBB 5I1KL 1DLFH 2FL5A 2G2RA 4PJAF 5KSBE 2QHRH 1N5YL 4KQ3L 3EYFB 3FO0L 1E27B 2VXSH 3AXLA 4JZNB 5BRZA 2A6JA 3V4VH 1A02N 1RK0A 4FQXD 4AK1A 2PR4H 4ONHA 3RGVC 5GS0H 1V3MA 5I1EH 3O8XB 2NY4D 5MERB 1B0WA 4M62L 4DEPC 5HGAB 4PB0H 3TNNB 5TDOA 5I15H 1MJJA 1AQDB 4NZRL 2Y7QA 2X4PB 2AJZB 1LMKA 4WO4C 2XZAH 4JY6A 3KPMA 3O3EA 1GGIL 3EOTL 5E8NA 3MXWH 5FM8A 1L7TL 2H2PC 2BNRD 5INCA 2VLLB 5DT1L 5D2NA 3VI3E 1MCOH 3PWUB 4JR9H 1MLBB 1JHTA 2R2HB 3O45B 5GRVK 4GRWH 2QJDA 3DX7A 1U92B 5E1AB 3AAZA 1A6ZB 1I9RL 1DTUA 3TBSB 1V7ML 1NL0L 5HHNB 1BIIA 3CH1A 4NRYB 4XPAH 4ZOBA 2PO6D 2HN7B 1WBXB 3RZCD 5CSZB 5MI0B 1PKOA 3UROR 1QLFB 1U9KA 4ZQKA 4Y2DD 4PGDB 1KXQE 5JOFA 3VMPA 1S3KL 2O5ZH 2HA1A 3P30H 3CD4A 2NMSA 1NFDA 5I8CA 4LCCA 3LV3A 4IRSC 1UKSA 3GSXB 3SDXA 2NR6D 4KTYA 5C0RL 3OGOE 4HG4K 4KPHL 1N4XL 1A7QH 2V7NA 1JIBA 3MLVH 2F15A 1QQDB 3WXWL 5FA4A 2J3SA 4PY7B 4U1JA 3HR5A 4NHCH 2ICWA 3U6RB 3MUJA 5DMGC 4ZFOL 1A6AA 3QHFL 5ALBH 1UZ6F 2IBGA 4HKZB 2XQBH 4YXHL 4MB4A 3GI9H 4RIRB 4XRCA 4MWFA 1ZT7B 2VITA 5D96C 4NWTH 4Q6IA 1T3FB 1TNMA 1PX4A 2VZTA 4OFDA 4PJXF 1W2KT 4DOHB 4MD5B 4UDUB 3VWKA 5MEQA 4IRJB 3BPNC 4QRTA 3H9SD 1G9ML 5KSAB 4URTB 4F15B 3VJ6A 1A2YA 3EJZC 4LSRL 4R90L 4OI9A 2GSIB 4LHUB 1TXKA 5JIHA 1NANI 4TUOB 1CWVA 3O4OC 4ELMA 4NYLA 3IAQA 2Y9RT 4EOWL 1TDQA 2DWEB 4JEGB 5ETUA 1NGXA 3SCMD 3FN0L 3TNMA 1A8JH 1NDMB 2ZCLH 4PJ8C 3KPRE 4G8GB 1ZV5A 4ZNCD 1Z3GL 3KHQA 4KJPD 1I1RA 5I1CH 3I2CL 1VB9A 2NY6C 2JKXA 4B53A 1DQQB 3IDXL 2JIXD 4Y4FD 3MV8E 1CGTA 1KACB 3CSGA 4HF5L 5KVDL 4YXLH 4X6CF 4AEHL 3VDCA 3ULVE 1TJGH 3W0WE 1Y6KR 4ORZC 4RSVA 2PTTA 4KUCD 3IS1X 4HWBH 5TQ0H 2I9TB 5EIIA 4R26H 4QO1A 4R4FH 3I6LE 1U8KA 3BIKA 2ICEB 4XNMA 2EXYD 2YN3A 4M00A 5I74C 5E8OA 4L29A 4XWOD 4WNQB 3MV9D 3FRPG 2L4OA 5DC0A 1QYGL 5AEAA 5GS0D 3S3PA 5IIEA 5DD1L 5DVKA 4JFDB 3IVKA 1VPOL 5FOBA 1TPXB 5HVGB 4PJCF 2G75A 2ITCB 4CW1B 3SDYL 1HXMA 3BDYH 5CLWA 35C8L 4FQIH 4LNRB 3V0VB 1G9NL 3DX8B 3OG4B 2MOVA 3PQYB 4GKZA 1JVKA 4QRPA 2G60L 2F58L 4NM4L 5IB4A 4KKNA 4M7LL 2O5XL 5F7FA 3RGVD 5J8OA 1N6QH 2DF3A 2MTPA 3MA7B 4XCYB 1GHFL 4JCMA 3O2VL 1T2QL 2WWKO 1BLNA 2B7DT 3U30B 3BWAB 2B1AH 2B4CC 3QIBB 1I8IB 4PRHA 4Z7OE 1QSFB 5SWSD 1I1AC 2D7PA 3QYCA 3MXVL 4N0UE 1CFVH 1U8QB 1N3NB 4H0HB 4G8FA 2GK0B 4KK8C 3IRPX 3NFSL 4WO4D 3DUUA 5F7YC 1AJ7L 4UOW0 3S3JA 4DGYL 3O9WD 4ZMAT 1IE5A 1UFUA 1IARB 4BJLA 1ZSDA 4H1LA 2H2PD 3X11A 4NOFA 2BNQE 1HKFA 3TBVB 2AEPL 2H3NB 2IPTH 3LKSA 4G80A 5BS0D 1HZHH 4CAGA 1YQ2A 2QQKL 4NQDE 4GKSA 4PV8A 3PDOA 5EH1A 1MFEH 1QSED 2ZG3A 4C83A 4F3FB 1EEYA 3W2DL 4WFED 5AZ2H 5HBBA 3QEGL 3FOMA 4JCLA 5HYSA 5E6IC 1KYOK 4NQXB 1Q72H 3IU4H 1G7MA 1MNUH 1F6FB 2VERN 1GGUA 2FRGP 4PRIE 3MOAL 3KWWA 4PJHF 3BT2L 2EYRB 1C16A 2HVKB 3T0XA 2DLIA 3MRNA 3BXNB 1OAQL 4RMSA 1KPVB 3OKMB 4GSDL 3HZYB 1RULL 1M6OB 4JZOB 5EU7C 2A1WL 3EUUA 2D7QA 1CR9H 4P23B 3WO3B 1BOYA 2EH8L 2C3WA 3VGHA 2YD2A 2DJSA 1GAFH 1BAFH 3UDWA 4Z8FH 5DMGD 5AYUL 1ZVHA 3SKMB 3MX0A 1UXSB 5ITFB 1FO0L 5I76B 4LHUG 1NGQL 3VXMB 3QNZB 2CLRA 1QSVA 3QWOB 1IGFL 5JUEH 1G0DA 5DRNA 1T2XA 2OMNA 3SDDA 5JW4R 1L9NA 4HAFA 4LDEB 5FCUL 2ADJA 4Q0XL 3RWDB 2LVCA 1HH6B 3GHEL 4L4TE 4MA8H 3U4BH 3CSPA 4CU7A 1IC5H 1B88A 1ZMYA 1JNLL 1S8DA 2X1WL 1A7PH 4MAYB 4E41B 4OIBA 4Y5VB 5E1HB 5I1HH 3CX2A 1U2HA 3EGSB 3ZKXB 4E0RB 5IROC 2NY7L 4Q2ZA 5D7SH 4PTTB 4GUPB 5SX5H 2YBRA 4ZXBA 4P9MH 2DI8A 1RI8A 4X9FA 1NAMA 3RY6A 5ESQB 3SOBL 1JPSH 3K7UA 2NY6D 4F15C 2QKIA 1TVDA 1I7UB 4S2SA 4C59B 4O58H 3WFZA 2C9AA 5DR5L 1EK3A 4QHLB 3CDYA 4NQSB 3U9PL 5J57B 4YZFE 1VGEL 2H6PB 2VLRE 3RVXD 4MA3A 3DVNA 3W5NA 5MEND 2ZJSL 4RRPG 3ARGA 4X6FB 5I2IA 3DO3A 2BOCB 3DVGB 1ZVYA 1DUYB 2P5ED 4KHTL 2IAND 4IHOB 4OZIE 4JFQA 4EQ2A 5HHVH 1H3XA 1KT2A 4YLQT 4JQVA 3TYFB 2CKBB 2CGRL 4HCRH 4PG9B 3WO4C 4P4RB 3EYUL 4ZSOA 1ZT1A 4W4OC 5EBLA 1G9EA 5ICZB 2J6EA 1MJ8H 1CBVH 3U0TA 1YDPB 4PJAB 2ZUQB 1OAYH 4PJBF 3B8SA 5FUZH 1ZHNA 3WFEL 3IT8D 5CILL 4J1UB 4HZLB 4P4KB 3LN4B 4EI6A 2IADB 25C8H 1MUJA 4OJFH 2F8XC 4UQ2B 5CEYB 1S7QA 2G9HA 3GKWH 3BKYH 5KN5A 3HMXH 2XWBA 1SEQL 3QDJE 4JM2C 1FRGL 1LILA 2GY7B 2RAMA 3K4DA 3BW9B 3CX5K 1S7UB 3KJ6H 1N2RA 4OT1H 1S9WB 3FHQA 4KK8D 1I85A 5BCAA 2Q7NA 4HIIB 3DV6A 3VG0H 3G08A 4YBQC 2DLFH 2VDLH 4UT6H 3MLRH 2ITDB 5C0FB 3L9RB 3BGMA 3EFFB 2YXFA 1J05A 4HIJA 4CRPA 4PJEF 3QJHA 3DBXB 3BP6A 4HXBL 3EYQC 5JDSA 3MLYH 4NKMA 4GKOA 5F6IB 2VZ3A 4HJGA 4C56A 5JOPD 3LEXA 3EDFA 2CIKB 3Q5TA 3L3HB 2DTMH 3RRQA 5T33L 1E28B 3K8MA 4XCEA 5HDQH 5H2BA 4JY4B 4QCIB 4XMPL 3E8UL 1EHLH 1XGYL 3KLHC 5D8JH 1A7NL 3SPVB 1RZ7H 4OLUL 3VXSA 4N1HB 4LEOB 2G5RA 4AQOA 3EZ8A 3RA7H 3LCYA 1UVQA 1KJ2B 3G5XB 5FYKL 4QLRA 4LQFH 4OGAC 4JRXA 4F37F 4K9EL 3OJMB 3ILQD 1IMHC 3GJFB 3QUZC 4OCRH 1P7QD 4WRLA 5LQBL 5GRJL 3MGTB 2ZOLB 4JPWH 5T1MA 3QUKA 1X5IA 4DGIL 4L3EB 2BNRE 5JO5A 2WK2A 4MJIE 4AH2B 4BSWA 4HS6A 4H26B 4WFGE 4ZNEE 4JPVH 4HUWB 4TUJB 1FIGH 1TQBB 2A74A 2VB5A 2IAMA 5LXGL 4OLWL 3U46A 3PL6B 1ZS8A 1CQYA 5F89A 2O61A 1S7TA 3CVHL 4ZTOH 5CJOH 4F9LA 1J87A 4NPYB 3A6CH 1KEMH 5I1GH 2WQ8A 1R5WB 2F8OA 4I9WD 3SDAC 3UTTE 3QDGB 2EKJA 1T0NB 4WTZG 5L88L 4X4ME 2RBLA 2XWJA 3ET9F 3OX8A 4ODXA 3L95B 3M17B 4NWUH 4AJ0A 1X5AA 3SGKA 2NY5C 5ADPH 1J0HA 3HE6A 4I1NB 2IPKB 3T1FA 1NGPH 1RZKC 3WXVH 2JELH 2VZUA 3U0PB 2WBKA 4UDTA 4WUUD 5ERWA 2HKFL 1NFDF 1EFXB 5F7MC 3HZKA 5KSAD 3S96B 3SDXF 2Z93B 5E5MA 1NBVH 1BQSA 1MCDA 5F1OB 4OZGE 1UB5A 4APQB 2FCBA 4LHUD 3TIEB 1F4YL 4LLVB 3GSNA 2Y06H 1ACYL 3E3QC 4M4PA 4X6CB 5FA3B 1VKXB 1VEOA 1AI1L 2F8VA 2NY5H 3MCLL 1WIOA 5IJKA 5HI4D 1CFSA 1IGCH 4G8GD 2YXMA 3OXSA 1RZKH 4TQEH 1AR2A 3ME0A 2VLJD 1VFMA 4I4WA 3N1MC 3KPSD 2MCPH 4O00A 4B7LA 2YRLA 4N0CC 5L6YL 3H9SE 1LQSR 1MEXL 4HJ0D 5D71H 1IKNC 5DZNA 4NRXA 3VFOB 5IB5A 4JRYA 1MCWW 1EBPA 4PJCB 1MRCL 1RHFA 1NH6A 1FNGB 4I18B 1RIHH 3QQNA 1LDPH 4MZ2A 2YMXL 1K3IA 4GG6A 3QCUH 1BVKA 3R0MA 3D39B 5CFHA 5IGXH 3BEVA 1MWAH 4ELMF 4JFDD 5EO0B 4G3YL 1F4HA 1SHMA 1XF1A 2L7JA 3RIFK 3WCYA 4ODUB 5EDXA 3RUGE 3RTQB 5CEZH 3ZDXF 3B2UC 4JDZA 5J3HC 5E0QA 5EU4B 2XZQH 3BSZH 5CKGA 1U0QA 4QTHB 5GZOC 1X5KA 2D2OA 3PQYD 3HA0A 4LIQL 1YYLL 1EH9A 3NFPB 5IHUL 2QTEA 1U6AH 3BKCH 3MV9E 5HD8D 4UBDC 3C9NB 2P45B 4X4ZA 1FL3A 5L9DL 1TZGH 1J1PL 2CKBH 5DMKB 1JYNA 2BNUA 3OJVC 1QLEH 4RFEB 1I8LC 3D0VB 3OBAA 1YEKH 3V6ZB 4FA8A 3QIBD 3VXOB 2E27H 4IDLA 4NQCB 3L6FB 4LPXA 7CGTA 3RY5A 1QSFD 2OP4L 1D7FA 1KIQA 1XGTA 2JCCE 3MV7B 1R5IB 1MREL 3QCVH 3RX8A 2E7BA 3HNTL 1VFAA 1HQ4B 5ADOH 1MCPL 4Y1AB 3KPPB 2EDBA 4K3DH 5IVOA 3MRDA 3EDKA 5I17A 3IXAB 1DLHB 4QHUA 1T0PB 2X42A 4JPIB 5I30L 4WI6A 1Z9MA 5JPMA 3O6MH 4U3HA 4HQQL 4PJIE 5LGHL 4ZS7H 3ZSTA 5T3ZL 1T03L 4PJGF 3GUTA 5C7XL 4GRWE 5F6IC 5SWSE 4PJHB 4P5TB 4OGAD 4QF1A 1CDBA 4Y5YA 2EC9U 2B1HL 4JLRB 5L2JA 5DHYA 3TT1L 3TJEH 3FFCB 3KPQA 1GZQA 2V9TA 5HDLA 2IH1B 3GSWB 2X7LB 5IOPB 1DQDL 3T3PF 4YHML 5IBUB 1ED3B 4OF8A 1B0RB 2GUOA 1XGUA 1JRHL 4ZUTA 2YKLL 3QIUC 3ULUC 2BRQA 2Q7YA 1CICC 2YZ8A 5BS0E 3L3JA 1QNZH 3GNMH 3IFPB 4U3XA 1CGWA 1QSEE 3MC0A 4I5BB 2BZDA 1U36A 3DO7A 4K2UH 4P23D 2Z35A 2YA1A 3HNVL 2R0LH 4XNUL 1D3CA 2HJLB 2IGFH 4WFEE 1WTLA 3ABZA 3GMQA 5JNYB 5CZKA 1Q9OB 3SDAD 2B0SL 2BVOB 4UNTA 4KH2A 1P2CB 3BHBB 4GBXA 5JW3L 5L0QC 4HX1B 3LQZB 3VXMD 3ULUH 1KJ2H 1PG7W 1TQBC 2RIKA 4QHKI 1VENA 4POZD 2M8XA 4F7PB 4Z0BL 3ZKMC 4MA1C 3GJFH 4X0KA 1CDJA 2Z92B 1ZEAH 3CXDH 5IHZA 4WEBH 1RUQH 3DYOA 1P9MA 4PLKD 4LAQL 2AXHA 3O6KH 4HKBA 3OGCB 3L5HA 5EU5A 1OGAD 1OTSC 1NC2B 1I9IL 1UEYA 1YUHB 3FO2B 5D1QC 1JTTA 2XA8H 3BZDA 4MAYD 5E99H 4E41D 1AGEA 5C07B 3VU2A 3P4NA 4OB5L 3NTCL 4JANB 4Z5RA 2FX9L 1JK8A 5F9JA 2WIIA 5DRWB 1F90H 3MRBA 5HGDB 3VXNA 5FYJL 1BJ8A 1Q1JL 1IGYB 1AIFB 1CLCA 3PGFH 2I5YH 2OQJA 3S6CA 5HY9A 2J12B 1JCKA 4GRLC 2XNAA 1KJMB 1II4E 2VXQL 3NOIA 4W68A 2YD8A 1UENA 1X5JA 1OQXA 3LHPH 1U2CA 3C6LB 4YR6B 4LCWE 4M61B 5D5ME 5DVNA 5IESL 4PD4K 3ARFC 3AC0A 5CEZD 5I1AA 4HH9B 3H8NA 3V6OA 1F97A 3QHZL 5F1SA 4MB5A 3SY0B 5TQ2L 5CD3B 4KDTC 3CLEH 3V8OA 3S37X 4Z78B 1OPGL 2W91A 5CSBA 1NCTA 1UCBH 3O6FB 1OHQA 4D3CH 4OV5B 3B9KB 3EO0A 2EO1A 4PJBB 5FECB 3V52L 1UB6A 4CNIB 3EO9L 5GS3A 3T77A 4MXQC 4M6AA 4MJ5B 4X4XB 1E4XI 1MAMH 5DJAA 5J3HD 4I18C 4OIIL 4YXKL 5GZOD 5MENE 1F6AA 3NACL 2FSEA 3QUXA 4ISVA 3PV6B 1DBMH 2DQEH 5DJ0B 3KNBA 4WUKH 4R0LB 2P5EE 3INUH 2IANE 4XGZA 4QTIL 3NMEA 4ORGB 2BOBB 2WLZA 3IDYB 5AD0B 4U0QB 1C5DB 3T8XA 3RTQC 2WM0A 3RWEB 2LE9A 3GEWB 5J11B 4XPBH 4HV8B 4WWKB 1VFBB 1SYVA 4U1LA 4Z95L 3SE3C 5B22A 4PJEB 1M7DA 5BV7B 3CDFA 3B8YA 1RZJC 1K6QH 5DI8A 3HUJE 5FUCE 1TMCB 1CT8A 5D1ZB 1JF5A 2HT3D 5DK0B 1U91B 4L8DB 1EXUA 1P4IL 2A6KA 5ACZA 1Q9LB 2IQAA 4HIEB 1WFNA 1NANH 4CJ0A 2DJ4A 2C3HA 1BZ9A 2OZ4L 5GGRA 2FL5B 2G2RB 2GTZA 2MNUA 2Y72A 5DJYA 4P3CL 3DX9A 1H8NA 1XIWA 3UC0H 4G6MH 2WINA 3AXLB 5BRZB 1YEIL 1GJIA 1NGZA 5D1XA 2XTJC 4O9HH 3TVMC 1RK0B 2X4NA 4V1DA 4MJ6A 4ONHB 1DBJH 3SQOL 5E9DA 1JZ4A 1JGEA 2R2EA 3KR3H 2WBJC 3LPWA 1MCEA 2PTUA 1YA5A 2CSPA 3THML 4HS3A 1N7ML 2BXZA 3V4UH 3AS2A 5T3XH 1NCAH 2IBZY 4KKBD