2M83A

Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of protein phosphatase-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
139
structure length
139
Chain Sequence
GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 1 regulatory subunit 3A
publication title Molecular basis for Protein Phosphatase-1 regulation by the muscle glycogen-targeting subunit GM
rcsb
source organism Oryctolagus cuniculus
molecule tags Hydrolase
total genus 24
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2m83A00
2V8MA 2DJMA 4EIBA 2M83A 4BFOA 2VQ4A 2EEFA 4BFNA 2V8LA
chains in the Genus database with same CATH superfamily
1I3RA 4FABH 4XMLH 5CBEB 3B4NA 2PLTA 1CI5A 1FORH 4IKLA 3NSYA 4PJDE 4BRJA 3O3AB 3BKJL 5IBUB 1QVOA 1IGYB 2BNQE 4NIKB 4ZFOA 3QEUA 5DJDB 4XVSH 5DF0A 3WSQL 2H0JA 1JK9B 5IEHB 4JY5L 4ELKB 2XI9A 1XF3B 1XGRA 1URLA 3HG0A 5EG6C 4UTAL 1NC2B 2DQUH 2WPGA 4JZNA 5CJ8A 3DVFA 2AXHA 2EIZB 4V11A 3RU8L 1QW8A 3CQPA 3EFOB 3NZHL 4Y5VC 3SBPA 4LE8A 3MUUA 3IDMA 4KO9A 5CUSH 3WL9A 1TQVA 3O4LA 3I6GB 4LRNL 5A7BA 5D4IA 1DVFA 3T2QA 1F4YL 2HAZA 2X40A 4ZX5A 5F0JB 5AYQA 4PJBA 4PWKA 4UOW1 2P5EE 2HRPH 2KPWA 5H2BB 2BSTB 1YC8A 5CHNB 4XWOC 5EEVA 2ICCA 2HA1A 1FG9C 3US1A 2VLRE 3QR0A 1JK9A 4POZD 4PJ5D 1E30A 4ELKA 2CCWA 1PCXA 1UD3A 3BZ5A 5IROC 2B20A 1PJ9A 3F7QA 1BGXH 1TSRA 4P46B 3DOIA 1L7TL 1S3KL 1NC2A 1OGPA 3TA3B 1C7TA 1BWMA 4LSUH 3S3BB 3IAQA 5HVHB 3NJXA 4WY7L 3ORJA 2O93L 1TMCB 3GHBH 1A8JH 1FGVL 2X1QA 3I6GA 3ARDC 4KO6A 3U4BH 3V5KA 5CP3A 3EZJB 3QEQD 1WZKA 4FOMA 4U1LB 3J7HA 1FZOB 4Y4FC 2ERJC 2JKRM 1KBKA 1KCSH 2BSTA 4NQUA 3LRLA 5CHNA 2BCKB 2O5YH 4BE6A 4XN4A 3MFGB 4MQTB 3WTUA 1P4UA 2FQEA 2HLEB 2X1WL 5DUJA 1BREA 4HLZG 3S96B 3D0LB 5C0IA 1RVFH 3EBGA 4J6IA 4D0BB 4FTVE 1GKEA 3PPEA 4W4NA 1VEPA 1CGSL 3UG5A 1N4XL 4UBDD 2MOQA 1FE8L 1HIML 2XCMC 3N1QC 4KVNL 4LNRB 5ESAB 4XC1H 4UOW0 1F4HA 4N6QA 4UV7H 3ZE1B 2QHRH 4K3DH 2IVFC 1G7HB 1NCAH 3KLQA 1VEMA 2IMNA 1CFBA 1KCLA 4HIHB 5CS7A 1H5BC 1N10A 3TO2A 4A6YL 1FZOA 4UTBH 3AUVA 1VENA 2UVFA 2WXGA 3D4YA 1OCZB 2XC8A 3DMMB 3N41F 4EN2A 3TZVC 3B9DA 1RHFA 2IOIA 3P69A 4OM0L 3S96A 4ZMAT 1WP6A 1BLNB 3PHSA 1CLOH 2ATPB 1W6LA 5GS0C 4EUPA 5L2JA 5F9WC 4AUYA 4DIXA 5F6IC 3TWCH 3MRQA 3RNKB 1P1VA 5TDPB 5B7FA 2W1NA 3V95A 3K80A 1U33A 5CCKL 5IZ7A 1FL6B 4LNRA 5FCUL 2VLMD 4X6CB 4HUMB 1GCYA 3SBRA 1ZT4B 5KOMC 4Z7QE 4XVTH 1E6OL 3I9IA 1NFDB 4ZUTA 1RSFA 4R4FH 2XPYA 1G7HA 5INCB 1B9ZA 5FYJD 4CSSA 4WF7A 3LSOB 2E76C 4F9PA 3OKLA 4LBAA 1N64H 3ZKXC 4N5UA 2EDXA 1ZSHA 4X6FB 4L8BB 5DHVA 4ZFGL 2PCPA 1YEDB 3VD1A 1HILA 3TJEL 1BLNA 4OGQC 3BFOA 2I9LB 2ATPA 2ZF9A 4LEXH 4LLWB 5KBNC 1M56B 1UEYA 2ZX9A 3RNKA 5TDPA 1YDPB 1DJXA 2FVNA 4NO0A 5HHOE 4U1GB 4PB9L 1TDQA 5DD0L 3ZTDC 3CD4A 1OPOA 2X1OA 3Q9QA 5KVEE 1FL6A 2CDEB 1YN7B 4YSDA 1K4CB 3PABB 2JF1A 1ZT4A 4P07A 4PTUB 2ZX6A 1FFRA 2FD6H 4R2GB 3QRBA 4OJYA 3PFUA 1GZPB 2B14A 5E6IC 1UENA 3HZMB 3LSOA 3IVKB 1EH9A 1Z3GH 2G3MA 4MAYB 4S0SD 2E4TA 4F15B 5A2CA 4LCIL 1P4BL 4PCKA 5SWZA 4HDIB 3W82A 4L8BA 3GSWA 3AT8A 3SO3B 4N8UA 3QIUB 1IM3B 1LEGB 1MG2C 5FFGA 2IXQA 3EUUA 5F8QC 1J8KA 2I9LA 4OIIL 2LFGA 1ONQA 2DMHA 3HNTL 3ARBB 2AGJL 5HPMB 5BO0D 4YEFA 4PD4K 2P42B 5FHBH 4QRRE 1DQQB 1XGQB 2XOTA 4DN3L 4N2NA 2BZCA 2NSMA 2DIJA 3OZLA 1K4CA 5FS5A 1MKFA 4PTUA 4TTGA 3UZVA 1G9MH 4KY1L 2J6EH 1KBWA 3L95A 3OKNB 3IFLH 2VERA 3HZMA 3L9BA 5H94A 1HH6A 4BUGA 1UD2A 3NBNA 1X9UA 2HFFB 1KTJA 4MAYA 4NKIL 5E2TH 3SQOL 2MMXA 4JHVA 1NCIA 1ZXQA 1MNUL 1D5RA 5AVXB 4OM1L 1NEZG 4KMTH 1F3DH 4KZ0A 4KUZH 3WIIH 5MEND 2NXYD 5ALCL 2PO6D 5JHDB 2AW2A 1UKSA 3QIUA 1IC4L 2FNWA 2GJ6D 3EOBB 3LB6D 3TEUA 5DS1A 3VM7A 4W4OA 3N43B 3ARBA 1F90L 5HPMA 2V2TA 3Q2CA 1RUMH 3U7YH 1LO0H 3R8QA 3EOYG 1SXBA 3GKZA 3ILPA 4MA7H 1DQQA 1XGQA 2KZWA 4G6KH 5CXPA 3CSPA 1SM3H 5IW3A 3HPLB 1EBPA 3O81A 2B39A 4JO8A 4W9KC 1QLEB 1ZE3H 3QT2A 1A1MB 3OKNA 4AM0Q 3D08A 4FXGC 5F0MB 5T33H 4Z7OB 1EX0A 2HFFA 2NMSA 4AMKL 3GSXA 3AGVA 3EJJX 4FG0A 1CGVA 3BQUA 5E6SB 3CJJA 5IVNA 3ZMEA 4FLQA 4AGPA 1PS3A 3QIWA 3FKUS 4NUGH 1U6AH 5DRZB 3RVWC 2N7SA 2YFNA 4IKIA 2X4PB 4FMFA 3BT2L 4Y2LA 1JS4A 3FO0H 3MV8D 4WQOA 1R6VA 3RBGA 2G5RA 4KXBA 4HS6A 2BNQB 1WITA 3D18A 1CFTB 4ZQKB 4ZS6C 1YNTB 4X5XB 4R7NB 5ABDE 5LWYH 5DD3H 2VWEE 4EIZC 1GYAA 2J8OA 2BSRA 3GPEA 3CMGA 4AL8C 1NBQA 4CSPA 1OHQA 1JGUH 1HTYA 1ZLDA 1HQRB 1YN6B 3NMEA 1VZHA 4XBEH 2C3WA 1LE5B 3HEIB 1X7QB 3ECVA 3SKJH 5DRZA 1HZLA 2HCZX 2E7CA 2VDPL 4HS3B 2AV1A 4URKA 3LN5B 4K94L 3HFMH 3IGAB 2UZYB 3DX2A 2HKAA 4PJDA 4Q6IB 3AB0C 4YSUA 1RZ7H 5I0YA 1Z0NA 2BNQA 2JKLA 3FHQA 2NZ1A 4RFNB 3SYOA 3V0VB 1G6RA 4ZQKA 1AQKH 4N2MA 3FU0A 4JM4H 3VSTA 3S98A 3HS0B 3PWLB 4WU5B 2ENJA 2V2XA 3PWPD 4RZCB 1UJ3C 1PLGL 1HQRA 3D1MC 1PVHA 1ZHBB 3H7BB 2X87A 2JKWA 3Q1SL 1EEZA 1KMGA 3O9WD 1X7QA 3RWFB 3MV01 2W95A 4E2OA 5KN5B 1KCWA 3LN5A 4F2FA 1R3KB 2HTLD 5FX3A 1JWSB 1IU1A 2UZYA 4BK8A 4H88H 2NZ9C 1IGCH 1CLYH 3N85H 1BG1A 5C0DB 2P5EA 5JXEA 2FO1A 1CQYA 4HLZH 1OARH 3LZNA 3ZL1A 2PYED 3V0VA 3L3JA 2B1OA 2H9GB 2VLRA 2YAEA 3QYMA 4PJ7E 5GZNA 1JXFA 3OKYA 3PWLA 4TUOB 3RVUC 2AQTA 4K9EH 2R1XA 1ZHLB 1YAZA 3GO1H 4QF1A 1WSST 1AG6A 1EV2E 3CC1A 3BPLB 1ZHBA 3H7BA 3IDXH 3KBPA 4X7DC 5F89A 1NSNL 1K8IB 2A0LD 3QH3B 4DOHE 2VLME 4HT1L 3WU1A 5FM8A 4A39A 4N4YB 5KN5A 2WXKA 3RPIB 4JRXD 3U6RB 1AE6L 5FYJE 1JWSA 3BSZL 2RTTA 3U4AA 4YFDB 2AEQH 5B3NA 1ZS2A 2MIZA 5L6YL 5C0DA 3MKGA 2E7HA 3SCMA 2ZUWA 4ZMXA 5E2VL 4ABVA 5GGRA 4Q9RL 3SYPA 4HJJL 1MELA 1XF4A 5HXMA 1O5PA 2VZOA 3ZDYF 3RVVC 4PSPA 2MCPL 2ZKHH 4TUOA 3AAZB 4PWEA 4FTVA 3C60B 5DFVD 1G0DA 5T3XH 1ZHLA 5T3ZH 4CADA 2OTUB 5D8JH 1XDTT 4LBEB 1E4XI 1UQSB 2P80D 4Y9FA 5I26A 4P23B 4ZG1A 4PGEB 1K8IA 3ILQC 4PD4J 4ZDHB 3T2PA 3QH3A 3RTQB 3BPNB 4PR5B 5DHXB 4KZEL 2EEXA 3GBMH 1SUJA 4B9JA 3F12B 1QFUH 3RPIA 3U6RA 5ABAA 1VHPA 1MDAA 2I5YH 2X6UA 3C6SA 3LYRA 4RZKA 2VJ8A 4AYMC 2VR8A 4FQJH 5B39B 1K5WA 1BPLB 1KF9B 4KJYA 4ZMQA 4ZUUA 1B6UA 1EGJL 1CR9L 2WUCH 1RLBA 4R97C 4BFNA 4M8UA 1PKOA 4WUKH 2N1KA 1OPGL 1FQ9C 4HU2A 4V2BA 4LDEB 4M7KL 5A3IC 5JW3H 1SXCA 1X5FA 4BDVB 5KBLA 4MHHG 1FO0B 3JVGC 2D31B 3QO1B 4IYKA 4NM8L 5DO2D 4JG1L 2OTUA 3GQFA 1ZVHA 4F5CE 3M17B 5HHOB 3HI5L 3ESPA 4M6NL 5LN8A 2V6HA 1T2XA 5FKAB 1LXMA 1LEKA 4PGEA 4PR5A 5E6YA 3F12A 1OAYL 4BKLB 5CZVL 2Y0SA 1J9TA 2N3JA 5DD5H 3HE7B 4P48A 5B39A 1RLWA 3EAKA 1TUPA 4GBXD 1N0XL 1MCPH 2HT4D 1AYOA 2CSPA 3T9WA 3FU7A 3VX0A 4JK0D 2XX1A 1XH3B 4WFGD 2B0SH 3CDZB 1MF2H 3BWAB 4URTB 2XG4A 1NGZA 2D4FA 5MENE 3Q06A 2Y7LA 2VH5H 2ZOWA 2OQJA 2BINA 2G60H 4BDVA 2GJ6E 3X2QB 2B1HH 1UB5B 2D31A 1KCKA 5IBLC 1H6UA 3DGGB 2ENSA 4LLYB 5HHOA 4KI5F 5C0GB 2FECL 1NC4B 2Y5EA 3CFCL 1LO5B 4KK9C 5FKAA 3T4AC 1QEXA 3LZFH 4XHJC 1IEHA 1GCFA 2P45B 3GK8H 3IS0X 4A55A 1H0DA 4PGJA 4TQHA 3KH3A 4PQXA 3UTTD 1FUNA 4JB9L 5F96H 4PGCB 4GY4A 5EU4A 4EIBA 3PPSA 2XV2A 4M7JL 1T03H 1BG9A 3HAEG 2QADC 5CZXC 1IQWL 1OAKL 4ILDA 1EEQA 3DIVA 5KTEL 5CGBA 1XH3A 1O6TA 5C71A 3BWAA 4I0CC 3EYSH 3BH4A 3GUFA 4HSCX 1UB5A 5F7LB 3LIZH 1J86A 2CDFA 4KKBC 5CLZA 4WSJA 4QRRA 3MAWA 1NC4A 4LP4A 5F93C 2DMKA 1LO5A 1FHGA 2FIRT 4JHWL 4OI8A 2EDHA 2XYBA 1Y7VA 3MV8E 4E5XG 1XCQA 2HRLA 3IDIA 1I1AD 1KG0B 2OTWB 2YBRB 3II2A 1RI8A 3PS6A 4NDMA 1SMAA 4QRTB 4L29B 3L3KB 1IX2A 1MAJA 1SVBA 3C2SA 4JO1H 3RWDB 5KBKA 4F93B 3BN9D 1J12A 2EUXA 4R8WH 5FW8A 4ACTA 3ARFC 2XZZA 3P3YA 4ICWA 2GQHA 2IH3B 2ZXQA 1FNSL 4XP9H 5IQOA 4HUKB 1AZUA 1M7IB 5DJ0A 3VSVA 4XOAA 1KGYE 4FG4A 3P9LA 3AXHA 1UM5L 1JZHA 2NXZD 3W56A 4FAAB 1ZKAA 2ADIA 4J3OG 1DVXA 4YO0B 3D51A 1KG0A 2YBRA 3RFRA 3MACL 3OB0H 3KL5A 4XP6H 1RZ8B 3NCYP 3N06B 4QRTA 1CZ8H 4J3XA 5E1QA 2XQ0A 4PJ5B 1AYRA 1U91B 3DYOA 3QJXA 2J88H 1AJ7L 2IQ9L 1JZGA 1R5WB 3NPSC 3PWPE 4PWIA 2DLGA 4PWHA 3LVEA 5E23A 1IM9D 4U7MA 2F54D 2ITEA 3H53A 5HHPB 3T0VA 3TBBA 2ZTBA 3HHSB 1M7IA 2IJ0C 3TTSA 4NRYA 1PSKH 4PJ8D 4PJXF 4ZZKA 2D7OA 4ETQA 5TFSL 3QEQB 5EO1B 3DV4B 4UQCA 4XCFH 4ANUA 5CFHA 3SDAD 4WHDA 3WDJA 3MNWA 2WCPA 4AGOA 3JZ7A 3F6JA 1YMHB 2O6CA 1HKLL 4YO0A 3ATBA 2P5WD 3H85A 3NEOA 3MBWB 2PYEE 1RZ8A 4JFQA 1TR7A 4UTAA 2UZPA 1KYFA 4PJ5A 1U91A 3MYZA 2J1WA 2CLZB 1T0OA 3TNNB 3QXAB 5DU7A 2VC2L 1R5WA 1AGBA 3TPKA 2VQ4A 1KBBA 2IDCA 4O4YL 1GAFH 3MA7B 4DCQA 2Y6TE 3V0GA 3LJ3A 3T3PF 4GMSH 2YD4A 3OPZH 3LD8B 3MV9E 2VNCA 3L48A 3PGFL 4P57A 1CLZL 3UYPA 5I74C 5JIIA 1OAUH 3DSFH 3SGEH 4O5LH 3QEQA 2ZUVA 4BSVB 5T5NF 3DV4A 2APVA 5EUOF 1W8OA 4N68A 3LPGA 1R0AL 1GYWA 4N6RA 1YMHA 2XKSA 1GTNA 3U1SL 1ODAA 4U1NA 2XPGB 3KWWB 3MBWA 3QORC 1KEGH 3RE0A 3PWJB 5D70L 4WWPA 1BEYH 3Q2LA 4PJ7B 1CFQB 2CLZA 3KGSA 2BRRH 3TNNA 1C8QA 2EDMA 3QXAA 2VL5A 3HC4H 3QULB 5BNXD 1SJEA 4HQQL 4QMEA 4AXWA 5C0NC 3VTTA 3MA7A 5CCJA 3QZMA 2P46B 1RUKL 4DOHB 4RNRA 2AK1H 2CM5A 2H2PD 4WFHD 4XI5C 1ECYA 3CTTA 5CGTA 4A6YB 2E7DA 4C59B 2GSGA 2GITB 1QSEB 1DBMH 4OJAA 3EYVB 1AC6A 2F8OA 3J2PA 3MA9L 1NBVH 2NY2D 3LN9A 4TS6A 3UROR 1AOHA 1S7TB 4Y2NA 5JIKA 1IEBB 2I27N 5EPMA 1OTTC 5IHHA 2XTJE 1MFDH 2XPGA 1U8NB 1EJ6A 1BOYA 3PWJA 4G6JH 4B9PA 2YGQA 3KPMA 4PJ7A 1CFQA 5LAXA 2NNFA 1OWWA 2ZJSH 3IGLA 5E4IA 1I9IH 3IU4L 2WWKO 1D7BA 1U0QA 2DQTL 3QQ3B 4UILH 3BAKA 5DZJA 3UBGA 2BNUB 5GGQH 4G7VH 2R39A 3Q8CA 4R6UA 2NY5C 4OB5L 3WKMH 1VZGA 2WKOF 3BPOB 3ZDWA 3GKWH 4MA1C 2UXFA 3BAIA 3LNIA 3EYVA 1MIML 3VUAA 4AGLA 1IIIA 2FIKB 4JPVH 5EIIB 4XCYB 4YUEL 3C5ZD 3P77B 4MMZC 3ZW3A 1IEBA 3DIDA 4RFOL 5D1XD 3U4KA 3TLRA 3HMXL 1GGUA 1KFAH 3LQZA 2YZ1A 3AG1B 1ZCRA 4HWEL 4WFGE 3W57A 3WKQA 5BOPA 5LXGL 2X70B 1PY9A 4KQ4L 4BZ2L 1LJMA 1HHHB 3I9GH 4QTIL 2R9HC 1CC3A 2WUBH 3IGKA 4OLXH 1MZYA 2NTFB 5IG7B 1FNAA 1ROCA 4ODTL 3IF1A 4CN6A 4Z9KB 1ETJA 2ZXWB 3L9EA 3QQ3A 2W65B 3F05A 3ZRCC 3AS2A 2BNUA 1IGFH 5CF3A 1ACYL 2GTWA 4F7CA 5ITBL 5L8JB 3CSFA 2X44D 5D7JD 4MZRA 5FYKU 3DKHA 4X5WB 2A9BA 1A3RL 3B56A 4M6MH 4MCMA 3POHA 1T6WA 2EACA 3UTTE 4F3FB 2FIKA 5FM5M 4XCYA 5EIIA 3P77A 1JHLL 2WZAA 3KG5A 3QNXB 3S37X 4GG6F 3QUXD 4GKNB 1WFOA 1NWOA 1SQMA 4FA8A 3T2NH 3T0BA 5E24E 3H42L 2X70A 1RSYA 2NXYB 4MNGB 2PO6B 5DD6A 1E4WH 3IFOB 2IGFL 5KJRL 2OR8A 2AC0A 3WBDA 1WGVA 2NTFA 3RX9A 2JK5B 2WVTA 3E3QC 4M56A 2HH0H 2AJSH 2IPTH 5LCVA 4F5CA 2CHZA 4U6HB 5DRXA 3QHFL 3QVAA 5L2KD 1IEAB 2QMKA 4OZFG 1I9EA 1EMTH 1TTCA 3FO2A 1JXJA 2ZCLH 2XZAL 2GEEA 2QSTA 3L8QA 3OZ9L 4N87A 1E5UI 1BM3H 3HAEH 4TRPH 4F3FA 4OLWL 1SMOA 4LKXA 3SPVB 3RWCB 1QBLL 2Y24A 5GJSL 1G9MC 1IRAY 3GBDA 3VMNA 5CBAA 3PP4L 4I0PD 2PP9A 4GS7B 3V52L 3INUH 1U4EA 2COVD 5MENA 3CWGA 3ARGD 3IFOA 5TF0A 1U3ZA 1O7VA 2GJ6A 1T66C 2BK8A 3WENA 1XQ4A 4OQTL 1NGPH 4NOBA 2JK5A 3MJ7B 3STZB 3MLVH 5JW4R 4U6HA 3N44B 1FNFA 4QRUB 2EIMB 1CDJA 1YUHB 5JW5B 5CJXA 2DM2A 3DPBB 3MV8B 4NKDB 1I9RH 2XQBL 3MLPA 5EZIL 5C6PB 5GS1B 5ICXB 3TP4A 2LAGB 4JM2C 1TTRA 4O51A 4PW3A 3RYMA 4FQXA 1QR1B 3IBOA 3EYUL 1B4LA 4AQ8A 2XG5B 2NYYD 3RWCA 1SOQA 2BHUA 2V7HB 3BSGA 4NQED 2HFTA 3S9DB 5CU9A 4NKMB 2VZVA 5F7HA 3GMNA 2F58H 5CFAA 4WV1C 3SKNB 4BZ1L 2FB4H 2F54E 1AZRA 1NA8A 3RWJB 4GW1B 4U2YA 2FJHB 3STZA 2OYPA 3MJ7A 5E2WH 4UYPA 3ETBJ 2IGTA 3KJ4C 4J3OH 4YDVA 4UB0L 1YUHA 2APXA 3KPQA 3TBSB 4FD0A 4KHXL 3HLAB 5I1EL 3MV8A 1RK0B 4NKDA 3KGUA 1L0QA 4ZMVA 4QXVA 2W9EH 4G71B 4YIQB 5MI0C 4JVUA 4BE5A 2P5WE 2ALAA 4D9RD 4UMSA 5HD8C 4QKTA 4QDGA 1UKQA 1CE6B 1LVEA 4KROC 2QELA 2RHEA 5GRJL 4XAKD 1EVTC 2K8QA 4R7LA 4JANB 5ENWB 5D6CA 4PUBH 3SKNA 4BUQA 2VDPB 5CD3B 4JKPL 3QZWB 2VZ1A 4GW1A 1KELH 4YAQB 3UFIA 2B2XL 2FJHA 4XNAA 1MFCL 2PW1B 2WXHA 3UYOD 1UFGA 3POCA 1T0NA 1MREH 4KRPD 5I1KH 1ACZA 3T8MA 3K5RA 2R8SL 3TBSA 2VR6A 3HLAA 4UMGA 1RK0A 4G70B 3UZEA 3TO4C 3A47A 5TQ0H 5AYUH 3RL2B 2EDOA 4YIQA 2MPAH 1RKRA 1MH5B 1RK1B 2PYEB 4AGNA 4KKZA 3D85A 4JY4A 1BQRA 1MFVA 4DEPC 4BWTA 5HHXH 1N70A 2OSLB 4HD9A 3PWPA 4DFHA 1HNGA 2CWRA 4JFDB 5ENWA 4DKFL 2YMXL 4AEHL 3OLGA 3Q1EA 5CD3A 3RKDD 2EXWD 1FVEB 1AS7A 5I1HH 3QZWA 2CKNA 1GGCH 3O9WA 3NFSL 4FNLL 1G6VK 3LTVA 1DYZA 2WQAA 43CAA 3DROB 4WFHE 1AXSB 5IB5B 2WBJD 1AHMA 1QTPA 1JP5A 4JRXB 3COOA 4KXCA 3W37A 5DZ9A 1Y6NR 3D48R 2QLYA 4FZ8L 3WXWL 1OZTG 4H26A 3RL2A 4GKSB 3P0YH 2C7UB 4UOZA 1A7PH 1I7ZB 3WN6A 1MH5A 2DLFH 1QFHA 2PYEA 3VXSD 1B90A 4KGJA 5JW4M 2Q7YB 1J1XH 4AK2A 4NQVB 2HKFL 3APNA 5I5JA 5FYLH 1Y07A 1K85A 1R75A 4KI5D 1G9HA 4QYOB 4WW1A 4QYAA 4BKTC 2P3YA 3EJYC 4Y16C 2YLKA 3HG3A 4BXSV 2JTYA 1SHWA 1TU2B 4WW2B 5DDHB 2H1LM 4X80H 2OMVA 1NFKA 3DROA 3LPOA 4AEIL 1N5AA 3ABKB 4JRXA 4EI5C 5DJAA 2YRZA 5DEGA 1N7ML 4OV6F 4QR7A 3VFTB 1MHEB 1XSKA 2ILLA 2C7UA 3APMA 1I7ZA 2BSBA 3LZRA 5D1XE 4IS6A 3C8HA 4GSDH 4K3EH 1ZHKB 2FX9L 2Q7YA 4K55A 5ISZD 4LRIA 1P5UC 4HLJA 4P2OB 1ZT7B 4PRAB 4XPFL 4QYOA 5J6GA 4X4ME 2F18A 2F5AL 3TWYA 2R23B 5L8LB 1A6WL 1IILE 4K7PY 4N85A 4KXDA 1L9QA 1NBYB 2P80A 1TU2A 4BIKA 4WW2A 3NA9L 3CX2A 3NCXA 4AYGA 3GHEH 1VGEL 2JB6B 4LK4A 3G08B 2W07A 4KDVA 1OF0A 3FFCB 3N0AA 1LDPH 1B4TA 4NZ8A 3AXIA 3VFTA 3VB8A 4OI7A 1MHEA 4GBXB 1EFXD 3IPEA 4X4YB 3TEWA 3P0VH 3TEZA 4D9LH 4XOEA 4FXKB 3X3FL 3O4OB 2GSMB 5IQMA 2AI0H 4YHIA 5ETUB 5AAWA 2W0KA 5CGMA 4CN4A 3VRIB 1AD0A 4H5SB 3T4YB 1E40A 3E7JA 4W9GC 8CGTA 5L2KE 1MCNA 3ISRA 1II4E 2WB1A 1SFHA 1B9KA 5D1QD 5BJTA 1EEUA 2JB6A 1B88A 1IO4C 3G08A 2K0RA 1AHWB 2ENPA 3UTTB 2OMWB 1QQDB 4LLAA 4G80A 3WE6B 2QZ5A 4S1SH 4JMXA 2F6AA 1QWNA 3CHSA 2VDMH 4GBXA 2I7OA 4P3CH 4X4YA 5EZJB 1HCZA 2H3XC 2JJVA 4HZ1A 3DO7A 3SDDD 4FXKA 1VB9A 5HHQA 4PM1A 1F8TL 2IWKA 5IVXF 5EBWA 1EPFA 5FUZL 2ZWSA 5K9JL 1KCVL 2G2RA 4PREB 2Y22A 1M3IA 2B1AH 2YD7A 2Y9RT 4OZFH 5E5MB 4GRLB 1UTDA 1H3PH 2AMGA 3M7OA 1DJYA 3VRIA 1E90A 3T4YA 1XZWA 4WJ5B 1XZ0B 2C9RA 5GRUH 1RERA 5E8OA 3ASOB 1T21B 3VGAB 3S4SG 1X5ZA 3RI5K 1TJGH 2DPKA 1I1AB 4GLRH 3AC0A 1AHWA 3SODB 1BDYA 3UTTA 4DF9A 5D7IF 2BWDA 4XXCA 3KPSD 5FA4B 4JCLA 2YK1H 1YY9D 4JO2H 4PJCF 5F21B 1PEWA 3PL6C 5IJVB 3PDGA 1J05B 3VG9B 4NQEE 1VACB 4NJ9L 1ZA6B 1M42A 4FHBD 1XL6A 4X7EC 4AJWA 3ALPA 5K1NA 1MY7A 2R69A 2G3NA 1XFPA 4K5MA 4AE1A 4PREA 1HSAB 2JKSA 4KNTA 5E5MA 2X4OB 5DD1L 5FWQA 1LO2H 3V0WL 3RA7L 1HXKA 3VGEA 3OAZH 4H20H 1TZOA 2MNWA 5IHBA 1NH6A 4WJ5A 2NXZB 5J9PB 1NCWL 1J5OL 1TJIL 3D25B 1RULH 3V79C 1UOKA 1A4KA 4NENB 1SBSH 1T21A 3N41B 1G4RA 4YQXH 5EZLB 4MA8L 1I1AA 1N12A 3RGBA 5L88L 3NP3A 3ZDYE 5F3BB 5ADOL 4UNUA 2WO4A 3RGVC 5FA4A 3FSZA 2XHNA 4EBQH 4YSPA 5IK3A 3KCWA 3D9AL 3RURA 1J05A 2CKBL 1RZGB 1VACA 3G6AA 5DR5H 2O61B 3IJSB 1A64A 2HX8A 1IM9B 4Z3IA 2F54B 1PG7X 5KYUB 1SEQL 2ADFL 2P48B 1HSAA 4KU1A 4MJ5B 4PJ8B 2O5ZL 1X4ZA 2K78A 1SDDB 1FVCA 2OW7A 1B3JA 5J9PA 1BMWA 1NANI 3SDAB 3ARZA 1Q0XH 1KENL 2O5XL 3WFDL 3GSQB 1TTBA 4FFYL 5C2BL 4ZUWA 4NC0B 1VEOA 2C7FA 5F3BA 1V3LA 4YBLB 3ZIMA 3MPCA 2CD0A 1YNKL 4RCAA 5JOPD 2CO7A 2ZUQC 3MJ8B 4DKAA 5DT1H 5FECA 5F9OH 1NIBA 3ZL2A 2ZOTA 1AQ8A 4JFFB 1YEGH 2O61A 1PZDA 4F7TB 3IJSA 1MRFH 4IW4C 2DQEH 2HUEA 1IM9A 4ZAKB 2F54A 5DQJB 3U0PB 5IB4A 4YFLI 2OX5B 4LLUB 5KYUA 1CFVH 3AT9A 2XWDA 4PJ6A 5CNHA 5ACLA 1YEHL 1WCBB 2CLVA 1A7RL 2IIJA 3QXUA 5D5MF 1CDUA 3VI4E 1BQSA 4NJAH 2Y2TA 3WOVA 4P2QB 4F8TA 2Z8VC 3SDAA 3VFGL 5JPMB 4M8VA 1QYGH 4BZYA 4XX1E 5MP6H 3IWUA 5K59F 3QHTC 2P5WA 4DHLA 2VC2B 1SJHB 1JIBA 3VXSE 4R4ND 5HHMD 1VFAB 3MJ8A 2AVFA 3FQTB 4FQLL 1OGTB 5L9DH 3ARYA 3GNML 2R2BA 1Z9PA 2UX7A 4KI5E 5AW2B 4DZBA 2R15A 3CSBA 4NZRL 1O5DT 1IGTB 4F7TA 1F00I 3BZDA 5JHLA 2DTMH 2I9TB 1JGEB 4MJ6B 2D7TH 5DQJA 2Y7NA 3S5YA 2EDLA 2OX5A 1QUNB 1U3HC 4KNSA 1N3NB 3H1ZA 2G3XA 3OGCA 1P1ZA 1AI1L 2MFNA 3LNDA 4XP5H 1Y0LB 3BI9X 3ZLQC 2ICES 1OP3K 3S2AA 5C8JB 3K6DA 4NN5B 1CIDA 5I1DB 2NY2B 3W9DB 1J1OL 1AS8A 3EZ8A 1PEZA 4AOFA 5GS2H 5DGQA 3R4DA 4W70A 5DQ9B 3FQTA 3RX5A 1U30A 3UPRA 5ISZE 4UANA 2NQCA 5TPWL 1AGEB 3F7VB 4YE4L 2YGVA 3O45B 5DK0B 2RJMA 4L3AA 4CJ0A 5SWSD 1IGTA 2BSCA 3F58L 4KTDH 2XV6B 2I9TA 4MJ6A 4UOQA 4G42B 3L4UA 1DQKA 2WCGA 1QUNA 2DQJH 4FG6C 1JZ6A 2YC1B 1BEXA 1M9SA 4YPGB 4JL1A 4OGAD 1AIFB 3ASWA 2HFGH 3QDHA 3QG6B 4AMXA 1Y0LA 4CGUB 4YL9A 1JXGA 4U1SB 1FL5B 5C8JA 1ZS8A 1SHMA 5AVSB 5I1DA 3GIVB 3W9DA 4L05A 4RISL 5GRYA 5D1XB 2V5RA 4NHUB 4LSTL 4K5NA 5E6RB 5JHBA 1ROWA 3TFBA 3VFUA 4NSKB 5DQ9A 1KCUH 4L2LA 4XMWA 4Q9CA 4POUB 1AGEA 5G2NA 4RAHA 2CK2A 2YEZB 3O45A 5DK0A 3A4EA 2EC8A 4XAWH 4ZXBA 3L1OH 1XH2A 1PDKA 1J9SA 1MFBL 1TTAA 4QJ3B 4G42A 1JPTL 3K74B 1YJDL 4QHLA 2YC1A 3BLPX 3EDFA 4YPGA 5D7JB 3ZUCA 2ZWLT 3IJEA 4D7PA 5I0VA 3GBNH 2Y2YA 4L5FH 3PIQB 4H8WL 1PGRB 2ADYA 2MSPA 2V7NB 1YNLH 5MEQB 3H9HA 4KKAC 3C5ZA 2Z31B 3G6JE 4CNIB 5IW1A 2NTSP 5D1XA 5DVNA 1U42A 3QUXB 5J1AB 2NRDA 2VXQL 5ANME 5K9QI 1YZZA 1OW0C 4N1HB 5JTWA 1NCOA 2VMJA 4GSXA 2BIQA 4JPKL 2IDSA 3RDTD 3L4VA 3TASA 3Q48A 4X4MA 2YEZA 1GVIA 1HEHC 1KEMH 2R4RL 4IK7A 1IZKA 1ZPLA 1TZHA 5G4MA 1CICC 2RCSL 5L2KB 2NQ3A 5IVZA 4FJ6A 2XU9A 1S5IL 4PWJA 3U4EB 1W0YT 2DIBA 3MRRA 5D7JA 1ZLWK 3F7YA 1QD0A 2WOBA 2WBWB 4JRLA 2Z8WC 4MLIA 1MW1A 2V7NA 5MEQA 3KPSE 4ALAL 4P5TC 3Q8AA 3B1UA 3JTSB 4ZS7L 4FYRA 1NLBH 1O9WA 2BY0A 4CNIA 1HN1A 2Z1KA 4YHMH 3QUXA 4I0PB 4XP1H 5IFJB 1HYSC 1MRCL 3CNKA 4N8PA 5I66A 3DX7B 3T3PE 4Q9QH 5I19L 4IOFC 3LKPB 4N0FB 5JO5B 3TJPA 4B0MM 3ARGB 2GTZB 4EI6A 2EUWA 1Z66A 5ADPH 1CIUA 1HHKB 2IBZY 4XH2A 5AW1B 4KZCA 5EUOE 5L2KA 2ZKXA 2YAOA 4RWYH 3WCYA 5JHLH 5EF3A 4N3TA 2DKMA 1BMZA 2CBTA 3U4EA 1PY4A 4HCGA 3A6CH 2AQSA 1ZV2A 1MWAL 4B3EA 1RZKH 3TFKD 4HP5A 3CXHK 5TK4A 3ZSTA 2BVYA 1DZBA 3QUKB 3JTSA 4I0PA 5LNGA 1YO4A 1U8KB 2H32B 3BQVA 2P7TB 1KJ3L 2FO4B 2G4GA 3CFNA 3ULUF 5JO5A 3OJDA 3ARGA 4D3CH 1BF8A 3GMQB 1HHKA 3QGVA 3L4CA 3U30C 2DMGA 2J20A 2YD2A 1NAML 4ANXA 1A0QL 3GSOB 4Q2ZB 3V7MA 5HTSA 3HG4A 1DQLL 5HJGA 3FJTA 3V4UH 3RY6A 4W9JC 4HUXA 4NYLB 5EV7A 3HS9A 5C08D 1KXVC 4QY8B 5JXAL 3ZRSA 4E9YA 4RMBA 5JOPE 1E8XA 2X10A 5FR3A 2AQ2A 4NOFA 1OZUA 3NCJL 4NQEA 1U8KA 2Z0BA 3KCPA 2P7TA 3SOBL 3B83A 2EDYA 3GTNA 4OBRA 2FO4A 5GGSY 1CTOA 5FO7B 2RACA 4B6ZA 2Q6WB 2Z3FA 2YQ2A 4ZMYA 2G75B 4L3EB 2BIHA 5FCSH 5DUPL 3BGAA 3O2WH 1YYLL 5JHMA 3KLHD 1FRGH 3GSOA 3II1A 1XSIA 1U8LA 4J3OC 4QTFA 1P6AB 1UA3A 2WXPA 4YZFE 4HAKA 3A6BL 3QZNA 3MUGA 5AWNH 1SVCP 1EO8H 1ILSA 3K6SB 2X4QB 3FN0H 4PJ9C 3L5IA 3MN8A 3GM0A 4ZODA 3PJSB 1M05A 4Z6AT 2Z1PA 2PR4H 2D03H 9CGTA 3VXRD 3E2HB 2FZ3A 1C5CH 2ROXA 4YXLL 3NIGB 4D7BA 2W38A 3I2CH 5FO7A 1VF5C 3TTYA 4R7VA 3K1DA 5I6KA 2G75A 2HB0A 5IQLA 4GT7A 2WBJB 2NY3C 3PUUA 3UGXA 4WWKD 2W9DH 4ODSL 3R8BB 3RVTC 2WTRA 4M1DH 5AG8A 2B7DT 1OEZW 4Y8DC 4TVPE 4Y19D 4PRIB 3MGAA 4U1IB 5H35B 5E6UB 4JDZB 4TQEL 2OZ4A 2CHDA 2EXYD 4NO5A 4TULH 1AXTL 1UH3A 3K6SA 3VXSB 5L4JA 2FWOB 5F7FA 3K8KA 4MXWL 5DCCA 4EZMA 3ULSA 2ZOKB 3PJSA 2IC2A 3WS3B 5SWSE 2IF7A 4ANKA 4FLOA 5E6ZA 3ARUA 1OLLA 5DHYB 3J07A 4N2OA 1F97A 2WBJA 3HRZB 4HMEA 3VI4A 1IC5H 4IDJL 2ZKMX 1FWXA 2AQPA 3GB7B 1AKJB 4M1CD 3IS1X 4U1IA 3DVIA 1FFNB 4JDZA 4ELDA 3U0TB 3FB6B 3RIFF 3VXSA 2FWOA 1NCUA 4P5RA 3HB3D 2AJUH 2FBRA 5EC2B 3KR3L 3QCTL 4NN7C 5D1ZI 4EDWH 2ZOKA 4XPGH 3UCQA 4A2DA 5IFHL 5LDUA 1BAWA 1BAGA 1LP9E 3SD5A 1CVSC 1FJ1B 2FR4A 1U3NA 1U2CA 2X89D 2ARJA 2XXFA 1RZIA 5ICYA 2FAUA 3F01A 5DMGC 1XF2B 5DHYA 5I8KH 4LU5H 1VCBC 3PXJA 4LSVH 3P1VA 4TTDD 3WJMA 3ZXAC 3QJTB 2C9XA 2J4WH 1XAUA 3GXIA 5B4MD 2YAPA 5KVDE 4K8RL 3CLFL 3VXMD 2GFBA 3NRPA 1EFXB 1X5GA 2ZCKL 5IESL 4Y1AD 3QZPA 5DHMC 3U0TA 4IRZH 3FB6A 4JPWL 1YUKB 4ODVH 5C0EB 2NDFA 4Z7WF 4WEEA 5ISZA 1JGIA 4A2LA 1I9JL 2XRAL 5A7EA 4UZSA 3FHAA 3B37A 4NPJA 5A2JH 2XZQL 4UQEA 4PSRA 1J18A 4QHNB 1BVZA 1FJ1A 4P59H 4QXUH 4YDNA 3RL1B 5F88B 5EF2A 2ENQA 2Q3XA 2R0KL 1NL0L 2GCYB 1GC1L 4GMTH 3OBAA 4N5ED 4NCC2 5D1QB 1KJ2A 2CGYA 2B4CH 5AL0A 4JZJB 3E6HB 1ULVA 5FEBA 2X0UA 1KBPA 5L4IA 4TL5A 3TT3L 4N26A 3V8OA 1TZ8A 4UNVA 3N1GC 3P30H 5I8CB 2CK0L 1P84K 4L9LC 4WRLA 2C3HA 3SDDB 1PKQE 1AZCA 3FQRB 4PJXB 4PLKD 1IFHL 1BJMA 4UM8B 1U8QB 1WF5A 5TF1H 3HI1B 5C70A 1MZZA 3I6LD 4QHPA 5GRWA 3V7AG 2ITDB 5F88A 1JMZA 5CGYC 1P2CB 2E6JA 2GCYA 1C5BH 2X0VA 4NO3B 5DJZA 5JIQA 3RHWF 2YWYA 2YA1A 3VW3L 2XVGA 4R3SB 3E6HA 1I8LA 1SPDA 4GXUN 3N2JA 3LXAA 3G6JA 5I18L 2R7EB 4JFSA 1NPUA 5I8CA 3CZNA 1JCKA 5ANMA 3WLBB 1FZMB 3QO0B 4PGZA 5C0BB 5TQ2L 4ONFH 3T3PB 2P28B 3SDDA 1C8PA 3ECUA 4IMKA 3C9NB 4Y2DC 1KWKA 1GPOL 1U8QA 4O2EB 4WGVB 3D4ZA 2VDRL 3HI1A 2APTA 4LLQB 3GYRA 1NICA 5EUOB 1G9NC 1LWRA 2Q8AL 3RUGF 5A2IH 4UQ3B 3UEZA 3L6FA 1J10A 2W0FA 5F7BA 3B5HA 3KYOB 2R29H 5DO8A 2VYRE 4WWOA 4RMQA 5ID0B 3U82B 4X6BA 3G04B 1J1PL 1FAIL 3KPSA 1CXIA 1SDYA 3WJLC 3AFLA 1NM4A 4B5EA 4JAMB 4R90L 4R5VA 3AU1A 3WLBA 5F0LB 5ITFA 3AREB 3QO0A 2CJUL 4ERSH 1IAII 4I3RL 1G7IA 5F1SA 4WHCA 3UL4A 4G8GB 2GHZA 3C9NA 4MNHB 2RA1A 4OLZL 3FQXB 3S3PA 5I6MA 4O2EA 1M2VB 4C54A 4YS4A 5EUOA 5HI5D 1OB0A 4BQBA 2VR9A 3CHRA 3NABL 2PW2B 4K71C 5FKPB 3ULVL 3HZKB 2K70A 2H7WA 3U36A 2AEOA 3KYOA 3RLSA 4LSSL 1CD1B 1RU9H 5KSAC 2FT6A 1JHKL 4X5LA 2WQ8A 4M03A 1T7VA 2YA2A 1PLCA 5BMFH 2CKBB 3QIBC 4OLVL 4YHOL 1A4CA 5JOFB 4TLUA 4U2ZA 5TE4L 2GHWB 4RDQG 3LHPH 2WWMC 4GW4B 4JAMA 2RFXB 4XNBA 3SJVD 4L8SC 3CDCA 1WZ1H 5AENA 4FULA 3PGDB 3VXRE 3U9UB 4N2EA 5BOJA 1YEIL 5EEXA 2HT3C 1OSZA 3LEYL 4MNHA 4IU3B 2XA8L 3OJ2C 4PJEF 5C92A 5AVQB 2ZAGA 4B41A 4G6MH 1QFOA 1TFPA 1T4KB 1PPIA 1A65A 1XR9A 5HJ3B 2PW2A 4QRPD 5FKPA 1AR1D 4J27A 3HZKA 4PBDA 4XMXA 3V2AR 3X1NA 5HBBA 3DYMA 1M9WA 1CD1A 4Y19E 3MLTB 4B27A 3UMNA 1NKOA 1KJ2H 1YPZF 4UQ9A 2NY1C 2V3DA 2GI7A 2CKBA 3FRPB 4MFHA 1P4LB 4D94A 3K0YA 5HHMB 3T77B 1KGCD 4LPCA 4PCYA 4GW4A 3P0GB 3ROOB 1I3GH 2WP3T 2IPKA 4CVXA 3K2IA 5FOBB 1DJWA 5J3HD 3U9UA 1ZEAH 2WKOA 2COQA 4XRCA 5JIHA 4ELMB 3BMVA 3CFKB 2CRIA 2FEEL 4IU3A 1WIUA 3LZLA 4PS8A 4ZX3A 4Z3JA 4AZ8A 4V2CB 1T4KA 4XC3H 5C0CD 1CGXA 1DTUA 4XGZB 5HJ3A 3VFMB 4FFYA 4KJWD 4GG6B 2YA0A 3BKYL 3U9PH 3D07A 5CP7B 3VD7A 2NY7L 4C4UA 4GXFA 3HN3A 3MLTA 5INDB 5B3SB 5DHDA 3K1KC 4OJCA 4S1RH 2OKMA 5IVXE 5HI3D 1SY6L 2EDQA 5GZOD 1P4LA 1ZAGA 2AP2A 1YHPA 3BEWA 3DK0A 3RWIA 4YXHL 1S78C 2LFEA 4JR9L 5IFAL 4Z7NF 4Z7VE 3ROOA 1BFVH 4MXQC 5KJ7E 2ZT9C 4HIEA 3L3OB 4CMHB 5SWSB 1X5YA 4DP2X 4O58H 2KZKA 4QXTA 3QPXL 2WY3B 3CFKA 4GAJL 1ED3A 5E8NB 1U8JB 5CR8A 2AQ3A 1EO5A 4LEEA 4F9LA 4GW5B 5D7IE 1NM9A 5E56A 5EF1A 1F6FB 2OXGA 3CXDL 4GQRA 4I3SL 4JFPA 4L1SA 3B9KD 1JGVH 3FQYA 2Z7ZA 4XGZA 3I3EA 1XF5B 3VFMA 3OGOE 4FFZH 4PJCE 5CZKA 3TBVA 1F4WH 2XBZA 3OHXA 4KH9A 4KK8C 2H1PH 5CP7A 3H0TB 1ADQL 5EC1A 2WXNA 2APSA 1C12B 3FTGB 3HZYA 4TPRH 3S36H 3VXME 2AANA 1KN2L 4Y1AE 1IZJA 3RJDA 2K6ZA 1OCRB 3CX5K 1DP0A 3TBTB 4P06A 3HE6C 5A16B 5BZDA 3EJTA 2YPVA 5DMKA 4ONGL 4HBCL 1E9OA 5SWSA 4RMUA 2WXJA 5E9AA 2DQFA 4M48L 1SYVA 2B5IC 2WJ7A 4L9DA 3K72B 2B9BA 2I07B 1KY7A 3FQ4A 5E8NA 5LGHH 1U8JA 1HXYB 2E27L 1YQVL 2LLLA 2OMUA 1TITA 1E3FA 4GW5A 4XVJL 5DA0B 1VFMA 3V5DB 1NMAL 2BOBA 1JPFB 2YXFA 4DW2H 5CLYA 2WV3A 3LN4B 4K3JH 3BAEH 2BRQA 3MRLA 3QPQD 3H0TA 1F11A 3FCTB 4ZNCD 5TH2B 4RGMB 3ZSSA 5AALA 3ULUD 1NLDH 1TQCB 1YC7A 5FAAA 4F7MB 5I73C 4XMZA 4IGBB 4DP5X 5FGSA 4Q8BA 3KL0A 2GUOB 5AZ2H 3ECBB 3TBTA 5CWSB 3ZL4L 5CM1A 2R2EB 3PWNB 1LP9A 2YKLH 3I6LE 4ANWA 1HL4A 1KPUB 1S9VB 2UZXA 4Q89A 4QRQB 4Q9BA 3LH2H 3K72A 4WFFD 2I07A 2FLMA 4HJGB 4FNSA 1XTMA 2L04A 3S3SA 3V5DA 3WTSA 1KPRB 3EYOB 2ROYA 3VYNA 4A67A 3MROB 3LN4A 2HWZH 5EEYA 4JJ5A 1T5WA 4U31A 3AM8A 1N8ZB 4X0KB 3UERA 3VE0A 4WVRA 4FADA 1ASOA 5AEAA 3WELA 4F7MA 1OM3H 3ETSA 1JI2A 4OD1L 5EORL 3RDTA 4FXLA 2R27A 1G1CA 2WM0A 1EIBA 3H55A 3JV6B 5EOQH 1MHPL 3IAPA 4RLDA 2R2EA 5D5ME 3PWNA 1KC5L 4R0LB 2KHAA 2V8MA 2OI9C 3QJHB 4K5PA 3LVTA 4GXVL 4K23H 1XGYL 1H8OA 1S9VA 4QRQA 3G5YA 5K59E 4G9DB 2HKHL 4NWTL 4N9GB 2DEYX 5IJKA 2F7QA 4LSDA 5E2UH 4A2FA 5TE7H 1AZZC 3G5XA 1PL3A 1KPRA 2WCSA 3BX7C 1FO0H 3VWJB 3H9YA 2AHIA 4I18B 3HG1D 4LSRL 3QNZB 3NZ8A 1IKNC 4X0KA 1FVDB 4J12A 3QDJB 4U1MA 5F7AA 2DWEB 2FQDA 2OR9H 5T5FH 4TF4A 2ZZUT 1AZVA 4OD3H 1PKQA 1W0WB 1EHLL 3FQ1A 1SUHA 3QQ4B 1T2QL 5F97E 3I9AA 2BNRD 3JV6A 2FJUB 3P4NB 3STLB 3QJHA 1BVNP 2UUDK 3NCCB 1MWAB 1XXDC 4A2HA 2VXVH 1U92B 4G9DA 2ITFA 4N9GA 4C57C 4ZJ9A 1OKEA 5CIPB 4EKJA 3C6LC 1YVLA 1U8HB 1OCCB 3VDCA 2VQ1B 5AB2A 1FV1B 5F7NC 1JDCA 4OFKA 3KWUA 1R5IB 5BW7C 5HHNB 5C08B 3BUDA 5HDOA 4I18A 2F15A 1ORSB 4H1LA 3RDJA 4TVPH 4XWOD 4HJSA 4JFXB 1FVDA 1RMFL 3SE4A 2VN5A 3SJVE 3O8XD 4Z7UF 4B7LA 2A38A 4WENB 4Q7DA 5IROD 3GT6A 2ISDA 2PTTB 3QQ4A 3WO4B 5E00A 1NAMB 5D1ZC 3X1GA 5GQBA 3P4NA 3RZWA 3AG2B 4JG5A 3MLRL 2X7LB 3EGSB 4YX2L 4LCUA 1B0IA 4QRPE 2OJZH 1UWXH 3ARDD 5CIPA 3L9RB 5LAPA 4FZEL 4ODHH 4CILA 4O02L 1UYWL 1FV1A 1X44A 2XA3A 5HGDB 3T6VA 1A6AB 5HHNA 1G7QB 4YSAA 1W2KT 1PMYA 2EEFA 3QDAA 4Y4FD 3RIFK 1ORSA 4U4BA 4A2MA 3LKSB 3TV8A 1M4KA 1KGCE 4JFXA 4E9QA 3D4CA 4KXZH 3QJZA 2EVGA 2BP3A 3WFEL 1EJOH 2VITB 1FSKB 1ZTXL 2CGRL 1OF2B 5C0RH 2PTTA 1NCGA 3FUDA 2NY6C 5GGTL 3MXVL 3NTCL 1YSOA 2X53A 3Q05A 1BJ8A 1UACL 5BV7L 5EU6B 4HG4K 5CEZH 1INDH 2JVUA 5AB0A 3EGSA 1MCRA 2VSCA 3ZDXF 5C0CE 3EJZD 4WWKB 3AITA 1PAMA 3M86A 5CJOH 3A6OA 3TGXA 4FXTA 1PQZB 2A1WH 3CUPB 3L9RA 4Y19B 4KKCC 1WFUA 2QFPA 2X4RB 2J72A 3HVDA 1KIUA 4FFWC 5HGDA 2QHLA 1G7QA 1MAML 2J21A 5DJ2B 5C07D 1I1CA 2B15A 3LKSA 5KVDH 3NH7L 2DQIL 2I69A 3WEBA 2UV3A 3TZVD 3EFDL 3VSUA 1GGBL 2VITA 4FP8L 3VXRA 2X2HA 1J11A 3VGBA 3WSQH 4JY5H 5J56B 1OF2A 4KTEL 1U8OB 2JI3A 2C1OA 3UABA 4N22A 5D7KD 2X1XR 3FULA 1U4FA 2AITA 2FLBT 2PPDA 4Y7OC 5HYJD 4NI6A 4XNQA 3RU8H 3T09A 4A66A 2YKKA 3CN2A 4I9WD 2X41A 1E4HA 2X5PA 4U49A 1QAWA 5T1MA 4Y19A 1SMDA 3CUPA 3OG4B 1MRDH 3I74A 4LRNH 4PS4L 4PIBA 1AHKA 3BRDA 1MAKA 3VJ6B 1A5FL 4OGYL 1FHNA 4MDIB 5B21A 4ZPTB 5IVXB 3K0WA 2CU9A 5M95B 2XN1A 3WTYA 4Z3HA 3TYFB 2FE0A 3M1BA 1U21A 1PZ3A 1G94A 3HB3B 5FYKL 4XXWA 1QTSA 4MRBA 3WIFB 3UO8B 2Q76B 3US0A 1BVKA 4NQSB 2GKIA 3S37L 4XPTL 4ZOCA 2J1ZA 3ARTA 3UDWC 4N3UA 5HJBA 1OSYA 1OP9A 1Q9KA 5GS3A 1U8OA 1XCTA 1J9RA 1T22B 2DQCL 1URIA 2ZXAA 1K6QH 2EDFA 3BEVA 1N26A 1RP9A 1S3KH 4X9GA 3VFSB 3Q5YA 1MCBA 4P3DB 2R2HB 4QO1A 4PJCB 4ZW7A 5B1JA 4N0CC 3V4VH 2NR6C 4WY7H 5IR1A 3BDXA 3FAWA 2J6WA 1FGVH 1SLUA 1RURH 4X99B 3FAXA 4P46C 3VJ6A 3F5WA 3ULUE 5IVXA 4Y1AB 3UAFA 3TA3C 3TYFA 5HYSB 3DXAE 1CFNB 4U1JB 5EDSA 2AQ1A 1WT5A 4MMYB 4H7VA 4U3CA 4N8VB 3WIFA 5HVHC 1FH2A 4ZMZA 3KXFB 2BZDA 4FQ1H 3TCXA 1KJMA 1KV7A 1EHKB 3QUML 4Q58C 5BXFB 2D3LA 1ND0B 2X89A 1P0SE 2ZIDA 1OTSD 4BFOA 1X5AA 1I7RB 4J4PA 4B60A 4M3KB 4WI8A 3KYKL 3PGCB 5D7IA 1DVYA 1CGSH 2O6DA 3JBG7 4P3DA 1ZV9A 4HIQA 4RGND 1WUZA 4PJCA 4ATWA 2MNJB 4KVNH 5E5LA 4P05A 1OAJA 1JK8B 4RMSA 2DI8A 1S9YB 2W80C 3AADB 3B8SA 5F44A 3VG0H 3VXMA 3RPKA 2FQFA 2IV8A 1I1YA 3KPLB 4Y1AA 1GS8A 3FUMA 1ITCA 1CFNA 4U1JA 1ZHNA 3RJOA 3TBWB 4MMYA 1KGJA 5G4OA 5TDNB 3U46B 4N8VA 3GZQA 4A6YH 4DFIA 3TF4A 4F2ME 2HJFB 1CD8A 3NG5A 1LO3H 4QHUB 3AY4A 1G7PA 4K07A 4OM0H 1H8SA 3FUFA 5HI4C 2WGNB 4BFJA 3WKYA 1ND0A 1KTDB 2P8PA 3BUQA 2GBTA 5ILTL 3B7UX 3WS6C 3H2WA 1JOIA 3PGCA 4HUNB 2FWSA 3MRIB 4MJHA 4UT9A 4OZHF 3RG1C 3DMMC 1HJBC 4KOCA 4UDUB 5CCKH 2WN2A 5FCUH 2Z64C 1O6SA 2CRZA 2GT9B 4IKKA 5GGVL 1JK8A 3DLQR 3HG1E 1SJXA 5B7EA 1E6OH 1AQMA 3PLYA 4Y4KB 3FU6A 5C09D 1YMME 3LNFA 4ENZA 2DAVA 1H6EA 3U46A 2FGWL 3FQUB 4G6AC 4QHMB 4IKJA 2BNRE 4WIQA 2HJFA 4G1EB 4FC3E 1UM4L 4HD5A 3LZPA 3TJEH 1E6JL 4YDIH 1HKFA 4LF3A 1A4JB 4UI2A 3ETTA 4QOKE 4ZTOL 1V10A 5ID1A 2EEBA 4HKXB 3MRIA 3QQ9C 4PB9H 4HK3N 4M5YL 5DD0H 4MASA 3ZX1A 3K81A 4UDUA 3KEHA 4YLQT 3QDMD 1DSYA 1S9WA 1Y18B 5GIRB 3MLWL 4ZS6D 3TF7C 3EADA 3F3HA 2GK2A 3VYOA 2VDRB 5DMIL 4U1GC 4U7SA 4C83B 4M3HA 3FQUA 4WK0B 3SDXF 1N6VA 4LCIH 4JJOA 4QHMA 5D5MA 4I8DA 2TAAA 2BHYA 5ANHA 4R2GC 3LMJL 3D8MA 4HXBL 1E5BA 4HG4J 3CN0A 1MVYA 4PJBF 3HNTH 3BO8B 1AANA 2AGJH 4F15C 1JTPA 2A3TA 4FKKA 2UX6A 4HKXA 1MCQA 5E94B 4J3SA 3D39E 2VQTA 4DN3H 4HFUL 3SO3C 2BXZA 1T6BX 3PDOB 4S2SB 5C0AD 1MPAH 4QWWC 2CNYA 2V5YA 1V7ML 4W4OC 3SJVB 2YS4A 2ZYIA 1OCWL 2PETA 1AFVL 1FGNL 3OXSB 5FK9B 3GIZH 1FFQA 4LFHD 1D7CA 1BYNA 2XFXA 4A7GF 2W5PA 4X9HA 1MIEL 4UNTA 4M93B 4YN3A 1YYCA 3S2CA 1VDGA 5ALCH 4I88A 4DKTA 2H6UA 4EDXB 3KBFA 1C7SA 3TESA 1FBIL 2CRYA 1DJSA 1IC4H 1S2EA 2H6PA 1AR1B 3UGEA 3ZZQA 3WEOA 4IU2B 2YOAA 3GHPA 4W9HC 1F90H 3FOLA 2ZP8A 5TE6H 3VXUE 1JDAA 1NDTA 4J28A 5DLMH 3ZO0A 5E94A 4Z7WE 1IAKB 2Z65C 3SBWA 3MJ9H 2X6VA 2NZ9D 3WE1A 5KAQF 4LGRB 4Y9EA 4FX5A 3PDOA 4S2SA 5EB9A 4JHAL 4AT6B 5C07E 3GI9H 4DN4L 1YAIA 2VM9A 3SJVA 3LKNB 4JM2F 1KXQE 2JKIS 2LVEA 4LPUA 3OXSA 2R59A 4AMKH 4JKNA 4MQ7A 4F57H 5CN3A 2CA4A 3SY0B 2YIHA 1JF5A 3L4WA 1C1EL 2J43A 1B2YA 5D7KE 2NZIA 3BIKB 4JKMA 4YVUA 5DQDH 4Y5YA 5HYJE 4MCYA 4QRPA 3O6KL 3E80A 4FMVA 4I9WE 4IU2A 5BCAA 1GZHA 4L3FA 4U6VL 5HGBA 3BT2H 1IAKA 3QXTA 2DQGL 3DOSB 4YHPB 3VI3F 2MNUA 4BHUA 1WD8A 4ZFFB 1E7VA 3FT0A 2WLZA 4Q14A 2DJSA 1U2YA 3L7FB 2OSYA 3RVVD 4LPXA 3WN5A 5IOKA 2YGNA 2BO0A 2A99A 3B5GA 3UBXA 4TNWF 1LE9B 3QDGB 3BIKA 3NACL 5C0CA 2QKSA 3B9KB 4E42B 4HJ0C 3PHOB 3RIAF 3ENEA 3LQMA 2VDPH 2VE6B 3EJSA 4K94H 4HUUA 4O9HH 1T4WA 4YHPA 4B50A 4NNXB 5KYXA 5GZOA 5IHZB 3U7WH 3L08A 5AOJA 3KE0A 4BA8A 4ZFFA 3RUGE 3DBXB 3EFFB 5I6LA 2R1YA 2KH2B 1KBGL 2HJLB 3PFQA 2XJLA 2YD8A 4JO3H 2QVMA 3L7FA 4ABUA 1ID5I 4YHZL 2X4SA 1BIIB 4Q6IC 3QR2A 1EJ8A 1GYVA 1JV2A 2Q87A 3EO9L 4RFNC 3WHE0 3T6QC 3B9KA 5DZNA 1L5GB 2V5SA 3L4TA 1TEGA 3HS0C 3F7KA 2VE6A 4IBLT 4IRJA 2C3VB 1KB5L 1UH4A 1G0YR 1PYWA 2FBJL 5I1GL 5DWPA 1PX8A 1T80A 5IHZA 4PJFE 1QA9B 4CSTA 3S34L 4X4XA 3T2LA 1Q9OA 2HJLA 3KVQA 4HEME 5HYEA 3LNHA 2DTSA 3GLAA 2OL3L 3B2VL 4WU7B 3B2XA 4ZSOE 1VFOA 3QZLA 3UTSD 1WV7T 5J1TC 4HSQA 2FQGA 4KK9D 5D4JA 5I0XA 5I2IB 4JO4L 4JFYB 1L5GA 1NSNH 2XTSA 4HT1H 4P9HH 2OM5A 8FABB 3LV3B 4XMVA 1LK3L 2C3VA 3LX9A 1ZK5A 1AE6H 3BSZH 3DXAA 3MRFA 4QXGH 4PJEE 2QADD 1WFTA 3BPLC 5L6YH 1K2DB 2FGZA 3IFNL 4N0YL 3QC5X 5E2VH 4K4KA 4HFWA 3NJLA 4W6YB 4HJJH 2BLFA 5BUAA 2WN3A 5D2LF 2OMTB 4JFUA 5CEYA 4K7PH 4AEEA 4OVUA 4KKBD 4RA3A 4CUCA 1PG7L 5KUMA 2WLJA 3E9UA 1XB8A 3SPHA 4J5VA 5I2IA 1UA7A 4JFYA 2QL1A 2AJZB 4IOSD 3HG1B 3REWB 1S8DB 4XMPL 5DUML 8FABA 3QDME 4KKRA 4P2CG 4ZZFA 5JDSB 2DM7A 2FL5A 3C60C 5DK2B 2N0KA 4AJYV 4OJDH 4CJ1A 2PP8A 3W2DH 4HSAC 2F53E 2VXSL 2G9HB 3IETA 1K2DA 3C87A 4MZ3A 4R83A 2VXUH 4P23C 4F2MA 1KWGA 2BNRB 1EGJH 3SE3A 1CR9H 2CDGB 3BPNC 3RTQC 4U7KA 5BVJB 2EKSA 1PCSA 3O3BB 4HA1A 4DZ8A 3N9GH 2X4TB 3FT1A 1GTFA 4QHKI 3QRGL 1OT2A 3KYAA 1RPUA 2NNCA 2XLLA 3NJKA 4M7KH 2PR9A 4IBZA 4QT5B 5CSBA 4FL4B 5FIEA 2B77A 3HI5H 2D3NA 4HPYH 3E8VA 5EZPA 4ORZC 2EH8L 3H3KA 1QFWM 5C0AE 4HOZA 3DX6A 1DFBL 1OQOA 3HG1A 4PRHD 3REWA 2J8UF 2VMEA 4HAFA 4HJUA 2A9AA 5JDSA 1OAYH 3GJFH 4TSBL 4X6EB 1WA0X 5CUSL 5DK2A 5CZVH 3OAYK 5CJQL 4YSSA 3O8XB 4ENEC 5F8RC 1BLIA 1QUPA 2GYSA 3DUUB 5KEZA 3DWTA 1N0XH 4L0YA 2KMWA 2ZOUA 2BNRA 4AQEA 3DJ9A 4LDCA 2CDGA 2ZG1A 2HRPL 1QPPA 3FO1A 3WIHA 2WLIA 2LU5A 4Z18A 3BP5A 3O3BA 3Q5TA 2X4TA 3CVIH 4E0RB 1WFIA 5BVPL 3HE7C 4X7SL 3SYAA 1ZVSA 4QOKA 4QT5A 1KOAA 2H0PA 3BH9B 4W6XB 5AZUA 1BGXL 1CTNA 2ZWKA 3FT9A 4I3GA 3HI6L 3CFCH 5FGBC 1JFQL 2HLAB 3KGTA 3FQNB 4K2UH 3FC8A 2ATAA 1D6EB 4N2LA 2EUVA 1QSZA 4OFQA 2GAZA 4JB9H 2BIIA 2HN7B 3U4BL 2WBXA 4M7JH 1EXUB 2OYKA 3MRHB 1HNYA 5IROA 1DBBL 3T0ED 1UXLA 4MMXC 3VD4A 1IQWH 4F8NA 2AERT 1OAKH 1GS6X 5KTEH 4UIMB 1WQVT 2ZX5A 5C7XH 3F7PC 4WI3A 1CS6A 5D6DA 3MKKA 2O5YL 3V4PL 3FTYA 1MLBB 3L1GA 2ZX7A 4O02B 4MYWB 2MQGA 4OQ1A 1RVFL 2OMXB 4A37A 4L1TA 2K1MA 3ARDA 3PUCA 2IALA 5E03A 3IJYB 4Z7WB 2YPLD 1TJHL 3D39A 3OQRA 3VQ1C 2BOLA 3QG7H 5IMMA 4JHWH 5T1KB 2HLAA 5EEUA 2K6WA 4Y4FA 3NIDF 1OAZL 5F72S 3M6DA 4XC1L 2IMMA 1W6WA 4UV7L 1E5YA 1MI5E 5DC9B 1CF8H 4K3DL 2DI7A 3FPYA 1HOCA 2YAHA 5BV7B 2VN7A 4WUUB 4JN1H 3W11D 3ZGIA 4UIMA 1JZEA 2JQZA 2GVYA 5C0ND 1N59A 2A2QT 4X9BA 3PREA 3IN0A 5LBSA 1ANUA 4LOVA 4O02A 1ZT1B 1M6OB 2OMXA 1CLOL 1DQVA 5DFWH 4NQTA 3Q01A 3VXUA 2QVFB 3RNQA 3IJYA 2QGEA 2C1PB 4Z7WA 1SN0A 2Z7UA 1H5BA 4IHOB 2QLVB 5C07A 1OTTD 3SPIA 5LGKA 1UH2A 4M8QA 2DWDB 2FCBA 3THMH 3BZFB 3DPDA 5GGTA 4JNXA 3TZVA 1WK0A 1WWBX 3QQNA 4R4FL 5IT2L 1GJWA 2E0PA 4AEFA 1KXQA 3UXFA 4TM9A 3VNYA 6PAZA 1EAOA 3MGTA 3UTPD 3IPFA 4NQCE 1WISA 1JZ8A 1SLXA 3MCKB 1QFPA 4JFZL 3B3BA 4BINA 5HYJA 2J5LC 1ZT1A 1M6OA 1R34A 2DLHA 1TYEB 4N2HA 4NC1C 5IMKA 3KPRD 1WA1X 4LEXL 2G0LA 5TFSH 3X11B 4HIXH 2C1PA 3C6EA 2BVQB 4YNYB 4JG9A 3AG4B 5K93A 1CDIA 1SLVA 2D7MA 3HPJB 4HOWA 2G5BB 1HKLH 3RUGB 3FZUD 3BZFA 1WH0A 1VGKB 4QAWA 3S0PA 3SBQA 3I84A 2ZKYA 2R9HD 2DWTA 2ZYHA 4XPAH 1PLBA 5IQ7L 1JI1A 1Z3GL 3E8UL 3EJCA 2GW5A 4Z7QF 3NCBB 1GGTA 3OC5A 1Z5LB 4PP2B 5GGUA 3AACA 4G7YH 3B6SB 4NZUL 1PU0A 2H26B 4GAGL 4RGNB 1M7DA 2C9PA 4X6DF 2IAND 5DWUH 2IBGA 4F91B 1PZCA 3TYGH 3JV4B 1CLZH 4Z7UE 3BVTA 3MMEB 3SQBB 1F58H 4YNYA 1HL5A 3VXPB 2ZF8A 5FHBL 1R0AH 5EH1A 2FNBA 2GUYA 4J3WA 2G5BA 4UBDC 3QUMB 4G9FD 5TDOB 3H6JA 3RUGA 4Z8FH 3A67L 1T7XA 1TF4A 2VLJD 3LD8C 3CZJA 4XNUL 1VGKA 2UZIH 2R4SL 1CFSB 3H7LA 5D70H 1O9ZA 5LAXB 5C7ZA 4NGHL 1SHSA 4YHNB 4PG9B 3MFFA 1NOFA 1EHNA 4NBYB 3RWGB 2PXYD 5DRWB 5E2TL 3BZEA 2CRMA 2Q5BA 3FMGL 4FHKA 4MB1A 1DVSA 4KMTL 3Q3GB 2WKLA 1RUKH 3FB8B 3D2UB 1C16B 1NWPA 4RQQB 5ERWA 1A7OL 3AWEA 4AW4A 2X05A 3HMWH 4NM4H 4OF5A 1QKZL 3Q13A 4D0CA 3MLSL 1YQ2A 4QTHA 3FQWA 3OPUA 5C09B 3U7YL 2PPEA 3VXPA 4DAGL 3UC0L 4PJFA 4PJEB 1U95A 4KAQL 5C86A 5IUSA 2NNXA 1SM3L 2V9TA 4TLTA 3QUMA 3C5XA 5TDOA 3C8DA 2DOCA 3GLZA 5JORB 3MYJB 5ECGA 3WHXA 5K9OB 3T0WA 1CFSA 1OK0A 1IAIL 1KXTB 1KJVB 2PP7A 4PY7A 4HEMA 4PG9A 3FT3B 3JWDL 5D7LD 3U2JA 5T33L 2DN7A 2WTPA 1RFDH 1YPZB 2ZYRA 2YUWA 1J0ZA 4KKLC 4ZSOA 3W81A 3WV0A 3IU4H 4B9KC 1FA4A 3Q3GA 2QGDA 5LBSH 3DX9B 3FB8A 2O6EA 4OB5H 1N6UA 4LVNB 1C16A 4RQQA 3JUZA 4JM2D 4UUJB 3QDMB 5I1AA 1U6AL 4PRHE 4NUJB 2VW4A 5GGVY 2NUPA 2EKJA 1EXGA 4HCIA 1E3ZA 3C09C 3E6FB 4FXGA 4Z0XB 5C09A 3RAJL 4PJEA 3W39B 3MCG1 3FO0L 3ZHDA 4ZX4A 4LCVA 2PABA 1T83C 4RFOH 1TPXB 4H13C 4DGVL 2E6PA 3HMXH 2Y1YA 2ITCB 3IXAB 2Z4QA 1FL3B 3MYJA 3H2QA 3VFVA 4HWEH 4H8HA 5K9OA 5LXGH 3L3GB 4LDLB 3S8WA 2GB2A 4LHUB 2FSEB 3JV5A 1KJVA 4KQ4H 1J5CA 1FIEA 4BZ2H 3FT3A 3QPKA 1DVQA 2ADGB 5LWYL 3NJHA 2KZBA 1YPZA 4ODTH 1HSBB 4G8EB 5GS0H 1M1XA 3BRGC 5IHLB 1F3JB 3H4FA 4JFOB 2VISB 4FERA 3A3YB 3UZQB 1ACYH 1ERNA 1DQIA 5ITBH 3DX9A 4Z7NB 1DSFL 4NRXB 4XBEL 2EDRA 5CZRA 1A6TB 4BFRA 4UUJA 4GUOA 3QDMA 3SKJL 1MJJA 4NUJA 1IGJB 1QRKA 1XSOA 3NJMA 3V6BR 5HD8D 3FFDB 4PS3A 4Z0XA 2F53A 2VR5A 4XHQA 3W39A 4L0ZA 1H9DA 1B6DA 1T1XA 2YD0A 1URZA 2BXYA 1F5WA 5A6MA 2ITCA 3IXAA 1FL3A 1RZ7L 2AK4D 2OULB 5ESQB 4POYA 3L3GA 1BBDL 3QFJD 4B9CA 1AQKL 1PZ5B 1WICA 5KJRH 1KYOJ 5CR1A 3IDNB 1LYQA 4NLAA 4DUXA 1XR8A 1CDCA 1HSBA 4JQXC 4FF9A 3RIAK 3SGDH 3W0WB 1F3JA 3MVSA 2QT6A 2X6MA 4JFOA 4NPYB 1V3JA 1JYWA 1OALA 4B97A 3VD0A 5C0AA 3NFPB 4TSAL 2PO6C 3LQAL 5GHWH 2Z7YA 3HR5B 5E4OA 1BD2E 2FO8A 4DO5A 2BVOA 1IGJA 1AGCB 5E95B 2ICWB 5F9DC 3QEGH 2WVUA 2X3AA 2VDNH 3ZKMC 1QBLH 3F7RA 4H88L 2C4FT 3PP4H 1IGCL 1VZIA 1SOSA 3N85L 4QRSA 5IEKA 1UJ3A 3V52H 1JWMB 1OARL 2P24A 5ESQA 1A02N 5AD0B 3U9WA 4F92B 5SWZD 2XN0A 4DK5A 2H32H 4LB8A 3IDNA 5TGBB 4OQTH 4S1DD 1I7TB 1UM6L 4R7DB 2Y5TB 1FFPB 4TNEA 4K9EL 5BRZE 1LQSR 4HK3J 4NPYA 3KPOB 4GS7C 3KW8A 3BDYH 2ED6A 1KTBA 2HJKB 3IDXL 3LRSA 2WNXA 1UWEL 1YYMH 1IT9H 2C9VA 4HX1A 1AGCA 5E1IA 2ICWA 3EYUH 3TC9A 1THCA 2OCFD 3H2PA 3PAUA 3VX1A 1LHZA 4JY6B 1A9VA 4HMCA 1J0JA 5AW7B 3CH1A 2C3GA 4HC1A 3QQDB 4DSYA 1NQBA 5JLZB 2XT1B 1OP5K 5GS1C 1CURA 4OKVA 1E5ZA 1K9TA 5AD0A 4BZ1H 3O3DB 1JD7A 1XIWD 2H8PB 2H5UA 4DPAX 4GQ9H 5AKTA 4BH8B 2W9LA 1I7TA 4R7DA 1RL1A 2Y5TA 4GYBA 4F20A 2E3VA 3KPRE 4U3SB 5T3XL 3GZPA 2FDBP 3L5WB 4NBXB 3HZVB 4UB0H 4YDKL 3AMLA 5D8JL 2WZ6A 5I1EH 4AIZB 2HJKA 3B2UC 4A7VA 1I31A 1WDAA 4H4NA 3JSSA 4TSCL 1C9SA 2XSKA 3IJ9A 4W68A 1A25A 3BFQG 2CPUA 2MTAA 3UTQB 5K69A 3GBML 2KZ1B 1EO7A 1MI5A 3QZOA 4J3OF 3RRQA 4IBVA 3BFWA 2IOOA 2J8HA 3OF6A 4KZDH 4JY6A 4M5SA 2K9UA 2CHWA 3MGOB 4ZUSB 3BZ4B 4FQJL 3P11H 4YWGL 1DEDA 3DJSA 4ZT1A 5GRJH 2MWCA 4XNYH 2D0GA 3UZEC 1G7JB 5KVFH 3Q0HA 4JZOB 5HDBB 3IU3B 2CUIA 2WUCL 4KQ3L 2APWA 4HKBB 5T3XD 1E5AA 1QWUA 1CL7I 3ARQA 5T3ZD 2FX7L 3FRPG 1U9KA 2IANE 4R9HA 4YXKL 2FATH 3JQOB 4OCWH 4B5ZA 4BH8A 5JW3L 3DRQB 1BWWA 1MFCH 2P43B 3GMRA 1WAEA 3HZVA 2W94A 1VFBB 2R8SH 3SDXE 4AIZA 2XV0A 4NHCL 4HPOL 4MXVF 4K94C 2LQRA 3MRKB 3AJ7A 3UTQA 1BSIA 1BCIA 4G9FE 4Y9BA 1UT9A 3PP3K 5IQNA 2UXTA 5AYTA 3CQFA 4JM0A 3EYFA 4P9MH 3GMOB 3WTVA 5DD5L 1IGIL 3MGOA 2YARA 4LOFA 3D7PA 2BJMH 4ZUSA 1QSFE 3BZ4A 5I17B 3D30A 1OANA 1KIPA 4JHZA 4PRBA 4NQCA 1X5IA 5JW4Q 3IU3A 4DKFH 2ZICA 4AEHH 3UTSB 3PJLA 1MF2L 4AQ1B 1KB5B 1G6RL 35C8H 4K5LA 2P4AB 3A4FA 3NFSH 5EOCL 1HOEA 2Z8SA 1JPST 4FNLH 1FYTD 3BVDB 3MI6A 2HYMA 3WXWH 3TIDA 4FZ8H 4ZMWA 3VVWA 2J3SA 3DGDA 4G8AC 4NXSA 3FUHA 3MRKA 3SDCC 1KB9J 4OF6A 3U1PA 1L0PA 3GK8L 5GXBB 2BMKB 2ZG3A 4UAHA 4HEPA 2AZUA 3IPBA 3ZYJA 5C2UB 5F96L 2HKFH 1NFIB 5I17A 5D7LE 3FCBA 3FCSB 1NAKH 3BGFB 4GUPA 4AYSA 2N56A 3ZDZF 4JQVA 2UWEF 3FB5B 4HWZB 3T4AA 3IRPX 4ZW3A 2VR4A 2XWZA 3HNVH 3IDUA 3ZQ9A 4Z7UA 1FCCA 1Y6MR 2EJ1A 4OSUH 3EKCA 3WTTA 3BWSA 1X4XA 2O6FA 3GF8A 1N7MH 3RIKA 4JDEB 2GEQA 5DZOA 4WW2C 4UQ2B 3ZDXB 5E4EB 1EBAA 3CPUA 4EKXA 3V8CA 2MQ3A 2P5ED 1A22B 1P9MC 3RFZC 5J6HA 1FNEA 1NFIA 1QW9A 4DVRL 2K4WA 4JO1L 4XPFH 3QUHA 3VI3E 4R8WL 1A6WH 1F56A 3WFHA 4TNGA 4XO4A 4KFMA 3OKDA 3SQRA 2XWBA 3FB5A 3GSVB 1UKTA 1DN0A 4HWZA 4XP9L 4P4KD 4IOSA 3OMZA 4HWNA 3U7AA 2ZWZA 4P2OC 5AAPA 3QYCA 4KHTH 2AQRA 5DO2C 1PX4A 5DURD 5AAWC 2YXVA 4CW1A 5PAZA 4IIQB 4CBPA 4JDEA 1K3IA 2JCCB 5F1IA 4XZ4A 1BV8A 1MLCB 3VWKB 4IKNA 5IKCB 2AK4E 3N5AA 3CC5B 1SNRA 3QFJE 5E1HB 3SSGA 1NPNA 1U41A 1T89C 2WINB 5HDWA 2KDYA 2J88L 1XEDA 2GSIB 1LO4L 4GBXC 4XNZB 1NCBL 1WAAE 3C2AL 2HT4C 3VD3A 1CXLA 2F19H 1TO5A 2V3FA 1G1YA 5ACZB 3GSVA 5AB1A 4N86A 4PWFA 2A6KB 3O4OC 3HNSH 4LL4A 3NT0A 1PFCA 4PRHA 5I76B 1L0XA 4U0RC 1QLFA 3WKPA 3UJTL 4IJTA 3ESMA 3FB7A 3OKMA 2UY7B 4AZUA 2V2WB 3EG9B 4IIQA 4XCFL 3T0EB 4B53A 3FF7A 3IEAA 3KLLA 1MLCA 1QO3B 1IL1B 1I82A 5BZZA 1G7LB 3CC5A 1AHWC 3QFDB 2FT8A 1F8TH 1WGOA 4XO3A 5FUZH 1R17A 1MFEH 3CZFB 3GRWH 5J11B 4KJQC 4J7RA 3RB5A 3X12B 2YPLB 4JRFA 1UD5A 4BKSC 2F7OA 2WOYA 3P2BA 5EOTB 4GMSL 2WK2A 3OPZL 3PQYB 1THAA 3WNKA 4C4KO 3A24A 5IJDC 1ML0A 2K7QA 3R0NA 5IWLC 4GRLC 3LKQB 4LGPB 1OAUL 2UY7A 2YSSB 4WI5A 2V2WA 2NNAB 2MQ0A 1DO5A 3V4PB 5KVEL 1SF5A 1IBHA 2JH2A 4YHLH 3IXTB 1IAOB 3SOTA 2EZ0D 1IL1A 1BQHB 3G3LA 4NJ9H 1U3YA 1I1AC 1YG9A 1WBZB 1G7LA 1IBGL 2J2ZA 4AG4L 1U3HD 5A2LH 3QCVH 1BEYL 2R1WB 5E1AB 5HPOA 1KNOA 3CZFA 1JXKA 2Y36L 4LO9A 3V0WH 1P7KA 1XHHA 1O75A 3HC4L 3DI3B 4W1TA 3BN9C 2WWNA 1ETZB 1S7VA 2EO7A 2H3NA 4H25B 4HV8A 5DFTA 3VG9C 2YPLA 3X12A 3BHBB 3PWUA 3UAJC 1J5OH 3NP4A 1TJIH 1JZFA 3EHBB 3BPCA 3RX8A 4TQIA 1FF5A 3V0FA 4AV0A 1R19A 1S5HB 2AK1L 1BZ8A 4MA8H 1KDIA 1Z9OA 2WXIA 1AQHA 3GMPA 3D69B 3LKQA 2XWCA 5F2FA 2YSSA 2Y69B 4IHBA 5D2LE 4PJAB 3DA0A 1BXUA 2CXGA 2NXZC 1JF6A 3D9AH 1NBVL 3DX1A 1WS7A 3IM1A 4AC4A 4OZHB 5AVWB 1F4XL 2VDLL 5BRPA 3CSYB 1ID2A 3H9SD 1WBZA 1DVUA 5T3XE 4G5AA 1A9EA 4I89A 4FG6D 4G6JL 5T3ZE 2Y7OA 4HK0B 2R1WA 2NQDA 1NIFA 2ADFH 2XPZA 1H19A 1VCAA 2ZJSL 3VD5A 1Q90A 4M61A 1ETZA 4LAQL 1I9IL 3FU9A 4WI4A 1LL1A 2IO5A 5GGQL 4F58H 3WFDH 1KENH 4G7VL 1GS7A 4J2XA 3PWVA 4QRRD 1D5BA 1I3RB 4P8QA 1L9PA 5C2BH 4PJ8C 3D69A 4UTBA 1RXLA 1YNKH 1SYSB 2ID5A 2Z35A 1T0PB 3D3VD 4JPVL 4LSQH 4L48A 3EBHA 3IDYB 2NY0C 3SDAC 1FIGH 3AUWB 1TZAA 2N7BA 3OAUL 3QEUB 4LKCA 2OFQA 4OFDA 4OZHA 5E9DD 5F6HJ 3SPCA 3CSYA 3B43A 4ES9A 4OLUL 5A2BA 3B3IB 5EBGA 4MSWB 1FFTB 3N91A 2J8UE 4YBLC 1DUYA 4HK0A 2IANB 1BHGA 1KIRA 2DJMA 4NP9A 4OLXL 3KPRA 4XE5B 1FYTE 2IEPA 5K33A 1YEHH 1KXHA 2CR6A 1A7RH 1XB3A 3Q7JA 1ZOXA 1OP3H 5HY9B 2CIIB 3IDMB 1HVXA 4JFED 4PCTA 1IGFL 3VFGH 4ZAKC 3QRFM 4PVBA 1ET7A 3VCLA 4LVOB 4G9FB 4UIKH 1DVFB 2VLJB 3SB3A 2EVHA 4M6ML 4RGOL 4TVUA 25C8L 5KBPA 1SYSA 4PJBB 4FQLH 4GOSA 2WNKA 3CBKB 4GRMA 3MREB 4HJ1A 5JPMC 1YEKL 2PXYB 3KLAB 3ESOA 1WPCA 2W81C 5CU5A 4NZRH 4F37K 1TCRB 5MERA 3B3IA 3T2NL 4MSWA 4J3VA 5D71L 3VVVA 1DBAH 1E4WL 2IANA 4YE0A 3OX8A 1OT1A 1TJMA 1AI1H 4QCIB 4GAYA 4RMTA 2AJSL 5HY9A 3SDXA 2CIIA 2JLPA 3Q44A 4AKQA 1EMTL 3V5KB 1CG9A 1QP1A 1MFUA 4BXVA 1JZ4A 1J1OH 4G9FA 4H2AA 1SFDA 2VLJA 2H2PC 4YHYB 5KSBF 4PRPD 4IOFD 3X13A 4OFPA 2XQYA 4TRPL 4FFVC 2HZHA 5D7LB 1QSFA 1V55B 3MREA 4NN5C 4YE4H 1E9PA 2NY2C 2PXYA 3KLAA 5E7BA 2VLKD 4NEHB 1TCRA 3LIUA 3L4XA 5C0IB 4GPVA 3INUL 3NIDE 2IQAB 2LLGA 5HYSG 1HYRC 4OT1H 4QCIA 2ARJQ 4WZ9A 1LDSA 3V9EA 5EULV 2LU4A 2XBTA 4N2BA 4ZOBA 2FX8L 4OU3A 3ME0B 1JRHI 4A7GA 2Q2LA 5I1LB 2J6EA 1BZ9A 3VGFA 1KY6A 3Q6GL 4RISH 2BH0A 5CD5D 3QHZH 1WC7A 2BS71 3CFDB 5GSRB 4AWJC 4OUUB 3MZGB 4GQZA 3TO2B 2MKWA 3G5VB 4CMMB 2YD3A 1Z9LA 5D7LA 3CSTA 2VCOA 3CU1A 1E7UA 2MKLC 3CFUA 2F8IA 1G84A 2WHVA 3VI3B 5D1XC 4ATTA 1S7XA 3D05A 2WQWA 2IQAA 1MCWW 5FF6B 5L2JB 3R06B 4FLRA 4EUPB 2FB4L 3QC6X 3CVHH 3MRQB 1TQBB 4M62L 1ZLWH 1K5NB 4EXPX 4JM2A 4ISVA 4NT6B 4KKPA 2YWZA 3PNWB 4TUJA 5ALBH 4H8WH 4D8PB 3ME0A 3HN5A 5C0FB 1JVOA 5I1LA 4ZUTB 1CPUA 1PD0A 4EOWL 2J25A 3CK0L 1MCHA 2V9RA 2VXQH 3CFDA 4M00A 5D7JC 5GSRA 4OUUA 3V4LA 4WV1A 3OKLB 2AK4B 2APFA 4YDZA 3G5VA 2PMZA 4CMMA 1BZQK 4JPKH 5F71A 5LN4A 5FYJL 4M7LL 5DHVB 4GG8B 4NUQA 2PCPB 2Z31C 3LDBB 3VI3A 1QATA 5B8CC 1HILB 3QA3B 1CYGA 3QUXC 2RCSH 3HC3H 2NNRA 1DVTA 1A9BB 5FF6A 4PUBL 1S5IH 3R06A 4H44C 5EO9A 1CO1A 2NY5H 5JOEA 5DS8A 2K9FB 1K5NA 4NO0B 1KELL 2PN5A 4FE9A 2AXJA 4NT6A 2GBUA 3PNWA 4PH8A 4D8PA 1RZPA 3MRCA 3SE9H 1RQ5A 3L3HB 5C0FA 4PJ9D 1X4YA 4L2YA 1HWWA 3MOAL 4ALAH 1WRFA 5JNYA 1GXEA 5TQ0L 4E41D 5AYUL 3VACA 1HESA 3AMKA 1MRCH 4X6DE 2AK4A 3SO5A 2YSTA 4QKXB 3QFJA 1BXAA 2DIAA 2M8XA 2XVLA 5SWZB 5SX5K 1LQBC 3F04A 5E99H 1EZVX 4FJYA 2VSKB 3GSWB 4GG8A 4IMLB 4I85A 2C4FU 3QA3A 2NY3D 4I0PC 2IXQB 5HDQH 4S0HA 1A9BA 3VSQA 1ONQB 1HEZA 1J87A 3LPPA 2O30A 4L1DA 5AOKA 3ASNB 3U6XS 5L7XH 3AY2A 1VPOH 2A4EA 3HBPA 4TNVK 1EANA 1GGCL 3ARGC 3CE1A 3ARVA 3MRBA 1MWAH 2ZG2A 4YVNA 3QWOB 3GS4A 4NNYB 3T8VA 5LCVL 4OZIE 3L3HA 1ITBB 4WWID 4AQOA 1HQ4A 3UZVB 1NPJA 2K3TA 2BSDA 3L95B 2XYCA 1XWVA 5H94B 4L3CB 1A7PL 1HH6B 3FU5A