2M83A

Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of protein phosphatase-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
139
structure length
139
Chain Sequence
GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for Protein Phosphatase-1 regulation by the muscle glycogen-targeting subunit GM
rcsb
source organism Oryctolagus cuniculus
molecule tags Hydrolase
molecule keywords Protein phosphatase 1 regulatory subunit 3A
total genus 24
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2m83A00
4BFOA 4BFNA 2V8LA 2DJMA 2VQ4A 2V8MA 2EEFA 4EIBA 2M83A
chains in the Genus database with same CATH superfamily
2KZKA 5JHLL 2FYYA 1FNGB 2IPTH 4FZ8L 4XODA 4HJSA 1YMMD 4JRXE 1FGVH 2EEXA 4KTDH 4UV7L 5IVOA 4BUHA 4HGWB 1FQ9C 4G6JL 4S0TD 2DQEH 3I2CL 2FEDD 1CFTA 4GG6F 1SHSA 5HVHB 3IJEB 1AP2A 2OSLB 3B2VH 4KUZL 2ZIDA 2KZ1B 2RQ8A 4Q9RH 3MKKA 1ZT4A 3ZZSA 4XVTL 1CQKA 2G0KA 1L4IA 3OJVC 1LDPH 2AJXL 3JTTA 2HLAA 1AACA 1IBGL 2HRLA 1MCWW 4Q0XL 3PFQA 4P2OC 5F9JB 2PXYA 3HS0A 1MAML 4YL9A 4KXZI 2EXYD 2YSTA 4QRRB 4Z3TA 4LSPH 1NCJA 3ZDYB 2Z35B 3FYEB 2PXYD 2OR9H 1BFVL 1C5DA 2EDEA 4I3RL 1WPCA 4C54A 5DRZA 5CWSA 3Q5YA 3WUWG 2AZUA 2BZDA 2HT2C 4PJEA 1P5UC 2EYSA 3NPZB 3B56A 4UAOC 4HIIB 3H1ZA 2FX9L 2F53E 1HKLH 2WIMA 3DX2A 1MWAL 1BLNB 5FUOH 5BUPA 2K6ZA 5J11B 2MEJB 1TVHB 3E9UA 1AO7A 3AGVA 4EI5B 3DX9B 2FEEL 4CA4A 5F96L 4KC3B 1JNLL 3QXDA 2G60L 4DVRL 2Q76B 2HRPL 4UBDC 1KTLB 3INUH 3UAEA 4UM8A 1XD1A 4KNUA 4V1DE 4X5XB 3UAJC 3VUAA 2GABA 1ZLWH 3LRKA 4MAYC 1O7VA 4U1GB 4YK4C 1IILE 3M86A 1FBIL 1G9ML 2OYLA 4OGAC 1I7RB 5T3XL 1BECA 4GKSB 1QTPA 3I9IA 2I07A 1NCOA 2DQEL 2IC2A 2B4CH 3DBXA 3WELA 4ADJA 3H8NA 5CINL 1BQHG 3WBDA 2HLAB 2EKJA 4PM1A 1IBFA 2P80A 1L9PA 2X89D 4PJFF 4X6EB 4Y2OB 5C6TL 3BCFA 4QKTA 3ZR6A 3B2DC 4PJ5A 2IQ9L 1LLAA 1UXLA 1WT5C 3X12A 2ENQA 2A6DB 3CDGB 3NH7L 2DAVA 4ANVA 1A6WL 1AHKA 2CA3A 3GKWH 3IDMB 4R4NC 2FIRT 3ATBA 3P2BA 3TA3D 1Y6NR 4IGBD 5HPMB 3WAJA 4LVHB 1YN7A 4HCRA 3O41A 3WJLC 1AY1L 1PSKH 3BESR 5H35A 2WBXA 2AV1A 1NOFA 1UCTA 1NC2A 3Q01A 3LDBC 2D7MA 4I3RH 1OQOA 3S98A 2EKSB 2VKXA 3UP6A 3K6FA 5I24A 2R15A 1ZVSB 1O5PA 2D4DA 3K0YA 2EINB 2X1XR 3T0ED 2AK4E 3KGUA 3S5LG 3VXSA 3VVVA 3HE6D 1YEWA 2AGJH 2XZCH 1MHCA 1W0VA 4MX7A 4FXKA 5E24E 1J0IA 1EMTH 2X9YA 1YMMA 3CHPA 1BWMA 4PRAA 3KLHD 3EBIA 3R0NA 3BZFA 1JZFA 1N26A 5GRJL 2VLJA 1N7MH 4XCCL 4XPBL 3PWPB 2CLVB 3STBA 2ZX9A 1LWRA 2ED6A 4QHPA 3RKDC 5TGBA 5E00A 3ROLA 4XR8C 4JY4B 3SDAB 3VG9B 1OGAB 1OTUC 1IX2A 3L9EA 5IOKA 1EERB 5T3XH 5IB2B 3LB6D 4Z78A 4OM1H 1E7VA 2QVTA 3IFNL 2I7OA 3GMPB 4FFWD 1MG2C 4UIMB 5I5MA 3K6NA 1Y6KR 4HLZH 4J2XA 2K78A 2WLIB 3QZWA 1CN4A 2MPVA 4LU5H 4NN6C 3LJ3A 2HT3C 3ABKB 4L1LA 1Q0YL 5F9DC 3WFDL 1LTXA 2Z8SA 1X5AA 3WEOA 5JOFA 4HJTA 4R0LB 1PBYA 2ZCZA 4LHUB 4OF0A 1AGBB 5G4OA 2ZWYA 4QJ3B 3O3EB 2EDNA 4AG4H 2HKHL 4HUXA 3SGJA 5JIPA 4NQTA 1BZ9B 1JF5A 4QXTA 2QMKA 2L7EA 3ECWA 2BNQA 2WWKT 4ZUUA 4CU8A 3TCXA 1X7SA 4CKQA 3C60B 4Z5RA 1KJ3L 1IGFL 1OM9A 3EO1B 2RD0A 2GI0A 4E5XA 3IJEA 4X4ME 3ULUD 4PI2A 2VN6A 4NDMA 2XETA 3W2DH 1IQWH 1OAYL 4IOSD 2YBRA 2BXZA 2JTYA 3TH4T 4K8RC 1FV1B 1NGWA 4G59C 3MLYL 2YA0A 3Q6GL 4DIXA 1INQB 3UTSE 1OGPA 1U4EA 3SYOA 1NIBA 1TQUA 3M17B 3ESVF 2WSKA 4HIHB 2CO7B 1KXVA 4MNQD 3BAXA 1KEMH 4K3JL 2QQKH 1PG7L 4P9MH 1VLXA 5TDPB 1JUFA 3RL1B 1Y6MR 1NKGA 5C8JA 3MA9H 1JF6A 4YE4H 3CJJA 1KGCE 4XO9A 2DZEA 4OZ4A 2XU9A 5E8NB 2GJ6A 2UWEB 1TVDA 1T2XA 3LEYL 2EDJA 1V3JA 2XY2A 3BDXA 1KPUA 3MBXH 3ZTJH 4E68A 4TPRL 5D5MB 1XF5B 3ARWA 4KKRA 1CFVL 2CHZA 1F45A 3JV4B 3F58L 4E9VA 4NQDB 3FQXB 3SDXA 2EUZA 4UB0H 1U92B 1PFOA 4G6AD 2F5AL 2FJHB 3TJEL 1F6AA 5JYLA 2Y7MA 5EWIL 3L8QA 3RHWK 4BWUA 5CEZD 4PJEE 2GSMB 3QDHA 1MWOA 4PRIA 4BQ9A 4Y1SA 2P8MA 3KWUA 3LS5L 3OPUA 4QHNB 3EGXA 4YFDB 3WJMB 3OKNA 1S7UB 3O3UN 1PZCA 4OF6A 1RZJC 4R7NB 2NX5A 1DVXA 4N86A 3QCVH 1JGVL 2KMWA 3FRPG 4M62L 1PS3A 4NQXB 3C60D 3R7RA 3EH5B 4XCEB 3TT1H 4JFPB 4MNQE 3DX9A 2ZF9A 4QOKB 4NKDA 5EUOB 4NPYB 4S1SH 2BNQB 3UGEA 3CFJA 2FYYB 2EIDA 3Q8EA 2E76C 5TE4H 3U0WL 1I1RA 3ARBA 3L5IA 3QJXA 1WHOA 3IJ7A 3RVWD 4TQIA 1JZDC 1KXTA 1ZSDA 1U8QB 1E8ZA 3G5XA 1X44A 5KYYA 5HP5A 3EW3B 2IADB 3PGCA 3CFBA 3WEMA 5E0QA 3WTYA 3VXMA 5B3SB 4IM8A 3AITA 2H1PL 3O2DL 3HCVA 1J18A 1U3HD 3QWOA 4TOYH 1WCQA 4ZMXA 1U8LB 4AEIL 3JYBA 4H1LA 1KYOJ 3RFZC 3D3VA 4PLJD 2DB8A 1ZLSH 3DVFA 5F0JB 1KPVB 1OPGL 2DBLH 4P4KB 4PIBA 1TETL 1O6SB 1A9BB 4P57B 2CK0L 3OKNB 4UM9B 4KKAC 3LMJH 4DQOL 1T03L 2H32A 4LCCC 4Q9CA 5I9QC 3CXHJ 3O3BA 3C5ZB 5DC4B 2ROYA 2LR4A 2HZHA 4MNHA 4W9JC 5D6DA 2LFGA 2DQTL 1N67A 2WXQA 4QXGH 2AQQA 2IDFA 3VD1A 3ZTNL 3MGOA 5EHFA 5C09A 1MNUH 2V8LA 1E6JL 4E9LA 3SY0B 2G75B 1HDMB 4W4NA 4CVWA 1QSFD 3OKOA 5CSBA 3VXSB 5HSFA 2PCXA 1PJWA 1U8PA 5I16B 2UX7A 2R39A 2CK2A 3TFKC 5KBKA 1HOCA 4PJAE 43CAB 1M7XA 1M9SA 5F96H 5BRZA 4PRIE 5GJSH 1OB1A 1E0OB 3QUXC 1ZVNA 4OJFL 5CLZA 3T2PA 2WVUA 3GSWB 4KMLB 1XGUA 2NNCA 1LE9A 4XNMB 2WXKA 3QQNA 1XVSA 3N43F 5F6HJ 1Q9OA 4QHLB 4KDVA 5DMGD 1E28B 3GJFA 2VR9A 3LIZA 5C0AE 3UADA 4PLOB 3QO1B 4LSRH 3S34L 5JIKA 4BKSC 2OSYA 4H1LB 3ELAT 3ZRFC 1WP6A 4H0GA 4NFCA 4I18B 1J9CT 1BM3H 3ARGC 3QHTC 1BSIA 1GZQA 2AKRB 1NCAH 2ESVA 3PP3H 5CXPA 1ACYL 1DUZB 3DUSA 3BPLC 3DO3A 3SGKA 2GITB 1G7HB 4Y4KA 2V9QA 1QLFA 1MG3C 4HUWB 5I74B 1X5IA 3ZKXC 3IFNH 4NQDD 4Y5YA 1CFMA 3KPRA 4N90E 1IU1A 1DBMH 4PRNB 4X6CF 5I0DA 1MHHA 5KVFL 4FTVA 4ZTOH 3P30L 1KPVA 3IT8D 3FO1B 5I5JA 3QIBC 1WAAF 5EO9B 5D7JA 1GSKA 2BSRB 3T3MF 3HVDA 2H4EA 1FV1A 4LE8A 3GSQB 3P4OA 1L6ZA 1ASQA 2EO1A 2G3NA 4F20A 3BT2L 3FU7A 4GO6B 4BSJA 1AHMA 3O4LE 2YAFA 5IQNA 1UWGL 4S1DC 5HBBA 12E8H 4YOKA 1P7QD 2IXQB 2O6DA 3MRJA 5JOPD 1P2CA 5D1ZB 4O2EA 1PNDA 2BP8B 1KTDA 4L0YA 5SWQA 4NRZA 1ND0A 43CAA 1DJXA 4C83B 1H15B 2DOCA 4RNRA 2J1KA 4LNVA 1SHMA 4U1GC 1QQDA 2XZAH 2GBAA 1KIPB 4LFHD 2P44B 2ZCKH 2RIKA 3WNNA 1G94A 5IEHB 5FR3A 3VFNB 4XRCB 1YO4A 4PR5B 1A1NA 4JPQA 4P46D 5FYLH 2OL3L 4FG2A 4HKJA 2VLME 4YO0A 5AW5B 1TTUA 2GIXA 4U3XA 1P7KB 4G8AC 4N1CA 4YSCA 2GEQA 1JPSH 4YDIL 1NANI 1NGXB 2ZUWA 4KI5D 1G9MC 1FH5L 1UD6A 4RZCA 5F9JA 1GYUA 3ZRSA 1JGLH 5AW9B 5GRVK 3CUPB 5IVXA 1EAQA 4NUJA 5BQ7A 3DTUB 4S1RH 3SDDD 4HLEA 1NBYA 2AK4A 3BKCL 4IKJA 1E65A 1NCIA 3RWEB 2VDMB 4N2GA 3SDDA 2VAAA 1I82A 2MQGA 3V0WH 1HWGB 2BWDA 4GIAA 4WV1A 3SIKA 2FUQA 3JVGC 3K3QA 4XAWL 5D2NC 1X3DA 3W56A 1OWWA 2GSIA 3KXFD 3WNMA 4K7FA 3VYOA 3EYSH 3ORJA 1GKOA 5TDPA 4AW4A 2QQQA 3IGUA 4FP8H 4ZS7L 5EULV 3O6FA 1BEYH 4YDLB 3KJ6H 4TOYL 5CUSH 5GSVB 4K23L 4LP4A 4YX2H 5I1DB 3IDIB 2J20A 1V3KA 2YK1L 3B9KA 2O6FA 1YEFL 2P28B 5DVMA 3DDFA 3SDCA 1VFAB 4N2LA 3RY4A 4POZD 5L7XL 1A6VH 1JHKL 2WBWB 5FFOA 1YEGL 3QPXH 3M88A 5SWSB 5HDRA 1I9IH 1RUKL 2YXFA 4KO5A 4M00A 4Z0BH 4ZAKA 5AW4B 3RGVB 3DO7A 1DQQB 1WE5A 4UV4H 4J3OH 1B2WH 2PO6A 3HA0A 3OMAB 3QRLA 1HYSD 4RMTA 4NQSA 4BH8B 4FNUA 4Q6IB 1S7QB 1QAWA 2CRMA 4FKKA 2OYPA 3M1BB 5BOZG 1P4LA 2JKXA 3QORC 3QQDB 4WGVB 4OSUH 1HJBC 3CVHH 3QB7C 4FDWA 4JUTA 4UQEA 4WNSA 4LCUA 2XWTA 5CBEB 2UWEE 5IFHL 3PU7A 3U0PB 1GR7A 2X0VA 3PWJB 4WV1B 2ZOOA 4L0ZA 4KKBC 4N24A 4JFED 4QD2E 2VM4A 1MI5E 3B2UD 3O4OB 4MA8L 4DP2X 2FNWA 1GJIA 5ABDE 1T0NA 4PGBB 5I1HH 3VI3E 4N28A 5LG1A 1XZWA 1U8JB 4H8PA 3K4AA 4LPTA 1JXFA 1W72B 1ESOA 1UOLA 1DHKA 4O02A 1P7QB 4EN3A 4UNVA 5CP7B 5I6PA 1D5XB 5IHUH 1BIIA 4KHXL 4EPSA 4NUJB 3MNWB 3NIFB 1LE9B 4EVNB 1HI6A 1K72A 2WXIA 4WHTA 4QHMB 3MRLA 5IZ7A 1HCYA 3EO9L 2QFPA 2YEZA 3R06B 3MV8B 4M5ZL 3U1SH 1KZYA 4K5NA 3MFFA 4PGZA 4XPTH 1T1WA 1IJ9A 3F7YA 4FMVA 1AIZA 1TENA 2ZKXA 4E9XA 5FDWA 3DJZA 4YDLC 1KV3A 5TF0A 1NM4A 4ZPVB 1AIFB 1OAXL 1PY0A 5E94A 1UZ8B 1YAIA 4ZTEA 1S3KH 2GBTA 4XPGL 3V4VB 1MELA 1NBQA 1JPEA 2DQJL 1MCRA 2D9QB 4OLZL 1K4DB 3LX9A 1MW2A 4WWID 3MRCB 1EGJA 1AMYA 4HUWA 5HXMA 2X5PA 1KCRH 1NCTA 1GMEA 2F54E 4R2GD 3ECBB 2ICCA 1FAIL 2CMRH 5KUMA 3IMBA 2VJXA 3QG7H 1XD0A 4NYLB 5C0FB 1JCVA 2OXHA 4J4PD 4JHBA 4QXTB 3ZKQD 2DQ6A 2IPUG 5D1XE 4HQQH 2H8PB 4APQB 2R2CA 3FUKA 4I77H 5I1AB 3ULAB 4N8VG 4XCFH 2FQDA 3WKYA 1SVCP 2BJML 1HKFA 2Q8AH 4MJ4A 4OLZH 2X40A 2D03H 2AFNA 4AL8C 4PJGE 1MW0A 1F11A 1E5AA 4LPYA 4KMTL 1DVFD 4LLWA 2ICEC 1E67A 4N0UE 5FYKD 2G9HA 5GS3A 3SE9L 2B9BA 4FA6A 1DDHB 4OKVB 2EYRB 3VXQA 1DSFH 4A55A 3QCUL 5BXFA 4ELMB 1DP0A 5EIQA 4F37K 3R4DA 1TSHA 4TQPA 4OAWB 5C7ZA 1PF3A 3ILQD 4MD4A 1LO5B 4N0YL 3JT0A 5AZUA 5I15L 2L7QA 1BZEA 3Q2CA 5KVGE 1K4DA 3PIQB 3HRZB 2YAHA 5ENWA 3VDCA 3UJTH 3RWCA 4KV5F 4U1HB 3RWDB 5H37H 1YLBB 3HC2A 2VXQA 5JIDA 1IEBB 4YDJA 6FABL 1ROWA 5AZEL 4TUJA 1EXUA 1B3IA 4AV0A 3QUZB 4BGLA 4NZRL 2WZAA 4A6YL 4LLMA 2VMJA 1A3QA 4BFGA 2BS9A 4DHLA 2Q7YA 3C5ZD 2XWBB 3QG7L 2K45A 2W60B 4YHPA 3UO1H 4BJLA 1WEJH 5CF3A 4MA7L 2X4RB 3PV6B 3UC0H 4HWEH 3VW3H 4Y4HC 4U3SB 4KUCF 3WIHA 2VCOA 3F7PC 4Z7UB 4M3KB 5C6TH 5EU5A 3F6JA 1TTAA 3ZHKA 4L9DA 1QI3A 4NJ9H 1SDYA 1OV8A 4N0CD 1BVOA 5IFHH 4KJWC 4W93A 3VFOB 5C2UB 2R0KL 2B14A 4IDJH 1HZHH 1DJWA 1HTYA 1KULA 2A9NL 2QV2A 3FU8A 3V55A 4XBGA 4XMUA 4IMLB 2NZIA 3BFQG 3E9TA 1E8XA 3GIZH 5AB1A 2WLZA 3ZYIA 3S8FB 2APSA 2HVJB 4OFYA 2KDGA 2HLFC 5HHPB 1LP9E 4OF8A 4Y9GA 3GHBH 1PZUB 4Y5XB 2NTFA 5DQJA 3FXIC 1FNLA 2WWMD 4P9HL 1QBLL 4X9IA 3TYGH 4CSZA 3V2AR 5E4EC 4HLJA 4HFWB 4IRSC 4HWZB 5EIIG 1R17A 1X4ZA 3ZE1F 3DUHA 4NNXA 2E7LC 2XTJE 4I4WB 3MKGA 3KLSA 4GMSL 4KAQH 4GP4B 4AGPA 1QPXA 3ISRA 2LFEA 1P5VB 4OGXH 3DNKA 4JHWL 3KPRE 1T1YA 2DEWX 4ONHA 3VI3F 5BOPA 1KWKA 2G30A 4XAKD 4D9RE 4ADGA 1E9PB 2Q3ZA 2UX6A 4YHPB 1LMIA 1PKQB 5T1JA 5C0DB 4RFOH 1HL8A 3TV3L 4ZDHA 4GUOA 5IUCA 1E40A 3E2HC 1NCBH 1T7WA 2P4AB 1E4WL 3WIAA 4UTBA 1A02N 1CFBA 2XQBH 3VI4F 1U3YA 4H2AA 2DTML 2XN9B 3VE0A 2WXPA 4HPYH 5BS0E 4YH6A 4XMXA 3KL0A 4G8IA 5IHZA 1SBSH 3P77A 3VFOA 4ELMF 4DP5X 1S7XB 5JW5B 1EXUB 3ROOB 5I74C 5DK0B 5DK2A 3ZKXB 4QRTB 6TAAA 1B0RA 5F7LB 2HJKA 3GS4A 1D6VL 3QIWA 1V3LA 2WQRA 3VWKD 4KRPB 2D3NA 1J9SA 1HZHL 4ODTL 3CZJA 1BQ5A 4PS4L 4YHLH 4Y1TA 5GHWL 3PWUA 4EQ2A 1RSYA 2Y36H 2XXGA 1IAKB 2PCYA 1QWUA 1WFUA 4R8WH 3SJVB 3WL9A 2W94A 1OB1B 1H0DA 4NQCD 4M7LT 5D72H 4P9HC 2X4NA 5DYOA 1OLLA 4HAFA 4MMYA 3WI9A 3OB0K 4BD4A 3N41B 2BNRB 3GMQB 4HK0A 4P2QA 4PJCB 5DURD 2WB7A 4WUUD 1HVXA 4OBSA 1FVEB 3B2VL 2WNWA 3U4KA 1OAKH 2HG5A 3C09C 1R34A 2BINA 4TSAH 5EEVA 1S9YB 1PDKA 2R9HD 3QZLA 3CX2A 4N0UA 3GB7B 1NMCB 4YSOA 4L48A 1FDLL 4IHOB 5JPNB 1RCYA 2BFGA 1AD9A 4HALA 1C1EH 5T1LA 2XTSA 4HAGA 5LN8A 1CFSA 3PJSA 3SQOL 4HFWA 3GSNB 5DFVD 2HFGH 2BRRL 4OIAA 1EO7A 2PWHA 4ZUUB 3VGGA 4XH2B 4PY7A 5AVRB 1WFIA 1QLFB 5D7KE 4BZ2A 5DD3L 1EDYA 2P8PA 25C8L 3D09A 3EJYD 4XWGH 3BH9B 3TPKA 4WVRA 3QXAA 4QRRA 4U6XA 5I82A 5JW4Q 4MA1C 1FFPA 1U91A 2F54D 3GEWB 3X13B 1EHAA 3GSRA 4HUVB 1OALA 5DHYA 4V33A 2VDKL 3X11B 5I0ZA 3BSZA 1DANT 3VD7A 5M94B 4PJHB 3O8XA 5HD8D 1ACZA 4TULH 5IVNA 3OHXA 5C0BB 5J13C 4AUJA 3SPJA 4CGUB 4NAMA 1EZLA 4PJCA 4WHTB 4AYBA 1ES0A 3KPQB 1T80A 2DL9A 3MJ9L 4OFDA 2NY5H 4YE0A 1N4XL 4ZPTA 4ZO8A 2HN7A 3QAZC 5IB3B 2EH8H 3FUDA 4MD5A 3CSPA 4M48H 5BS0D 4LRIA 3EXLA 1L7IH 3ARZA 3QI9C 4ZMWA 3CNKA 1WGVA 3DYMA 4ENED 4F5CA 2NX5E 4R5VA 2B5IC 4L4TE 4A38A 4KJPD 4NAJA 2LTQC 3SQRA 3W11C 2X4UA 1RZKH 4EBQL 3HZ3A 4F27A 5E4EB 3TL5A 4P3DA 1OT4A 2CDGA 1FG2B 3DMMB 1J0HA 4MASA 1BG9A 4BFBD 1CLYL 3LEVH 3JVGA 1JAEA 3ECBA 4FA8A 1QFWH 1CGSH 2XKNA 4JFYA 4FD0A 3T8XB 2QELA 1N68A 3BWSA 4PGDA 3TBBA 3BVNA 5AW1B 3FCGA 3GMOA 2KT6A 1WWCA 1JWUB 3T65A 5JPMA 2FT6A 4IIZA 3BAWA 3S5YA 2A74B 3ZOAA 2BNQD 4GKNA 5JZ7C 2EO9A 3HKZA 1B6DA 4IBTA 1JFQL 2CIKB 1HHGB 3IDJB 5MERB 3IJ9A 1KB9J 4JFFB 4HZAA 4YZWA 4JHUA 5HHXL 4DPCX 1CFTB 5E6SB 1LHZA 2K8MA 3H42H 4KX8A 4NQUA 4IOSA 3MSPA 4PJEF 5EO0B 4APQD 1ZLVH 4MDRA 2XC8A 1T5KA 2MKLC 4Q89A 4Z8FH 5EWIH 3Q13A 4A7UA 1EO8L 4FTVE 3QEQA 3FN9A 2J5LC 3PCYA 1WBYA 3TCLA 2ITDA 1WC7B 3MRFA 3PV7A 5DT1H 3NN8B 5KVDE 2WJ7A 1GY2A 4HK3J 2IH3A 5GISL 2VM3A 2VITB 2DLIA 3LV3B 5GS1C 3CHSA 1T5WA 3FH5A 2CHDA 2FHBA 2QEJA 2WOYA 4P5KA 5E6RB 5F21B 5LNGA 2WLNA 2Y5EA 4ZMQA 1LK3L 4FMFA 1NFDB 3VCLB 3NIFF 2OP4L 4GXVH 1L0QA 2WIIA 3DROA 4ODXB 1IL1A 3RBGA 1QWHA 3ILDA 4AX3A 4PJFE 4PJ6A 4X7DC 4R3SB 3TZVC 1NOLA 1ID2A 3GMMA 2WKLA 3JTSA 4NQSB 4B3VA 5DJ8B 3CFEB 4ODVL 4JANA 4NUGL 3QG6B 3QIBA 1NGZA 1Y0LA 2Q7AA 2YPKB 5HI3D 2BC4A 1OP3H 3VB9A 5IESH 1D7DA 3X2QB 5C0RL 1RFDL 4HEME 4BH7A 1IZKA 4MA7H 4LOVA 1TO5A 5MHSE 1L9SA 2R2BB 4IS6B 1J1PH 1XF3B 2OL3B 1CO1A 2F08A 2GCYB 1W72H 2FGWL 3FFCD 4QRUA 2FWLB 2NXZB 4L8SA 3EBHA 5HGHB 2A83B 3VDBA 1A7QH 1CF1A 1G7MA 4RGNB 3GMRB 1N9PA 3O2WH 4AQEB 3MRFB 2HUEA 3C5SB 4OB5H 1MSPA 2VR8A 2IH3B 1K6QL 3T2NL 4G80A 3IMWA 1WITA 4U1MA 5IB1A 4NNPH 4JFFD 3K6DA 3GMQA 3MUUA 3C5JB 1OIOA 5B39G 2FSEB 4RESB 4R7LA 4ZFZB 1AGEB 2VDOB 1ZIBA 4J6RH 3GSXA 4LCYB 1RUMH 2O6PA 1OTTC 4WFHD 2OZ4L 3MRGB 4JFFA 1EHLL 4ODSL 2MNJB 1ZT1B 1DJHA 5K39A 5C71A 1Q94B 3CDYA 4ZMAT 2PYEB 4X80L 3S7GA 4C47A 1QR1B 2CZNA 3FQRA 3ZO9A 1K3IA 5FHBL 1Z5LA 2APBA 1I3RA 3JWNC 5FW7A 2YAOA 3IKCB 3L1OH 1MQKH 4ZI8A 1HU8A 2C3VA 1MH5B 5B38A 5J8OA 1A6VL 5K33A 1J9TA 3MREB 2VN7A 3LY6A 4MFHA 5DD0H 1QUPA 4IRJD 4WLCA 4BH7B 1MFCH 3S36L 2BOBB 4M61A 1WFNA 3VA2C 1CDBA 1DDTA 2HLEB 1EEQA 4YGVA 1NKRA 3DVGA 5FFGA 4AVKA 4GG6E 3GXFA 4XBEH 3BPNB 4R4FL 2OULB 2QQLL 3FB6B 3H4HA 3CFMA 3QQ3A 3Q44A 2I60H 5L88L 1I8IB 4PJ8A 5DT1L 1NBCA 3V5DB 3L45A 2VAJA 3KPSB 2VLKE 3AAZB 3NT0A 3SSGA 4APQA 4ECNA 4OZIF 4LSUL 4TNWK 5HGDB 3US1A 4M93C 4ZYKA 3VWKB 3LSOA 4GG8B 4OT1H 3UACA 2F0CA 3STLA 3UDWC 4OB5L 4A7QA 4XB3A 1UB5B 2VERA 5TH2A 5KZCB 5DO2C 3N42F 4HMCA 1EEYB 4HW6A 2QLYA 2HN7B 3HUJE 2CUMA 4MXVE 2H2SC 5DS8B 4OKVA 5I1EH 2VXSL 5L9DL 4R0LA 2IQ9H 3SDYH 2G2PA 5AVSB 4QAMB 1FL5A 4F7KA 2ZSVA 4IGBB 1CD1A 2BHZA 2JB6A 4P46B 4FABH 3H56A 4MZ2A 1C5CH 4XVSL 1IBZA 4HHGA 3ARDC 3HCVB 5M95B 1QFWL 4YNYA 3MOAH 5HY9A 1G7LA 4GUCA 1OXYA 4YGVB 1MHEB 3L3KA 3V6BR 2OI9B 4JN1H 1RLBA 4ZFFA 4L3EA 2XWXA 3BGAA 1QW9A 5J12C 2PABA 1MCKA 4FHKA 3UX9B 1SJEA 4MAUL 4R26L 5EORH 3VFMA 3WN5B 2ZUYA 4FQLH 4EIGB 1DVTA 2B4CC 2NCEA 3EOAA 4JFSA 5CUSL 5F7AA 4AMKH 2KH2B 4HJ1A 5TDOB 3S4SB 4Z3GA 5HPMA 1QEXA 2XZCL 3CE1A 3GSNL 3GXNA 2FJFB 1H19A 3JTBA 4QRSB 2VO8A 3P0GB 3FQNB 3LSOB 2CO7A 3ARUA 4PB0L 3N1FC 5E2WL 1J0JA 1O75A 2WINB 4I5BB 2P46B 5LAXB 5K9OB 3SPVB 4IBUA 2VMEA 3QORA 3MUY1 1QLRA 5CEXB 2RALA 1DJZA 1E42A 2YD3A 1MWAH 4N5EC 2JKNA 2P42B 2UVEA 3MR9B 1ZVSA 4HKBA 1IGJB 2F6AA 1EFXB 4G43A 3MMEA 2APWA 4ZMLA 3QIUD 3RPIB 5L8JB 1RZKC 2ITEA 4X4YB 1OAUL 2IFFH 5I8EB 3PWPD 4PJ8B 3ZZQA 2VRAA 4TVSa 3CVHL 3NPSC 1H9DA 1Q9LA 3AWFA 3DI2B 1A7BA 4KXCA 1BDYA 4AZ8A 4LLQA 4BQCA 3DX0A 2QSCH 3T4AA 5HHMB 3CFQA 2VW7A 2H32H 3HB3C 4NCC2 4L3FA 1M7IA 5DUML 2Z4QA 2VC2H 3JBG7 1JV2B 4W9IC 4KKLD 3KBFA 1DBAL 2NXYC 3AXHA 3E1F1 4KNSA 2BZCA 4L3EB 3ETBJ 3LTVA 4U0QB 2VW6A 4TRPL 5K1VA 2BW4A 3SO3B 2RMNA 1KXVC 1I7TB 2E9WA 3AB0B 3FTVA 1RURH 3EDEA 3JV0A 3QAZB 4KROD 4LCIL 4N2MA 1RUML 3MRRA 1XAKA 4MJID 4AW7A 3KL3A 2QKIC 1A6ZA 1IARB 2R1WA 3FQTB 4MDJA 4RX4D 1QZNA 2OR8A 5DRZB 5FOBA 2IPTL 3MLXH 5CLTA 4R3SA 3UJIL 2WXOA 3NFSH 1MAKA 1T89A 3BVXA 5J11C 5TQ0H 4W1TA 3US9A 1J48A 1YUKB 2R23B 2UZIH 3K2UH 4GSXA 4XCYA 5HJ3B 5B7FA 2DQUH 3FCSA 1BEYL 4XN1A 3V4UL 2Y2WA 5GGVY 1B9ZA 4I3SH 2A0LD 5E4AA 3LN5B 4JFEE 4JJ5B 4UOQA 5TPWL 3WTWA 1VIWA 2E47A 3OPZL 3QNYA 3J27A 4X7FC 4ATWA 2TSAA 2YXVA 5IROA 4LBEA 4NZTH 4XO8A 3GBML 1IAOB 3OGCB 5FAAA 1CE1L 1QLEH 2OJ1A 4BKLB 1S7VB 3KM1A 1MRFL 2R7EA 3LQMA 1ITCA 2XIBA 1TUPA 5ILTH 1SYVB 3A24A 2O30A 5CWSB 3G7TA 3KDMA 1VADA 2A6JB 4JN1L 5GZOD 1A0QH 4U1MB 5IB1B 2UVFA 3KVQA 3GUFA 3U4BH 4KROC 1ZEAL 1BVLA 1KT2A 1KGCD 4RCAA 2CR6A 2XG5A 4HIXH 2CG9X 3I9AA 3VU2A 4BGDA 1MUJA 2NXYD 1KCKA 1Z9PA 4PI0A 1D5RA 1M71B 3QWRA 5DJ0B 4YR6A 3U9UB 1AG0A 4PN6A 4EKJA 2ZOWA 5EEXA 3RWFB 2DD8H 3GXIA 2GJ6D 3SPHA 1IC1A 4CC1A 2HFGL 3FQUA 4LLQB 4QRRD 1FYTB 2P1YA 3LPOA 2JCCF 3QG6A 3QIBB 2A6KB 3BVWA 3QIUC 1IKOP 1VFBA 5B3JE 1WS8A 2WVSA 4LRNL 4X99B 4LSUH 1AD0A 4GJTB 3HE6A 1WA0X 3VFVA 4MJ6A 1X9RA 1UUNA 1TKWB 3V6OE 2PPCA 2VZVA 1BQHB 1TITA 3QO0A 2ADJB 1WTLA 4KO9A 5SWZB 4YFLF 4I0KA 4WSKA 1PIFA 1E7UA 4NO3B 3VRJA 5IT2H 3IETB 2AAVA 3KPLB 5HGBB 2FSDA 5K9QG 3MC0A 3D2TA 3RRQA 1Z2KA 1IGYB 3AGWA 1TJIL 2VR5A 3L1FA 4L1SA 4QLRA 5BXFB 5JHMA 5JW4M 1KACB 2QADC 2Y3AA 4U1LA 5ICXB 5TDNA 1G6RA 2VMFA 3FU6A 4YHOH 3ARDD 4A6YB 2HTLC 1YMMB 1G7QA 4URKA 4P23B 3HRZA 2VUYA 2ZOTA 3RWDA 3BKJL 5K69A 3ARFA 1NUFA 3HG5A 1J10A 2H2SD 3UYPA 1LVEA 2G75A 4UI2A 1OF2A 2ZXAA 4X4KA 1CFVH 5IB2A 4UMGA 4H20L 1ZA3A 5DO2D 3ZN6A 3B34A 3FO1A 1WV7T 5CLYA 3X3GH 2P49B 2QBWA 2WWKO 3GJEA 4KVNH 5A2BA 1HSAB 1JG9A 3HI5H 4M5SA 4BH8A 4KPHL 3O2WL 3MRDA 1ZRUA 2XCMC 3BUBA 4I9WE 3T8XA 4OD2A 5EBLA 4OD3H 3ZE0F 1OAQL 3DRTA 5F3HB 4YVNA 1JFQH 3KPOA 4TQHA 3IETA 3KPLA 4KTYA 4NS0A 4POUB 5JOFB 3TZVB 2NXZD 1BLNA 3WIFB 4L18A 3QDJA 2G5BB 2EDTA 2O5NA 5I1KH 5C09D 3IU3A 5DTFB 5GZOA 3SOBH 1DEDA 7TAAA 3VXNA 1LNUA 4DK3A 4JNXA 2IBZX 2VMCA 3NEXA 3RL2B 1NCWH 2XI9A 3HE6B 1M2OA 4BCYA 4QRQB 4N1EA 2WLHA 4IRJC 4YSRA 4G6JH 1K8IA 5AAWC 4A2DA 3HMXH 5A6IA 3E38A 3MV8D 1R1CA 3UBXA 5E2VH 1CIDA 3FBQA 4Z18A 1RZJH 3LYRA 4WU7A 3A6BH 2JIXD 2FAUA 3QHFH 2GITA 4OQTH 1XF5A 2IG2L 4WUKH 3EFOA 1SYSA 2I9TB 2ICWB 3RIFF 4U7KA 3QDJE 4MMZA 3GMNB 3D06A 4G71B 1Q4NX 4G7YL 3CX5J 4L5FL 5CJQH 2R29H 4HDIB 4JVWA 3EADA 2QPFA 3D1MC 3ZJAA 5IREA 3N42B 4RGMB 1MIEH 4F57L 3IPFA 2D0FA 5C2BH 5FUCE 3NGBC 2EILB 3VACA 4ONOA 3FBKA 4XOBA 1OP4A 5D7JB 5JXED 4ODVH 3CVBA 3QHFL 4OQTL 5F3HA 2R23A 4XCYB 4C55A 4Q56A 3O0LA 4JFHD 4I87A 3L3JB 4FYQA 2C9XA 3LKQA 1W72L 2FGWH 1U36A 1XDTT 2N59A 3NSYA 5TJWK 1FIEA 4NQDA 1MFNA 5EUOA 5I1GH 1D6EA 4F2FA 2YOAA 1NAKH 4E41D 4QKXB 3PDOB 4FTVD 3OM3B 2YS4A 4OGYH 2ADGA 5AVVB 2ALWA 5HI3C 5D1ZD 1SUJA 3WNIA 1ETZB 1XH3B 3EYVA 1I3UA 1F90H 1JZEA 1MLBB 3DK0A 3FQ2A 1U4FA 4NSKA 4P3WA 5GGTL 2AJZA 3MRBB 3BEVA 3BUIA 4LLWB 2J2ZA 3LN9A 3ZL2A 3GBNH 4Y2DB 4G7SB 5HHME 4PRPE 2CXKA 3EZ8A 5MEQA 1CBVL 4I3SL 5CFHA 3HI5L 1GC1L 3F7LA 4RGNC 3WEAA 2PMZA 1EO8H 2WLKA 4NNYA 2BPBA 1UXMA 2D7OA 3VXNB 4IIQC 4UQ3B 3SE6A 3PS6A 4D0BB 2NQDA 1KUMA 4FMKA 1OARH 5TE4L 3U0WH 4IRJA 3ZBMA 1IBYA 1K5WA 4WJKB 3HHSB 4IJ3B 3B2PA 3VXRA 1CLZL 3IWUA 2DLEA 3RI5K 4WU7B 2R0WL 1NUGA 1FAKT 4OLVL 3EFOB 2TRHA 3B9DA 5AG9A 1J0ZA 1BZ9A 1YN6B 5ERWB 5MENA 3WHXB 4XC1L 3VD5A 3KMDA 3VFTB 3SQBB 1VFMA 3TT3L 5GGRA 2X2IA 3CXFA 4WEMB 3TWCL 1DEEA 4RWHA 1AZVA 3K4DA 4NJ9L 2HFTA 4W9EC 3BUPA 4W9DC 3WO3B 4L8BB 3G08B 3MV8A 3MAWA 2AJYH 4M1CC 2OPCA 4XE0A 5C08E 4MWFA 4AH2B 5AOZA 2YRLA 2ALAA 3L3JA 4P23C 1S6NA 1BMWA 3RVUC 3WFEL 2DQGH 2BVUA 4NNYB 4R7DB 2AJVL 2EXTA 4QRAA 3VGHA 1BVZA 1ZSHA 4LRNH 4RFEA 4XMPL 5TE7L 5HHPA 4WWKD 5KBDA 1DBJL 5TD4A 4Q58C 4NP4L 1OGAE 1M9WA 2EICA 2ESVB 4TLKA 1RZFL 4KAQL 3F7RA 1U2YA 4I85A 4KRLB 4L3ED 4ENEC 4JPVH 2NZ1A 1NWPA 3OAZH 2R2HA 3ZDZE 3BN9D 2BSSB 1ZE3C 4U1KB 1L0XA 4NP9A 3MLUL 4BDVB 1P5VA 2MSPA 3WHXA 4K8RH 2IO5A 5IOPB 2RR3A 4K3GA 3H6AA 1VFBB 1AR2A 5L6YL 1CE1H 4DETA 3OHXC 4FRWA 5EZJB 3DV4B 2YFNA 5AYTA 3RKPA 3SKNA 4TNGA 3X1FA 4R6UA 5AB2A 1O9WA 5BQDA 1TU2B 1MJJA 2AJUH 2OCJA 4P06A 5HHNB 3EH1A 5I26A 2Y7SA 4CBZA 5AW2B 2XVGA 3UP1A 3ZTNH 2FX7L 2H1LM 3DURB 4MWFB 4LSTL 3QIUA 4AH2A 4AK2A 1CK0H 3ECUA 4LESA 1Q1JH 3HMXA 4JJOA 3QXWA 3AACA 2DWSA 5AW6B 1KBGL 2Z31D 5AKTA 3SPVA 1A1MA 1SXZA 4FEIA 1QSZA 2AQRA 2NY0D 4PRBB 5EFIB 3HFFA 3UMTA 1J8KA 5EC1B 5KAQF 3N06B 1JOIA 4FLHA 4QI3A 5CCJA 1RK1A 1N6UA 2IOIA 2EADA 4JKMA 3QUYB 1AMXA 4PMEA 2IANE 5B1CA 1KB3A 4RDBA 4HIQA 1JWMA 1SXCA 2AVGA 3BEWB 1P7QA 4LSQL 2BLFA 3GTNA 5AWNH 4NZJA 1Q1JL 1BIIB 3DHJA 4K94L 3IMUA 1CYGA 1A6PA 2YGPA 1GZPA 2VLKA 3VYNA 3I3DA 4JN2A 1N5AA 3VXUA 4JM0A 1I9RL 1KB5H 2R9HC 2WQAA 32C2B 2AV7A 3T6XA 1KFAH 5KSVA 2CKNA 2OX5B 1P6WA 3IPBA 5IW6A 1PDKB 3MO1A 3QFDB 2V17L 4G8EA 2Z64C 4N0UB 1JNJA 3H54A 5IQOA 4HIJB 3JZ7A 2NUTA 1ODUA 3STZB 3KBEA 2N1KA 5E1QA 3V9EA 3MNVB 3WJJC 1ZWIA 3C2SA 3D85A 1KLFA 3EDKA 3WS6A 3PDDA 3LNDA 4PJBE 2FR4A 4L3EE 5EUOE 2ZXCA 4ERSH 3O41B 1DQMH 4B9KC 4U1JB 2XUWA 1N2RA 1R24A 1U8NA 2VDKB 3H9HA 3U82B 3VWKC 5MHSD 3QCVL 3EXJA 2X9ZA 5KVGL 1RP9A 3GHEL 2BFVL 2DQMA 2R8SL 3P4MB 1I75A 1AJ7L 1HQRA 3T77A 4L8SB 4YDZA 5CU9A 4L4VA 4P8QA 1QFHA 5CEYA 4JRFA 1NGYB 4N9OB 1BFTA 3HC3H 2Z8WC 2A38A 2Q1EA 3PGFH 2ZJSL 2X44D 3W39B 2VNCA 3GBNL 4NB7A 4QRPA 4C8XA 3AFLA 3EJTA 3MRNA 4OI9A 1ZKAA 1DZ0A 4FG6C 5J6GB 4UILL 2WYHA 1BXUA 5DJCA 3KPNA 1R46A 2NZ9C 4P4RB 1CVRA 5HYEA 1YPZB 1P4BL 3GTVA 3FUEA 2H0EA 5J1TC 1KPRA 2JKTM 2YMXH 4AJYV 5JPNA 2ZONA 4PJXE 5D9SB 1O7DC 1VENA 3WXWH 4DGVL 1R3LA 3ZKMC 3P4NA 1XR9B 1IQDB 2HH0H 2CM5A 3VSTA 5I2IB 2WTRB 3BUQA 3SDXF 5LGHL 3EFDL 4NBZB 1F97A 5GGUA 3ULVH 5HDQH 3CC1A 2YA2A 4P07A 1DJGA 1GGBH 3UTSA 5T1DL 2FO8A 2CK0H 2R51A 4MD4B 4U3SA 5G55A 1YDPB 1RJZA 2GFBA 4WW2C 1TMCB 2ITFA 2P9RA 4JB9L 4B60A 3UO1L 4DGYL 2D31B 4AGOA 4JLRA 5CN1A 4HWEL 2SEBB 5MENB 2KLTA 3DXAD 4UB0L 4Y2LA 2GY7B 1KC5H 5F7NC 3F3HA 3UPAA 2TSBA 2PPFA 1MFVA 2HX8A 1U8OB 3Q2NA 4N0CC 1IGMH 1PVHA 5TQ2H 4YSUA 2PW2A 4J39A 1JZGA 2O5XH 2WW8A 4QRPB 4UM9D 3QUMA 2WXGA 3GBDA 2WMPA 3A6BL 1WQVT 3EJZC 1XH3A 4LDEB 4GKNB 2N3JA 1CG9A 5K9JL 5SX4H 4AG4L 3RE0A 5T1KA 2YQ3A 2UZYA 3FFCA 5GRZA 1PZ5B 5DZOA 4G8FA 1BAFH 2IFGA 4NBYB 1G0YR 5DZ9A 5BJTB 3OC5A 3P4NB 5L2JB 4Z7WB 4X80H 2V4LA 5H94B 1WIOA 1RD6A 3QR2A 3ARQA 3CDZB 2EEFA 1MY7A 4JCWA 4KUZH 5JNYA 2I9LB 2BDNL 1A6UL 3GC3A 5JA8B 5FYLL 2N7AA 4AUYA 2NY3C 3BUYA 1NDTA 2W07A 3SBPA 4NT6B 4Y4FA 5DFTA 5K9JH 1U3HB 1JGDB 3Q2WA 5FXCH 4ONFH 5JHLA 2OP4H 4GXVL 4G5ZL 4JGUA 1NUNB 4Y2DC 3EYUL 4UTBL 3HRPA 1VSCA 2JLPA 1QTSA 3A0OA 4KVNL 1KDJA 4Y19B 4NYLA 5C0FA 4O2FB 5DJAA 2X9WA 3WNOA 5EO1B 4UQAA 5IJVB 1WVZA 4XMVA 2VT0A 4LF3B 1TZAA 3QDJD 1W8OA 2GHWB 3RLSA 3CFEA 1LEGB 1EJ6A 4B9CA 3ETBF 1ETA1 3OKMB 4FXTA 3ECVA 2IF7A 5AZ2H 2NY4C 3C8KB 2AJ3A 3QQ9D 3TLRA 2BHFA 1HS6A 1JS4A 1UCBH 5ANMB 3WIFA 5LO7A 4BQ6A 4AJ0A 1FNSL 2A9AA 2F9BT 2ATKB 5IJKC 4LLVB 4LKCB 5E2TH 2CCLA 3AS3A 4R2GC 4DNLA 3I3BA 2OTWB 3GSUA 1J12A 3GSVA 3KE0A 5PCYA 3RWIB 3RY6C 3T4AB 2CGRL 2DQHH 3FO9A 3NABH 3HE7A 1K8IB 3Q6FB 3LEVL 4JO1H 4OLWH 2JLLA 4M62H 5CR1A 2DQCL 4UT7L 3A5VA 1FG2A 3ESMA 4E9RA 5KYWB 4LHQB 3RQ3A 2UZYB 3NZ8A 2P7TB 3IJHB 4TUJB 3AZUA 4V1DA 5ECGA 4KKCD 1VFAA 4ELDA 2EIEA 2H26A 3QJSB 4N8VB 3U7AA 2VDRB 4IBQA 1DVQA 3P9LA 4KVPA 1BJ8A 2PYEA 2YPVA 3U25A 4HUMB 1FFPB 1U91B 4RISH 1XGYL 3SKJH 1GYWA 1RP8A 2F5AH 3KGTA 1ET8A 2A74A 5D6CB 3GBEA 1KG0B 3FN0H 4N20A 3SKNB 2Q3AA 1Q0YH 1HL5A 1P4LB 5F7FA 1URZA 2K3TA 4F9LC 1MJJB 4P3CH 1N59B 2ZUUA 4X4ZA 4AGNA 3R8BB 4AQAA 1H6EA 4PG9A 3X14B 2BIQA 1U58B 3B3IB 4PLKC 4WKZA 4B9JA 1XH0A 4DGYH 2X4OA 1C7TA 3NACL 4TULL 2WO4A 3M8OL 1A8ZA 1W0VB 3MA9L 2FX7H 2XNAA 4MX7B 4ZW6A 3U30C 3WTXA 4KKBD 3V9CA 1KCUL 3PXHA 3WYRA 5EFIA 2DKUA 4TVPD 1XGQA 2PPDA 3O4LB 2QFRA 1YJDL 5DLMH 4YSTA 1AAJA 4ELME 3MV9D 5GIRA 3Q5OA 1J8HB 1FG9C 1GOGA 3QORD 3TO4D 1VJSA 2HPTA 1FUNA 2DH2A 3MJ8A 3QNXA 2VSKB 4EVNA 1UXWA 1NEPA 1LILA 2VQ4A 4KGJA 2FE0A 3NJMA 4EN2A 4FNLH 3P0VH 1VEMA 3HOGA 1BVNT 1WZLA 2BCKA 3THML 1U3ZA 1SMOA 3PL6C 4UOJA 1L7TL 3S2CA 2QVKA 2QV4A 1PLGL 1UC6A 5SV4A 5DHVB 4OR1A 3UTPE 1X9LA 2DW5A 3QZNA 1KWGA 4K7PX 5BS0A 1WWAX 4HKZB 4D8PA 4EZLA 1ZT4B 4QRRE 1JWUA 1HEZB 4Q52A 2E9GA 4AYMC 1KC5L 1Y07A 3PWVA 1X5ZA 3VO0A 2OL3A 4JQIL 4G8IB 5IHZB 5EBWA 2JJSC 4ETQA 2F74B 3GLEA 3DMMD 2XFXA 5CBAB 2V8MA 3RX7A 4E41E 4JPWL 3MROA 3DMMA 4WI7A 4Q7DA 2BY3A 5TTRA 1ZEAH 1CXKA 2BNUB 3OTTA 4BEIA 3H3KA 1I85A 3FT3B 4FLSA 5CJOH 3DMMC 3EFDH 4HXAH 3A21A 2YD0A 1B3JA 1GGUA 1NGWB 2HUHA 1KCUH 5EPMB 5HGBA 2ZXQA 2PP7A 2VITA 5D55A 1LP9A 2QGBA 1JIBA 5DMIH 1AQKH 4KI5C 1ZT1A 2VXVL 3CFTA 1UQSB 4X7SL 3LKPB 1A25A 4XO4A 5DQ9B 5FM4A 1G6VK 5TF1H 3UTZA 3WS3B 2OYKA 2XQBL 4M7ZB 1CCZA 3IK2A 4P46C 4WEEA 4Y5VB 1R3LB 3FN0L 4NQCA 2F53D 3PL6D 4U6YA 3B2XA 4U7SA 1KBBA 2HB0A 3RDTC 3QGVA 1G9HA 1KGWA 2HCZX 4OZFH 2VSDA 4N9GB 4H0HB 5B7MA 2H3NA 1V10A 3MOBL 3PPEA 3RA7H 3RUGA 4NAQA 2PF6A 3TO4C 1BAGA 1X6NA 3FMGL 3KWWA 3MYJB 5ENWB 1Z9NA 1CLCA 1GOFA 1TZIB 1Z9SA 4TL5A 3O0RH 1AKJA 5L4IA 1QQDB 4TSCH 1AXSA 12E8L 2C4FT 5KJRH 1PMYA 3WIIH 4GLRH 4GKZA 4PJ5D 5AD0B 1G87A 3WLWD 3MX0A 1R33A 1OAKL 1FFTB 1SEBA 1KGXA 1NL0L 2CO1A 2JCWA 2FWSA 3EYQD 4KKZA 4DOHB 2MCG1 2CGZA 3U9PL 2Q7YB 1UD5A 4E9YA 4LXFA 3VX1A 2CO6A 1THCA 2EIJB 4HC1L 4OLVH 1H3VA 4OM0L 5FA4B 4FQ1H 2EIKB 4QCIA 4OIIL 4KRPC 2JFCA 2GUOA 3STLB 4G9FA 4LLUB 4OF7A 4Y16A 3CZFA 3ASNB 1CR9L 3BRFA 4JQVA 4TUOB 4J3OF 5L9DH 1E3ZA 3OX8A 4XN4A 4D3CH 3DTXB 5AAPA 1A14L 3R4RA 2E7BA 4AYFB 1BM3L 1S7VA 4NQCB 3Q43A 3NACH 4HOZA 1AP2B 3NA9H 3INUL 2QPSA 1UWYA 4CC0A 3MZTA 4X7CC 3UBXB 4X6CA 3LKNB 3RWIA 3N44B 3QNFA 4OD1L 3OMIB 3MRKB 4AQ1A 4NZ8A 1F3DJ 1XSJA 4JREC 2AEOA 2N7SA 5E1IA 1CICB 1BFOA 4ZFFB 2VISA 1DBKH 1PW3A 7PAZA 4NRXB 2NY2B 4PCKA 1FSKC 5AOJA 4UNUA 3IMRA 4N8VA 3FUIA 1E6OH 5AZEH 3G3LA 3BD5A 2J1YA 3GRWH 1FCGA 4G5ZH 2XQYA 3MNMA 1F3DH 2ZYIA 2F7IA 3OXSA 3CU7A 4F58H 5IB5A 1FL3B 2CUIA 1D6VH 3ARFD 1FVCA 4MD5B 4WSGA 2WP3T 3N04A 3VG0H 3M8OH 2PLTA 3FPYA 3OR7A 3ZDXF 4CN6A 1MH5A 4BZ1L 3O3EA 3IE9A 5B38B 3TA3B 2VZTA 1NCCL 3K8KA 4JBSA 3MUGB 1DE4B 3ULSB 4QT5B 1G1CA 2YC1B 3IE4A 3G6AB 5F3FA 1XBRA 5KUKA 4IDJL 1QRKA 5AZ2L 4YZFF 2ZD0A 5H37G 3VQLA 3P3YA 3UYRL 5M7QA 2I07B 3IDYB 4RISL 1GCYA 5ACMA 1FL5B 4GY4A 2YOCA 1KBVA 4Y2DD 5JHBA 4N0RA 4MB5A 4G8GD 3FT2A 5ID0A 1XHHA 4W6XB 1BFOB 2X28A 1Q9OB 3C2AH 5L0QC 4Y16B 1TQBB 5DU7A 3KR3H 5I75C 3D2UA 4PJFB 2E7LA 4XMZA 2M2DA 3M7OA 3S8WA 4P04A 2B5IB 1PGRB 2NY3D 3FTSA 1OSZA 4F33B 3Q8AA 4OLWL 1FZJA 2X6UA 3L4XA 4ABWA 3BVTA 3QCUH 4IK7A 2VLRD 4IRJB 3SODB 4CN4A 1YN7B 5D70L 4JFHE 5T1DH 3FB7B 4LU5L 3VXRB 1FL3A 3NPSB 3RX5A 3D9AH 4GOSA 4PJAF 4OCLC 2GJ6B 2UWEA 5EIVA 5BS0B 4ZZKA 1XTMA 5DLML 3NESA 4ORGA 3GRWA 1MW3A 1RUKH 2WV3A 1OZUA 5E8OB 2Q86A 3D69B 4JJ5A 3KYKH 1FZKA 4NX0A 5KYUB 4JANB 2F2HA 4K3JH 4A7TA 1QNZL 3BMVA 1FN4B 5I73B 1C16A 3VXTA 1F4WH 1NIFA 3BDYL 4UNTA 4C56B 3BAEH 4G9FD 2XFGB 4S1QL 3E8UL 1CI5A 1SBSL 5GRJH 4BXVA 2D31A 1KYUA 2QQNL 4S2SB 2DRUA 1T4WA 4G6KL 3IRCA 4HKXA 5HYJA 3KJ6L 2YXWA 3OAYK 3NCBB 1RULH 4ILDA 2WIIB 4OZGA 4NIKB 1SRDA 5H2BA 1UOWA 2GAZB 2V3EA 1FZMB 3G5YA 2PPAA 3ILPA 3KPOB 1SOSA 1TXKA 5JO5B 3WN5C 5IKCB 4PWFA 1CT8B 5AAMA 2XIDA 5LNEA 3OR6B 1AHWC 3C6LD 4HBQA 4IOFC 3WE1A 4P2YA 2AABL 3QDAA 3QXUA 4PGCA 5LXGL 3WUWA 1NAMH 4M4PA 4LVOC 1AGEA 2GC7C 4AIEA 3OAZK 5D1ZA 4NQEE 2X70B 1EZVX 4Y5VA 2A7BA 4H8WH 5I8OL 3CPLA 5IMOB 4N2AA 2FQEA 3ZKMD 5E6IB 3SDCC 3FQTA 4LQFH 4OSUL 2VDQH 2ZG2A 1D5IL 2BH0A 3KYMA 1UYWH 3ESNA 4GG6B 5AL0A 3VI3A 4QY8B 2WLMA 3U79A 3CHXA 5JR1H 2CJ3A 3TT1L 3NQKA 4FNRA 2XJKA 1SN5A 1MF2L 3EJCA 4X7TA 4FG6D 5GRXG 4Q9QH 1ICTA 3QPQD 4RH4A 5AAWA 3FRUB 5J7CC 3QEGH 4X5WA 4N6RB 4B0MB 4Z5RB 1IQWL 1OAYH 1TTRA 2H0JA 2XRAH 4LBEB 3VFRA 3SHSA 4U05A 4CC4C 1R3IH 1T2JA 4NQEA 5C9KA 3VXRD 2J25A 1NEZB 1ZS2A 1I1AC 4P05A 4X0NA 1XXDC 4OTXH 3AU1B 4KZEL 3HG1D 3HNSH 2XQ0A 4WK4B 3MTXA 2FB4H 1P4UA 3D30A 3QRFM 4HU2A 2J8UF 4PGCB 4YHML 4OJYA 2Z91B 3DOSA 4G8GB 2WQXA 3UC2A 2AJ3B 2IDTA 1AI1H 4XP5L 2GPZA 4X0KA 3ULUF 2RQEA 5C8JB 2WXMA 2WXRA 3QT2A 3HHRB 2RAMA 5AKRA 4X7EC 3L81A 3IBOA 4F7TA 3BEWA 1Z5HA 2PW1A 5FUZL 3AC0A 3H7LA 1WBYB 3GZPA 3TXAA 1ZXKA 4ABQA 3RUGF 1UXSB 4ERSL 4DP6X 4W9CC 4ZX5A 5E8DL 4OIIH 5I28A 2FIKB 1YYLH 4CSTA 2P8LA 4UT6A 3KNBB 4AJVA 1AYRA 3IN0A 1KLUB 3MO1B 4HGKC 4ODWB 4Z9KB 2VTFA 3EDJA 2B1AH 4W6YB 1QRNB 4JEGB 4M7KL 3NYKA 4AWJC 4FFWC 2X89A 3RTQD 2CDFA 3ELQA 3MZGB 1CGSL 2D03L 3B8YA 4KROB 4TSCL 5C0GB 1YEKH 4BFIA 2HSIA 4PTUB 1F3JA 4KO7A 1KTCA 2VDNB 5HYJD 5DHMC 5GS0L 3ASWA 1RJLA 3SKMB 2N4IA 4GQRA 4X6BA 3AY4A 3R1GL 1IUZA 2DIJA 4LPXA 3NFSL 4P4KD 5LCVL 2BVOA 4Y4KD 3FSAA 1HXYB 4BZ2L 4WO4D 4ZRGA 1LO3L 1H6TA 3HBZA 2DWYA 1AGBA 2YUZA 4L1DA 1NC2D 2DDQL 3P0YL 1HINL 3GHPA 4XVJL 5FYJH 5C0EA 3FU3A 5IUSA 2G2NA 3B6SB 2YXMA 1I4FA 1UZ6F 2YEQA 1A4JB 5HGHA 4FF9A 3HZVB 3WFDH 4A63A 4PGEA 2ZUSA 4OCYL 4M6OL 2BSRA 2R27A 3L16A 4L8BA 1U8IB 2EO7A 4NQCE 2WBJD 1MKFA 1ZT7A 3OL2A 4NCC1 4UDUB 3AU1A 4X50A 3M45A 4MB1A 1S9WA 5E8PB 3IVKB 4MTMA 3HIZA 1LXMA 1P84K 2JJUA 4NO0D 5F2FA 4E5XG 5BRZE 4IGBC 2H6OA 5E7FA 2YEZB 3NH7H 3CLFH 4DN4L 1TIUA 1DN2A 3E6HB 3WL9B 4ZS6D 1N6QL 2VDPH 3TTYA 3T2QA 4KXBA 2UY7B 4WWKC 4X9GA 5AOLA 3S4SG 2LW3A 1JZ4A 2A6DA 1NCGA 1MCFA 3DIDA 4N26A 5C0GA 2ODIA 5E94B 4KTGA 4I48A 1IJNA 3DJTA 1Q94A 5GPRA 4LBAA 1YEJL 2YUWA 2WBKA 4KNQA 5EBMB 4P23D 1OY3B 2DWEA 3MODH 4PS7A 1Z5LB 1U8CA 1PY4A 5AVQB 3B7SA 4ODUB 4M1CD 2ZJSH 4H25B 4P23A 4AZ8B 5DCCA 2JJTA 2YQ2A 3QDJB 1K85A 4UTAA 3CFKB 3UAJD 5E5UB 5C0EB 3ZO0A 3DVGB 4XVUD 1AHWB 5KVDL 3IDXL 3ML9A 4B9IA 3P11L 1F6AB 3EYVB 2DN7A 4PLNC 1ZPLA 4HWNA 2UXTA 3KCWA 1HSAA 4P9HH 4I1NB 4LASL 3NVQA 3L3DB 3UBXI 2BY0A 3IDMA 4Y88A 2ZZUT 4AEHH 4KWUA 2MNUA 2CA4A 3QBTB 4DKTA 5I6XB 4G7RB 1S7WB 3RWEA 1HFUA 1UADC 4N2FA 3C8HA 4PCSA 1T89C 2ATPA 3KEHA 5C92A 3U6RA 4L1HA 3BPNC 1DQKA 3JSSA 4R7NA 5DO8A 1HC1A 4O02H 3FCSB 2JIXB 4P2RD 2E86A 3LHPL 5IF0B 3ZTCC 3I6GB 1QA9B 1DJIA 1ORSA 5LGHH 4WTZG 5I0VA 3BDYH 2VDPB 4X6DB 1S8DA 3B43A 1I7UA 1MW1A 1U3NA 3CPLB 2VDRL 4K7PL 4WDIB 5IMOA 1A2YA 3SBWA 5DJ6B 4Q9QL 2C5DC 3MBEC 3FTGB 4ZTPH 2DTMH 4ODUA 2MWCA 3V5HA 1WLHA 1NTDA 3CFCH 1HINH 4ORGB 4XVJH 5FYJL 3KLDA 5CCKL 3I50L 4CUCA 3D4GA 3KWVA 5D1ZC 5F71A 1MCSA 1X6LA 3ZKSD 3BVUA 2MH4A 1Z0MA 3D34A 3GMNA 5ETUA 3HLAA 5HGAB 1P9MC 3REWB 1PPIA 1L9NA 2Y1VA 43C9B 2A4CA 3B9EA 4XT1C 4B0MM 3UJIH 1BGXH 3D8MA 3W9DB 1FO0L 4WWOA 2FLMA 2LAAA 2MMXA 4U1SA 1ZIAA 2ITCA 4OFKA 3TA4D 1F6FB 1MAMH 1D5ZA 1KGIA 3FU7B 4FKHA 2BO0A 2Y1AA 4Z0XA 1CGUA 4LL9A 1G43A 5DQDL 1INQA 1P1ZA 4JPWH 3BKYL 1P4IL 3WEXB 4GBXA 2ZUXA 3CZFB 1QLRB 2R0ZL 5CEXA 1YY9D 1T03H 3NJGA 4XWOC 4YZFE 3EYOA 5EUKB 4DW2H 5ACLA 2A9NH 4TNVK 3L5XH 2CIKA 4UZUA 1WUNT 5ACZA 2K6YA 1E9QB 1TETH 4OLUL 2WAHA 1E3XA 2FD6H 4C83A 1KIQA 1WT5A 1OAJA 3O2DA 2IOMA 4D9LL 1MWAB 2NTFB 5I1JL 2WXHA 3II3A 5H4ZA 3QFJE 4RWYL 1RUQH 4NQQA 3JWOC 3KYMB 1OM3H 1BX2B 5DRXB 1TLKA 2CIIA 4MCYA 2W9DL 3K2MC 4MA3B 1RJYB 1WISA 1BXXA 2E5EA 3OF6D 5ICYA 1UJ3B 2AJZB 1Y7VA 4KK9D 4X8JB 5IOPA 5ESVB 4HKJB 4YHMH 4KJYA 3CBRA 1MZZA 3NCWA 3M17A 5BV7H 4QTHA 2EZ0D 4GQZA 3VDAA 4ABVA 1P6AB 2C4XA 5HDOA 1ZHBA 4FLOA 2R29L 1V27A 5E6IC 3F6IA 4YHNA 3U2SA 5D7IF 3UIYA 2PCPA 3GTTA 3L4WA 1R5WA 1JTTA 5F88A 4YXHH 2VN5A 4NZDA 4AIZB 2NXZC 4X42A 4JVPA 2F8IA 2IAMB 5C7XH 4F7PA 1CZ8L 4AQAB 3FTWA 3FYIB 4XXWA 3ATDA 1C7SA 1ET5A 1SM3L 3VX0A 3SN6N 4FNTA 2N1TE 3FO0L 2QVIA 1BYNA 4HP5A 3UYPB 5IHHA 4JRYB 1LK2A 3I6KB 4LDLB 3L54A 4XNQB 4J4PA 4N2BA 1FIGH 2DI8A 4G8GA 1MLCA 2ZWSA 5D7KD 4G83A 4NGHL 3D25B 5EDSA 2DYRB 4MXQD 2VDQL 1E5YA 3FCTB 4QHUA 4HT1H 3UABA 2QR0A 4W70A 1U6AL 2XPZA 2OCFD 2GSGA 4MQ7B 4ONGH 1TEGA 1KBPA 3G5XB 4OLEA 5IHUL 3DRTB 2FJUB 5JIMA 3UG3A 4I7ZC 2XV0A 1OGAA 2G2RA 2HTLD 2X3BA 3OGOE 4Z78B 2R4RL 2A73B 4TMPA 4UZSA 3WFBL 5JNYB 3TONA 1OGAD 1TCRA 3KYOA 3VXSE 3ABGA 3MCG1 4LLAA 2QADD 1CS6A 3EJPA 2J6EH 4NKDB 3G04B 2VWEC 3VRLE 3KM2A 3LD8C 4U6VL 1M71A 2F1EA 5BRQA 2DEXX 1R5WB 2J88L 2X7LB 3HNSL 4KX9A 3T4YA 1PCXA 4AQ1C 1R0AH 1ILUA 4MCZA 4DJMA 3IS0X 5DEJA 1YEDA 1NLDL 3I75A 1FLRL 3DURA 4Q97A 4R9HA 2AXGB 2J12B 3OB8A 5AAMC 2NY1D 1J7VR 2VLLA 1KB5A 3QA3B 1T6BX 4ZJ9A 3VXMB 1A6AA 3CLFL 3LPFA 1FP5A 5D1XB 4KK8D 1E5CA 5I5RA 4PRID 3MQIA 4NUGH 4C56A 3KLLA 3HI6H 1JNHB 2DKSA 3SCMC 3PHSA 3UGUA 3DVNA 4JQVC 1Z66A 4I1RA 3L2LA 5BV7B 3A4DA 3L3HA 5CP7A 3U36B 1F2XK 1J88A 1DUYA 1FO0H 2IAMD 1D9KA 1S3RA 1RK0A 5J5EA 1FLRH 3OAWA 2OMYB 3OHXB 4FQPA 7PCYA 2D7TH 3VTTA 2GAZA 4ZW7A 4URTB 1QFWI 1XR9A 2F54A 3GI8H 4Z7OE 3ME0B 1FVDB 1SDDB 2M83A 4NN6B 4ZXBA 2NY2C 4HLZG 3LKRA 4J2QA 4U6YB 3VWJD 3MGTA 2OMVB 1ID5I 5KVDH 1MCNA 1M53A 3K71B 2CUAA 1TJXA 1NC4A 2HFFA 4N0FB 4PP1C 4LGSB 2BW5A 1LEIA 1QPKA 1CGYA 2NY6D 3OKYA 3TCTA 1UM4H 4A2FA 2MTAA 3BWAB 4Z23A 3GI9H 3LNHA 1VF5C 1W15A 2QPEB 3QUYC 3JV5A 2DJ4A 5D7EA 4XCCH 3T08A 2IQAA 3MJ9A 3MODL 2CKBA 3I02A 3QJOA 5B22A 4X4XB 1NGQL 2YN3A 3WHE1 2QADB 4EXKA 2DEYX 3LVTA 1JTOA 2YKLH 4GQ9H 1ASOA 1BD2D 3MLUH 1QVOB 1L0PA 4Q9RL 3R7QA 3GJEB 3LZFH 3L3HB 2W91A 2K8QA 1EDHA 3BVNB 3W57A 3FAXA 1IZJA 5I1IH 1BD2A 4ZDHB 2I25N 5H4YA 1KNOA 1JGEB 5K9KA 1UM4L 2A0LC 2NY0B 5E70A 5AW0B 3F5WB 3MRNB 2HJFA 4YX2L 1YQ2A 3IDXH 1KLFB 2K6WA 2P3YA 3D50A 3KPNB 5IJCC 4B9ZA 5T3ZE 2DQUL 4PJ8C 1NFIB 1VACB 2A6IB 4UF7C 1XR8B 4PJCE 1QZ1A 3H2QA 2V6HA 4H0LC 5CCKH 3VFWA 1T7VA 4RMSA 2Q0ZX 5LAXA 1TLMA 1S7TB 3LDBB 5I5IA 1IM3B 3T77B 5FYKU 5I2IA 5F0PB 4M3HA 5LDUA 3VI4A 4DCQB 2YPLA 2ZF8A 2WN2A 2C3XA 1KTDB 1OCWH 3HPLA 1LEIB 1YUHA 1LO4H 2ICWJ 2E27L 4YHOL 2FBOJ 3HVNA 3MLZH 3P73A 2CCVA 3DJ9A 3HB3D 5AKVA 3Q8CA 3QNZB 5IFAL 3NAAH 3GMLB 3QI9A 3N6YA 3ULUL 4OZIA 1HH6B 1D5MA 4S1RL 1UH3A 2GTZA 2VZUA 1JPSL 2F53A 3PL6A 4YDIH 2P5WB 2I7SA 1S5HB 5L4MA 3L5XL 3FO2B 3ZHFA 4YDVB 4Q6YA 2XY1A 1FFRA 4JG0L 1IGIH 1T1WB 4R96B 4Z7VA 1FLTX 5DZLA 1GJWA 1UB6B 4R90L 2Y69B 4OKDA 5CEZH 5CJXA 2V17H 4HJGB 1IMHC 4JRYE 3NJNA 4KZCA 3QRBA 3CUPA 2PR4L 3QPKA 1OWRM 4OIFA 4GAGH 3EOTH 1Z9MA 3SGEH 4Z7QB 4P59L 2J88H 2Y6SC 4NO2A 1NCBL 1GHFL 2PO6D 4DP4X 3ZT7A 2ARJQ 3QUML 1VFUA 1FRGH 1JRHH 1AXTL 2B77A 2EQDA 5D7JD 2JI2A 3Q2LA 1U8HA 4DEPC 2VGLM 4G42A 4GMTH 1RUPH 5I15H 3E0GA 2FX8L 2QTVA 3RWGB 5J89A 2WBJA 4ZSOE 4BDVA 4BIKA 4I2XA 4D0DA 4PR5A 2HRPH 1DBKL 2NW3A 3GLDA 1PEZA 1OZTG 4IQHA 4TM9A 5D1XC 1GGYA 4WJ5A 4HETA 5IVXE 3WO4C 1U8PB 2WZ5A 3TN0C 5I16A 1A4KA 2HMID 4JGJA 3FCTA 4QHUB 3CSYA 3N85H 5AYUH 1ETZA 3CTTA 2GG1A 2R69L 3CVIL 3ATFA 1Z9OA 4H5SB 1W0WB 1ZGLB 3N50A 2F5BH 3L3IB 1IFHL 5E6YA 4XZUB 1ZXQA 5F3BA 5T5NG 3UTQB 1QEWA 1SHWA 1U8KA 5E8EA 4M7LL 3LZPA 4R8WL 1NBYB 4WJG3 1RUPL 2G2RB 4HHAA 4ZO6A 4GAYA 1EWHA 4M29A 4QHLA 5DGQA 2NR6A 4MA3A 3GZOA 4JFOB 5DZNA 4JX0A 4XXDA 1T1YB 3G6JB 4JY4A 3SDAA 1ZMYA 1KELL 1TJIH 3T0AA 1G6RL 3I2CH 3ULUH 3QZPA 4Q2ZB 4HS3B 4G11A 2DQFB 5BW7A 2G3MA 3SDAD 4DK6A 4WW2F 2X0WA 3RZWA 3L7EA 1JCKA 4HX1B 2H3XC 3X1GA 5I18H 1UKSA 3OKDA 1YEDB 4JG0H 3SGDI 1KENH 3KWWB 3MYJA 3CCHA 5AB0A 2R29A 4DUWA 3WNPA 3HC0B 1HWHB 1T0MB 3U30B 3FT9A 3COOA 1YN6A 3GPEA 3DIFB 4TUUA 4I2XB 3L1EA 1PD0A 3P11H 3QIWC 4ODHH 5IFJB 4O4YL 3ARVA 4F7MA 1HXMB 4MS8D 2XBTA 3FT4B 4EI5C 4LK4A 2UUDH 2F7PA 4NRYA 4AEIH 5C86A 4O58L 5JTWA 5LXVA 5J12B 3K1KC 4Z1PA 1E27B 2VDNL 4IKKA 4PYHA 4JFEB 1YNTA 1W0WA 2H1PH 2ERJC 3O2DH 4M8QB 1ZGLA 1I1AA 1IGML 5FYJE 2Q6WA 4QRPD 3ZK0A 5F7YC 3NK4A 5T3XD 3DOIA 3MCKB 1RZ8A 4N8UA 2N01B 2DLHA 4YJZL 1CU4H 2ADJA 2BOCA 3GM0A 4TNFA 3OX8B 5CKAA 2AQNA 2Y24A 3IJSA 4IU3A 4OZHA 1L9OA 2C1OA 4U1JA 3E6FA 5CBEA 1OHZA 4JO8A 1A1OA 5CMAA 3P2TA 2X70A 2VYRE 2XG4A 4JRYD 2ENYA 4K71B 4KZDH 3ZW3A 3LPPA 3MLRH 1CFQB 1KJ2A 4F3FA 4X6DA 4DZ8A 5J3HD 3F7KA 1T6VN 2V7HA 4YPGB 4L9LB 5K9QI 3G5ZA 2FVNA 4LT7A 4GSUA 3HFML 5JHDD 3ES6B 2NTSP 4M5YH 1CZ8H 4QNPF 1PFCA 3HBPA 3P3TA 1LO4L 4UT9L 2BJMH 2X3CA 4FQXC 2WTPA 4Q4IA 3SE4C 2HWZH 3QJTB 2VLRA 5F1NB 4AVJA 5DJYA 2NR6C 2PTVA 1ZVHA 4HQQL 1IKNC 5CHNA 5I0XA 3HJEA 2XTJB 4I13B 1F5WA 4G1MA 3WN5A 1R3JB 2W88A 1U8OA 3KD4A 3QQ4A 4JE4B 3MFFB 4ACPA 1JHTA 3V0AC 4F57H 1YNKH 1TTCA 4HXBH 4HUUB 1YEIL 1MAJA 5F7HA 5ICUA 2BM3A 5C0DA 1R3HA 1LD9A 5GGQL 3B83A 2A9ML 5DHDA 4YDKH 3MV11 3OWEA 4KKNA 3CCHB 1SQ2N 4L29A 4Y2NA 1YDPA 2GFBB 4F8PA 5KS9E 4Y9FA 3O81A 1GGBL 3J07A 3SDDB 3R0MA 1GGCL 3GNMH 4GRWE 4Z3JA 1TQVA 5DJ2B 2R1XB 2GCYA 4M9PA 3TZVA 4HS8H 3RJDA 2G3ZA 4UZGA 1NIAA 2JV6A 3C75A 1EAJA 2WLLA 1DLHB 5JQ6H 3NFNB 4F7EA 4E41B 2A74C 1XF1A 4JY5L 1DANU 3G5ZB 3OLDA 2E59A 3TVMC 4EUPA 4I18C 3VMOA 4H88H 4Z7UF 3ETTA 2I32A 4PJBF 3U4EA 1FGVL 4KTDL 4UV7H 1EBAA 4K3HA 1NWOA 3VQ1C 1BJMA 3MCYA 5JOEA 4RIRB 3N55A 3RTQB 3HE7C 4KQ4H 4LSSH 4QHKI 1IEBA 4YDJB 5KSVB 1I7TA 2A99A 2CKBB 3BLKA 1H9VA 4XNXH 4KJYB 3QFDA 2VDNH 2DI7A 4AT6A 4YK4B 1MCPH 2ICEA 2MRYA 1E90A 1U33A 3GMOB 5FF6A 1YMME 1CQYA 1MJ7H 4N2DA 4GRMB 2V7HB 1INDH 1OLZA 2AV1B 3IJYA 3O4OC 3PAYA 4DTGH 5JZ7D 4EE2A 2QL1A 4X5PA 1XF4A 2MCAA 1MCBA 3I6LD 3NIDB 2FH6A 3H4FA 4G1EA 1OTSD 1QKZH 1U42A 1AQMA 5IVZB 2X2YA 4LCWD 3QARA 4DP1X 1IT9L 4ISVA 2IALB 3GGWB 4L1TA 5E1HB 4AQZA 4OCRH 4ZODA 4H7VA 5FO8B 3DHMA 1A47A 3IB4A 2EJ1A 3IMSA 5DEFA 5MP6L 1QX1A 3HFMH 2C9UA 4JRYA 1W8EA 4N2HA 3ZXAC 4FFYL 5DD5H 2X2UA 1C8QA 1MLCB 4FC3E 1QMUA 5GS2H 2J3SA 4F93B 4ANXA 3DRQB 2BWIA 4KJPC 5HHOE 2BK8A 3SBQA 1E4JA 4FFVC 3SJVD 2EDBA 2B7DT 5INDA 4QNPE 5E5MB 3NIGF 4FQIL 1S78D 4MDIA 4P2RE 3RIFK 2QVFB 1IM3D 3P9MB 5TE6L 1RK7A 3A3YB 4P5TA 5DR5L 3KPQA 5IB5B 4R97C 5F7MC 1ZOXA 3O0RL 4M43H 4XAWH 3SKOA 5SX5K 1WZ1H 2J1ZA 2TRYA 5FDWB 2ATKA 3NTCL 1XF2A 5F0MB 2WANA 4HX1A 4OT1L 4MAYB 4UQ3A 5HYQA 4H25A 4JREB 3KLQA 4LEXL 5D1QC 4YFLI 3LZRA 2F1AA 1S9VA 4XOAA 4ZS7H 2FZ3B 2EE2A 3ZQXA 2XXMB 1ZTMA 4OJCA 1D5BB 4E36A 1JRHI 2NOYA 3H3PL 1CGWA 4M48L 2J1XA 3TBVA 3UZEC 4M1GH 4E9WA 4XCNA 1OQXA 2J1WA 3AXLB 1AS8A 4X99A 4FI6A 1JXKA 1XT5A 3N2JA 1FJ1A 5KSAC 4H1LH 5T8IA 3NJJA 3EJYC 5IW1B 3OAUH 2F7RA 1D7CA 5GHWH 1SEBB 2VDPL 1JNHA 1NDGA 3WAKA 3OXRB 4AEFA 3C5SA 2XN9E 4Q9BA 3FH7A 1S7WA 5DFVC 3TP4A 1W6LA 2E7HA 3CC5A 3ZZLA 5MEOA 3KLAB 1U93A 4W9FC 1CG9B 3DX1A 3RNKA 3V4PH 3WXVH 5D7LE 2L0DA 3GS7A 4QGYA 4QWWC 1UKQA 4JHZA 4NBXB 1PD6A 5H8DA 2R69A 3FT1A 2JXMA 4TUOA 4BSVA 3BP5B 5E95B 4YVUA 3CN1A 4CILA 1FH2A 3CDZA 5DJ6A 5GGSY 3T0EE 2BOLA 2F58L 4H8HA 5F1IA 2VDML 5DURB 4HH9B 4IOIA 3SE8L 3ZSSA 3QEHA 3SQOH 3KPPB 4KI5F 1FFOA 3WD5H 5J1SC 4M6ML 3SGDH 4GRWF 4OIBA 2CCWA 2ZUQB 3S3BB 2IMMA 3QUMH 5F8QC 1IC5L 2FYVA 5KS9F 1NIDA 3IFPB 4LOUC 3MNDA 4GMTL 4X6EA 5HHXH 4XMPH 1X5YA 4C58B 3MRMA 3V7MA 1QRNA 4FNSA 4F8OA 5IMLA 4O02L 4FCHA 4OZGB 4MJIE 3QUXA 5LGYA 2VDKH 1CXLA 2P8MB 1I1YB 2NT0A 2C7UB 4F37F 4PCYA 4UYQA 3RB5A 3APNA 1I85C 3BWUC 5F1SA 3NSXA 2MCPL 4D8PB 3DGGB 1MFEH 5BO1H 4JFDB 3TWCH 3K1DA 4WUUE 1UB5A 4X6CE 3ZDYF 4B50A 2JKLA 4NKQB 2XN2A 5GXBB 4K9EH 1PQZA 3NJFA 1XR8A 3V52H 4FLQA 3ULSA 4FXKB 3Q1SL 4N85A 2GW5A 5LG6A 3CN2A 3WSQH 4PD4K 4PJXF 1GVIA 2O5YH 2VDOH 1BBJB 3GSUB 2AJVH 3QEHB 1XCTB 3WDJA 4HXBL 4YDNA 3V6FB 4OH2A 3KG5A 4G6ML 1VADB 2A6JA 3QUYA 4LAQH 5DQJB 2W9LA 2CR0A 3QDGE 5ID0B 4WI0A 4XN8A 3QEQD 1MHEA 2R4SH 3L3KB 2F61A 3ZYJA 1A7OH 2VLRE 4O51A 3QW9A 4FQLL 3AT0A 3MRMB 3EBGA 4HDIA 3WD5L 4N8PA 4AL8H 1UM5L 3BQVA 4X8CA 1NEUA 1TTBA 5TF1L 3NG5A 1S46A 5HDWA 3Q1SH 3NIDE 3JWDC 5KSBB 1CBVH 32C2A 5B1BB 4MRBA 1F4WL 1RURL 3GXTA 4YR6B 5DJ0A 3FUNA 3U9UA 1A3LH 5B39A 2DIAA 5IW6B 1LDPL 4PGDB 1QFWM 2XV2A 4R7VA 4PJXB 2Z7ZA 4TL4A 1KGJA 5LJYH 5F89B 3P69A 2K70A 3MHZA 5JW4N 2VDQB 5T5FA 5GGTA 4GQ9L 1QHQA 4Y4HD 4BZYA 3TESA 3V6ZB 2DYPD 3LKQB 1D9KC 4PP2A 4Z7QE 1JZ7A 3L5HA 2QPDB 5C0AA 2EC8A 5DD5L 3TYFA 2WQVA 2V37A 1XIWB 2DM7A 2D7QA 3UXFA 2KC0A 2VIRB 2GIYA 4HK3N 4FZ8H 2ZNWA 4Y16D 3FB5A 5C07B 1UWXH 1TKWA 1SJHB 2YD4A 3ZU8A 4F7CB 4OD3L 1NAML 2JCCA 4A6YH 1UWEH 4OUUB 1TJHL 3MA7A 5CLXA 3HUJA 3QS2A 2YMOA 2TAAA 4QOKD 6FABH 3C09B 3QULA 1FZMA 3G5YB 3N91A 4XHQA 5DR5H 4QYOA 1HE8A 3UC0L 2CPUA 3CU1A 2VISB 1J1XL 2VLJD 4J3UA 4PVLA 3WY3A 1P69B 3TBTA 3W5NA 1N5YH 1E4HA 3ILQC 3M07A 3ZSTA 2KERA 3MNWA 2JF1A 5KS9B 2ORBH 1URLA 1OEZW 1S5IH 4LVNB 1A2YB 1T21A 1EAPA 3IN2A 5FC9A 5FOBB 1HQ4B 4LVOB 4AT6B 2D0GA 1AZNA 3OXSB 4LDCA 5HYQB 1BP3B 1DVFC 3GIZL 2H9GA 2P5PA 2EEAA 4GG6A 5IJKA 4Z7WE 2VL5B 2AP2A 3D3VE 4IBZA 5D2LB 4XPTL 2FHFA 4PJIE 1X4YA 1X5KA 2OMBA 3HLKA 3I3EA 3OAUL 5J57B 5CGMA 1YY8B 2CLRB 2DLTA 2WVVA 2BSEA 3RP1A 3LZNA 4Y7OC 3TYFB 2FWUA 4RLDA 1HWWA 4PJ7E 4JFUA 4BRJA 4LP8A 4PY7B 5IVZA 4JM2C 1SMAA 4PRNA 4WTQA 5D7LB 4CMMA 4J4PC 4JKWA 2VQUA 2WYZA 4GW5B 5SWZE 4ESKA 1HX0A 3T6ZA 4MD0B 4AEEA 3CZUB 4OV5B 5EEUA 5EF2A 3PAZA 5E8PA 1NJ9B 3IVKA 3G5VA 4EF3A 3RIKA 5CS7A 3LQZA 4PJBB 5EPMA 3HW7A 2CD0A 2CH8A 2ZXDA 2BIPA 2O72A 1NCDL 1FL6A 4I2XE 3R8QA 1QP1A 3TNNA 3QUMB 5TE7H 1YMHB 2EKSA 2ZP0T 1J5DA 4C4BA 1NPJA 2YPKA 4HCFA 2P24A 1A6TB 1CXFA 1JNNH 5C0CB 4EIBA 4G3YL 2DIEA 4FI7A 2VW4A 3KPSD 4PJ9C 1J8HE 3P9MA 3ALPA 1MCPL 1MWAA 2GIMA 2HA1A 1J8RA 2V5SA 3B7UX 3GKWL 4RGMC 5H94A 3RVVC 1CF8H 4AYSA 3ZL1A 2AJSL 3FU5A 3LH2L 4XGZA 4F2EA 3FU0A 4PQXA 2CGRH 2DQHL 3QJFA 3B4NA 2DYSB 1CIUA 2QGDA 5EF0A 3S5LB 1JPGB 4D0CA 3ZTJG 4AQEA 4PS4H 4YHLL 3ULVL 2CRZA 3BZ4B 3I02B 1ZDQA 3SDXE 1JBJA 2FZ3A 3A47A 3ARXA 3LKOB 3E80A 1AKJB 3LH8A 4KUCD 3LVEA 4RMBA 4BWTA 3QPXL 2IBZY 4FYRA 3A6CH 3NCYP 2F8OA 2OK0L 2C9QA 2XJLA 1SN0A 3LS5H 4MJ6B 5LKNA 3ZT6A 1RZKL 4I89A 5FKPA 4XP4H 4EBQH 2ADIA 1BQHA 5B1KA 2MNWA 1J05A 3KBHE 3MRGA 5KBPA 2ZOKA 1WAPA 2Q5BA 2QTEA 5GGQH 3SD5A 3OLEA 4M8UA 4PREA 1G7PA 3AT9A 3L48A 4FXKC 3MRHA 3FNKA 4J1UA 1RLWA 4IU2A 2GJZA 3HN8A 2BCMA 1X4XA 2O61A 4LPVA 3CH8A 1CT8A 4KZEH 2RBLA 2YJLA 3QYNA 1FZKB 4WWNA 1V3MA 2IH9A 3ABZA 1KYFA 5FK9A 2X6BA 1KBGH 4JDZB 4LVHC 4MA8H 4BE5A 3ZE1E 2ZXBA 3EYFB 5D96C 2YUVA 4S1QH 1D6EB 3VI4B 3PXLA 1SOXA 2WTOA 3C60A 2BFVH 2BIOA 4ZO9A 3WJLA 3HI1A 4PUBH 4POZC 5KEZA 1BQRA 3D18A 4FQQB 4Z77B 4FFTA 5DZAA 2H2PD 3D4YA 4X4MA 1ZE3H 2BX5A 3QNZA 1COBA 3RWJA 4RETB 4Z7OF 5J06A 1S9WB 2MCPH 1YEJH 1E28A 3SO5A 1KCSL 3MRQA 5D7SL 3CFKA 1CGVA 2NYYC 4PV8B 2GK0A 3EHBD 4U0RC 5SWSA 3DPBB 2Y7NA 4ELKB 4D0BA 1NFDA 3DX4A 4HJGA 3WXWL 4BFNA 4WO4B 4V2BA 1XSKA 2DTSA 5HHMD 2CM6A 4HGWA 1C5DB 3MRHB 4J1UB 1P1ZB 3PF2A 2B59A 4JPIB 4MJIA 4WNJA 1EV2E 5D5MF 2ADYA 3GMMB 4CJ0A 4G6MH 4LAQL 2XWZA 1KB5B 3SDDC 4WI3A 4X98A 4AYID 5AW7B 5C3TA 3NMEA 4I0PC 1NKOA 3RVXC 1OHQA 1ORSB 3W0WD 5EU4A 4QR7A 2IH8A 3NFPA 5ESAA 2A6KA 1L7IL 3VFSB 3WKPA 1EFXA 4FLRA 5A1AA 1T5XB 4HISA 4YHYB 5I18L 1A4CA 2XNAB 3V0WL 2VN4A 4YSQA 3A4AA 4CADB 4GAJH 3HR6A 3WLBA 1I8KB 3X3FL 4GFTB 2OMXB 5GZNC 3VH8B 1KBWA 2XA3A 3FUFA 3RJOA 4IU2B 4N68A 5C0IA 3FQWA 4XC1H 4L1BA 2D7PA 4CC4A 4FNPA 4LCIH 1AGDA 2HTKC 3L9RB 3B1UA 2GBVA 4DGVH 2NUPA 4R90H 5I66B 1OSZB 4JK0D 1SPDA 2Z65C 3NCJL 2P52A 1MI5B 5DD3H 3ZR5A 4X0KB