2M83A

Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of protein phosphatase-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
139
structure length
139
Chain Sequence
b'GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 1 regulatory subunit 3A
molecule tags Hydrolase
source organism Oryctolagus cuniculus
publication title Molecular basis for Protein Phosphatase-1 regulation by the muscle glycogen-targeting subunit GM
rcsb
total genus 24
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2m83A00
2EEFA 4EIBA 4BFOA 2M83A 2V8LA 2DJMA 2VQ4A 2V8MA 4BFNA
chains in the Genus database with same CATH superfamily
4H20L 3IS0X 1E28A 4U4IA 1CFNA 4M8QB 4JN2A 1DP0A 2ZOLB 1T1XB 3CCHA 5IMMB 4G7YH 1ZMYA 1FO0A 1EUTA 4A7GA 3D5OF 1YJDC 3KYAA 1SN0A 2WWMC 3X1NA 2F8XC 3FPYA 4L5FH 3SCMB 2APFA 1P5VA 2XV3A 2EXYD 4YHPA 4F3FA 2QFPA 4GBXB 2WLLA 2HRLA 2WVVA 1IARB 5J7CC 1M71B 2IBZY 3VH8B 1WK0A 4F15B 1HHHA 5CR8A 5KYWB 2APBA 4XBMA 3KPRA 3AWFA 4UTBL 1WGVA 3WELA 3PAYA 2K4WA 4X9BA 1P1ZB 1JWUB 3VWJB 4JL1A 4MZ3A 3T3ME 3LPPA 5IMKB 2KHAA 1IBBA 4BDVA 4M61A 1E5BA 2QLYA 4X80H 4ZODA 5IMLA 1T03H 5E5LA 3B2VL 4P8QA 4XO5A 5LCVH 3KLSA 6PCYA 2P28B 3Q2NA 2YSSA 3A4AA 3FYEB 4IOFD 4QRPA 3LPFA 3B7YA 3I84A 3HMXA 2QELA 2HVJB 1M7IA 4XVJH 1BBJA 3OM3B 3WE6A 3DWTA 1OM9A 4P2AA 5KJ4A 3SQBB 1I3GH 2WQWA 2A77L 2BY3A 1YZZA 3BAEL 5BMFL 2PP9A 1FH2A 1NAKL 2P24B 1M4KA 4YXKL 3FK3A 3UEZA 3TGXA 3UAFA 4U1JA 2QADB 3FHEA 3ABLB 4J8QA 1BQHB 1WDAA 4EN3B 1LJMA 5D2LE 2HLAB 1E2WA 2YPLB 3GSNB 3RZCC 4GG6E 2YK1L 3ZY7A 4Z18A 3KWXA 5EPMA 3VVVA 4PJ7B 1VLXA 3U4KA 2DQGL 4QXTA 5HHXL 1K8IA 1FL3B 1I7TA 4P9HL 3JWOC 1F6FB 4H44C 4HCGA 4OD2B 5I0WA 3NJFA 2IGFH 4LLYB 1LK3L 1R3KB 1R24B 3RTQD 3BZ4B 4NP4H 3QNZA 5BRZD 1GS7A 2V9TA 4UIKH 5HYIA 4B50A 5T5NF 3N2JA 4ZQKA 1N19A 5E2WH 2X1PA 4PSRA 2GITB 2F19H 2J6WA 2WYIA 1NLBH 3ORJA 3SIKA 3QT2A 4XOEA 3G04B 2WLYA 3F85A 2QR0B 4ETQA 5D72H 5J6HB 5DJ8B 4E9RA 1J8SA 2GUOA 4JFZL 1XCTB 3BLKA 2YZ8A 1UB6B 4GG8B 4GUPA 4QGYA 2J44A 2QPUA 3ATEA 5CGTA 4O2FB 1P5UB 1SHWA 4G5ZL 5DWUH 2YWZA 2NY3B 4L23A 3AQDA 4Y0GA 3TJHD 4EXPX 4LP5A 5CR1A 3X13A 4OZ4B 1BQRA 5KS9F 1JI1A 4JRWA 3MGAA 3US0A 1ESOA 2WXOA 3NCBB 3TJEL 3NPSB 1IL1B 5KOVC 4G9FB 1S7WA 1P7QB 3S6CA 4FQJL 1TVDA 3LDBB 1DQDH 1AGEB 3ESMA 3NIGB 5IMLB 2XKUA 4K7FB 2WO3B 4A2DA 4GYBA 4LF3B 2DQMA 5AWNH 5TDOB 2NYKA 4G8GB 2E9WA 1EAPA 1UWEH 5C09D 4XP5H 1AS7A 4JFFB 2HX9A 5FW6A 2UYLB 5F6IB 3MAWA 4R83A 3EHBB 2WCSA 4PG2C 1I85A 4BCXA 5FCSH 3V0DA 2A9AA 2C5DC 1NCGA 2WLJA 1RK1B 2AJVL 2YR3A 4PGJA 2YGPA 3ULVC 4XNZB 3NZ8B 4WENB 2KZBA 2O5YL 3QJTB 4ONGL 4BFNA 3V7AG 4LPUA 3FQWB 1DQLL 1W72B 2V7HA 4XBPB 4LSPH 3OD3A 2ZXQA 4M7LH 3WFHB 2OMVA 4Y19A 5I1CH 5IFHL 4UT9L 1FNLA 4C56E 5DSCB 2Z31B 3L5XH 3VX1A 4CA4A 3OAYH 3L7FB 2E7CA 4PGZA 2ZCKL 1I7TB 1TZOA 2AQQA 3CE1A 1BVZA 2NY2C 2KYIA 1PKQB 2ZICA 2MQ3A 4HLZH 5GRUL 2DIEA 5C97A 3GHBH 2OJZL 1BVOA 1J1PL 2CLZB 3GMMA 3QIBC 5IBLD 3QH3A 1G7QA 1KGIA 4G8FB 5C0FA 1PZUB 5E24E 1S7XA 5ITBH 1SJEA 4PJEE 3TC9A 3FSWA 4ZS6C 2H3NB 2F18A 2Z7WA 3B5TA 2AEWA 4HGWB 2H1LM 4HXAH 3BIKA 4RETB 4YDMA 5E8PB 2HJLB 3N40F 2EDNA 3WO4B 3HIZA 4I2XA 1J1PH 4AYGA 1U6AL 4J3OD 1KEML 1XGUB 4OCYL 5F2FA 1YQVH 1NZRA 4R5TA 4L1LA 1E5AA 2D7PA 1B0WA 3U4BH 2PTUA 3I9AA 1I8UA 5GISH 2F53A 1NC4B 3II3A 1QBLL 4GQQA 3I50H 5F8RC 5D7JA 5HHOA 5IWLC 1U3NA 1ZXQA 4FTVD 3B9KC 2WJ5A 4O9HH 4WV1B 5ID1B 2LQRA 3MNWB 4BKTC 3BHBA 1QQDB 4M6ML 3KCPB 1S7WB 3QB7C 4H8QA 1HILB 3QUYA 3G5VB 4KVCH 4LZKA 3IMSA 5TDPA 1ZLDA 3ARQA 3IXTB 3KNBA 3U1PA 2BMKA 1M1XB 3MNZB 4ZUUA 3O0RH 5AKRA 1F3JB 2W9EH 3VFTB 3C6LA 3VI4A 4XNXL 4IMKA 3REVB 3UJJL 4P4KC 2CDEA 1NDTA 5F9JB 1F90H 2WXJA 3B56A 2XC8A 5HGHA 3MA7A 3S48A 3BN9D 4TUUA 3ULUE 4MNQB 5HPOA 3MCLL 5JHLL 3U9UA 1IBYA 4HPOH 4PRDA 3SYCA 1PEZA 1SNRA 2UWEE 4GT7A 4OJCA 2MH4A 4HJIA 3NGBC 3SPHA 3T77B 4NJ9L 4MMZC 1NAML 2XPGB 3KHOA 5KAQF 3TVMD 5GS1C 4Z1PA 1D7DA 1LDSA 5DZNA 5T1KB 3QZWG 4OLUH 3ZZLA 4W4NA 3IVKB 5I71B 3MZGB 2G75B 1AC0A 1P84J 3M7FB 4MSWB 1U93B 1NKRA 4H0IA 1ZANH 1ADQL 3L9BA 1F3RB 3LRGA 3HUJA 4M1DH 1GIGL 3GSRA 1SDDA 2HKAA 3BH8A 3UYPB 4R90L 4KRPB 4UMSA 1TCMA 2D3VA 2XNAB 3C60A 3NPZB 4PG9A 4BFIA 1K5NB 1AXTL 4FQ2L 1YG9A 2EYTA 4CMHB 5C2BH 5TQ2H 4G8EB 1E27A 1ONQB 2X70B 4ANVA 3CHOA 3LS4L 4HU2A 4WO4C 4B9YA 3ZO0A 5E2VL 5KVEH 4R84A 3TNNB 4PRNB 1URIA 3BVDB 2G5UA 3AW5A 4YEEA 1OV8A 4I4WB 1R1CA 4MJ5B 3BUDA 1TETH 3HZMB 4GRLB 2ZOUA 4TMPA 3STLA 4X4YB 1EDQA 4W68A 4N0UB 5F7HA 3N1QC 5FYKE 1OKEA 5I1KL 3AY4C 3LMJH 1JNNL 2BO0A 4B0MM 1A64A 2JKTM 5EF2A 1HHGA 2B9AA 3CNKA 2Y72A 5I0ZA 4DO6A 1UYWL 1DVYA 3BP6B 1T89C 3EFFA 2XXCB 5HVHB 2FWLB 1UCBH 5D4QA 4N90D 4F80A 1RUPL 4FXTA 4KKQA 4C4UA 1WPCA 2YD7A 4F3FB 5L88H 3L3OB 4OT1H 3GKZA 1M71A 1F45A 3NCCB 4P9MH 3VH8A 1D5XA 3OQRA 3T0WA 3E6FB 3HMXH 4GRWE 3QUZC 3H9HA 4JPKL 4WUUA 4XXDB 3ABMB 4JLRA 1RLBA 5I6OA 1RURL 1SVZA 1UKQA 3AG3B 1JZ5A 3AGVA 3SDDB 4G6AC 3C8KB 2RH0A 1GAFH 3F7PC 3QXDA 3D25B 3FT3B 2V8LA 1DJIA 4KMLB 3U9UB 1RZGB 5E6RB 1QHOA 2WOBA 2FWUA 3D2TA 3QDJE 5H94B 1A6TB 1CFMA 4M9PA 2PR4L 4J3BA 3MQIA 3THML 4E9SA 1DQLH 2BNQA 1SBSL 4MAUH 4N3TA 4ZXBB 1JHKH 3GXPA 4D2NA 1TVBB 3BP7A 2FJGB 1EFXD 3PE9A 1OARH 4O2CB 2UXVA 1HKLH 3QC5X 1QLEL 4MB5A 3ZHLA 2OAAA 2JSFA 3VYOA 2J6EL 5FW8A 1BAFL 1K6QL 1QKZL 1WD9A 4HOXA 5LBVA 3IEAA 4G9FE 2YD8A 5IB2B 2NCMA 5CINL 5JOPD 5JIIA 3NJJA 3LZRA 1QFWM 5IVZA 2WQVA 5IJDC 3ZDXF 3UZQB 4KITB 4HUNB 4GAGH 2BNRD 3ZTCC 4LRNL 1I85C 2FECI 3MJ9L 4K8RH 3SDXA 4KUZL 4XP6H 5IFAL 2JB6B 3HG1E 5DYFA 4BIKA 1AXSB 1QKZH 1WFUA 2FYYA 5EUOF 3R1GH 1XGYH 3VXQA 2X7LA 3QUGA 3SEPA 1ONQA 3FQTB 3T0EA 3BP5A 1P4IL 4OGXH 1TFPA 2BPBA 3S37X 3S98A 3T0DA 4Y2DB 1SBSH 5K9OA 4F2FA 1MPAH 2PXYB 1F86A 3DARA 4PJXB 1BFOA 3D39D 5C0IA 1JWSB 2P8MB 3GJFA 5INCA 5KBKA 4X9GA 2IOMA 2J5WA 1AH1A 1A5FH 1TXKA 4V1DD 3RVXC 2A73B 2R39A 3EYVB 1CFQB 4G80B 3FQXB 1F4YL 4TSCH 4X8XA 1D6VH 4U31A 4M6OH 4RRPM 3ASWA 3UYRL 4FMFA 3LTVA 3PDOA 1CLYL 4YGVB 2FLBT 7PCYA 5ADOL 2XHNA 4NRXB 4QHUB 1WFIA 4FJYA 4CSTA 3D48R 1RP8A 1NANH 4MDJB 4ZFGL 4NYLB 4HUWB 3HG4A 1X5LA 4YXLH 5KVFE 2QQKL 1JCKA 2X9XA 5JOEA 3S9DB 1KCBA 2GC4C 1A6VL 5SWSD 4KXAA 2BVUA 4FG4A 3W5NA 3BUQA 4TVUA 5KZCB 1S9YA 4UTBA 3FT3A 5KSVA 1PSKL 2NY3C 1MCOL 4FFTA 1G7IB 1YLBB 4JRYE 4X7SH 1HEJC 2Y23A 1PJWA 1RJCA 2W0KA 3HOGA 4TQPA 3JV4A 4AENB 4G83A 3NPSC 5DI8B 4DP5X 1MCFA 4NQXB 2SEBB 3A6BL 5GS0D 3FYIB 4AW7A 1BV8A 5E51A 1YAZA 3KLAB 5CSGA 4E41E 2EE0A 5AKTA 2X4SB 3R0NA 2R1XB 5D4HA 1CLCA 1HKFA 4C4KO 2IPKB 2HRHA 5ICXB 1U8NA 1YECL 1NFDA 4KJQC 3K6NA 5E2TH 1A4KA 3CDGA 3MXVH 2AQTA 4HFWB 4JGMA 4FNPA 4KJWD 2JKSA 1OAQL 4YK4B 1IGMH 1MWAB 4KBPA 4YHIA 2BH0A 4GEIA 1Z66A 5IMOA 3RDTB 4HJSA 3WIAA 2H5UA 1RHFA 2X7LB 1KOAA 1OAJA 5D55A 1FG9C 2VCOA 2WO2B 5TF0A 4AGMA 3ARFA 2YGNA 3GB7A 1FCCA 3DV6A 2XG4A 4MDIB 3NCEB 5K9OB 2C1OB 1EJ6A 1MVYA 5AVQB 3UPCA 4C83A 2NY6B 4NC1E 5AQ0A 1JPGB 4UV7L 3QUXD 2UXTA 4IM8A 1LDPH 5F21B 5BS0D 1HZLA 1NWPA 2C3VA 2ZP0T 3OKEA 3GXIA 1OAUL 2Z1KA 2XTSA 3WS3A 2J1XA 3WXWL 3KWUA 1B2YA 2CKBL 2ZG3A 1J8HD 4RGNB 3TURA 1YUKB 3CDYA 3BEWB 3H9SD 2VXQH 2AZAA 4HUUB 5JHDB 2XFXA 4H8WH 2WBJD 3ARSA 1IQWH 2UY7B 3IT8D 4KVPA 4YHNB 4PREB 1OCWH 2WXGA 1BFVL 4PJDA 1A7RL 1TQBB 1HU8A 1WFTA 2GG1A 3E38A 1KTKE 2IPTL 2VLRE 2JJSA 3RIFK 4UT6A 1N10A 1FSKB 2OK0H 1JRHL 4Z3HA 1G1YA 3DUUA 1I8LA 1JF1A 1JHLL 4LSUL 1SHSA 2ZKMX 1XSOA 3SBWC 4AQAB 4DK3A 2CO1A 2F5AH 2G0LA 4YHML 2VQ4A 1G7IA 4JO3H 1NCCL 4YSAA 1OWRM 1EQWA 1LEIA 1CK0L 2EXSA 2YAEA 1FAIH 2QKSA 3P54A 1RERA 5A1AA 3F5WA 4I8DA 5DRZA 3V0IA 4UQAA 3GK8L 3RY5A 2I07B 4M56A 4BGLA 3V6BR 2X3BA 1MFBL 1QP1A 4UANA 5E1GA 1OCCB 4JFTA 4XMLH 3WTTA 1FGVL 3JV0A 3IRZA 1U8HB 3B1UA 3I3DA 3RWGA 2B1AL 3GMRB 2FSDA 2Z93A 3IDUA 4X80L 5KYYB 1Q9LB 2ZIDA 4DH2A 5EZOH 2ZOLA 5DYOB 3SKMB 1BWWA 3MLYH 5DCCA 3ETTA 3NGBB 5HSFA 2GUYA 1AGDA 5DJ2B 3GI8H 4Z77B 1AY1L 3LRSB 5GS3A 3VXRE 3GB7B 3LQMA 4B96A 4W4OC 2FUQA 3QDGD 3HUJB 4RNRB 4ZOCA 2YUZA 3ARXA 4GQ9L 4ZFFA 5JR1H 5AW6B 3SDYL 2J8OA 2L7QA 1J18A 4O5LH 1FH5H 1NOAA 2JMRA 2A77H 1EXUA 1GHFH 1MI5A 5JW5B 3C8DA 5J1TC 3MLUL 1DQQA 5F7DB 5F7AA 2I24N 2NZ9D 3HFML 4BHUA 1WYJA 1H6UA 3MYJA 1FQ9C 1KN2H 3E8UH 4JHUA 5GJSL 1VERA 1TNNA 2YKLL 4DNLA 2K4AA 2BC4B 3DETD 3VXRB 1A4AA 1CGVA 4PJ9D 5AZEH 4LOVA 4IHBA 3STLB 3QEQB 4ZOAA 2X87A 1TENA 1SEQL 1J5IA 4LLMA 4FFVD 5IGXH 1ZS2A 1HH9A 2Z92B 1CICA 3CZLA 1GGIL 3P0YL 2R4SH 3S96A 4A6YA 2I60H 1H3WM 1KY6A 4ZK8A 1JZFA 2DTSA 3B1TA 2NYYC 3SQBA 2G3ZA 1GR7A 1TQUA 1XSJA 4R4ND 1MG3C 3MLTB 3V4VB 3BPOB 5C0CB 4APQD 2VMCA 4FQXC 1H0DB 2FT8A 4I89A 4ZPTB 5FDWA 5HHVL 1A6ZB 2WN2A 1AR1C 2GFBB 4G7YL 2WLIA 1CD8A 4PMFA 4S1DC 4MNGB 1N8ZB 3WN5B 4PJIA 1YNTA 2I07A 3QXDB 4X0KA 2JQZA 1GA2A 4UTCA 1AI1H 4XRCA 3S8GB 1UVQA 5I6KA 3ARRA 2WQAA 1QNZH 3KW8A 3DI2B 3T6QC 1YN6B 4EUPG 3IDMB 3N06B 3FTGA 3GMQA 5E8OA 2GJJA 4JGUA 1CXEA 4ORGA 1CWVA 3NABL 3ULVH 3TL5A 3NCWA 1KACB 4JO2H 3MNMA 1EHLH 1VF5C 2CRMA 3WG7B 2E7MA 1LILA 5IJBC 3RILA 3OKLA 5FM8A 5EZLA 1E40A 4PCTA 3U46B 2D7TH 3ZRFC 1IKFH 3MFFB 5TE6H 3VE0B 2VLKB 1F58H 3V5KA 4M43H 3C2SA 2CHXA 4TPRH 1LMIA 4MNGE 3ULVD 3BW9A 4AUJA 1KN4L 4I0PC 4P23A 2XACC 4LEEA 4F27A 4DO4A 3TN0A 3DXAD 5I1AB 1BJ1J 3IETB 5C09A 4M6MH 1O6VA 4FEMA 3IF1B 1YNKH 1JMXA 4M6NL 4LFHG 2W80C 1RUML 1ROWA 4GUCA 4DEPC 1NA8A 3U0WL 4L8BA 1IAIH 1CBVL 3L16A 5CUSH 1OK0A 3UGEA 2XZCL 3QI9C 1B4JH 4Z7WE 4OUOA 4PJ5D 4TQ8A 3TO2B 1WH0A 3FH8A 4Q6KA 1HL8A 3L3IB 3QBTB 4KMTH 2VDOL 1O0VA 1PIGA 4LU5L 1G0YR 1MW0A 5CEZL 3KDMA 2UYLA 1HJCA 5C2BL 5EU3B 4CILA 4WK2B 3MLUH 5H37H 2R51A 3VXOB 1NPJA 3BKCL 4OCWL 5AOKA 4HCFA 5DD1L 4QRRD 4U1LB 4NN6C 3SGJC 5JPNC 4HSCX 1AJ7L 3LSOB 1I1AC 3BXNB 3CN1A 4NUJA 1BM3L 4PJ6A 3RYMA 1XZWA 5HDWA 2WO4A 3P4OB 3HB3B 3KJ4B 4K2UL 1VAHA 1AQDB 1F1DA 4KTEL 5F0LB 3VYNA 4OFQA 4RAHA 1UWYA 4P49A 3PFUA 5F97E 4KRLB 3SO3C 2FL5B 2FDBP 4R26H 1DLFL 5SX5H 4HWEH 5I1GH 5AB9A 5I66A 3HJ0A 3ZYJA 1DQKA 4XI5C 4NHCL 1NFDE 1S46A 4PJGA 3P40A 3DPDA 3M46A 2O5YH 4FQPA 4ONGH 4OY9A 2I9LB 1R6VA 3BH9B 2F53D 2M83A 3P73A 4OIFA 2W07B 2V3FA 5TTRA 5BZDA 2Y07H 4P57A 3TZVD 3O6ML 1NBVH 3PP4L 4NQSA 2FQFA 1OCZB 3ARWA 3RZCD 1KY7A 4JPSA 5HD8D 5HYSG 4GAFB 2B1HH 3SDCB 2R2HB 2CM5A 3K7UA 3KBFA 2FWSA 3KPPA 4G6KH 4AL8C 3CQPA 5F7UA 3H9SE 5IEKB 3U2SA 1DVXA 1AAJA 5EA0H 3PWPB 1MJ8H 2AK4D 3DHPA 4P2CG 4D9LL 2VABB 5KBNC 2DLFL 3QO0B 3UP1A 4OJYA 3QR1A 4LNRB 2NZ9C 5GQBA 3HBZA 5CJ8A 4BZ1A 3LZOA 3STBA 2X6UA 4QGTA 4HT1L 3LPWA 2AITA 3AREB 1LHZA 1CI3M 1ZT4B 1ZWIA 4MJ6A 1N6QL 2IQ9H 2PCXA 2EZ0C 4AK1A 4Z3GA 4DGIH 1EDHA 4L8SB 2B3IA 2F0CA 1OGSA 4RFNC 3DK0A 1VJSA 2B77A 3NYKA 3FT4B 2EDTA 4XB8A 2DLFH 4L3CB 1BZ9B 3RVVC 3ARUA 5K9KA 4PJ8C 3FZUD 3WFDH 1U3HB 4AVIA 5JIQA 2OYMA 3DOSA 4ZSOB 1X5KA 3ZDYB 4UT6H 4WO4A 3ZKMC 2UVEA 4ODXA 2FQEA 3AS3A 2ZXWB 2VLRA 1YY8A 2VZSA 4S1QH 3O4OC 5E9DA 1UC6A 2LR4A 4JZOB 4P9ML 1P2CB 1I1AA 3HG0A 4ERSH 5CLWA 3TYFA 3GMPA 4NRZA 1NBZA 4FFWC 2J6EH 2HTKD 4FC3E 1AR1D 1CZ8H 1IBHA 4S1DD 3ROOA 1TQCC 1YQ2A 3LAFA 2CR3A 3WENA 3G6AA 2VM3A 1BLNA 5CP7B 4L0YA 2FL5A 2NR6A 1UQSA 3EKCA 4QD2E 4OGQC 1QBML 1YQVL 4FZ8L 4F20A 1LO3H 3NZHL 2VLMD 4TTGA 1FA4A 3QI9A 4UQDA 4ZG1A 4PJGB 4XMWA 3WDJA 1L9SA 3MV9A 3PWVA 4P2OC 5KWYC 3LIUA 5ES4B 2J6EA 3UC2A 4J12A 5DVNA 1ADWA 2XVBA 2D9QB 4G71B 4CMHC 4H26B 5F44A 5IESL 3O11B 5T1DH 3HLKA 5E8DH 5DQDL 3BZDA 5B7EA 1OAYL 3QARA 1I53A 4PJFB 4M4PA 2IV9A 2VL5B 5ALCH 4JY5L 4M62L 1KELH 1G0XA 1G43A 3RPKA 5CEXB 1SFHA 3EYFB 4H88L 5IEKA 5CBAA 4FYQA 3FO1B 1GAFL 4X7EC 2JTDA 4X98B 2NPLX 1WHPA 4DPAX 4XBGB 5DD0H 5GS0L 2HFGL 2FH6A 3GUTA 1QSFA 3QJSB 4AV0A 2CLVA 3NP3A 5DMKB 2E9IA 4KKAD 4FNLH 2IGLA 4JBSA 4XNDA 3BZFA 2PUQT 3FC8A 1AIZA 4PJCF 3KL3A 3N1GC 1S78C 3WNPA 4JY5H 3FO2B 4YHYB 2X4NB 1B0GB 1RI8A 3LS4H 2PNDA 3RDJA 5CCJA 1UGNA 1KYOK 4WKZA 4DKEL 2YXWA 3TEXA 3QUZB 1T2JA 2P44B 2N4IA 4G42B 5I16B 1ZV5A 1GZHC 1F4AA 1X5MA 1QFWH 3MYJB 4LEXH 1RH8A 2V3DA 4R7NA 5IB3B 1GTFA 3UTPD 2AGJH 4PAZA 4TLTA 3IN0A 4GINA 2GW5A 3FJTA 1F4WH 4ICWA 4YPGA 3ZE2F 1NH6A 1O7DE 2OTPA 3HN5A 4JQVA 1VADA 1JXKA 4JDZB 2KQMA 3DIFA 3F83A 3QORC 5HHNB 3T0AA 2AVFA 2J8HA 3T3MF 1BLNB 4GSXA 5AKSA 4QXWA 1JSYA 5I6PA 1QFPA 1T5WA 2W9EL 3MVSA 3ESVF 1D9KD 4AVJA 3CVHL 3KPMA 1X7SA 1ORSA 2D2CC 1REIA 3PPEA 4HUKB 3ULUL 3DK2A 1MCCA 2BIHA 2EYSB 4ZW7A 3AXIA 2JIXD 2G30A 3KHQA 3BWAA 5IVNA 4I48B 5SX4H 4EI5A 1HI6A 3DXAA 5A2AA 1UA6H 1NMCC 1HT6A 2Y07L 3QAZB 2HJFB 1V7NH 1TQSA 4WJ5B 4N2EA 2CIKA 2YAFA 3AMKA 3HRZB 3LKNA 1EX0A 3QDMB 2Y1ZA 3DX8A 5E4EB 4Y5VA 3IJEA 3H4FA 4PG2A 4FQXD 2HVKA 3MRNB 4F58L 3C8HA 4KQ4H 3EO9H 1PX4A 1ZTMA 4ZJ9A 3NCYS 5I8EA 1BFOB 5C0AD 1E4KA 3AY2A 2QKIA 2W38A 3OKKB 1LWHA 3QUKB 3IJHA 3H4HA 4YHOL 2WNGA 3EUDA 5BUPA 1R5IB 4CNIA 4D9LH 1X4XA 2DQGH 2WQUA 4KK8C 4WHDA 2RAMA 4UILL 5IFAH 4DW2H 4PH8A 1T80A 1HZHH 3EF7A 5D1XD 4FG0A 4XN5A 3EAKA 3LIZH 3MGTB 3BZFB 3PCYA 4HH9B 3SKOB 3ZKSD 4Q0XH 4XR8C 4OLWH 2GIYA 2J1ZA 2WZ0A 4PRHA 1DYZA 3LXUX 1MJ7L 3QWRA 4WKZB 5F9OL 3WNLA 4KJQD 4OZGA 5E7FA 5EZJB 3SQRA 1SPDA 1MHHA 1TYRA 4XMTA 1SEQH 2FHBA 5H37A 2DDQL 4MXVF 3K91A 5FUCC 1PFOA 3UCQA 2QPEB 1QPKA 5GRUH 1OGTB 3ILDA 1J11A 4QHMA 2HCZX 4F8OA 4FD0A 2WPGA 5A6MA 1KJVA 3O6FC 3NCYP 2VJ8A 1FZMA 2ITCB 2QV4A 3HN3A 2JKIS 4JFED 3V6OA 4AYDC 1J05B 5HDBE 4AYFA 1G6RB 3QJHA 5HHMD 2BIMA 1HOEA 3LVTA 4URTB 3I6SA 2N0KA 5C07D 4RDQF 1JNHA 1UCTA 2JXMB 3BRGC 4XMLL 1JV5A 4KQ0A 1Q90A 3VXTB 5D1QD 2VN3A 2QTVA 5HDBF 3GO1L 3Q1SH 3B8SA 1UZ6E 3LEVL 1NDGA 2NY7H 3GRBA 4P2QD 4PD4K 3ZIYA 1J5CA 3NCFB 4X6BA 3ZW3A 1IC0A 3QWNA 4XMKH 3V4PB 5DD6B 3O6FA 3NJLA 4I48A 4WWNA 2I9TB 5DR5H 4ACPA 3OKOB 1JGDA 5JUEH 1MOEA 1MHEB 3TN0C 3WIIL 2AQSA 3CZFB 2X28A 3Q7JA 3JWDH 1V3LA 2BS8A 4P5KA 4WJ5A 3F58L 4FG6C 4OFIA 4K71B 1Q8MA 2JJWA 4Y5VB 5B38G 1MXGA 2BVEA 2Q20A 1TEYA 2AK4A 2CK0L 2C7FA 2BOBA 5D7KD 3NIGE 4NZUL 3MRKA 3J27A 2HT3C 4L0ZA 2AQ1A 4ZQKB 4JR9L 3WNMA 1TLMA 4X6FA 4L4TE 1WA2X 1NPNA 5TPWH 4KQ3H 2R0ZH 5LGHH 4OV5A 5I18H 5I2IB 3VW3L 1UFUA 2YN5A 3VQMA 3MGTA 1BHGA 1BX2A 3FFCB 3L13A 3W5MA 1MCKA 9CGTA 4ZDHA 3GLEA 3MUZ1 3EOBA 3S34H 1TQVA 1AO7A 3E2HB 1H3PH 2QSTA 3T0XA 3E1ZA 1UB6A 4ANKA 4HIHA 4UNTA 3CSTA 1CG9A 2ZWNA 3MLVL 1BAGA 2X1XR 2XN2A 1JRHH 1LP9E 2BHFA 2CE6A 3CSYB 3O81A 3TZVA 3RVWD 4BHUI 3MR9A 5AENA 3ZHDA 1PZ5B 4ODVL 2OPCA 4Q6IC 5T3XL 4HKBA 3SSGA 2Q2EB 2VQ1A 5HYJA 1H8OA 5IVXA 3LKQB 3QQDA 1BVLB 1LEGA 1X5XA 1GYUA 4ELMB 4J3OC 4HQQL 3DURA 2Y2TA 2CKBH 4H1LB 1U58B 2H0JA 2H32B 4HIJB 2NX5E 4QEGA 2GJ6B 3QUXA 5I8KH 4MZ2A 5F1NA 1UXSA 4BWWA 5ISZA 2VN5A 3QR2A 1CFTB 3TA3A 2BZ7A 4CRPA 1AXTH 4R8WL 4L8SC 2ENJA 4ATWA 2DM2A 3PREA 3BP4B 4RFNB 5E9DB 1WFJA 1ODUA 4OIBA 1C08A 1G9HA 3CG8A 1D2OA 2QV2A 2VQTA 4Y5XA 5C0AE 3IMUA 3F01A 3FRPA 2PCPA 4ZUSB 2XKNB 4IU3A 2H1XA 4X5WA 2AJZA 4ORZC 4Y4FC 5CS7A 1NGYB 2FRGP 1RZQA 4JN2B 5DD5H 4XMVA 4KROC 5C92A 1OTTD 5DSCA 4J6IA 4LLWA 3EADA 3BN9C 3WUWB 2AQRA 1RULL 3C6SB 4AQ1C 1NPUA 1T7VA 3B2VH 1XMEB 2NY1D 1CQYA 1PKQE 3AXLB 1QI3A 1N64H 1NGPH 2OW6A 2Y06H 3JQOB 4EUPA 5EEVA 4FG2A 4OD3L 4QRPE 3IFPB 4ETYA 3PXLA 1Z3GL 1FFTB 3J2PA 3UTTE 5CJBA 3VG0H 1RVFL 1WEJH 4JFOA 5SWQB 5DZVA 5KTEH 4RISL 2EIZB 5DRWB 5A6LA 4I18B 2DYPB 4X7TB 5FYJL 2OMWA 2WIIB 3QQ9D 1KIRB 3AQYA 4OLXH 1Q72L 5MEPB 1ACXA 5F89B 1O7SA 3RWDB 3QFJB 2CO7A 5CLTA 1CURA 1JPEA 1SJXA 1BX2B 1BD2B 3MLVH 4P2OB 5BVJA 1VGEL 2VAAA 4LCVA 2X88A 4Z3TA 2A38A 2P4AB 4JO3L 4NQTA 5TFSL 1I9RH 1UURA 4GXVL 3T4YB 4AC2A 5CCKL 3CDCA 4IU2B 4HXBL 3EDEA 2D4FA 3O4LA 3KVQA 1NC4A 3K8LA 4OJDH 4PGEB 1IGFH 4DZBA 5I0YA 5L8KB 2OS7A 2R56L 4LLMB 5FYLL 2X9ZA 2UUDK 4G2AA 4P2RB 4PGDB 5EOQH 3HC2A 1HH9B 3Q05A 4X4MA 4AUYA 1QW9A 1WAPA 3FQNA 1LK2A 4JPVH 5DK2A 3WMPA 2FJFB 4OQTL 4LDOB 1R5VB 4J1UB 1QSVA 5IVXB 3FO2A 1C12A 2CLRA 4QHNB 3OJDA 4OZFA 4S1QL 4GW4B 3HR6A 2DMBA 5DVMA 4C58B 4Y9FA 4L1HA 1W9XA 4U6XB 4LCUB 4M6AA 4V11A 4DK5A 4QY8A 5E6IC 5LAPA 5ISZB 1ACCA 1ICTA 3GT6A 4S1SH 4XNYL 2FEEI 1AQKH 1PS3A 1HOCB 4AG4H 3ZQ9A 4PWHA 4JZNA 5IQ7L 3KYMB 3MRMB 3MSPA 1KBGH 4JRYD 4PBDA 3ESOA 4JPIA 3WUWG 4CMMA 4CC0A 4X7CC 4PJ9A 4X8JB 2BSCA 4OZFH 5I8CB 4N90E 4R4NC 3DMMB 2IBZX 3IU4L 4X5XA 5EOQL 4DF9A 3TN0D 1KB9K 3QJFA 3KPQA 3AY4A 3AG4B 3IKKA 3O0LA 5EOCH 3GXNA 5HHVH 2C1PB 4MXQC 1KJ2L 3AU0A 3C6SA 4BSWA 4YC2C 4XP4L 3RTQA 1TOXA 2CALA 1T1WA 3I85A 3LEXA 4RSVA 3ASNB 4U2YA 3RRQA 3FH5A 2HG5A 1ZA3B 4FN0A 1HSAB 3HAEH 1MVFA 3RNKA 2E59A 4W9ZA 3UJTL 1ZGLA 4EOWH 1A9VA 5DD1H 3WE6B 1DQVA 5T3XD 4W9CC 1I3RB 1XH2A 5AVRB 5HYSA 2HJFA 4FX5A 3PWUB 4KX7A 3ULAB 3BIBX 2E9BA 5SWZB 4IDJL 4R7XA 2CO2A 3X3GH 3B2XA 1UOLA 3QCTL 1I7UA 2JKNA 3L1OL 1EIBA 4UOQA 5FYKL 4DN4L 3OF6D 2FJUB 3CUPB 3D9AL 3RX9A 2J12B 3QAZC 3QEUB 4C57C 4E9YA 4ADGA 6CGTA 2GBVA 3GTVA 4X4YA 1G87A 4IRSC 2AQ2A 4HIIB 3ZDYF 5EOCL 4XTRD 3BMWA 1NINA 4ZYKA 3GZQA 1RY7B 3X12B 2A6JA 1RZIB 2J55A 1FVCA 1QRNE 1UD2A 4KO9A 2GAZB 3O3EA 5ABAA 2C9AA 4DVRL 5ALCL 3PQYA 4XNQB 5DUPH 1D6EB 4X7DC 1C12B 4QHNA 1CTNA 5TDNB 3UJTH 1IU1A 3RHWK 3SOBH 5JMRA 2CKBB 4EI5C 4MA1B 5HD8C 3GM8A 3BUPA 3CMOL 2NY4C 1IM3D 1RPQA 1CGXA 2Z91A 4TOYL 3U9WA 3F7LA 3OB0H 4QDGA 1D6VL 4FP8H 4JO2L 4Y1AE 1MSPA 4LRIA 4LU5H 4Z7UA 3ZTJH 2CO3A 2R29A 5E08L 4HWNA 4RFOH 4R96A 4YVNA 2EDBA 1WC7B 1FIEA 5CJXA 3OTTA 4OJFH 5IROA 2BP3A 1BJMA 4FI6A 1OGTA 1HYSC 2D0FA 3C5ZA 3IN2A 4FQCL 4U49A 5J11B 4LB8A 1HXYB 4XPTH 4HBCL 2EZ0D 2L3BA 3X13B 2UZYB 3GRWA 4P5TA 3U2JA 1TEFA 5C2UB 4Z7NE 5B1CA 4GSDL 3HBQA 3A0OA 4LESA 1OZTG 3RPBA 2QVTA 4Y7OC 1MCWM 2GABA 4Z76B 5CILL 1HH6B 1INEL 1E2ZA 2FZ3A 2DQEL 5I24A 1ZLEA 5I1JL 1ZHNA 1M2VB 2WQSA 2XX0A 1MUJB 2PYEE 2G5BB 2WQXA 3D30A 3H3KA 3ZVVA 4M7LT 2XFGB 2EDOA 4X6BB 1FFPA 1HDMA 4ENED 4PJFF 5EU6E 3V4PA 1ORQA 2YMXH 3NEOA 4JFFA 2VGLM 3L95A 5I1DA 1KYDA 2MJWA 3OKOA 1ECYA 5F9DC 4GAYA 1MIEH 1OW0C 2R2BB 2R4RH 3BHBB 1EJOH 2X38A 4LK4A 3DX9B 4F7TB 5DEZA 1ZAGA 3QHFH 4RGNE 2EIMB 4WLCA 2YUWA 1WIUA 2DEXX 3IXAB 3I50L 3KBPA 4WFHE 2C9SA 4G59C 1S9WB 2AXGB 4JRXB 3NMEA 2CMRH 4XNBA 5C0BE 2EC9T 5GGVL 3VFSB 5JIMA 3Q13A 5BJTA 2XQBL 1AO7E 3CPLB 1ANUA 2CO4A 3KPRB 3MCKB 5LBSA 3NCXA 3V9FA 1P4BH 3D69B 4PJ8B 3FB8A 5D1ZC 4UQBA 4XMPH 1A3ZA 2W8CA 4XP6L 2FQDA 3D8MA 5DMJB 1WT5C 5I76A 3C6LC 4YVUA 1RHHA 3O0RL 5EU7C 4UTAA 1RZIA 3V2AR 5IV2B 4ODXB 3BPLC 1AO7B 5HYJE 4Y4KA 5EO1B 2CKBA 3WU1A 1QD0A 3A6CL 4IBWA 4UBDC 4LLQB 5HXMA 2BM3A 5CFHA 3SD5A 2ENQA 1EZVX 1KXHA 1GW0A 3NJVA 4JKLA 4KI1A 3W38A 4KK6C 4DT2A 3BCFA 1NOLA 4GO9A 4HKXB 4K3JH 4ODSL 4M8VA 4XGZA 3IDNB 4FQCH 5FC9A 2LLLA 3WNNA 3T5WA 4DTGL 1QASA 2GPZA 2Q3AA 1MFVA 2IADB 4NC1C 3HI5L 2VDQH 1BVNT 2XQBH 3RGVB 2R83A 3JWNE 3QFDB 1G9NL 4IMLB 3HNSH 3ARPA 4HETA 1U8PA 4WWID 5DI8A 3EGXB 2EKSB 2UZPA 2WSKA 2V33A 1P7BA 4NQXA 1ETA1 1FL3A 2Z4TA 5SWSA 2ICWJ 3DROB 1DZBA 4LVNC 4L1SA 1E27B 4DUVA 3LV3A 5CCHE 1WZAA 3VB8A 1BM3H 3MRHA 3TP4A 2A6DB 3HC4H 1X9UA 1R24A 5IBLC 2JKJA 3OQ3B 4XZ4A 4IKIA 5AAMA 2ZP9A 1L9PA 3HI1B 1XIWA 4PM1A 3C5ZC 2FGZA 2PCPB 3V0GA 4ZUSA 5CN1A 1CLVA 3K0YA 4BH7A 3H2WA 3NESA 3PDGA 2ITDA 4NIKB 1QBMH 3F7KA 1PSKH 5CEXA 3QK0A 4LXFA 4OQTA 1RUKH 3L95B 1MNUH 1PG7W 3WFDL 1S5IH 3VFRA 3I3BA 1SZNA 2Y25A 3EFFB 3V7MA 3NSXA 4IOFC 1RZJL 1MCQA 4YDIH 1R3HB 1IKNA 2HA1A 2DJMA 2AXGA 1PCSA 3L3OA 1N2RA 4D7BA 1Z7JA 5HHPB 2FIKB 4WI9A 3B37A 4XXCC 4NKMB 5I82A 4BINA 4HMDA 5FO7A 2WHVA 5C0EB 4BE6A 1WICA 3QWOB 1TJHL 2YOCA 4Z9KB 4G9FA 1FORL 4I77L 2OQJB 1GCYA 4W4OA 2F15A 3D25A 5I76B 1RK0A 5IT2H 2CZNA 2PO6B 4X6EB 5CZXC 3KM2A 2IG2H 3SDAA 4Q9RL 4NQCB 1OGAE 1B3IA 2RFXA 4U7MA 2BHUA 5EG6C 2BNUB 2DLIA 1L0YA 2GSIA 5HDRA 2XA8H 5TPWL 2IGFL 2ROYA 3CH1A 3FO0H 4HIXH 2R0KL 1KPUA 3OV6A 1N59B 4IMKC 4WWPA 2WTOA 4MKTA 3H0TB 4B9JA 4KROD 1MHCB 3BPCB 1JK9A 1IJ9A 2J25A 2BSDA 3PAUA 5B8CC 5H2BA 1JHKL 4RQQA 2VDLB 3UDWA 2VB5A 3L4VA 2IADA 3FQWA 4H25B 4MJ5A 2ORBH 4GB9A 5D7EA 2IOIA 3OR6A 5HVWA 1ORSB 4KUCF 5AW7B 3DJZA 3K72B 2H0PA 5CINH 1HJBC 1UB5A 5AYQA 5HJGA 2A3TA 3QEQE 4HCRH 4FFVC 1A7OL 5CIPA 3VJ6B 3DGDA 1KB3A 3KL0A 3W11C 2QSCL 3VXME 1VEPA 1DEDA 4KTDL 1J5DA 4ZMQA 1HAWA 1WO2A 3APMA 3QNFA 1QPXA 2HVKB 1WZLA 4Q6YA 2C9QA 3HZYA 3RWEA 5MENA 1NUDA 1KWKA 3H9HB 2VDQL 1J1XL 2BY1A 2AP2A 3ZZSA 4PW3A 4WWKB 4LPCA 4XVJL 2ZSWA 3C87A 4F7CB 4GUQA 1Q9WA 2Y7NA 3U83A 2Z1PA 1ZPLA 5F7NC 4JREC 1VRSA 3T2LA 2BW5A 1BF2A 4XHJC 3RTQB 3DUSB 1XZ0A 3ZL1A 1A7NL 3CH8A 4XPFL 4EZMA 1HSAA 3RNKB 3VRIB 3O3UN 4XODA 5C08D 3H55A 3W9DB 2V5RA 1CFSA 2YSTA 4DP0X 1YEDB 4HG4K 3MPCA 2E9JA 3MREA 1I4FA 4PQXA 4PS3A 5LDUA 5AAPA 2ZWSA 1NCAH 3VACA 4CVZA 1TU2A 4IBSA 2CWRA 4NO0B 3GBNH 4CU7A 3HN8A 4AJWA 3GRWL 1B0IA 3AT0A 4MYWB 4WSGA 5DHMC 4ZMPA 3CVHH 1MZZA 1SJHB 2Q1EA 3FUJA 4WI2A 2CGZA 2AANA 4FLSA 3S5LA 3SDXB 1FPTL 2J4WH 3LJ3A 4AVKA 1KJ2B 4X6DA 1YMMA 3EDKA 4J3OG 1RCYA 2VH5L 2VERN 5GHWL 1H15B 3ECWA 4RGOL 2HXAA 4X4ZA 3TFKD 1GS8A 1KULA 4QLRA 2OMUA 3MJWA 4ZS7H 1D5BA 1SM3L 4JM2D 5I15H 1SXBA 3TWCH 3J7HA 5BW7C 2JE8A 1CLZH 3H7BB 1NICA 3M1CA 4IRSB 4NPYA 4W81A 3V6ZB 3SE3C 5B1JC 1XGTB 4G8GD 4CL7A 5D7LB 1KXVA 4JCWA 1I3UA 5T1KA 4JG1L 1ZT1A 1TTCA 1H0DA 4GG6F 1LNUB 2XJKA 3RDTA 5CEZH 2FX7L 3CSBA 1JGUH 4DOHB 2P9RA 2R29L 2G75A 3VJ6A 3HS9A 1R4XA 5DC0A 2WGXA 3P30H 4N9GA 4H40A 2YAQA 5DQJB 2IANB 3FRPG 3CMOH 4K3DH 2OX5A 5E70A 5AUMB 4N2LA 2CNYA 4IQHA 3GZOA 5C6WH 3F7VA 1WEJL 5CWSA 4OI8A 3WDHA 4AITA 1N6QH 3INOA 3QZNA 3H53A 1VA9A 5I6NA 1MRDL 1TTFA 2DMGA 1K5NA 2OKMA 3G3LA 4Y9EA 1LEKB 2OJEA 2WD0A 4FXKB 3B9KD 4P07A 2J56A 2OR8A 5DR5L 3MOQA 4WK4B 5J3HC 1FLTX 3TASA 3EFDH 2GJ6E 5E6UB 2X1OA 3W1ZA 4NAQA 5D1QE 3HRPA 3VDCA 3GQFA 2YPKA 5T3ZE 4F8LA 3AADB 3M8OL 3P2DA 3TBCA 2VC2B 3VRIA 1ORQB 1A9EA 1CL7H 5I1DB 1PZBA 3FCBA 4UWQB 2EUXA 1AQ8A 3ELQA 2GK0A 5AVWB 3CSPA 4PV9B 3T8VA 4S11A 2WKLA 1CDJA 5D93C 3LH8A 3ZE0B 1GZHA 1FC2D 1GKOA 3VG9B 1KIUA 2OSXA 2C4FU 3KZ8A 2XTJB 4JM4L 2P7TA 1DBAH 3CLWA 1U92A 3PFQA 1L7TH 3A47A 3QHZL 1IBGH 4RZCA 4BUHA 4F15C 1ET7A 2HKFH 1NC4D 1JV2A 1RULH 3L3IA 1MLBA 2ZXGA 3SB3A 4XPHH 5JUEL 1U8MA 1KV3A 3TFKC 2QPDB 5EZOL 4P9HC 3CU1A 5AG8A 5CGYC 5BRZA 3B7SA 1XB8A 4RZKA 3ZMRA 5IOKA 2BP0B 1TMCB 3TA3B 2QMKA 4YEFA 4A04A 4L4TB 2XWCA 3CFNA 2C1OA 1FP5A 1G7HA 4ZI8A 4U1LA 3SDYH 4Y4KB 1J12A 1XSKA 2IF7A 1YJDH 4TV3A 4QPEA 2F1EA 1XGTA 2XKNA 4IU3B 4YSRA 5TK2A 5ALBL 4IRZH 1GZPA 4LLQA 5LBGA 5GPRA 2H0EA 3J8F7 5E2UH 4XVTH 4MA3B 3A4EA 5DXWA 1H8LA 5DYOA 4AGQA 1I9IH 4WFEE 4ZMAT 2WZ6A 3A67H 1INQA 1OF2B 3M17B 2PYFA 2YEZA 1HNYA 2IANA 3ZUCA 2Z9TA 3H54A 3M7OA 5ID0B 4WUUE 4N6QA 4GKZA 5I66B 1YEHH 1WAAA 1BD2E 1CQKA 3HRZC 5GGSA 3VI4F 4IKJA 4AJ0A 5KSAB 2J8UA 4ANXA 2R23B 4YHNA 4K7PY 4OQTH 5JHAA 1TMQA 3EGXA 5L2JB 1AXSA 3QHTC 4JUSA 2JH2A 1CU4H 1NUGA 5AVYB 3KE0A 2XU9A 1GL4B 2DI7A 1MFEH 3CFCL 3FU7A 4JN1H 1E3ZA 1YYLL 4P57B 4PP1C 3I6GA 1O75A 5GGQL 3I6LE 4KH9A 2ZKXA 5IJCC 4WEMB 3KPTA 5C8JA 1EFQA 1DBML 1TZGH 3MLWH 3O8XC 5D6DC 5BVJB 5EB9A 2ZYIA 4GRMB 2WTPA 5L9DH 4LPXA 1O9VA 3TEUA 2MKWA 4D0BB 4S1SL 3VFGH 4LSUH 4WUKL 2F54A 3PWPA 2R2EA 1T4WA 5F3HB 3DBXA 1VFBA 2VABA 3C2AL 4D94A 4FQLL 1C5DB 2E8ZA 5IHLB 2HFEB 1E9QB 2LHAA 2WLZA 2H9GB 5EOTA 3OAUH 1TTBA 2FX9L 1MAJA 2WZPD 3UX9B 1NFIA 3KLDA 2DB8A 4WW1A 3PS6A 3D39A 4K94H 3OKDB 2TSBA 3RFZB 4L8CA 2LW3A 2DM3A 4UNIA 1DFXA 3WAJA 4X2UA 1ADQA 1KGYE 4LGPB 4R97C 2O61B 4CN1A 2IWGA 1AQKL 4JDTH 4FA6A 1WV7T 4XO8A 4M48L 5E4AA 3O9WB 3MBEC 5LBSL 4TUOB 4RMBA 3ZTNL 3EYUL 4TLKA 5ICYB 4LRNH 3UO8B 4IBUA 1MFDL 1CUOA 1Z9PA 1TQTA 4NUMA 2EADA 4PRIB 4XI5D 4JZNB 4C56D 4IIQB 4HJGA 1RL1A 3IDGA 4LMQE 2IH1B 5JIPA 2OR9L 4ABQA 5BV7B 1GGYA 4CJ1A 2GJPA 2E6QA 1SVBA 2AJSH 1XGPB 3CHQA 1FL6B 2A9BA 2VXSH 4NJAL 1ZLWK 1DQQB 4MJ4A 3K4DA 4PMEA 4UB0L 2NR6C 4MJJA 2ZKHL 4MWFB 3RB5A 2FLRT 1JNNH 4MYPA 3CCHB 1MHCA 4QTFA 4YSEA 1HQRB 4POUB 3D0VB 1G6RL 3RUGB 4ODUA 3OXRA 4XTRC 4CKQA 5FUZH 2HWZL 2AGJL 2DIBA 1DCLA 3NRQA 1I9RL 4GXVH 4LCCB 3RX8A 4AEFA 2V4LA 3NDYE 3UZVB 2WY3B 3MV8D 3FUKA 3TO4B 4PI2A 3DRQB 1A6UL 4A63A 3K72A 1B2WL 3OLGA 4RX4A 2Q9OA 3BRFA 4WI5A 2EIJB 2ZUWA 3LXBA 2P8LB 3HMWH 4PJIF 5G5DA 3GINA 3UABA 3NIFF 2F1BA 5DT1L 2BXZA 1BPLB 1OB1B 2R69H 2Z4QA 1M05B 2IDCA 4X6CE 5ICUA 4BGDA 3BGAA 1M3JA 1IZJA 4LPTA 2WUBH 1XF4B 2OJZH 4N20A 5DGRA 3HAEB 3V4UL 4Y1AD 2GTWA 2CPCA 2Y2YA 1HE7A 3OPZL 4HJJH 2EIEA 3B7TA 2XZCH 3CVIH 2L04A 1B6UA 1N8ZA 1NC2D 2GT9B 4N2DA 3TH2T 4NCC2 2GJZA 3N55A 4FFZL 4TKWA 3VXOA 5ITFA 2ZCLL 3LN9A 1A6PA 4Z6AT 4N4YB 3PWJA 4Y2DD 5K39B 3EGSA 2DWXA 1FVCB 2EDLA 4XN1A 5HI4C 2B3RA 3ZDYE 3D39B 1GRWA 2FX8H 3KXFD 2CJUH 1UZ6F 4OF8A 3UG4A 1RJLB 1SYSA 3AWGA 4BFBD 1E5ZA 1TZAA 3C5ZD 3RKPA 1G9MH 1UOKA 2ICES 5GGTH 2JLLA 1RZPA 4PJDB 1V7ML 2DWYA 2AXHA 1AQMA 5CJQL 4CGTA 4NUGL 1FO0B 2EE6A 1MFCH 1XH3B 2W5PA 4JFQB 3GIVB 3IGAB 3GNMH 5J06A 4YFLI 2EEBA 1EVUA 3ROLB 1A6AA 3LD8B 3K1KC 4KVNL 2P80D 1UA7A 3P77A 5KSBF 5CZVL 2EC9U 4RBPH 5SWZE 2OYLA 1BG1A 5KVEE 4M29A 3G08B 4Y4HA 3WEAA 1VFMA 1IGYB 4AQEA 5IEHA 3DYMA 3UEQA 3FOLA 4O58L 4NQDA 1F3DH 2CU9A 3R19A 3WBDA 2UY6B 4AKOA 4Y4FB 4PCSA 4BKSC 2QR0A 1C5CH 4WTZG 5E1QA 2NXZD 5AYUL 5I8OH 3Q48A 2IDQA 3FL7A 3BSZA 4KVNH 2IG2L 4AX3A 5H35A 3D4GA 4PJDE 2O6EA 4LCWD 4MFHA 1CD1A 2O5ZH 4FHJA 3UAAA 2BCMA 2HT2D 4AQ1B 5E5UB 2WLKA 3D87B 1EUUA 1ZT1B 5CM1A 1OZUA 3FOMB 4YDZA 4NUGH 5FECA 2JI2A 3EBHA 1Y1UA 5I71C 3CXDH 4C47A 3COOA 3WMQA 4JN1L 4Q9CA 4J8RB 5EFIA 1LO2L 1BJ1H 2ADIA 3FT2A 4NDMA 1LO5A 5CZRA 4EQ2A 1RD6A 3I02B 2X6MA 3K6OA 4PJ9C 5CJOL 1XGQA 1BXVA 3SGKC 4P46C 3IJEB 5ENWA 3INUL 1IEBA 3CFDA 1VFOA 4N2KA 2EJ1A 4QRBA 3VFSA 3TPUB 2DLGA 1E6JL 3QUYD 2C3XA 2PWHA 2VDPH 1KG0B 1WIPA 4I9XA 3MLSH 3ZKXB 4B7IA 3N85L 5GRJL 4IGBD 2YD4A 2D7OA 4M3HA 4PJDF 4WO4B 1PAMA 4F37K 4NNYB 3LRLA 3CBJB 3AB0B 3BPLB 1CE1H 3NIDE 2FATH 1GSKA 1MRDH 3PUUA 5C0GA 3TBTB 4JQIL 4AM0B 2RCSL 3MLRH 2XZZA 3DGGA 4DPRA 3VXRA 4Z7AA 4LLDB 3O45B 4Z7VF 5G4NA 4ODSH 1SXCA 1CC3A 1FVDA 1NANI 1NGXB 4N6RA 2EABA 1NM4A 4N25A 1PKOA 4HU8A 3DYOA 3S0PA 2X2IA 5AD0B 3EO1B 2AW2A 5JW3L 5KN5B 1NWOA 2LTQC 4PJXF 5TQ0L 1YVLA 3HG1B 4FQHA 3CBKB 3PRZA 2FTAA 4KJYB 2H26A 3GIVA 3IGAA 3EFOA 4B0MB 3VGFA 2IALB 4ANWA 3HCVB 4TYUA 2W81C 3QQ3A 2VM9A 6PAZA 3L4XA 3D2UA 4GG8A 3LIZL 3ZE1F 4LQFH 4CBPA 1JHLH 3PWVB 2EKJA 4YE4H 3PYCA 1T0NB 1JV2B 1H5BC 4G5AA 4PJ5E 1GH7A 1KJVB 3V0VA 3NIFB 1XHHA 3D39E 3ZSTA 4PJIB 2JTYA 3QAQA 1WISA 3D3VB 4MA7L 3L5HA 3LV3B 1W8EA 1OAZH 4BFRA 2F74B 1E4WL 4N2BA 4HDIB 1K3ZA 2BERA 1MFBH 4Y2NA 3FQRA 4MMYB 2GEQA 4AQ1A 2VLLA 5DJAA 4YLQT 3QEHB 2GYSA 5GJTL 1QWHA 1QA9B 1CGTA 3A6OA 4L9DA 4XMPL 1C9SA 4BBWA 1QFWL 1QSFB 3GC3A 5EBGA 2IPTH 2VSKB 4WNQA 2OZ4L 1XGRA 2VKXA 5L7XL 1R5WB 2PYFB 1Q1JL 3OKLB 1C1EL 1S9VB 1J8KA 1RK1A 4GSRA 4F2EA 2NNFA 1CLZL 5T5FA 2ATPB 4BFEA 2EDHA 4MVBC 4JFSA 1T7YA 4O02H 3QUMH 1W72A 2V7HB 3CFKB 4J3OF 4RGMB 1L5GB 4BZ2A 3MV7B 4LSVL 5IBTH 1TZHA 4XCFL 4TN9A 3DRTA 1QUNA 1IB5A 3LNDA 5FYJE 3KMDA 3U2IA 2QQNL 3GBML 3MRJA 3EHBC 3V0WL 3Q8EA 1MNUL 1UJ3A 2KLSA 2W0FB 3BD4A 1DJWA 1MAML 5FWRA 4CC1A 3ARGA 3K0WA 2YSSB 4NM8L 4TM9A 4KKLC 3IKCA 4X83A 3ZX1A 3JUZA 4Q6IA 4L3FA 1SJEB 3W0WD 5CD5D 4V33A 3BMVA 4XHQA 5F3HA 2YPLE 4UDUA 4N24A 3BVVA 6FABL 1A3QA 4C56A 4AYEC 1C5DA 4DESA 3NSCA 1DFBL 1YPZA 4OVVA 3C09C 3WFCH 1RUAL 5E8EB 3VSVA 1F4WL 1T4KA 2ZWKA 3THMH 4B3EA 4M93C 1L6XA 4FERA 4PW9A 1HFUA 3DJSA 1IM9D 4UIMA 3P4OA 3SQOH 2OW7A 4JM2F 3RA7L 1XCWA 3EOAB 4M62H 1KPRB 4DETA 1GPOL 1PNDA 1QRNB 2DQJL 5JNYB 5HHOB 1II4E 1T1XA 4JZJC 1F8TL 4RWHA 4ODWA 2AEQL 3GZKA 4GMSH 4R3SA 3IMRA 4PS8A 3B4NA 3QISA 1GOFA 1QQDA 4G8EA 4KU1A 1OWWA 4HV8B 3QDGE 4FJZA 2B0SH 4XN2A 4FLRA 1FLRH 4IJ3B 4JG0L 2RQ8A 2N7AA 1XBRA 2FO1A 3KNBB 1ITBB 2H6PA 4I87A 1M2OA 4F57L 4Y7MA 2MRYA 2F58H 2C9XA 2Q8AL 1P7QD 1UA3A 4Y9BA 3ZPDA 5I16A 5KYWA 3F04A 3CFBA 3UO1L 2YD0A 1JWMB 4IIQC 4MCYB 5BV7C 3BP6A 1IFRA 3BQUD 2XJLA 4P46D 3U0PA 3QI9D 2OR7A 1DVUA 2BS71 5HBBA 4Y88A 2V2WA 5EBMA 4ZMLA 3GLDA 5IB1B 1PY4A 3EYSL 4Z7UF 3QO0A 1W8OA 4YAQB 5JLZA 2V0AA 1M6UA 1QEWB 1JXGA 1CS6A 4XC1L 5KVDL 3CHXA 3F8UB 3E3QE 3B2DC 4FADA 5MEOB 5EBLB 5F89A 1OAKH 2Q7AA 4Z7VE 1H3XA 3OC8A 4P2YA 4ODBD 4PN6A 4PTTB 3PGDA 4BSVB 4AJVA 3NTCL 3DX2A 1XX9C 5H94A 3Q6GL 1SJHA 4CADB 4L1DA 3DDGA 3LN5A 2VLRD 3L6FA 1HI6B 2C3GA 3DXAB 3TWCL 1F11A 4WAFA 2ESVA 4ZX5A 2GT9A 5E94B 1TKWA 3QIUC 1IGTA 4Z3IA 2XG5A 3SBQA 4V2BA 4AZ8B 1HL5A 4UU9A 1D2PA 4KUCD 5JW4M 2CSPA 4LLYA 3T6ZA 4FI7A 4LASL 4ZOEA 2DQCL 5B1BB 2VO8A 2LFEA 1XT5A 4HPOL 1SYSB 3E80A 5AZUA 3G5YB 3HUJE 5FV1L 3VGGA 1NCIA 2XYBA 3PXJA 4GW4A 2RD0A 3WIHL 3QJUB 5D7LA 4XCYA 3UPAA 2RACA 1IIKA 3C6LD 5BW7A 3FCTA 4DKFL 1JYWA 4CUCA 2MOGA 2VXUL 2V17H 4LGSB 2CRZA 3DIVA 3HMXL 3N44F 2VYRE 3AQXA 1G9ML 2XPZA 2FEJA 4WFFE 5FYLD 1E7VA 4X50A 3D18A 3KWWA 4NEHB 3SOBL 1GZQB 1W0VB 1K4DB 3FHAA 4JPIB 5I15L 4ZMZA 1JZGA 4OD3H 2EXTA 4Z7WF 2FUTA 2F7OA 2XQ0A 4FLOA 5TF1L 3DVFA 4I3RH 5KBDA 1CYWA 1E3XA 4UQ3B 1YDPB 2BCKB 4Y4FA 5CNHA 3ZIMA 1J5HA 4IK7A 3FFCA 3U4BL 4ZMWA 3F6IA 4FKHA 1JTTA 2BVQB 5TE7H 4BSWB 3EJZD 4N0CD 2KPWA 4X42A 1VGEH 1CDGA 1AC6A 3NJKA 2ITCA 2YRBA 1KT2A 2F53B 3FOMA 2O93L 1VACA 1KC5H 1LQBC 1SY6A 2DQTH 1LDPL 1JUFB 3MV9E 4IJTA 3WFZA 3MR9B 4MA8H 2F08A 3CZJA 5HI3C 3LMJL 1L6ZA 1ZJAA 4N8UA 4WSKA 5GZOA 5A2BA 3U6RB 4FLHA 3BWUC 3IFNL 4AYMC 5IHBA 2VN7A 3CFDB 1BVKA 3AC0A 3QDJA 4NXSA 4KKLD 3W9EA 5D1QC 3RGBA 2HSIA 3EG9A 2FE0A 3WAKA 1SRDA 4MMXB 1S3RA 2XTLA 1F3JA 1SOQA 2AV1A 1DUYB 4PRIE 4J6RH 3BGMA 4LARH 4QCIA 4WHTB 2Z3FA 3C5XA 1ZS8B 2VDML 1PKQA 2H3KA 5F1OB 1BZQK 3ZGIA 2NQ3A 2ZX6A 3FUMA 3H2QA 1B0RB 4RMTA 4UUJB 4YSSA 2J7LA 1CDUA 4ONFL 4LLDA 3VXPA 3DJ9A 1DHKA 3FSOA 4R2GD 1E9PA 1SOXA 2YPVL 4TVSa 4DP6X 4Z78B 1PCXA 2DH3A 3ZZQA 3NIFE 5DJ0A 1G84A 3VXUD 4KZ0A 2PMZA 5AD0A 2V17L 3DIFB 3IU3A 3MJGX 5FF6A 1YEGL 1YEEL 3CLFL 3HG1A 4FLQA 4L3EE 3BX7C 3JWOH 2QZQA 3O2WL 4GRLD 1A2YA 4MD4A 4P23D 4U1NA 1R17A 2DJSA 1QUPA 5HGDB 3GMLB 1W16A 1XGUA 3ZQXA 4JFXB 5KSAC 4DGIL 3GSRB 4PUBH 3WD5H 1IAOB 4LASH 4ZTOH 4P5MA 5DJYB 1AR1B 3TCXA 3TJEH 5L2JA 2BJML 3W0WE 4HS3A 1S7TA 1KWGA 1VEMA 5DS1A 4HBCH 4QHKJ 4P2OA 3QQDB 4XNUH 2HRPH 1OSZB 4N0CC 1H5BB 4L3EB 3GKWH 4ALAL 3CQQA 4P3DA 2WZPA 3TNNA 4D0DA 4MS6A 3DURB 4G1MB 4LIQL 1Z5HA 3FO9B 4FEIA 2ZUYA 5JHLH 1MEXH 1KELL 3D2UD 1BZEA 1KT2B 4GI8A 2OSYA 4LEXL 3SDDD 2V7NA 1JRHI 1XVSA 2A83B 1NM9A 4G6FB 3BYTA 1N67A 3PP4H 3GMNA 5EF1A 5GGRY 1C16A 1CFTA 1L7IH 2QT6A 5KVDH 3KWVA 1D7BA 1ZJBA 3EOTH 5AZ2H 4DGVL 3IFOA 1C08B 4P4KA 1A47A 1U8NB 3S4SB 2DMCA 4TUKH 3RFZC 3RVXD 3LH2L 4HHGA 2MCAA 3MA9L 3W37A 2H8PB 3SE9L 1TPXB 2ERJC 2VE6B 4P5TC 4TNFA 5FUZL 2NY0B 1MHHB 2ZWLT 3D69A 4PJ8A 4H2AA 4HFUL 5EWIL 4KO6A 3TV3L 2J5LC 1DVFD 1Q0XH 5CJXC 1FNSL 3B9KA 4ZAKB 3X2QB 4HAGA 4XP1L 3B9EA 2DIJA 1GC1C 4Z3FA 4Y16C 4EUPB 3MRIA 4QWWC 5C9JB 5C1MB 4WW2F 4M9OA 1U8QA 4KPHH 3RTLA 2BNQB 3HBGA 4XPGL 5GSRB 3BJ91 5I8CA 2APTA 1OALA 4ZNEA 4LHQB 1J9QA 2H2SD 5DRWA 3VD0A 1S9KC 5DUML 4AG4L 2OMWB 1ZLVH 1NTDA 4MWFA 1XXDC 3WN6A 1PYWB 3B5HA 1OOWA 3CVCA 3QCUL 4LOUD 3IDYB 4N2OA 4MAUL 1MI5D 5LQBL 1JAEA 1JPFB 5HJ3B 3EYOB 4XGZB 1I75A 1RSYA 4OZIB 3RVTD 1ASQA 4JQIH 2CO6B 3F84A 2H1PH 2TSAA 5DZPA 1X7QB 1WJ3A 3BEWA 1OE2A 1S8DB 2MPAL 1J10A 2HB0A 2J1WA 2P80A 2Q10A 5ANMB 5EWIH 5INDA 3N5AA 5FEBA 1JERA 32C2B 3PIQB 3C08H 3FUNA 3S2CA 2I7OA 3UPRA 2WTRA 4BK5A 2XICA 3INUH 4ZTPH 5AW4B 1N0LA 5DHEA 1O9WA 4DQAA 3VCLA 4UM9A 2O1AA 4Y5YB 3A4DA 1F1AA 4KY1L 1WVZA 1J1OL 3QXTA 3TTYA 1EAQA 4EKXA 1F13A 1WIOA 3LB6D 1PZSA 2IV8A 3GPSA 1XIWC 4Z7QB 1MFUA 3RWCA 3RAJH 5AVSB 1WSST 4PJCB 1JDAA 1RKRA 1A9BB 3IDJA 1S6NA 2B1AH 1S7VB 2BJMH 1A5FL 2AABL 2YUXA 1IAKB 3ZYZA 4OVUA 3EOBB 3PQYB 1DBBL 4XNQA 1O6TA 1NAMH 4ADJA 5CEYA 3HI6H 1CG9B 3LKSB 1CT8B 1HEZB 3PGCA 4LAJH 4A37A 5K9QG 3WL9B 2FIKA 1BCIA 3APCA 5E9DE 1HWHB 2WKOA 3NSFA 1J9RA 4YHZL 2GK2A 3SE8L 4AY0A 4GY4A 2IJ0C 5FHAL 5I1IL 1MQ8A 5D1XB 2HTKC 3DTUB 3CVIL 5CAYB 2YUVA 1EA9C 3O2DA 2ENYA 1GIGH 1NCDL 4XRCB 5KJ7E 1E90A 3NH7L 2MTAA 4CADA 1JZ7A 5GIRB 3UBFA 2YGQA 2CD0A 2X42A 2J57A 3SPJA 4Y4KC 2YD9A 3GS0A 1HCFX 3FZUC 5TE4L 3KXFE 4H2CA 4WU5B 4F7PA 2OMZA 4UM8A 4UMGA 4XPTL 2KDGA 3B2MA 2OMNA 4NHCH 3NVQA 5DEFA 5IHUL 1PDKB 2P5EE 3G5YA 4GXUN 5KS9B 4PB9L 4AIOA 5FYKH 1R3LA 5EUOB 1YC8A 1YYML 4G80A 1MG2C 2YOAA 2XX1A 1AKJD 1RUKL 5DTFA 4F9PC 1I3GL 3BAEH 2L0DA 1DFBH 3AGWA 5C07B 5EC2B 3HE6A 4M1CC 2OYPA 5KYNA 4YXLL 5BOPA 3RVVD 4OT1L 1BQSA 3CC5A 5MHSE 4KXCA 4UM9B 3CZUB 1YEKH 1VSCA 1ZE3C 1EO8H 4H0GA 3UBHA 4KTDH 4K5MA 4YX2H 4ZPVB 2NXZC 3QRLA 3RWEB 5MENB 1BVNP 1MCOH 1KXQA 2D03H 2YEQA 3QWQB 1ZANL 4PJFE 4U6TA 4GMSL 4UQ3A 2YQBA 1IC7H 1L0XA 3NAAL 4K5LA 4Z7UB 3LS5H 4KI5D 5T33L 4IBYA 4XPHL 3QIUD 2CJSA 2AF2A 1KLUB 4FOMA 4CVWA 2V5SA 4PJBB 3P9MB 2Y7MA 1G4MA 3CFMA 4HD5A 3HI5H 2PLTA 1N8OE 1JDDA 3N91A 3W0WA 4XPBL 5AW1B 2VR9A 2ZNXA 1QR4A 3E8UL 4MD5A 5GJSH 2NW2B 2E9GA 1N3NB 2IDTA 1DVFA 1HEZA 5T3XE 3FB6B 3O4LB 1OVZA 2UZYA 4FFZA 1UT1A 3HBPA 4XMXA 2LTQB 3FH7A 2NRDA 3BO8B 4GIAA 4EI6A 3WSQL 1IBZA 2IH3A 4IEFB 4WFED 2N1TE 4RCAA 5C0DA 3OB8A 1YEDA 1OLZA 4UT6L 1ND0B 1KJ3L 3FULA 4KGLA 4HVBA 4ZFOL 2XN0A 5ICXA 2MQCA 5F7EH 2Q86B 3WEBA 4LRIC 4NM8H 1CK0H 3DUUB 1FNEA 2YMOA 3CDGB 3LRKA 4IBZA 4JG1H 5E5RB 4EI5D 4UNUA 2O5ZL 4JY4A 3ARVA 1FFPB 1PL3A 3MBWA 4ZUTA 3WMSA 5DMIH 1T22A 4N8CL 2XN9E 5C0NC 1OGAB 1P4LA 2CIIA 5ICZB 1DUYA 3V0VB 5HHQB 4JG5A 5EIIA 2R0WH 3NG5A 4E0RB 3E0GA 5BZDB 2FT7A 2Y4SA 3QJOA 4LAQL 5CU5A 1Q9OA 2I5YL 4Q56A 4JDEA 3ZQWA 5GSVB 4EBQH 4DP9X 1FGVH 1X44A 4V1DA 3TTSA 2YC1A 3BC9A 1EH9A 3JTTA 3MACL 3MOAL 4TNWK 5DC2A 2JI3A 4GI6A 1NGZB 3ILEA 3QHFL 3P02A 4IRSA 1PD6A 1RZ8B 4X8GA 4HZLA 2Q3ZA 5B4MC 1C1EH 3ES6B 4WU7A 3QCVL 2V5MA 3I75A 3SPCA 3QJFB 2DKUA 3OAZH 4M1CD 2C3VB 4WUKH 5I18L 1JD9A 1NCOA 4LEOB 2UZXA 3SJVB 4N5EC 2CUHA 1BP3B 2UZIH 4EZJA 4N5UA 2HP4A 4YDLC 1S9VA 2N01B 1J5OH 1OL0A 2EVFA 2KC0A 3DOIA 5DZAA 5IW6A 3BXNA 2CCLA 3AQZA 4KVCL 3H3BC 3O6LL 4XAKD 3H42H 1W0YT 1SM3H 4W1TA 5G4OA 4GS7C 1VEOA 4JPVL 4UOZA 2OFQA 3KBEA 5FHBH 4L3CA 1Q4NX 4APQB 1S7TB 3EDJA 5C0CD 2B4CC 2FHFA 4W9DC 3SZKC 1N5YH 1WA1X 1N9PA 2IAMD 4UDTB 3HHSA 4PUBL 3WD5L 4YFEA 4KUZH 5F93C 1OSZA 2NY1B 4PV8B 2J43A 5E9NA 1T1YA 4G8IB 2ZF8A 3MCYA 4LO9A 3WO3B 1A3LH 1GOHA 5FYKD 1QSEB 4GW5A 4LSSH 4JFZH 4M4RA 1I1AB 4FCHA 4DTGH 3QS3A 2A0LC 1JGLL 2ZCZA 2J1KA 3QEQA 3RZWA 1IRAY 7FABH 2EECA 4OZHF 3V9EA 2DYPD 1CF8L 1AVAA 2AJ3A 3BAKA 4U3XA 4UOJA 4EI6B 5J57B 1KPUB 4MAYB 1NLBL 3PHOB 4HKZB 4APXB 4PV9A 2APVA 1YPZB 4PJBF 12E8H 4P2OD 4AIEA 3GIZL 2NNAA 4RQQB 3TIDB 5IR1B 2CXGA 1NSNL 3QQXA 4OCWH 4AGLA 1DN2A 5CF3A 2YQ3A 3MO1B 4R0LA 5JQ6H 2NUPB 2JK5B 3LQAC 4OFYA 4AGNA 5FKAB 2QEJA 2E5EA 4KC3B 2PPAA 5EIIB 5B21A 3U0WH 4QRQB 4NPJA 2VLKD 4L4VB 3ULUF 2W95A 3HE7D 3J07A 4KKNA 4LVEA 4AK2A 4F2ME 4LHJB 5DC9B 4Z77A 4F93B 3MX0A 6FABH 1MNNA 5MEQA 1HCZA 4JFYA 1NSNH 4PJEA 4RH4A 2J71A 2IAAC 3AG1B 2H47C 1KBGL 5DJ6A 4MCZA 4QXVA 5FO7B 3ZKMD 5IUSA 1HE8A 4I1NB 1BBDH 3JTSB 3UBXA 2YQ2A 4JHVA 4QRFA 1JHTA 1J8HA 2VXUH 4AH2B 5FO9A 5LBSH 2FEDC 4OW6A 1FYTD 3V0WH 2ZPKL 4XP5L 3FAXA 5HYFA 3NFNB 5L8JB 3SJVA 2WSDA 4BCZA 4M5YH 4TPRL 1TJHH 4NO2B 3QZMA 4L8DA 2JKRM 5D5MF 4OZIA 2FBRA 2WCPA 3U0PB 1TSRA 4NZJA 2AEPH 3BPNB 4PEEA 3TT1H 1V3MA 4J4PC 3HE6D 1C7SA 4XHJD 1AGFA 1ZSDB 2VSMB 3NABH 3ULVL 3BW9B 1N5YL 2H7WA 3UMNA 2F2HA 3OAUL 3W9DA 5IG7B 4LOUC 3TN0B 1UM4L 4G42A 3D85D 1CJYA 2Z92A 3VMOA 2E74C 2BWQA 5DJDB 1ZD6A 3EGDB 3H8NA 2X4PB 5DVKA 3WIIH 4Z0XB 1ETJA 3B43A 2BOCA 4UDTA 1IC4L 4Y5VC 4Z95H 3ZJAA 1EHXA 1F4XL 4JEGB 4QO1A 3ZKXC 3DTXB 5EO0B 3T6WA 5C0CA 4PTTA 1DSFL 2P5WA 2NMSA 4QWWD 1WUZA 3EF4A 1IBFA 3P1VA 5EHFA 4OZHA 4U0RB 4IHOB 3GBNL 5D72L 4PS7A 2FX7H 3VXMD 4ZTPL 1QLEB 3Q6FB 1NBVL 1P84K 5EU6A 5K9JL 4OQ1A 2BIIA 5C9KA 3T71A 5JXED 5ESAB 2E46A 3ECVA 2VMFA 2XZAL 4Z7QF 2YD1A 4QXGH 4FXGB 2D7QA 4FG6D 5LGJA 2YZ1A 2B5IC 3R4DA 4OCYH 3SGDI 1R33A 1CXHA 1AD0B 2ZUQB 3FTGB 2GKIA 3GMQB 5IHZA 4AJYV 1T83A 3FU3A 3K6SB 3C5SA 3CMGA 4MCNA 3S5ZA 2RR3A 2N1KA 1JXFA 1JPST 4OM0L 1MIML 4GIOA 5GRZA 4YSCA 2NYYD 4GFTB 4IIQA 4YXHH 1K4DA 4JX0A 1NIFA 3NFPB 1A7NH 2X0VA 4MJIB 3CLEL 1M53A 1JN6B 5I1AA 3ARED 4JJ5A 4XC1H 2P8PB 1YNLH 2W07A 5ILTH 4Z7NF 2OJEB 4FNQA 1KB5B 1FL5A 4CVZB 3LB6C 3MJ8A 2GY5A 1MVUB 3T0VA 2XIIA 3SY0A 3N85H 4M5TA 2NNCA 5DZJA 3JWDC 1R3IL 1KZYA 3PUCA 1BMGA 1TDQA 2ED9A 3T2NH 2Q8BH 2YPKB 5FFLA 5D2LA 1XEUA 2ZP8A 1QO3A 1EMTL 2YXFA 5CHNA 4FJ6A 2EO1A 3IJ8A 2DIAA 2IOOA 4BQCA 1KCSH 3DV4B 4DP7X 5I19L 1YMMD 1PLAA 2J2ZA 5DTFB 4Y8DC 5EU3A 4DSYA 5T3ZH 2HFFA 2OMUB 3OXSA 3T04D 4NJAH 5SWSE 1I8AA 4WI7A 5DMYA 5I75C 1MREH 1CL7L 2PP8A 4G3YL 1ZWIB 3VFPB 1FZJB 4NPYB 4X5PA 2CR0A 1D9KA 5IP4A 5EU4A 4KZDH 3BAXA 5F3BB 3MXWH 2XBZA 1G4RA 1ZSHA 2DTMH 3NCJH 3GI8L 2H0FA 4JQXA 5T5NG 3TF4A 4I77H 5J6GA 3TLRA 1LO4L 5E2JA 2OQJA 1Z9MA 3RGHA 1RJZA 2X2HA 2BSSB 4M5ZL 4MQXD 4PIRF 2M2DA 5FA3A 3TIEA 3VTAA 1KGWA 3FAWA 3BKYH 1OARL 4X6EA 3KPLB 3W39A 1IQDB 5D2LF 3EH3B 4MD5B 1AGBB 4R7DA 1ZEAH 2ODIA 4F92B 3CZSA 1SN2A 2Z8VC 2AJVH 4NRZB 1RJLA 1HZKA 1NBZB 1DLHA 4PJ8D 2R0KH 3CH1B 3MV7E 4DZ8A 5KW9H 2ZE0A 4MQ7B 3SO3B 1IGFL 4AT6B 1P53A 3DVGA 1NMCB 4NQSB 5IB5A 4B9PA 2ADYA 4E41D 1U36A 3C5SB 3GXUB 2APWA 1F58L 2BIOA 4H4NA 4XC3L 1E4XH 3QJXA 5L9DL 2FB4L 3TOPA 4N28A 3GBLA 2DD8L 2BSTB 2F54E 1A9EB 1KGCD 1Z9NA 3MNVA 1ZE3H 1KFGA 4ONFH 3RWJB 1OGAA 1P4LB 2DWDA 4XWOD 3S3JA 4HW6A 2EINB 4IRJA 3G08A 2P8PA 3FCGA 2XT1B 3OF6A 4KK8D 1KB5A 5IBTL 4KK5D 3MJ8B 1JF5A 3D4CA 2VKWA 4NJ9H 1MF2L 1CR9L 2WWKO 1U92B 3VFVA 2IFFH 2DAVA 5FIEA 4U6VH 2ZX8A 2XSKA 1XDTT 1T0MB 5L2KA 4HZLB 4NLAA 5A3IC 1LE5B 3VX0A 5IB4B 1IGCH 1DBAL 1BQLL 4Y19D 4KKRA 3RAJL 1M9SA 1SF3A 2SODB 2OCFD 2JJUA 1LO0H 5GGVY 3ARGD 3T8XA 1SYVA 3REWA 1SFDA 1FFOB 4QRSA 4EN2A 3GSXA 4S2SB 1IAII 3KGRA 3UAJC 4AI7A 4AGPA 4JKKA 3VFNB 5D71H 4B41A 2R59A 4M02A 2QFRA 3D50A 1Z5LA 1BFSA 1TTGA 1MCDA 1J9SA 2XY2A 4H1LA 4E9WA 2VDNB 3O6FB 4OGZA 5FYLH 5MENE 3LDBC 4OM1H 4K3JL 5BZXA 4PYHA 1FYHB 5ICYA 4P4RB 1TTRA 4LQFL 4OIAA 1OGPA 4JS7A 2W60A 2O5NA 4WEUD 3Q01A 2JIXB 2ESVD 5MHSD 5FCUH 2WLNA 3SPVA 1N4XL 4HJGB 3MRIB 2WWNA 1QHQA 4O02L 3S7GA 3ATAA 4B3VA 4APQC 4AYSA 4NRYB 4YIQB 4TL5A 5DDHA 3BSZL 1A4JA 2WNKA 2VDLL 3GSOA 3HC0B 3PHAA 3W11D 3ET9F 4ZQTA 5I17A 1UFGA 5GZNC 1LWJA 4OFVA 2OR9H 4IS6A 4BXSV 4TSCL 3HAEG 3WKMH 4Q0XL 1K2DB 3N1PC 4K71C 2CUMA 5A6IA 4YHLH 4LIQH 1CLYH 4PW4A 1U8CB 4OGYH 4PJEF 1XTMA 2HT2C 4JVWA 4HIHB 3IFPA 3DRQA 4N2IA 1FV1A 4Q4EA 4W9KC 2NUPA 3EJYD 5IROD 3BQUA 4PJ7F 2DWTA 3JBG7 5INDB 1BLIA 4GKOA 4X7TA 3CFIC 2LOEA 3U6XA 43CAB 1KENL 1MCSA 2C4FT 2X4OB 2VO5A 2OLDA 3QG6B 2WTRB 2YGVA 2PWEA 3RWDA 3MZTA 2CO7B 4RESB 4TSAH 3WTSA 1U8KB 3HZVA 3F65A 1XF2A 2K6YA 4JFHE 2VDRL 5D1XE 5LG6A 5MERB 4PJXE 3Q8CA 1X5GA 2WYZA 3B6SA 3ZE0F 4NXKA 4ZUUB 4I13B 1AKJA 1BXAA 3O2WH 1V05A 3G6DH 3KS0J 4RAUB 1T6BX 1NUNB 3UJJH 3UMTA 2B4CH 4DEWA 2R0ZL 2IMNA 5LGHL 4DN3H 3BE1L 2Y3NA 5C7XH 1F5WA 1MCBA 4G9DA 4QTIH 1A3RH 2BK8A 2PKDA 4FABH 1HVXA 4NM4L 1B9ZA 1AACA 5DFVC 3WHE0 2E47A 4Y5XB 4OSUL 2NX5D 3VTTA 2Q7YA 4XPGH 4BUQA 1EDYA 1MF2H 1OAZL 1I1YA 3LKSA 2Y6TE 4BWTA 5IF0B 5JW4R 3GI9H 4WWKD 2KBGA 1MXDA 4O58H 3MJ7B 4HK3J 2DW5A 5D1QB 3VRJB 2QPSA 3DKHA 3LVEA 4MMZA 3IGKA 5IJVB 4MX7B 5EBWB 2FNWA 4AUUA 4MSWA 1HOCA 3SPVB 1KLGA 3GSVA 4I5BB 1COBA 3GRWH 5DMGC 4QHMB 3DUHA 1MFCL 4LPWA 1XL6A 1U8MB 5CGBA 4NOFA 3UTSD 1KJ3H 3Q9PA 2EIZA 1SLXA 2XA3A 3SN6N 1MH5A 4NQDB 2A9ML 2F61A 4I0KA 4OTXL 4BFIB 1ZT7A 5HI3D 4AE0A 4P2QA 3CN0A 1S9XB 1UXWB 4LBEA 2ATAA 4G7VH 1KIQA 3N6YA 3KD4A 1FDLL 4U0RC 5GS1B 2N3JA 1HXKA 1NBYB 4NNXA 5LXGL 4LSSL 2IPUG 3QYMA 5LNEA 2RALA 4UIMB 3PU7A 3OKKA 4YHMH 2HLFD 1IGJA 1Q0XL 5D7KE 5IHZB 1RSFA 1R5IA 4CNIB 3VXSA 4UV4H 2BNQE 1OPGL 4BCYA 4IDLA 3VDAA 3G6JB 4M6NH 2ID5A 1RZ7H 3FUFA 1P6FA 1YEIH 4TQIA 5BRZE 3FS9A 1KCWA 3QG6A 1XR8B 4WKXA 4XCCL 2QGBA 2XDHA 3D3VE 4M7JL 4PRPA 4D9QE 3PAZA 3CC5B 4QLWA 5HGAB 4JFDB 4LP4A 1O5DT 5LKNA 1TT6A 2BW4A 4OTXH 5B39A 4JJ5B 4OLYL 3DIDA 1XF3A 3O4LE 4OKVA 1FUNA 2ICWA 2BSEA 3BKML 1VKXA 2F5BL 3GYRA 3OGCB 4W93A 1GPOH 3ARBD 1S7QA 4MCYA 3FTVA 3SDDA 4X4ME 4WRLA 1RUQL 4QKTA 2HKHL 3GSWA 4I0PD 1QR1B 3IWUA 3KYMA 3KBHE 3M1BA 1XGZA 3F6LA 1SLVA 4K8RD 4D0BA 3FQUB 3GF8A 3JV5A 2VRAA 2Z8SA 1H6FA 3FB6A 3FNKA 4KAQH 1IAIM 5IEHB 2APXA 5T3XH 2IANE 1JGIA 3DBXB 3NK4A 2FJGA 5DRNB 4HK0A 3NFSH 3F12B 2WJ7A 1NFDF 4N68A 2ZAGA 4IW4C 4LSQL 2A4CA 3UJIH 5IQNA 4ENEC 3ZK0A 1XWVA 4L3AA 1JV5B 4X6CF 3GZPA 3RL1B 5HGBA 4XWGH 3DHJA 1CD1B 1FE8L 1WD8A 3TPKA 4I5BA 3ERXA 3RBGA 1CLOL 3WY2A 2MOQA 3OB0K 4JFEA 2A1WL 4ZUWB 4DFIA 4ZUTB 2V2TA 4JHWL 5FECB 4K3EL 3NT0A 1KIPA 4PJGF 5AW5B 1NCAL 3QEGL 5KG9A 1KBVA 3SGEH 1CE6A 2BSED 1KTLB 2EDJA 4LSQH 3ZTEA 1BYOA 4JO4L 4KI5E 3I02A 4ES9A 2EUVA 3MRDA 3JV6B 3T8MA 1OHZA 1XGQB 4YBHA 1JFHA 3T0EB 4J3SA 4YH6A 1IQDA 2G9HB 4B9ZA 1LE9B 3IXTA 2P48B 4HXBH 5DFTA 4BEIA 2GB2A 1FL6A 1EGJH 2VH5H 1XIWD 5DVLA 3REVA 4YDNA 1UGKA 4BRJA 3P9LB 4OF0A 3D0VA 4NZTL 1KNOB 4TNEA 3TA3D 2AZUA 1YNLL 3SDXE 4F7TA 1KCRH 4CW1A 4ZDHB 2NY2B 4JRYA 4W9IC 2Z34A 1MCPL 4U3SB 4KXDA 2ETWA 3FQ2A 4NQED 3PJSB 3QIBB 4JFDA 1N6UA 1YC7A 3KPSE 4XMUA 2VZ1A 1AHWA 3QG7L 1BBJB 2OA9A 5BVPL 3V52H 1RIHH 5F88B 3TCLB 2DEYX 4GQZA 4JHZA 3WEOA 3IVKA 3P9WB 2FBOJ 3FQYA 4AYID 5MEPA 3BLPX 2WZAA 4NFDA 2VDOH 5K1VA 2A74C 3FB5A 3VD4A 3QQ3B 4HZ1A 2Z0BA 3K2UH 1JPSH 3RVTC 1X5AA 4U7SA 5AW9B 5DFWH 1A22B 1UWGH 5KSAD 4MQTB 1RFDL 1E43A 2NY3D 3BVNB 1UACH 4PRAA 4ZOBA 3UADA 3Q5OA 2ZCHL 2F53E 5E03A 3LZPA 2GJZB 3NA9L 4E42A 4YDVB 2LAAA 3L5WA 1N18A 5ITFB 5TF1H 5E8EA 4A66A 5DJCB 3ARDC 3KLAA 3JXAA 4KO5A 3EXLA 2ICCA 3BP4A 3EGSB 3IDNA 1R5VA 2FZ3B 2DM7A 2W59A 3DMMD 3M8OH 1AZCA 4OCXL 1EZSA 2QDVA 3EH1A 1MCLA 3NZHH 2IAMC 1U21A 4QRUB 4PLNC 4A2HA 1JXJA 2D31B 4YSQA 3EJCA 2YA1A 1QA9A 4HCRA 4BFJA 4BFKA 4N0UA 4Z3JA 4AEIH 1NEZG 4QRAA 3GSQB 2ED8A 3G04A 4FQJH 2AV1B 3EW3B 4IRJC 3VI4