2M83A

Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of protein phosphatase-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
139
structure length
139
Chain Sequence
GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein phosphatase 1 regulatory subunit 3A
publication title Molecular basis for Protein Phosphatase-1 regulation by the muscle glycogen-targeting subunit GM
rcsb
source organism Oryctolagus cuniculus
total genus 24
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2m83A00
4EIBA 2V8LA 2DJMA 4BFNA 4BFOA 2VQ4A 2M83A 2EEFA 2V8MA
chains in the Genus database with same CATH superfamily
3IMSA 4A63A 4Z7WE 3NCMA 2NUPB 2YLKA 4NP9A 3ZT5A 3Q2VA 2RAMA 1LO3H 4LCWD 1PZ2A 1R24A 1X9RA 4Y2DC 2FYYB 1GS7A 3WO3B 5C0CA 4LCWE 4G5ZL 4OF7A 4PW9A 1KCRL 1JPGB 4LSTH 4ELKA 1TTGA 4FTVA 4PJ5D 3TT3H 3KVQA 4QGTA 2D7QA 1OQOA 4BZ2H 2R27A 4PIRF 4AL8C 4PJ5E 3B2VL 3U6RA 2DB8A 1HSBA 2NQCA 4PP1D 3UACA 1DJHA 4G9DB 5IW6A 4LL4A 4MXWH 5C86A 1KPUA 1WAAA 2AANA 2XN2A 4ZAKA 4IGBD 2O1AA 5FHBH 1OAUL 1A65A 3R18A 5JZ7C 1URZA 3G5ZA 4P9MH 2N3JA 3FQXA 4PJHB 2QVFB 3BPOB 4WI6A 5E2WL 4K7FB 2AEQH 1XGTA 4GAJL 1LGVA 3KR3L 5FOBB 4UQIM 1EFXD 5HHVL 5ID1A 3OKEB 4QO1B 3HZVA 5I73B 2GVYA 3HCVA 2OP4H 5D4QA 1FPTH 2PTUA 2E7BA 3EH5B 4LSRL 1IC4H 1Q9OA 4L1HA 5DRXA 1SRDA 1QRNB 4PG2C 4LK4A 5HI3C 1GTNA 5L0QB 5ALBH 5C0BA 2J5WA 3I9GH 4X9BA 2W60B 1SFHA 4CADA 5EZJB 5KVDL 4YEFA 4FFYL 1I8IB 4IRZA 1FE8L 3ZJAA 4U1IB 4RFEA 5E8NB 1CYWA 2WYZA 1PZ5A 1BMGA 3GBMH 2WBJD 4X5XA 1YECL 3UO8B 4KHXH 5I9QC 4N9GB 1SXNA 5KW9L 1K72A 1FL5A 2RB8A 2Z4QB 5IMOB 4GAYB 5CSZB 5DJAB 3MLSH 2AK1L 5IESH 1I4FA 2UXTA 4MQXD 3JQOB 5TGBB 4D94A 1RPKA 3TM6A 1A1NB 4CMMB 3PGCA 5C7XL 3VXQB 2L7UA 3IJYA 1B4JL 1T1WA 5C0FA 2OK0H 4Z9KB 5H4ZA 3O2VL 4FNPA 4PJIB 4XXDA 4C59B 3SKJH 4LNRB 3NJHA 3WJMA 3SPHA 2E9JA 1O5PA 5K9QG 4F2EA 2WWKO 1Y1DA 3Q7JA 3ZPDA 4GUQA 2R0LL 3MACL 4LMQI 3V5HA 3DX2A 4XI5C 2EUWA 1JWMB 4AQAA 2I85A 2J21A 2RR3A 3FB5B 4IJ3B 3C5JA 4JFYB 4P3DB 1JWSB 1A1OA 1QUNB 3DX1A 4KAQL 1XR9B 2X10A 4HUWB 2BSRA 1MLBA 4LLWA 4QF1A 5JIKA 4JDZB 3RVVC 4PJHE 1YPZB 1ZA6A 2Z34A 3AFLA 4IU2A 1J9RA 3VNZA 1DLFL 2J6EH 3U1QA 3I3BA 1L7TH 1IC5H 1E43A 3EJYC 3SDYL 4F7PA 5HBBA 3VRLE 2WQSA 2YKLH 1BOGA 4L1BA 4GMSH 4XPHH 3HE6A 3TCLB 1MREH 1QRND 1A7QL 4OCNC 1JZ8A 4YSRA 2LTQB 1QRNE 2RGSA 3U46B 3E6HA 1JZ2A 2VC2H 3P40A 1ZHBA 1CDIA 1MCCA 3US1A 4XB3A 3DX9B 4GQPH 3IJ8A 3S37X 3M8OL 3IFPB 1FZJA 2KDYA 2H26B 4OGYH 4XVJH 5J6GB 1XZWA 4PGBA 5DUML 1OTTD 3DJRA 3WEAA 3H3PL 3MGTA 5KJRL 1ASOA 1OOWA 2WCGA 5I8EA 3LRSB 1P4BH 4UV7L 2DWSA 2B4CC 3BUTA 3TBWA 5FLUA 5A2CA 4PJGB 1IIKA 3VE0A 4YZFE 1G7QB 3AAZA 3IXTA 3BH9B 3QUYB 3AWFA 1TENA 2CAKA 1CDGA 3L2MA 4UILH 1U8KB 2KMWA 3VXMD 3NSFA 3LEXA 2ITCB 4JZNA 5DYOA 5G55A 2PXYB 3VVVA 3T1WA 3TOPA 2MEJB 4IOIA 3HLAB 4AG4H 5IV2B 2HVBA 3OZLA 3IMRA 1EK3A 5J4MA 4Y5XB 4TOYL 1CIUA 3WXVL 1H8OA 4KTEL 5FW7A 3SQOL 1UOKA 3WLBA 4PJIE 5EOCL 4JCWA 5CBAB 5MEOA 1IM9D 3U7AA 4TTDD 4P57B 1JL8A 3RVWC 4KU1A 4MJIB 4UOJA 3KWUA 2E46A 2I32A 2H0EA 1QSFB 3W9DB 4OKDA 5DK2B 4Y9FA 4GQZA 3PP3H 5JW5B 5IHUL 1YPZE 1BJ8A 2R83A 5ICXA 1Z9OA 1AD9B 4P4KB 5IR1B 2DTML 4XPGL 5BRQA 4UNUA 1J8SA 2W0FA 1ZLVH 1ZSDB 3VWJA 3QFDB 4LSSL 1HCFX 1JDDA 4GKSA 1I9EA 3LEVH 2N4IA 4P9HL 3W11D 4XZUB 1F4XH 3V4VA 2OMZA 4L9LB 3O4LA 1NSNL 1OARL 2ICEB 2J12B 3O4OC 4YR6B 3SGKC 2KYIA 3L8QA 4C54A 2DQFB 4X8JB 5KVFL 1AI1H 3CSYA 2WBXA 2VR3A 4ELDA 1IBYA 5EO1A 4NQCA 3DETD 4HZLA 1ECYA 1T2QH 2RQ8A 4BQBA 4O2FA 3S0PA 4HX1A 4NZRH 3PGDA 5TE6L 1YLBB 3QUYD 4PJGE 3CIQA 5IVXF 5E5UB 5ADOL 1VAHA 3EZJB 2PXYD 3V6OC 3P1VA 2CLRA 5CJOH 1B6DA 1BEXA 2C1OA 5MERB 4OZHB 3CZNA 3DYOA 4L5FE 3L9BA 1C9SA 3D39D 4PG9B 1LK2A 4WI3A 4WJKB 5DHVH 5GS0L 5CLZA 3BD4A 1OAXL 1A2YA 1U92A 4ZQKB 5K1VA 3S4SG 4EDXA 2CHXA 4XOCA 5GRXG 5LAXB 5F7BA 1A22B 4JPWL 4K2UL 3L3GA 4ZTOH 5I1CL 1UADC 2CDFB 2PYEB 2BIQA 4MJIE 2EXWD 1QSFD 4K4KA 3LIZL 4X5WB 1QSFE 4HJJH 4XT1C 2W65B 3KPSB 4GRMA 4KXZI 5JPMB 5DMYA 4NNPH 3RDJA 3V6ZB 1JVOA 1PJ9A 3RGVC 5GGUB 2UZIH 1YMMB 4P4KD 5AYUH 4CC0A 5JUEL 5DS2A 4KOCA 1GY2A 2XZCL 5I6OA 2NDFA 5KAQF 5JORA 4DN4H 1NBVH 1H6EA 4FZEL 5BUAA 2K4WA 1MFEH 3RFRA 1ZWIA 2AXJA 4FQLL 2FX8L 1B0WA 2D7TH 3DIFB 3ARBA 2Z7YA 4F15B 1JK8A 1ZVSA 1MRDH 3SE6A 2RH0A 1DANU 5HGAB 1LE9B 3MOBH 4RVBA 3MNZA 3BPCA 2YPLA 1CF8H 1E3ZA 2KZBA 4LAJH 4MMYA 1FLRL 1M6OA 3I84A 1VADB 1JOIA 4XPFH 2C9QA 1HAWA 3ZR6A 5ICYA 3Q9QA 4FMKA 3SDCC 3EGDB 4M48H 2AEOA 3NGBB 4RESB 5EDXA 1CL7I 2Y2WA 4OZHE 2VERN 4HVBA 4FQJL 3FU9A 4P23D 4U1KA 1FL6A 3HIZA 4OW6A 3QULB 2VDLL 2IPUG 4JRYA 4BK5A 4EDWH 2FEJA 4ODSL 5IF0B 2ZXEB 3FB6A 4JO4H 1REIA 2PYED 1K5NB 4R5VA 1YRKA 2XRAH 1NBYB 5D6CB 3I75A 2PYEE 3WN5C 1BVNT 5AW4B 3Q8AA 5DJXB 3KPSD 1SXZA 5I30L 1NCGA 2OXHA 3KPSE 4RMRA 1JGUL 2A1WH 2HVKA 1OD9A 1QLEB 4PJ8D 4NZFA 5BS0B 1YMMD 5HGDB 4FF9A 1FL3B 1DQJA 4JZJA 3QIUB 1YMME 1EEQA 4PY7B 3UC0H 1JPSH 1WISA 3QCVL 1FYTA 5J3HD 1X5ZA 3GUTB 3VXNB 3GSVA 1ODAA 3R0NA 2YXWA 3T4AB 3A4DA 4BM7A 3RTLA 1RK1A 4NWTL 1CI5A 4U6XB 3SGDH 3VVWA 3QHZH 5FGSA 3DO7A 5HI4D 2EH7L 3EADA 1U2YA 1KBKA 2DWDA 5AYTA 3X3GL 3APMA 3CU7A 4JQXA 1LVEA 2CUIA 4JNXA 3GXMA 2UX6A 2R2HA 4JN1L 3ZKMC 1D5IH 3QG6B 2VM3A 3RVUC 4FFWC 4I1RA 1G94A 1NM4A 4N2GA 1EVUA 5EIIB 1I8LA 1OM9A 4XN8A 2O5YH 1A6AB 5D1ZC 4DGVL 3HN8A 3U7YL 2D0GA 4AIXA 3CH1A 4DH2A 4Z3TA 5T3ZD 4HGWB 4ANUA 3VW3L 5T3ZE 1TSHA 1P7QA 1IGYB 2E74C 1UB6B 2Y2YA 1KB5B 4ZRGA 1B2WL 1FCCA 1KGIA 2F54A 2W0KA 3GK8H 1I3GL 4HT1L 4OU3A 5DC4B 4YHZL 2ZWLT 3HW7A 2UUDK 2J8HA 4ZSOB 2QKIA 4FJ6A 1AGBA 3P9WB 1F4WH 2VDNB 4N8CL 3CVHL 3JTSB 4OD1L 4XP6H 4P2QA 1DUYB 2V17L 5SV4A 4JFHD 4XP4H 4H44C 4X99A 2P24B 1BECA 5AAMC 5I0VA 1GIGH 4JX0A 4X42A 4JFHE 4R4FL 3N9GH 1AD0B 3U36B 2ZSVB 5C0EB 1WWAX 2VRQA 4FNQA 3N40P 1GC1L 1L9OA 1SQMA 2YAOA 3LIZA 1AXTL 3MUZ1 4F5CA 5BS0D 1R47A 1XWVA 5IFAL 2OMVB 1F3JA 3JT0A 5BS0E 5TQ0H 5EU6B 5AWNL 3QNFA 3B6SA 2Y1YA 5C92A 2E47A 3BN3B 4AGOA 2X2IA 4KPHH 1R19A 3FB7B 2A6JB 1WGOA 7FABH 2ZUQB 3IAPA 2APSA 2C34A 5HJDA 5I8CB 2I25N 1G9NC 3BHBA 4IRZH 5FUOL 2J1YA 4BZ1L 3MLVH 2F61A 3P30H 25C8L 2DH2A 3AT9A 4NERA 4ZUSA 1JF1B 2A73B 2VN4A 3WJLC 3V0IA 1MZZA 4PGDB 2BVPA 5DQ9B 1J10A 4Y19A 2N7BA 3HUJB 3UAJC 3OC5A 3DRTA 2LVCA 1RURH 3JWNE 3HMWH 4HJ0D 4JB9L 1F90H 3VD9A 3S88L 4AEFA 4M3KB 4X80L 4PJ9A 3QZWG 4N4YB 2VSMB 1EEZB 2G30A 3RWIB 2UXGA 4KX9A 3P9LB 2GY5A 1RPQA 5AOJA 1KCKA 3QQNA 4XPAL 1I8KB 4Y1TA 5CMAA 2VN5A 3KPQB 2WZAA 4GIAA 1K6QL 4RMBA 3WS3B 2E59A 4FXKA 4ZSOE 2X4SA 4FS0A 5JDSA 1NIEA 1NPJA 3BPOC 4O02H 3WOVA 4NQVB 4LOEA 3TBSB 1QSEA 4U1MB 5KVEH 1BGXH 5I73C 4HIHA 4DOHB 4JJOA 1JZ3A 5H35A 3DSNB 4A67A 1MAML 2JCCA 1T3FB 5IIEB 2WP3O 4JFOA 1G5GA 3U4EB 3STLA 2NX5A 4N0CD 5B38B 2X4UB 2OXGA 5L0QC 3P3UA 5E7BA 4JFXA 5EU6D 5DT1L 1U3HA 4HH9A 5EU6E 1E4KC 1XF3B 3RWFB 3SJVB 5B3JE 4ZPTB 3DXAB 4NC0B 4XO3A 5J6SA 2BCMA 3GXUB 3MO1B 3EJJX 3MTRA 3MGOA 2VAJA 1OTTC 4XCEB 3R4RA 3U4BL 5TDOB 1J5OH 3S4SA 4WV1C 3ZQWA 5CN2A 1FGVH 3OG4B 3VWKB 4FAAB 3OKMB 1P7HL 2A9DA 4QXGL 1NBZA 1N6QH 2IPKA 3LIUA 4WW2C 3UABA 2EE2A 4XVTH 4H0IA 2HMIC 1F4AA 2PR4H 3FCBA 4GOSA 3PJSB 4Q2ZB 3HUJE 4PRPA 3P4NA 3DX7A 2E4TA 1AG0A 3K2IA 1AYRA 4XN1A 1AHKA 4HUVA 3VFTB 3E2HB 5GJSL 1F6AB 1RJYB 1A9VA 1WTLA 4JHZA 4TNVF 3KGTA 3IDJB 5IB4B 4PJHF 5DQDL 4FXTA 4G5ZH 4HWZB 4U1NA 1KCRH 1OCCB 3Q9PA 3CSFA 3D30A 3IJ7A 5DQJA 3RWJB 2D0FA 4TTGA 2E7HA 4MX7A 3REVB 5DEGA 1AO7D 2X70B 3B2VH 4KKNA 4ONGL 3O3AA 1DQLL 2PP7A 4Y1AA 5I6XB 3CVHA 3DHUA 3ILPA 1B4RA 1HYSD 4XN4A 4DOHE 1G43A 1OAUH 4U3HA 5FUCC 3SGJA 4AEHL 1TTCA 4XMTA 1M9SA 3OMAB 5E2WH 3CDCA 4GAJH 3EUUA 3KR3H 4A7SA 3QZNA 5DJYA 5HHVH 5L8KB 4GY4A 4WW1B 3FH5A 5IQLA 3EW3B 3MRIA 1JHTB 4DO6A 3SJVD 2G75A 5GISL 5ERWB 4OKVA 5FF6A 3CDZA 3SJVE 4LSRH 3S37L 3DXAE 4XC3L 2V7HA 4YDJB 5T3XD 2EDKA 4R5XA 4WW2F 3QI9B 3DETC 4DEWA 4TN9A 5T3XE 1U58A 5KVDH 3KGRA 1TDQA 2B4CL 4FFYH 4FQ2L 3VWKD 5BOPA 4A2EA 4I18B 4LARL 1FE8H 3GSUB 4WI4A 5IFHL 2P49B 4UIMA 4Q6KA 3WHE1 4DVRL 2PXYC 4P5TB 1QABA 4NI6A 2ZCLL 3AROA 3GS4A 3VFGL 1YECH 5KW9H 4MS8C 1N2RA 2PPDA 2HN7B 2AK1H 3ARDA 1PLGL 2EAEA 4TNGA 4S0SD 2QT6A 1F13A 5D71L 1IGTB 1HHHA 2Y7LA 1BPVA 1W80A 4JFWA 4G72B 5C7XH 1XBRA 3WIAA 1SEBB 1B4JH 1O7VA 1P84K 1RLWA 5LGJA 3BDXA 3BFWA 3O2VH 3FK3A 1M1SA 4X7DC 2EXWC 5DLML 2WLIB 5GZOC 4J1UA 4B9CA 5IJBC 3BP5A 3HI6L 3O2DA 3FO9B 3M46A 2I9TA 4UTBL 4BH8B 5IW1A 3IDYB 2ITEA 3MACH 5A43C 2EEFA 4JDTL 1UCBL 5SWSA 2VJ0A 2KPWA 1P2CA 5MEQB 3V0VA 3NCYP 4KAQH 3HC3L 3IRCA 4Q52A 2W80C 5J89A 3D1MC 1TPXB 3WIHL 4JE4B 3MXVL 3SSGA 1NAKL 3V0FA 1IBHA 1OPGL 1WK0A 1DLFH 5CD3A 3I6GB 1P84J 4BEIA 4M93C 3SDYH 1XF5A 2DJSA 1I7ZB 1MCJA 4K9EC 3IMBA 1A7QH 3ZO9A 3AGVA 1MG2C 3ECBB 3PHQB 3B9KA 4U1JB 2P8PB 3QI9D 1ZHNB 2IFGA 3D09A 2GY7B 5HHMD 4EI5B 4BELD 2DIAA 3M8OH 5LXGL 1SEQL 3BSGA 3SCMB 3FRPG 5DUMH 3R7QA 4F3FA 1DE4A 3H3PH 4P5TD 5KJRH 4JFPA 4Y16A 3TV8A 4JY4B 3NCFB 1HL4A 1PD1A 4UV7H 3DGDA 2BXYA 3OKLA 1R5VB 4OCRL 2CZNA 5ITFA 3WFEL 4P23C 3K6DA 4NXKA 2DF3A 4ICWA 1N0XL 3K72A 2HT3D 1KXVC 1N59B 1JGEB 5J06A 1UQSB 3BZEA 4TOYH 1WQVT 5FK9A 3I50L 4Q6IC 3WXVH 2IO5A 2FJSA 3CN1A 3O41A 4RAUB 4KTEH 4LGPB 5EBMB 2X0WA 3SQOH 4AKPA 5EOCH 4NNXA 5FM4A 1P5UC 35C8L 4MLIA 4X98A 3BKML 4D8OA 1KIUB 3UEZA 3GTTA 5JOFB 5JLZB 1UWYA 1A6TA 4PJ8C 4BGDA 3MRDA 3T77A 2ARJB 3GEFA 4U7KA 4Y89A 3PFUA 4ZXBB 3STBA 4JAMA 2IOMA 2TRHA 2B0SL 4RSVA 3L4YA 4BCYA 1PGRB 2IQ9L 5IHUH 1XXFC 3T2QA 2H47C 3OWRA 5DHYA 4DFHA 3QZWA 3ALXA 4IS6B 1YMHB 3BEVB 2DTMH 4XPGH 2OZ4A 1VACB 1GY1A 4MDJB 4TNVK 3MLTB 4FRWA 4LSSH 1K4CA 3VFOA 4BQ9A 2VZSA 2XBDA 5CJXC 1QFPA 3J27A 5DMGC 2OTUA 4P9HH 3ILQC 3Q43A 3LRKA 2WTRB 1B2YA 1NSNH 1OARH 3M1BB 4OZHF 1J7VR 1R3JA 1TR7A 3SCMD 1TZHB 2WGNB 4U2ZA 5KVFH 3VRJA 2K6WA 4W9FC 5FO2A 3BAWA 3QO0A 5EF0A 2Z64C 5DC0A 1E28A 1GMEA 2FCBA 4HPHA 5A16A 4WK4B 1U8HB 5TE6H 2D31B 4LXFA 1BBDL 5ADOH 4MCMA 4M29A 4H1LH 3TYFA 4ZMOA 4MNQB 3NCXA 3HI1B 4PJAA 3V5DB 5ESQB 1A64A 5EFIA 1HNYA 3GI9L 4JJ5B 3HB3D 2ZP0T 4HUUB 4UUJA 3TEWA 2WSPA 4I0CC 5GSRA 1MUJA 3OR6A 2P5WB 2IOIA 4DK5A 2HPOA 4NYLA 4HD5A 1QQDA 4RQQB 3RIAF 5GS0H 4P2OB 1OAXH 4IIQC 4BFJA 4OLXL 5D7JA 2YAMA 4K2UH 4JPWH 1ZV2A 3B1TA 5I1CH 1W91A 2H4EA 2J1KA 4KTGA 4QRBA 2MQGA 4YFEA 5HHXL 4Y4KA 3VD1A 4ZXBD 2JLLA 2M2DA 3LIZH 1RZJC 4YVUA 5EPMB 3VFUB 5K9KA 1IQWL 2ENJA 4JPVL 2RTTA 3KWWB 7PAZA 2KT6A 5EMYA 3L6FA 1BM3L 1QUPA 2BSED 3RNQA 2XZCH 2MCAA 5JUEH 4GEJA 2J44A 2HJLA 2K9FB 5F7LB 3V7MA 5DZVA 2BP0B 2EH8L 3VQ2C 3IAGC 4RGNC 4FZEH 2BP3A 2NY5L 5JXEC 4TL4A 3QQ9C 2ZOOA 4FQLH 4PLJD 1M7IB 2FX8H 3L5IA 3E6FB 3TIEA 2YXFA 5CIPB 5F7WC 5I16B 1CQKA 1LP9A 2Z3FA 4AK2A 3JWNC 1J9TA 2BLFA 5DTFB 1EZSA 4MAUL 1ONQA 2F7IA 4Z7VB 1Z5LB 3EDKA 2VDRB 3UAEA 2XQBL 3MLUL 1D2OA 1AANA 3QA3B 5E4OA 1QR1B 1FLRH 1U3YA 2JKWA 3QT2A 1I8MA 2WJ5A 4UT9L 2FJHA 1TO4A 3Q2WA 1THAA 1I3UA 1LEIA 2CCWA 4MNQD 1SHSA 4PGCB 2G4EA 4MNQE 2PABA 2H1LM 1VFAB 3PNWA 3SOBL 1S3RA 1KPRB 2L04A 3FW6A 2P5WD 4FQJH 1VFMA 4ZUVA 5BJTB 4I48B 2P5WE 1TSRA 3GKWL 3VFVB 2VDLH 3OJDB 2QGBA 4YSSA 4U1GC 5JO5B 1Y07A 4KROB 2CLZA 4ODSH 2VDPL 2ZWSA 5D7LA 5ENWB 2JQAA 2NR6D 1KYUA 2GIMA 1BQHG 3H4HA 1CD1A 2X88A 2Z91B 5CEXB 5I5RA 2P3YA 1MHCA 2XNAB 4N0CC 2EDLA 3OJVC 4AH2B 2PCFB 4M00A 5I30H 1EAQA 5HVWA 1W8OA 1JGUH 2VSDA 3T1FB 5CILL 1RIUL 1EQWA 4W4OA 1Z9LA 3CAFA 4B50A 1X5IA 4G82A 4Y4FA 5LKNA 4L3ED 1AIFA 5KJ4A 5C9KA 4V1DA 3QCVH 3QNYB 2ATKA 3HS0B 2DQGL 1PX3A 3VDBA 1T04A 4WSGA 3W82A 4NWTH 1EEYB 2GJZB 1KEGL 1EERB 4QHUA 4X6BB 4MAYC 2EH7H 3X3GH 5CCGE 5HYJB 3G6AA 3NCJL 1HHKA 3C6LB 4HW6A 4KDTA 4JM4L 1YN6B 4JN1H 3CMGA 4DZ8B 3QISA 3EUDA 3KCPA 3FZUD 4Z7VE 1RKRA 3JZYA 4CRPA 2B5IB 2BOBA 2V3DA 2WXOA 3DBXA 3GSOA 3GYRA 4KTYA 5L8LB 1CK0L 5BO1L 4MHHI 4DGVH 3R19A 3WIIL 3U7YH 5BO0D 5ICZA 4CN6A 1XEDA 4TQIA 1T1YA 4GT7A 3TX4A 2NXYC 3SO3C 3VW3H 1XMWA 2OMXB 3B7TA 5E1AB 4WZ9A 4F33B 1AGFA 5B39B 4YX2L 2CHNA 2ZUSA 4MHHG 2J2ZB 1B2WH 4HT1H 3GXNA 1I3GH 4QRPB 1XGYL 4YHZH 4KROD 4FG2A 2ZXBA 2X2HA 3QPQD 4JUTA 4ZMVA 1UACL 2NY1B 4N8CH 4OD1H 2L7QA 4RNRB 4NHUB 2V17H 2FJUB 3SDDD 5SX5K 3RJOA 3OXSB 4G9FA 4M7ZC 3WO4C 2XN0A 5IMKB 5EC2A 4R4FH 4AUJA 3AITA 2EVHA 3LKRA 3SEPA 2EADA 1AJ7L 2E76C 1GC1H 3DOIA 1JD7A 4W9CC 1AXTH 4ZDHB 2H32A 4BGLA 5IFAH 4I5BB 1ZGLP 1DANT 3HHSA 4JKLA 4MXQC 1KJ3L 1IO4C 4YGVB 5AWNH 4X8CA 3L1EA 1BFTA 2X9ZA 5GRJL 1T89C 3MR9A 4M61A 3HUJF 1NCUA 2J57A 2Z92B 5KSAC 2OX5A 1CU4L 3ECVA 3RIAK 5FUOH 2VLJB 4BZ1H 5HYJD 4JG0L 4G7QB 3ARRA 5DMIL 3C6LD 5HYJE 25C8H 3WHE0 4Z7WA 1KWGA 4UI2A 3S97C 4CKQA 3SYAA 1XR8A 3E1F1 1TVHA 4OZFB 3N55A 4JGMA 3DTUB 4LCWA 4AYBA 1NCWL 4FI6A 3L4UA 4ODWB 3T8XA 3RWEB 5LDUA 1R5IB 1QOKA 5L2JA 2PP8A 4PJ5A 3KYOB 3P54A 1XGPA 1XB3A 2RA1A 4JB9H 4UT9A 1URLA 1MCFA 1ZIBA 3QUMB 12E8L 4G42A 4MD0A 5GIRA 3T0ED 3U48A 4X80H 3ULUD 3WCYA 1MSPA 2AKRA 5HJ3A 1HXMA 2YD6A 4XC1L 1HEZA 3FKUS 3AREC 3N43F 4IGBA 1HJCA 1UH3A 4XPAH 4JM2C 4Y5YB 3TJHD 2F53B 1K6QH 2MOVA 4IQHA 3FHQA 4QRPE 4YPGA 5AAMA 1EFXA 1D5ZB 3WNJA 5GRWA 4HUMB 3LDBC 1USQA 3H9SB 5DJDB 4D0CA 2IV8A 2PLTA 4X4YB 1U3ZA 4N28A 2A4ZA 2DEXX 5A40E 4ZUUA 1MAMH 1ZHLB 2X4PA 4MNGB 4ZUWB 2COQA 1OTUC 4BA8A 4Y1SA 1MJJB 2APFA 4HOZA 4M8QB 4KXDA 4GLRH 5JIPA 5D7IF 4PJDB 2VLKB 4Y5VC 1MJUL 1IBFA 5T1MB 2PO6D 4YSOA 4LKXB 5DT1H 2EYSA 4R9HA 3V0JA 3RWCB 2J8UF 3N41B 3UBGA 1KBVA 3QQ3A 2SEBB 2KLSA 4PN6A 1YNLL 2EABA 1N5AB 3EOTL 4BDVA 4DP7X 4L1TA 1IGIL 3HVNA 4WI5A 5SV3A 1IAMA 1XDTT 5DJ0A 2WBJA 2GBVA 2VLJD 3K2KA 3U4BH 1WZLA 4FULA 2VLJE 1QLFA 5E5LA 2E7LC 1S7QB 4P4RB 3NT0A 2V2XB 2NCEA 4HAKA 5I75B 1GYAA 2PYFB 4DZBB 4Z6AT 4QXGH 1YO4A 2NUPA 3HZYB 1KNOB 4PWHA 3THML 5GXBB 2V3FA 2FYYA 3NH7L 1AHWB 4GBXC 4FYSA 4LSPL 1EJFA 1JPGA 2D9CA 3HZMB 3I6KB 4J3VA 2LQRA 5LO7A 4FQQB 3RNKB 3IFNL 1G5AA 1WH0A 4KBPA 3D06A 4R7VA 2CQVA 4JM2F 3WENA 3BX7C 5GJSH 4YHIB 4G9DA 3BFQG 2BWQA 5DQDH 3KAAA 3NTCL 2F53D 2O5XL 2VR8A 1MCKA 2DI9A 2IALB 2DYRB 3MRLB 4IRSC 2F53E 4K7FA 4PJHA 2BVEA 5FOBA 4PPTA 1JG9A 1M9WA 3OKEA 4ONGH 2JB6B 2BFVL 2XG5B 4QO1A 3S98A 1DQLH 3HRZB 4B97A 2AQTA 1JRHL 3H9SE 3FOLB 4ODVL 4LP8A 2F8IA 1JI2A 3SY0B 3JBG7 1SUHA 2EUVA 1QRNA 4MNGE 4AEHH 3FFDB 2W60A 2GABA 4K9EL 4PRAB 2VLKD 1PU0A 5EZJA 3B7YA 3X1EA 1IGJB 2G0KA 1I8IA 2VLKE 1ZK9A 4OH2A 4PJDE 5F7UA 4Q74A 2A4CA 4UT6L 5E9DB 5L4JA 5GISH 4U1IA 5E8NA 4B7LA 1ML0A 3S37H 4K3HA 4XC3H 4G83A 3CGTA 1XB8A 1TQSA 1MCOL 3N1GC 4N9GA 2FTAA 1L6XA 2UUDH 2IGFL 2Z4QA 5IMOA 4GAYA 2WV3A 5CSZA 4K07A 5DJAA 2B4CH 4FQ2H 3D08A 3KPMB 4LARH 5BZDB 5IFHH 5TGBA 1QRKA 1CUOA 2A83B 1A1NA 4CMMA 4DVRH 1TVDA 3VXQA 3UBXB 2MIZA 2W0LA 2ZCLH 4QDGA 7CGTA 3VFGH 1CGXA 4PJIA 3HB3C 4N2KA 3L4CA 5HVGB 4LNRA 1A9EB 1O6SB 1MI5B 1YQ2A 4HLZH 1QX1A 8PAZA 5IB3B 1PLGH 3X1GA 2AQ1A 5D71H 4AWJC 5E4EC 4W9HC 1MH5B 3HE7C 4JO2L 1NFKA 2I24N 1JWMA 1TJIL 1UJ3C 3EJPA 2NCMA 4LNVA 3FB5A 3RKPA 4JFYA 4P3DA 1F3DJ 3HBGA 1JWSA 1QUNA 5EIIG 1XR9A 2W07B 3NJMA 4HUWA 1MCNA 2ADFL 1UEMA 4JDZA 5DLMH 3W39B 1YPZA 4ZXBC 4LLDB 3INOA 4GRLC 2EDFA 2EIBA 3HI6H 4OVUA 1CXKA 1JE6A 4UTBH 5H37A 3VG9B 2C3VB 1Y0LB 1NMCC 4GUPB 1QYGL 4JDTH 1D5BB 1UCBH 4Y88A 3TCLA 3X14B 5KBLA 4NBZB 2L4OA 3S5LG 3HC3H 4XMZA 3U46A 3CPUA 3WIHH 5GHWL 4G43B 3MXVH 2V9TA 1NAKH 3DX9A 1OPGH 1MCWM 3IFPA 3SODB 2JJUA 2H26A 3C09B 1D2PA 5J6GA 3BYYA 5E9DE 3F7PC 3AABA 3MV11 4I0PB 3TP4A 1S7XB 1QWUA 3UG4A 2ENYA 3HS9A 2Y6SD 3LRSA 2VDKB 2YD5A 1HC1A 3DTDA 2CA4A 5A2JH 1M2OA 4PJGA 3TIDB 1G7QA 2XJLA 4OD2B 3BH9A 3H7BB 3QUYA 2DTSA 4FLSA 5T3ZL 2XWRA 1U8KA 1OKEA 3SBWC 3V52L 3II2A 2ITCA 5LXGH 1SEQH 2PXYA 5LQBL 1U6AL 3ZZQA 3ORJA 4W81A 5IV2A 1JWUB 2ZKHL 1M56B 3HLAA 1PLCA 3K8LA 4YPJA 5TD4A 4HLJA 4Y5XA 1BPLB 2OPCA 1LMKA 4A7GF 4AIEA 4B96A 1MDTA 4GI8A 1NH6A 3PGFL 3N91A 1ZLWK 4OCRH 1F56A 3LQMA 1MI5D 1NJ9B 4M5YL 4R0LC 3RZCB 5CBAA 3WFEH 1DJXA 1MI5E 1NIAA 1ZK5A 2BY2A 2VITB 3GHPA 4MQ7B 4P57A 4MJIA 1N0XH 5LBVA 3BJ91 1U3NA 3ZE1B 1QSFA 2WCSA 2AV7B 2K9UA 4LVHC 3W9DA 3I50H 5DK2A 2HKAA 2OL3B 2VNCA 5JW5A 3DO3A 3Q3GB 4PBXA 4YDZA 3Q06A 4OV5B 2FJGB 4M6OL 1RZJL 35C8H 3BKMH 3G6JF 1AD9A 4NPYB 4P4KA 5IR1A 2WXRA 3IMTA 4E9TA 1ZSDA 4IEFB 3QFDA 1J5IA 3MZTA 3DUUB 1BZOA 2B0SH 2D7OA 3FAWA 4F20A 1HILB 4XZUA 2IQ9H 5AAPA 4L9LA 4A2HA 2WINB 4JW3A 2ICEA 2DV6A 4YR6A 3D85B 2DQFA 4X8JA 1QTYT 3QW9A 4I0PD 4KK9D 4PLNC 5CR1A 1CGYA 4FQPA 4UT6A 2O4EA 1KTJA 2W91A 4JGUA 5CEZD 4PSRA 1WSST 1A3LL 1JUFB 1QTPA 4A37A 5CEZE 3PXLA 4YGAB 2DLTA 4KY1L 2QVMA 5HGBB 1UZGA 4MMZC 1VFUA 3L4WA 1JP5A 2IG2L 4NQDB 4PJCB 5MERA 1AOHA 4OZHA 3LH2L 5CCHE 3L4ZA 1YAZA 3FONB 3WJJC 1PKOA 3CMOL 2GTWB 2NQ3A 4P5SA 1B90A 3EZ8A 3RZCD 4AE1A 1JDCA 2VDNL 4ZQKA 1SYVB 1BBDH 5F9JB 3QFJB 5LAXA 1ESOA 4LEOB 5L4IA 2CDFA 4ZI8A 2YHGA 2PYEA 4KROC 3GI9H 2FT6A 4QIRA 3GIZL 3PP4L 5DEZA 2MQ0A 4X5WA 3ZE1E 3SDDC 2W65A 2FEDD 3KPSA 2HTKC 4N2CA 5JPMA 2NY7L 2OYMA 3V6ZA 4EMZA 3V95A 3OAWA 5GGUA 4OLXH 3S36X 1YY8B 1YMMA 4HQQL 1S9XB 1TQCB 1Z9PA 1F2XK 1JV2B 2H9GB 4R2GC 2AABL 3ES6B 4FNTA 1MFCH 5HHXH 1CDHA 4XWOD 3D87B 2Q7NA 1E8WA 1IQDB 4UMSA 1VEMA 4AYFB 4S1DD 3GBDA 4PJBB 3A67L 5AVSB 1IQWH 4JPVH 2F1BA 4PU2A 4WHTB 1E9OB 1R9FA 4WO4C 3RFZB 2KH2B 3DIFA 3D85D 4Z7VF 1BM3H 4ZBJA 3TV3L 1X3DA 1LE9A 5HGAA 2EH8H 1UKSA 2BM3A 5CF3A 4DJMA 3FO2B 2OTPA 2NY5H 3FU0A 3U4KA 3RL2B 4YFLF 5TDPB 2N7SA 3QCUL 1VADA 3IEAA 2ZXCA 3RA7L 3EGDA 2FUQA 4NQDD 2Q0ZX 3HAEB 3BQVA 4MAUH 2V8MA 2QVIA 4NQDE 4PJCE 2NNCA 3SE3A 2XQBH 3MLUH 4TLUA 1HZKA 4LFHD 3T0EC 4TNFA 3ULUC 1KOAA 1UD6A 4UT9H 5JOEA 3QULA 4DETA 3QFJD 2GK2A 5EF1A 2WXFA 2DLHA 1E9QB 1PEWA 1Z5YD 5IF0A 3QFJE 2V9QA 5LGYA 2VUKA 4RGOL 3TJHC 3OLDA 1K5NA 3QP3A 5G2NA 2XETA 5EO9B 3SOBH 1NBYA 3DJSA 5D6CA 4N8VB 1VKXB 5LAPA 5DJXA 2FNWA 3U2SB 1HCYA 1RSFA 1BQRA 2X40A 3GKWH 2V0AA 4M3HA 2P5EB 5E2VL 5KSBB 5BS0A 5HGDA 2VDPH 1FL3A 1J86A 4R7LA 2HLFD 3QIUA 5LB1A 4POZC 2LT9A 1FIEA 2C9RA 4PY7A 4GP5B 3GUTA 4EZMA 1CF1A 3VXNA 3T4AA 2PO6C 3REWB 1GJIA 3ZRCC 4U6XA 2CRYA 3QWRD 3L7FB 2BSCA 5CILH 2YAQA 3S3BB 4PJBE 5KVGE 2JIXB 3KPLB 2K6YA 2NTFB 4QTFA 2YA2A 4J3UA 4FYQA 2XX1A 2XX0A 4MB4A 2P4AB 2WIIB 1LL1A 3A21A 3L9RB 3QG6A 4AK1A 4U0RB 1GGIL 2NNRA 4X9IA 2DQGH 2WZPA 1SJHB 4DWHA 5EIIA 4Z8FL 1T0PB 1B4LA 2BOCB 1KEGH 1A6AA 1J8KA 1LD9B 3ULUF 4WGVB 5JW4R 4LHJB 3NCJH 4JM4H 4GYBA 5E99L 4F9LC 1CN4A 3B8SA 4HGWA 2Q76B 4PGEB 4OQTA 1IGYA 5KYXB 2A77L 3CLFL 4YL9A 1UB6A 4HC1L 3ZE0F 2BSTB 1KB5A 2R9HD 1CK0H 5BO1H 3VG0L 4ZSOA 3VGDA 3WIIH 3P73B 2C9VA 3JTSA 1BYPA 2H8PB 1DUYA 3FL7A 3ARUA 1ID5I 1MDAA 2P24A 3AM8C 4U1HB 5DRWB 3P9MB 1QBBA 3PPEA 4UWQB 1NKOA 2QLVB 4YX2H 3LNGA 1AD0A 3WD5L 3FQNB 3U36A 2ZSVA 1VIWA 3NSCA 4EPSA 1NPNA 5C0EA 2WY3B 2P5ED 3VGHA 4UV4L 1WCQA 3EF7A 1XGYH 1B4TA 5KSBE 2P5EE 4EOWL 4PHXA 2OMVA 1UACH 2CNYA 4M1CC 2IPUK 4ATWA 1DVUA 3PCYA 4B6ZA 5EU6A 1UFGA 4EN3B 1KGJA 1MQ8A 3KCWA 2FL5B 3H53A 3COOA 4UM9B 3ML8A 2ERJB 5C2UB 4YH6A 3FB7A 2A6JA 3FUKA 3CVIL 4YHYC 5I8CA 4FOMA 1AJ7H 1SXSA 4DEPB 2JIXD 4QJ4B 2LHAA 4PJ6A 1CD0A 3FJTA 1KJ3H 3D7PA 3K4ZA 4OIBA 1JF1A 4BZYA 2EEAA 2ZWNA 5BW7A 1LWJA 1ITCA 2A73A 5GRJH 4GFTB 4QLWA 4ONOA 3M86A 4PGDA 1X5AA 4FQ1L 1RY7B 5DQ9A 3K91A 1RP8A 1CU4H 4B95C 1UD8A 1JNNL 2DJ4A 2WKGA 3HUJA 1XV8A 3IFLL 3QK0A 3EOAB 5EZLB 3VQLA 3MXWL 5D1XB 3J2PA 4JG0H 1AHWC 3AB0C 5DMIH 5F7AA 2ATAA 3QUXC 3P3TA 2C7UB 3S8WA 2HFEB 2N0MA 1EEZA 2VLMD 4KVPA 1XH3B 4NUGL 3RWIA 3F7YB 5D4JA 5HYQB 3UC2A 3LKSB 3P9LA 2DM2A 1NCWH 2W9DL 3D18B 3SGEI 1I8KA 2C26A 4FMFA 4AM0Q 4G7YL 3B7RL 3KPQA 1CG9B 1NOLA 1M1XB 3LHPL 2AITA 2J8OA 2LE9A 3WS3A 1F6LL 5IZ7A 12E8H 2KQMA 4B7IA 5MEPB 4NQVA 3TBSA 3MJ9L 4KGLA 4MYPA 2M83A 4U1MA 4XC1H 4CMHC 1LJMA 2HT2D 3DSNA 5D1QC 5B8CC 1T3FA 5IIEA 3O8XB 1JFQL 2RIKA 1PG7W 3U4EA 2QMJA 1YNKL 5B38A 1J8RA 2X4UA 4TYUA 2XZQL 1L9TA 3N41F 1LO5B 1JXKA 3MRQB 4EN3D 5A6IA 3PXJA 1UJTA 1XBDA 3D9AL 5CLWA 4L8CB 1XF3A 5IG7B 3RWFA 3SJVA 4UM9D 5C2BL 4ZPTA 3DXAA 4JQVC 2WUCL 4OB5L 3MCLL 3T6XA 2OV0A 5C1MB 3MO1A 4J39A 4LLUB 3ESPA 3WNOA 4IM8A 4R4BB 4ONHB 4XCEA 5H8DA 5TDOA 5AW0B 5D8JL 1VZIA 3EH4B 1LYQA 3OKNB 2Y6SC 4JGJA 3IGFA 1MJUH 4ZT1A 1RUKL 1AHMA 1N70A 3CFCL 3LQZB 4XN7A 2QHRL 3VWKA 3OKMA 2HKHL 4P2YA 2LU7A 4OJDH 1YNLH 3EOTH 3NEEA 1IGIH 1ZE3C 4F93B 4IOSD 1HEJC 4KC3B 5D1XD 1TMCB 3PJSA 4Q2ZA 2Y0SA 5D1XE 1KTRL 3EAKA 3ZO0A 5IHLB 3VFTA 4CJ0A 4XVSL 1F6AA 5EV7A 3G5VB 3B2DC 1RJYA 4HU2A 1DBML 2BMKB 2W5PA 2WTPA 1HQRB 2YK1L 4HIPA 4Y2OB 3THMH 3IDJA 5IB4A 5IEKB 3NH7H 4LSPH 4HWZA 2QQLL 5CNHA 5DWUH 4BBWA 2A9CA 5C9JB 5E5RB 4X83A 1OAYL 4HC1A 4QJ3B 3RWJA 3IFNH 4WO0A 3X1FA 3DSFL 4LOFA 4NM8L 3REVA 1IVLA 2DMGA 1PIGA 2X70A 4I9WE 3H9HB 2HH0L 1SN0A 3T3PB 3MLWL 4YFLI 3DGGB 2A3TA 1E5YA 3DURB 5I0ZA 3O3BB 3G3LA 4HPOL 4KZ0A 3O8XD 2G4GA 3NTCH 1W9XA 2O5XH 4UZUA 5BVJB 5I1JL 1SHWA 3NJNA 3ZHKA 4I8DA 4C83B 1WA0X 2NQDA 5D6DC 3R4DA 1QWHA 3SPCA 4WW1A 4OV6F 2BFVH 3K81A 1JHTA 3S6CA 1B0GB 4L23A 5ERWA 1JRHH 4ODVH 5B7FA 4CC1A 2Y7QB 3C09C 3HBZA 3ESOA 2BO0A 4APXB 2R4RL 4YDJA 4FERA 4S10A 2OBGA 1EH9A 3VGAB 4K9EH 2ICWB 3QI9A 3NSDA 4G6KL 1NOAA 4M5TA 1NQBA 3WNLA 1ZDSA 2YMTA 4I18A 2APVA 4UT6H 5IJKA 3GSUA 2VDQB 3IS1X 1QAWA 1HCVA 4JVWA 4YSTA 3VXRB 4P5TA 2HVJB 4NCC2 1X6LA 1MCOH 2GFBB 2DKSA 1CD9B 1PZAA 2IGFH 4QTHB 4TSCL 3F6IA 1IARB 2IXQB 3F2LA 3P02A 4NN7C 1Y6KR 2WSKA 3WAJA 1IGTA 1PQZB 3VAEA 2OA9A 2YPVL 3RVXD 1XQ4A 3AT0A 1SEBA 3G6DL 4KX8A 3O6FB 5BOJA 5AOMA 3NRFA 4RMVA 2OSLA 2RQEA 2ZNXA 2WLIA 2COVD 2H0JA 3QAQA 5SX4H 3FQUB 3NFNB 3FO9A 4MS6A 3U0TB 3CN0A 4BH8A 5LBGA 3FTVA 4JO2H 3T3PE 1V7NL 1CTNA 2ZJSL 3FOMB 5JW4N 1TJIH 3MJ9A 5JIIA 2HX7A 3A22A 5MEQA 2ZP8A 2ADFH 5CHNB 1UOLA 5F3BB 3PV6B 1XT5A 5K1JA 2YBGA 3I6GA 1IEHA 4OUUB 2V33A 1V55B 4M1GL 3T65B 3IXAB 1I7ZA 1UASA 4M8UA 1MAJA 3LX9A 1QYGH 1QA9B 3ECBA 3PHQA 1P4UA 3LPFA 1WUNT 3LNFA 4U1JA 4E41B 3AQZA 2P8PA 3QDAA 3CWGA 2XVGA 4OZGF 5GHWH 2XVKA 4EI5A 2B15A 4OCYL 1SBSL 4PJFB 2VDRL 3SCMA 4LVEA 3RDTB 1WA1X 2X2JA 4ENEC 3VXRD 2QR0B 2ZOUA 4XOEA 3RYMA 4F24A 3VXRE 4JY4A 1DVTA 4UDUB 2AZUA 1MZYA 3EJZD 1R5VA 5HPMB 3VM7A 1N5YL 1DL7L 5T3ZH 5F1KC 2Z31B 3V52H 2DMBA 3FT0A 5LQBH 2AQ2A 1U6AH 4FHJA 1WBXB 2C3XA 2ZKHH 4NXSA 3LYRA 4PCTA 4Z7UB 5KTEL 1N59A 1E8YA 1JGEA 3V0WL 1UQSA 2G2PA 4L8BB 1B0IA 5ABDE 3IBOA 2ED7A 1TQUA 4WI8A 3PGFH 4RAUA 4LLYB 4QYOB 5EBMA 2KQNA 3GKZA 4M5YH 2YAFA 2D2CC 3VYNA 3GZOA 4TMPA 4B27A 1FFPB 2VZ3A 3W2DL 3VX1A 1HWGB 1YEKL 5F88B 1KIUA 5JOFA 4ZW3A 5JLZA 3L3OB 3M45A 1T0OA 4XP9L 3S36L 2ARJA 3EYSL 1TJMA 5FO8B 4EXKA 3T2NL 4ZXBA 4ZD3L 1DVFD 4G7VL 3VI3B 4ORGB 4BQ8A 1UA6L 1BFSA 4M6OH 1RZJH 2XY2A 1RPUA 4IBSA 4DPAX 2UXVA 4IS6A 1YMHA 3S5YA 1BQSA 3BEVA 1ETJA 2BSEA 4A04A 5T5NF 1VACA 4MDJA 3LD8B 3MLTA 1ODUA 9PCYA 3ZHLA 4E41D 1F58L 3HKFA 1BDYA 4AYDC 4Q6YA 1IU1A 3O6KL 4E41E 3J07A 2WTRA 3E3QE 3M1BA 2ZXWB 2FX9L 3RDTD 3PDGA 3ZZLA 2V5MA 1TZHA 1ZTXL 2WK2A 4PJFE 2WWKT 1A9BB 1PFOA 5ISZD 5F7YC 5HTSA 3VH8B 5EIQA 4U33A 1T5XB 3G04B 3ZQ9A 3E9UA 5EDSA 3JWNH 1BP3B 1OF0A 5CD5D 1A3LH 1U8HA 2HRLA 1KMGA 2D31A 3K4AA 4KY1H 2OMYB 4UQEA 4PTUB 2Z31D 3ULUL 3B7UX 4TQPA 4MNQA 3HI1A 4JKMA 5ESQA 3V5DA 2IG2H 1A7OL 3CQFA 3LH2H 4HUUA 4JJ5A 4MASA 1LO4L 2VISB 3DVIA 4Z7UE 2EE6A 4P59L 3UTQB 2P5WA 2R1YB 3CMOH 2PETA 2VC2B 3K6FA 4RQQA 4P2OA 2VDNH 5CS7A 3HG1B 4HGMA 3TA3B 3R8QA 1KY6A 2HRHA 3L3JB 1ZVYA 2NR6A 1XGZA 4J3TA 3UYPB 3GIZH 3PP4H 3MNDA 4PJBF 2Y7NA 2LOEA 1E42A 5EPMA 3VFUA 1QHOA 2NY7H 1D6VL 3GQFA 5DFTA 1OQXA 3VI3E 3MNMA 4C57C 3RY6A 3OHXC 3OLGA 3P77B 3KWWA 2DQ6A 5TK4A 4HQQH 1U21A 5CFHA 2Z8WC 3IM1A 4AM0B 2AABH 2QVTA 2BP0A 4N9OB 3GT6A 4IKIA 1Z9NA 4UOQA 3KPOB 5DZAA 2ZUTA 3T6VA 3CFDB 5GZNC 1MFMA 1PNDA 3MOAL 1PIFA 4G1MB 2EDXA 3A67H 1MCDA 3WLWC 1M7IA 5I16A 5C08D 3E6FA 5CIPA 5EO0B 3GMNB 2LLGA 5F93C 3TV3H 5DTFA 2A74C 1X5MA 1KCBA 4Z7VA 1CMOA 1Z5LA 2ZXDA 3GS7A 5C0DB 3DX3A 1U8OB 4UU9B 5F9WB 4QD2E 3QA3A 1QR1A 3NYKA 1VZGA 1U9KA 2WGXA 5FECB 4DK6A 1J0IA 1CXFA 3QUML 4Q14A 3QCUH 1LEGB 4HISA 4LVNB 5HDBB 3L1OL 3RA7H 4IBTA 4J5VA 4PGCA 1VFAA 4XPBL 1AOZA 1T6VN 1KPRA 1S8DB 1CBJA 3GGWB 3G9AB 4EUPH 5KSBF 4TPRL 4G7SB 4F92B 5BJTA 4I48A 3UBXI 5K39B 3HG1D 3HNSL 3VFVA 3ECUA 3OJDA 4HJ1A 2HUEA 1CQYA 4ECNA 5JO5A 3L7EB 3TA3D 2HT2C 3HG1E 2PW2B 4AW7A 4B3VA 2BP8B 5K9JL 5ENWA 3FCSB 4RGOH 5FYJD 3NSXA 5CEXA 3GHEL 2Z91A 3PIQB 5FYJE 5HY9B 2XNAA 4MKTA 4CBZA 1MHHB 3UBXG 4AH2A 2PCFA 4YSCA 2JJTA 4LP4A 5A6MA 1X7TA 3E1ZA 2YZ1A 3T1FA 5E2VH 1LO0L 4L0ZA 3D05A 4NZJA 4MD4B 4H0HB 3WU1A 3CVBA 3QBTB 5E6ZA 1QO3B 5CEYB 3QNYA 1FNSL 3HS0A 3QJSB 1TFPA 4DW2L 1QP1A 1ZLWH 4CBPA 1EEYA 2GJZA 3BGAA 4X6BA 5EA0L 4H20L 1YZZA 5CSBA 3S88H 2CKNA 5HYJA 1PZUB 2QVKA 3C6LA 4LF3B 1V8HA 1YN6A 4DZ8A 9CGTA 2Z1KA 4EKXA 1GGIH 3X3FL 5JHDD 5BUPA 4YDVB 4Z8FH 6PAZA 2G5BB 3IMWA 3ZKXC 5EULV 4Z5RB 5DK3A 4JHVA 4X4XB 2GG1A 5HDBE 4BSVB 4YLCA 1J48A 3JWDC 5E99H 4JZOB 3WS6A 5IBUG 2OMXA 5E1AA 2KUTA 4IMLB 3WY2A 4F33A 3C5SB 2A77H 3CLFH 5B39A 4RBPK 4HC1H 2J2ZA 3PLYA 1JMZA 3K2UL 4XNZB 4YDNA 3TVMB 1G6VK 5IMLB 1PDKB 4QRPA 2XTLA 3P0VL 3VG0H 3MUUA 3APFA 3SDXB 2KKQA 2ZXQA 1L9MA 3O8XC 4UQ9A 3GMPB 1CYGA 4RNRA 4HJGB 4NHUA 4JKWA 1JYWA 3EH2A 3KL3A 2V5SA 3OXSA 1S3KL 5IMKA 4DHLA 3WD5H 4DFIA 4N68A 3CH8A 3D3VB 2FX7L 2NY0D 4UV4H 5M95B 4Q4EA 2NY2D 4ZDHA 4EOWH 4I5BA 1YNTB 3GTVA 1QZNA 4HEPA 3J7HA 4N2FA 3EF4A 4OGQC 4R4NC 2YR3A 4YGVA 3BFOA 1G0XA 1K4DB 3GLEA 6PCYA 1F1GA 2FO8A 3QZBA 2AQSA 4HAFA 1KT2B 1FSKC 2TSBA 1D7FA 2Z92A 1W0VB 1G9EA 3CVIH 4N85A 1NCOA 5FUZL 4CDGC 2F9BT 1H9DA 2B7DT 3C8HA 3WKNA 2VLJA 5F97E 5I24A 1BMWA 2WNXA 1ZLDA 3WKML 4N3TA 3SQRA 2X3BA 4Z7OB 2X9XA 4OZFA 2HAZA 1OP5K 2I9LB 1G7HB 4N22A 4FQ1H 5TTRA 4ODWA 1A7RL 3O6ML 4HPYL 4MJJA 1AGEB 3NCEB 3RWEA 1R5IA 1J12A 1JNNH 3IFLH 3MXWH 3KYOA 1DEDA 1JIBA 1JSYA 1SY6A 3QUMA 1R33A 1Z0MA 4L4VB 4A7VA 4F8PA 4XCNB 1DSYA 4NUGH 1G7IB 5F89B 5D93B 4YDLB 3TVMD 2W9DH 2H6PB 2JTYA 5A2LH 2IQAB 4Y5YA 2R8SL 2F53A 2ROYA 4G7YH 4KMLB 1D7CA 4E36A 3LHPH 2DMKA 3E80A 4HCIA 3SDXE 1D5ZA 4WHYH 1EMTL 3DI3B 4FFVD 2OCFD 1UKTA 2ICCA 3H9SA 4JG9A 5DJDA 1OXYA 4X4YA 1OGSA 2OKMA 2GSIB 4MNGA 1ZHLA 2VR6A 1TMQA 2EECA 4ZUWA 3D3VD 4PYGA 1NINA 1JFQH 1LHZA 4M8QA 2Y06L 3D3VE 1A3ZA 1FH5L 2CUHA 1YNKH 1HL9A 1NCTA 1O75A 3ASWA 3KE0A 1DLHB 4PJDA 2VLKA 1K2DB 2XZQH 3KJ4B 5T1MA 4LKXA 3MU3A 2YSSB 3RWCA 4HKBB 3NJXA 3D9AH 1C5BL 2N56A 4RMSA 5C2BH 2VDKL 3FTGB 2WUCH 4OB5H 2SEBA 3MCLH 5KBDA 3OKYA 1N5AA 1QR4A 3ESMA 3S3SA 3LRMA 4N8UA 3VXOB 4XWGL 1A8JH 1L9QA 5D8JH 5JMRA 4Z7NF 1RUKH 1S7QA 1NPUA 4P4RA 5C0NC 2V2XA 3CFCH 3MV7B 2QHRH 2QSQA 2PYFA 2HKHH 4DZBA 4ANWA 4IBQA 1OE2A 3HZYA 1KNOA 3W1ZA 4Z7OE 4ZMZA 3B56A 1U2HA 1AHWA 1ND0B 2YN3A 3I6KA 3HZMA 2XV3A 4TUKL 5B3NA 1S7WB 4FQQA 2O6EA 3RNKA 4M7JH 1I1FB 3T2LA 4NZTL 4RMWA 4E5XG 4URTB 3NSJA 3NZSA 4L4VD 4FNLL 1LO2L 2AJ3B 4XVSH 4YHIA 3LNDA 4L4VE 1JAEA 3BDBA 3BZFB 1DBMH 2YK1H 1HNGA 5B7EA 3U6XS 2OL3L 5A6LA 3ECQA 4PBVC 3LKOB 2XXMB 2QQLH 3N44B 1MY7A 2FWSA 2IALA 1OAYH 3MRLA 3N04A 4IMKA 5A2BA 5EEUA 4WTXA 3DSFH 4NM8H 2AJYL 1SHXA 2OMBA 4OFVA 5LG1A 1X7QB 1MVFA 2JB6A 2XG5A 2HH0H 1DVFC 4RFNC 4ZFGL 4HUKB 3HAEG 3HRZA 3MLWH 3CZUB 4FEIA 3EDFA 5E2UL 3FOLA 4HPOH 3SY0A 3ARQA 2ZQKA 4O2CB 3PG2A 3U30B 1SXBA 3FFDA 4DVBB 3PU7A 4KJYB 5I1JH 1AR1B 4PRAA 3SYOA 2YO3A 4BH7B 1IGJA 1WE5A 4N2LA 4WFED 1T5WB 3EO9L 1AMXA 5E9DA 3CSBA 2DQIL 3K74B 4WFEE 2XA8L 4MKMA 1TZ8A 2MCG1 3P2TA 3TO4B 1BA9A 4DAGL 2W1NA 2CKBL 3L3IB 5JXAL 2R4RH 1MWOA 4KUZL 5FX3A 4G6KH 2Z6FA 4JFTA 4FG4A 1BVOA 4ZS7L 1U2CA 3MV7D 5CD5C 4O02B 3KPMA 3SGEH 1TLMA 1TCRB 3Q0HA 5BZDA 2AAAA 1WLHA 2VRAA 3MV7E 4KKCC 3DKHA 5LUMA 1H9VA 2A83A 3RPIB 4S0HA 2Z31C 2XZAL 3UBXA 1QATA 3HPLB 3GRWL 1QWNA 1HKFA 2N1KA 2H2SD 5FV2A 2CBQA 1USZA 3A4FA 3NJVA 1A9EA 1O6SA 1MI5A 1BV8A 4TSCH 4LSDA 1DBKL 5IB3A 1MLCB 1CLYL 3LZRA 1LWHA 2E4FA 1GOFA 1YEWA 3L9YA 3NZUA 1MH5A 3QYNA 2YPVH 2GYSA 1K8IB 4MD5B 1X44A 1I8UA 5AUMB 3G6DH 5GS1B 1MVUB 3ZRFC 2W07A 2VR4A 4APQC 3W39A 1UEYA 4LLDA 3LMJL 2AS5M 2EIJB 4NUPA 2HLAB 2PN5A 2C3VA 1Y0LA 3BSZA 1W0WB 1XCWA 1V7NH 2ZJSH 3HG0A 4OFPA 4AW4A 3GSWB 4GUPA 3X14A 5T8IA 1D5BA 3GXPA 4GAFB 4EVNB 4WKZB 5ITBL 1AR1D 2E7MA 3DX4A 4YDMA 3ZZSA 2H7WA 4Y2NA 4G43A 1XMEB 1ID2A 3NDZE 4Q0XL 1PX8A 5I5IA 4M1GH 3B5TA 2MQ3A 1LTXA 1T83A 3TO4D 4I0PA 1SXCA 4FXGB 4OIFA 3BQUD 1S7XA 2CDEB 4N2EA 5JMOC 4JREB 5T1LD 3ASOB 1WWCA 4PR5B 2R0KL 1I7TB 3TIDA 2OCCB 4OD2A 3EHBC 4W6WB 2Y36L 4HS8L 2ADJB 4OCYH 1SBSH 1OY3B 2WANA 2VDRH 3B9VA 1JWUA 3ARFB 4XX1E 3UZQB 5KVEE 2WD0A 2XYCA 5D2NC 4TKWA 5TK2A 3ETSA 3AJ7A 1W8EA 2DRUA 3Q13A 5FW8A 2R1XB 1BG9A 1WT5C 3RZCA 1NJ9A 3GHBL 3LSOB 3TURA 1E6JL 2GI7A 1DL7H 1N5YH 2VITA 2F0CA 5MI0C 3QDMB 4MQ7A 4N2HA 1IILE 4QTIL 5I1EL 2F5AL 2XTJB 1DBBL 1EUTA 2NW3B 3L81A 2KPNA 3QVAA 4PV8B 3VI3F 5KTEH 2Y23A 3TPUB 2JVUA 3V0WH 3V7AE 2AV7A 3DARA 5LN4A 2WBKA 4ACPA 1VA9A 3IN2A 2OL3A 4OI8A 3Q3GA 4OV5A 2FJGA 3W2DH 1YEKH 4NPYA 4R84A 1V3KA 3HZ3A 4XRCB 4BCZA 4XP9H 3S36H 3EYSH 4PS4L 3VYPA 5IQ9B 4IEFA 3WHXB 3T2NH 3DUUA 1UZ6E 4ZD3H 5AYQA 4G7VH 4P0DA 3TN0B 1HILA 1UA6H 2WINA 1WFNA 3BVNB 3ESVF 1BD2B 3D85A 3G5WA 5D2LB 5F6IB 1F11B 4FLOA 5ELIA 1I1AC 1S9WB 2VUOA 5LLIC 4XMXA 1F58H 1JUFA 3ETBF 3O6KH 5HGBA 2FVNA 3EBAA 3ZDZB 4N2AA 1ASPA 2O61B 2FX9H 1ULVA 1FBIL 1ZTXH 4IBVA 4NQDA 4PJCA 3ARFD 2EE3A 4BWUA 3F58L 3FONA 4AQ1B 1DQQB 2R2BB 2FGZA 2GTWA 1J9CT 5EHFA 4MZRA 4WLCA 1NGQL 3GRWA 1SYVA 5F9JA 3QFJA 2EIEA 4J3OD 5JPNB 2NMSA 3ULUH 2VR5A 4LEOA 3MKGA 4NQQA 4GG6F 5K9OB 5AALA 3QDME 1HINL 2XTJD 1PY0A 3Q1EA 1EEUA 1A7OH 1AACA 3IFOB 2BVYA 3KM2A 3QXWA 1LO4H 2AJSL 2XTJE 3V4PB 1CURA 4P59H 5HDRA 5GS3A 2P47B 1RH8A 2WIMA 4Z23A 2AQNA 5KVDE 2WSDA 1YY8A 3KHQA 1S9XA 4BINA 4E42B 3SZ6A 1JV2A 2NY0C 2H9GA 3RPBA 1U8QB 3B4NA 3ES6A 4PLKC 2NY2C 4X7SL 1UWXK 1CXLA 2GI0A 1U36A 1IQDA 4AYFA 2XY1A 3F85A 1DN2A 2WOYA 1E30A 1D6VH 1AG6A 4PJBA 3ZDYE 3EBHA 4WHTA 3QWRA 3VU1A 1E9OA 3RFZA 3L5XL 1FIGL 1BD2D 4WI0B 2WWMD 1BD2E 5D2LE 3GI8L 4V11A 1NEPA 4YBHA 2H45A 2EDDA 4EF3A 1WAPA 3AXHA 3FO2A 1R3LB 3MOAH 4FQXD 43C9B 5IHHA 3UIYA 3APNA 2IJ0C 3RL2A 2WQ8A 5TDPA 3GZPA 4FGMA 1ZXQA 3DJZA 3ZDZE 4OZFH 4RWHA 1H5BB 2ICWI 1S7RB 3HAEA 4G8GB 3ZW3A 3FUJA 2K1MA 2AMUA 3E8VA 3JWDL 4KKQA 1HOCB 2A9ML 2VMEA 3QUMH 5EZPA 5L88L 3MRFB 2NXZC 1E9QA 3L1OH 3QORD 4XNZC 3TVMC 3CHPA 4XMUA 3BUQA 5EO9A 4XPBH 4NKMB 4N8VA 4HWBA 1VKXA 1BHGA 1KACB 4URKA 2DY2A 3VRIB 1NFIB 4TPRH 2N7AA 3U2SA 3DDFA 4KK5D 2ZICA 1DHKA 2E56A 4LO9A 4HULB 3HNSH 5KSBA 2P5EA 1IBBA 3SB3A 3FQRB 2VZOA 4OFIA 2WB1A 5K9JH 5DJ6B 4QAWA 3LKQB 2APXA 4HIIB 2ZG1A 5E6IB 3GHEH 4F8NA 2CXKA 5FM8A 5BMFL 3REWA 2D3LA 2VXVL 3MAWA 3ZQXA 2PWDA 3KBHE 2C9PA 4G80B 3L7FA 1LO0H 4KRMB 3RX9A 2JXMB 1ACXA 2JIXA 2WVUA 2NTFA 3KPLA 4H1LB 4Z18A 5LNEA 1AQHA 2IAMB 2X87A 2WIIA 3CFEB 2VMFA 5AFAA 3Q8CA 1IJNA 2L3BA 1FNSH 2J5LC 5DO2D 3VSQA 3L9RA 1MKFA 4HXAL 1SJHA 5T1JA 4DW2H 1QFUL 2YJQA 4CAGA 3O6LL 4HZAA 2WM0A 2BOCA 4XTRD 3GINA 5EA0H 4H20H 4Z7QB 1LD9A 1OHQA 2WQRA 4JHAL 3ZGIA 5EEVA 1I53A 1MHPL 2IGLA 1GW6A 4G8GD 2FK9A 2NSXA 2Q76A 3K7UA 4G8GE 4MJ6B 4TV3A 4WU7B 4PGEA 5KYXA 3CX5K 3MYZA 3X3FH 1ACYL 4X50A 2CGYA 2BSTA 2XKNB 4JFDB 3SDXF 1W0YT 3JYBA 1TEFA 4Q9QL 2QL1A 1IKOP 3P73A 4NENB 2IADB 2VQ1B 2H8PA 4K7PX 4C4KO 3VD5A 1HAUA 4U1HA 1MJ8L 5DRWA 3P9MA 1BW8A 3MROB 3D33A 5BQ7B 2EIZB 1WS8A 3FQNA 3G5YB 4MA8L 2GJRA 3I9AA 3K2UH 3QGVA 4JG1L 4NLHA 2PPCA 3P0VH 1JZFA 1MVYA 3OR7B 1Q0YL 4N2OA 4NQSB 3CX5J 5E6ID 1EXHA 3VXUD 4EN3A 5L4MA 1QPPA 5DWUL 5KVFE 1YJDC 3PWUB 1S3KH 1N68A 5KS9B 2FL5A 1HE7A 4UM9A 1CLVA 5EEYA 1N67A 1NFAA 2PNDA 1FFQA 3FCUB 4CN4A 3C5ZC 3EGSB 2AFNA 3OX8B 3EFFB 2FX7H 4AYSA 3QIBB 1DJGA 2IAMD 4Z7OF 5B22A 1WF5A 3WEMA 3ETBJ 1WAEA 3CXDL 1VLXA 5CGYD 1H8NA 1AH1A 2EKSB 2K3HA 1NGXB 5GS0D 4ZUTB 1RD6A 4YOKA 3FFOA 2VDLB 5FUZH 5TE7L 2Z7ZA 4IOSA 1AP2B 5EZLA 2UVFA 3EOAA 2KHAA 4IW4C 5D1XA 4Z1PA 5C0GB 3JSSA 2B39A 2VDOB 4J2XA 4Z7QE 3L2LA 1ZE3H 3WKMH 2C7UA 2AZAA 2BERA 5D7KD 2HFEA 1XH3A 3CQQA 1PY9A 1Q4NX 3F7YA 4A6YB 5D7KE 4EI6B 5HYQA 3LKSA 3IDMB 4YWGL 1A7RH 3O6MH 4JFDD 4HPYH 3D18A 3T4YB 3NVQA 3F04A 1X9QA 1CDCA 4JFDE 1CG9A 1ZXKA 3KJ6L 1M1XA 2KDGA 2V8LA 3ILEA 5EN2A 1H6UA 1SJEB 5J13B 1BVNP 3UXFA 4MCYB 5IROD 3UMNA 4E9SA 1F3RB 2NUTB 3CDFA 4XMKL 4OIAA 1EX0A 3KD4A 5MEPA 2WZ0A 3AG3B 4WTWA 2J72A 1HX0A 1CFQB 3AWEA 2WQUA 3O8XA 2CR6A 3WDHA 4EXPX 1WFOA 2R8SH 5DR5L 2AQRA 3UAAA 5A3ID 3N42B 5EZIL 3ML9A 4ZO7A 3U30C 2Y7MA 1LO5A 3MRQA 3RX8A 3ZKSD 1EMTH 4L8CA 5DUPL 5IG7A 4B9FA 4I4WB 3Q5YA 5KS9E 4FADA 2JKTM 4LLUA 3DK0A 2ZSWB 4G6AC 4HJEA 2WN2A 4R4BA 4ONHA 4X7EC 4XNYL 2Y06H 3GC3A 1FH5H 2XWXA 3BQUC 3CTTA 3OKNA 3TONA 1I85C 5E00B 3LQZA 4BXVA 5E9NA 4G6FB 5IMMB 1C5BH 3K6OA 4CVZB 1IM3B 4RDBA 2VDKH 1MCRA 4IOFC 5HDWA 4JKNA 5G5DB 1FZMB 1ADQL 1TJHL 4F8QA 4L4JA 5AVVB 4LCCC 4XWGH 2CJUL 3KPRD 4NT6B 1QD0A 5HD8D 4F1SA 1Z3GL 3Q01A 1E3XA 4ANVA 3G5VA 3FUNA 2BMKA 1HQRA 3FT9A 4Y2OA 5FM5O 3LN9A 2Q3ZA 5IEKA 4RDQG 1RUAL 2J3SA 3BCFA 5C9JA 4TUKH 3APCA 2ILLA 4NZTH 1OP9A 1G9MC 3QXTA 3EJUA 3H9HA 2F8OA 4RA0C 2YJLA 1LO2H 3B5GA 1O7SA 4FNLH 1D9KC 1GS8A 3IPFA 1HDMB 3KGUA 1DZ0A 3DGGA 3N3EA 1MNNA 1NEZB 3DURA 3X11B 3O3BA 4ZQTA 2OL3H 1BZEA 4GMTL 1QI3A 5BVJA 3S35L 2FO4B 4NO3B 4ZFQA 3JV5A 1KB3A 2AJYH 4C83A 2ZAIA 3PHSA 1U8LB 4ZFGH 4Y4HB 3T6WA 4U3CA 1B0GA 3WXWL 4HS3B 4Q58C 5GGTL 5ANMB 5ICUA 5E2UH 1KLGB 5EU7C 4GKLA 4B9KC 4JGNA 4M9OA 2QEJA 2Y7QA 3ZGHA 2HT4D 2P45B 1GL4B 1Q9LB 4APXA 5KEZA 2D3JA 4Y2DB 4JPQA 3TNMB 2ICWA 3QJHB 2XXGA 4BFFA 4G70B 1FHNA 3DVFA 4JPSA 4MCNA 4G6FD 3EO9H 4NQED 3FYEB 2DQIH 2HUHA 2J43A 1DVQA 2XA8H 1IM3D 1DJYA 3VXRA 4DAGH 1S7TB 2CKBH 2GUYA 2XACC 3TH2T 2HVJA 4RBPH 5JXAH 2GFBA 3ARFC 1RZ7L 2DL9A 1DN0B 2XG4B 2XKSA 4KUZH 3GBNL 4QTHA 5FO9B 4ZS7H 4Y1AE 4KQ3L 5HDOA 2IXQA 5AZUA 4ZNCD 3FFCB 2C9SA 2JKXA 3TWCL 3MREB 1PQZA 4J3OC 3DO4A 2XZAH 4MSWB 1QBML 3GRWH 3O6FA 3VM5A 2X6UA 2XTJC 3EYFB 3TTYA 1B0RB 2OTWA 2L7EA 5DUJA 5G4MA 3BGFC 2VO5A 5FYJL 1P9MA 1DBKH 1F5WA 3FQUA 3NFNA 1CLYH 1PJWA 3RIKA 3U0TA 1SMDA 3HBQA 1H3WM 5DSCB 2P8LB 2X6VA 3F7QA 2QTEA 3FOMA 5SWZB 4X0NA 3CZGA 4AUYA 5CHNA 1GZHC 2F8XC 3GD1C 1BZQK 4PJ7F 5F3BA 3PV6A 3LMJH 1EZLA 3EYQD 4Y4HD 4I3RL 5I9QB 3DBSA 4NRYB 4DP5X 1AFVL 3BLKA 3B37A 4OUUA 4HALA 4HOWA 2Q86B 3T65A 3IXAA 4PY8I 5ANME 1OP5H 4LPYA 3RJQB 2WWMC 2EDEA 4Y2DD 3U9UB 4E41A 4BZ2A 5ITBH 4MDRA 4BSWB 1ETA1 4Q0XH 4FQXC 4PJFA 1BZ7B 4UQAA 5E7FA 3RDTA 3FU8A 4NDMB 2XBTA 3EBIA 2QR0A 3QEQB 5JOPD 1A8ZA 1QFWI 4IRJB 2XDHA 4UDUA 5JOPE 2EQDA 2UZXB 2BY3A 3TYGL 3B83A 4J3OF 3CFNA 4MDIB 2R0KH 5HPMA 4AQ1C 5C0AD 2Y36H 3GPEA 4HS8H 2Z31A 2CR3A 3T8VA 5GZOD 1LMIA 3FFCE 2WPGA 1I9JL 1INDL 1WBXA 5JPNC 4Z7UA 1P6AB 3D2TA 3QORC 3NIGF 3B34A 4L8BA 5F0MB 3MBEC 4LPUA 3ROLB 2WXQA 4LLYA 4QYOA 3UTZB 2OMUB 3GHBH 2F7RA 5HI3D 1E6JH 4JFFB 1SQ2N 3QEGL 1FFPA 1SM3H 5E56A 3VGFA 4O5LL 5F88A 4F1ZA 4J28A 4Y7OC 4GB9A 2P80A 1WD8A 3L3OA 4QTIH 3SKOB 1RZQA 5I1EH 2F5AH 1DBBH 5SWZD 5FO8A 5SWZE 3DGCR 1PTZA 1PVHA 3VI3A 4LSUL 1HSAB 4ORGA 3WTUA 3CUPB 1TZOA 4TM9A 1EAJA 3WY3A 3TZVB 4GINA 1KENL 2XKUA 2P42B 1TYEB 1DQDL 3LXCA 4XMPL 2AEPH 4ZTPL 3US0A 1R3KB 4PS4H 3UGXA 4PMEA 4K55A 1HYRC 2JJWA 1WFJA 4A55A 3MCKB 1MW3A 4L8SC 5IVXB 5BV7C 1CGTA 2C5DC 4YHKL 4N86A 3LVTA 1A9BA 3QEQD 3R0MA 1OAZL 4DUWA 3VH8A 3UTSB 2HRGA 3QEQE 4IRJD 5TF1L 1T5XA 3G04A 2IH8A 1BAGA 1BZDA 3S34L 5C07B 1ET8A 2CR0A 1AXSB 1E7UA 2OMYA 4PTUA 3FT1A 4OCSL 4ZYKB 3RVVD 1FBIH 3CXHK 2OYPA 2X4TB 3OAZH 4DSYA 1RZGB 3OV6A 3F58H 2VISA 1WT5A 5DHDA 1S7VB 4JVPA 1MFBL 3EJYD 1LE5B 4WY7L 3UTQA 2R1YA 1FO0H 3UPRB 1RERA 1NGQH 4ZMYA 2YQGA 4JFFD 4MA1C 2ZG3A 3HG1A 3AY2A 2APWA 2GEQA 5FYKD 4JFFE 3TA3A 4C4UA 4RLDA 4WFFD 4LB8A 3L3JA 5FYKE 5PCYA 1HINH 5FS5A 3ZKNC 4WFFE 3UYPA 4XVUC 5IVOA 2AJSH 4XAWL 3O4OB 2K45A 1OW0C 1IEAB 4ODXB 3VFRB 3JT2A 3MRMB 3OG6B 3CXHJ 3ARGC 3CU1A 1F97A 4FLRA 4L9DA 4YN3A 3TZVD 2ZOTA 4Y2LA 3SYQA 3P77A 1QFWL 3EGXB 4XMWA 3D4ZA 2RHEA 1AMYA 1SMOA 4OLYL 3CX2A 4AM0A 2YOAA 3OKKB 2ODIA 2YAPA 3ROOB 3KPOA 2L8AA 5DEJA 3CFDA 1DQVA 4FZ8L 1FC1A 2OMNA 3WGVB 3C2SA 2JKRM 4G1MA 4PRHB 4B5ZA 4ELMF 5I23A 2NY3C 3QDGB 2F58L 5IVXE 3U0WL 5CGYC 1C12B 4UYQA 4QCIB 3L5XH 1FIGH 1KIQB 4YZWA 5EO0A 5J57B 3GMNA 4BRJA 3P3RA 3QHTC 3UTSD 2ZUXA 3GI8H 4ANKA 4K5PA 1JZ5A 5C0DA 3UTSE 1U8OA 3GNML 4UU9A 2E27L 3UDWC 4PJXF 1NC4B 2H5UA 5C07D 5FECA 1KEML 5DUBB 4TQ8A 4DKAA 2P44B 1W6LA 2F6AA 3LZLA 5C07E 1LEGA 1M57B 3T0WA 5AD0A 4NWUL 2Q3XA 3DV6B 3KVPA 1O9VA 1MCEA 3RGVB 3MUGB 4MMXC 1EJ6A 4LDEB 3TJEL 3CLEL 4UMGA 2JLPA 1S8DA 3QO1B 4LCUB 3GGWA 1IE5A 4K7PL 3JWDH 5F2FA 3QJVB 2A9MH 4Z3IA 5K39A 4Z7AA 1P1VA 3NPZB 1PSKL 5L88H 5E5MB 3L7EA 2PW2A 3RY5A 1ZANL 2AI0L 2BP8A 3SE4A 3OD3A 3FCSA 4MJHA 4OFYD 5D7EA 3WY4A 4CGTA 3RGHA 1EUUA 3PIQA 5HY9A 1A0QL 4LASL 1MHHA 3DI2B 3B8YA 1QEWB 5E0FA 4PGJA 3NFSL 2VM4A 1DQKA 4GH7B 5I71C 3OSKA 2EXSA 5GQBA 5B1JA 4MD4A 1NLDL 2R15A 2GB2A 5DD3L 3FSVA 1J88A 1QBAA 4AI7A 1NICA 4W70A 2X1QA 2YA1A 5IWLC 5CEYA 1QO3A 1X4YA 5BMFH 3KL0A 4WRLA 3MFGB 1AKJB 1WFIA 3SDCB 1CCZA 4HZ1A 3T9WA 3V6OE 1IAKB 2GJ6B 2VXVH 4PRHD 1R46A 2NT0A 1I1CA 1WIOA 4PRHE 4Z3EA 3QDGE 2X6CA 3TO2B 1NC2B 4F58L 3N2JA 4LF3A 3F7LA 5LNDA 4CW1B 3AMLA 5HD8C 2XT1B 4HEME 1KBPA 1NC4D 4HXAH 3UO1L 4YDVA 5D55A 1QFUH 3MV8B 3O6LH 4PREB 3WN5B 2G5BA 3ARXA 3X13B 2Z35B 3V0EA 3TH3T 4Z5RA 1AC0A 3NN8B 4X4XA 4CSTA 4JHAH 4BSVA 4R7NB 1MHPH 3IU4L 4ZW5A 2NRDA 4JZOA 3VTTA 1CR9L 3CHXA 1J9SA 5B4MC 1T0MB 2IC2A 4IMLA 2F1AA 3MV01 3C5SA 1ACYH 1ZCRA 3H3BC 5CN1A 3TVMA 5IY5B 2DEYX 5IMLA 4WAFA 3P0GB 4Q9QH 1L9SA 1F86A 1PDKA 3LZQA 3H0TB 3MUHL 3SDXA 2OI9B 5D70L 2QSTA 4RISL 3GMPA 4HJGA 2FR4B 4NZ8A 4H4NA 1XZ0B 5FGBC 1T21B 3HLKA 1LQBC 1KGYE 1MJ8H 4Y9CA 3ISRA 2E6QA 4WSKA 2FDBP 4MA8H 4JG1H 3D3VA 2HXAA 2WZ5A 2MTPA 4PAZA 1Q0YH 1F45A 1YNTA 5D1ZB 1EO5A 1K4DA 3VXSB 5JDJA 3MJ8B 2Z8SA 1AKJD 3SDCD 3TEUA 1KT2A 4A1RA 3CFQA 2GJ6D 4MRBA 1W0VA 2VXTL 5DJ2B 1VDGA 2XPYA 2GJ6E 3RU8L 4LKCB 2XHNA 1NCNA 3IT8D 1NC2D 2X09A 3ARTA 2XWTB 3ISYA 5H94B 1JGLL 1SDYA 4F37F 2PP9A 2I9LA 3CXDH 1G7HA 1F02I 1TNNA 3LS4L 3A23A 4NKDB 3MV8D 1AGEA 2ZKXA 1A21A 5TE7H 2O5NA 3IE9A 3MV8E 1JJUA 2P48B 3RTQD 3MI6A 3FQTB 3OL2A 1HXKA 5F70A 1YEFL 2KC0A 4PCSA 4L4VA 3BLPX 4XCNA 4ZFFB 1M2VB 4ZMXA 1G9ML 4PD4K 2WKOF 1UWXH 1G7IA 5F89A 4YWGH 2H6PA 2IQAA 4XBGB 2XWZA 2UZYB 3QQDB 3O0LA 3KJ6H 2FQFA 4X6CB 3BI9X 4DF9A 1L7IL 1NZRA 1RAMA 3K8KA 4HV8B 1XHHA 4XMKH 2B77A 4Z76B 4E9VA 3C60C 3ZKMD 5E1QA 2GSIA 43CAB 2M26A 1UVQB 4WQOA 4UIKL 3RVUD 2NY6C 4FFWD 3RWHB 1GOHA 5DR5H 2EVGA 2XQYG 3VFWB 4PH8A 1J1OL 1DLHA 4RRPG 5EZIH 1K2DA 3ZTCC 1K3IA 4IKNA 3MA7B 5D1ZD 5LCVL 2Q8AL 2BWIA 3VXSD 1DFBL 1YA5A 2YSSA 2HP4A 2X12A 4HKBA 1H0DB 3VXSE 5DUPH 4WEBL 4QPEA 3FTGA 5SWQB 2A6IB 4QXTB 4Q97A 2XFGB 5F3FA 3VXOA 5HXMA 3GF8A 4OJFL 4R97C 1FH2A 4XNYH 1IGML 1ZVNA 1KF9B 2WLMA 4PMFA 4POUB 3CVDA 3IJ9A 1MCBA 2DW5A 3MV7A 4BFOA 3OQRA 2CIIB 4OD3L 4TUOB 1ADQH 1TJHH 4PV1C 5HDQL 1ND0A 4WNQB 5CBEB 3WELA 4DESA 4DK3A 3CZKA 2BVOB 4EEEA 1S7WA 2CJUH 1I1FA 5FFOA 3QXAB 4NN6C 4FCHA 3E7JA 2W8CA 1Z3GH 1RZFL 3AS1A 4NPKA 2AJ3A 1JNLL 1AZRA 1BFVL 2DKUA 2R7EB 4R6UA 1DSWA 3BZFA 4MLSA 4M62L 1GYCA 3UADA 3SYPA 1BOYA 1W15A 3LKOA 1RUAH 3OHMB 3F84A 4KXAA 2CD0A 2WLKA 3B9DA 4ADJA 1X7QA 4X6CE 3K80A 4KXCA 1N18A 3FTWA 1FC2D 2FB4L 4WV1B 4BFKA 1XIWB 4IU3B 4BFGA 2WJ7A 4GMTH 2X4QB 1GGTA 2G2NA 4L4TB 4O2CA 4R5TA 2YRLA 4ALAC 4DVBA 3S35H 4WW2B 3VXMB 4KJYA 3OAYK 1HS6A 4N5EC 5LJYH 4AZUA 3B2XA 5CN3A 5DO8A 2YFNA 3UAJD 3V0AC 4BH7A 1T5WA 4QHNB 5JW3L 1PZCA 3WXWH 5GGTH 1CDBA 1XAKA 4QR7A 2CRZA 4X5QA 3TO4A 3T0VA 3L3IA 3EJQA 4MNHB 1ET7A 4X6DB 3O9WB 4KZDL 2NYZA 4J3WA 1IM9B 1YUKB 4IRJC 3KYAA 2IBZY 1KCSL 1NWOA 1QW9A 5CCKL 2Q8BL 1XAUA 1OAKL 2XJKA 1NGYB 2ESVB 1TCRA 4O02A 1QVOB 1IC0A 3QHFL 5DJ0B 3R1GL 2WYTA 3RPIA 2Y2TA 4H26A 3HPLA 2IF7A 1L3NA 1RZ7H 5FW6A 2P43B 3GBNH 2OJZL 2G3ZA 3NRQA 4UB0L 2AF2A 1MLCA 4KQ3H 1QLRB 4ODUB 5J7CC 3D52A 3TNNB 3TWCH 3K0WA 3AY4A 3V4PL 3BYTA 4K5LA 2BZ7A 5FB8B 3U25A 4NBYB 5A2IH 1M53A 1K8IA 1QBMH 4MD5A 5AUMA 5GS1A 1MVUA 5DZPA 1OV8A 3MJWA 3V9EA 1FF5A 4H8UA 3QJTB 4XXCC 5FYJH 5F7DB 4XO9A 1Q72L 2HLAA 1IAOB 5CINL 3TZVC 4E9YA 1W0WA 1XIWD 2EYRB 4F37K 4DT2A 3GSWA 2WW8A 4L4TD 4EVNA 4WKZA 3DHPA 4L4TE 4S2SB 3VXME 3LPWA 4BFRA 4HJUA 5EN3A 1H3XA 4PI2A 3WFCL 2HMID 4I3RH 4XOAA 5AKTA 1AFVH 1IFHL 1I1YB 3FSOA 1QMUA 5DCCA 5LCVA 5BV7L 5L9DL 3D39B 2A9AA 3PE9A 4FXGA 3ET9F 2CDEA 3CSGA 2EXYC 4EN2A 3O9WD 3F7VB 1NIBA 4XHJD 2AQ3A 3FCTB 4X6DE 1QNIA 4PR5A 1Q9KB 1I7TA 5I6MA 5DHEA 2YS4A 4JO5A 2ADJA 3CZEA 2ESVD 3V79C 1FG9C 3STZB 1U42A 2YRZA 2X3AA 2ESVE 1JNJA 4KRPC 1ROCA 1SPDA 3ARFA 3NMEA 3UZQA 2YPKB 5E6SB 4KQ0A 1ZD6A 5FCUL 2ZYHA 1OP3K 3PWJB 3Q6FB 1KIPB 4OTXL 2R1XA 5DA0B 3TYGH 1T4KB 3LSOA 1DFXA 5F8RC 2GAZB 5FUCE 1OVZA 3IDNB 5DS8B 3QDMA 3BVUA 4J2QA 1VRSA 1BQUA 1INDH 1I9JH 2J73A 3DPDA 2NW3A 4PV8A 3TPUA 5CM1A 4M93B 2JJSC 1YG9A 2X53A 2DJMA 2ALAA 3FQXB 4FQIL 4YS4A 4G8AC 3QEGH 4FFYA 4O5LH 1XFPA 2Y7OA 4MA7L 3MLXL 2X41A 5FGCB 3FO0L 1UD2A 2B20A 3N6YA 3QQ4B 4XRCA 5C97A 2F74B 5IQ9A 1DCLA 3WHXA 1MIML 4ZX6A 1YYML 4LSUH 1QACA 3TN0A 4PRNB 4KOBA 2ENPA 4CDHA 3IGLA 5LGHL 4LHUB 2VH5L 1KENH 2ETWA 1MFVA 3BVNA 3WKYA 2O93L 1BD2A 4MS8D 1DQDH 4XMPH 5LWYL 2A6KB 5D2LA 1F11A 4ZTPH 1UURA 4MB3A 4PGZA 4PEEA 5I66B 4P23B 4ZMLA 1QI4A 4AEEA 3LRLA 3D39E 1WHOA 3KYMB 3LCYA 3NEOA 4Z95L 4HSQA 1QHQA 1S9WA 4G6ML 5AW1B 4CC4A 4NO2B 5JR1L 1KYOK 2IH3B 1TYRA 3EDDA 4Q6IB 2O61A 4YHKH 1ZA3B 5KZCB 5GRZA 2KZWA 4JO8A 5DD6B 3QYCA 4HETA 1OAZH 4X7TB 1T7WA 1P5UB 4G8FB 2HX8A 2J55A 4L2LA 5J1AB 1ZAGA 5TF1H 1CGUA 3FF8A 3AADB 3UZEC 4AQ1A 4ZG1A 1DQQA 2DQMA 2R2BA 3DDGA 4PJ8B 3S34H 3KH4A 1Z9MA 3UIZA 2XQYA 3ABKB 4XPTL 4RRPA 5JPNA 4OCSH 3UL4A 4HOXA 2QHLA 5K9OA 5GRVK 1MCQA 5FWRA 5AG9A 3IFOA 1BQLL 2GSMB 4MFHA 3TBYB 4TS6A 1HNFA 2DM7A 1KYOJ 1MFBH 3II1A 3UTPD 1CTOA 4F