2M83A

Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of protein phosphatase-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
139
structure length
139
Chain Sequence
GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for Protein Phosphatase-1 regulation by the muscle glycogen-targeting subunit GM
rcsb
source organism Oryctolagus cuniculus
molecule tags Hydrolase
molecule keywords Protein phosphatase 1 regulatory subunit 3A
total genus 24
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2m83A00
2DJMA 4BFNA 4EIBA 2VQ4A 2V8LA 4BFOA 2M83A 2EEFA 2V8MA
chains in the Genus database with same CATH superfamily
3ISWA 4FE9A 4PJXE 4QRFA 3B5HA 4HGKC 4TUKL 3O81A 4CC1A 3BKCL 5T3XD 4JFVA 2NZIA 4B7LA 2GBUA 4P59L 4ODTH 3ASWA 3VSUA 1FYTE 1XR9B 2DRUA 3ZYOA 2Z0BA 5HSFA 4OM1L 1U8HB 3BP4A 1HXYB 1HNGA 5G4OA 2KYIA 2W9EL 2PCYA 2H3KA 2H0FA 4Z3JA 5IUSA 1NGWA 1A7PH 1R3IL 3H3PH 3S88L 2YXVA 4GRWB 4YGVA 1KLUA 4PCKA 5IGXH 2CA4A 1P7QB 3MREA 1ZTXE 5CBEB 2YGQA 2WQUA 3EYFB 1XEUA 3Q2LA 4MRCA 5JDSA 5ADPH 4EI6B 2VXQL 4MB1A 1IC5L 3CC5A 3M1CA 2AZAA 1I7TB 4GUOA 4GKZB 2CJUH 2GJ6B 3PJNA 2IQAB 4IJTA 4XT1C 4KXDA 4JFXB 1XBDA 3BPOC 2B2XL 4GT7A 1EXHA 1XL4A 2QADB 3GKWL 4N2MA 1EHAA 3NZSA 1GRWA 1A22B 1IJNA 4FG6C 3V7AG 4NO2B 3VFPA 3U1QA 3BP7A 1K4CB 1AGCB 1RUKH 4KPHH 1JV2A 4MMXB 4F20A 3OWEA 3CBJB 5D96B 5EBLB 1LE5A 5IFJB 1ZA6B 1PZ3A 4NNPL 3UPRA 1CR9H 4FA6A 4X4KA 4PJ9C 3D85A 5GJSH 4O2CB 3OLDA 4QRRB 2P4AB 3ARRA 4OGZA 2ZF9A 3B56A 4PLOB 3T0XA 4NKIL 3MBXH 3GO1H 5A3IC 2B39A 2CO4A 2XPYA 5EN3A 1DR9A 3OKMA 3VXMA 3WNPA 1SXNA 2VQ1A 5FUCE 4B97A 2AJUH 4K7PH 1OTUD 2EECA 3ABZA 3LIUA 2X70B 3AQXA 3HRPA 1MXGA 3HUJF 4PJBF 5DJ8B 3ULVL 1ID2A 1MJ7L 2W0LA 5T3ZL 3CQQA 2Z7YA 4BHUA 4ZXBC 4FXGC 3FS9A 4JFYB 4YX2H 4DTGL 3TO2A 3GXDA 5MEOA 4MD0A 5L2KD 3DVGA 1UD4A 1UWYA 3GK8H 1IBZA 4NKDA 2XWTA 4P2OA 4K73A 1ERNA 1I8KA 3CLWA 4LGRB 3K4AA 5GPRA 3TBYA 4EPSA 5C9JA 4X9FA 1J0YA 5C70A 1QG3A 1G9MC 3DGCR 1VADA 5EUOB 2FK9A 4Z7QF 3SKNA 4TSAL 3FB5B 1SLVA 5JMRA 1ZDSA 3OB0K 1U3NA 2QQNL 1ZA3B 2W80C 3D0VB 5FB8B 1INQA 2WO2B 1ACXA 2DYSB 3RWDB 4TSBL 3IDXH 4GBXB 3QI9A 2ZD0A 3V4PH 1NAML 1ZWIB 1NGQH 4ALAL 4R90H 4U49A 2CM6A 2DAVA 4J3OC 4N5EC 1F3JA 1PY9A 2DY2A 1MH5A 3NCJH 1OLZA 5TDNB 3VVVA 4HUCA 2HX7A 3JV5A 4IOIA 4G80B 2CAKA 1XGTB 4K2UL 4UQAA 4ERSL 4HG4J 2WAQA 4MX7A 3WENA 2O5XH 4W6YB 3UTTB 1AP2A 1KTJA 1T03L 2ZNXA 4HHGA 1GGBL 2OCFD 2QVMA 3DPDA 3QJFA 1G6VK 6CGTA 2F9BT 4UI2A 5I26A 5BVPH 2FDBP 2V5RA 2FNWA 4LPTA 4W6XB 3OXRA 1DJZA 1SYSA 3V6ZB 4IGBC 2VDKL 4JG0H 3KGUA 3FFDB 3L7EA 1U4FA 1JZ5A 3BUQA 3FTSA 5D4JA 3BQUC 5IVXF 2WVVA 2ZXDA 4P3DA 3F00A 3AS3A 3EJYD 1CXLA 3IN2A 1KV3A 2EEXA 5ISZE 1XVSA 4YR6B 4RESB 3AXLA 2HRLA 3RZCB 3W0WE 5F0JB 1AR1D 3OKEB 3IJSB 4JQVC 5B4MC 3DETC 5A2BA 3EH5B 2X1OA 1KCSH 5FA4A 5ANHA 3MCKA 5FO7A 1ILSA 1B2WH 1JF5A 1YEHL 5DZNA 1S9VA 4M02A 1LILA 1TZHB 4ZAKD 5I30H 1ZOXA 2PPDA 2X87A 4Y1AD 2Z31C 4NZRL 1BPVA 3N41B 4K3EH 4OD2A 4WU7A 4L4TE 3LVEA 2XKUA 1GAFH 3N42B 2W65A 3QQDA 4K94C 5FYKE 3Q6FA 3TZVA 5K9KA 5FYJU 1CGTA 3EKCA 4Z7NF 5E8NB 5BRZE 1U95A 4P2RD 4NPYA 1PKQA 3QXWA 3BVWA 4CVZA 4XPBL 5JLZB 3SJVD 3Q3GB 1GZQA 3ZDZF 6FABH 4LGSB 4O2EB 4WWKC 2DQTL 4AEHL 5LJYH 5EORL 2OSLA 1CLOH 4JN2B 1LDPL 1RLBA 3GRGA 5BQDA 1NFDB 2RBLA 2XPGB 1XF1A 2OW6A 2YQBA 5F0MB 2CIKB 2VXSH 1MF2L 3KLHD 2D3NA 3IJYB 3GRWH 2VDQL 4U1IA 4P4KB 4D0BB 3UJIL 3SGEH 2HXAA 3GLZA 2YPVH 3PV7A 1F4HA 3VFSB 2ZE0A 2ENSA 4YE0A 4LLDA 3KBFA 4PJCB 4XXCA 1A5FL 1NCWH 4PJDE 1BDYA 1Z1WA 4L0ZA 1XAUA 3SDXF 3H9YA 1MIMH 3JZ7A 3H3PL 1GHFL 3TX4A 3WXWL 3S88H 2E75C 1IGMH 1MWAL 3C6EA 3KCPA 3VG0H 4XXWA 3FW6A 5C09B 1CICB 2W9EH 5I6LA 4W68A 1N19A 3MRNB 1FQ9C 1UA7A 4YK4C 3VQMA 2XIBA 3QIWD 5AL8A 2J25A 2NQ3A 1DJWA 1HKFA 3NJVA 5AW1B 1NBQA 3IKCB 2DS4A 3RGBA 2Y06L 1U8IB 2PO6B 2YXFA 3V6OA 4XAKD 3H53A 4ZMPA 3ABGA 2G5BB 1WIUA 1WG3A 3MRGA 1S3KH 1OPOA 3QWRD 5A6MA 4IDLA 1A7OL 3IJ8A 5IT2H 1Z9SA 2HB0A 2BIMA 3P11H 3IDJA 4H26A 2HT2C 4IRJD 3S34L 1HI6A 3EJRA 4ZFFB 2ATAA 3MNVB 1LNUB 2P5WB 4KKCC 2R0LH 5C0IB 1G4MA 1PD6A 3X1GA 3UTTE 2X7LA 3D39B 4NQCA 3Q7JA 3DK2A 1H8NA 2OL3H 4FRWA 3BWSA 3NSFA 4HUNB 4FNPA 4FCHA 3VXQA 3D07A 5I9QC 2VDMH 4XNXH 1R3JA 2X9WA 1MCKA 2JKRM 5HI5D 1C7TA 3FFDA 1IJ9A 4HJUA 2H45A 3OQRA 2XZCL 3SDXE 1QPKA 3BFWA 1L9OA 1J9QA 1LO2H 2VXVL 5HI3D 4UT6H 5I1GH 2CDGA 2YO3A 3S8FB 5FHBL 3Q2WA 3MLWL 2X6CA 3CXDH 4XO9A 5EF1A 4KNUA 5HI5C 5FLVA 1BA9A 1BLNA 4TOYL 4UIKL 2XN9B 4OLWH 4ZMLA 3L6FA 4UM8B 4N0FB 3C09B 3QI9C 1ORSA 1KTDB 4RGMC 1BFVH 5I18H 4MNGA 3I6KB 2E3VA 3CFJA 4NUJA 2CWRA 3QXDB 3MCKB 5IMMB 2EICA 4OH2A 2CJSA 1QRNA 3MOBH 4LQ1A 4AE1A 4MJIB 5D7IA 2X89D 1FFQA 3ZE1F 4CDGC 1XZ0A 4LLWB 3QAZC 1LP9A 4GAFB 3SGKA 3CPLA 1QLEL 2Z34A 3E7JA 1UFGA 5JXAH 5E00B 4M1DL 4EIUA 5TF0A 3VGHA 5E8DH 3WTXA 3LKOB 2IEPA 1T5WB 2E9GA 5CHNA 2DWTA 4TQEL 5E1AA 3V2AR 3HR5B 3SKMB 2ZPKL 1CDYA 4AWJC 3VB9A 1J5CA 1BVKB 5DFVD 5CWSA 2HKHL 3DSFL 3X17A 5DMYA 2Y7OA 4XH2A 1PLAA 4ZPTB 2I5YH 4EQ2A 5CMAB 2FD6L 5DD5L 1P69B 1U3HB 4BUHA 5EU6B 3UJTH 2WUBL 1QQDB 3HZVB 4Y2DA 1DQLL 3G5YB 3ZDXF 5DD5H 1BD2A 3LIZH 3MLVL 1JFHA 4LRNH 3RA7H 3SDCA 1BZ8A 4UF7C 2DZEA 4OFKA 3A4FA 2XNAA 5B38B 2GK0B 3VNYA 2L04A 2RFXA 4ZSOA 3V5KA 4NOBA 1OCWH 3IDIB 4KI1A 2AQNA 2UZIH 4LVNC 1MCPH 3KH3A 2UX7A 2HKFL 5DUML 3LNIA 1Q0XL 2PW2B 1UCBL 1MIEL 1X5FA 1QSEE 2YOCA 4HT1H 4XHJC 4XZUA 2L7JA 4F15B 1NCUA 2NLJB 1I82A 1FP5A 4ZDHB 3LRMA 4PJXF 3WKMH 3HB3D 1AXTL 15C8L 4IYKA 4MQXD 2Z4QB 4RBPH 5LCVL 1QZ1A 5FX3A 1JNNH 5AOKA 1UZ6E 4PJGE 3V6FA 1T22B 3NRFA 2NMSA 4OVVA 4Z95L 1IEAB 1RJYA 2Z35A 3KPPB 1OSPH 4KH2A 4ZG1A 4Q56A 2XWTB 2R2BA 5GS2D 5JIKA 1DDHA 1OAYL 3FU9A 4JFED 3SE4A 4CVXA 4NWTH 4HPYH 1P6WA 1X6LA 3D7PA 3OF6A 2A6KA 2X38A 3HC3L 3B7YA 3MKGA 32C2A 3EFOB 4UZUA 1SFHA 2VKXA 3P3SA 3MRLB 5DFAA 4LVOB 3EYFA 1FN4B 3N44B 3CDZB 3W0WB 4F2EA 2DQTH 2XPZA 2Q7YA 5CU9A 1IGTB 4NKQB 2UYLB 5IBUG 1S8DA 1FF5A 5KAQF 2F7RA 1AOZA 1WD9A 2FT6A 4YBHA 3WDJA 4JPWL 4OD3H 4F1ZA 2B4CH 4HWBH 4QRQB 1UQSA 4PJAF 1NL0H 4BFEA 4KY1L 2AJZB 3BT0A 1W8NA 2B4CL 2F19L 5KSUA 4G9DA 3BVDB 3DO3A 1GZHA 2AITA 2K4AA 1RZJC 3G6JB 4NC1E 3DX2A 3DX1A 4CN4A 1AGCA 1NCCH 5L2JB 2Z92B 1J0JA 2CALA 3QK0A 5GGQH 3QFDA 2DQUH 1URZA 5K39B 3KM2A 2VW6A 3AAZA 2VRQA 5HVHC 2Q3XA 4GAAA 5KYYB 4O2CA 4M8QA 5L88H 2MHAB 4L9DA 4NQVB 2HCZX 1TQCC 4ANKA 3L5WA 1WH0A 1NMCC 1RERA 3P0GB 1T5XB 4MBRA 3ZL4L 4XWOD 1V8HA 3BH8B 1OSZB 3MRCA 4DQOL 4G7QB 4MASA 1P1ZB 3TCXA 4L4TD 4QRSB 4UU9A 1GW6A 1U8LA 2OMZB 2VLKB 1G7MA 3NDYE 5GZOA 3GSNA 1LEKA 2VAAB 3HG5A 2N7AA 3SO3B 4P4KC 1KXHA 4G59C 4FQLL 5D8JL 2OZNA 5I82A 3VD0A 4NM4H 2ADFH 2FATH 4JFDD 4YR6A 2HX8A 2IH8A 1GJWA 2ZSVB 3TN0A 3O6LH 4ZTPL 4Q9RL 1AO7A 1U6AH 3AG3B 3DSNB 5F7WC 3UZQB 2F8OA 1YEGL 3L3IA 3U2SB 3GMLB 3MRQA 5AKSA 3WNNA 1OE3A 3UAJA 4QF1A 2ICWJ 2VYRE 3OGCB 5I1EH 4H8WC 3FOMA 3SDXA 1G6RH 2PMZA 2HPOA 3QXVA 4GB9A 3AXLB 4NCC1 4BIKA 4MD5B 5IROA 4PYGA 3OKEA 1F4XL 2BNQB 4PJDA 2H0EA 3KVQA 1SLUA 3IU4L 1BX2B 4G42B 2VM3A 1N0XH 3PGDB 4N3TA 4PJBB 4XOEA 5B3SB 2ZUYA 4XB8A 4PRPE 1OLLA 5AUMA 1MFVA 5FHAH 3JYCA 4XWGL 3MUJA 3VD5A 5HGAB 4KO7A 4OV6F 5E7FA 1HHHB 4FXTA 2DQIH 2NXZC 4NUGL 1UH4A 1L7TL 3QDJE 5DC0A 4GG8A 1AO7D 2W65B 2GJ6E 2JKSA 3C08L 3IJ9A 4NBYB 4XBGA 1DE4A 3LQZB 3FNKA 2CH8A 1O7DC 4A37A 3DURB 1JK8B 2LVCA 1C08B 4X4XA 4JCMA 4KQ4L 5KVGE 2ICWA 2MNUA 2K70A 2QVKA 2MOGA 4LBEB 4Z7VA 2FR4B 2J4WL 3H4HA 3B8YA 3T3MF 2DTMH 4M56A 4D9QD 1SGKA 1KCBA 3T6XA 2EKSA 3TESA 4M1DH 2CA3A 1Y18A 4O2FA 4QHKI 4AZ8A 4EVNB 1R19A 3OHXB 3VFUB 3T8XB 4OIIL 1EANA 1QKZH 3FUIA 3F64A 2EABA 3WO3B 3LEVL 1MVUB 5GRYA 5HD8C 4OIIH 4OR1A 3QR1A 1F6LL 2EDDA 3MRDA 1RUPL 1A6VH 1HSAB 2I26N 4GKSB 3R7QA 3W0WA 3ZY7A 2Q7YB 3QQNA 3EO0B 4RMTA 3KPQB 1IAIM 4YO0A 3Q8BA 2WZ5A 2ADGB 4JN1H 4ZBJA 1OF2B 3QUHA 3LXAA 2K6WA 2V5MA 2VXVH 4UANA 4DO5A 4GSRA 1CBJA 2VLKE 3OXSA 4FLHA 4K9EL 4HWEH 3KPNA 3IJEB 4OD1L 4MSWA 4UT6A 4X4MA 2F6AA 3CHOA 2DTSA 3FL7A 3QFDB 1TJIH 2CO6B 3P73B 4ZO6A 2Z91A 3BVTA 2APSA 5BRZA 1DBMH 1D5BB 1SOXA 2BO0A 3EH4B 4YWGL 4ZW8A 3TYFA 1JG9A 2OPCA 3BP6B 2KLSA 5B38G 4NM8H 5I2IB 5JR1H 4QOKD 3S98A 2ESVB 3ARBB 3SE4C 4W9IC 1A7RL 3RWEA 1RMFL 4MDJB 1JZEA 3GMOA 5ERWB 3WTTA 2EVJA 3LV3B 1M6OB 3PWLA 2YWYA 5ACMA 3SE3A 2ROXA 4XB7A 5FYJH 5HXMA 7PAZA 1YDPA 3OJ2C 4GQRA 3JWDL 2V7HB 4IMLB 5F88B 2DYPA 3DARA 4GAGL 1IGYB 2IPUG 2F53D 3D4ZA 5F9DC 3FT1A 2XA3A 1OQXA 3TT3L 1R9FA 5ISZA 2D31B 4ZO9A 2BCKA 2BVTA 1QD0A 2OMTB 2H3NB 3PIQA 4HSCX 4LVHB 4WU5B 1EGJL 2Y1AA 3APCA 4W9FC 4ZW7A 5I6XC 5IM7B 4TLKA 1NA8A 3GKZA 4XAWH 2Y7NA 3O9WC 4KDTC 4ZAKA 5KS9E 2BERA 1AQMA 3FB7B 4PFEA 1R5VA 2R69H 3OR7A 3U7YH 1XF3B 3BUTA 2WUBH 4M6OL 2YZ8A 1M05B 4UOW1 2Z4TA 4I9XA 5T1MB 3US9A 2W1NA 2WXRA 3HR5A 3LZOA 5D1XA 1KWGA 1FGNH 1MEXL 2IANA 3CPUA 2OJZH 3GC3A 3LNGA 1KPRB 2ZYRA 4AYSA 1DSFH 4OGYH 1R4XA 5EZLA 2QADC 1NLDH 4L4VE 2WV3A 3GD1C 1U8MA 4JHZA 4YDJA 4PJEB 2NY7H 5SV3A 2Q2EB 4LPYA 1YY9D 2B1HH 2BSBA 3B4NA 2BZ7A 1F02I 1VFUA 2H0PA 5I1JH 2FYVA 4U6HA 4LCYB 2X1XR 2JB5H 2NQDA 3L2MA 4ONFL 3TLRA 1DUZA 2IGTA 3V0GA 4EUPB 1KPVA 2OTUA 2XJLA 1N6QL 1C9SA 5F96H 2PXYA 1G9NC 2JJWA 5HVFB 4B5ZA 3B9DA 1CL7H 2ICCA 3GIVB 3O3BA 4AX3A 4F2FA 3DOIA 3QZNA 4K71B 3IDMA 3OKDB 4IHBA 3U4BH 2XCMC 5DJ0A 4Y5YC 1CFNB 4F93B 1NFIA 1EZUA 3UTSA 2EDJA 5HY9B 5T5FA 3DSNA 3WHE1 3D3VB 4GPVA 4M1CD 4WW2B 1HAWA 1ZY9A 3IU3B 2P5EE 1NIEA 1PY0A 1J11A 2Q87A 1IM9A 5BO0D 1JJUA 2DB8A 5HYJD 2NY6C 3WD5L 2QELA 1UT9A 4N2OA 4XCNB 3HFFA 3V8OA 1MJ8L 1IQDA 2IWGA 5TE6L 4JG1H 4H5SB 5D7JA 5JZ7C 1H3PL 1O6SB 3WHXB 4N0UB 1LLAA 5EEYA 1ES0A 1ZLSH 3VYNA 2MIZA 1U8NB 4I4WB 3APFA 4LHUA 4RZCB 3SGJC 4JZJA 4S2SB 5GISL 2XICA 4UV4H 2PYEB 5CSBA 5F71A 1USZA 3UIYA 3BVNA 3QGVA 3ESMA 2A9DA 5AVTB 1L5GA 1NCGA 5DEFB 3RVUC 3OX8A 3ZR5A 3GMRB 2MCG1 4K8RH 2D0GA 4MNQA 4Q0XL 4DKFL 2P8LA 1BVLB 1IKFL 1I1CA 1KOAA 4I3SL 4NIKB 3UEQA 3KPMA 4V1DA 1HHJA 2MCMA 4ZJ9A 4UNVA 2PXYD 5CINH 1QACA 3DURA 1R5WB 5JIIA 3UTZA 1LE9A 1C1EH 2YXMA 3NG5A 3PWUB 3L3GA 2BNQE 1R34A 3TCTA 3MZTA 4B9IA 2I5YL 1NBZA 3L5JA 3K2UH 2ARWA 2Y72A 1UURA 3U83A 1FO0L 4K3HA 4PG2A 5B8CA 4DP5X 3IGAA 3DDGA 1SDDA 2VQTA 5TE4L 1CLZH 2CBMA 3DJSA 5J7CC 1BAFL 2AJZA 2YGNA 4MS8C 4M6NL 4OVUA 5DGRA 15C8H 3GMPA 1E30A 1ILUA 4UMSA 1LEGA 2FBJH 2AHIA 1OM3H 2GCYB 4X99B 1MFEL 5T1MA 4OZ4B 1BM7A 2P26A 4JFDE 2DQEL 3KGRA 3CTTA 5FGBA 2Q10A 1G7MB 2WC7A 2FNBA 1FE8L 4ZS7L 4FERA 1EBPA 1FI8C 3PGFL 1PQZB 3ZDWA 1WZ1H 4AYBA 2AVFA 5KN5B 3NIGB 1JCVA 1ECZA 4H0GA 4DUWA 3K91A 4MXVF 2E9WA 3IE4A 1OCWL 2Q5BA 5GRWA 1I8KB 3BKJH 2B9AA 3OC8A 1KYOJ 4YSRA 3W9DA 4HHWA 4TULH 4MDIA 3R4DA 2Y5TA 4PRHD 4KTGA 1VFMA 2ENQA 3KMDA 3F6IA 2ZKXA 2VL5B 1JZ7A 4FQIL 1DLHA 3Q44A 5CJXC 3C5JB 2EE0A 2QVFB 1OB1A 3ATDA 4F8PA 2NY5H 4RRPM 4GBXD 3BKMH 1TKWB 2X6UA 3ZO9A 1JYVA 3FU6A 5ISZD 1FPTH 3ZHNA 1MZZA 2YAPA 3TFBA 4U7MA 4X6BA 2NPLX 4P5MB 4X5QA 1HL4A 4HLEA 3CLEH 1DJYA 4KJYA 2GUOA 1OSEA 1UGKA 2PXYB 3HZMA 4R26H 2F54B 1DQMH 2F8XC 1OKEA 1ZTMA 2KPWA 5ERWA 3X3GL 4NT6B 1QNZH 4K5MA 2FHBA 4PG9B 1JDAA 3NABH 5F9AC 3PGCA 4QNPE 2ERJC 4YSOA 2W59A 4MS8D 2YJLA 3ARFB 2YPLA 3EJJX 4HWUA 1QLEH 4GP4B 2X0WA 3BGMA 4HJTA 3TWCL 43CAB 4PR5A 1RZGB 4HJJL 4JPKH 3F12B 3ETSA 1BREA 1HHHA 1I85A 2UUDK 4RVBA 2E7BA 1N3NB 4PWGA 2KQMA 4R3SB 5IHUH 3ILEA 2BIIA 1BJ1H 3CVHA 3S4SG 1KELH 1UA3A 3VFNB 4U3SA 5I0DA 4LSQL 1MCIA 4L3AA 1MJJA 5KSAC 1O6SA 2BPBA 3RTLA 5BJTB 1A7PL 1R3IH 1OM3L 1EPFA 5E8EA 1RZ8B 3PUCA 3HW7A 1IGCL 2BSRB 4LLUB 5KVGH 1S78C 2VDRB 1KCVL 5CWSB 4L1LA 5JHLH 2N0MA 4X6DE 1QTPA 4PBXA 5CJ8A 1E9PB 4XNBA 3MYJA 1FBIH 2NNRA 2H32B 5IZ7A 4KTDH 5D2LA 4LPCA 4DKTA 2MPAL 3LKQB 4HIXH 2YPVL 1CGWA 1AQHA 3IF1A 2ZSVA 4FP8L 3TN0B 3EHBB 4ZUSB 3US0A 3O2DA 5K33A 4BK8A 4GOSA 3IXTB 1RKRA 5JPNB 5T1LA 2H3XC 2AQPA 4JFPB 3BMWA 3AREB 4YZFE 1VFAA 1OOWA 1EWHA 2X28A 2NY0D 5JHAA 4IOFC 3WFCL 4MAYA 4G8FA 3SPHA 4L1TA 3TBTB 2UY7A 2OP4H 5F1OB 5LDUA 3NDZE 1EMTL 2CMRH 1Z3GL 4L3FA 4OB5L 5ABAA 1JGUH 4M48L 1WAEA 3BZ4A 4NKOA 4CVZB 5BPPA 5KTEL 4N6QA 3M88A 1E90A 4NKMB 1A6WH 4GG6A 1QAWA 3O6FC 4TQPA 2X41A 5AW9B 3D39E 5DRXA 5FV2A 5JOPE 1U8CA 2JI2A 4N85A 1X5LA 3MDJA 1TSHA 2X2JA 4WUUD 3T0ED 1ZT1A 1EJOH 4M8UA 4BUQA 3VW3L 5FYLD 3VXRE 2C9UA 1FNGA 2AJUL 2TSBA 1JI2A 4PS4H 3SO3C 5E9DB 3BWAB 5F9WC 3VE0B 4RFEA 4Z18A 4HLZH 1MRCH 2IALA 5F2FA 3V79C 2BY0A 2JCCF 2GEQA 2C3HA 1JS4A 1JGIA 4NCC2 2W0FB 3AB0B 3C8DA 2OFQA 3QCTH 3FAXA 1URIA 4YHML 4OCSH 3CSPA 4CSPA 3POCA 2LHAA 5J6HA 4BA0A 4GKLA 2DLEA 4R7XA 3ZKXB 5K9JH 4PJIA 3PDOA 1KLFA 1GA2A 1CDBA 3MTXA 1FFPB 2XWBA 4FOMA 1KB9K 2G0KA 2AJVH 2D7OA 4MBOA 1CK0L 1NFKA 5M95B 5JIMA 2AJVL 4N2KA 4XP9H 3NSYA 1N64H 3MBEB 5AVVB 4HAGA 4WY7L 1J1XH 2XY1A 3R7RA 3TPKA 3U82B 5E56A 2XIDA 1NC2B 2QV4A 4Z78A 1JZHA 4AI7A 1MHPH 1IGIL 2JNZA 3IFOA 4L05A 2JTDA 2G4GA 4LO9A 5H35B 5BS0E 3OSVA 4DH2A 3D30A 3LEXA 3L5XL 2GJZB 5GHWH 1BV8A 1P9MC 5BMFH 4HH8A 2E4FA 2NY5C 4LF3A 5K39A 3SE8H 2PW1B 2VXUH 1IAMA 1DO5A 2ICEC 4KJPC 3P40A 5B7MA 1AZUA 3DYOA 3O2VH 4AQOA 1KB3A 4FCAA 4IM8A 2NSXA 4KQ3L 4KO5A 5BRZB 4XPAH 1PG7L 3WIHH 2Y1ZA 5B1BB 4ORGA 1D6VH 1UD5A 2R2HA 4TQHA 4Q97A 3BN3B 1DBAL 1BMWA 5IHUL 1SHXA 3LZRA 4PB0H 1BF2A 4HJSA 3EOYG 2F74A 1AOHA 2P5ED 4KRPD 3US1A 4ZQKA 4LESA 2IDTA 4U7SA 2FWSA 4DN4H 5GSVB 4CJ0A 5FK9B 1K2DB 4XPTL 3ULVD 4DN4L 1LM8V 1KT2A 3K8KA 3WL9A 4Y4HA 3TPUB 1VGEH 1GS8A 4QO1A 1LQBC 3DI2B 3WN6A 4NNYA 3V4VB 2AKRA 3C9NA 5IHBA 1XGPB 1PAMA 4JRYA 4HKJB 1AGFB 5DYFA 4WWKB 1L9SA 3SE9H 4E0RA 4LL4A 5D2NC 4G42A 3KL3A 2Q76B 4GS7C 4IK6A 3LDBC 3QDHA 4R4BA 5KJ7E 2XN0A 2XZZA 5IG7A 3GS7A 2FB4H 3ESNA 4GSDH 1NBYA 2CRIA 3MBEC 1R75A 3KPSD 1XH0A 5EO1A 1SBSH 3FN9A 4FNTA 4IKNA 4NQSA 1WHOA 2LOEA 7FABH 1PPIA 1WZKA 5DUJA 1RK7A 4BWTA 1AR1B 3GWJA 1RU9L 2FB4L 3GHPA 1ZT1B 3L4TA 3MXWL 4WHTB 3INUH 2MQ3A 5IW1A 1JCKA 3UBHA 1G7IA 3VXPB 3AM8C 1I9EA 2PYED 4GYBA 4N22A 5C07A 2MFNA 3JT0A 3FCSA 4MDRA 1HOCA 2UUDH 1SVCP 5L4FA 4PR5B 4LIQL 3X2QB 1CDCA 2BSDA 4M5ZH 1L5GB 1NBCA 4U1LA 4WW2C 1E9QA 1M1XB 2C7UB 2XQBL 3S5LB 2P42B 1FZJB 4HS8H 1OARL 3HUJA 3AT8A 4NAQA 3KPMB 1W16A 3GK8L 3RVWC 2QGEA 5K9OA 2F5AH 4TLSA 3PHOB 4ZFOL 4J3OF 3CMGA 3LYRA 5D1ZC 2H6UA 4JUSA 3RU8H 1N26A 3OWRA 5TQ0L 4JMXA 3WFDL 3O2DL 1IUZA 4PJ8A 5TDOA 4UV7H 1ED3B 1SY6L 4RISL 3UG3A 4E68A 3FB6B 3KDPB 1MCOH 1VFBA 1FRGH 4E36A 2A0LC 1RJLB 2GFBB 5DJDA 5LGHL 2VSDA 4LFHD 2R1YB 4QCIA 5DK0A 1JZ3A 2N56A 4Y8DC 3K4ZA 5DK2B 3RY4A 1WUZA 2HN7B 1QFPA 4YDLC 1W6WA 3DX9A 4UV4L 4EJ1C 3QPKA 2DJMA 4WJ5B 5HHVL 2WNGA 1UT1A 2Y7SA 1MRFH 2UXTA 3NIFB 2F58H 1OSYA 1QHQA 1MXDA 5IBUB 2G3ZA 4MNHB 4NXKA 4XNUL 1SXZA 5FGBC 1YNKH 1TETH 5A2AA 5CCHE 2Y4SA 3ILQC 2GK2A 3S7GA 2NY0C 3IRCA 3S35X 2I69A 3LIZA 5F7DA 4HHAA 2VXQA 2BOCA 4GI9A 3MODL 2P5WA 1JVKA 4ISVA 5I66B 3RL1A 3GM0A 2RACA 1E0OB 2C34A 1T21B 2QBWA 3ILQD 2J1WA 2OJ1A 2R0WL 1FIGH 4M1CC 4XVSL 3IPEA 2QJDA 3RBGA 3K2IA 2GUOB 3HZMB 4KZCA 4ZX3A 3QT2A 1LE9B 3FCBA 4ABQA 4F8LA 3CFDB 5KVDH 5B1CA 1JPTH 5CP3A 3FC8A 1ZHBB 1QNIA 3NCYP 4XBEL 1HINL 1G7HA 1D5MB 1IT9H 3PE9A 1T66D 5HGHA 1B9KA 2KDGA 4NKDB 4U3SB 1WZMA 4Z7VF 1RJZA 2Q1EA 4JM4L 3TBSB 4YZFF 5AD0B 1PZ2A 4OLEA 3IGLA 1E27B 4EZKA 1KDIA 3TH3T 1A14L 2NTFB 4GRWH 1KZQA 2OMZA 3CXHJ 3M17A 2WP3T 1NFDE 4FNRA 3T3PE 2EIMB 4MJIA 4L3EB 5IVOA 3IPFA 3VJ6A 3K6FA 5CZVL 1DSFL 5E1QA 3IB4A 3B9VA 4E9XA 3ZSTA 1MHPL 4GW4A 4D0DB 1TVDA 5CBEA 1RZ8A 1N0LB 1OQOA 3FFOA 3GXTA 1IEHA 1Q0YL 1T4KB 1IX2A 1IAOA 3H7BA 4PBDA 1E42A 1RZIB 5DVPA 4XI5D 4A63A 1E6OH 3GGWA 3ZHFA 3B3BA 5AVQB 4ESKA 1JPSL 1TR7A 2WPGA 2MOVA 5H94B 4EQ3A 2DQCH 2BINA 2PN5A 3WUZA 5LCVA 1S7TB 3C5JA 3QWQB 4EN3D 4L1HA 2P28B 4QEGA 4WCYL 3MJGX 4L8SB 1U8JB 4GKOA 2VWEE 4M7KL 3UROR 2R4RL 2OX5B 2E7MA 3SPGA 4FZEH 3OJMB 4LL1A 2IDSA 4HJGB 1DFBH 4OZIA 1P5UB 3U46A 1ZIBA 4GI6A 1OGTA 1DE4B 3LQZA 4M5TA 3JSSA 1A4CA 1J8HD 5BZDA 3GSVB 4ZS7H 1BQLH 3RWFA 3RWGB 1FIEA 4OJFH 1NLBL 1BJMA 4NQQA 5LNGA 4GG6B 3HG4A 2R1YA 1EXUB 1PLGH 3H3KA 5DK0B 1IBBA 4XO8A 1MG2C 3PHQA 1P5UC 3VSQA 4QTIL 3A4DA 1TPXB 2LU5A 1AYRA 2PYFA 1AXTH 1CB4A 4Q4IA 4DP7X 1UD3A 4TNVF 4NM8L 3QDGD 2WKOF 3V0WH 1NINA 2YARA 1F4YH 2FEEL 2ODIA 4BDVB 4LZKA 4DVBA 1HEZB 3BRDA 3O6ML 4QXWA 2HG5B 3FYIB 4Y4HD 5BXFB 5CZXC 1FL5B 5FW6A 3D2UA 4PWEA 4GSXA 1F6FB 4JO3H 3F04A 4LLVA 3IVKA 1D5XA 2YD6A 3N6YA 3U6XA 2BY2A 2NNAB 3NFPA 3FF8A 4WHTA 3FB5A 2ENJA 3CE1A 3PNRB 1MNUL 2CLRB 1TJHH 4QT5B 3WKYA 2FJSA 3A21A 4LCUA 5KJRL 3WIFB 3WNMA 1P6FA 5C07B 1ORQA 3FMGH 3WLBB 3IXAB 4DP2X 3PWVB 4XMUA 2QKIC 5JPNA 3G9VA 4FQCH 1NFDA 2IMNA 3ULVE 3E6FA 3NIDF 1I1RA 1TYRA 1PKOA 3VI3F 4P5TB 5DMKB 1NCIA 2XI9A 3ABLB 4AXWA 5DCCA 5IBLC 2IBGA 3C5SA 3CU7A 4GRWF 4JFQB 5A6LA 4G80A 3VGAC 3VXUA 2XBZA 2WYHA 2YRBA 5IOPB 3I3DA 4NUMA 5H35A 4PP2A 5F1NB 4QY8A 3RUGF 2AQ2A 3WMQA 1YRKA 3ARBA 4K5OA 4F5CE 3U30B 4ZPVA 3A22A 2B1OA 3WUWB 2X5PA 1MFCL 4QHKJ 2F0CA 1RMFH 3GLAA 5CNHA 2NT0A 9PCYA 1ZGLP 5E4AA 1ZT4B 2FWOA 4X80H 1AY1L 1YPZF 3BVVA 1MY5A 3BAXA 3VXNB 1YAIA 3MRGB 4JG5A 5H37G 5GRVK 3I50H 2A9BA 5DEGA 3NESA 5IBLD 2GHWB 3GS0A 3L4UA 5ITBL 5MEOB 3AXHA 1YO4A 4JHWH 2XYCA 2G3MA 2O72A 5HHME 2VW7A 4YHPA 4KKLD 1TEYA 1MFNA 4QRSA 5J12C 4IBVA 5DHYB 4XBPA 2E7DA 4Y89A 2CCLA 4LLYB 3WUWG 1DLHB 3HVDA 4CW1B 1F11A 2PCPB 1EVUA 3LNFA 3VWKC 5FK9A 4P23D 1OP5H 3SY6A 4PJEF 5EDSA 3QW9A 3H9SD 3R18A 1AI1H 2Y7QA 3DVGB 3MFFA 2CLZA 2CSPA 5EU6D 3TYGH 2H47C 4WO4B 2XWBB 3ML8A 5BZWA 3G6JF 6PCYA 2F54A 4PI2A 4GSUA 1S9VB 3MRFB 1DLFH 2IVFC 3DOHA 3O3EB 3ULUH 4M61B 4BRJA 4HOZA 4Y4HC 2A7BA 3QO0B 4OFYD 2O6DA 3TWYA 2KUTA 3TEUA 4Y4KA 2DIAA 4ZFOA 4J3SA 3GSUA 3OKOA 4A6YL 2HVJA 1PZAA 1SJMA 5DD0H 2GAZB 1I3RA 2WGXA 3ECBA 2AXFB 3HS9A 1T2QL 4UT7L 5GGSB 1GXEA 3RVWD 3MJ8B 1LWJA 4PJ5D 5EZJA 2HMID 1XMEB 3DHMA 3S3SA 4AYID 4JM2C 1T1XB 4R7VA 1NCAL 3I6LE 5GRZA 4KNQA 2H2SC 2Y07H 3NEXA 4KU1A 1NPJA 2Y23A 1E4WL 3DTDA 4CJ1A 3RBSA 3D85D 4UQIM 4JM4H 3N85L 4PRIA 1NLBH 4JDTH 4G43A 2H0JA 4JRFA 4G9FA 3UEZA 3HEIB 3GHEH 1C8PA 5JHBA 1GC1L 4KK6C 3L5HA 5D71H 4BDVA 1ZLUK 3T3PB 1E67A 1BOGB 2QHRL 2VLMD 2YSSB 5HHQB 4LVNB 3GSWA 4A7VA 2XQ0A 2DQFB 4XGZB 5E4EC 4TVSa 3DDFA 2A5UA 4Z23A 1MI5B 3IJSA 1H3PH 4X8CA 5AAWC 3MO1B 3OPZL 5AVSB 1RJLA 3ZTJG 4EXPX 4PRBB 1A3LL 3ZIYA 3SO5A 3L3JA 3ZSSA 3B7SA 3MV7B 1B3JA 1WLHA 1YAZA 4AEHH 4JFHE 3RNQB 3QRFM 5HHPA 1B0RB 2CD0A 4UT9L 4AH2A 2NY3C 3QRLA 2I07A 3FK3A 4YVUA 4AL8C 5DHXB 3WDIA 4FNLL 1CDIA 2WKLA 2FO4A 2Q8AL 5IOPA 2GJPA 4GW1A 5C0CA 4TTDC 5CBAB 2A2QT 1K5NA 1JGVH 3LNDA 4L3EE 2PYEA 2EDTA 4XPTH 4Z3TA 1UXMA 1J9TA 3BPNC 4Y19E 3T6QC 1WT5A 4JRYE 1OGAB 1U9KA 4IHOB 3HG3A 3ZMNA 4ZFGL 2B59A 2NYYC 3ZDYE 5T33L 5CFAA 5MP6L 1U58A 3F84A 4N5UA 4C56D 2V9UA 1KEGH 5AYUL 3QJVB 3N2JA 5KBDA 1BZ9A 1P2CA 3VFOB 2AW2A 4X7TA 2VUYA 3VG9B 5D7LE 3NIFE 1WA1X 3OJVC 2CJTA 4N8PA 4BQ8A 4XMKL 3WI9A 2BP0B 4OGQC 4PRDB 4NRYB 1HJBC 3MGAA 3CC1A 3HA0A 1HHKA 3II2A 2ZUXA 3PWJB 4P8QA 4U33A 4ZUTB 3IMTA 3WFBH 4N0CC 1TTFA 5IESH 1T89A 5IB1A 5H37A 3MBED 3GMNA 2GQHA 3N5AA 1AKJA 4KJQC 3ZDZB 1XL6A 4AIZB 2GSIA 4HWZA 4J4PD 1IC4L 3QCVL 3X3GH 5FM4A 5DJXA 3D8MA 2J8OA 3N9GH 2FJFA 4KX7A 1ZHBA 3G6AA 3TF4A 3LNHA 3QEQA 4Z5RB 3BD3A 1ZPLA 3PCYA 5C0EA 2YUWA 4OZHA 1EEQA 1MLBB 3CDCA 4U1GB 2QPEB 3ZTEA 1EZLA 1HZHH 2BM3A 2AQ1A 1KV7A 4IIQA 3PL6A 4OFDA 2MPAH 3R06A 1BQSA 3R4RA 4KXZI 1GOFA 5D7HA 1RIUH 2QL1A 4UWQB 3K6SA 1HILA 1Z0MA 4HOWA 1HKLL 2B20A 2CDEA 4IRJC 4YPGB 1KENH 4J2QA 2PPFA 5DA4A 3RGHA 3WOVA 1JYNA 4ONHB 1KG0A 3HE6A 1JPGB 1RK1B 5ESVA 3FUHA 4KV5F 4PJBE 1IQWL 2X2HA 4P5MA 4MYWB 5MI0B 1T0MB 3AQYA 4S0SD 4K3DL 4LBAA 4X8JB 4AGPA 3RPIA 3QORD 2BIPA 5I5IA 5FM5M 4ZRGA 4E9YA 5FCUL 4PLKD 5F7DB 5I17B 1KPUB 4ZTPH 1VGEL 5GRJH 5LB1A 3VXOA 1WGVA 2ZOOA 3TT3H 1F41A 1R17A 1KB5H 3V9CA 4DETA 3KHOA 4QO1B 4W6WB 3VXRA 3V4VA 3GSRB 2HLFD 4R83A 3P54A 4S1DD 1KXTB 4O51A 1ZIAA 4A1RA 4RAUA 3VDBA 5DHYA 5I1HH 4Y4KC 2BVQB 3BUBA 2KC0A 4FNSA 2IFFH 2OTWA 5ANMB 4F7EB 4X9HA 4Z7NB 5FOBB 1ROWA 2QGDA 1TQTA 4FD0A 1S9YA 4PJAA 4F2ME 5FKAB 4M7LT 5KVFH 2AJYH 4JE4B 4JM2A 1B3IA 4XX5A 4UILL 3FQUA 5FYLE 4L2LA 1T0NA 1FV1B 2CJ3A 4AK2A 2G60H 1TJIL 4FTVB 3LJ3A 4MJ4A 5D70L 3QUZC 1NFDF 5I71B 3TL5A 3Q6GH 1JZIA 4IS6B 4JVUA 4EN3B 1P7KB 2YGVA 4F2MA 4M93C 3WJMB 35C8H 4GSDL 3GKWH 1HAUA 5EIIG 2GBAA 2BVPA 5T1KD 2PWEA 1J1OH 1C08A 1YUKB 1N0LA 3K1KC 1NUNB 4PJCF 3WJLC 5IQOA 2F15A 4QRPB 1UYWL 3EUDA 4XP4L 1T6VN 3RAJH 5DJ2A 3VFTB 3S5LA 4CC4C 4HUMB 4G8FB 4OLVH 4LPUA 4BZ1H 5IB2A 2HJKA 2P24A 1U3HA 2FQGA 2GUYA 2GK0A 4MB5A 5DFTA 3RTQD 3ZYIA 4RMQA 1KNOA 4XVTH 4Z7UE 1YNLL 2A9AA 3FTGA 4OLUL 1JVLA 2QPFA 3SYPA 1R5WA 5EZIL 1YYLL 3JVGC 3QA3A 2ATPA 1OSPL 2DMCA 3PXJA 5I8KL 1XFPA 1KLGA 2XLLA 3EH3B 2PP7A 3BP4B 4G71B 5DJZA 3V6BR 4CKQA 2FJFB 5IF0B 4P46C 2VN5A 1TYJA 3T8XA 3LRSA 2E76C 3BPCA 3VDCA 5C7ZA 2BS8A 3ZJAA 3CMOL 3T65B 4DGYL 4I18A 4NDMB 1IFRA 1E3ZA 4QY8B 2WN3A 5CAYB 4PREB 3K8LA 1NMAH 3JWDC 2G75B 3QUYB 3B8SA 4W4OC 2WXKA 3H55A 5HJ3B 2HWZH 2CHWA 3NCYS 4APXB 3S3PA 5GIRB 3B9KA 1D5BA 2WXOA 5DS8A 2Y9RT 4NO0A 4HWBL 5GRVL 2FO4B 1R0AL 5KAQG 4XOCA 3HE7B 4HEPG 1VZIA 2J12B 2RB8A 2D03L 3PWNA 2A6DB 3RNKB 2P8MA 3RWJB 3U4AA 2W0PA 5E4EB 3KL5A 4IHOA 3DPBA 2JVUA 3V0VB 1Y6MR 5CO1A 3KJ4B 3LV3A 1S9XA 1D5XB 2B5IC 2WD0A 3MGTA 3OZ9L 3AJ7A 4FFYL 5BNXD 4ACPA 5HYIA 5JA9A 1IEBA 2EXTA 2ID5A 4HCRA 1MCWM 4HIEA 3V9FA 2KL6A 3TJPA 3FT0A 3IFOB 4A2GA 2XN9E 4B9PA 3BZ5A 3FQWA 4XPAL 1F1GA 2WQRA 4G9DB 1PY4A 5HGAA 1GGCH 1NSNH 1JIBA 2EIZB 5JPMC 2OCCB 3FUDA 3MLSH 3E9TA 1IM3A 1Z9NA 5BRZD 1JPFB 2FBOJ 2WNWA 2SEBB 4ZUUA 2BMKA 2Z6FA 4LLMA 2DQHL 3BZFB 3WNOA 5AENA 1GYAA 3HRZA 5F1IB 3CN1A 5HVGB 5E23A 5AD0A 3EDJA 5FKAA 2YKKA 3CFKA 4L4JA 1YUHB 3CFQA 5HJDA 1JTTA 5CJ5A 1Y0LA 2D9CA 3EF7A 1OPGH 3WELA 5C9JB 1CLOL 5AAPA 4L3EA 1XO8A 2J3SA 5AW4B 2HJLB 1TEGA 1ZDQA 4KUCF 5BZZA 4LLAA 3FB7A 4QI3A 2KZBA 3FO0H 3O2WL 3DGDA 2E7LA 4N6RB 2GTQA 3P9LB 1YEEH 5I28A 1NGWB 4OGYL 4QHPA 1E43A 4FFZA 2CO7B 1M05A 3UZEA 1Z6JT 4M43H 5DFWH 1LO2L 2X4OB 5GSRB 3BESR 5EOQL 5DHVA 5M94B 4N9GA 2LT9A 2CXKA 4EUPG 3RTQA 4NO3B 3CFTA 3GXUB 4GRLB 2LAGB 5I76B 2KZKA 3IWUA 1IFHL 3H1ZA 1LD9B 2ZZUT 5EBGA 3WCYA 2DKSA 5K59E 1CUOA 4OTXL 5FDYA 4ZXBA 2M83A 2VO8A 1AVAA 3O41A 2XETA 3BZDA 1IVLA 3NOIA 3MA9H 4V33A 1KTCA 2Z3FA 5AZEH 2NR6C 4G7YL 2GSGB 3RWHB 3HPJA 2BLFA 4EZLA 3T6ZA 2IPKA 4Z6AT 4XP6L 4UV7L 4CGUB 4P2OC 2XTJD 1KXVC 1K5NB 1GSMA 3QQ4A 3QWNA 3U4KA 5LQBL 3Q05A 3P73A 5BS0D 2MQGA 1CL7L 4JFZH 1A7OH 4MAUL 4OZFH 1QKZL 1FHNA 4LPXA 5GGRA 3N1MC 1MZYA 2V3EA 4GKNA 4POZC 2J21A 3G04B 3RZCC 2VWEC 2ESVA 2F5AL 3MMEB 4NWUL 3V0DA 1KJVB 3HKZA 5FYJD 1LEIB 1W0VB 1WQVT 4MKMA 4HOMA 4YQXL 4YFDB 4N2HA 3UYPA 1KUMA 1R3HA 1JHLH 5E94B 3WLWC 3UMTA 4X5LA 1FFOA 4AENA 4C83A 3FQTA 5E2UH 1ITBB 4DZBB 4FS0A 3J07A 5KYXB 3AADB 4EKJA 3HHSA 1IM9B 3HNTL 1ZHNA 5FM5O 3TIEB 3VE0A 4RFEB 5I16B 3ULUC 2FR4A 1ACYL 3FT2A 1A4JB 3V8CA 3VXRD 5I1CL 4JZOB 1MVUA 2BP0A 2WCPA 1ZV2A 1YQ2A 4PRDA 4NN5B 4AL8L 4OFVA 4HWEL 3T4YB 4AZ8B 5J11B 5E8PA 2XWCA 3FT3B 4KJWD 3QFJE 2DQFA 1HSBA 2DM3A 2VMCA 1XF3A 4OI8A 3G5ZA 1WE5A 3JWNE 4IGBA 4UUJB 1FVEB 1UVQA 3DYMA 3N0AA 4JG9A 4DZ8A 4U0RB 4LSSL 1RUAH 3QG7L 4DCQA 1DCEA 1QOKA 4XN4A 3ROOB 1RURL 1R5IB 1AJ7H 1Z9PA 1T89C 4QRPA 4W9JC 1KFGA 4P5TA 1KY6A 3MX0A 4MJIE 2P8LB 1MW2A 1QHOA 4JRXD 5IK3A 1KTLA 3GUTA 3UOAB 2PR4H 5ALBH 1TEFA 2R9HD 3BXNA 3TWCH 1QI5A 1NGXA 1J5IA 1JXFA 2ADFL 2A9NL 1VF5C 4FQLH 2NUTA 1FNSL 1NCOA 4BFKA 3DOSA 4PV8B 1QBAA 2FE0A 4RNRA 2MEJB 1T0MA 1UGNA 4JFDB 3SCMC 3L1FA 3QISA 1AZBA 3LQAH 1JVOA 2E9JA 2YA0A 4IIQC 1YNTB 4XMKH 4A2DA 5ECJE 4E42A 3B9KC 3TONA 2VZSA 1D6EB 4IQHA 4ODSL 4AVIA 4P2RE 4Z77B 2B3IA 3CDGB 2X4TB 3RX8A 5CGYD 5BW7C 4RRPG 2YRLA 1JRHL 4I18B 4NDMA 2HFEA 4H88H 5FYLL 1A2YA 3EOTL 1IBYA 4FL4B 4AEFA 2VDRH 1ADQA 3LPWA 3EJYC 4UOJA 5I1GL 4FQIH 4GSQA 1FJ1B 2P5WE 3JT2A 4P2CG 4FF9A 3WIIL 3VFGH 3KLAB 2EXYC 1BG1A 1R0AH 4M43L 1I7RB 3CZLA 4G6AC 2VSCA 2OTWB 2VMEA 4N3UA 4O02H 4E5XA 2YN3A 3GBLA 1UOLA 1MSPA 1KT2B 1KFAL 1T5KA 2OMNA 3M1OA 2WLJA 4MXWH 1GS7A 3BI9X 3S5LG 4RAUB 1X7SA 2Z0UA 3KH4A 1N64L 4JFFA 4OCMC 4PD4J 3LKPA 2Y2TA 3T04D 3PYCA 2HZHA 1KFAH 2FYYA 2VDLB 4GH7B 4LMQI 4AYEC 2GAZA 4DQAA 3S8GB 4TQIA 3ZKMC 3F58L 5F3HA 3B5GA 2BHZA 4FTVD 4NERA 2J1KA 3FQWB 5ANME 3GHBH 2D3JA 1DYZA 3VWKB 2CQVA 2BDNL 1EFXA 4KROC 3N43F 3OKLA 5E51A 3HPLA 3RI5K 4A04A 2FJHA 4YHOL 3MLSL 3RL2B 4LT7A 4P2AA 1QASA 4TMPA 3RZWA 2IDFA 2XPGA 4YLQT 1MRCL 4A7TA 4AGNA 4UM9B 2YBGA 3W2DL 2RQEA 2ZUQB 1B4JH 2WQ8A 4W9HC 4N0FA 4CN1A 2JIXD 4UAOB 5HVHB 2RJMA 1JHLL 5EZOL 4DIXA 3EADA 3PP3H 5CSZA 3JV4B 1SJHB 2EYRA 1TCMA 3W3BA 1G6RB 1CU4H 1ZLWK 2X6BA 1NDMB 5IVZA 4NSKB 3IFPB 1M2VA 3VCLA 1JZGA 1NCBL 3QHTC 1FUNA 1KLUB 1QBLL 4YPJA 4NRZB 5DT1H 1MCPL 2LAAA 3QZOA 3K6IA 1EHNA 4Q4EA 4ZT1A 5E9DE 3GMPB 3CC5B 4UZGA 3MJ6A 1NCDH 3AROA 4LK4A 2GJ6A 4L5FL 5C0AD 4TQ8A 3IU4H 3AREA 4RFOL 3V4UH 3MLPA 4FEIA 3BOVA 4XCFL 4WNJA 3U36A 2K4WA 3ZX1A 3GYRA 5FO9B 5IMOB 5C7XH 4PRPA 4KVPA 3RZCA 2FHFA 2JCWA 1FNFA 1G0YR 4MXWL 3EGXB 4S1RH 4I87A 3S3CB 1I8MB 4OV5A 1T7WA 3SPJA 2DMBA 4X4ZA 2NY2B 1B0GB 1ET5A 3N3EA 4R90L 2NUTB 1YPZA 1OGAA 2ZONA 4RGOH 3MNZB 3CD4A 1JF6A 3A6CL 1YN6B 5D5MF 3VFWA 4CMHB 4XNYL 5KYWA 4H4NA 1WC7B 1H5BC 5DEFA 4E41A 3FN0H 1CURA 2MOQA 3VRIA 2IBBA 4NQXA 2CGRH 4OLYL 5DS8B 1S9XB 1CD1A 3MGTB 4QT5A 4ZYKA 4NKMA 3NTCH 3SGKC 3IS0X 4JFHD 4GIOA 4LHUB 1SUHA 5TK2A 5F3BB 4JFSA 4U3CA 3GI8H 1FZOA 4QHNB 5TGBB 1N6UA 1UZ8A 4MTMA 4BCZA 1S7SB 1T03H 5TE7H 4RQQA 5F8RC 5TF1H 3FQTB 4ZUWB 3D69A 4KKZA 5IB3B 4O9HL 4FEMA 2EH7H 1YEJL 5GS1B 3DGGB 4JHBA 2V3FA 4P46D 4U1IB 1D5IH 1XSOA 2APWA 4QOKB 5DD3H 4UT6L 3TO4C 5TE7L 4MNGB 4TVPD 5EWIL 1I7UA 3DV6A 4K3JL 3ULUF 2AEPH 3BZEA 4EN2A 3MROB 2HJLA 3VMOA 2O61B 1LP9B 4KI5D 2AF2A 3BPCB 1RUAL 5C3IA 2R29H 4IBSA 5FO2A 3MCYA 1ZE3H 3ZIMA 1OW0C 1JPST 3V9EA 3HC3H 2X9YA 2FJUB 1TOXA 4GQ9H 1UFUA 4GS7B 4YHZH 3QEHB 3BISA 2D03H 1W0YT 4P5RA 5GGTA 4OCWH 4MCYB 4P23A 2YKLH 1F3RB 1RULL 3HC2A 2YS4A 1U8IA 1R3LB 5E6ZA 5T3XH 4XMPL 3V55A 12E8H 5TDPB 1KB5A 3AITA 4NQTA 1LYQA 5I8CA 4YIQB 1JGLL 5FUZH 2NUPA 4O58L 5GGSY 3C6LC 5DQJA 1ID5I 1EAPA 2O4EA 1JNNL 4G3YL 3QPXL 5E2WL 4H26B 4G6ML 4P46B 1ZRUA 3A5VA 4NZUL 5ICZB 2OZ4H 3BH9B 2VL5A 3UZEC 4Q74A 4YQXH 1I9RH 1LD9A 3IDNB 1I9IL 3MSPA 3OKOB 4NRZA 5KOMC 2X4TA 1EAJA 3II1A 4OQ1A 5E2WH 5CEXA 4L2YA 3HUJE 1CD0A 1OTTC 1GGIH 3U0WH 1HL5A 3FUFA 2OBGA 2EIEA 4XZ4A 5HTSA 5IFAL 1FZMA 4DUXA 2IWEA 4LHUD 3QFJD 4PTTA 2YMXL 4JM2D 5J4MA 1KJVA 3K46A 5DMIL 4ZS6C 3GSNH 4ZMOA 4FQ2H 4OIFA 4JRYB 4Y4FA 4Y16D 5D1QC 1SLXA 4PSPA 3TO2B 4TTGA 3ZDYF 5DVKA 4ODHH 4AC2A 2E6PA 4XO4A 5PAZA 3H2QA 3SDDB 1HIMH 3N85H 4GG6F 3GF8A 2AAAA 5CCKH 3MR9A 3BGMB 4PLKC 2V5TA 3D08A 1H6TA 3ZO0A 1P4BL 4I48A 1YUHA 5AFAA 5IUCA 4K8RL 2DQUL 2HTKD 2JQAA 4FI6A 4NUJB 4WI9A 1CXEA 2COVD 1BEXA 4AIEA 5I1KH 1IZKA 4BSVB 4TUOB 4DP1X 4YOKA 4OCXL 3AS2A 4OBSA 5F8QC 1QP1A 5D7LB 3FBQA 3TNMA 4NQXB 1QVOB 5EN2B 3HZKB 1NEUA 1ZHNB 5INDA 4XOBA 4ABVA 3FQ2A 4MJID 1ZWIA 4XCEA 1AACA 3PXHA 5BV7L 4QUOA 2ZCHH 1OO2A 4CILA 1HQRB 4ZNEA 1JSYA 3OLEA 3QUYC 2EDQA 4LKXB 3ZPDA 2WHVA 4P2YA 4CBZA 1T83C 4JRXA 4LKCB 4AUUA 4Z78B 1BFOB 3LMJL 3RWCB 5D9SB 3Q2CA 3GI8L 5FV1L 2WKGA 1JK8A 3LH8A 3PP3K 3B9EA 5SV4A 3VFSA 4Q9RH 4AKOA 3UC0H 4GW1B 5CBAA 1ANUA 2QT6A 2Z93B 4ICXA 5F6HI 5IFJA 1WAAF 4ZFZB 1A9BA 4AQ1B 4YDMA 5JTWA 3VFVA 4JHAH 1DQQB 3GUTB 5F7YC 3FSOA 2MSPA 1BEYH 4JS7A 2Y6SC 1XCQB 3K71B 3QCUH 3V5HA 1TQUA 3PABA 5E9DD 5IROC 3R0MA 2HT4C 2VQ1B 4AQ1C 3FQXA 3I2CL 1ZXKA 4FYSA 2G75A 3VA2C 2HFGH 2P5WD 1H8SA 2AC0A 1RZ7L 2D2CC 3A6BL 1LHZA 1CJYA 2BFGA 2C1PB 4U31A 1TZOA 2BWIA 4WV1A 2DWYA 1RVFH 5F1KC 3HAEH 4HIIB 4OJYA 4XCFH 2RCSH 4Y1TA 1D2PA 4ZDHA 4ZUTA 3KPRB 4CBPA 1QWUA 1K2DA 2HUHA 3MNDA 3BWAA 3ZKND 2A6IA 2GJJA 2JKLA 3NCJL 1ZVHA 5FO7B 2ZG3A 3Q0HA 2ADYA 4D0CA 1JDCA 4FQXC 2RQ8A 1I8IB 1M7DB 4MMYA 3P4OA 3C60A 1RULH 1AHWA 1UCTA 2ORBL 2VDOH 4OCXH 2WMPA 3SGDH 4D7BA 3ECWA 4JCWA 4WIQA 3QIWB 1RIUL 4KOCA 2G60L 4K5LA 1A3RL 1AHMA 2CO6A 4A2HA 5KJRH 2H6PB 2W07B 4FLRA 1SNRA 3RUGA 5LUMA 4FYRA 2WINA 3JYBA 3ZTNH 4B53A 4FFYA 1KGIA 4OLZH 2VR5A 3VH8G 2D7TH 4DCQB 1XGQB 4U6YA 2ARJA 2BMKB 3ATAA 3FU5A 2QTEA 4PJ9D 2A6JA 3T3ME 1IGTA 4PRPD 4NO0D 1A5FH 1M9WA 1NCWL 4UQ9A 1OTTD 1DVSA 2IH9A 4HCFA 4I1NB 4BKSC 3FU8A 5LLIC 5EBMB 2XG4A 4Z7WE 2CIIB 3P2BA 1BF5A 2WLHA 3MNWB 4X5RA 2V4LA 3CH1A 4AGQA 2FX9H 3ARFD 4MX7B 4B6ZA 1A4KB 4JKLA 3P4LA 3ZUCA 4A6YB 1JZDC 1QFHA 2IO5A 2YD5A 1K3IA 3SDAC 4M00A 5EEXA 2WXLA 4HISA 2NTFA 2E74C 1F56A 1NGPL 4BFIB 4B3VA 3GJFK 4NFDA 3D12B 2BJMH 4Y19A 2AXWA 3ARFC 2WBKA 4JFUA 4F7CB 2FEDD 2WLKA 3IFPA 2PUQT 3FFCE 1NAKH 4L37A 4AQAA 2DIBA 2R8SH 5C0AE 5JR1L 4QTHA 1GOGA 5FA3A 3P9MA 5KG9B 1IFHH 2IAMC 4JQVA 2DW5A 1T5XA 2WKOA 4RDQG 2LABA 4W81A 4K4KA 4E5XG 3M17B 5CEZL 1WISA 3T5WA 1KJ2H 4PWKA 4DPBX 5IQLA 1UWXH 3VVWA 2DL2A 2VTFA 4P04A 2A1WH 2JFCA 3OMNB 4PRHB 3ZW3A 1HE8A 3FB6A 1U8OB 4XNXL 3F6JA 5DI8A 5DRWB 4AYDC 3O3AA 3TVMB 1G1CA 3TTYA 3IYLW 1ODAA 1WZLA 3HPJB 1WBYA 2G2RB 2AK4D 4OSUL 4FTVA 4GLRH 5IHZB 4XC1H 4ZSOB 1J05A 3HI6L 4HD9A 3EUUA 3FCUB 4WWKA 1M3JA 5EIQA 1BZQK 1SOQA 4TQEH 1IGFH 5CKAA 3J7HA 1E2WA 3IT8D 3DJRA 3GSQA 3T0AA 1D5IL 1M7IB 3ZE1B 5E2VH 4FJZA 4JG0L 3U4EA 5GZOD 2VDMB 1E5CA 2FJGB 4GW5B 1G7LB 4BK5C 1G1YA 2XN9D 2Y06H 4YK4B 2OR9L 1TENA 2PR4L 4PGDB 1U3ZA 1NSNL 1KF9B 1ETA1 3MJWA 5IVXE 2PPAA 4HAFA 3NACH 4I85A 4P3WA 2HT4D 5CUSL 3GHEL 2IG2H 4DZBA 4XAKE 4PJ5A 4XHJD 3DX6A 5EOTB 4LSTL 4AITA 1IEAA 1RJYB 3RX9A 3X13B 3WTSA 3L3HB 4UB0H 3ZE2F 4MMZC 1DBBH 3OBAA 1A47A 1AHWB 1X5HA 1LL1A 4KI5E 1T04A 5I8EA 5BMFL 2EO9A 4NNPH 3L5XH 1NGQL 1LE5B 2BDNH 4WU5A 4KMLB 1CICA 3GEWB 4KPHL 2AV7A 3DKHA 1JXGA 5MHSE 3LKOA 4Q52A 1MPAH 4N9OB 3RG1C 3VFUA 3Q13A 1PCXA 3FDWA 1NCHA 3W81A 3V10A 2H8PA 2JMRA 3GMQB 4XX1E 1N10A 3GSOB 2B4CC 4IRSB 3UC2A 1P53A 4U6YB 3OX8B 3WEBA 5I1IH 2YEZA 1GR7A 4AM0Q 4MCYA 4LCUB 1LTXA 4APXA 1PNDA 5K5YA 5KZCD 1S6NA 4G8GB 1UZ6F 4PJGF 3EYSH 1S7VA 5ITFB 1BFVL 2WXNA 5LBVA 3WS6C 1LWHA 2CLVB 5J1AB 5DQJB 1U8KB 4G8IB 1DJSA 3EW3B 1OIOA 4YUEH 2LU3A 4KKAC 1YEHH 2YD7A 1DANT 1CU4L 3ZE0E 2J44A 5I1LA 1T0OA 1J8HA 3X11A 4ZMTA 1GC1H 2JCCE 3L5WB 1HDMB 3REVA 5E6ID 4HAKA 2IADB 3MJ9L 4B9ZA 1TTBA 1HU8A 2Z31A 4RISH 2CXGA 1UWEL 4DK5A 2FO8A 2AQTA 3EJZC 4BH7B 3RPBA 5KSBE 1ADQL 1BWWA 1MIML 1RHHB 4FG0A 3ESUF 1GKEA 5HPMA 4YLCA 4FKEA 4FQHB 4WV1B 1O6VA 3T08A 2WBXA 4CW1A 1CR9L 3CFEA 4QXVA 3BAEH 3NIFF 3PG2A 3BKYH 4M7ZC 3LD8B 4XWOC 5F1IA 3T71A 4FXKB 1RUKL 3U2SA 2JKWA 3B7UX 2X4RA 3UTSB 3QUKB 1TZIA 3KYKH 3B2UD 4E9LA 3EOBB 4IKKA 4LIQH 1T3FB 4K7FA 1XZ0B 1SJXA 5E6IA 4N1CA 4NJAH 1G7HB 1HH6A 2KT6A 5I6KA 1HYSD 2J6EA 3QJUB 2OI9B 4HMEA 4ERSH 4K94L 2DBLL 3L9RA 1MFDH 2E86A 3AY4C 1SJVA 4P9HC 4PMEA 4PBVC 4Y4FC 1II4E 2QLYA 4RFNB 4HK0B 3KPSB 1F00I 1XGYH 1GGIL 3SDCC 3SBPA 2WVSA 5EFIA 5DWPA 4DGIH 1LK2A 5CJOL 4WK2B 1E8YA 2H1PH 3PFQA 2HVJB 4WGVB 2IQ9H 2GB2A 4PLJD 2OYLA 2ZCKL 3CN4A 1ZHLB 5ICXB 1BVLA 3QDMB 3GSXA 5HHXL 3HNSL 5LCVH 5EZJB 5GRJL 1M42A 2YQGA 1O7DE 3QJSB 1S7XA 4N0YH 3LKNA 4HMCA 1JERA 3SGEI 5HDOA 4GT0A 1T04B 1HOEA 2VIRA 2C1OB 3ARUA 4G9FB 1AS7A 4NN6C 3MV9B 1YEWA 5JA8B 3DX8A 2E59A 2W60A 3GFUA 3JTBA 5HHMD 3GI9L 3TEZA 1I3UA 3JWOL 1T1ZA 2Y7MA 1PZ5A 3WTUA 3RJOA 1KYDA 4JPQA 5IHWA 5EU6E 2VRAA 5JDSB 4HZAA 4W9DC 4FULA 5J6GA 1TTUA 4XNMA 4HJGA 5HGBA 4I1PA 1PEZA 3P3YA 1DQML 3WSQH 3QDJA 3M7FB 3RNQA 4E9WA 1EGJA 4E9QA 3CUPB 1HC1A 1PG7H 4TNFA 5IJBC 2EDYA 4J23A 4UILH 3ZK0A 1MNUH 2Z1KA 4GQQA 1L0YA 3L7FA 4HUUA 5EWIH 1QLFB 5JNYB 4H1LB 1WEJL 3A4AA 1DBKL 3IRPX 5IB5A 4DP9X 8CGTA 1F4WH 2LTQB 2CBOA 1AAJA 1DUYB 2UZXB 5D72H 4A7GF 3HLAA 4UYQA 4XI5C 5TQ0H 4AKQA 1YEKL 2CRYA 5C0DA 5FFLA 1WFTA 5JIHA 4QYOA 5JIDA 5ESAA 2UZPA 5F3BA 4PJ5E 2AXHA 1L9NA 3BD4A 4WV1C 2QGCA 4MJ5B 5JO5B 1D7DA 1ZA6A 1ET7A 4XVJH 5DVMA 3QIBC 5KSAA 4O9HH 1JBJA 4KKAD 4XVTL 4QWWD 1CDUA 1U8CB 3QIWA 3MX0B 1PZUB 2CJUL 3B9KD 5HJGA 3PU7A 1XMWA 4N0YL 3KPSE 1QRND 2PTTA 2FEEI 2VDLL 4XHQA 4P5SA 3ZE2B 4PG9A 1L0QA 4PJ6A 3RGVC 4UQEA 4FXKA 4M5YL 3ARVA 4X6CA 3TA3C 3NK4A 3G5VB 3QH3B 3JWNH 1P5VB 2DIEA 3DMMA 4HWZB 1PNCA 1IKNC 1T1XA 1SUJA 2W0FA 1JRHI 4PVBA 3MROA 2KPNA 1SXSA 2I24N 3EZ8A 6PAZA 1JZ8A 1JZ2A 2W8CA 3QDAA 3BIBX 2OMXB 1IGIH 4QYAA 5I73B 1D5ZA 2YLHA 3QDME 5D7SL 2VMJA 4P2OB 3MNWA 2VITA 2OMYA 4YSPA 4XVUC 4WWNA 3UADA 1XGRB 1NGYB 4KMTH 5F7NC 3QUXB 4ZPVB 2VLKA 4ZFGH 2J88L 2D3VA 3SJVA 4JM2F 2F8VA 3CU1A 4HEPA 3K0YA 1YA5A 4RFOH 5EUKA 3V4UL 1X7QA 3MGOB 3BFOA 4G1EA 4PRAB 1RJCA 2JELL 4HUWB 1REIA 4HMDA 5EULV 1JWSA 3BIAX 3M46A 2GJ6D 1NM9A 5C0AA 1EZSA 3I02B 2JELH 2PP9A 4XPFH 1XGTA 4GXUM 5EUOE 1TZGL 2V0AA 3F7QA 4PJEA 4XBPB 5L9DL 1TO4A 3T4AC 1YQVL 4EUPH 4JFPA 2X1PA 4KAQL 4J39A 3K74B 5HHXH 2X53A 1VEMA 2J73A 3NJHA 1UWEH 3VXMB 4RMWA 4HKZA 3FPYA 1WTGT 3UCQA 1G7JA 4H13C 4A2MA 3O9WB 3WFDH 3GMOB 4XBEH 3H4FA 4CL7A 4C57C 5IHZA 5DEJA 5E9NA 4KJYB 2D73A 4AV4A 2ICWI 1XF5B 1A1OA 1CQYA 1CZ8L 3MHZA 4I5BA 4QWWC 3WN5B 4C4BA 1B4RA 3LN4B 1SMDA 3M1BB 2XTJC 1AXSA 5EMYA 2ZCLH 3MR9B 2PPEA 3WS3B 2K7PA 5EOCH 5CD3A 1A6TB 4OLXL 4HIJB 3BEVA 4HSAC 3IFLL 4J27A 3SQBB 2FRGP 2FT8A 4X8GA 3D25A 3JQOB 3IJ7A 3ILDA 4M93B 2Y2WA 4D8OA 1LDPH 1XQ4A 4G6KL 3F12A 5CZRA 1YVLA 1DLFL 4XP5H 2JSFA 1JXKA 4G6KH 4N0UA 4AEIL 4Y9BA 3RP1A 3OR7B 3KBPA 4D7PA 3OHXA 4P4RA 2YA1A 4AQAB 5ESAB 2PWDA 3BPLB 3KLHC 1CG9A 4KHXL 2DM4A 35C8L 4XN2A 4MGXA 4S1SL 2FUTA 3NN8A 2I25N 4OGAC 3DXAB 3UTOA 1U8HA 4OCSL 4N8UA 1KBVA 2GIYA 2OSLB 4JRYD 5CFHA 3EYQD 3UO8B 1E8WA 3DUSA 3QR0A 3TBCA 1UM5L 4KBPA 4RAVA 1HHJB 1MRDH 2WNKA 1PX3A 4J28A 3PQYD 3T9WA 5ICUA 3Q3GA 4TXVB 1IM9D 3KL0A 4GXVH 5B1JA 4P4KA 4GQZA 1QW9A 1CICC 3N04A 1OD7A 1QBBA 2BC4B 1MFMA 3L3JB 3O2DH 2GTWB 3KPNB 1ZJBA 2BNRA 3LB6C 4FI7A 4CKVX 4UQ2A 2DIJA 4NX0A 4ATWA 4JFXA 2A83B 4HS3A 2FCBA 2EIDA 3D85B 4U6HB 5AVUB 2DMHA 2B7DT 3VXSD 1L6XA 1UZGA 2FT7A 4QXUL 3MOQA 5EZIH 4B9YA 1VJSA 1A7NH 1TVHB 2VLJA 2WB1A 1EERB 2W60B 3GBNL 4OAWB 4YDIL 1K3ZA 4CSTA 4JRXE 4KI5C 3U0PA 4LCWB 5DJYB 4XVSH 3AT9A 1C7SA 1U2CA 1U8PA 1E4XH 3PLYA 3MLTB 4XTRC 5BVPL 1VDGA 3ASOB 3U25A 2PO6A 1C5CH 1YNTA 1KPUA 4P5TD 4JAMA 4Y5VA 2EDNA 3NAAL 5HY9A 3WIHL 3JWNG 1CLYL 3FUEA 5CZKA 5EA0L 5C0RL 1AIZA 2JJSA 4XX1G 4PREA 1J10A 3DGGA 3MLUL 4NC0B 4R8WH 3GJFH 4NCDA 5F9OH 3DV6B 4X4YA 2XX1A 3NA9H 1XGYL 3UGXA 2V9QA 3UO1H 5KVGL 2R59A 3CX2A 2I7SA 1J1PH 1UXWB 3MLUH 4KHXH 4D3CH 2AZUA 2LE9A 3B7RL 3X3FH 5HYQB 1U21A 2F7OA 4Y5XB 3VU1A 3NIGE 3AUVA 3L9RB 4P2QB 4KJWC 4LOFA 4JDTL 3ML9A 3L16A 4X80L 2VDLH 4JE0A 3KZ8A 3QULA 1IBDA 3Q2NA 1Q9KB 4JN2A 2WWOA 4MCNA 3CCHB 4LXFA 4ZTOH 3KPRD 1KPRA 4ECNA 1BJ8A 2QQKH 3T2OA 2F61A 4HFUH 3LHPL 4IW4C 5TDNA 4A6YA 1GGTA 5FFOA 5AB2A 5DSCB 3LHPH 1E4XI 4JKNA 1W0WB 4YDJB 3WD5H 1G9NL 2B16A 3STBA 4G7VL 5T1KB 3H85A 3Q2VA 5C3LD 1ADQH 3D18A 1K6QH 2GKIA 2ZOUA 4N2DA 4X5XB 1QSEA 3L4XA 4R26L 5SWZB 3QDMD 3PXLA 4LAQL 4U1JB 4YC2C 3RPKA 4TF4A 4WQOA 1MFAH 1PD0A 3BJLA 4XMTA 3RGVD 5TH2A 1HCZA 1NTDA 3PP4H 3I6KA 3CIAA 4EE2A 5E00A 5HI4C 4JR9H 1EJOL 4KHTH 4Y1SA 1M9SA 1JZJA 1OK0A 3TCLB 3PUUA 2GI0A 3IKCA 4PQXA 4P9HL 3GJFB 1NDMA 3CH8A 3MRMA 4L4VB 3VJ6B 4DO4A 1EAQA 3FRPA 5T5NG 1KXQA 3QIUC 4IRJB 1CXKA 1KBBA 3SDDA 2BY1A 3WKPA 4FA7B 3N1PC 5LBSL 3IMVA 4WNSA 5AW3B 4URKA 8FABA 1G84A 1BQHB 1GYWA 3O41B 4QXGL 3ZBMA 3FSWA 3QQXA 3INOA 2V9TA 2VZUA 4FHBD 4TRPL 5DJDB 3WFCH 1XF4A 2VL4A 1J05B 1P0SE 1HL9A 1NUDA 4K9EC 1CFMA 5FYKL 3QQ4B 1BPLB 4PYHA 3DIFA 3W56A 2XRAL 3QHZL 3CLFL 4PB9H 3IMBA 4KC3B 3HZKA 4JBSA 5DMJB 5INDB 2FATL 3FQUB 4AV5A 4OV5B 3GXIA 5KS9B 3O9WA 1M7XA 1YY8B 4HZLB 5G4MA 1BG9A 3KXFB 2J5WA 1CZ8H 2N7BA 4FLSA 2MNWA 2VR7A 3KPSA 2R1WA 4NQSB 2OCJA 3ZGHA 2EDRA 1D3CA 3ARGD 1DBBL 3MV7E 3SDDD 3EF4A 3QORC 1W72B 4QHLA 5DJAA 3KWTA 1DBAH 1Z5YD 1XV8A 4DW2H 2EE3A 1U95B 4PN6A 4ZTEA 4LSQH 1RPQA 4M7JL 3FMGL 3BUIA 1WS7A 3FUKA 4TUKH 2VN3A 4ZW5A 3MUHL 5IIEB 4KQ3H 2IF7A 4M6MH 4YSQA 3L1EA 3MODH 4EIZC 3EDDA 4NXSA 4LOUC 4WNQB 1FFOB 1OGAE 2OR8A 4ZUUB 5J6HB 3RDJA 4F15C 2N59A 3QEUA 2M1KA 4PJIB 4JGUA 3OMIB 1KIPA 1E28A 1J87A 4B60A 4WEBH 4PJ8D 3JUZA 3ZL2A 1JF1A 4S1SH 5DJ6A 4PIBA 5ID1A 1F4YL 1VCBC 2O6CA 2VITB 4PJXB 2GCYA 1UB6B 2DWDA 3EGSA 3W5NA 2NY2C 4JANB 2OSWA 2E9BA 5IF0A 3WNIA 3VNZA 5D5MB 2UYLA 4R96A 5G4NA 1QLRA 3EJSA 3G6JE 1YZZA 2AEOA 4PJ8B 4JJ5A 4U4IA 4FMFA 3MRLA 3UAJD 1K4CA 5CJXA 4XVOA 3LD8C 4A67A 1ORQB 3WLBA 2H2PC 3MJ9H 4LU5L 3IXAA 4LF3B 2EQDA 1UWGL 2HN7A 2Y5TB 2P80D 1I1AB 4JFDA 4Y5VC 3HS0C 4UQ3B 4GRLA 2WLNA 3CFUA 3QPQD 5I8KH 5FWRA 3CZFB 2DWEB 5L4IA 4EI0A 3DO7B 1JWSB 4H0HB 1CXFA 1QATA 1HH9A 3VYOA 1PGRB 5JIQA 2YR3A 1E5AA 3HE7A 4JFFD 2R51A 5DRXB 3ZVVA 3FRUB 1ZEAL 4MJ5A 3NH7H 4NENB 5JO5A 5KSAB 3QJXA 2J5LC 5T3XE 4Z9KB 1XSIA 5DUPH 5MENE 2RAMA 4H8PA 3QDGA 1DVFC 1FJ1A 2HAZA 2HJFA 3HN3A 3W1ZA 3L8QA 2E47A 4Y5VB 5T3ZE 3O3DA 3E80A 4DP0X 3HNSH 1A8JH 4XVJL 3S3BB 5I0WA 1TQWA 3NZ8A 3WE6A 4P9ML 1AXSB 2CKBB 3HG0A 5D1QE 3WY1A 3TS8A 5D70H 2E8ZA 3MLYL 3OAYK 3A24A 1FSKC 4H8HA 3PJSB 4KO9A 3ZRFC 3UPAA 4QF1B 3QH3A 1M57B 3B9AA 3IGKA 1RZPA 4LLMB 1IZJA 1F4WL 4GQ9L 3VFNA 3QRGL 1AO7B 1RIVL 2ARJQ 5HI4D 4S1QL 3TV8A 5C0BB 2NY5L 5D1XD 1X5MA 4YL4A 3AMKA 5DRNB 1AIFA 3ZKNC 2ZKWA 1BP3B 1XCTA 4S1QH 1IIIA 1UKTA 2FQDA 5A2CA 1TTAA 4EMZA 2JI1A 3GXNA 2FSEB 2R2EA 1RZKC 3QRGH 4BSWB 4Y2DC 3NACL 1D9KD 5FR3A 1KIQA 1GMIA 2C5DC 1CFSB 3EH1A 4BQCA 2RH0A 2P47B 1CIUA 3AT0A 4KX8A 3WAJA 2BNQD 3B2UC 3LEVH 3L9YA 3O6MH 2VN6A 5K69A 4K23H 4HUWA 5FGCE 2DH3A 1I9RL 4LDLB 5ECGA 1FVEA 1UVQB 5TE6H 2IDUA 1EEYB 1QSZA 3GRWA 1OT2A 4LARL 2E0PA 2Y6SD 4M5YH 4NZDA 4XMZA 3UTSD 3UTPD 4K71C 5L2JA 3G5XA 2WOYA 4D8PA 1C5CL 2VUOA 9CGTA 2NY4B 2IPKB 4CMMA 4AZUA 1MQKH 1RAMA 2H2SD 3MV8B 3QEUB 2FLMA 4EI5C 5IJKA 1KIPB 1WA0X 2P5EB 4FFZL 4POYA 5LWYH 3VO0A 5J6GB 2XX0A 4YSSA 3IMSA 5F7MC 2PR9A 4X98A 2BNRB 4NUGH 2Y1YA 3ZZSA 3QUMA 1U8LB 2ZX7A 3NPSC 1MAKA 3VFVB 4Q6IA 2XZCH 1KJ2A 2QQLL 3MRMB 4L4VA 3C5ZC 4MKTA 4R4FL 3UYPB 2XTLA 1E4KA 1U92A 4LLQB 4OAWA 1OY3B 5FO8A 3M1BA 2EIJB 4YGAB 2V33A 5DO8A 1VEPA 3CHSA 3AY2A 3OGOE 4PJ7A 5KVEE 3KLQA 2KKQA 1QSFA 5BQ7B 5E2JA 4W9CC 5D6CB 2WAHA 4WSJA 3CN2A 2BWDA 3T2QA 3KPPA 1RIVH 5KZCB 5MENA 3O8XD 1LMIA 3N9GL 4QRTB 1RK0A 1SEBA 2J8UB 2NNXA 2XZAL 4NQEB 3DIFB 4OCRH 2HPTA 5KBNC 1WWAX 2Z4QA 4MA1C 5AWNH 1MCRA 5A2KH 4PLJC 2AQ3A 2NY3D 4R2GD 3HFMH 2QQQA 4NO2A 1Z7JA 1KJMB 4G1MB 3WU1A 5KS9A 1WZ1L 5D2LF 2EIKB 1DJXA 3DRTB 2VW4A 2LGNA 3CDZA 1MHEA 2A99A 3O45A 4M03A 1E2ZA 4I9WE 3DRQA 4DW2L 2FHCA 4M3HA 3ZT6A 3SDAB 4Z7QE 2X89A 3IJYA 3GJEA 3NH7L 4QHUA 4PS4L 2NY4C 3OJDA 3W2DH 2VLKD 4FTDA 3H6AA 4YH6A 3D05A 1SRDA 1CLVA 3BLKA 5GGUA 5AAWA 4MJ2A 3EG9B 4KXZH 1JGEA 1SQ2N 2QEJA 4U1KA 3SDAD 3QCTL 5HD8D 4FZ8L 2D7NA 3LEYL 3QXUA 4KVNL 3MBWA 1EUTA 3UJIH 4S1RL 5GS1A 4ANUA 1JWMA 2YD8A 4Q6KA 4P5KB 2IGFH 1NL0L 3KM1A 3UTQA 4FNLH 4APQD 3K2KA 2CKBH 4TNVK 4U7KA 1XBRA 1TTRA 3ETBJ 4R9HA 1FL6A 4E42B 3QIUB 5DZOA 3FO2A 3T1FA 3U1PA 4YHLH 3WDHA 2V2TB 1SM3H 2WZ0A 2BHFA 5L9DH 3Q06A 4N90D 4K7PX 4F24A 5E6RB 4TTDD 4HP5A 1TETL 5D7LD 1Q0YH 1MDTA 2P8PB 5D2NA 4OUUA 1E4XL 3I3EA 1MW1A 1KYUA 1Z3GH 4WTQA 2VH5L 1X9LA 3VH8B 1NMBH 1H15A 3CK0H 4WUKH 5C1MB 4P23B 5HHQA 1ZXQA 2ADIB 2BOBB 1EHKB 4EIGB 2R1XB 2IH3A 5EU7C 3LVTA 4HIQA 3DO7A 1AANA 1U33A 2QHRH 3ABMB 2KHAA 3BQUD 3GDCA 4NUQA 2ALWA 2CUHA 4RWYL 1CF8H 1B4JL 4LMQE 3EXLA 3NCFB 2VM4A 2ED9A 5GGVH 3U7YL 1U3YA 1O9WA 4KK8D 5C08E 4QHMA 1X3DA 5J13B 4L3CA 5GJTH 1QSVA 3VSVA 3CBKB 4Z7WA 2HKHH 2WCGA 4EUPA 4JKPH 2YGOA 3VQ2C 4QJ3B 1JDDA 5L8JB 2AJSH 1Q4NX 1K4DB 1X9UA 3QYCA 1BSIA 5BO1L 2ZCHL 3DIVA 1LO5B 4L9LC 4PHXA 5F7KC 1YEFL 5ETUB 4MA7L 4P06A 1YECH 3I9GH 1I1AC 2K8QA 1HTYA 2ZNWA 2AMUA 2BXYA 4KY1H 4F8QA 2EUXA 4DPCX 3RUGE 3GIVA 3O3BB 4BFOA 4HPHA 2BCKB 1QFWL 3WY4A 1G7LA 4AOFA 1UUNA 5D1ZA 3JV4A 1OAZL 2VDPH 4TL5A 2FZ3B 8PAZA 1RURH 5I5RA 4NRYA 4LSSH 4XXCC 4HXAH 3FFCA 1WWBX 4G43B 1I3GL 1KJMA 3QORA 2ROYA 1MPAL 2X4SA 3H9SA 3ARTA 2PLTA 4MCZA 1NOFA 2ZUUA 4R4NC 4GO6B 1QO3B 3DTXA 1HNYA 4HXAL 5IJKC 1MHEB 3O45B 5D6DC 5EO0B 3H9HB 5MEQA 3O4LE 4YZWA 4G83A 5E8DL 3QYNA 2HKAA 2WTRB 4MJ6A 3OLGA 4Z7NE 3F7VA 4WWPA 4ODSH 3GBDA 3CZJA 1RZIA 5DUBB 1CT8B 3ZT7A 1CD8A 1KIRA 3EO1A 5E2UL 3UTZB 4GP5B 1WCBA 1LJMA 2QSQA 1L9RA 2DQEH 2QZQA 1BECA 3MV9D 3TGXA 1EGJH 4JJ5B 5B8CB 3O8XA 2AQRA 5TDPA 1SDYA 2GYSA 3PREA 5F6HJ 2IBZX 1AS8A 2CIKA 2NR6D 2P3YA 4QRUB 4CVWA 5BO1H 4PJFF 1DN0B 3PWUA 4ONHA 4E9SA 4PGJA 2AJSL 3EYVA 3LRKA 2X1WL 1DQQA 5ICYB 5JQ6L 3MRBA 3REWB 5EBLA 3KVPA 1Q1JH 1KULA 2R23B 2YEQA 3QG7H 1N5YH 4JO2L 1KJ2B 1O5PA 2J1XA 3AU0A 3V0HA 4YXKH 4JKMA 3RHWK 3RJQB 3RB7A 2K3TA 2VLJE 4MQXC 5CIPA 3O6FB 5CINL 3MRNA 1J88A 1CFVL 2CUAA 5HYFA 3NRPA 2R29L 1CO1A 2CKBA 5AQ0A 2C4FT 1OWWA 1R46A 5GS0C 2WLZA 2Z7ZA 1A3RH 1BJ1J 1J1PL 4KTYA 5ACZB 5ISZB 2ZWLT 3UDWA 3HE7C 2HJFB 3FU3A 3NSDA 2ORBH 2VDOL 7FABL 4Y2DD 1OE1A 4DVBB 3T0EA 2W07A 4PBWD 2F7IA 1ZLVH 1LK3H 3TJEH 1KCWA 2VISA 2BHUA 1A6UH 5EUOF 2EP6A 3P0VL 1HQ4B 4XPGL 3OV6A 2E7CA 3CFMA 3RKDC 1OT4A 2B3RA 3B5TA 4ILDA 1VAHA 2K6ZA 4WW2F 1MOEA 3JVGA 5I1EL 5GS1C 5IM7A 1NEZB 5DA0B 4HETA 4OFQA 5HPOA 3RUGB 4OZGA 1RUPH 4OZGF 1TKWA 1ASOA 2N7SA 1R5VB 4FLQA 1SDAB 3MOAH 2P5PA 5CU5A 5FW7A 4N0UE 4F2MB 3ZZ1A 3WNJA 1F90H 2CK0L 3KEDA 5I5MA 4YSUA 5K9JL 2E4TA 4KZ0A 4PRHE 4J8RB 2Y5QA 1ZT7B 1IBGH 1G9MH 4LOUD 3AU1A 3C09C 3QI9B 3Q8FA 5J13C 1QTSA 3TFKD 3ATBA 2EEFA 4K9JA 2MKLC 3SBWA 1UB5B 3E2HB 43C9B 1MWAB 3PV6A 4OTXH 3KDMB 1MH5B 2L7EA 1P4UA 3KBEA 3NFNA 1H5BB 2J6EH 4YHYC 1FLRH 1EO7A 3CLEL 5F7UA 4GEIA 1OP3H 4LEOB 1FPTL 5E8EB 3SGDI 4Z0BH 4A55A 5HVWA 1B4LA 4NHCH 3C08H 2Q7AA 1WFOA 4D9RD 2HA1A 3FO2B 3T1FB 1A1NB 4FKKA 1AZRA 1P5UA 3I3BA 1JPSH 1DVZA 2IIJA 5DS2A 4DKDC 4PS3A 1I1FA 4OZFA 4JO8A 2CDFA 5KTEH 1M71A 4OF6A 5IKCB