1CLZL

Igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
DVLMTQIPVSLPVSLGDQASISCRSSQIIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG FAB (IGG3, KAPPA)
publication title The x-ray structure of an anti-tumour antibody in complex with antigen.
pubmed doi rcsb
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1995-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzL01
1MCPL 5IW1B 1V7NH 1GOFA 1FGVH 3WXWH 3IVKB 2DQCL 1K8IB 3MR9B 5HTSA 5T3ZL 4GSDL 3QO1A 4PJHB 3UZEA 4BH8B 5C9KA 2GJZA 3MACL 2FYYA 3LRSA 5K9KB 4UNVA 2XZCH 4ODBD 2BNUA 3P73B 4V1DB 4QHNA 2P24B 4DZBA 4PJ7F 1YECH 2JK5B 2GSIA 4PJ9A 2QQLH 4WWKA 1ZA6A 2I26N 3NFPA 4QTHA 5J1SC 4QGTA 4F3FB 3VFSA 2RB8A 1VPOH 3VFVB 1CDJA 4FFZH 2VITB 3RWGA 4HXBL 1VENA 3ECBA 4JCLA 3QUML 3DROB 5E56A 2YPKB 3G9VA 2ESVD 2QV2A 4UTBL 5CEZE 5JHDD 3OZ9L 3MV7B 4JM2F 5E8EA 3D2UB 4JPKL 5EZLB 3SKNB 1TXKA 4WTWA 4PJFE 3LZFH 8CGTA 4UAOC 2LTQB 4NRYA 2DTMH 2X9YA 4ZG1A 4GAJH 3MV9E 1E28B 2MHAB 1RUQL 1WUNT 1X5AA 5IQ7H 1CTOA 4K7PH 4OZFG 2L7JA 1MRFH 5F88A 3DRTA 5DK2A 3LKPA 4E5XA 1OF2A 2AXJA 3O0RL 3G6AA 4QRPE 4U6YB 2AQ1A 3P0YH 4XMKH 3MBEB 4POUB 1FDLH 3T77B 3N06B 4DJMA 4J6RL 3B4NA 3QJHB 4UDTB 5J11C 2X1QA 4AM0B 4DQOH 5FHAH 5B8CA 4XTRC 1XR8B 4WFHE 1AKJB 3FONB 1O7VA 1IGFH 3ARYA 4JANA 2XA8L 1HHIB 4X8JB 1ZA3A 5MEQB 1OAXL 2VQTA 3HUJF 3ARGD 2N56A 1S7WA 3RWHA 4BZ1H 5F3HB 4CU6A 5FFLA 3KXFE 4XVJH 4Y19E 4YGVB 4FQIL 1F90L 2XQBL 4QGYA 4FQJL 5BQ7A 4IS6B 5I30H 3EDJA 5B39B 1MNUL 3QRGH 5H8DA 4ZPTB 1M05A 4PB9L 3T0EA 1ZKAA 2ZCKH 5IB4B 4G6JH 2HFFA 4XGZB 1WCBA 1X3DA 4C58B 4G43B 5EPMB 1FFRA 1RZ8A 5BOPA 5D1ZA 2N1KA 2ZSWA 4FMKA 1I4FB 4NNXB 4ZSOA 1A1NA 2NY5L 4MD4B 3BD4A 3W82A 1NC4D 1VEPA 2C7UB 3CVHA 1WBZA 4PJ9C 4WWKC 4P5TB 3C5ZD 5C0JB 1J0IA 1OSZB 2NW3B 4G7YH 2XTJC 3MRQA 4RX4A 1JPST 1GSMA 3R0NA 3B2VL 3BPOB 5HPMA 2ZUWA 1N5YL 4H26B 4KRPC 4OGYL 3N50A 3B2UC 3GIZL 1GGCH 5I1AB 1CD8A 3ARFD 2CR6A 5ILTL 1JZ2A 3MBXH 4PJIF 1TCMA 3GSNA 4J3UA 1Q72H 1V7ML 1FNGB 1T4KB 2QR0A 1T1WB 5I8EB 3QR2A 2QQKL 5IHUL 3VI3F 4E41E 1ZSDA 4KRMB 3PGCB 1TNMA 2QJDA 1UXSB 1RHFA 3KPSA 4TNVF 2JE8A 3U9UB 3BPLB 1F6AA 5EU5B 5FUCE 5FO8B 4ZS6C 2YK1L 4EQ2A 3MRDA 1IQWL 3SDXB 4UT6L 2LE9A 1WFOA 3K4ZA 1BREA 2BNQA 3E6FB 4O02L 3GSVB 3FOLA 4NM4H 4UUJB 1T2JA 4NCC1 3BP6B 3OKMA 4MNQB 1KJ3H 2BNRD 1JPGA 4ZUSA 4APQD 5SWSB 4WW2A 4HHAB 2YPLD 5F9AC 4PJFB 5D7LE 3X3GL 4NHUB 5B8CC 1NDGB 4NO0B 3RGHA 1CICB 1IM9B 1MY5A 3FZUD 5E1AA 3MV9B 4ONFL 4LBEA 2GW5A 3O8XD 1XGRB 1YDPB 3GMQA 3WDIA 2NY2D 3EO1A 4XAWH 5LBSL 4RFNC 1QFPA 5CFHA 5KSAB 5AZEL 4XVTH 1HINH 3BXNB 2BY3A 3OTTA 5JW4N 4K23L 1BLNA 4LPWA 2BVEA 2XWTB 1G1CA 4QT5A 2QQNH 1J87A 2FIKA 3MV8E 3TN0B 3P0VH 4QRUA 5D1ZC 1WIUA 4PJXB 1TJIL 4YHNB 5DJDB 4X80L 4L4VA 2CQVA 3EYOB 3R0MA 4TUJB 4KK5C 4KQ4L 4S1QH 5F7HA 3P77B 3KXFB 5GJTH 1NGPL 5DA0B 4OUOA 1C16B 1R5IA 1AGFB 1VFAB 5ID0B 4RA3A 3UAJD 4Q6IA 4GW4B 4LCCB 4X7SL 1ZOXA 3MOQA 4HIHA 3RNKB 1ZTXH 4F7EA 3IFNL 1NBZB 2YUXA 2MCPH 3PABB 4FQCL 5KVMC 4Z7UA 1CL7H 5EIIA 3MLVL 4L9DA 2X44D 4HUWA 2VDOH 1K4DA 3HS0B 1OAYL 2Y36H 1LDSA 3ROOA 5DS8B 1I1FA 2BY0A 3L6FA 4JO4H 4X99B 1HH6B 4XX1E 2OK0L 2BMKA 1N6VA 5ID1B 3S6CA 3BWAB 4PV8A 4XRCA 1NSNH 2X70A 3S98A 1JIBA 3LEXA 3QIBB 3R06B 1EO7A 1A0QH 4X7EC 5DLML 4U6HB 4GG6E 4HIEB 1BZQK 2PETA 5HDBF 4OB5L 3FQNB 4AG4L 4WW2C 5C0EA 1KIQA 2ADFH 3EJYC 3BGFB 3PHOB 2HA1A 5C0GA 5FEBA 2PYEA 4V1DD 2NX5E 5TJWK 3TBWB 3H6JA 3VMNA 3SE9L 4P2OA 3H8NA 1RMFH 2ZWLT 5JOPD 1JRHL 5DRXB 3QG7L 3TO2A 3AU1A 4HFUH 4P9ML 4X6BB 1JGLH 3MXVL 1DBAH 3P11L 1NAMB 2DM7A 1U8IA 2PCPB 3KPPB 1AE6L 3DSNA 5I75B 1FFPB 1E4XI 1DN2A 4WI8A 1FQ9C 2JB5H 3MV7D 1EAPB 1K85A 4P5MB 5JLZB 5CUSL 1HK6A 5AUMA 1R3KB 3QUYA 5JA8B 5CWSA 3VRJA 5GGRB 2D03L 5GSRB 2DL9A 5D7LB 4QOKD 1A14L 4U7KA 3IDIB 5GGQH 2ZG1A 4HIXL 1MLCB 2AABL 3C5SA 4ELME 3KPOB 3PP3H 1G7QB 1P7KA 5IBTL 2OJZL 5KJRH 2H2SC 4ZOBA 4I2XE 2VUYA 1MVUB 1NGXA 2WIIB 2HLAB 3BH8B 3U1SH 1UA6H 3QEGL 4Q6IC 1JGVL 3JVGA 1RZKH 5DO2C 2NR6C 1OB1B 3ZDZF 2G5BA 1NBVH 2C4XA 2OZ4L 2X89D 3ZHDA 4XPHH 1AKJD 5L9DH 2H6PA 1A7RL 3VJ6B 1DL7H 3JUYA 1EXUB 3OKLB 2DYPA 4Y5YB 3WN5A 4PS4L 4XP4L 3L95A 2OR9L 3QUZA 4RBPK 2JCCA 2OXHA 4L3CB 1AFVH 1IZKA 3UBXI 3E6HA 3ES6B 1U95B 2WAHA 5I73B 3EOYG 4JFXA 4MXQD 1BVLB 4PJCA 1I75A 3VE0B 4NO5A 2NY6C 1KEML 3MYZA 2F19L 4S1SH 1INEH 1ACZA 1UM4H 1BD2D 4HS6A 4XBEL 3L5XH 3OAZK 3WFEH 4ZUVB 2VZOA 1TCRA 1F97A 3AS1A 5EO0A 4X7CC 4PRIE 4MB3A 4P2OC 1LP9F 1CDIA 4HGWB 1PLGL 4HUVA 1NGQL 3L7EB 1H3GA 1FL5B 1GC1C 2F8OA 4R7DA 1VSCA 4P2CG 5AG8A 3V5HB 4YAQB 1Q38A 1LNUA 4JQXA 1U93A 4M6ML 1MJJA 1SEBA 1CD0A 5IVXE 5D70L 4AMKL 3DXAA 1QFOA 4H88L 1J10A 1QBAA 5CEYB 5IUSA 3M17B 3QUYC 1UJ3B 4ZPVB 4HV8B 5C2UB 4K3EH 1QKZL 1XH3B 4ZNEA 2W9EH 2XI9A 3J8F7 3IS0X 4ETQB 3W39B 1JJUA 2R4SH 2ZG2A 3REVB 3SDAB 3LOWA 1KN4H 3MRRB 3U2SB 2R29L 5GRUL 3L3JA 4XCEA 5BVPH 4K9EC 2XXCB 4NBXB 1HYSD 2PTUA 1NCAH 4MNQD 1W0VA 4PY8I 5CJ8A 3BP7B 5SWSD 1I7UA 1DUYB 3JVGC 4RZCB 2ATPB 2W65B 3ZE2F 1ZVSA 3TIEB 3W9EA 4GAYA 4CNIB 3VWKA 1NH6A 3IFOA 3FQTB 4HSQA 4NO0D 2CLZB 3C08L 1CICD 3WHXA 5KVFL 4F8QA 1MFAL 2YD1A 2FWOA 4P2RB 3DRQA 4M6AA 2F5AH 1XEDA 3QUZC 3W11D 2QQQA 5DFVC 3EOBB 2FECL 4QY8B 3TVMB 5EU6B 3X14A 4OBSA 5CGYD 5FA3B 1B9ZA 5HJ3B 1KJ2A 4AL8L 1BPVA 2HJLA 3GSWA 5KSAD 5FF6B 3QQ3B 1VFBA 3WSQH 1J8HE 4UT7L 1G7LA 1JN6A 3KYNA 4HG4K 2WM0A 3DURA 3IU3B 4F58L 5HGDA 1KEGL 3WIHA 5HHVL 4DKFH 2EDNA 3TN0D 3WXVL 4FRWA 3VXRA 2EH7L 2FJHA 1UJTA 5F6HJ 4YDVA 3WJLA 4JVWA 2LVCA 3T65A 1U8KA 2F8VA 3MGTB 2YXFA 1SEQH 4RSVA 2ZKHH 2LABA 5BJTB 2DQFB 4JQXC 1LDPL 4XNYH 1RD6A 2ORBL 4ZFZA 4OM1H 2DLIA 2HKHL 5FM8A 5F7EH 2JB6A 3IDYC 3MV01 4P2QA 5DQDH 5SX4H 1OAKL 2J88L 4JO3L 1C7SA 3MLZH 4WV1B 5LGKA 4KHTH 3WS6A 3H42H 1U58A 4WDIB 3ARDB 1D6EA 1YNTA 5GIRB 5DD3L 4DUXA 4HG4J 3QDMA 4XXCA 4Y1AA 1P6FA 3FT3A 4H8WH 1S78C 2CLRB 4F8TA 3AAZB 4GBXB 4MLSA 3VXTA 2A74A 2F5BL 1FO0H 4IIQA 5TDPA 3HFMH 2H3NA 2RIKA 4NGHL 1QSFB 4MX7B 4U1KB 1YMHB 1Y6MR 1FAIH 1W8NA 3ZTNL 4IEFB 2DQTH 3QFDB 4MAYB 4EI5B 3OSKA 3FQXA 1CFQB 1HCVA 1P9MA 3MRKA 3IJSB 1NMCB 1FFNA 1S9YA 2GYSA 4HIJA 3O3BB 5IVXB 3O4LE 4D9RE 5B21A 3MROA 1AQDB 5HHPA 2Y07L 1FL6B 3QEQB 4IMKA 1F3DH 3D6GA 3TBVA 3VXOB 2D7QA 4Z7VA 2D4FA 3VWKC 1R5VB 3E8UL 5DFTA 5C07E 2IWGA 2VXVL 3C8KB 2W07A 3QT2A 4NCC2 4YHMH 3DIFA 4FQPA 4ZO7A 4NO3B 5FA4B 2VDML 5ICYB 1L7IH 3DHJA 1CD1B 1QFWM 5J3HC 1MWAB 2VDPH 2HVJA 4ODWA 3QNZA 1PQZA 4GLRI 4JRYA 3D39E 3MLSL 4DUVA 5KSBF 2QHLA 4NZDA 4CRPA 3P4NB 1ZS8A 3O6LH 4NQVB 1HXYA 3PL6A 4NQCA 1DN0B 5A40E 1IC7H 3WJLC 2X7LA 5E2WH 5SWQB 5I6XC 2P5EE 2P5WE 4JFHD 4DN4H 1AXTL 3ARBA 3TEUA 1OGAB 3CZFB 1RK0B 3LQZB 5BRZE 3O2DH 5EBMA 4ZOEA 3MRGB 2R8SH 3IT8D 2YWYA 1FORL 4U1LA 1DQLL 3HKFA 4WY7H 4KK9C 2IH1A 3Q1SH 4O51B 1NC2D 3I50L 1OTTD 2ITDA 5I15H 4PJAA 4K94C 4DCQB 4M1CC 2R23B 1I1RA 2YUWA 3QO0B 1UWGH 1T2QH 4OT1H 2W91A 5AWNH 2ARJB 3P0GB 3MOAH 4U49A 3LDBC 5GGVH 3UJJL 3V6OE 3WS6C 2Q6WB 1AO7D 1I7ZB 4H25B 3LQAC 4TQEL 1U3JA 2DMCA 3BN3B 3B9DA 1MAML 4WU5A 1IZJA 4HKZA 4KKLD 4XXCC 5E7FA 3D85A 5TGBA 4J3OC 4GRLA 4M43H 4LLVB 1MCNA 4I18A 3GB7A 4PFEA 4DVRH 1A6ZB 1AGDB 3O6FA 2N7AA 1ADQL 1UKQA 3MRMB 1NGYA 2DDQH 3OPZL 3TO4C 1JPFB 1GOGA 1MIMH 5A43C 4JDTL 2AXFB 3SY0A 1YEFH 5F7YC 4UIKL 1JZ5A 3MJ6A 4K8RD 1NCBL 1CE6A 4RDQF 5LJYH 4KK8D 4YXKL 4GW1A 5DYOA 1A7OH 3VDAA 2AJUH 4ODHH 5BV7C 5E8NA 3JTTB 1HILB 3VCLA 2A6KB 2VQ1B 3RTQA 4NUGH 1JPTL 1V7NL 5KS9E 5CKGA 5L0QB 2VISB 4F7TA 3MNVB 1QFWL 4BSJA 3NCYS 4JFEA 1JRHI 3OB8A 3VXMA 5KVEH 1OLZA 4TPRL 3ULUE 5IBUB 2WWKT 3OJDB 2ZOKA 2KBGA 3BVNA 4LQ1A 2KUTA 3RI5F 3EFDL 1FG9C 4XB8A 2IMMA 3MJ8A 2H8PA 1Q1JL 5C0BE 4Q0XH 5E4EC 3ARBC 5IWLA 5H2BA 5C07B 5CBEA 1MREH 3VXPB 1A6VH 2JJUA 5ALCH 2N7BA 3VFTB 3IDJB 4WUUB 3REWB 5A16A 3SDAD 4YBQD 3CFBA 4S11A 2DKMA 1CDHA 3DECA 4M3KB 4NOFA 1ZLUH 2CIKA 5KZCB 4W4NA 3C2AH 3F7VA 2DQGH 4F2MA 1B0RA 5GS1C 3QA3B 5I1CL 1WK0A 4G9DA 4YEEA 4CKVX 2VAAA 5D93B 4JG0H 1U8NA 4R7NA 5DC0A 4H20H 4M61B 1F4YH 4CMHC 1D5IH 3ZKXB 1E6OH 1NBYB 1L9MA 3LZFL 4QXTA 3E3QE 3MRIB 5HDOA 4KKNA 4YFEA 2R2HA 1WWBX 2O93L 4M93C 3DX6B 2X2YA 1LEKB 1OPGL 4GFTB 4P2RD 5HI3C 3UTTE 1L0QA 3G5VA 1QVOB 4GRLC 3RVVD 3VXSA 2ICEA 3RWFA 1IGTA 1DBBH 1KCRL 2PXYA 5IQ7L 5EU6D 1KXQE 2NTSP 3PHSA 3IXTB 1DQQA 4G9FA 3U79A 1RURH 2VN4A 5GS0C 1B6DA 3JV4A 5HYQA 3GBLA 4FQ1L 4I0KA 1KNOB 5JPNA 2OTPA 5KANG 4HWBH 4JZJB 1BQHA 5IB5A 1DVFA 3MRFB 2OTUB 3IF1A 4KI1A 3VWJC 3B5HA 4YHKH 1OW0C 1XZ0A 3DI2B 2GJ6A 3JWOC 3PWJB 1EEUA 5ACLA 3LKRB 1GGIL 2VJXA 4M7ZC 2QSTA 4NO2A 4LCWD 1YNKL 1MWAL 2BVUA 3RTQC 5F96H 3KJ6H 4N0YH 1CQYA 3Q3GA 5CP3H 3PV6A 3HI5L 3MUGB 43CAA 5KG9A 5D9SB 5E95B 5DD6A 2UZIH 3FB5B 1N0XL 1R3JB 2HJFB 3QRGL 4FOMA 3HTLX 2VE6B 1QNZL 5IT2H 4LFHD 4G6JL 2X09A 2CUMA 2VTFA 1MHCB 3WS3B 3PWLB 5EZJA 4NNYB 5E24E 4MJIB 4NNPH 2A6JA 3ARDD 1X5KA 4NWTL 1WZMA 2F53E 4NJ9H 5ETUB 1FYTA 1U8JA 5JMOC 4S10A 3H3PH 1KN2H 4R0LB 4N0CC 3WO4C 2VKXA 5I1IH 4MQXC 4GBXD 3QG6B 3TBSB 1QSFD 1IVLA 2EDFA 1I9RH 2H9GB 3F6LA 4KJQC 5KAQF 4POZD 3VGBA 4X5WB 1CLOH 3F7RA 4MAYD 1E4WL 4EI5D 2Z92A 4M7JH 4Z7WB 5KS9B 1Q9OA 5EORH 2QKIB 4RFEA 2IAND 4JRXD 1U8MA 2H32H 4I4WA 3QEQD 1PZ5B 5KOMC 4S1RL 1KIRA 3JTSB 4E42B 3VXNA 1CFSB 1C12A 2JIXA 1EEYA 4PJ7E 5ADOH 4KVNH 4D8PA 3AFLA 3GRWA 3U30B 1B0GA 1C1EH 1UB6B 4FQQB 3LH2L 4PRHE 5C0BB 2AP2A 2DMBA 2MWCA 3PIQA 3EOAA 4F33A 5ISZD 1Z2KA 1RHHA 3BFOA 5CCKH 4YDLC 4XP9L 5HGHA 4J2XA 5L7XL 1YEGH 1IT9L 5FO9A 4U6VH 3VXQB 3GK8H 5EBWB 3NZ8A 1D5BB 2DQDH 1FFOB 1ZWIA 5BZDB 2J6EA 2X4PA 1QR4A 4Z0BL 1QA9A 1ONQA 3BQUA 4TNVK 3ZSSA 4E0RA 1FZJB 2QSCH 2FECI 5CIPH 5TDOA 3GIVB 4ZS7L 4N1CA 1DVFC 4ZXBB 5C0AA 1TDQA 1R3HB 4X4YA 1OGAD 1OAUH 4K3HA 2XKSA 2FJFA 1MCCA 1MEXL 3IJHB 2AJ3B 4YDIH 1LVEA 4S1DC 2B5IC 4EKXA 3V5DA 3UTTB 1UVQB 3W0WB 4NFDA 2O5YL 2B2XH 3IRZA 3U7WL 5HHOB 3O6KH 4YHLH 2F9BT 4LSQL 3VFWB 5LXGH 5HGAB 3ZYIA 2XKNA 3L3IB 1Q9WB 3BDYL 5LGHL 1NCDL 2VMFA 3G5XA 3QDJE 4Z0XA 4XC1L 2QQNL 4WFFD 1Z5LB 2CRZA 2HRPL 3P0VL 3D18A 1PKQE 5DUPL 2NY0D 2DRUA 1JPSL 4LVNB 3ULVH 2A0LD 2J8UA 4XP1H 3NN8A 3O3EB 5HDQH 1IGJA 3PJSB 3RUGA 2GK0A 1NANH 2ESVA 3O3DB 5JHDA 2FX8H 3CVHH 1G7HB 5CSGA 1HIMH 4ELKB 2NXZB 2DWEA 5FKAA 4FFYH 2E6JA 3QCTH 5DD5L 4GMSH 3QHFH 4NKQB 5HHME 2Q76B 5K33A 1OCWH 4IRZL 1N6QH 3VH8A 5DJ0B 1DQML 4EUPA 3MA9H 4LPTA 4GUPA 1D9KD 3CMGA 1ZTXL 4TTDD 4YIQB 4R9HA 1F4HA 1J0ZA 5C1MB 1RI8A 2HFTA 4Q9QL 3UYPA 1MCOL 1XR9B 3GSNH 4U3CA 2VDOL 2XZQL 2F53B 5FHBH 4HCRA 2LQRA 5FECB 2YA0A 1ZLUK 2X4OB 3LKQB 2R4RH 4O2FA 3MUHL 1BIIA 4U6XA 2AJXH 4JFFE 2LAAA 4TVSa 4W6YB 3HMWH 5L6YL 4WFEE 2Z4QA 3GSXA 4OFKA 3WE6B 5J89A 2ZSVB 5TDNA 4KHXL 4OFVA 1MJ8L 4OI9A 1K2DA 3TFKD 4UQ3B 3MCKA 1BWMA 1X5LA 3EO0B 2P46B 1HXMB 2ZJSL 4XNXL 1OGTB 4HMCA 1TZIA 3T1WA 3EHBD 3ILQC 2EH8H 1DANT 1YY9C 3ARGA 2DQIL 3EYSL 2AI0H 5KW9L 1LK2B 4WUUD 5DC4B 4DGIH 5I2IB 4PRHB 1VGEH 3QUMA 2VWEE 4ODTL 4FNLH 3L3HB 5CINH 1MQKH 3C9NA 1ORQB 1M6OB 2DM3A 1X7QA 5CEXA 4JM2B 2XPGB 3H3BC 1KTDA 1PDKA 3Q5OA 5I0DA 4P3CL 1JHLH 1NC4A 1CGSH 3C5JB 1KELH 2VDLL 1H8NA 1BBJA 2WBJD 1IC1A 1W8OA 4WHYG 3C5ZA 1RJLA 5E8OA 4LKXB 1JZ4A 1HHJB 3D0LA 3D25A 1C7TA 4HK0B 4NN6C 4JG1L 2HT4D 5MEPA 2PF6A 3ARFA 4L29B 3S5LB 4JO1H 1I9JH 5KJRL 1HOCA 5ERWA 5C6TL 3G04A 4P4RA 4XXDA 4X6DF 5GRVK 4LCIL 4XCFH 1E0OB 4L3AA 4P59H 3ULUL 1N2RB 3PWVA 2CD0A 5M7QA 4MNHB 3W5NA 1WAAA 3HC0B 1S9KC 5KOVC 2X1XR 5ITFA 1PBYA 2EYSB 4M6NL 4X4ZA 5EZOH 5FDYA 1DL7L 4MA7H 4TN9A 5DJZA 3E2HB 4QRSA 4UMGA 3VGEA 4XWOD 3RKPA 5ELIA 3HUJB 3MA7B 3V0WH 5TFSH 3TNMA 4PJEA 4PJ5B 2A9NL 5GZOD 3CZJA 3KPMB 2AXGA 5DF0A 1L0XA 4ZTPH 3ZMRA 4APQA 2YPLA 4UQ2B 4CVZA 5GSVA 4MA3B 1INEL 1UM4L 1MCSA 4YX2H 1WZ1H 4MJID 3L3DA 1BEYH 5DK3A 1HWHB 4S2SB 3UTQB 1LEGB 3ARGC 1QBLH 1QFWI 4LVHB 1AD9B 3V5KB 1K4CA 3PWUA 4R4FH 2VL5A 3Q6GL 2PR4H 3O6MH 4M7LT 4OIBA 2O61A 3A6CH 1PG7X 2CMRL 1KLUB 3RZCB 2A77L 3TCXA 3CDFA 4P23B 1RZGA 4OCMC 5I1LB 2F74B 4GG8A 4LSTL 3PP4L 1GC1H 3IGAB 1EGJH 1XF3B 2P8LA 5IKCA 1H3PL 5DD1H 5FGSA 4XPGL 4XT1C 4PJIB 1FSKB 4YQXH 3U4EB 1QO3B 3F7YA 4O9HH 3ZKMD 6CGTA 1DLHB 1IFHL 4J3TA 4NBYB 1S7XA 3UPRA 3C5ZC 3BW9A 2W9EL 3BPCB 4XC3L 4D0DA 2A83B 4WO4B 5IMLA 2EKSB 3GSUB 4QWWD 1PVHA 2BVQA 4EVNB 3PHQA 3K4DA 4P4KB 3ARFC 3VFMA 5GS2H 2NY7L 4ZUWA 5FYLH 3G6JE 4PJGE 1BQHG 4FXLA 4N1HB 1OP5K 3TYGH 1OARH 3MRPA 3D0VA 5E9DE 2Y23A 3TPUB 1NPUA 3U36B 3KPRB 5HY9B 4ZXBD 2B7DT 3BH9B 3BJ91 1QSED 2HLFD 4PUBH 2WIMA 2CRYA 5IW1A 3LEVH 1TJGH 1DSFH 4NZUH 5LCVL 3CSGA 3IVKA 1K8IA 3HI6L 3MR9A 3ULSB 4LARH 4MAUL 3W0WD 3EW3B 4HWNA 1YEJL 3BX7C 3G6DL 4PJHA 5FB8B 3QWQB 4BH8A 5HHOD 5K9KA 4MQ7B 1HZHH 4APQC 5E5MB 3P73A 3GNMH 4UU9B 4V1DA 4KXZI 2V2TB 3M8OL 2P24A 1XGPB 2JK5A 4L8CB 4C55A 4FMFA 5GRJL 2XA3A 3FZUC 4QXUH 3VFVA 35C8L 3MRLB 4JKWA 2VITA 4K3JH 3R4DA 2OI9B 3DROA 3O8XC 2YPKA 1DBJL 2NY2C 4Y2DB 4WEBL 4GOSA 2O26U 2X4SB 3MV7A 4U3XA 3D2UA 5I18H 5CLWA 1UZ6F 2I9LB 2NXZD 3GO1H 1TENA 5E2TH 1XF5B 1DQTA 5EZLA 3SKNA 5BMFL 4OM1L 3WLBB 3GKWL 3AS2A 3I85A 2XV6B 4OGXL 4UOW0 1J1XH 1B90A 3M07A 2IG2L 4U1GC 1ORSB 1BOYA 4FZEH 3NOIA 1OVZA 4JFYB 4L8SB 3G9AB 4PY7B 4ZO9A 1YEHH 1E28A 1LP9E 2MHAA 3LSOB 4O58L 4L4TD 2Y9RT 3SDYH 4BQCA 4PG9B 3PNWB 1UB5B 2P8MB 3BT2L 1BMGA 2VN7A 3MLUH 2Y4SA 2C1PB 3IXAB 2UY7A 3ETBF 3H9SB 3S37H 2V17H 4U6YA 4MB4A 4MVBD 4MCZB 3DLQR 3MBEA 3HR5B 4XMPH 3STLB 3UAJC 3T77A 5B38A 1TZGL 3QJHA 4UDTA 5D7KD 4AM0A 5J12C 2X89A 3FN0H 1XR8A 1AKJA 3FONA 4KAQL 1KTKE 2A6IA 3DVGB 3O11B 1HHIA 4XVUD 5MEQA 5HPOA 5T5NF 2DS4A 6FABH 2FCBA 4W70A 4C59B 4RAUB 1LO3H 1JV5B 1UQSB 4M3JA 5F3HA 1EHAA 4HC1H 1ODAA 1FYHB 2D7TH 4U7SA 1MFDH 3L5IA 4I48B 4YGVA 4EIZC 5HHQB 3O9WB 4IS6A 3IDNB 5B39A 3NFNB 1ZV5A 4Y4FD 1OP3H 2BOBB 4ZPTA 5IB4A 2F8XC 4XGZA 4AJ0A 1A7QL 1DLFH 4G43A 5EPMA 3BP5B 1ZAGA 2BFVL 2XY1A 1I4FA 4NNXA 4PJBE 4MD4A 1N0LA 1U8LB 5JMRA 1YMMD 2C7UA 1TIUA 2A73B 4P5TA 5DRWB 5C0JA 2NW3A 4NJAH 4Z76B 5E2WL 3WIHH 2AEWA 4LLQB 2HTLD 2J3SA 1NLDL 4XPTH 1RJZB 2OR7A 4H26A 1YN7B 5I1AA 4D94A 1P2CB 4Y88A 1MI5E 3K4AA 1CDYA 1FNGA 1T1WA 4UV4H 3UBXG 5EA0L 5I8EA 4EUPG 1WQVT 1YJDH 2IJ0C 1B2WH 5MENE 4HPYL 5GGTA 2E7LA 3PGCA 1XT5A 2LTQC 4ONGH 4NQXB 1UXSA 3ARPA 1JNNH 2FGZA 3FHAA 5GGVL 2H32B 7FABH 4CVWA 3U9UA 4LL9A 5EU5A 4BJLA 1IC4H 4RFOL 5FO8A 2W0KA 3I9GH 3SDXA 5E8EB 4K3GA 4KGJA 3E6FA 4DK3A 4PJ5D 4D0BB 4M43L 5CZVL 4UUJA 5LQBL 4QXWA 3BP6A 4MNQA 2W9DH 4JHAH 2Z8RA 3IDMB 1J11A 4GKOA 5SWSA 4HHAA 5HGGS 4B5EA 4PJFA 5K59F 4WEUD 4L9LB 1FLRL 3CCHB 3WNLA 4IHOB 3KJ4C 1MIML 4NHUA 5I1DB 4NO0A 3QIUB 3OKNB 1CICA 1YQ2A 5BVJB 5DR5L 1IM9A 1W72L 2IALB 5T33H 4HWZB 2DI9A 2XQYG 2YRZA 2AEQL 1TLKA 1EERB 5EOQH 4E5XB 2B4CH 3MV9A 2XXMB 1LP9B 5CIPB 3NGBB 1F11B 1RUPH 1CGWA 2DLFH 1XGRA 2VQUA 1YDPA 4YEFA 3RZCD 4KKCD 2EDLA 1LWRA 4OTXH 3HRPA 4MXQC 5KSAA 3AREB 5I76B 3BXNA 4LLUB 5HVHB 1YNLH 1T7YA 2DJSA 5BV7H 2XWTA 4I77H 4POYA 2XN9E 3D48R 3TN0A 3I2CL 1VKXB 3DX7B 4PJXA 4Z7QF 2HMID 4YHNA 5DJDA 4AEHL 1ES0B 4N8PA 3RU8H 2I25N 5DMIH 3EYOA 4MCYB 5EG6C 4CW1B 1S7UB 4TUJA 4WO4D 1A6VL 2EEAA 3P77A 3U7YH 4JGJA 3BPOC 3KXFA 5ALCL 1C16A 3NZHH 1AGFA 1VFAA 5ID0A 1QTYT 4KTDH 3RI5K 2FD6L 4GW4A 4LCCA 2V2WB 5D5ME 3E1F1 4QKXB 1CFTA 3C2AL 3RNKA 5KSBE 3MLXH 5ENWB 1NBZA 3EDFA 4YHPB 3PABA 1FNLA 2E7LC 3TV3L 3ARRA 4KVCL 4PJDF 3HS0A 1D5IL 5JOFB 1E6OL 4LQFH 3KPRD 3K2UH 5IW6B 4MNGE 1IGCL 5DS8A 3BPLC 1ZHNB 1ZMYA 3MOBL 4LKCB 2B1HH 4RAHA 5IG7B 2APVA 4QRQB 4X99A 1HH6A 1T6VN 1U3HD 5ID1A 4FA8A 2YZ1A 3BWAA 2OTWA 3KWWB 5DTFB 1BFTA 3QIBA 2VO5A 3R06A 4FXGB 1HYSC 3OGOE 4U6HA 2VLRB 4HIEA 4ZD3L 1MCHA 3C87A 1MJUL 3QIWB 4WHYH 5C70A 5EUOF 3PHOA 3EIFA 3VFPB 2R56H 4N68A 1LILA 1CGYA 5J1AB 1RURL 3TBWA 3TNNB 2I5YH 3SDDB 1CICC 1ZT4B 2IBBA 1YA5A 1Y0LB 5DRXA 4GAGL 3FL7A 3EOTL 1FL3B 4X6BA 4YHKL 3W11C 4MSWB 4ENED 2V5SA 3FFCB 1ZANH 2PCPA 1JPGB 3HC3H 3KPPA 3UJIL 2WMPA 2WWMC 4Y2DD 1FFPA 1Z0NA 5CGYC 2NY3B 3KVQA 5DUMH 5KSAC 1EAPA 4P5MA 5JLZA 5F96L 1PAMA 3MFFB 1KV3A 1R3KA 1S3KL 3TWCH 3KLDA 1RFDH 3TN0C 3BGAA 1W2KT 5GGRA 3HPJB 4GQ9H 5GSRA 2F54E 5D7LA 5EOCH 4R8WH 4G6KH 3IDIA 1NLBL 5GRVL 4PGZA 1MLCA 5DRNB 4MA1B 2VXTH 2X05A 3KPOA 3EDKA 4Q58C 5C09B 1G7QA 1A3QA 3VFNB 5I1IL 3FO1B 3DMMB 3H9SD 2IGFH 1G9EA 3S88H 2DM2A 5JXAL 4UV7H 4OF5A 3QXDB 2WIIA 1MVUA 3BH8A 2HLAA 3TT1L 5F7WC 4LCCC 1LO2L 1OB1A 4RISH 3CX5K 1A9EB 2B20A 4YUEL 1CXHA 3P9WB 1N4XH 3CH8A 1A3LH 3HNVH 1FBIH 4OI8A 4LASH 3DSFH 1EX0A 3VJ6A 2BOCB 2Z0BA 4OFYD 4OQTL 1IGIL 2OM5A 3OKLA 4OD1H 4Y5YA 2ARJQ 2R0KL 1LK3L 1NEZB 5DMYA 4L3CA 1KCVH 2DKSA 4LVOC 3SGJA 4MS8D 1UZ8B 3O9WD 4ZMAT 3ES6A 2VRAA 1U95A 2ZNXA 1YPZF 3PGFH 1BVLA 3E0GA 3S7GA 3KPLB 3VE0A 1S7TB 5TPWL 1YEGL 1FCGA 3D87B 3FT4B 1JYXA 4H0HB 4OIAA 3CUPB 4ZUVA 3BGFC 3GSQB 1CQKA 5CSBA 1DBKH 3EO9H 5KSBB 1VA9A 3CFKB 4HGWA 1I9IH 3BIBX 4HS8H 5C3LD 2ATKB 1A3RL 3L7EA 4IM8A 1FL5A 3SHSA 3CX5J 3V5HA 4YAQA 4LGPB 1UH2A 1URLA 4XP5H 3NPSB 5JUEL 5H37G 2J5LB 1J5OL 4RGNE 2X40A 3QCUL 4M48H 5CEYA 3WV0A 1WFUA 3OAUH 3M17A 4DOHB 4YHLL 1Z3GH 3FAWA 2ZP0T 1UJ3A 1UKSA 4ZPVA 4HV8A 1ZLSH 4BUHA 1XH3A 4JFZH 3AGVA 1QUNA 2DM4A 2OX5A 2KH2B 3MV11 2H2PC 4CVXB 4L5FH 1WZLA 1CLYH 4ETQA 4OFDA 3W39A 4KZDH 3QHZL 3REVA 3SDAA 4KMLB 3MRRA 3U2SA 3NCJH 4MJ6B 1J05B 3F62A 2W60B 3GMRB 5D2LF 1FGNH 1OTTC 5TQ2H 4M62L 5IFJB 5I1GH 2HT2D 5B38G 4G42B 2ZPKL 1KFAH 3BP7A 4DW2H 2XYCA 5B3JF 1DUYA 2DD8L 1HIML 4RZCA 1H3VA 2ATPA 4YBHA 3SJVB 2W65A 3TIEA 1A7PH 3RWJB 4FFYL 4CNIA 4OCXH 1MHPL 1O0VA 3FQTA 3LV3B 2CLZA 3QIUD 1SJEB 2E7CA 3QISA 4BZYA 3MA9L 1S9XB 3BUYB 2P7TB 4Y5YC 4P2RA 4KKLC 2XIDA 2YD4A 3EOBA 5B39G 1I85A 4QY8A 4M8VA 3BWUC 4JREB 4NQEB 3TVMA 5EU6A 5FA3A 5HJ3A 1EO8L 5I73C 4QLRA 5FF6A 3QQ3A 3ARED 2R2EA 4LAQH 2AJXL 1T0MB 3IU3A 3FAXA 3QDGE 3WN5B 2BY1A 1KJVB 4K8RC 4NHCL 1WEJH 4N9GB 1SYVB 2ICWI 4R4ND 4BQ8A 1BP3B 1BQSA 3WFZA 3DOSA 5C0RL 1OL0A 1KF9B 2DBJA 4OZGE 4YE4L 3VFOB 3E6HB 3MGTA 5IV2B 3T0XA 2J8HA 1SMOA 1CFVH 2NW2B 3V9FA 3NCMA 4JCMA 3T0ED 5BJTA 1A47A 1KB5L 2DQFA 3MLWH 2AI0L 3ULVD 1E4XH 2ZCLL 1UH4A 4HFWB 4KMTL 1PG7W 4KH2A 1MQKL 1Q9KB 3ZSTA 3VGGA 4WV1A 4M4RA 3CNKA 4ZFFA 2XZAH 1JGEB 4WDIA 4GS7B 2EDDA 1H3XA 4RX4D 3OKEB 3WUWB 5GIRA 1QRNE 3F12B 4JFDE 1FIEA 5F7DB 1AC6A 4YXHL 1XAUA 2CLRA 1I8MB 3AAZA 4GBXA 4JDZB 2X4RB 1B6UA 1MRDL 1QSFA 3SDAC 4YBQC 2BDNH 4MX7A 4UIMB 4OZIE 4U1KA 3U83A 1YMHA 4BH7B 4RWYH 5DJ6B 1G7MB 3QFDA 4HULB 1SHMA 3WFBH 4MAYA 4EI5A 3WL9B 1CFQA 3CD4A 3IJSA 3PDDA 3FN9A 5IVXA 2VLRD 3O3BA 2OL3L 1JHKL 1AQDA 4OLYH 3SCMB 1G9ML 1W0WB 1FL6A 3KPSD 3QEQA 3QIWD 4RAVB 1A6WL 1VCAA 3VXOA 5FGBA 1BJ1J 1R5VA 4RQQB 4P59L 1UENA 2BHZA 3SDDD 5E08L 5JW3L 4OV6F 4X6FB 3C8KA 4B53A 4Y2OA 4MHHI 3ZL4H 1CZ8H 4LRNL 3S35H 2ITCB 1K6QH 1BBDL 4F9LA 2D9QB 4G6FB 4HAFA 2GSGB 3F6IA 5EZOL 3RVVC 3FFCD 4NO3A 1I85C 5FA4A 1CVSC 2ZUQB 3MGAA 5ICYA 2YMXL 1MFCL 1YC7A 1CD1A 3BYTA 2NY3D 4MJ5B 1MWAA 5F1SA 3W9EB 3GJFH 1OAQH 2CIIB 2UVEA 4JO2H 2VZTA 5C08E 3HC4H 3F8UB 1OQOA 1MCPH 3HNSH 4B41A 3P4NA 3DX8B 3DRQB 3S36X 4NQVA 4U4BA 1DN0A 5C71A 3KS0H 5SWQA 5T3ZH 3RVUD 2NYYD 4GSDH 3BSZH 4YX2L 1OGAA 3CZFA 1RK0A 3LQZA 1BEYL 3UTSE 1GXEA 3ARTA 3MACH 5D7JB 2HJLB 5C09D 3MRGA 4N0UE 4ODVH 4WUKL 3LKSB 4O51A 5D2NB 4HJ0D 4JQVA 3BZEB 4DCQA 2R23A 3QO0A 5B4MD 1GH7A 4GMTL 4R97C 2VSDA 4CN4A 4K71C 2ARJA 4HXBH 4L4VD 2BRRL 3ARVA 3K81A 2Y72A 3QUMH 4WV1C 2Q6WA 1LO4L 1I7ZA 4H25A 4Q9RL 2PUQT 5INCA 1EZVX 5I1EL 3ARDC 4JFQB 3KLSA 4UTBH 5IR1B 1Z0MA 3OZ9H 4ALAL 1I3GH 4JPKH 4OCRH 5GZNC 1IAOB 3UPAA 4YHZL 4GBXC 4HGKC 4LLVA 1A6ZA 1AGDA 1X5XA 2R15A 2VDRH 1X4YA 4POZC 3V6FB 4MWFB 3MRMA 4MAYC 4EI5C 1KCSH 3S4SG 5FDWB 4RA0C 1NMCC 4ERSL 2NTFB 1JPFA 1RUQH 2AXFA 1QLFB 4EDWL 5FGBC 5FYLL 2ZUSA 3O0RH 4JPWH 5DQ9B 4HUNB 5DJ2B 4F9LC 5EC1B 1RJCA 3I3EA 3JTTA 1HILA 3MRBB 4J6RH 4PGBA 4E9LA 2A6KA 4CADB 2VQ1A 4Y5XC 1M7DB 1KGCE 3LEVL 4EN3B 1EDQA 1DSFL 2M1KA 4IMLB 4AEIL 2XA8H 2VISA 1FN4A 1AGEA 3MNVA 3FO9B 1OAXH 1KPUB 4X6DE 2G5RA 4BFIB 4M1DH 3OJDA 5E94B 4LDOB 1HZHL 4K7FB 4A6YH 2HH0L 2C3XA 1A6TB 2QADD 2XQBH 3QP3A 4FQJH 1IE5A 2A38A 2YPVL 4V2CB 2ERJB 3RP1A 3FO2B 2GHWB 3ISWA 4PB9H 5C07A 4M7LL 3VXPA 5I1KH 5D6CB 3VFTA 5F7UA 3IDJA 4WUUA 3REWA 5CZKA 5L88H 1H3UA 2G75B 2ZCHL 3VW3L 1R24B 3VD4A 2NY5H 4NKMB 4OD2B 4JQVC 1HNFA 3DJ9A 1NGZB 4LF3B 4K2UL 3EYUL 1GAFH 3QA3A 2VC2L 2XY2A 3SJVD 5E2TL 1JF6A 2FSEB 4M61A 1CVRA 2X4TB 1NBYA 1TZHB 3B2VH 1UACL 5GS2D 5C08B 3MRIA 1N5YH 1I1YB 4OGYH 1MF2H 3GIZH 3BHBB 5FYLD 3FJTA 4GAFB 2NY0C 3DX6A 5J13B 5ILTH 1LEKA 2FIRT 2A0LC 2Z8SA 1V7MH 1QVOA 2WUBH 3DGCR 3DX9B 3SDYL 4GG6F 5JW5B 4NZTL 4NQED 5CHNB 3VDCA 1U6AL 1VB9A 4F9PA 3RX7A 1TJHL 1RZIB 3IXTA 2DI8A 1ZLWK 4QHKI 1EK3A 2MOVA 4LU5L 4YK4B 5IGXL 5CJOL 1JWUB 1QSZA 4PLJD 5JZ7C 1KNOA 2YK1H 3BPNB 1ZGLB 5K9JL 2DYPD 1NFIB 1T5XB 4JZJA 4UT6H 1LO0L 1L7TL 1MCWM 5D7IF 1D9KC 5DMKB 4O02H 4TTDC 3FN0L 3MRFA 4XH2B 3V6OA 4MA8L 5SWZE 2OTUA 3NBNA 3PWJA 5GPRA 2CDFB 3LKRA 5DURB 3K8MA 4J12A 2C3VB 4MXVE 2X9WA 4XX1G 4Y8AA 1FG2B 4HC1L 3ALXA 1T6WA 4M5ZL 15C8L 4AH2B 3IETB 3L1OL 2X4UB 3GSRB 3MUGA 3UEZA 1YC8A 4KI5D 5D9SA 5L0QC 1QYGL 3MZGB 2Q86B 1R3JA 2HJFA 1HDMB 2VE6A 3O3AB 3RBGA 1IL1B 4ONFH 2KZ1B 3TFKC 3X13B 3QXAB 1MHCA 1U91B 4ZUUB 3WS3A 3PWLA 4ELMF 4NNYA 1OLLA 4MJIA 1GHFH 3FB8B 5ETUA 3EHBC 5LBSH 2VLLB 2ENSA 5AZEH 3UYOD 1Q8MA 4R0LA 2BC4B 4I0CC 4K23H 3CSBA 3QG6A 4NPYB 2DTSA 2H9GA 1XIWB 3ALPA 1JVKA 4X5WA 1I8KB 3JWDH 1HNGA 1TJIH 3S97C 4X80H 4BK4A 1CK0H 4P46B 5KS9A 1JFQL 4N8VB 1OT1A 1PX4A 2QKIA 3SCMD 4NC1E 4IRSB 5D93C 1PZ5A 2CGRH 4X6DB 3JTSA 4E42A 5DGQA 1CFSA 4KQ4H 3ZKXC 1YJDL 1NGPH 5EU3B 1C5BL 2ED7A 2WBJC 5J7CC 4BKLB 1UB6A 4X9GA 4FQQA 1MFEL 5C0BA 3TZVB 1F8TH 4X7SH 4TSAL 4PGJA 1IC4L 3ARSA 4C4KT 2HYMA 4F2MB 1P53A 3IFNH 2HT4C 1AI1H 1MCBA 1Z9SA 4RNRB 4U1NB 2C9AA 4F9PC 3MLVH 3VXQA 1JHTB 3DTXB 3T0BA 1DCLA 5EBWA 3SO3C 1D5BA 4DFHA 1YEDB 1ZGLM 4OKVB 5F93C 1FFOA 2XFXB 5BZDA 3NIDE 1GIGH 5E00B 4ZTOL 1FNHA 1AHWB 4HZAA 1MCRA 1FZJA 3V0AC 3OJVC 4JZJC 2OK0H 3GIVA 1U2CA 3BI9X 3V6OC 3GMLB 4ZXBA 3PWPB 1R3HA 2D31A 4LHUB 1MHEB 1OD7A 4RGOL 2Q87A 2IPUG 4OB5H 4XWOC 3EGSB 3IJHA 1U92B 4XCNA 5DDHB 4AG4H 5JA9A 3UTTA 5DT1L 3WFHB 2R0ZH 2EXWD 3BMVA 2I07B 1UVQA 1CCZA 3O45B 3W0WA 5MHSD 1RUPL 3J7HA 3SE9H 5DZNA 4PRPE 5GZOC 4LEOB 1NL0L 1HKFA 1P4LB 5HHOA 5B3NA 4M02A 1JRHH 3VFWA 5HGAA 5KVGL 1MCLA 2GQHA 3FB7B 3L3IA 1Q9WA 4P9MH 5IBLC 2GJ6B 3P11H 2Q7YB 3U6RB 1Z5LA 1AE6H 4QRRE 5K9QI 1TITA 3UTPD 5K9OB 1S7RB 1CF8L 4R0LC 5SWZB 3C09B 1FRGL 5CUSH 2VLJB 1EPFA 1VACB 4YC2C 4KDTA 4M1CD 1F58L 3O3EA 3PJSA 4H1LH 1CXIA 3O3DA 5CSZB 3MRCB 3QFJE 4NQDE 1G7HA 3RAJL 3VG9C 4ELKA 1A14H 4OI7A 2RHEA 4L8BB 4HIXH 3W81A 2AABH 2M2DA 5IIEB 5DFWH 3T3MF 4PY8J 5DJ0A 3LAFA 5L2KB 4Y1AD 1T1XB 4WU7B 5IBTH 1Q94B 4YIQA 3ZKMC 1XR9A 2B39A 4KTEL 4P5KB 4ODUB 2F53A 2OQJB 2FATL 3FO0L 5FECA 5DEGB 1JGVH 5JNYB 1C5CL 4NQUA 3SGEI 4QWWC 2GT9B 1QLRB 2X4OA 3LKQA 2OZ4H 3U0PB 1PFCA 2OSLB 4PLOB 2L7UA 4EN3D 2NXYB 3WE6A 2ZSVA 4OM0L 4U1MB 4BYHA 5DRZB 1OWRM 2Z35B 4PS4H 1E27B 2FLBT 4XP4H 2YKLH 2OR9H 4UQ3A 4JJ5B 3LEYL 5AAWA 3EO0A 1BGXH 1HXMA 1OGTA 2MMXA 1HCFX 4ZFOB 2XTJE 3IFLH 1QACA 4OCYL 4PJ7A 4ZXBC 3CAFA 4MJ2A 5BXFB 4LSRL 2HLFC 2F19H 1S9VB 3SOBL 3T1FB 1LK2A 4FN0A 5I2IA 4XBEH 3ELAT 4PRHA 1RPQA 3VMPA 5HI4D 3ZLQC 4JRYD 3L3HA 4BFBD 5DHXB 5HBBA 5HVWA 1JYVA 1ZANL 4GXVL 1ORQA 1M6OA 5L8LB 1PLGH 1NGQH 1F3JB 4WHCA 1IAIM 5DUML 2GK2A 3PL6D 4NQCD 4JM2A 2XPGA 3VFGL 5AG9A 4XP6L 3TWCL 4M6MH 2AJYL 3C5JA 2Q3ZA 4HXAL 4OGZA 3LD8B 5D70H 3UTZB 1L6XA 4XCCL 4R8WL 4G6KL 1A2YB 4LKXA 1HHJA 2BSSB 3S3JA 4BUGA 1P7QB 1UXWB 2J7LA 4KDTC 4HK0A 5MI0B 3OXRB 3WLWD 1A7NL 4W6WB 4L29A 3JWNC 3S5LA 3C6LB 1AGBB 1F6FB 3AS3A 2NXZC 4HKBB 3HE6B 2P43B 2C1OA 1REIA 3NIFF 1AR2A 1N2RA 3IDGB 4MNHA 2R29H 3D85D 4XAKD 5GRUH 3HC0A 3RVTD 5T5FL 3QDJA 4Z7QE 2J8UB 3MLTB 4JVUA 2BSED 3GMMB 2FRGP 1A3LL 4FFVD 3HNVL 4JY5L 1G7JB 5I17B 2R0LL 3O6FD 4N0FB 3HUJA 3MA7A 1X5IA 3TH4T 3EAKA 3N9GL 2AJSH 2KQNA 1AD0B 1KENL 1YQVL 4PJ5A 4K07A 3UYRL 3KPMA 4MVBC 5KVFH 1MFAH 3HPLB 3PGFL 3UBXB 1RUMH 2EEBA 3QFJB 3GMNA 4UQ2A 5J11B 4G6AD 4EQ3A 3GJFB 4MA3A 3HMXH 2HFGL 4WTZA 2HN7B 4DN3L 2L0DA 4N1EA 4LHQB 4J7RA 3S8WA 4XVUC 4S2SA 4QF1A 4D0CB 2EE3A 4PJDE 3TCLB 4AL8H 1DBKL 1LEGA 1IJ9A 3QPQD 4UT7H 1AD9A 3V5KA 5GJSL 3TM6A 1KEGH 5HHVH 1GRWA 4L8DB 1KLUA 3RZCA 4U05A 4PP1D 3WXVH 1XIWD 3V95A 3PV7A 4P23A 1N59A 3U0TB 2EH7H 2UUDH 4Y4FC 4WHTB 2F74A 4C57C 3GMPB 5K93A 3IGAA 1XF3A 1X5YA 2CKBL 3QI9B 3WKNA 3UDWA 1LE9B 4PJIA 1IAIL 1QFHA 3OG4B 2WBKA 4JM2C 3PXJA 4HQQL 1A6AB 3PDGA 5EUOE 3U4EA 4F37F 2ZG3A 5F6IB 1QO3A 3RL1B 3IKKA 1LDPH 3NCEB 1DLHA 5FYJE 2ED8A 4KJQD 4M8QA 2HKHH 3DYPA 1ZLSL 2Z93B 4HUKB 4PB0H 3I6LD 2BNQE 3BPCA 25C8L 2B1AL 2FO4B 4WO4A 5HYJB 2EKSA 3GSUA 1CLYL 1OAKH 2HTLC 4XNMB 5F9JB 4HH9B 4OIIL 1D5ZB 2ZOLB 3PUCA 1V05A 4JO3H 1QQDB 4KJWD 4EVNA 4P4KA 3GBNH 4H8WC 1N64L 3C60B 4WFGE 4UNUA 5JQ6L 3IU4L 3M1BB 4LSDA 1ERNA 4NZJA 5DD3H 1FGNL 4AK1A 2BVPB 3S3SA 2APTA 3HG1E 4OCLC 4NGHH 1CL7I 3QQ4B 4L3EE 1A7PL 3D0LB 3TPUA 3ZTNH 3DNKA 1ZEAH 3VXSD 3H9ZA 3KPRA 5HY9A 2Y06L 3BH9A 1W72A 3PWPD 2PXYD 5GISL 3BEVB 5CP7B 3E2HC 4XNZB 2EKJA 5I1HH 2Y07H 4NQTA 1PZUB 3PDOB 2OJEB 4HMDA 3ULSA 3WKMH 3E8UH 2AK1H 5FB8A 4KRLB 2VXVH 4MB5A 4Z8FL 3EJJX 3SKJH 1WFTA 3VG0L 1UM5H 1WJ3A 5E5MA 3IFPB 3CK0L 2C5DC 4UU9A 2V2TA 1F5WA 2GJ6D 4ZFOL 4YFLI 3BO8B 4YNYB 4L8CA 1T1ZB 2VDMH 4OV5B 3D3VE 4KROB 4NFBA 1WEJL 3NA4A 4A6YB 3MRLA 2VLJD 1JI2A 3MLSH 3TF7C 2PTVA 2WP3T 3QH3B 5H94B 3PWNB 1KLGB 2NZ9C 3RZCC 5C2BL 4KKCC 4Y2DA 1CFVL 2X4SA 1Q0XH 5EUKB 4X7TB 5TF0A 3MLWL 4ZQKB 3RY5A 3LN4B 1HKLL 2I9LA 5I8OL 1XF5A 2E9WA 1E4XL 3TH2T 3WLBA 4FTVB 3L3DB 4JN2B 3BEWB 3ESVF 3UDWC 2V9RA 5E5UB 4LSUL 1FYTD 1FSKC 5CILL 1ORSA 1FORH 4L8SA 5E70A 3VFRB 5L2KD 1DQLH 1K4CB 3W2DL 3V4PH 2V5MA 4PY7A 2HMIC 3LSOA 3CFCH 3QJFB 1AXSB 1M7IB 1NAKL 4PG9A 3PNWA 1G0YR 3BIKB 5EO1B 1UB5A 2P8MA 2GIYA 2APXA 4PJDB 1AXIB 4U0RB 5T1MB 4WO4C 5EU4B 2C1PA 3H9SA 3IXAA 4KY1H 3UJJH 5IKCB 2A9ML 5E7BA 1NCTA 5IFHH 2BDNL 4P4KC 5CJ5A 2NXYD 4MCZA 3HR5A 1RZJH 3STLA 1TVBB 2QEJA 3WFBL 2PYEE 1C8PA 2CDGB 3O2VL 5JOEA 4OLYL 3PGDB 3D5OF 4C56E 3DVGA 3O11A 5EUOB 5J6HB 4OFYA 1SJHB 1ADQH 1FHGA 4RAUA 1Z9LA 4XHJD 1JV5A 1UQSA 3OPZH 2AEPL 3AB0B 2EXYD 3ZL4L 5J57B 4I48A 4JDTH 5HHQA 1A1OB 2VLKE 3O9WA 3MNWB 4UIKH 2PYFB 3IDNA 1NCBH 3AXLB 4Q9BA 3NFNA 1OM3L 2YD3A 5D2LE 2BOBA 3BQUD 5L2JB 5CP3A 3RWCB 1MFNA 3BP5A 1EEQA 5C0AD 3TIDA 3BUTA 4DKAA 4JE4B 1U8LA 3INUL 4D3CL 2FB4L 3HNSL 4I9WE 1JPTH 1MH5B 3R8BB 3BE1L 2FX7L 4LLDB 2A73A 5MP6L 4L3EB 1CIDA 1C08B 2IQ9L 5DRWA 4OF7A 1QFWH 1JZ6A 4Z76A 3NABL 3KYOB 1OT2A 4LLQA 2OI9C 2R0WL 3BSZL 5I0ZA 4TPRH 1L0YA 4X83A 4ENEC 4ORGB 1RJZA 3KYAA 3EFDH 1PGRB 1YN7A 4ODVL 4Y2DC 3C6LD 1P2CA 3DHMA 3T2QA 1Q1JH 3QULB 1QHPA 5GGSB 3HE6D 3QRFM 1OY3B 5EULV 2LV4A 4LPXA 3RX8A 4NQXA 1T20B 4L8SC 2H32A 2JCCE 3VA2C 3FB6B 4OQTA 3D3VB 4UT9L 5DSCB 5I1CH 3FHQA 2UUDK 5GRWA 1I3GL 3WNOA 4OCRL 4PJCE 5HD8D 4D0BA 3ME0A 3PQYE 1AC0A 2EDHA 1JCKA 3WNMA 2VDRL 4WW1B 1YPZB 3IDMA 1MCJA 1OPGH 1KCSL 5IHLB 1XGUB 4L9LA 3CCHA 4Z78B 5JPMB 1IGYB 4IHOA 5I1DA 3WYRA 3QIUA 3OKNA 1KCRH 1WFNA 3WHE0 5BVJA 2IALA 4HWZA 1U8OB 3DVNB 1YY8B 5J4MA 1BJMA 5C0ND 3B9KB 1LP9A 5CIPA 4JY4B 4JPWL 3TC9A 2UVFA 4QNPE 1F11A 1OHQA 1T0NB 4FQ1H 4UOJA 1UGNA 5T3ZD 4AIZB 1NGWB 3DXAE 4MS8C 4OZHF 3O9WC 4M9PA 2AK4E 5B38B 3LKOB 4NBZB 3K0WA 3AREA 2NY6B 5I76A 1Q0YL 4Y8DC 4LLUA 2YZ8A 5CJBA 4PYGA 1Z9MA 2A6IB 3QI9D 2PKDA 5IVZA 3CLFL 2IFGA 1FZOB 1GGIH 1DQJB 4LRIA 4KXZH 1VKXA 4ZNEE 3DX7A 1F2XK 4M1DL 1YNKH 3LRHA 3MNZB 1MWAH 1ES0A 3B43A 2EIBA 4A6YL 1B4JL 4ZOAA 4C56B 1A21A 3HI5H 3VXUE 5FK9B 4MCYA 3MODL 4CW1A 2HAZA 1MLBB 1S7UA 4I3GA 2PW1B 1N0XH 3MLYL 3U4AA 5HYJD 1QNZH 2V2XB 3ARZA 3CDGB 3S5LG 4ZDHB 5SV4A 5I1KL 4YHYC 1OP9A 5L88L 5IOPB 4TVPE 2VLKB 5A1AA 3C60D 4NWTH 3VGAB 5BS0E 5T1LB 1QG3A 1WVZA 4H1LB 5D2LB 2V2WA 3BZDA 4HGMA 3RBSA 5ENWA 5J8OA 1GAFL 4YHPA 3LHPH 4Z18A 3KYMB 1EFXB 2VZVA 1AR1D 3SE8H 3GDBA 5JOFA 5IW6A 4OLEA 1E4WH 4RBPH 1ZHNA 3WNPA 4LKCA 1MF2L 1FCCA 5F1NB 4N90D 5IG7A 4X0KB 4IRJB 4QRQA 4NM8L 1U2HA 4S1RH 4OQ1A 2HG5B 3RL2B 3S36L 2WUBL 3KWWA 1P4BL 5DTFA 3OKYA 5C86A 3C2SA 4FXGA 2HT2C 3HHRB 2VLRA 4KKAD 4WTZG 3OAZH 32C2B 3QIWA 1KXTB 3LH2H 4GW5B 3VFPA 5J1AA 2V5YA 3TNNA 4XP9H 3QIUC 3SDDA 5L7XH 2DQHL 1ZT4A 3WMSA 1IT9H 4KROD 1Y0LA 3SDXF 3RGVB 1BWWA 1N7ML 1G6VK 2CKNA 1FL3A 3NGBC 4MSWA 4Z0BH 3FFCA 1G0DA 2MKWA 2W38A 3ZDXF 4P2QE 3TBYB 3AREC 4ZS7H 4DZ8B 2L4OA 5HVHC 1JUFB 3PQYB 2OS7A 3BD3A 3MFFA 5IVOA 3D9AH 1OTUD 1XF4B 4FTVD 2SEBB 3SQOH 5EIVA 3TT3H 1UM6L 3L3KB 1MEXH 2EIEA 1C5DB 4LRIC 3HPJA 5I16A 5I74B 3QDME 4R4NC 4DEPC 5IMKB 2VABB 5L8JB 5DRNA 1I7RB 3WIIL 1GHFL 3G5YB 3BZ4B 1U8HB 2JJTA 2O5YH 3U7WH 2QSVA 2V7HA 3FTGB 4EDXB 4LSQH 5C09A 3RY4A 3VFNA 1IAII 4QRPB 3T0EC 3BDYH 5LGHH 2O5XL 3DMMA 3FO1A 1NCDH 3K1KC 4MHHG 4XC1H 5FUOL 3ULVC 5AD0B 1IEAB 3QXDA 2HRPH 4PP2B 5DUPH 5C6WH 2XKUA 5CJQL 2AK4B 2B0SL 4FG6D 3JWDL 3DARA 5DXWA 1JPSH 4NQSB 1A9EA 1CK0L 3RIFF 4AENB 4HKXB 3MCLL 3DETD 1MUJB 3UTOA 2BOCA 2CGRL 2YC1B 3T4YB 2FL5B 5D71L 4U1JB 3FFDB 4Y19B 4JZNB 5FUZL 4PV9B 1NEZA 3KGRA 5F9WB 3I6KB 4DWHA 5DD5H 3VXUB 2R1YB 1RULL 3Q0HA 5FOBB 3OMZA 5F71A 2YN5A 1UZ8A 5HVFB 4TTGA 1F8TL 4IRZH 3EBAA 3UMTA 1DQMH 1CFTB 4V2BA 3CFJB 3KPLA 1S7TA 2HTKD 1AI1L 2DI7A 4Q9QH 1BZ9B 3FT4A 3QUXB 1A9BA 1MCOH 3K8KA 5BS0B 2XZQH 3CUPA 3QIWC 5IM7B 5KN5B 3KDMB 3GSQA 4HT1L 1GIGL 1JWSB 1KPVB 3D69B 5KSBA 5EU7E 4TYUA 4WCYL 4F7CB 3CFKA 1ZVYA 1FIGL 3SDDC 5DI8B 3T4AB 5L6YH 2ATKA 2D7MA 1OOAA 1RUKH 2OTWB 3B9AA 2WQRA 2VR9A 1Q9LA 4KHXH 1MJ8H 3FQRB 5EH1A 1K3IA 3SQBA 2ZJSH 3S4SB 4XNXH 2NY3C 2R0ZL 1RU9H 1CXLA 4R3SA 2V5RA 1YZZA 2DQIH 5IJVB 4E41B 4OUUB 3V7MA 3EYSH 3HA0A 1CBVL 3OR7B 1EGJA 5KW9H 3DYMA 2DKUA 4ODTH 5D7IE 5I6XB 4CVXA 5GRZA 2NYYC 3RVUC 1XGTB 2XICA 4JHZA 4DAGL 5IESL 2JJTC 4MA1C 4X5LA 1RVFL 2HWZL 3RJDA 3D2UD 3OKOB 2NLJB 3C6SB 4MJ6A 1ZGLP 1J05A 3DMMC 2W60A 3BAEH 3GMRA 4P3CH 3G6JF 4PJGF 5E2VL 5IFJA 4HJ0C 4G42A 4OCSL 4ZO8A 2CRIA 5C0CE 2XACC 2E7MA 4HS3B 2VDLH 3BD5A 4HX1B 4FZ8H 4XPBL 5FGCE 3X11B 2IEPA 4AYFA 5B4MC 4IDLA 3Q48A 5IB1B 4JFPB 1FV1B 1CDBA 3SJVA 4NRZB 3RWJA 1NDMB 1G9MC 3B3IB 4XZUB 3LV3A 4JG1H 1LO5B 1SJEA 5JR1L 1RQ5A 2FR4B 4NC0B 1G9NL 1IARB 5F89B 3QNXB 1WWWX 1S9XA 3BUYA 3QXWA 2P7TA 1AGCB 3KYKL 3B9KD 5C6TH 4EOWL 4LCIH 5DEZA 1QEWB 3MBED 4NQEA 4G7VL 3ULUH 1I9EA 3FT2B 1GJIA 4G8GE 1AY1L 4JFEE 1NUFA 1XGYL 3KR3L 2VLME 3VXME 1MIEL 4H5SB 5DHVH 1EVUA 4RMRA 3TO4B 2A1WL 4OGAD 1T0MA 4M6NH 3MV8B 2Y5TB 3X3FH 3NCCB 5SX5K 3V2AR 1HSBB 1CR9L 5FV2A 1KJVA 4IOFD 4ACPA 2YKLL 4N9GA 4Y0GA 4GRWE 1DQDL 1SYVA 4XPAL 2BSTB 2A9NH 4Q6YA 1BGXL 4QHLB 3VFOA 5IV2A 4G8IB 4HZLB 3NAAL 3IFLL 5CEZL 2NW2A 3KAAA 1J1PL 2A2QT 3IAPA 2NNAB 2VH5H 1XCTB 1XMWA 3K3QA 1T7ZA 3V8CA 1KPRB 2J5LC 3N1PC 2LVEA 3TYFB 4HFWA 5T1LD 3RWEB 1Q9KA 3OR6B 1ETZB 4CN1A 4YZFE 3GUTB 3Q6GH 3LIZL 4P5TD 5EC2B 1EFXD 5DWUL 4UZGA 2CMRH 1JGEA 1X9QA 2QADC 2A77H 2X5PA 1BQLH 3OKEA 3WUWA 3F12A 3BDBA 5F7DA 2YBRB 4LSTH 3PP4H 4WTXA 1I8MA 4JDZA 2X4RA 4LP5A 1H3PH 3JV5A 4IRJD 1CGVA 4XPGH 5LG1A 4UIMA 3FRPA 4BH7A 5DJ6A 1NCNA 1G7MA 3CSPA 4G9FE 4GG6B 3WL9A 5GS1B 1IFHH 3CC5B 1S9WB 3RWIB 3SCMA 1W0WA 2NX5B 1A4JB 4RAVA 4CMHB 4XC3H 5C0FB 2OMBA 5TH2B 2ARWA 2BJML 4RQQA 4TOYL 5FYKE 4X6FA 4ETYA 3RGVD 2X41A 2ITCA 5D7IB 5E6ZA 2GSGA 4PLKD 2NY7H 2GAZB 3MJ7B 4A2MA 2NCMA 5DVKA 3B9VA 5F3BB 4OLWL 5CEZD 4JREC 3MQIA 5E1HB 3GEWB 4HC1A 2BVYA 4MJ5A 3HB3D 2AJSL 2D7PA 4TVPL 4DVBB 5CD5D 4PJBF 2CIIA 3RJQB 1N5AB 5DJCB 5C0CB 1IM9D 1JNLL 1S8DB 1RUML 4PLJC 3MRNB 3DX8A 3WN5C 3T3ME 3T0AA 3MV9D 1QFUL 5LCVH 3HI6H 4NP4L 3VWJB 4MAUH 3HMXL 4CGTA 1YEJH 3G6DH 4ELMB 1G7PB 4B7IA 2WWMD 3EZ8A 4QRTB 5DA4A 5D7JA 1GGYA 4LPUA 2P47B 2WANA 1H15B 2R2EB 4HDIB 4HK3N 1NCCH 3LKSA 4QRPD 1KJ2L 3ARUA 4I2XB 5D2NA 3M8OH 5GRXG 4LNRB 2IFFL 5FXCH 3BZEA 3WCYA 5GRJH 4KI5C 3KHOA 2AJZA 1HH9A 3A67H 5IB2B 3SKOB 35C8H 4TSCL 4WFHD 4EXKA 1EIBA 1J88A 1I3RB 4BZ2L 1DBJH 3QDGA 4JFQA 2VUOA 4GS7C 4Z5RA 4FP8H 4WEBH 4OKDA 3GKZA 4LCYB 1A4KB 3MUJA 5IR1A 4U7MA 3KXFD 1E4KA 4Y19D 1IAOA 4YO0B 1J0HA 5BMFH 2ID5A 1JTTA 3GKWH 4AEFA 4OGXH 3NACL 4PB0L 4K94L 2IG2H 3ZE0E 3V6FA 2NY4B 4MWFA 3CXDH 3KLAB 5FDWA 4F37K 2FH8A 4YHIA 4O58H 5C8JB 1QBML 3GBNL 3QUXD 2CPCA 1DJSA 2NTFA 4ZFFB 5TE7H 1ULVA 3SCMC 4F15B 1HHHB 4JB9L 3BT2H 3LQAL 3L5WB 3QQ9D 1QLFA 4PRIB 4JDVB 1FNEB 2EDWA 4EIGB 7CGTA 1SJVA 2Y6SD 3SN6N 4W6XB 3WJJA 5DQ9A 1ZEAL 3U9PL 5DJ2A 5EC1A 3QIBD 3MRBA 3BKML 2X4NB 1TZGH 3MLRL 2XG5A 4CADA 4KK6D 2ZUQC 1M7DA 4KAQH 5I1HL 3VRLE 4EN3A 5C0DB 4IMLA 4HF5H 3RHWF 4D9LH 1U36A 3L9RB 3B9EA 3FO9A 1UADC 3WKML 4OF0A 1KPUA 2ENYA 2W59A 4DGYL 2AK1L 4BFIA 4NWUH 5D96B 4E41D 2KKQA 4EJ1C 5E94A 1T89A 4HIIB 4QHUB 3NIFE 4K7FA 3SKJL 4U1SB 1A6TA 1OD9A 1UM5L 1NMBL 3FO2A 1MRCH 3CH1B 2P8PB 2XWJB 4ZOCA 2GTZB 2K9UA 5ESVA 1DE4B 3WD5H 3RUGE 3LKNB 5D6CA 3ALWA 2ESVE 4U1IB 5D7JC 5H35B 5JHDE 1A7QH 2J8OA 1UWEL 2G75A 2MTPA 5D5MF 2BFVH 1R24A 2EXWC 5GGUB 5D2NC 5DHYB 4NKMA 4OD2A 2D3VA 4M6OL 1NGZA 4LF3A 5DK0B 4FXKB 1Q0XL 4GT7A 1D6VH 5D7LD 4ZAKB 3OWEA 4EI6B 2KZWA 3RDTB 2AV1B 1HYRC 2H2PD 5I8KL 2FSEA 3N1FC 3HZMB 2X4TA 1NLDH 1TZHA 1UEMA 5C08A 4KRNA 1I1YA 3TGXA 1NEZG 3BHBA 1NCWH 1YJDC 4PG2A 4PBVC 3V4PL 1E4KC 2Z91B 3CFCL 4GRMB 1KBGL 3DX9A 4P3WA 5EA0H 5JW5A 3AS0A 5EO9B 3FOMB 1CGXA 2DBLL 2VXUH 5CHNA 3QCVL 4HPYH 4N0UA 1J8HB 2CRMA 1RZIA 1SVCP 3MUZ1 2NY1B 1LGVA 4KY1L 4TRPL 4N5UA 3HNTL 5ESQB 4M1GH 5IFHL 5CGMA 5INCB 3MV8D 1I3VA 1JWUA 4RFOH 1RZJL 1VFOA 1ZGLA 2BY2A 2IAMB 3OKKB 1NFIA 1T5XA 2DLEA 1IKFL 1A02N 5DMKA 4XH2A 5CZVH 4IIQC 2MQ0A 5LQBH 1PSKL 2CDFA 1RUAL 4G80B 3ZE1E 2C3VA 2VDQL 1P9MC 3NA9L 5T1KB 3SKMB 1FG2A 1FLRH 3ZT7A 2EECA 2OXGA 2JJWA 2EYRB 2B4CC 4AH2A 3IETA 4LLYB 2X4UA 4EN3C 3GSRA 1DBML 5DR5H 1W72H 4IMKC 1N8ZB 5GS0L 2Q86A 2AEQH 5CBAB 5I19L 1Y6NR 1HDMA 3O3AA 1IL1A 3X13A 1T89C 3QXAA 1U91A 2FNBA 4ZUUA 3BRFA 2APWA 1L6ZA 4FFWD 3FB8A 3OHXB 3JWOL 4PGBB 2ERJC 2VLLA 1RZ7L 2ICCA 1AQKL 2BC4A 5EN2A 1OAZL 4HEPG 4OD3L 3WNNA 3SGDI 4FS0A 4LIQE 1FN4B 1AGEB 3H2WA 4NPYA 4O4YL 4PTTB 3U82B 3I2CH 1XIWA 5HI4C 1I8KA 3O4LB 1EBPA 2IPKB 2DOCA 3KPTA 3QPXL 4AEHH 1PYWB 5F7LB 4JZOB 4P46A 4N8VA 1G6RB 2YR3A 3PL6C 4JEGB 4IRSA 2NX5D 1X5JA 4X6DA 1QOKA 1RK1B 3T3PE 4JHBA 4RDQG 1R5WB 5EU3A 1L9NA 4PGDB 3OBAA 1VERA 2E6PA 1V3JA 4PG2C 4BKLA 3QEHB 5INDB 2FD6H 2EC9U 4PJEE 4AY0A 4X4XB 3TZVA 4CMMB 1MY7A 2R1WB 1IEBB 4PTUB 2DB8A 2BNRE 4RNRA 3WLWC 4U1NA 3NVQA 2XWBB 1L4IA 1JHTA 3DO3A 3DTXA 3TV3H 2YPLE 3DV6B 4HWUA 4KVCH 3D39B 2UWEF 1MQ8A 1NFDF 1YEDA 4OKVA 4W4OA 1T2XA 2XFXA 4FHBD 1IGCH 1EEZB 5E00A 3MOBH 4YK4C 1AHWA 4CU8A 12E8L 4TUKL 3UP1A 4ESKA 3MX0A 4PRNB 3BPNC 3CFEB 2P5WB 2P5EB 3RVTC 5BRZB 3GMLA 4FFVC 3PWPA 3GJEB 1D5MB 4LHUA 3TVMD 4I18C 1A1MB 1MHEA 3O6FC 4ZD3H 3EGSA 1U92A 5DDHA 1MJUH 3IB4A 3CPLB 4NKOB 3WFHA 2I07A 3O45A 2GKIA 5F70A 2VL4A 4LEOA 3U0WL 1P4LA 1LD9B 4UBDD 1UCBL 4GAGH 1I8LA 3FB7A 3EOTH 2QHRL 4G6AC 2VIRB 4K7PY 3WUWG 3CLEL 1EHNA 2Q7YA 4NN5B 3U6RA 1BAFL 2E5EA 3UJIH 1YN6B 4YFLF 4OF6A 5FYKL 5K9OA 1S7RA 4FQHA 3QPQC 3H9HB 4GXUN 5SWZA 3FRPG 4F57L 2VLJA 1VFUA 1VACA 2M8XA 2J4WL 1S3KH 2FGWH 3MRHB 2E9JA 4FQXB 1FE8L 4PP1C 1XIWC 2NY4D 5CSZA 3MRCA 4EEEA 5KANI 1FH5L 1NLBH 5F9OL 4OLUL 4L8BA 1JGDB 4G5ZL 1TVHA 5IIEA 1H3WM 4W81A 5FM5M 1N6UA 4PRID 5GZND 5L2KA 1T1XA 4WU7A 2YA1A 2K7PA 5IWLC 1Q94A 3LHPL 5JXAH 4HKJB 3LS5L 3SE8L 4P5KA 4ODUA 4NOBA 2OQJA 5HDLA 4CDHA 3LB6D 3TT1H 5DEGA 5JNYA 4GXUM 3V4VL 2WQ8A 1LO2H 2GT9A 4RMUA 1QLRA 4YUEH 4PJHE 9CGTA 4Z7WF 3U0PA 2OSLA 3ZKND 4KJWC 2FEEI 4NUJB 4OQTH 4ZUTB 4U1MA 5DRZA 1IGIH 4W4OC 2PN5A 2Z35A 4V1DE 1E27A 1KIPB 2R0KH 1LK3H 1JMXA 3HAEH 5IJKA 4C83B 1AHWC 2YA2A 4OZGF 4JJ5A 5DHVB 5JOPE 2KPNA 3NCFB 2OLDA 3GRWL 3IKCB 4ZFOA 5AYUL 4X9HA 4HWEL 5TPWH 5BXFA 2PXYC 3P9LB 1G7IB 2ICWJ 1S9VA 4CUCA 3T1FA 4F7PA 3FCTB 1KLFA 3MV7E 1DZBA 4CDGC 2AXHA 5KAQG 1U42A 5EFIB 2FX9L 3EZJB 2DWDB 2J6EL 1F3JA 2H1PL 1A3RH 2N4IA 4KV5E 4ZAKD 3BKYH 4LSPL 2XRAL 1QLEL 3MJ9H 3RDTD 4QOKE 4ZFGH 2D31B 3D9AL 4ISVB 1UWXH 4K7PX 3SQOL 2FBJL 3TT3L 1KG0B 4XCNB 5JUEH 4OZIF 3UTZA 1FVDB 2X10A 2WLYA 2Z8VC 1J5OH 3QCUH 4M7KL 1A2YA 2BSSA 3C09C 3T2NL 1P7QA 4RIRB 5J9PB 1UXWA 2JJVA 4HH8A 1UH3A 1FPTL 3OXRA 1NUNB 4R6UA 4OZHE 1J8HD 2D7OA 3WNKA 3C6LA 3OV6A 1KT2B 1AGBA 2EDBA 3OB0K 2NY1D 1G6RL 3KPNB 3LY6A 4HKBA 3BN9D 3HE6A 1I7TB 1SY6H 1OP5H 2RJMA 3IDGA 3QHZH 4JY6B 4BFGA 2IAMD 3F7PC 1F45A 4MXWL 2Y5EA 5DMGD 3MLTA 4LOUD 3GMMA 1IBGL 4NYLB 4M62H 1UCTA 1PEWA 2ZPKH 2ILLA 3PF2A 1G7JA 5I17A 2BERA 4N0FA 1CN4A 2DD8H 2DIJA 3BISA 1TETH 3OGCB 4XMLL 5EWIH 4ZODA 2WUCL 5T1KD 1AD0A 4PR5B 3A6BL 1MHPH 1T04B 3RIFK 5JZ7D 1BD2E 2NXYC 1ZHKB 3S34H 3HPLA 3UBXA 3HCVB 3QFJA 2OYPA 1BF8A 4J23A 4NKIH 2COQA 43C9B 5IJKC 3GJFA 3F58L 1WGOA 4U2ZA 1YEEL 2HN7A 3LPWA 5BO1L 3GM0A 4D0CA 1EO8H 1ZLVK 3TCLA 4OCWL 2CK0L 4HCRL 4XHJC 4QO1A 2YOCA 3V6BR 2ADIB 3I02B 2EXYC 2OR8A 1WCQA 3VU2A 1TVDA 1RUKL 4L8DA 4O5LH 3F7QA 4IOIB 3LQMA 1QPXA 3X17A 4NHCH 3U0TA 4WHTA 5TE4L 3GMPA 3O4LD 2IADB 4D9RD 1U0QA 3BQUC 5C0RH 3HZKA 2P49B 3QI9A 4YE4H 1LE9A 1RU9L 4AZ8A 4O2CB 1A6AA 3IDUA 4PJ7B 4WI4A 1IAKB 1U9KA 3TBTB 5C07D 3RL1A 1KB5H 4JKPL 3LD8C 3SDXE 2I60L 2ZCLH 2LFGA 2Z93A 4KMTH 2FO4A 1DR9A 5HYJA 4XNMA 5F9JA 4H0GA 4HH9A 5KZCD 1D5ZA 2ZOLA 4KC3B 3OX8B 5EBLB 1QQDA 4MNQE 5MI0C 3RRQA 3ZDXE 1YYML 2E27L 3C60A 5SWSE 1JYNA 3C6LC 3M1BA 3D39D 5ANME 3BAEL 2BVPA 4XHQA 1JMZA 4YXHH 1B0WA 1HSAB 3HE6C 4Y16B 5D6DA 4FZ8L 3QWRA 1MRDH 5T3XE 2H45A 3QQ4A 1TQCC 4QOKB 2P5WD 2P5ED 2VERN 5BRZD 4Y4KB 3RIAF 4JQIL 5HYFA 5A2IH 3BEVA 5GXBB 2OL3H 5CP7A 4IDJH 1JHKH 4LIQL 3SGEH 1G9MH 1A6WH 5HD8C 3PDOA 2OJEA 3RQ3A 2YSSB 2C1OB 1GCFA 2XNAB 5JW4R 2B8OT 4FQLL 5E08H 3L3GB 4OZHB 5JW3H 4KQ3L 2I24N 3FN3A 4LRNH 5JORB 3QDJB 1BBDH 2LU7A 4PJXE 3IFPA 3KJ4B 5J06A 1PKQB 3X3FL 3BO8A 4YNYA 5IB3B 1T1ZA 1MVFA 3QZWB 4OV5A 2YMXH 1MFCH 3TESA 1GPOL 2FHCA 1LEIB 4MYWB 5F1OB 2G60H 4A6YA 4JRWA 5C0NC 4YDJB 1MPAL 2ICWB 1KTRL 1HI6B 5KTEH 4WGWB 3QH3A 5H94A 5DUBB 3PWNA 1KLGA 4FQXD 3GMNB 5F8RC 4N8VG 5EUKA 4X7TA 4ZQKA 3LN4A 4FABL 1UEYA 5IBLD 2VH5L 4G3YL 1UYWH 3QEUB 3V79C 5HHMB 1BD2B 4FTVA 4JN2A 3QI9C 3BEWA 1KC5L 5IFAL 4QF1B 1Y6KR 1WBXB 4ONOA 3JUZA 1FC1A 2EYTB 3VFRA 4WUKH 5F6IC 3RZWA 3V0VB 3ZTJH 5GQBA 4NDMB 2GUOB 3MREB 3QJFA 2R69L 5I66B 1AXSA 1M7IA 5A2KH 4LVEA 4CJ1A 3BIKA 1BQLL 5EO1A 2Q8AL 4PJDA 1N59B 5T1MA 2NMSA 4GMTH 5HYIA 4R2GB 5EU4A 3UXFA 2P44B 4JFFB 1TTUA 2BRRH 2MSPA 4OLVL 3H0TB 3NCBB 1LO4H 4GH7B 1V3LA 1D3CA 4Q9RH 4J3VA 3N0PB 3C60C 3N1GC 5F44A 5I1EH 1TVBA 3ULUD 3BJLA 1UWXK 4ALAH 2CDGA 4KZEH 3S96B 3CU1A 4UOW1 4YHZH 1S5HA 5D6DC 3T8XB 2VZSA 4M8QB 3PGDA 4QHKJ 3N85L 4HUUB 1AR1C 4LHUG 1EMTL 4MXVF 5C0BD 5EUOA 5J6HA 3EDDA 1SJHA 2QTEA 2ADJB 3DUSB 1O7SA 1NJ9B 4BK5A 1S5IH 4NRXB 4Y4HB 1WSST 4ERSH 3BESR 3ROLB 1PX3A 4XNZC 4HPOL 1PW3A 3MMEB 3LMJH 1A1OA 4UDUB 3MNWA 2PYFA 3WIFB 4EDWH 3AXLA 4MDJB 2DIBA 1MJ7L 3K8LA 4Z7NF 5L2JA 1X6NA 5I1JH 2FLRT 4KKAC 2PO6B 2UYLB 5ANMB 3RWCA 3BGMB 1DDHA 3QBTB 2BK8A 4BQ6A 1W72B 1PKOA 5HYSA 4JFHE 2CK2A 3HG1A 5IW3A 4DK6A 1MH5A 4LLDA 5F9DC 4L3EA 4KROC 4AEIH 1C08A 4U31A 3UTTD 4ONHB 3KYOA 2RCSL 3B6SB 2YD2A 4HJJH 4OAWB 4ORGA 4X6CF 1V3MA 2CJUL 4R26L 5J6GB 2FEDD 3CX2A 2HH0H 3EYVB 4X9IA 5FO7B 3SGKA 4OF8A 1NCCL 4JHWH 1IGML 2YPVH 5FOJA 1T66D 3QULA 4KUZL 5GGSA 3LVEA 3LS4L 1OTUC 1AO7E 4M7LH 1NBQA 1WBYB 3TJEH 4XCYB 2NY5C 4HK3J 1AJ7L 2E8ZA 3A67L 5BZWB 1T20A 2ZCHH 4QHMA 3VW3H 4MMZC 2MPAL 3ORJA 3FB6A 4RMTA 1JZ8A 3D3VA 1XFPA 4K2UH 3QUKA 4FP8L 5DGRA 4LSSH 3OL2A 3EYUH 5DSCA 3WFDH 3P30H 4U0RC 4Z7OE 1B88A 2VC2H 3P4OB 2QSQA 2DQEL 3NIDF 4UINL 1UACH 2DQJL 2R2CA 4WI5A 2KL6A 4WW1A 1YPZA 3MGOB 4FG6C 3CXDL 5JW4M 1XGUA 4Z78A 5JPMA 1IGYA 4AQOA 1WZKA 5TE7L 2CLVB 4NZTH 2F53D 1BM3L 2IPUK 3DETC 1U6AH 1U8OA 1IC5L 3DVNA 1YY8A 1TJHH 3TH3T 5I71B 3B9KA 4BM7A 4JY4A 3U4BL 1WTGT 1CT8B 3AB0C 1ACYL 4LU5H 4LVOB 5IGXH 5CJOH 1CWVA 1T0NA 1WC7B 4NZRL 4AIZA 1NGWA 4KPHL 3U48A 1PG7H 5K9JH 4I5BB 1LO0H 1P5UA 1L7TH 3LKOA 4NN7C 2HTKC 4X4MA 3VD5A 4MA8H 4JM4L 4HF5L 4D9LL 5F72S 1FZOA 1DQJA 4NWUL 1HHKB 1XF2B 3UZVB 3MNZA 4M5ZH 15C8H 4LDEB 1EJOL 3L1OH 4C56A 2R1XB 3Q6FB 4PRHD 5E2UL 5FK9A 1F02I 1QYGH 1MLBA 1MRCL 2PW1A 1BJ8A 3RHWK 2BXZA 2V2XA 3CDGA 4ZDHA 3WD5L 4XBGB 4CAGA 4OBRA 3UC0L 5IOPA 2VLKA 4JM2D 5IHBA 3SGKC 1SM3L 1YYLL 3TIDB 5T1LA 5KSUB 4H1LA 4XPFL 5FYKU 1PJ9A 4LEXH 5DD0L 5D2LA 5FKPB 4WI3A 3G6JB 4PJGB 1TFHA 1HE7A 3JWDC 4Y16D 5E9DB 4P57B 5FGRA 3KYMA 1D6VL 1EFXA 2BX5A 3WDHA 4P2RE 1ITCA 5EZIL 2VDNL 3MCG1 2AS5M 1OQXA 5T5NG 4K55A 4Y4KD 4I8DA 1PD6A 1INDL 3CU7A 1NCWL 5F1NA 1JFQH 4U0QB 2G2RB 4HD9A 4JGUA 4X0KA 4TULL 4IRJA 5EU6E 1I8IB 2ADGA 4BSWB 3G08B 4OLZL 1NC2B 2HG5A 3RL2A 4YXLL 5D8JL 1U8QB 2VXUL 4XWGL 1WIOA 3VD7A 5ECJE 3C8DA 1C5BH 2H26B 2OZ4A 2BSRB 3P4LA 32C2A 3QDJD 5GGTL 1MFEH 4GW5A 5TE6L 4M1GL 2YEZB 3ZHKA 2Q3AA 4TSAH 1AO7B 2AVGA 1JZ3A 4GKNB 4JN1L 3HAEB 3BP4B 4YBLB 3RGVA 2CUIA 4LCWE 1K9TA 3B9KC 5C9JB 4ZTOH 1B4RA 3MBEC 3BRGC 2D4DA 3LPGA 4AIOA 5GGVY 5AZ2L 2Y7QB 3TBYA 4WI7A 3W9DB 1OSPL 4DZ8A 1J1OL 5JXED 1JUFA 3PQYA 4P48A 4OGAC 2XZZA 3NPZB 3IJYB 1XF4A 3GI9L 2SEBA 5HHMD 4PYHA 4RGOH 3L3KA 1C5DA 2BXYA 4IOFC 5T3XL 2WWKO 5DT1H 1TPXB 5IMKA 2VABA 2NZ9D 1I7RA 3AMKA 4NCDA 3BZ4A 1U8HA 1NL0H 3G5YA 3U46B 1QSFE 5IEKB 1KJMB 3FTGA 4P23D 4G8EB 4EDXA 3KNBB 4LMQE 5KVGH 2C4FT 4R2GD 4QRPA 4JFFD 2NQCA 3K7UA 4WFED 5AD0A 4DTGL 5IVZB 3F65A 3R1GH 1IEAA 1E4JA 2IANE 4PP2A 4JRXE 4DGVL 3V52L 3VGAC 2AK4A 3QEQ