1CLZL

Igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
DVLMTQIPVSLPVSLGDQASISCRSSQIIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The x-ray structure of an anti-tumour antibody in complex with antigen.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG FAB (IGG3, KAPPA)
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1995-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzL01
3WFEH 1DCLA 5KSAB 1T7XA 3KLAB 1R3LA 3KXFE 1RI8A 3MRMB 4MNHA 2BCKB 1QLRB 5GS3A 1FO0A 3RJDA 1U8IB 1A9EA 2C1PB 5ID0A 1INEL 3KYNA 1V7NL 4GKSB 3SKMB 3VH8A 5C2BH 3D3VA 3WUWG 2VR4A 3VFVB 1KXVC 1RK1B 4G9FA 4LIQL 2DLFL 4XNYL 1X6NA 4OF6A 2X4OA 1BWWA 3MUGA 2F15A 1NKRA 4Y2OA 2Q20A 2J8UA 1DEEA 5FB8A 5CEZD 4HIEB 1JI2A 3G04A 4G3YL 4DKFH 3DYMA 1S7VA 3EGSA 1S7SB 1YQ2A 1MJ7H 1G7LB 5EUOF 1S5HB 5F6HJ 4F33B 1IARB 4N5EC 1YPZA 5AZ2H 1E28A 5KBNC 1FVEA 2X1PA 1EEZB 3CH1B 1FE8H 2VLRE 3BIKB 5E7FA 5JOPE 5HHPA 2CH8A 4ODWA 4U2YA 1G9MC 5E2VH 5EG6C 4NC1E 1OSZA 2CGRL 2EIDA 1XH3B 4I9WE 5DD3H 1A4JB 4HC1L 1S78C 3KPOA 3BPNC 3BPLB 3QDMD 4YE4H 2GJ6B 5IESH 1Q9OB 1OT1A 1BIIB 3IXAA 1JF6A 3DVIA 2DDQH 3VJ6A 1NAMA 2CIIB 4LCWA 5EBMA 4O51B 4ERSH 1RIHL 3BYYA 4KMTH 2LU3A 4X5WA 1NC4B 4YHPB 4WWKA 4IJ3B 1XT5A 3OL2A 3DETD 3P4NA 2H45A 1IAOB 5C0BE 5AYUH 4O4YL 2M2DA 1FFNA 1Z0NA 2CK0H 5IFAL 3T0VA 5JLZB 4GFTB 4Z18A 4WRLA 3B3IB 5GZND 4PP1C 3MRQA 2GTWA 1I85A 5JZ7C 3RFZC 4RWYH 1AGBB 3IFNL 4LAJH 1P7HL 4J6RH 1ZK9A 4M7JL 5I1CH 4DKEL 4LU5H 3FQXB 2Y4SA 3EYQD 1MRFL 1DUYB 2CXGA 1KEML 4IMLA 1YYLL 4KKCD 3GMOB 1T4KB 3I2CH 4PJDA 1J1XL 5I1KH 1IGTA 3MNWB 1XF1A 1AO7E 1QZ1A 1NBYA 5E2TH 4QRRD 2K7PA 1M4KA 3SGDI 3QP3A 2G2RA 2FBJL 4XGZB 4ODXB 2B1HL 4YX2L 4R6UA 5EOQL 4DGYH 2YPLA 4JO4L 4Z76A 3T09A 4BZ2H 3QWOA 3VXUA 4BQBA 4KPHH 3AY4C 4RGND 4XCEA 1MIMH 2VQTA 4RFEA 1NFIA 3H42L 4N8VA 4DGVL 1W0YT 1BM3H 3QDHA 3UBXB 3MV8E 5DFVC 5D1ZC 2CR6A 2BVTA 3FQXA 1N7ML 2ZNWA 4MD4B 2ZUQB 4HJ0C 5C6TH 3FO9A 5JXAH 4PJBA 2VXQH 3RL1A 1JWUA 2AJYL 3CZFA 5T1MB 3GSNB 1ZT7B 1E6OL 3KPMA 1F90H 4QTIH 4XB7A 4ZFZB 2DJUA 1TVBA 4LLYA 4M6NH 3DX6A 3R8BB 5KN5A 4S1QL 1VFOA 3NABL 2ZUSA 3JWDC 3O2DH 1MHEA 2BJMH 1R5IA 3QG6A 4OQTH 5T3XH 4XXCA 5DYOB 4ZSOA 5F44A 1YEJL 2F5AL 4CN1A 3NCYS 2D7TH 1T3FA 4R4ND 4C83B 4F7TB 4WDIA 1NCCH 3SE4C 2XWBA 4WFGD 4GRLC 1U8LB 1S7TA 4PJCF 4KQ4H 3ECBA 4ORZC 3RIFK 4KHTH 1UB6A 4DEPB 1BFSA 3VFSA 1Z5LA 4FQQA 2L4OA 5BRZB 1HH6B 5DJZA 3TA3D 4KJPD 2W9DL 4PRNA 4X4ZA 5I75B 4LLWA 2VL4A 4YLQT 1UVQB 5CZVL 2V9TA 1IGCH 1PSKL 4JZJC 4NN7B 1OARH 1DL7L 4URTB 2OZ4H 1OAKL 3RKDD 4ZNEA 1IFHH 4HAGA 1K8DA 5C0DB 3DUUB 5ITFB 4HZAA 1JGEA 5EU4B 5ISZE 4MA7L 1IQWH 4LEXH 4L5FL 4M7LT 4DVBB 1DFBL 3DECA 3GRWL 4N0UB 2YKLL 1HCVA 3SDXA 2C4FT 1I8LA 4OV6F 1KBGL 2ICEB 3RA7H 2Z93A 4Y4KD 3U0PA 3L95A 2V2WA 4JB9L 3FO1B 4HFUL 1GZPA 3UMTA 4PJ5E 1AH1A 1QTYT 3D2UA 1UVQA 1CICC 3VXUE 3A6CL 4J23A 1BJ1J 3T4AB 3M1BA 4AM0A 3BKYH 2BNUA 5D1QC 2K7QA 1A7RH 1LD9A 3HR5B 3GSRA 4QXTB 4F3FA 3AS2A 3A67L 4LASH 1P84K 4RMVA 1JHKL 2VLJE 4M48L 4C83A 4CVWA 4F7TA 4Z7NF 3QHTC 5E5RB 5ELIA 5TF1H 2DWEB 2NY3D 4PRAB 4JANA 1VENA 4R7DB 5EA0H 4XPBH 3PWVA 1KCVL 3QDMB 3NTCH 4L29B 5DFTA 2QQKH 1BFOA 3S7GA 1RK1A 1F00I 3EYFA 4IHOB 3CFEA 2BVQA 3EYUH 2XTJE 1NCAH 3TZVC 1NUGA 1RQ5A 4NJ9H 4QHUA 1M05A 3DXAE 5ILTL 3DSFL 4TTDC 1J0YA 3I50H 3TNMB 2E7CA 1GC1L 3ZHKA 1A7QH 1KJ2H 2Z31C 1BBDH 3HN3A 1RURL 1BJ1H 1KGCE 2DM4A 3I75B 4R7NB 2GW5A 4XBGB 3VH8B 4YH6A 5EO9A 1MCNA 3MRGA 3BN3B 1QSZA 4E0RB 2H32A 4RFNC 2SEBB 4MMXC 3QG6B 2HP4A 1HHGB 1DQMH 3AFLA 3WHE0 4L9LB 3UTSD 1XGQA 3KHQA 1R3IL 4GXUN 4R0LA 3S98A 5CZVH 3TBYB 4ODHH 4H8WL 1ZHKB 3MO1B 4NQCD 3SDYH 3GBNH 1U3YA 2Y36H 3P11H 3HLAA 4YHLL 4OF3A 2DAVA 2V5TA 3L3KA 2DLHA 3PXJA 4KKAD 1GZPB 4XPAH 4AENB 2EYSA 4D3CL 4PJFA 1WCBB 2C7UA 3VWJA 3WNKA 3IJHA 1AIFB 3RWIB 3MRNB 3N1FC 4KDWA 4KK8D 1Z9SA 3UC0L 3ETBF 5EU3B 2AXGA 1P5VA 4IMKC 2NY1D 2LV4A 3VFMB 4JPIA 3JWDH 4KTDH 2A6DB 3G5YB 1OW0A 1WZLA 2YHGA 4JM4H 5BS0B 5KZCB 4HV8B 2X9YA 4NZJA 4U2ZA 1T89C 1XF5A 4NO5B 3L3JA 2AJSH 3QZWA 1N0XL 4UMGA 3UROR 1ONQB 2BNRB 3B2VH 3NACL 4RSVA 3DX7B 1SMOA 1P4BL 2YPLE 4H88H 3ZYOA 3Q1SL 2QQNL 3D25B 3QT2A 2DQGH 5SWSB 2YD3A 5D7LB 1FCGA 1V3LA 1U8QB 5DFWH 1MF2H 5DO2D 1SEBB 4KK6D 1N59A 3C6LD 3Q48A 2XZCH 2J4WH 1DQQA 5FHAL 3TVMD 3WJLA 4WW1A 5ITBH 1FAIH 2R1YA 4M6MH 2OL3H 1TENA 4YXHH 3KR3H 4G6AD 3D9AH 1WEJH 4ORGA 4LCYA 3SGEH 3VWKD 3PG2A 1FZKB 2CSPA 3OJDB 4UUJB 4X6EA 5D93C 4NWTH 5IB4B 4XPTL 5I1IH 3H42H 2R4RH 3ZKQD 4NZRH 5TQ0H 3T08A 4ZFOA 1AY1L 2FLBT 2DI8A 1W72B 2Y1VA 3ZTJH 3CXHJ 3DX7A 4HWBH 1R5WA 1ED3A 2VDNL 4CADA 1MSPA 2OTPA 4Z77A 3V5HB 1IMHC 4LBEB 5T5NF 2NYYC 4JO1H 3T1FB 1NDGA 2QADD 2XA3A 3G08B 4FABL 2DJSA 1NMAL 2MQ0A 4MQXD 2CUHA 4X7DC 4P4RA 1IGYB 4BFGA 4F58L 2P4AB 4E42B 1VCAA 1I3GL 3VFTB 2ED8A 3EGSB 4G5ZH 4KK6C 3LEXA 1WF5A 2L0DA 4PG9B 1LEGB 2P5EB 4MJIA 4NKMB 3RL1B 1KLUB 1I9RH 1T2JA 4P48A 1WZ1L 4OFYA 4XB8A 5B3JE 1Y0LB 3H3KA 5MHSD 4X4XA 4K71C 3BIAX 3L3HA 2VWEE 2OQJB 2W65A 1R3IH 3JWOC 2D31B 3GMLB 1OP3H 5CUSH 3I6GA 2NXZD 3BW9A 3DGGB 4O9HH 3K4AA 1YMMB 5EO1B 4PLKD 3PWPD 1T22A 5GSRB 2JB6A 3ZTNH 1PDKA 5DURB 4OTXH 5E8EB 2QSVA 4A6YA 4PRHB 4JPWL 4NNPH 1NEZG 2GJ6E 3ZDXE 5JR1L 3ILQD 2R0KL 2XXMB 3KYKH 2G75A 3STZB 3PJSB 1JTPA 5E8PB 3F62A 1QFWH 1DBKH 4PY8I 4MAYB 5E9DD 1YMMD 1GPOL 4F2MA 3DVNB 3UTTD 1VFBA 4AYFA 5IROC 4P46A 1TZHA 3WUWB 2BNQE 4HS6A 4D0BA 5IP4A 2AEPL 3SKMA 1KT2A 3ARUA 5IMMA 3DYOA 1AKJD 2DQJL 1MVUA 1RUAH 2ZKHH 1GHFL 1HOCB 1SBSH 3KXFA 4H1LB 2BVUA 4Q0XL 5E2UL 4XMLL 3ZDZE 1JTTA 1QVOA 4DZ8A 5BVJB 1EAPA 4H20L 4XVUD 1R0AL 2YD2A 2HLFD 4YEFA 2EC8A 3ARYA 2XRAH 2BMKA 5DC4B 3T2OA 3SO3C 2E7LA 2AJZB 1AI1L 2OSLA 5FF6B 3WKMH 3QO1A 2DQTH 4R96B 2A9NH 3QDJE 1M71A 4R97B 5GGRA 3FT4A 3MRIB 1JZ7A 1NKOA 3MRPA 3BUYA 1UH2A 4L8BA 1JYXA 5FGSA 1IEAA 4MGXA 3WUWA 4HIIB 3PHQA 1QSFD 3V52H 5JQ6H 4OT1H 2CLRA 2XQBL 2DIJA 2YUXA 4GLRI 3D87B 2BCKA 2NW2B 5D8JH 5E8OB 2C3VB 5I16B 1D9KA 1YJDL 4UV7L 1CLCA 1KF9B 3MC0A 3MREA 4RCAA 1NLDH 3U9PL 4JRYA 1FAKT 1R5VA 5B39G 1T7YA 3C60D 3VWKB 5EC2A 5F1IB 3MJ7A 4NQUA 4Y1AD 5C9JA 1F6AB 1OHQA 5KTEH 1A6AB 2FEEI 4F7CA 4TNWF 3C6LB 4RA3A 1F3RB 3FB6B 3VRIA 3N9GL 4YHOL 5GGRB 5TE4L 3CDFA 1JI1A 3QO1B 1RZGB 4ONGL 1V7NH 2IMNA 5JO5B 3SDDC 3MV8B 5HBBA 1E6JH 1WWCA 3DVGA 4MJ6B 4QXTA 3UYPA 3ULVH 3B9DA 4K7FA 2PYEE 4RGMC 1L9NA 5MEQB 1DDHB 5ESQA 5BRZE 5F9OL 1UWGH 5HGDB 4ZOAA 2ATKB 3MCKA 4LP4A 3BRDA 3QQ3A 1BD2D 4OKDA 4ELKB 4NWTL 3BIBX 1ES0A 4HMCA 3X11A 1S9XA 3GMOA 3LKQB 1WICA 1SYVA 5FO7B 1KLFA 1KJMB 4O9HL 4JZOA 4PGCA 3FOMB 1SEQL 3L3IB 1DZBA 4YXHL 1RJYA 2VDNH 1RHHA 3KPRE 3KVQA 1MWAL 3BH8B 3V4VH 2EYRA 5ESVB 3S37H 4KJYA 4JRXD 3X12A 1JPGB 5TFSL 5DF0A 4FFYH 4K07A 4LHUB 2X7LA 4XCCL 2BSTB 3VXQB 3L3KB 4JG0L 3UBXG 5I30H 3IDXH 4GRLD 3HC4L 4Z5RA 1OTSC 1OWWA 4G8GD 3HR6A 4G5ZL 3SO3B 1J0KA 4HCRA 5I2IA 3H2WA 5IFHL 2X1WL 3S3PA 3O4LE 4MXQD 5CLWA 3LQAC 4KK5C 4TVPH 9CGTA 5I66B 1ETZA 2GKIA 2Y5TB 4KRPD 5AUMA 2VABB 3U46B 5GS1B 5SWZD 3KPMB 5T5FH 3EIFA 3TZVA 4JFDD 3DHJA 3SKUD 4F7CB 1IGTB 3MNWA 1M7IB 1RUQH 1KLGA 5IWLA 4OLZH 4Y0GA 5IB5A 2IC2A 2AQ1A 3OG6B 4OB5L 3FQNA 2ARJB 2GYSA 3EUUA 3KPPB 3VFPB 4PV8A 3H3PH 1U8KB 3O2WH 5D70H 3C5ZA 1MH5B 3LAFA 3WV0A 3EOBA 1AXIB 5DWUH 5DRNB 2NLJB 5D6CB 4LSPH 4XBPA 4G7YH 1H15B 3E3QE 3ARGC 1CU4H 1MY5A 5DGQA 4JPKL 1Z9LA 3ZKXC 4NRXA 2CLZA 3GHEH 2QTEA 4BKLA 2P5WE 1MJ8L 5B8CA 2ZJSH 3W2DH 5F7NC 1XIWC 2NY0B 3EOAA 2H6PB 5LAXA 4YC2C 4Q9QL 4YR6B 1P53A 3OB0K 3EYUL 5IFAH 4PRBA 3V7AG 4HULB 3FQTB 3IGAB 4PGJA 2QR0A 1GGTA 4Y4KB 4LRNH 4KTDL 4OLXL 5DMYA 3VFNB 2JJUA 3THML 4K3JH 2Q3ZA 4UOJA 1MQKL 3O41B 4Q97A 3PV7A 1ZSDB 3ZYIA 1NC4A 5KSBB 4P3CL 5FECB 3TFKD 4ZUTA 2QKIB 3CSBA 5IMKA 1FNGB 3BGAA 2MJWA 5FHBH 5F7DA 5I8CB 1QEWB 4WU7A 4HUUB 3I3DA 3QAZB 1BHGA 3C08L 3KLAA 3QIUD 2V7HA 1K6QL 4N0CC 4C4KO 2HKHH 4DZBA 4ZPTA 2QHLA 3OXSA 4UZGA 4KUCF 3K1DA 4ZQKB 2ZPKL 2NY2C 2DD8L 5DVMA 4X4MA 3MLWL 4APQC 1OAQL 5D1XD 5D5MB 1IC7L 3O6FD 3GI9H 4HC1A 2VSCA 3ROLB 4FFZL 5I6XC 2Q7NA 5K93A 2AK4E 2DQFA 2NNAB 3FZUC 3MA7B 4PGEA 5IV2A 3HAEG 1OGTA 1URLA 3ZT7A 2E27H 4LF3A 1XGPA 3GSRB 4UQ2B 3EO9L 2YA2A 4EI5A 4Z7OF 3IDIB 1WFNA 4WW2A 1ZTXL 1BGXH 3PWNB 5FHBL 5DMIH 4GRWH 3OKLA 4NJAL 2HN7B 4G8GB 1PKQA 1U6AH 5DSCB 1J1OL 4X6FA 3TYGH 1YEHL 3PDOB 4L4TA 1FVEB 2QBWA 4KI5F 5JW4R 1TNMA 3QUYD 4QTHA 5K9JL 3GMNA 5JW4Q 3V5DA 5L6YH 1LDPL 3O3BB 4EQ3A 4JCLA 1HZHL 2Q87A 1LO5A 5HVGB 1Q0YH 2Q8AH 3WIHA 4LMQE 2BSRA 4LQFL 5DQ9B 1NSNL 3IS1X 3OR7A 3L95B 1GOHA 4PJGE 4ODUA 2HTKC 2WUCH 5B38A 4WO4A 1CGVA 4IOFD 2CRMA 5IVNA 4EI5B 3CMGA 3QWRA 1A6TA 2FRGP 4Z7VB 1XGPB 5CEYB 3VGAB 2V2TA 4AT6B 1ZANL 1YNTA 2P8MB 1KENL 3DUSA 2HTKD 1RJZA 3OSKA 4N8PA 5LXGL 3B6SB 3DUHA 3L3DB 3R06B 3HG1D 5J06A 1OAUL 1ZVSB 1F4YH 3ABZA 4HFUH 3HMXH 5I73B 3KHOA 3IJYB 5T3XL 2HFFB 4PBVC 5HPOA 4NDMA 2D9QB 4UNUA 2VNCA 5LCVL 1K5NB 5CUSL 1CD1B 4V1DD 4JGMA 4PJAA 1Z5LB 4JCMA 3U36B 3O4LB 1MRDH 1CU4L 4X4ME 1NC2B 3MRJA 5DJYB 1H9VA 5CEZL 3F7VB 5IF0B 1LNUB 4ONOA 4RMTA 5KJRH 1I7UB 1T1YB 4NUGL 2AJYH 4QRTB 5J8OA 3PWUB 5CD5C 3WXVH 5BXFA 4KTEL 4KUCD 2VLME 1IGCL 1EPFA 4LSUL 3S88H 4R97C 3QHFH 3D2UD 4K9EL 1M7XA 4YDJB 1PY4A 2OP4H 2YPKA 1HSAB 1JJUA 1RFDH 5ADOH 2JCCB 1W2KT 3TVMC 1DANU 1LEKB 1QRNA 4XWGH 3QUKB 1G6RB 1G0YR 4FG6C 3TIEA 2AJUH 1I1CA 3F7PC 3DMMC 3MJ9L 4YDKH 1ROWA 1YN6B 3KS0J 5C0EA 1Y6MR 4AEEA 3MCKB 1K9TA 1W0VA 4N0CD 4HXBH 5IK3A 4YXLL 4OCNC 4R8WH 4X6BA 1ZHLA 4UOW1 4BSJA 5E7BA 5DZOA 1ZWIA 1UWXH 1N7MH 4FFYL 4XCCH 4EN3C 2RFXB 5BZWB 4ZD3L 4JG0H 3KPSA 3WXWL 4YQXL 3CPLA 3WFHB 1OGAA 5BS0D 5KZCD 1CDBA 3IJHB 3S37X 4NGHL 4NHUB 2NY1B 4HD9A 4KKAC 1CFTB 3AAZB 4JFFE 2BSTA 1DN2A 4L4TE 3BGMB 1MHCB 1BFVL 1ZVSA 2J12B 4TSCH 4Z8FH 4I77L 4KDTC 2Y6SD 5I1AB 5J13B 2GHWB 1VFAA 2VWEC 1JGLH 3FHQA 4LSVL 5E5MB 1JZ4A 3FFDB 2Z8WC 1MCPH 3O4LA 1ACZA 5E6IA 1LE9B 3CX5J 1JIBA 5DRWB 1KENH 2YC1B 5CEZH 5GRYA 2HA1A 3MLSL 1C5BH 5MENA 4JY6A 3M07A 1Y6NR 3GMRB 3LIZH 3L6FB 4ELME 2W9EL 1Q94B 2EDNA 3PHSA 4M00A 3S36L 4DGYL 2HT4D 4LQFH 1FBIL 1PEWA 4O58H 2AQ2A 5DJAA 5FYJU 1D5XA 5EOCH 1HNFA 1OAZL 5C0NC 1UZ8A 1QKZL 2YRPA 2XKUA 5CEYA 2V2TB 4LPYA 1JFQL 5JHLH 3WS3B 1LD9B 2IGFH 4DN3H 4YDJA 3EZ8A 1P4LA 5D7IE 2A77H 1ZMYA 2I07B 3OKEB 3HE7A 4PREA 1YECH 3MRDB 1MCHA 2WBWB 3IJYA 2ADFH 5JW4N 2WUCL 5E00B 2XKSA 1I9IL 2ZWLT 1V3JA 2WK2A 1BOGA 2NTFA 4XH2B 2DQEL 3KNBA 2ZCHH 3QG7L 5ILTH 5HGGS 5GS1C 3V0VB 4HT1H 3T04D 1I8MB 2FDBP 5L6YL 5DHVA 4LSSH 4F9LC 4R4BA 4S1RH 3T0BA 4F8QA 2DB8A 3BVNB 3EHBC 3SGKA 2NTSP 5DJAB 1GXEA 1HQRA 3CSYA 4AM0B 1OTTD 2QHRH 5GJTL 3TPUB 2VZ1A 5DUPL 5KVMC 4HJJH 3H7LA 3WE6A 2E6PA 4Z7QE 4OLYH 4YO0A 5J1AA 2J2ZA 3KJ6H 5I71C 5KVEH 3QRGH 1PLGL 4KVCL 3W9EB 5D7JA 2J5LC 5ICYB 3U4BL 1A9BB 3K7UA 2Q3AA 1A0QH 2GTZB 3O41A 3QEQE 2FECI 5A2KH 1AGDB 3LN5A 5FB8B 1BOGB 4XH2A 3ARDD 3ZYZA 15C8L 4R4BB 5DD0H 3VGGA 4LSQL 1IEAB 1U8PB 1SJVA 3OZ9L 3IB4A 1F2XK 3LEVL 5AG9A 2OTUA 3IDNA 4RDQG 4HUVB 3GBML 1ZGLM 5DA4A 1XCTB 2B39A 4JG1H 2OCFD 3SDDB 4BZ1H 1Q38A 1MCLA 4K7PH 4M62H 1YEGL 3RAJL 1A1MB 5EN2A 1MCPL 1OCWH 1OTTC 3TJHC 5EZLA 4POZD 5HYEA 4MLSA 5D7IF 1CE6B 4AEIL 5TJWK 5F72S 1AGEB 4LBEA 3QYCA 4N1EA 3MRKB 1PG7X 5GHWL 1BFVH 4H26A 3GSNA 2PTUA 3P4MA 5EORH 4HWEH 1F42A 3X12B 3WLWC 4FXKA 1QO3B 4JM2C 2DIBA 5BRZD 4HUMB 5EZJA 3OGOE 5T3XD 1UKSA 2VLJB 5MERB 1EFQA 4MNGB 1J0HA 2I60H 3W11C 2GUOA 4MJID 2BNQA 3PGFL 1EGJH 2VDKL 3QNZB 4QXUL 2NPLX 2OS7A 3OJMB 5FIEA 1A7BA 2OLDA 4PJXA 4KZDL 1FFPB 4LLWB 3LKOB 4GW5B 3MYJA 4PJCA 1MCOH 4HIHA 5CIPA 4GW4B 3L9RA 5CHNB 1A7PH 3L7FA 2IPTH 4JKLA 3QR2A 2R9HC 5BRZA 1U95A 4JAMB 4FOMA 3GIVB 4HH9A 5E6ZA 4JFYB 3MGAA 1ADQH 3MV7D 4G8IA 1ZGLB 4IMKA 3O8XC 3UTZB 1HSBB 3IAQA 4IMLB 1WZ1H 4MJ5B 5D9SB 4Y4KA 2OR7A 3X3GL 1IT9H 1TVBB 2XWTA 1OLLA 1AGFA 1AR1C 5J3HC 2JJVA 3O3AB 2IWGA 3T3ME 2Y5EA 2JELL 3B6SA 3L3DA 4GXUM 2Y6SC 3JWDL 3HE6C 4PUBH 5D2LF 1GVIA 1AXSA 1GL4B 4Z5RB 1JPTL 3EDEA 3QULA 5KG9B 3WDJA 1FYHB 1YQVL 3KR3L 2WWMD 3CFJA 1RU9H 2E8YA 5DJ6A 3HI6L 1U58A 1FZKA 5HGDA 4QOKA 5C09B 5F89A 4XP1L 5J57B 4N8VB 5F7YC 2FB4L 3SKJL 3RVWD 1AD9A 4IOIB 1F4HA 2NX5B 3HA0A 3NCCB 4XP9L 4LLUB 4MD4A 4EN3D 4ZTPL 3O6KL 4YFLI 3S35X 5IB5B 1KPUA 4AY0A 3FB8A 5SWSE 3RWGA 5TQ2H 5FF6A 4MNQD 4F7PB 4UDTA 4TOYH 4JO3H 2H2SD 3MGTB 4OD2A 1I9EA 5CSBA 4NNXA 4GS7C 3LEXB 4PG9A 3CX5K 1C5DB 3B9KC 4JRYE 1YYLH 1ZGLP 1TVDA 3VFTA 4P2OA 4L8DA 1FL5A 1S7WB 4PJ9A 5C0IA 4EDWL 3W82A 1KEGL 3R1GL 3RGVB 1N5YH 1OL0A 4HGMA 1NGPH 3H9SA 5HGBB 3FN9A 1XGRB 4KKBD 3MJ7B 3BZ4B 4KMQA 5JXEA 5ALBL 1AC0A 3KYOA 4BFIA 2VLLA 2XWJB 3C6SA 1CLZH 1IC4H 3TCLA 1FVDB 3FTGB 3HMWH 4Y4FB 5C0AE 2Z91B 1FFOB 3JXAA 4HG4J 2NXYB 2P8LA 4YGAB 1BIIA 3IXAB 1H3XA 2BNUB 4Y4FC 1RZ8A 4BZ1L 4HJGA 1NBZA 3WSQL 2CIKA 3WKML 4WWKB 1F5WA 4O51A 2CRYA 4RZCB 1U91B 3UZQA 5FYJE 1G1CA 1IM3A 1G7JA 1INQB 5C92A 3IDYB 3CVIH 1IKFH 3DROB 1PG7H 4QTHB 3LQZB 3OBAA 2DBJA 4DKAA 1E4XL 2PYFA 4LVEA 3FRUB 1J8HD 4GW5A 2DOCA 5C07B 3U36A 2AEPH 1RZFH 3K4DA 2VLJD 4Y5VA 2NY6D 3WN5B 1T5WA 3BDBA 3MYZA 2FIRT 3C6SB 3DRTA 4Z7OE 5FUZH 3OXRB 3O9WC 1I9JH 5B8CC 5T1DH 4Q0XH 5E2UH 5B39A 1MY7A 3FT3A 3HCVA 5KS9F 1JGDA 1DVFD 4PY7A 1IEBA 4XC1H 3ARGB 2OYPA 1W72L 2EDWA 4L8DB 2V7HB 1A14L 4YAQB 5I1HL 1XGUB 4GW1B 1OP9A 1BLNA 5LVEA 2K1MA 2R23B 1HQRB 4ZO7A 5DS8B 1KELH 4L9LA 2XN9A 2DIAA 2W9LA 3QI9B 5FYLE 3VFSB 4L8SC 1ZS8A 1Q72H 4YHML 3ECBB 2OL3A 3O3BA 2X4NA 3AB0B 2HWZL 4FZEH 1JPFA 4GUPA 4P46D 5DMKB 3B5GA 4M9PA 4QNPF 4MDIA 4TULH 2FCBA 4U7SA 3QQ4A 2YKLH 3ARDB 3FOLA 2GCYB 1T1XB 2DKUA 3DURB 5ISZB 3LMJL 2YN5A 4DN3L 4FQJL 4NZUL 3ET9F 5DTFB 4K23L 1HHIB 1BPVA 4PJEB 1D5ZB 4XMPH 1WV7T 5HYSA 5EWIL 4YEEA 4G6MH 3QIBD 3ARGA 4E42A 3MXVH 4UQ2A 4TNVF 2IAMB 4JFZL 4ELMF 3VU2A 4KQ3H 4L4VA 4HGWA 1XF5B 4HLZH 4JO1L 5GZOC 5I9QB 5L8JB 2AEQL 3HPJB 2WNGA 4WDIB 4I0PA 1E6OH 3W11D 3ARPA 1G0XA 2J3SA 1VFAB 3NIGE 2KQNA 3CFBB 2UVFA 2XTLA 4I18C 3RY6C 4LHQB 4U1GB 2BVPB 4FTVA 1S9XB 4OCSL 3PP4L 4HK3J 3N06B 4H5SA 5DDHB 1UB6B 3IJSB 4NFCA 2HG5A 4RGOH 5FOJA 2GIYA 3IDXL 1YY8B 1XIWD 4OLVH 1SHMA 2VL5B 1RUQL 1UXWA 1D5IL 4POZC 5EU7E 5TDPB 1Z3GL 5C70A 3MXWL 4LAQH 3GO1L 3NA9L 1NGQH 3C60A 1N8ZA 3BO8A 5K9OA 4F7MA 2B2XL 1AO7B 1OY3B 4PJEE 4OI7A 4YUEL 3INUH 4I3RH 5JDSA 3B5HA 4Z9KB 3G5YA 5EUOE 4NDMB 1B9ZA 2BXYA 3ROOB 3QZWB 4M5YL 3SKNB 1T6VN 2ZG3A 2EDLA 4O5LH 1TZIB 1U3HB 2R2BA 3DXAA 2B2XH 3I6KA 5JORA 4NQCB 3CFEB 3GMRA 3CX2A 5I1CL 3H6JA 5C08B 2YSSA 2H1PH 2X1QA 1BQLL 2NZIA 3MA9H 3NZ8A 4JHAL 3ZKXB 3AXLA 4JFPB 4BFEA 3BO8B 5BXFB 2IBBA 2FBJH 4HUXA 5FO8A 3HFMH 3ULVC 1U8HB 3TA3C 5CD3A 1DBAH 4LMQI 5T33H 2BVYA 3WS6A 5KJRL 1N6UA 2X4QA 2VR5A 4M7JH 1MHHA 2IPUK 4ODBD 4N0YL 4X6CF 4K3DL 3DRQB 1LO3H 1MIML 4X6DE 2XA8L 1N0LA 1SMAA 3QNYB 5CSZB 4NQXA 2FHBA 5CGYD 4CAGA 3AS0A 1FNSH 3SDAD 2NX5A 3GB7A 3HNVH 1BFOB 2C4XA 4G7VH 4PJ5A 2XFXB 3T2PA 2DF3A 2Y25A 1VADA 1WC7B 2HAZA 2PYED 3HB3D 2VLRD 2N4IA 4UB0H 1QNZL 4NHCL 4D0BB 4IDLA 2VAJA 1VPOL 5J6GB 4LLQB 4HF5L 2IF7A 3PWPA 2Z8SA 4S2SA 2I60L 1HN1A 4JPVH 2F5BH 4HV8A 1WBXA 3AGVA 1BBDL 5HHOE 5HI5C 1GZQB 1V7ML 5ALCL 4OZ4A 3BRGC 3BP4A 1B2WH 3VXMD 4F3FB 4KKLC 4JFQB 4DZBB 3FB5A 1DBBL 1S5IL 3IKCA 2A2QT 1RZFL 1UB5B 1FSKB 4WO4D 1A14H 4LP5A 3F5WA 1A6WH 2VH5L 1FL6B 1KIQB 4MD0B 3RY6A 1JGVL 2DWEA 4PRAA 1TQBB 1FORL 2Y7QB 4RGNC 4D94A 3BHBB 3QXAB 2XG5A 4FP8L 4JZNA 5IVXE 2F19L 1UG9A 2A6JB 3M17B 1NMBH 1IC7H 3SGJA 5MEOB 5FGBA 4JFEB 4D0DB 1WIOA 2YD6A 2O61B 3C60C 2PTTA 5IR1B 4LKCB 1A7OL 3T3PE 1KN2L 3MLRL 4KKCC 5EUOB 3MBXH 4XHQA 2WZPD 4D9QE 3IDIA 4NNPL 5DLML 3KYOB 4XAKD 1A9BA 3TN0D 3J8F7 2DQHL 3SDAA 1BQHB 1A64A 1FRGH 5SWZE 4EI5C 6FABH 1IQWL 4LEXL 4HQQL 1JHLH 4JREB 2PW2B 3IDMA 3EFFA 4PG2A 5GZOD 1FJ1A 2APWA 4LK4A 3PQYA 1FC2D 4HHAB 3QXWA 1CR9H 3ES6A 4OKVA 5GISL 2W0KA 3BPOC 1G9EA 3IF1A 1PSKH 2FGWH 4OD1H 5DJZB 1MI5E 1D3CA 2BSRB 5IBTL 1R3HB 1LO5B 3BVNA 4CW1A 2M26A 3V0WL 3BI9X 5DHVB 1CFVH 1IAKB 4GAGL 4DCQB 3BD3A 4PRHE 1N5AB 1KULA 2P5EE 4NHUA 5EUOA 2JK5B 3CSYB 4LSPL 1U3JA 4KKNA 4P5MA 1AQKH 2YK1H 2ZCHL 1FPTH 3IDGA 2UUDH 3SGKC 1JK8A 4YDLC 2P5WD 2KUTA 1FNSL 1P9MA 2VN7A 3SQOL 5KSUB 1VFUA 1OAXL 5L2JB 4PJ7F 4XX1E 3FO2B 5E5MA 5DQDL 2ZJSL 3QNXA 4Z7VE 5FGCB 4H0HB 5MEPA 1FZMA 5IEHB 1V5JA 2AJXH 3MJ9A 2X5PA 3O0RL 5FUCE 4Y16A 2FWOB 1N64L 2ICEA 5HDLA 1HHKA 4QTIL 3PWJA 4KQ4L 4TRPH 4PYGA 3CFJB 3O9WB 2N56A 3K81A 3VMNA 4NKOB 2GFBA 1IQDB 3VG0H 2NY6C 4HPOL 1YEDA 1ZLSL 4RGNB 1YMHB 5D1QA 1YNKH 4S2SB 4U6HB 4AL8L 4GKOA 5C0CB 4A6YB 1CE6A 4R0LB 1M7IA 3WFZA 2AJVL 1T22B 2D7PA 2BHZA 3D69A 1YEFH 1MEXL 3S3JA 4JHAH 2UWEE 3UC0H 1KNOA 5CKAA 5ICXA 2NY5L 2NYYD 4NC1C 5F7HA 3UPRB 2VDPL 1I1RA 2BNQB 4ISVA 4MCYA 4B53A 4P2QE 4L3EB 4PJ7A 4NOBA 4CNIA 1D5XB 4CW1B 5DZNA 1F3DH 1YEDB 4HK0A 1V3MA 4LARL 4Q58C 1OGAB 2GFBB 1CDJA 3MODL 3FT2A 5C71A 3FAWA 5F1IA 4LLUA 3STBA 4QEGA 4J4PD 1NQBA 2C9AA 2W38A 5FOBA 1T4KA 1XF4B 2APFA 4XI5C 3CU7A 25C8L 3AREA 3FZUD 4G8IB 3UJIL 4PD4J 1DLHA 4JQVA 4LAQL 1ZA3A 3LPGA 2NXYC 3VXSA 4U1LA 3TA3B 3O11B 2H2PC 3NFNB 4EQ2A 1KEMH 3LV3B 2XPGA 3KYAA 3KLSA 4EKXA 1LEIB 1DLFL 1TJIL 1YNLL 1PVHA 2DTMH 1T66D 1ZHNA 2WP3T 2KQMA 1FN4B 1I7ZA 5ERWB 1QRND 3RVUC 1MPAH 2YRLA 4LCUB 4QT5B 4JDTL 1J8HB 4ZUSB 1EZVX 1SQ2N 2PTVA 5T3XE 5KSAC 5L8LB 4LQ1A 1CFVL 3TFKC 2AJ3B 5F6IC 2FZ3B 3CFKA 1OCWL 4QNPE 3U2SB 3KWWA 1FYTB 5DMKA 2FGWL 5ANMA 5JW4M 3P9WB 3PP3H 2Z91A 2MKLC 1AQDA 1JPGA 3V6ZB 4U05A 2WBKA 4PRPA 3ILPB 1EJ6A 1YJDH 4UV7H 1AGDA 1TETL 5A2IH 2P8MA 1KV3A 4X7TA 1T0MA 1AR2A 1OW0C 5IG7B 4X7CC 2AK4B 3PABA 3PGDA 5D1ZB 5DZLA 4Y16B 4LSRH 1NCWL 3MRHB 1KCSH 1G7PB 5HI3D 1PLGH 1WK0A 1CWVA 1FO0B 4WVRA 1DBBH 1OSZB 2JIXD 3V5DB 2V5YA 2JF1A 2B0SH 5ID1B 3UZVB 2UVEA 5KVGH 5EZLB 4PRIE 3RL2B 4PJHE 3B5TA 3DI3B 4Y1AA 2VZVA 1U93B 1CK0H 3UZEA 1L0QA 1GCFA 4X5XB 1KCRH 3EYVB 1EFXB 5J1AB 4ZOEA 3P40A 1XIWA 3FQWB 1TVHA 1TTFA 4FQXA 3VXTB 5J0BA 1BZ7A 2R69H 3NFNA 5A2JH 2QSQA 3RWDA 4HKZA 1X5IA 1WWBX 1HHJB 4X7TB 3R06A 4XNMA 5D2NA 5BMFL 3BXNB 1GZQA 4LSDA 3FN3A 2R23A 1DBJH 1UJ3B 5GS0H 4HKBA 4YAQA 3O8XB 3TNNB 4KROD 4BSWB 3DLQR 1NCWH 2GJJA 1MJJB 5HD8D 4HG4K 3EDDA 4MZ3A 5I17A 2ADGB 2R8SH 2GK0B 2EDFA 5DUBA 2CJUL 3BZEA 1JL8A 2R0KH 1BZ9B 4C54A 4U0QB 3TJHD 2VXTL 2FZ3A 1U8IA 4QRUA 2ZUVA 5TPWL 1TDQA 4BZYA 4R90H 1CFSA 1D7FA 4NP4L 4PS4H 3DGGA 2H9GB 1T21B 5TDNB 1AGFB 1DEEB 3QA3A 1AGCB 5DJCA 5E8EA 3CPLB 4FXGB 3P0VH 3ARED 2YUWA 4XCYB 5IHUH 3KPPA 3VD9A 2VIRA 3LEYH 1IRAY 2BZDA 5ANME 4Y5XB 1CXHA 3NCJH 5JOPD 4JM2A 3B8YA 4RMRA 4PJCE 4XPTH 1F6LL 4ZUVB 4AJ0A 1IFHL 1BAFH 3LKOA 4WHTA 3G6JF 3S5LG 1GGCH 5DRNA 1VKXB 1NGPL 4I4WA 2Z8RA 3S6CA 3X14B 4XC3H 4BKLB 1K5NA 2B20A 4OF5A 3UTTE 3WDIA 2IMMA 2W9DH 2YS4A 4UILH 3C9NA 4KZEH 2F58H 4Y4FA 1WFUA 5F1SA 5B8CB 1CLYL 4P3DA 3V8OA 1MREL 1HIMH 3GSXB 3D39E 3EHBD 3RZCA 3MJ8A 4RBPH 5HD8C 2B1HH 3T2NL 1XZ0A 5CAYB 1MCQA 2XWTB 2A1WH 4KROC 2VXUL 1EO8H 3G9VA 1AKJA 4P4KA 4HUUA 4R9HA 5IQ7L 5JIIA 1IAOA 5I74C 1MFDL 1A3LL 4AEFA 2DTSA 4OGAD 4YGVA 3E8UH 4I0CC 1T7VA 1I1AB 2FYYA 3CU1A 3SKNA 4XAWL 4OZFH 1NEZB 3PUCA 4LPVA 2C26A 4AL8H 5ITBL 2NY2B 2WUBH 5LGJA 5E5UB 3F58L 2XZCL 3MLTA 1P2CA 2YOCA 1VACB 4I4WB 3BT2L 3WIIH 2PR4H 2V2XB 2IEPA 5T1LB 1NGWA 3D48R 2R2CA 3VGFA 5IEHA 2LTQC 4J3TA 5C0EB 1S7RA 1VGEL 3OKYA 3LS4H 1FLRL 2VXQL 2FO4A 3QDME 5JA8B 5IW6A 1Z9OA 5EZOL 3C5SB 3ZLQC 4I0KA 2ARWA 3EYFB 4GQPH 3NIGF 3BH9B 5CS7A 3OKDA 3CMOL 1X4XA 1OTUC 2VDKH 3ESUF 5HGAB 1WWWX 1Q8MA 1E28B 5GIRB 3PL6D 1RD6A 5F71A 4DKEH 2X9WA 4WWID 2VDMH 1JNHB 4GRMA 1EAJA 5CP3H 5LJYH 1E6JL 5F8RC 1RIUH 3REWB 1CVRA 1N64H 1AQKL 2YK1L 4ODHL 1B90A 2EDJA 1G0DA 3LKPA 5E2TL 4HX1B 4P23D 3IFLH 5ICXB 4NQDB 3D3VB 1PX3A 5FKAA 1I85C 3V95A 1I4FB 4DTGH 3VDBA 3UJJL 5CWSB 1DQLH 4NO0D 3DXAD 2GSIA 2CKBL 3K4ZA 5A16B 1RJZB 1RUMH 3CK0H 4ODVL 5E6ID 1R3JB 4I0PC 2AABL 3QQNA 3QEGL 3BRFA 4Z7VA 4CN4A 4G6ML 3SCMA 3SJVA 1MCDA 5EIQA 1ZA6A 4BELD 5KS9E 2V17H 1U3HC 2X9XA 2UZIL 3TA3A 4FQXD 1IAIL 4GS7B 1KN2H 3MLRH 2OTWA 3KJ6L 5I8EA 2NR6D 4HZLB 5MENE 5D93B 4BQ6A 4XVSL 4PV9B 1BGXL 2DD8H 1CFQB 1WISA 4MZ2A 4POYA 2OZ4A 1H3TA 1G7QA 4JB9H 5F1NB 1ZLWK 1FC1A 4LLVA 2H26B 4Y4HB 3BZFB 5FECA 2VITA 3WKNA 2ZKHL 1P7QD 1MLBA 1BQHG 4HUKB 3ILPA 1QEWA 1KCSL 1TMCB 1KLGB 3DTXA 1IL1A 2ORBL 1FIGH 4P3CH 1G7HA 2HJKB 4OF8A 1YA5A 2RBLA 4L4JA 1TETH 4N5ED 3LD8C 4PRHA 5DHXB 2E7MA 3KYMB 3TP4A 3IKCB 4Z0BH 5KVGL 3VD4A 4S1DD 3L3OA 4LLAA 2EXWC 4WUUB 1ZS8B 4FQXC 3MV7E 4NUJA 3K8KA 1FORH 1MRCH 4OCYH 3IAPA 4U1HA 2AAVA 4PJ8C 1GIGH 4JFED 2CLZB 4UIMA 2MSPA 4NQDA 1TCRB 2W1NA 4L9LC 4LNVA 3RP1A 2Y7QA 3PQYE 4JY6B 4P2RA 2H6PA 2W0PA 3RNQB 4XNUH 3TYFB 2VDQH 3RNKA 1YYMH 2ZNXA 1T1WB 5EO0B 2EE3A 5IKCB 1IC5L 2QKIA 3OKDB 1UFUA 5HPMA 4WJ5B 4OZFA 3MLSH 1ZT1B 4UU9A 4AIOA 4V1DA 2Z9TA 2GT9A 1S8DB 5GIRA 1I7TB 2HRPL 1D6EB 3QUMH 1MQ8A 5JR1H 4P23C 5GGRY 1XMWA 4MCZB 5K9QG 3RGVA 3OXSB 4LSVH 4M7KL 3T77A 3X17A 4Q9CA 4W4OC 2VLKB 1RUKL 3FFDA 5F21B 2ZSWB 3A6OA 1LO2L 1I3UA 5CMAB 3H9YA 3PWLB 1JHTA 2P8PB 1RVFL 4RMSA 4U3CA 4WI6A 2F74A 3U9UA 4EUPH 4KJQC 4JY4B 2H1PL 1J8KA 1CLOH 1CDYA 3D0LA 4WNQB 5JHDD 5TE7H 4N90E 3QNZA 5T33L 3CH8A 1OTUD 3CVHH 2OJZL 2H32H 4HUXB 1KGCD 4P46B 3MLZL 2EDBA 3SHSA 1CICA 3BEWA 4JGUA 4POUB 5HPMB 2BP3A 4QRUB 4R8WL 4PJHF 4XP4H 1U8HA 3LRHA 5EU6D 5FYJL 3QAZC 4ENEC 2NY2D 3RWCA 5EH1A 3PWPE 5MP6H 3E6HA 1QBBA 3Q6GL 1N2RA 4YUEH 1ONQA 1AC6A 1BQLH 5DJ2B 4JKMA 4G80A 1CFNB 4D2NA 2X4SA 3MJ9H 4YDKL 1F3DJ 2KDGA 1IM9A 5M7QA 5F3HA 5TQ0L 1MF2L 1Q0XL 4ZUUA 3RUGA 4B7LA 4DGVH 4CVZB 4EI5D 3OAUH 4WW1B 3TN0C 2CR3A 1ZLUK 4XT1C 3O3AA 2E9WA 4JVWA 3L5XH 2HFGL 2FHCA 4JKKA 5J4MA 4Y5XA 5FM4A 5HHOD 1IM9D 3MRPB 4L8BB 3O6ML 4NCDA 1FVCB 5ESQB 1NFIB 4Z0XB 4X6DA 3T4YB 3ULSB 1QLEH 1YJDC 3GI8H 2QL1A 1RZKH 2GAZA 4HS3B 5CCKL 3B43A 2CK2A 3BWAA 2O5XH 3VXPA 2R2EA 5JQHC 1XR8A 43C9A 4L3AA 5FO8B 4IS6B 5FDWA 2D03L 1D5IH 4YHKL 1GIGL 3L3IA 1T03L 1NCUA 3P0VL 4P49A 2VC2L 1S7XA 4P9HH 2FYYB 4PTUB 1IT9L 5HYSG 3HZVB 2Q8BH 4RAUB 1F45A 4OZGF 1KIQA 3F7YA 1CGXA 1NDGB 3UTSE 2X09A 4F57L 1RHFA 4Y4KC 4TQEL 1UACH 4HPOH 4V2CB 2VDQL 5JHDA 2X4UA 2NY4C 2AK4A 4LHUA 3SGDH 5IFJB 3SQOH 4JDZB 2D4DA 3HC3L 1E0OB 3B9KB 5FV1L 3ALWA 4G9FD 3CGTA 4QHUB 2WSKA 2EDYA 4LPXA 4LCCB 1XGUA 2KH2B 3TIDA 4P2RB 4WUKH 2DMKA 4PIRF 3F7RA 4NRZB 3RAJH 4OF0A 1T80A 3FRUA 4QCIB 5IVXA 5T3ZL 4Y8DC 2DQTL 3KWWB 3VWJC 4KK5D 4QOKD 5DJ0B 3TO2B 5L2KE 2X4NB 3U0WL 2X2YA 3MLXL 1RULH 4K23H 1NAMH 1HXMB 3F7QA 4O2EA 1OAXH 1R24B 4HWEL 2FEDD 2YXMA 5DRZB 3CNKA 3VRJA 4OUOA 1TZGL 3KPRB 4U1NA 4HHAA 1WWAX 2HFEB 3K0WA 4GAGH 1LK2A 4JFEE 3JBG7 4PGBB 4YPGB 4FTVB 3VXRE 2J8HA 1KLUA 3W39A 2A6JA 3B9KA 3CK0L 4ODVH 1N5AA 1S5HA 3V7MA 3VXSD 4YFEA 1S3KL 3HMXA 4NRXB 4S11A 4PRID 5FGRA 4KRNA 5H35A 2R0LL 1MJ7L 2VLKD 1AGBA 3QI9A 4XC1L 4Y7MA 4WEBL 1KJ3H 3WIHL 2HT2C 3TWCH 5C9JB 3IETA 4LKCA 4MDJB 1K4CB 5C86A 1CDHA 2DI9A 1KYOJ 1KN4H 5DHVH 5DJDA 2IAND 4HWZA 4XNYH 4UINL 5F9WB 1CDGA 5F9DC 2BSSA 5DTFA 2AXJA 1JHKH 3HNVL 2X4OB 4UAOB 1LK2B 4J12A 1U41A 4TNWK 1I9IH 5DFVD 4ACPA 1A22B 4MVBD 4TSBL 4ORGB 3IFOB 1TIUA 4HF5H 3TV3L 3RWHB 1IKFL 3K74B 3UPAA 4AQ1B 4GG6A 1QLRA 2IGFL 5MI0B 3PV6A 4MAUL 3MROA 3GM8A 3SE8H 4QRQA 4HGKC 3SE3A 1W0WB 5IVXB 5GGVH 5GS0D 5I18H 2VLRA 3LN4A 5E0QA 3S36H 3WS3A 1FLRH 1U92A 5C0CE 3U7YH 1DE4A 2CKBH 5FUOL 4CJ1A 3AC0A 3WYRA 2IBGA 2A38A 3M8OL 4CUCA 1KJVB 3QDJB 3BN9C 1K8IA 4ONFH 4WU5B 3CMOH 1OVZA 3QXDB 4QGTA 1S7VB 3B2UD 4MMZC 4JO3L 1DBAL 3FQRB 1OD7A 4UTBL 4CMHB 4Y4HD 2P1YA 5IROA 4QRPB 4PGBA 1S9YB 3GHBL 4JN1H 1T6WA 4UTAL 1XF3B 3QCTL 4FQIH 4QF1A 4M8QA 3BDXA 3MFFA 3PNWA 5HYJE 3VGHA 3MV11 4M5ZH 2OXHA 1YUHA 2C1PA 5ID0B 1ZEAL 1E4JA 5EU7C 1OF2A 1P7KB 5IB4A 1G9NL 4JRYD 4LL9A 3JV4B 1S7RB 3N85H 1OSPH 1HHHB 2MWCA 4FTVE 2IPKA 1T5XA 2Q86B 3VXMA 4APQB 2B7DT 5GS1A 4M7ZC 2FBOJ 2F53D 3VXOA 3U0TB 1QPXA 4XI5D 2BVPA 3OV6A 4HS8L 1JMXA 3QHFL 5TDNA 3T65B 3MV8D 3T3PF 1TXKA 4KRMB 1FFOA 3VFWA 4BM7A 3D69B 5C6TL 1K85A 2B4CL 4KJYB 1CL7H 3QISA 2BY3A 2EYRB 4S1QH 5E8NA 5DVNA 4JGJA 4JPIB 5DXWA 3PF2A 4MHHG 4XWGL 2V5MA 4M1GL 5CP7A 3L3JB 2KKQA 3GKWH 1PD6A 1MNUH 1CFBA 4NM4H 2QSCL 4FFWC 2XTJD 4WHTB 4P5KA 2PXYC 1CT8A 1N26A 2Q86A 3FONB 3HNSH 3WFBH 4OCSH 4YX2H 4QOKE 3WO4B 1ZOXA 2GJZA 2IALA 4A2MA 2DQUH 1NL0L 3LKQA 5J7CC 1Q9OA 35C8L 5I8KL 4Y5VB 1UM6H 3ARFD 3PE9A 1Z2KA 2K9UA 2BNRE 5FYKE 2AJZA 1N3NB 2I27N 4CKVX 2D7NA 1UWGL 4OUUB 3V6FB 3JV0A 5KS9B 4AMKH 3BEVB 5C0RL 4PJ8D 1EVTC 4FZEL 1XGTA 2R29H 32C2B 3UAJC 1FL3A 3BMWA 4ZPVB 1NSNH 5KSBF 5IB2A 2OMNA 2Y07L 1C12B 4R90L 5KSBE 3E6FB 2OI9B 1NCAL 4P4KB 5J6HB 3MRQB 5FGBC 3JV5A 1YPZB 2EDDA 5K9JH 4KK9D 4DCQA 5I8EB 4JRYB 1XAUA 4NZTL 4P99A 3TT1L 5IBTH 4OM0H 2VJXA 2XN9B 1T0PB 3OAZH 5DMIL 3D18A 5C0JA 5FO9B 1ZLVK 3O81A 5F3BA 5KSUA 4JRXA 1B6DA 3VXNB 2GCYA 1S9WB 1NJ9A 1V05A 1PZ5B 1JE6A 3H0TB 4XXDB 3UTZA 1MI5D 3IDUA 2GJ6A 4MX7B 4YIQB 2GSIB 4XHJC 4NO2A 2GSGA 3BXNA 5GQBA 1HE7A 1F4YL 2HJKA 1C12A 5IMKB 4ZXBD 1HHJA 3S96A 1L7IH 3OKLB 2XXCB 3MX0A 4WEBH 1GGBL 1FNEA 2X10A 3VRLF 4Y5YA 3TWCL 1CTOA 4XPFH 1MJUH 5HHXH 2H2SC 4EI6A 3PNWB 3O45A 3ARZA 1HHGA 5FA3B 3UO1H 3EO9H 1G7PA 5IHLB 3QIUC 4YK4B 2EIZB 5D6DA 4YBLC 5CGMA 2KZ1B 4Z7UA 12E8H 2QV2A 4UV4H 2H9GA 5FCUH 2IFFL 2OL3B 1S9WA 4PJEF 3B2UC 3ROLA 1HXYA 1HXMA 4LLDA 5MENB 3MBED 2LAAA 1UYWL 1DFBH 1A6AA 3GRWH 3H9SE 4QWWD 4YIQA 4CN6A 2CLVB 2J88L 3QWQB 3QUZC 4AK1A 1MQKH 2E5EA 1C08B 4LLYB 3Q6FB 3MLPA 1BBJA 1MPAL 1X5ZA 2QADB 1IGJB 1WIPA 4TUJA 1IILE 5CIPH 2ADIB 1W8OA 3T0WA 2E7HA 1MWAB 3FO0L 3SY0A 2F9BT 4DVBA 1EK3A 1R24A 1XFPA 1NCDL 3TF7C 4WUUA 2B1AL 4KFZC 4ZPTB 3OHXA 5F8QC 2CPCA 4LIQH 1NFDB 4RA0C 1OOAA 3CIQA 4ZO6A 4G7YL 3UJIH 4MVBC 4RIRA 1HI6B 3PDGA 4FQCH 5SX4I 1MFNA 3KDMB 1II4E 3O6MH 4WI9A 1RZ7H 3CFDB 4TTDD 1EUUA 1DLFH 3HS0A 1UACL 2VITB 1H8OA 3L6FA 4ZFZA 4Z7WF 1OPGL 3H9SD 1ACYL 2BSED 5CJ5A 1F2QA 4WI4A 4JFPA 3KXFD 5JTWA 3TPKA 4WTWA 3U4EB 3DX6B 3D0VB 4KHTL 1L9MA 1RU9L 2NY3C 3TH4T 5I8KH 3RX5A 2N7BA 3CLFL 2BC4A 1L0XA 3VXME 4HWUA 5F3HB 4MNQA 5EZOH 4NGHH 2D2OA 4J3SA 5EC1A 3TO4C 4QRSB 1ZV5A 2A74A 1N5YL 1X5AA 4ZOCA 1U92B 2FX7L 3MCLL 1VEOA 3ARTA 3HPLB 4QYOA 3KPLA 4GLRH 1QQDA 1ZHKA 3MO1A 5IGXL 2V5SA 3I6KB 2NMSA 5JPNA 3BP6A 1VADB 3LH2L 3H9ZA 4FQHA 4H1LG 1DDHA 2VXSL 4J3OC 3N85L 4TUOB 3NAAH 4XGZA 3BEWB 3EFDL 4Z95L 3IU3A 1KJ2A 4M6OH 3I6GB 5IVZA 3VWJD 2UZYB 2Z92A 4S0SD 5HHVH 4C59B 2YR3A 1KC5H 1ZT4A 4QHKJ 5EIIA 5F70A 1DR9A 4K8RC 2J7LA 3NPZB 3Q1SH 2J5LB 5C0CA 1JRHH 3O11A 4RGOL 3X13A 3MGOA 2RIKA 5F7EH 5F6IB 2R56H 3MRLB 2NY5C 5FFLA 4P2OD 1YQVH 3G08A 3D9AL 3RKDC 3HRZB 4NYLA 1A1NB 1ZHLB 3C8KB 1SY6H 3ZT6A 5L2KB 3HRPA 4JY4A 1Y18B 2X70A 1JGUH 1RIVH 3BUTA 1OP5H 3SE3C 4QRTA 3C5SA 4U1JB 3P4OA 4JY5L 3L7FB 4MSWA 5ABDE 5HYSB 3NCJL 5I1DB 3OKNB 2E6QA 2I9TB 1CF8L 3VFGH 4YHPA 5L2JA 1F11A 3FCTB 4AEHH 4RWYL 5KANI 4PB0L 2QJDA 3GBMH 4OGYL 1OAYH 3GJEA 4U6YB 5EWIH 2ZSVA 1ERNA 1QHOA 3AY4A 3O8XA 3UYRH 3LKRA 1A7PL 2VXVL 5H2BB 1DQML 4OZGE 4YHNB 3BMVA 4HXAL 2ZCLL 1JYNA 4LCWB 3NPSC 1H3VA 3RUGB 1B4JL 4KGLA 1KXQE 5I76A 5DI8B 4WFFE 1QUNA 5IK3B 2HRPH 12E8L 4QXGH 1BOYA 1H8NA 2FIKA 3O3EB 4CDGC 4J8RB 4IHOA 3V0WH 2HG5B 3KLDA 2DLGA 2F53A 2DM2A 4WHYG 1UCBH 3DTXB 4F2MB 1SBBA 4JFFD 4UT7L 3JVGC 3BDYH 2HT4C 1YYML 4EN3B 1FZJB 5DVLA 4V1DB 3ZKSD 5DD0L 3L5WA 4HWBA 5H37G 3DMMA 4HJ0D 1KB5H 2DYPA 1UQSB 3V52L 4LPUA 4NO0A 4JFXB 1XCQA 2JE8A 1IGFH 5JHDE 3RTQB 1H8SA 5J6HA 3BQUB 4N68A 1NCDH 1BQHA 2HFEA 2DBLH 4YXKH 1S5IH 1CIDA 3D39D 4M62L 1JHTB 1KJ3L 2P8PA 3LPWA 4HKZB 3WIHH 1CK0L 3EW3B 3MRFA 1LILA 3DOSA 4M9OA 4PRPB 4NQDE 4I5BB 1DVFA 2OSLB 4PJIE 5DMGC 1DBML 4Y8AA 4KU1A 4LDOB 1BVKB 1NPUA 1XCTA 4JVUA 4LCCA 3HC0A 3QUZD 4M03A 2F19H 4W81A 1QBAA 1IBGL 5K9KB 4L1HA 4QWWC 4HBQA 4MJ4A 4HS6B 3PHOB 1IAKA 3NFSL 1NBQA 5EBGA 5C1MB 3NZHL 5FCSH 3UTSA 2NXZC 3EJZD 2J6EA 3JZ7A 1KBGH 3RA7L 3OKEA 3T1FA 1UB5A 5EC2B 1CFNA 2XRAL 1MCIA 1WUNT 5ICYA 3GGWB 3PJSA 1NMBL 5DRZA 4PJGA 4QHNB 4OGZA 1TTUA 2DM3A 4OLEA 1DN0B 2H2PD 2AKRA 1QKZH 5CEZE 4OZIA 2C1OB 1MFBL 3BPCA 4UDUA 2V9RA 3BUYB 1PBYA 4JO2H 4X6DB 4M93B 2AABH 4QY8A 1SY6L 2XFXA 5SX4H 5LGJB 5FA3A 5C07A 5CD5D 5E8DL 2YPVH 1TPXB 4JAMA 4OFDA 3RHWF 5I1DA 5B3JF 4LVHB 2GK2A 3EYOA 1UM5H 2FO4B 5F88A 4HPYH 3TZVB 3SBWA 5AWNL 3K2MC 4KKBC 3DHMA 4EVNA 5DRWA 1MFEL 3LV3A 1LEIA 5DD1H 2X4TA 4F9LA 1FNAA 3GFUA 2BNQD 2H8PB 4IRSC 4UT6H 3UTQA 1IGYA 5F93C 4Y5YC 4L1DA 1WTGT 3NGBB 4JHBA 4M6NL 3WNNA 4OZHA 2GTWB 1JPSL 4X9HA 4I3SH 2NX5D 4N9OB 2V2XA 3D85A 3H3PL 5JOFA 2Q7YA 2JELH 5IJVB 3TEUA 4D9LH 1I3GH 1CZ8H 2P48B 4Z7QF 4K55A 4MXVF 5EO1A 1NCNA 2AK1L 3KDMA 3SE9H 3PDDA 3V6OE 4XVJL 3DURA 3PL6B 4XP4L 4QO1A 3GO1H 3NA9H 3IT8D 4ZMAT 3T0ED 2J6EL 4MJ5A 5D9SA 3QUYC 3NCMA 5C0AD 1FSKC 1KIPB 4OD2B 1VFMA 2DQGL 4MA3A 5E70A 5JA9A 2D0GA 3TBTA 2A74B 4D0CB 1B88A 3QDGB 4LFHG 4FQLH 2PO6D 1J87A 3QEHB 4OZHB 3DV4B 5HYQB 4IIQA 3U30B 3EZJB 5DA0B 3OJVC 1F58H 1YUHB 1UKTA 3GIZL 3LKSB 1OAUH 1I1AA 5J3HD 3K8LA 2AI0L 4P5KB 3WD5L 4MA8H 4PJXB 4M7LH 2HVKB 1WT5A 3MV7A 3QPQC 1JMZA 2Q7YB 5SV3A 2AEQH 2Y23A 2Z31D 4YHIB 3GSVA 2ZUTA 1I1AD 3GIVA 3LSOA 4S0TD 5E4EB 3VRIB 1A7QL 3EYOB 1HWHB 1GC1H 2G9HB 3P11L 3P77A 4YHLH 5CJOL 2VRAA 3IRPX 3VXRD 5FYLH 2WLZA 4OZFG 1TVHB 1XGQB 2J8UE 4XC3L 2CUMA 1PKQE 5J56B 4G6KH 4K3EL 3EYVA 4JJHA 4MA3B 1A2YA 3KPRA 4G9FE 4LPCA 5D2LB 5GRWA 2IQ9H 5D7SL 1UJ3A 1I3RB 2BDNL 3IDJA 1G6RH 1BD2E 4XNMB 5D2NB 3M8OH 4MA1B 3Q5YA 2Q8AL 5LKNA 3TN0B 1S7QA 2FJFB 2R1XA 4JFOA 2GK0A 3ARXA 1HYRC 1ND0A 4ZUWA 4I18B 1DQDH 4CL7A 4M6AA 5BMFH 2P49B 1VEMA 3FL7A 5GS0C 3OR7B 1Z0MA 1FVDA 5EA0L 1SVZA 4R0LC 1G7LA 5MERA 5EU3A 1WQVT 3C6LA 2EIBA 5EO0A 5IKCA 1EEYB 3CXDH 5A2LH 4TULL 3VXTA 2PN5A 4Z7NE 1K8DB 2B0SL 4PRDB 5FCUL 3OG4B 5A16A 4C56B 1EZVY 4NQEA 4F33A 4NQDD 1J5OH 5HTSA 1M7DB 3MR9B 1W0WA 3Q0HA 4UINH 4FRWA 2VMFA 3ARDC 3QNYA 5CSZA 2HVJA 3DV6B 1E4XH 1U8MA 1EDQA 5H94A 3LHPH 1A4KA 1CGSL 4LDLB 4YR6A 3WLBA 3TYGL 1I8MA 3O3UN 3HG1A 3OR6A 3GMNB 2VABA 3QI9C 3U46A 2HJLA 2KBGA 3RDTB 4HW6A 4RAHA 4CMHC 3MLXH 3G6JE 3DO3A 4WUUE 3QEGH 3QWRD 4OZGB 5GGUA 5FYKL 4DJMA 3REVA 2BSSB 4KJPC 4NO2B 1IVLA 1H5BA 1LO4H 5HGAA 4U4BA 4HCRL 1CDUA 4E41D 1CGUA 4GQ9H 5D2LA 1RZ8B 3TCXA 4TPRH 4WUKL 3MR9A 5GJSH 2E3VA 3FB5B 1EIBA 1WAAF 2BDNH 1ED3B 5FAAA 1M7DA 2BNRD 1MHPH 4RNRA 2VSDA 3BQUA 4ODTL 4GSDL 3QO0A 1NAML 2XV6B 4G6KL 4K3EH 3FQUA 3O2DA 4EDXA 2HFGH 1J8HA 4ZUSA 2X40A 3BW9B 4M1CC 4OB5H 1KTKE 5DJXB 1T83A 4LARH 3VFOB 3WSQH 4IS6A 4AG4L 2FH6A 3AS3A 3W2DL 3S36X 1P4IL 3FQTA 2PTTB 1ZGLA 4I2XA 4G9FB 3QRFM 4WW2F 2FATL 1BVLA 2O61A 3BH9A 5DWUL 4ZPVA 5C08D 3WD5H 2EICA 1UEYA 3SO5A 4ZO9A 4WCYH 2ZOLB 1XZ0B 2NY6B 3D39A 1TJHH 2V9QA 4U0RB 3BP5B 1A8JH 1IAMA 4I1NB 3ROOA 1XF3A 4WHYH 3QFJB 3SCMD 3SJVD 4JDVA 1TJIH 2DTML 1I7TA 3DPBA 4HS8H 2JCCE 2QSCH 2BC4B 2W59A 4G80B 5FM5O 3PIQA 5F7FA 5I71B 1D6VH 4ZO8A 4Z6AT 4HX1A 3L1OH 5SX5H 1CBVL 3D18B 1L7TH 5C0JB 2J6EH 3IXTA 4MQSB 4XNXL 3IVKA 1JWUB 3RRQA 4FQHB 1BX2A 4PJBB 4J2XA 3NZ8B 1NCBH 2A6KA 5EU5B 5IB3B 3DBXB 5LBSH 5JXAL 4QHMA 4NKDB 5J9PB 1CXEA 5I15L 2HYMA 5C0GA 4XX1G 3L1OL 2A6DA 4WIQA 1CD0A 3QEQD 1H5BB 1HHIA 3MNVB 3DX9A 4U6TA 4UOW0 1HQ4A 4HPYL 1N8ZB 3VGEA 2OP4L 3EYSL 5JMOC 3UTQB 1CICB 1EHXA 3D39B 1P4BH 1OSPL 3DVGB 2ICWJ 1C5DA 3K2UL 3LKRB 3RVVC 3P9LB 5JDSB 4Q9BA 3V6OC 2RR3A 4Y88A 1FZMB 1M6OA 1JPTH 4AZ8A 2DQIL 3RGVD 4OAWB 2VLMD 5IQ9B 1EJOH 2IAMD 4J1UB 3ZDYF 3CFBA 3LH2H 1H3UA 2CMRH 4QYOB 4L8SA 2E9JA 3IJSA 1Y18A 1YEGH 4H5SB 1ZWIB 1T1WA 3AXLB 3S35L 5D2NE 3BP6B 5DD5L 3ARQA 2NZ9C 4QOKB 3EOTL 3P30L 1BEYH 5C09A 4KUZH 3G6DH 4DK6A 3MNZB 2E7BA 1PJ9A 3TPUA 1CXKA 3FN0H 2ZZUT 5IOPA 3N1PC 4YHOH 2R1WB 5TE4H 5EORL 5EPMB 4P5TA 3G6JB 5IEKA 2XNAB 4U3XA 5DS8A 1N4XL 1EH9A 1KCKA 5GJSL 3BE1L 4PRIA 4WFHE 2VDOH 4RDQF 2H32B 4F80A 4OCYL 3TV3H 1KB9J 5LWYL 4U1HB 1SY6A 4OLYL 2IJ0C 2XKNB 3O9WD 4YHYC 3GRWA 1KACB 4O2CB 3KGRA 1ORSA 5HHMB 2P7TA 2QHRL 3HE6B 4ONGH 5EFIA 1YEHH 3HZKA 15C8H 5SWZB 1VA9A 5GRJL 1Q1JH 2APXA 1WBZB 3IETB 5L0QB 2YZ1A 4OFKA 3FT3B 4G8EA 3OKNA 5EPMA 1XCQB 4S1SH 2UWEF 1ZT1A 1Q9KB 1OT2A 4Z0BL 3LQAH 1C16B 1JYVA 2X4PB 5GJTH 1J05A 2XTJC 2JLLA 3QFJD 4YE4L 4DUXA 1FL6A 5HHXL 2EIZA 3F5WB 3QHZL 4XPFL 2CDEB 5DGRA 3GK8H 1RUAL 2X1XR 1IAIH 3RX7A 4BH7A 4O2FB 4UQ3A 2WQRA 3WMSA 2P42B 2ESVD 4OT1L 2X4RA 4LCUA 4QT5A 4NQTA 5DI8A 2CO7B 4O2CA 1A6UH 3S5LB 1SM3L 1MFAH 3H3BC 3L3HB 4U31A 1A7OH 3FFCE 1OGAD 5SWZA 1ADQA 3PHOA 2QSTA 3RZWA 5AZ2L 1GH7A 1FYTA 1A6VL 4QHLA 3QBTB 1V7MH 4WTZA 4E41B 4BUHA 3HUJB 5GGTL 3DMMB 4QXGL 3HR5A 4OM0L 1L7IL 3TT1H 3V6OA 5LQBH 3LDBB 3GUTB 3GJFH 2IQ9L 3RIAF 2EDEA 4LGPB 3U1SH 5JUEH 4Z7VF 2E7LC 2VH5H 3JWOH 5IFJA 3KPLB 4DVRL 4HMEA 3QB7C 2JJWA 5C8JB 25C8H 4LLVB 1X5KA 3QG7H 3LKPB 3V79C 3EOAB 3QULB 5KG9A 4Y19A 4XRCA 1QFWM 4XZUB 1X5FA 3EOBB 4PJ8B 5TDOA 2BOBB 2NNAA 4NKOA 3LIZL 1LVEA 2ADFL 1E27A 2HH0L 1JZ2A 3T0EE 1CT8B 2WINA 1J12A 1JGLL 3HI1A 1UM6L 4NHCH 1XR8B 43C9B 3NIFE 1Q0XH 3U4EA 2OZ4L 2HVKA 1B0RB 1OARL 3VD3A 1WSST 5B4MD 3VI4F 1KTDB 4J3UA 5CJQL 3AU1A 4FS0A 1S7XB 4PTUA 4YZFE 1KUMA 3G5VB 3ZHDA 5L2KD 1JNLH 3MGOB 3FB8B 3T0DA 2NTFB 1AHWB 2JKXA 2DJ4A 4UAOC 1G1YA 2VDML 3ZE2E 4E5XB 2P24A 5T5FL 1ZE3C 3NAAL 3WXWH 4D0CA 1BEYL 5CBAB 4XP9H 5L2KA 4MCYB 3CLEL 1F90L 1A3RH 2NX5E 4HWNA 4LCYB 3QUMB 1HNGA 3SCMC 4LIQE 1U0QA 3W0WD 1K3IA 2CMRL 1EHNA 3BPCB 4JQXA 1E27B 4Z78B 5GGTA 1CQKA 2GJZB 2IALB 2G5RA 4U6XB 1JWMA 3V0AC 3MXWH 4U6HA 3OGCB 1KTDA 1DLHB 4ZSOE 3HHRB 3UDWA 4QRPE 1JF1B 3P0GB 4IM8A 5BS0A 2DLIA 3QPXH 3BH8A 4ZTOL 3P3YA 3CVHA 3NH7H 1CLOL 1ZKAA 2KPNA 2QQQA 2P24B 3V4UH 4W70A 2YD7A 5F6HI 3SDAC 2H8PA 4L4TD 5D7LA 5DT1L 4JRWA 2HTLD 2HKFH 2DL9A 1BM3L 4TYUA 4R96A 4Y19B 4K94C 4KI5D 4NBYB 5BZDB 2E6JA 3ZKMC 5GGVY 2XZAL 4N0UE 1HINH 8FABB 1LP9A 3OJDA 4PJIA 2JJSC 4PRHD 4XNXH 1IQDA 2UYLA 3ZDXF 3IFNH 5ICZA 5CKGA 4UT9H 1K4DB 2EDTA 4OZFB 4B50A 4ZXBA 1KB5A 5HHNB 2VAAB 5JW3H 4DUVA 1KIRA 1MWAA 4YO0B 5KAQF 2VLKE 3KLHD 1J1XH 3AUVA 5I1KL 4P9HC 5CILH 4JM4L 2GT9B 4H26B 2F8XC 4WTXA 3TH2T 1FH5L 3GMQA 4NN7C 2BY1A 4X6DF 4YBQC 4NN5B 3UP1A 2CRZA 2VLJA 3JV6A 4MB4A 2BERA 4KHXH 2AKRB 1S9YA 5IHZB 2FJGB 4FXLA 2VISB 3QDGD 2B1AH 1QG3A 1A6VH 1IZKA 5C8JA 3QXTA 2YZ8A 2CO6B 3BIKA 4FNLH 1KJ2L 3MV8A 3S34H 3VD5A 4DOHB 3GSWA 5JIHA 1Q72L 4YHMH 1EEZA 1UGNA 4JO2L 4AIZA 5KOMC 3D0LB 4DN4L 1T5XB 1G7JB 3QXUA 1HCFX 1KIRB 3NFSH 1A4JA 1CXIA 2VLRB 1W72H 3LN4B 1UWXK 5DHYB 3DX8B 1FG2B 4RISH 2G5BA 4PREB 2V2WB 1QVOB 2D31A 5FA4A 2O5YH 3VFNA 1H5BC 4KROB 1DBMH 4IRZH 4Q2ZA 1QSFB 4M61A 2ZPKH 4PRIB 4UV4L 1EO7A 3ZKMD 4OQ1A 2AXFA 4KMLB 5HHOA 3C5JA 1KCLA 1CIUA 3IDMB 4IBLT 1JZ6A 4LCWE 3A67H 4JANB 1VGKA 4NFBA 1WBXB 4YXKL 5ESAB 1QFUH 5IG7A 5F96H 5ISZD 3FMGH 3QFDA 3UYOD 3WHE1 1CVSC 2O5YL 5H8DA 4P59H 4NQED 1P6FA 4EXPX 4ZNCD 4LSRL 3CVIL 1CLZL 1IC4L 3CDYA 5D6CA 5IBUB 3BKYL 3MRHA 1GSMA 4AIZB 3B3IA 4PR5A 1Q9LB 5HHPB 5T1LD 4P2YA 5T1KA 2R0LH 4QKXB 3QIBC 3LQAL 1EV2E 4XVUC 1LP9E 1CL7I 4M48H 4JM2F 1MI5B 4PJ5D 4JZNB 3VXPB 2DQEH 1RIUL 3JTSA 5K59E 2HKHL 4X5LA 4KC3B 1MVUB 5E2WH 3VFWB 3VRJB 3QQ4B 5ANMB 3DRTB 1NLBH 5DEGA 1F4WL 2A83B 2AV1A 3FQWA 3QPQD 4FQXB 1NBZB 3BEVA 5D5MF 2IADA 4ETYA 5I9QC 2VDRL 3Q2CA 3FFCA 5ALBH 1T2XA 1FNGA 3JUYA 4JE4B 1MHEB 1NEUA 4XCEB 4G8GA 1BF2A 4PTTA 4IJ3C 1HQ4B 2R0WL 3UDWC 4K7PX 3MJGX 3STLB 1AHWC 4P2OB 4X98A 2VQ1A 4JJ5A 4YNYA 4BQ9A 2GY5A 1I1YB 4LFHD 4JDZA 4HDIA 1RK0B 4ZTPH 2YUVA 4I48A 4EDWH 5CP7B 5DJ6B 4ZTOH 4MDJA 3FONA 5B4MC 1LK3H 5CJBA 4QRSA 1FFQA 3T8XB 2I9TA 1KT2B 1YPZE 1N4XH 1U42A 2VQUA 3N50A 4KGJA 1G84A 1KB5B 4DOHE 3S8WA 5EUKB 2A6IB 3N1MC 4GG6F 1YEKH 1AIFA 3RWIA 5KS9A 5CILL 2AV7A 1I7RA 1YN7B 3WL9A 4ZFGL 1KPVA 4AEHL 2MQCA 3SDCA 3KPQB 3IU4H 3SBWC 4FMKA 1U8OA 3OPZL 4KAQH 2AP2A 2CKBA 3P9LA 4HDIB 5I1IL 3G5ZB 2YPLB 2ZOKB 3E6FA 1HIML 5DYOA 4ZSOB 1IM3B 1MREH 2BRRL 5K33A 4UNVA 3OKMB 2ED9A 4XVJH 5C0IB 2J1KA 4EXKA 4MQXC 4J3XA 5H2BA 4NQXB 3QCUL 3UBXA 1U8QA 2EZ0C 4Y2DD 4MA8L 4PGZA 4XCNB 3K1KC 1IE5A 3GMMB 2H3NB 5DD1L 4FQQB 4F9PA 5CEXA 5EB9A 2DWDB 4QHMB 2YA1A 4EDXB 1A3QA 3V4UL 2VTFA 2FL5A 5JIKA 3A6BL 4Y19E 4L4VE 1ZVHA 2FX9L 4P3DB 5JPNB 3MV01 1VERA 8CGTA 4U1LB 4AT6A 3KPQA 4PD4K 2IANE 4Y2DB 4ZFGH 4P4RB 3PXHA 7FABL 4KK9C 1EHLH 4FFVC 2A9MH 5KN5B 1FFNB 3P73A 1QSEA 4NOFA 1G6RA 4NN6C 1O0VA 3IDYC 4PUBL 4PYHA 3AS1A 4Z77B 1OF2B 4ZODA 4I48B 3SDDA 1Q9KA 5DO2C 1P6AB 3B9KD 4LHUG 4NCC2 4NO3B 2N1KA 4XMPL 3LKNB 4PJBF 4MDIB 1SJHB 2EO1A 4FQ2H 4DK3A 5I1EH 2DKSA 3HG1B 4ONFL 3ZSSA 3WNLA 2ICWI 4JG1L 4XTRD 3I85A 3X3FH 5CEXB 3T65A 4ISVB 3UTPD 3QUXB 3VFVA 1DVFB 1PEZA 2YBRB 2XOTA 3GBLA 3WFHA 5DQ9A 1F3JB 2NY1C 3EJYC 3QXDA 5HHQA 1H3PL 3NZHH 3ARBC 1U8JA 1T7WA 3CDGB 4ETQB 5IIEB 5C0BB 1H3GA 4KMTL 1YEIH 1INDH 1U8OB 1NBVL 2JIXA 4JFXA 1C16A 3HUJE 3QUYB 1AI1H 1IEBB 4LCCC 1U8MB 4JJ5B 3SDXB 4P2CG 4YHZH 4R7DA 4EUPG 3HE6D 4PJXE 3B9VA 4XMKH 5FXCH 4GSDH 4PJGB 4XMLH 4WI8A 3LEVH 1QFPA 1UH4A 3B8SA 4FQCL 3NN8A 5IBLD 2XQBH 1D5BB 1CGSH 2WBJC 4XPHH 1FIEA 2UY6A 5D8JL 3RKPA 1AE6H 2P7TB 3HE6A 5E2VL 5I76B 2DQJH 3NMEA 5AYUL 1ITBB 1MLCA 1A6WL 1AD0A 4PGEB 4XWOD 3FMGL 3VH8G 3N1GC 2WLYA 3TNMA 1BP3B 1KCUH 5HHQB 1LWRA 2R9HD 1CDCA 4NN6B 3WJJC 2CD0A 2IAMC 4K7PY 4RAVA 4H20H 1GPOH 3L3GA 5D2LE 1MVFA 5ALCH 1R6VA 1QOKA 4NNXB 4UBDC 3RGVC 1BZQK 1EXUA 5EBMB 4I2XE 3T3MF 3CXDL 1PY9A 4LVHC 1PKQB 1QFWL 2QQLL 5E56A 4NQEB 2EE6A 5BVJA 3G6JA 5IEKB 3RVVD 2ADJB 1D5MA 4ZYKB 4BFBD 1PW3A 1T2QH 4HBCL 1GHFH 1KTLB 1JGVH 4HT1L 5C09E 4KY1L 4S1RL 4X7SH 1Q9WA 4LSSL 2JCCF 4OGAC 4X7EC 4HEPG 1EA9C 2OJEA 4XPHL 5KVEL 4K94L 1A1NA 4XXDA 2DQFB 2Z0BA 3GSWB 1A6TB 1QSFA 3TIDB 1CD8A 1SYSA 1HEZA 4U6VL 3G5XA 1IGMH 4GO6B 4JPVL 5LWYH 1A6ZB 3RIAK 4WV1B 3QIBA 5EU4A 1O7VA 1T03H 4ZUTB 1CICD 1NUNB 5E99L 1QFHA 3HE7B 4JPWH 5L88H 1D5MB 5E03A 4ZYKA 2Z92B 3I9GH 3VMOA 3I6LE 3MLTB 3RI5K 3VE0A 4RX4A 3HG1E 1NAKH 1ZA6B 2ICES 4KKLD 4XMKL 3WN5C 3MBEB 5LG1A 2R56L 3DWTA 4X6CB 4PJHA 2COQA 3LKNA 4GKSA 4NKMA 3VG9B 3QQ9C 2Q8BL 5DK2B 4BFIB 4OBRA 3GHEL 5C2UB 1FNLA 2VN4A 3QEHA 4WTZG 4B7IA 1NBVH 3ARBA 4YBQD 5DJ8B 1XF2B 3CUPB 3DBXA 1FGNH 4M93C 5BZDA 3VW3H 5KVFH 2Y72A 2FHFA 3RUGF 5IV2B 3HB3C 5CCKH 1YDPB 3SN6N 1MCEA 4PP2B 4WEUD 4NRZA 2JCCA 4UU9B 1R5WB 4Y89A 2GI7A 4U33A 1LO0L 3WEXB 4OZ4B 3LS5L 4I0PB 1SYVB 3FRPG 2A9ML 3REWA 1ZHBA 1OTSD 5DK0A 2X4SB 3U82B 1G9MH 2CQVA 2IQAA 3QEUA 2OJZH 4P5TC 4KI1A 4LSTL 1H3WM 1P9MC 4Z7WA 4L3CA 2FX9H 4JFOB 5B22A 5EZIH 1JPST 3BKCL 1GGIH 2NY5H 1IC1A 4X9GA 4YXLH 3V4PH 4JHWH 4FQPA 3TH3T 2Z31B 3UPRA 4A6YH 2Z8VC 4BK5A 1QBMH 2L7JA 2OQJA 2W65B 3RVXD 1PAMA 3F8UB 4FN0A 3GJFK 2B4CC 3BGMA 3QJFB 4WJ5A 5I30L 3FB7B 3QH3A 1NMCC 3P9MA 4ZAKB 3C87A 1MCRA 4U1MA 1E4XI 4QLRA 5CP3A 1EGJL 4F9PC 1H0DA 4L3ED 3HNTL 5IJVA 1MCCA 5CZXC 2ADIA 3QEQA 3G5VA 1TJHL 5FDYA 3QEUB 2AVGA 4PJFF 4MCZA 1FJ1B 4PLOB 3D3VD 2FO1A 3UTOA 4B5EA 3BKJL 5E6IB 4YDIH 3LOWA 3HZYA 2GUOB 2AJXL 2P5ED 2OR8A 3FRPA 4OZIB 1ACYH 1D9KC 5ESAA 4QXUH 3BESR 5IGXH 1UEMA 5KOVC 1X7QB 1JNNH 4OSUH 1MFEH 3FB7A 3HKFA 1PX4A 5T1LA 5GXBB 1MAML 4IEFB 1UH3A 4Y1AB 4I18A 4XCNA 1YEKL 4Q74A 1FPTL 3MUJA 3I75A 1PZUB 3KYNB 4CVUA 4XPBL 1BF8A 3CD4A 4H1LA 3EYQC 1QACA 4XCFL 4NQEE 4RQQB 2JB5L 1MIEH 3QO0B 1T89A 3VE0B 2IFFH 1MUJB 4GQ9L 1M71B 4G8FA 3U7YL 5DEGB 1UWEH 4OIIL 4HZLA 5C08E 1KFAL 4I13B 4WUUD 3S4SG 4LCIH 3PQYB 4O2FA 4UQ3B 3E0GA 4NP4H 4PS4L 1MFBH 5J12C 4OZHE 3S5LA 3PWVB 4I5BA 1RZKC 2C5DC 4MAUH 3DMMD 5L8KB 5LXGH 2BHUA 4GKZA 5I17B 1NGYA 1EFXD 2QQKL 4UDUB 1NC2D 2ZUYA 3L7EA 3MZGB 6FABL 1I1AC 3CH1A 3A6CH 4JKWA 1K4CA 3NPSB 2EYTB 5I1GH 2BFVL 1NFDF 1YDPA 1EGJA 1P7QB 4KDTA 4G8EB 3KPTA 4P46C 4WFEE 5GS0L 4NPYB 4GT7A 2RCSL 4DGIL 1A7NH 1QD0A 4WGVB 3SGEI 3FKUS 4MXVE 1EAPB 3GM0A 3QNXB 4LASL 1VGKB 2I07A 5I1AA 3REVB 1EFXA 3BFOA 4NUJB 1AQDB 3EDFA 2D3VA 4MA7H 4KJWD 4D9QD 3RWHA 2CDEA 1UM4H 1FZOA 2OTUB 3IDNB 3PGCA 2X89A 4ZS7L 4N5UA 3S9DB 3P4LA 5CJXC 1S3KH 2DRUA 3PDOA 5DQJB 1CG9A 3L5WB 2HJFB 4YFDB 4X8JA 1MI5A 2DL2A 2VZ3A 4DFHA 1HKLH 4OFIA 5A43C 2NQCA 3WO3B 2VDOL 1TZGH 2O26U 4GJTB 1NJ9B 3D85B 5JOFB 3H7BA 3MREB 3ZE1E 4HFWB 1NFKA 1FHGA 1OP5K 3ARFC 2XZAH 3THMH 1JP5A 3ULVE 3BOVA 2XPGB 4JDTH 4ZFOL 5EBLB 1QRNE 5MI0C 2Z4QB 3JWNC 3QUZB 3MRCA 4EZMA 2PXYD 2IANB 3QCVH 2JJSA 1XGTB 32C2A 3KS0H 2QADC 2VR9A 1NANH 2CDGB 4XXCC 1I7ZB 4Y4FD 1C5BL 2AEWA 1MHHB 4FHBD 4EI6B 3O3EA 4HLJA 4PJ9B 5D1XB 1P7KA 2EEBA 1ND0B 4ZUWB 3M1BB 1P2CB 2E9BA 1E4WL 5ID1A 4PJGF 3CFKB 3DARA 2MHAB 4DW2H 4HK0B 5D70L 2YD5A 4M5YH 4R26L 1B0RA 1O5DT 3KPRD 5EZIL 3RTQA 1M1SA 2YD1A 1C1EL 1JF1A 5FOBB 5GS2D 4G6AC 1AXTL 5D7JD 3HNTH 5IW1B 4KI5E 1RSFA 3HTLX 3VXSB 4Y2DA 1UENA 3VFPA 4EIZC 2W92A 2EDQA 3TBWB 3DX9B 2AJUL 4PY8J 2FWOA 1AXSB 4APQD 5BV7L 2ZOKA 1QBML 2CKBB 4P57B 2IFGA 3E8UL 4NQVA 2GQHA 4P2RE 4PJIF 1AXTH 2P44B 1H15A 3O4LD 3S88L 2RHEA 1F4XL 3O3DB 4OLWH 5TH2A 4YDLB 5C0CD 1KIUA 2FX8L 2IH3B 2B5IC 1V3KA 1QBLL 3MROB 3VGAC 3NH7L 1CCZA 5DC0A 1HHHA 1G9ML 2VUOA 4U49A 4QRPD 3BN9D 4X0KB 3RVWC 5D96B 3LEYL 3GMLA 3EBAA 3LZFH 1CLYH 2YBRA 3G9AB 5CHNA 3MRGB 5L9DH 1ULVA 3MUY1 5FV2A 5F7UA 2QR0B 2AS5M 4WNQA 1I75A 4Y16D 3ULUC 1MRDL 3KPOB 1IZJA 3GNMH 5J13C 1NBYB 2DICA 3RWGB 4WHCA 4U1SB 5GHWH 3GSXA 4WFGE 1CL7L 3FAXA 3I9GL 4Z76B 1JNJA 5GGVL 4DFIA 3IF1B 4CRPA 3WXVL 3HMXL 5D7IB 4YHYB 5TPWH 4F7EB 1D9KD 4MNGA 3VW3L 3MFFB 5GPRA 4C57C 3BISA 3PWJB 5D72L 4PY7B 1DQTA 3QIWB 3IS0X 1A3RL 2C7UB 3VWJB 3QIWD 3PGFH 4QY8B 5ADPH 1F13A 3ULUF 1U58B 5DJXA 5C0BD 5DUMH 1LO0H 3HAEB 2OTWB 4NRYA 3FQUB 4K94H 1F97A 3JTSB 3N1QC 5CZXD 1BWMA 2KZWA 4KVNH 4PRPD 1NAKL 2P43B 4O4YH 1F6AA 2FL5B 2FR4A 5ECJE 4AENA 1RJYB 4LKXB 4P2QD 4I2XB 4N8VG 3TJEH 3VA6A 3RJQB