1CLZL

Igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
DVLMTQIPVSLPVSLGDQASISCRSSQIIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG3, KAPPA)
publication title The x-ray structure of an anti-tumour antibody in complex with antigen.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1995-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzL01
3MRMA 2J12B 3C87A 3QDJD 1LNUB 1W72L 3N1PC 3U6RA 4EI5A 2C1OA 3I85A 5DRXA 3CZFA 3ZSTA 4HKJA 4LBEB 2Z8WC 3NCCB 4P0DA 2HMID 1CGSH 3C6SB 1ND0A 3DXAB 1HOCB 4XBGA 4JVUA 2W91A 1TPXB 2R4RH 4K8RH 2JELH 2WBJB 1P7KB 3RWHA 4P2QA 2B1HH 2YZ8A 4RFNB 2AXGA 5ACZA 3CFCH 4KPHH 1FVDB 2FECI 4HBCL 4UV7L 2P5WA 1RZJL 4M6NH 5C0ND 1LD9B 2E9WA 4DW2L 2V9QA 5AUMA 5IT2L 1PG7X 3VRJB 1DE4A 4YDKH 3BP6B 4FQCL 4ZTPL 2RFXB 3TGXA 1UACL 1GAFH 4DTGL 3BGAA 5IFHH 3ULUE 1N5YL 2YMXL 1V8HA 5BQ7B 1C5BH 5BMFH 1NDGB 3QEHA 4LRNL 3QEGH 3T0DA 3BQUA 2YD8A 5BZWB 2GCYB 1RHHB 4NM4L 3CVHL 4YGAB 4HX1A 1VEOA 3NOIA 4PBWD 4BZ2L 4B5EA 3OR6B 1I9EA 2V17L 3PABB 2YXMA 5IMOB 3BOVA 4MAYB 1FZMA 3ZT7A 1BOGA 1LO0L 3GJFA 1PFCA 1D9KB 4HGWB 2PW2A 1TENA 3P9MB 5GS1B 1K5NB 3U7WH 2IAND 3SE9L 5C1MB 1ZEAH 5TQ0L 5GRXG 1S7UA 1WFNA 3QCUL 4MD5B 3UTSE 3GRWL 5EU7E 1CICD 5BXFA 4IRSA 5F7YC 1BBDH 3X3GH 3EIFA 2WBWB 2NZIA 4CADA 4TQEH 3QQ3A 4D0BB 3PWPD 1GVIA 4F7EB 1QR1B 5SX5H 1YC8A 5H35B 1FNAA 5A3IC 3H9YA 1KIQA 1ZSDB 2DJ4A 4X7SH 5B4MC 4OZGE 4GRWF 5E7BA 5JXED 1JGLH 1IAKB 2B20A 1NPUA 5JOPD 1VADB 3PJSA 1BVLB 2A6IA 3MRNA 4GMSL 3HPLA 4KI5F 5KN5B 1MH5B 3CCHB 4NKIL 2BRRH 4BZ1L 2VXSL 1CTNA 5A43C 3C8KA 4WIQA 1F2QA 4BFIB 4P59H 1CDGA 1QSZA 1MI5A 5L2KB 1G6RB 1MCJA 2A73A 3MRIB 4QHKI 2BSED 3IXTB 5HY9A 1WC7B 3VXQA 2EH7H 1SYSB 4JDZB 5TE7H 1OLZA 4XP4H 2ZCLH 1CGSL 3QEUB 1A6AA 1BEYH 5FA3B 2R4RL 4K8RL 2JELL 1GRWA 4HHAA 4KQ4H 2B1HL 2Y7QA 4CVXA 1UEYA 4NN5B 3CFCL 4KPHL 3NZ8A 4GFTB 4U6XA 4KHXH 5BW7A 4M6NL 3ZYZA 1DDHB 4MHHG 1X6LA 4JY6B 1QLEH 4NBXB 1G6VK 4P23C 4U0RC 3NIFF 4YDKL 1JZ2A 1GAFL 2CJUH 5BRZB 1QSVA 5IFHL 4O2FB 4X6CB 1C5BL 4ZOBA 3VFSA 5BMFL 2CD0A 5BOPA 1LEGA 3QEGL 1MWAB 3GMPA 3MV8E 4FFVC 2Z31B 4I0PD 4KRPD 3OTTA 3VXOA 4LFHD 4DFHA 3SCMC 1HH9B 4Y4FD 1DANT 3O3EB 5JW4Q 4Y8AA 43C9A 2ICWB 3QIWA 1U8PB 5FGRA 4NN6C 1T3FA 4PJDF 5FHBH 4Y19B 2HN7B 4PJ7B 2DYPD 3U7WL 3FQUB 4N68A 1ZT4B 1ZEAL 1I1CA 4ZD3H 1MWAH 1S9KC 2B1AH 4PTTB 2KL6A 2F9BT 5C3LD 5I16B 3WNPA 1BBDL 2QQQA 4KTDH 3X3GL 4Z6AT 1NCWH 2E3VA 2X4TB 2CRMA 4TQEL 3DBXA 4YEFA 2EIZB 2Z91B 4F7TA 4WI4A 4HJ0D 5IM7B 1BQHG 4D0CA 5EOTB 4FFZH 4QKXB 5J3HC 4WW2B 3UBXA 43CAB 4X7SL 2DLGA 3QPQC 2R0KH 3NH7H 4NRYA 5LQBH 1QSFD 1JGLL 4HXAH 2DM7A 2CDFB 3MJ6A 3ARFA 4NNYB 5FKAB 5DHVA 5DHYA 4DJMA 2E8YA 1OB1A 5ANME 5DD6B 2BY2A 2X7LB 1CG9B 1UFUA 3R1GH 1H5BA 2VDLH 2XI9A 4X8JB 4LSDA 4L3EE 2JE8A 2BRRL 3HE7D 1A21A 1FDLH 3VGAB 1FO0A 2FWOB 3LPFA 3T1FA 4P59L 3HLAA 4O58H 4B0MM 1EXUB 3LHPH 2WZPD 2XZCH 5ICXA 1WBXA 3VXPB 1CGWA 4AY0A 2EH7L 5TE7L 3UO1H 4XP4L 2FL5A 2OXHA 2ZCLL 2VH5H 4ODXA 4IJ3C 2FNBA 5D5ME 3BGMA 1PAMA 1BEYL 2XWTA 1HXYA 4KQ4L 3AY4A 4HBQA 1FYTB 3QUYD 3PDGA 5LKNA 2ICES 4KHXL 3UEZA 5SWZB 3RU8H 5KZCD 1FC2D 2MJWA 4LLDA 4CN6A 2OTWA 4X9GA 1HI6A 2WWMD 4NM8H 1QLEL 2JF1A 5GZNC 5IMKA 4YNYA 3T3PF 1JF1B 4ZFFB 2XKSA 2C3WA 3GMLA 4WU5B 2CJUL 3L3HB 3D5OF 3OJDB 4UT9H 3TESA 4JY4A 1ERNA 1U91B 2BC4A 3KPSA 2GEEA 2C3XA 4Y5XA 3MZGB 1EEZB 1HYSD 3RDTD 1HKFA 2Y6SD 4OCXH 5IQ7H 1J10A 3QDGB 4V2BA 4Z7VB 4QOKA 3HZVB 4H1LG 2NTFA 3OJVC 4NO2B 2GJJA 4MNHA 1WWAX 2OBGA 4ZSOE 5EH1A 3X14B 1J8HE 1ZHNB 2NYYC 3FFDA 1F8TH 3BW9A 3MRRA 5FHBL 5CLTA 3S5LA 1AGBA 5CGYD 2FZ3B 3WFZA 4OZ4A 4PREB 4FQQA 3FFCA 4ZD3L 1IGMH 1MWAL 4C57C 2B1AL 2JJTA 1CFQB 4DQOH 5LGJA 4UOW0 2XPGB 3ZDZE 1IGTA 1MELA 1RI8A 4KTDL 4PRIB 1NCWL 4GUPA 4EJ1C 5DWUH 2PUQT 2XQYG 2W0PA 2XZZA 1R3JB 3VH8A 4D3CH 5EC2A 3OG4B 4FFZL 2E6QA 3FZUC 3IAQA 4PY8I 1NFIA 3KJ6H 3WFBH 2R0KL 3NH7L 4JRXD 5E1AB 5LQBL 3TP4A 4HXAL 2JIXD 4DEPB 4IRZH 3ULSB 1VEMA 3MFFB 5FUCC 4ESKA 2F8VA 3TO4A 4JKWA 2DI7A 3A6CH 1XF2B 4OI8A 2H9GA 3WJJA 4PJIA 3VXSD 1A0QH 4I18A 1OL0A 3R1GL 4U1KB 3S97C 2VDLL 1F3JB 1SQ2N 4YHOH 4BKLA 3PG2A 1FDLL 2CIIA 4POZC 3L3DB 3O6FA 3LKQA 1AP2A 1KB9K 2V2TA 1QA9B 4O58L 3LHPL 4FZEH 2XZCL 3CXHK 5GRYA 5GS3A 1ZWIA 5CKGA 5TJWK 2APFA 4Y5YA 3O11B 3DRTA 1N8ZB 3BIKA 1QLFB 2MMXA 3UO1L 4IOIA 1NEZB 3F5WB 2VH5L 1UZ8B 4M4PA 3VD7A 2AV1A 1W0WA 4XZUB 3OJMB 4FFVD 1B4RA 5E8OA 2X9XA 4WFHE 2L7UA 3OKNA 1KIPA 1MLBA 4L9LA 3SDXE 5F21B 3PL6C 2ADJB 4PGBB 5T3XH 3RNQA 1YQVH 1NCUA 2JB6B 4X0KB 1WCQA 5BV7C 3RX5A 3RU8L 4GG6A 4P48A 3GSUA 4JPIB 4NIKB 4F9PA 2DLIA 4NM8L 4ZUUA 3MRJB 4GKNB 4NSKA 2C3VA 2NLJA 5K33A 1YY9C 4UT9L 5E5RB 1GGIH 2Y5TB 1LEIB 4TULH 1NGPH 2Q1EA 1WT5C 4DOHB 1DEDA 3TCLB 1UYWH 4NQXB 5F9DC 2VQ1B 4OCXL 5H37H 5IQ7L 3HC4H 4CMHC 2UY7A 5ID1A 3ULUC 3D25B 2H2PC 5ESQA 5F6HI 1NUNB 1C8PA 1ETZB 1ZGLB 5J3HD 4XPBH 1I85A 1RJZA 3QPQD 5DLMH 5F6IB 1UWEH 4JFXB 4DN4H 1F8TL 3VRIB 5C9KA 5HI5C 5DUBA 5CCKH 3MREB 2V2XA 3B6SB 1BQLH 1IGML 3U79A 1LO2H 4OKVB 1FL3B 1Q0YH 1XF3B 2NY4B 3QZWB 4DQOL 5K9KB 2AEIT 3KLAA 2P5ED 1YZZA 1LHZA 5IQ9B 3ILQD 2DQHH 4PG2C 3QAZB 5DWUL 1S7XA 3I6LD 3ZMRA 5EULV 1DVFB 3OX8A 5D2NE 3BD3A 4D3CL 5EU7C 1RAMA 1GYAA 1T83A 2VZUA 4ZDHB 1M7DB 2C4XA 1KCLA 1QFPA 1ZHBA 2P49B 3KJ6L 2BERA 4IEFB 2OZ4H 3DMMD 3WFBL 2IALB 2VDKH 5I2IB 5F7NC 4IRZL 5E94A 5MEQB 2YA0A 1RURH 3W0WA 4IDJH 2YEZB 4PV9A 1BZQK 4F58H 3K8MA 4LCCB 1XGTA 3A6CL 4BFBD 3QIUC 3MGTB 1A0QL 4NZTH 2BNQB 3SQOH 3FO0H 3KR3H 3RGVA 4RIRB 4YHOL 2EECA 1PYWA 5ICZA 5GZND 2LTQB 5J6HB 4HIEB 1U8HA 2YPLD 3HG1A 4LAQH 4XVTH 4MQXC 3PWLA 4FZEL 4LHUB 4IS6A 4HXBH 4BH7A 3QZWG 3BH9A 2BNRE 5DSCA 4LVNB 1UWXH 3OKEB 5I1AB 4LPWA 3V4PH 4PJ8D 2X70B 1MIEH 3CJJA 2FHCA 4P5MA 1KCSH 3LSOA 4NFDA 1F2XK 2OL3H 1RZ7H 4LU5H 5T3XL 3ULVC 1YQVL 4Z78A 4DKAA 4XPAH 1EEYB 4P3DA 2NYYD 3L7FA 4N9GB 2X5PA 3NBNA 3DETD 1J05B 3P4NA 4S1RH 3JTSB 3RA7H 1FSKC 3B8SA 3KYMA 1I1RA 3OJ2C 3GMOB 5HGAB 5FCSH 3AS1A 4PD4K 4TNVF 4PLOB 4U6YB 1GGIL 4MD0A 4M9OA 3CFJB 1NMAH 4TULL 1NGPL 4O51B 4RWYH 3QWRD 3BP5B 3DGCR 5JPNA 1UYWL 3TPUB 3HC4L 1EAPB 3PWNB 1S7QA 5HHNB 4UQ3B 3ZT5A 4PRNA 5J1SC 5IVOA 3RX7A 1BBJA 4XPBL 3FZUD 1ZOXA 4NRZA 3MCKA 4QY8B 4KK5C 1S5HA 5DLML 1UWEL 2NX5D 5DQDH 1BIIA 4DN4L 5HTSA 2NY2D 1OM3H 5DA0B 4G42A 5CCKL 4WNQA 4MSWB 4YBHA 1FV1B 3D85B 1BQLL 1LO2L 1Q0YL 4ODVH 4XAWH 1P7HL 4Z7UA 4M93C 4PJGA 3WS3A 4POZD 3BH8A 2Z92A 1JGVH 3NTCH 2DQHL 1Z6JT 5GSVB 1V7NH 4NRXA 4JANA 4JFED 3R4DA 1HH6A 1E4XI 3RY4A 2WWKT 5FM5O 4HPYH 4W4OC 4P99A 5EO1A 5FM8A 5AYQA 1KJMB 3C09C 5C0CE 1MCPH 1G7JA 2PTUA 2OZ4L 2VDKL 5AWNH 4NO3B 2I9LB 3KPRE 4XAKD 4HH9B 4LSTH 3QXDA 3OKLA 1CE6A 1RURL 1F6AB 4IDJL 4U1LB 2CO7B 5GRZA 3PL6D 3WLWC 1EO5A 4F58L 3E2HC 4OIAA 1FN4B 5B3NA 4YH6A 1E28B 3D39B 1CDCA 1WFOA 3NABH 4NZTL 5HVHB 5FGCE 1T20B 3SQOL 3FO0L 3KR3L 4UINH 5ID0A 4Y4HC 4HIJA 3K2MC 4KZDH 4JFPB 3WN5C 1AXSA 2BFVH 3CH1A 4XVTL 2VXTH 4LAQL 5ELIA 3UTTD 1N2RA 3VMOA 4HXBL 5HD8D 1W0VA 4TVPD 1CU4H 1MIMH 3GSOA 2XWJA 5TFSH 4MLSA 5F8QC 4M8QA 3SBWC 4Q6IB 5LBSH 1JIBA 2FD6H 4MD4B 3V4PL 2PO6D 4P2RE 3NFNA 4JRYE 1MIEL 1MEXH 1G7QA 4TYUA 5FAAA 1KCSL 4ERSH 2QKIB 2H2PD 1P4LB 2OL3L 1D6VH 1RZ7L 4KTYA 3FB8A 4LU5L 3MV7B 5HHOD 4ORGA 4L29B 4YHPB 5C07B 4XPAL 4N8VA 4EXPX 4KQ3H 4S1RL 2Z0BA 4I2XB 5HI5D 3RA7L 2OMNA 5C3TA 5JZ7D 2MCPH 3Q48A 4HAGA 4K3DH 5FCUH 4NC2B 4PV8A 4NO5A 2ERJB 4JO4H 3GSRA 1OTTC 3DGGB 3ECBA 5BJTA 5T1LD 3Q6FA 4G8EB 4N8PA 3TYFB 1Z9LA 1NMAL 2EYSB 2J8UB 4RWYL 3OKKA 3T2NH 15C8H 3VXSA 2IH1B 6CGTA 1EHLH 1I1AB 1DSFH 4P23A 3P4MA 2I26N 4NQCD 4PJBF 1RVFH 5IEKB 4NNPH 3BYYA 5DQDL 3DX7B 5L2JB 2XY2A 1OM3L 4POUB 4P4RA 5KVGH 1JHKH 3MXVH 1CXIA 3HI1A 3D3VA 1XGQA 5E2VH 1CN4A 4PTUA 3QIUD 2IADA 5JW4M 1U3HB 1BWMA 3ARPA 3SCMA 3WNOA 4ODVL 4G6FD 1VGEH 4XAWL 4C83A 4OCWH 5CBAA 2XFXA 5IB5B 4U3CA 4MWFA 1JGVL 2XXMB 3NTCL 1V7NL 3OXSA 4MQXD 4R7NA 5FF6B 1R6VA 4OBRA 2X89D 1JUFA 4HPYL 5MHSE 2CRYA 4K7PH 4D9QE 3V7AE 2K7PA 1MCPL 4LQ1A 5J11C 3P9LB 4EVNA 5AWNL 3WUWA 2MFNA 3A0OA 4LSTL 4QRRA 3IDIA 2A6DB 1OGAB 2ESVD 1PG7W 3J7HA 5C0AE 5E8DH 3ULVD 4A2MA 2E6JA 1AR2A 4PJAB 4OUUA 3NABL 4JQXC 4YZFE 4WI5A 4P2YA 1I7ZA 2VZVA 2EDXA 3EHBC 4UINL 3ROOA 1H8SA 3HAEG 4KZDL 4W6XB 5T5NG 1RZIA 3FONA 2BFVL 5E9DD 2VXTL 1LE5A 3IXAB 1JN6A 1CU4L 1MIML 3WD5H 4XCNB 5TFSL 3DIFB 3T0AA 5D7LE 5LBSL 5CEYA 2FD6L 5EC1A 2VZTA 3KGRA 2CXKA 3X13A 2ARJA 1EERB 1ZGLP 1QQDB 2V5MA 1MEXL 4R6UA 2CDEB 2DBJA 2Y36H 3ALWA 4ERSL 4KROB 2A83A 4RQQB 1D6VL 5DD1H 1CF8H 1SYVB 1KLUA 3B4NA 4CAGA 1FFPB 1EA9C 5E2UH 4PGZA 4H26A 5MEOA 4KQ3L 3W9EA 3QUXC 3F7VB 3I3EA 3V6FB 2MCPL 5CSBA 4K3DL 5FCUL 2YRZA 1I4FA 4HUUA 4JO4L 3KJ4B 4JM2C 3MTRA 3TIEB 1YY8B 1MFNA 4PRHA 2C4FT 3DURB 3U0WH 3T2NL 4WCYH 1G9NH 1ZVSA 15C8L 3VXUE 3HR5B 5MEND 1XGRB 3BP7A 1EHLL 1QSEA 1XZ0A 3A6BH 1DSFL 4XNMA 1G84A 4F2MA 1RVFL 4FXKA 2QHLA 2OI9B 4EN3A 4ZMAT 4NNPL 4V1DE 4PJXA 5HGHA 1DLHA 1A1NA 4X98B 1RFDH 3QA3B 3GSXA 5IVZB 5TDOA 2GSIA 5D72H 5KVGL 3MV9D 1JHKL 3MXVL 3WLWD 2X40A 5E2VL 3RVXC 1I8MA 4OFDA 3FB6A 2VLRE 1DL7H 1VGEL 2WSKA 3QUKB 4WHYH 1OF2B 3QUZB 2OQJA 4Y4HD 4OCWL 1O7SA 3MGOA 5TH2A 1MJJA 3TBVA 4GBXB 3BN9D 3WHXB 4Y16C 2NZ9C 3VWJD 1JPTH 1OP5K 3ZKQD 1KOAA 3SO3B 4PRPB 2IQAB 4TOYH 3JV4A 3MRMB 5JUEH 4M7ZB 3CAFA 5L9DH 4K7PL 5D7JC 3DXAE 4EI5B 3V4UH 2C1OB 1MREH 1M6OA 5C0IA 5D2NC 1Y6NR 3QWRA 1P7QA 3TJHC 4D8PA 4G7VH 1ULVA 4EI6A 1FORH 5E8DL 3TBTA 1W0YT 4NHCH 1KFAH 4JQVC 1HSAB 4MXVF 3RPKA 4G8FA 4XWOD 2FATH 3SDDC 4A2LA 4MA3A 2NX5A 4PRAB 5J9PA 3MPCA 4RMUA 1NBYA 3IFPA 1NQBA 3G6DH 3WD5L 1CWVA 4U1HB 1XF5B 3BKMH 3QO0A 1QHOA 4U3HA 1K8IA 1YEKH 2M26A 2OCFD 1JWSA 2Y36L 3QEHB 3BQUB 4OJFH 4WO4B 3JTTB 2EDTA 4MJ4A 3HHRB 5DD1L 1NMBH 1CF8L 3E0GA 1AE6H 4POYA 5E2UL 5EWIH 2VR9A 2EDBA 4YPJA 1NAMB 1HHIB 5EU5B 3PF2A 1BAFH 1WVZA 2R4SH 1FVCA 5JLZB 2CK0H 3LRSA 3IGAA 3X11A 3PL6A 3MROA 4HUWA 4TVSa 3U0WL 5HHMD 1DBKH 4WCYL 1G9NL 4PGJA 3NIDF 2PTVA 4UNUA 1A9BA 4F9LC 3A6BL 5ISZB 5DRWB 3GJFH 3ELAT 1XGPB 1I7UB 1NDMA 4HWBA 4JE4B 4YHLH 2DQDH 1BP3B 5CP7A 5C09D 1WT5A 3FOLB 1RFDL 1OAQH 2X1OA 1Z9MA 2OR8A 1LK2A 2E8ZA 5D72L 1R0AH 1Q9LA 4K07A 3RIFF 1UEMA 2RAMA 1R3LA 2E9BA 1TIUA 4LSRH 2C9AA 2R2HB 2IAMD 1WBYA 4NNXA 1DL7L 3PJSB 4MDJB 3EHBD 5EUOF 2C7UB 1J0YA 5L2KE 3VFNA 3LKNB 1EFXD 4LCWA 4WGVB 3DV4A 2F8OA 3C8KB 5GS2D 1JPTL 2NCMA 2OYPA 4XB7A 3QQNA 2WK2A 1MI5B 4TOYL 3C5ZC 1AGFA 5JUEL 5T1DH 5L9DL 5HY9B 2ZOKB 2J8HA 3PXJA 3V4UL 1MREL 5TF1H 3VXTB 4YHMH 3GJEA 3DWTA 5CILH 1T21B 1F90H 1MVUA 3TVMC 1A6AB 3KG5A 5KSBB 2ED7A 1IZJA 4G7VL 4PG2A 4L4VD 1V5JA 1FORL 4FQHA 4HHAB 5FDWB 1B2WH 5C86A 4EXKA 3UTSA 4Z7QE 1YJDH 3AREB 2VR4A 4NHCL 2YSSB 3WL9A 1KFAL 5EBGA 5D9SA 1D5ZA 5EZLB 3G5VA 4U6XB 3FQWA 2WLYA 4CU7A 2OJZH 2FATL 2DI8A 4FQXB 4JDTH 1F4XH 3QPXH 1AC6A 3UMTA 2BMKA 5BRZE 4O2CB 1BD2D 2X4PB 2F5AH 1J5OH 2I27N 1JPSH 4H88H 1BF2A 1A7PH 2P8MB 4MB3A 3G6DL 3I50H 2HG5B 4TSBH 3BKML 3BUTA 5GGRB 5A2IH 2D03H 1T2XA 2GIYA 4OZGA 5FO8A 1LP9F 1E27A 1WFUA 1YEKL 3I75A 4LP4A 3LPWA 3JSSA 3H9SD 4G9DA 1LEGB 1JMXA 3BD4A 5JHLH 4OJFL 1A1OA 4TNWF 5F9AC 3SDCD 1OAZH 2H2SC 3QSKB 4K9EH 5D1XC 1NMBL 1CI5A 4UOW1 1AE6L 2BDNH 3IDYB 3UJIH 1U8IB 4QRTB 1E4JA 4NPYB 5EWIL 2YD6A 43C9B 2XTJC 4Y19E 3QIWB 4PJ7E 2BHZA 1HQRB 5CWSB 1V3KA 1IRAY 1BAFL 1F45A 2OX5A 4XPTH 2R4SL 2CK0L 2ESVA 2OXGA 5EFIB 3TM6A 1DBKL 4S0SD 3KPPA 4Y16D 3CFKB 2NY0B 2ZOLA 2NZ9D 3KPQA 5L0QC 2JTDA 4OCMC 2Q87A 2AXHA 3EYVA 4XBEH 4U1JB 2ORBH 4AEFA 1U41A 4YHLL 2DQDL 2ATKB 5TF0A 3WNMA 1O7VA 3ARZA 4JJ5B 3VCLA 1OAQL 3CDYA 3TJHD 1R0AL 2P7TA 2WMPA 3LCYA 4RX4D 1F13A 5DHVB 4LSRL 4G8GB 1OB1B 2D0FA 2Q6WB 3QUMB 2AKRB 1DQDH 1H5BB 3GSNB 2YUVA 3N1FC 2HVKB 3MV8A 2EC8A 4JFDB 5E1HB 5DZOA 3QB7C 5DMIH 4U2YA 1WISA 1OSZB 5T1DL 1RZGB 4QHLA 1JV5A 3QP3A 3VFRA 2F53D 4QTIH 2Q7YA 5TF1L 4I9WD 4YHML 4IHOA 3QULA 5DHVH 2FL5B 5IBLC 5J8OA 5CILL 3ZE0E 1F90L 4GQPH 4U0QB 3FRUA 1FYTE 2XWTB 1B2WL 1HXYB 3BPLC 2HVJB 5SWZE 1VA9A 1YJDL 3STLB 1FO0H 3ESUF 4XBPB 3OGCA 5C08B 2DLEA 1Q72H 3M17B 2OJZL 2OTWB 4JDTL 1F4XL 3QPXL 3MR9A 3E6FA 1S78C 3LVEA 2MHAA 2F5AL 4YNYB 1J5OL 1JPSL 4H88L 1A7PL 4FXGB 4MXQD 3GMLB 3I50L 1NC2D 3MV9A 4TSBL 4S10A 1FYHB 1A6ZA 5I1JH 2D03L 3QIBD 2A2QT 3QDGE 4QWWC 5FB8A 3KPSB 4BSWA 1QHPA 2E27H 4Y5XB 3ZLQC 4Z7VE 4YPGB 1OOAA 4G7YH 5JHLL 3RZCD 3QEQB 3TNMB 5F72S 5EUKA 1OAZL 3WN5A 4K9EL 5ANMA 5FM4A 3UJIL 2BDNL 4XVJH 1TNMA 5E2JA 2NTFB 2H3NA 5GIRA 4MNHB 4L3EA 3QDJB 3SBWA 3L3IA 5IMMA 5IW1A 2BXZA 3IDMA 1FIEA 4Z77B 4R26H 3TNNA 1WCBA 2EE6A 5IB4A 1IJ9A 1T4KA 1JTTA 4HUVA 1VSCA 3CFBA 4XPTL 4ZPTA 5C8JB 4OZ4B 4U7SA 4YGVA 4EDXA 5IVXA 3DOSA 1ZA6B 1FH5H 4PRIE 2B39A 1RIHH 4N90E 3RVTD 3KS0H 1OT2A 3RVVD 5LGJB 5D5MA 4QRPD 1CFTB 3HC0A 2ZPKH 3OQ3B 5B8CA 1NUGA 1I1YB 2VXVH 1Q9WA 1X4YA 3O3BB 4NP4H 4HEME 5K9JH 1KYOK 4XBEL 5D6CA 1E6OH 5D2LF 1JTOA 2ORBL 4PJFB 5EC2B 1A7QH 1BJ1H 1AGCB 1CIUA 3G6JB 2OTUA 3QJFA 3VFOA 4L4TD 5F7UA 4WEBH 2BSRA 3OAZH 2IPKA 1TZHB 2DTSA 1F11A 1HEZB 4XPHH 1XH3B 1H9VA 1P5VA 1YPZB 5J13B 4PJIB 1ZLUH 4I18B 1I9IH 1DQDL 4UMGA 1KIRB 1UM5H 3K8LA 2VNCA 1IFHH 1CFBA 5CIPA 4ZO6A 2Z35A 5I75B 4UDUB 3LKQB 1TJHH 2EDNA 4LLYA 3SKNA 4WTZG 5DMIL 1YDPA 2IANB 3L3GA 3ROLB 4ZSOA 1J8HA 4QTIL 1FFOA 1MAKA 4IOIB 1IAIH 1B3JA 4HQQH 4MB4A 4C56D 1CICB 2H2SD 5D1XD 1FIGH 3VFWA 4RAUA 1MLBB 4L9LB 3HZKA 4S1QH 1FO0L 2WBJC 3PWPB 3VD4A 2XTJD 2O61A 3CDFA 3ZSSA 3NCFB 1Q72L 3VDAA 1TVBB 4P9HH 3GSUB 5K59E 5HYSA 5DRZA 3QDMD 5C09A 3OXRA 5F70A 1A47A 4FNLH 4MQ7B 2BVQA 4QF1B 1D5BA 1RZFH 1TJGH 3GM8A 5FYLD 4HS6A 1IAII 2EDOA 4DOHE 3S4SG 2CQVA 1I8IA 5I1JL 2EXWD 2XN9D 3FB7A 4JQXA 4F8QA 2ZG3A 2E27L 1GSMA 1MVFA 4OIBA 4G7YL 3HUJF 3I6GA 2X4OB 2NY5C 5ESQB 4XVJL 4DZ8A 2QR0A 3HMXA 5GJTH 2YPKB 4HIIB 3NA9H 1KIUA 2CDGB 1RHFA 3MBEA 1V7MH 1XIWC 4R26L 4MAYC 3T3MF 2J7LA 3I02B 4X6EB 4ZS7H 3VWKD 1D9KC 2V2XB 1F6LL 1JF6A 5KSAC 3RI5F 1FLTX 1FH5L 1RIHL 3JBG7 1MQ8A 4P3WA 1FG2A 4L3CA 4YBQD 3ZKXC 3REVB 2ZPKL 2RIKA 3QUXA 3DNKA 2VXVL 4E0RA 3SDXA 3NIGF 4OF3A 4NP4L 1QUNA 1CGYA 2DM4A 3B2UC 3GIZH 1LVEA 5K9JL 3RVUD 1E6OL 3PGCA 3TA3D 4JM2A 1A7QL 1DR9A 2Y25A 4ODWA 1MUJB 1H15A 3MRPA 3O8XA 4RAHA 4LGSB 1TFHA 1FZKA 1BQSA 3QXWA 4WEBL 5DRNA 1B6DA 3RY6A 2EEBA 3RTQA 4S2SB 3VG9C 3WFEH 3KLSA 3VXRD 5CGMA 1UB6A 3BWAB 4PV9B 5CSZA 2BNQE 2QSVA 4KRPB 4I0PB 1FVEA 1XGTB 4P2OA 3C6LD 4XPHL 2YD9A 4G43B 5FM5M 1I9IL 5SX5K 4NKMA 2PN5A 1UM5L 4Y4FB 2VLLA 1IFHL 3RY5A 1PYWB 1S78D 5ERWB 1TJHL 1U8HB 2BVPB 2W60B 3AS2A 3PWLB 4DK3A 1A7BA 4BH7B 1UXSB 2FO4B 5HI4C 3BZEB 1MCHA 1T1YB 5FFLA 5DSCB 4NBYB 1NLBH 5I66A 4W68A 3T2QA 1IAIL 4HQQL 2X44D 3LQAC 2DOCA 4UB0H 2FRGP 4PUBH 3GI9H 3LSOB 1FIGL 2YUWA 6FABH 4S1QL 1AFVH 4J12A 3EOBB 3IFNH 2ILLA 1MRFH 2PKDA 4Z78B 4GKZA 4OCRH 5B21A 4P9MH 4I48A 5D7JA 4NUJB 2W9DH 3L7FB 4NN5C 4P9HL 5ACLA 3AUVA 4ONHA 5D2NA 3IKCB 1OY3B 3AVEA 4FNLL 2NXZD 1RZFL 1QSFB 1TJGL 2JK5A 1EO8H 4LFHG 4BZYA 5AG8A 4MCZA 3VRLE 3O0RH 4MD0B 5I8CB 1CGTA 2PYED 1IKNC 3ARVA 2R1YA 1AQDA 4RFOH 4WUUD 5JPNB 5I19H 4X8XA 4NQDD 1KV3A 5EOCJ 4PP2B 1NH6A 3SDDA 2Z8SA 3BO8A 3HRZA 1S7QB 3HE7B 3KDMB 3G5XA 1L7IH 5CEZH 3BIAX 5IHZB 5JDJA 5GJTL 3LV3A 3VJ6A 3MRDA 3NA9L 4NRZB 1GZQA 3EYOA 3MCKB 1S5HB 1V7ML 3DI3B 1X5JA 5HYFA 1BIIB 4L4JA 4AG4H 4OLUH 4R96B 4ZS7L 4G42B 3TN0D 4GG6F 2YN5A 2F15A 3TIDB 2APWA 5EBLA 3I3BA 1I1FA 3MCG1 2DN7A 5FYKD 3RWCB 3QUYB 1RJYA 3WS3B 3BH8B 2Z92B 4UTAH 3DX9A 3F6IA 4OZIF 1X7QB 2AXFA 3MYJA 4CVWA 4HDIB 3HZYA 3GIZL 3O3AA 4LLMB 3ARDD 1BZ9A 9CGTA 2MCG1 4Z7WB 1G7MB 1KJ3H 1NC2A 2HYMA 2AP2A 1G7JB 5IMLB 3C9NB 1H3GA 4WW2C 5F44A 1BM3H 5J4MA 2O5YH 3WFEL 3D39E 3OKLB 4F9LA 3RDTB 2H6PA 2MQCA 1INDH 1TMCB 4UTBH 1HHHA 1ZA3A 1R3KB 1L0XA 1VERA 4OCYH 5J7CC 4X5XA 2WV3A 3HE6C 4GKSA 3MUGB 1JZ8A 3R0MA 2HFEB 3HB3D 3VGAC 4YDJA 3GSOB 1EPFA 4JHZA 2E6PA 5DFVC 4M8QB 1NLBL 3BEWB 1NFDF 3IS0X 4G3YH 1P1ZB 4P4KA 3NFNB 1S9XB 4UB0L 1JFQH 3MV7E 4PUBL 2E7CA 4K7PX 2WUBH 3GI9L 3L9RA 5C07E 6FABL 5CLWA 1G0DA 3MJ7A 4AL8H 4O2EB 1AFVL 5F9JA 5DEGB 3C5ZA 3IFNL 1MRFL 5DJCB 1Q8MA 4ORGB 4QRQB 4OCRL 4I2XE 4P9ML 1VKXA 2VZOA 2FO1A 1KTLB 1XIWD 1N3NB 3FQTA 2W9DL 4PGEA 3AS0A 1U9KA 2P46B 2Q3ZA 4L4TA 4JRXB 3TVMA 1OWWA 3MJ8B 4NO5B 1EO8L 5KSAD 2JIXB 3KPOB 3O0RL 3T04D 2XKUA 1T04B 2AV7A 3ECBB 5BJTB 5C0CA 5BZDA 1V05A 1LO5A 4OZFA 4YX2H 2G5RA 3Q1SH 3OKKB 3KPRA 4RFOL 1WBZB 1NL0H 3VXSB 4NT6B 5I19L 1J0IA 1IGYA 5C70A 1BLNB 3HZMA 1L7IL 5CEZL 4ZNEE 1J1PH 1T0PB 1GOFA 4CNIB 1QBBA 2L4OA 4U0RB 1IGCH 4C58B 5T3ZD 4RZCA 4RMVA 4AG4L 4OLUL 4YHNB 2WINA 1A6VH 3MV01 3ZYIA 3L3OB 1PVHA 2DWDA 3BP4A 1XGQB 4J3OC 2F19H 1FFNB 1MHHA 2BVOB 1DQQB 4P2RA 4I13B 1RUAH 4UTAL 2Y23A 3S37H 1NGZB 3CDGA 1F4AA 4NN6B 1U8JB 5A2LH 2ATPA 2V2WB 2F54D 1U3ZA 3KWWB 2GW5A 1KJ3L 4HLZH 1FAKT 3TWCH 2I9TB 2X4QB 2XN9A 1OGAE 4QXUH 2DTMH 3P73B 1R5IB 3WUWB 1BM3L 3VFMA 4HZAA 2O5YL 4PJAE 4CN4A 4PBVC 1IGIH 1SEBA 2H32A 3OR7A 4DEPC 2ZUUA 2BVEA 1INDL 1VFBA 3CZJA 4L8DB 4UTBL 3NN8A 4J1UA 3LEYH 5F7KC 4DGIH 3EKCA 3ROOB 4OCYL 2ED8A 5D70H 4LNRB 4FA8A 1FLRH 4I4WA 1QKZH 3L5IA 4WI6A 1BQUA 4J7RA 1JNLH 2VDQH 4G3YL 4R4BA 1KACB 2ARJB 1FL6A 1U8MA 1JFQL 2Z8VC 2WUBL 4Q2ZA 2JLLA 2DF3A 2A83B 4AL8L 3O4LD 3GMRB 1KLUB 3FQXA 2GJZA 4H26B 3H7BA 5TDPA 5IWLA 4L8SA 5MEOB 3W9EB 1N59A 1KGCE 4IJ3B 5KG9A 5J6GA 3DMMB 4WI9A 3IJYA 4WTXA 4ZUTA 4TNVK 4YX2L 5EIVA 3Q1SL 1M71B 3O2VH 5CD5D 2ZSWA 2P24B 5HHPA 3SDAA 1NL0L 1ZVSB 3L3KA 5B22A 1VDGA 4H25B 3PWUA 4ODUB 5HHVH 4RMWA 1KLGA 4HS8H 5C0AA 4PY7A 1JWUB 5FUZH 1J1PL 4E5XA 2YPLB 2YD2A 4X99A 1IGCL 2HTLC 2ZP0T 5MP6H 1FGVH 3PHOB 3B5TA 3BJLA 4JZNB 5C0GA 2APVA 1FZJA 5HGHB 3KPLA 5BVJA 3JWOH 1FFQA 3GSXB 5TDOB 1A6VL 4PJ8B 5HGDA 4Z7NF 3N0PB 1E6JH 2IBZY 5D7LA 4AENA 3JV6A 4OD1H 4PG9A 2F19L 1I8MB 2ED9A 1MY7A 1DTUA 2GSGB 1RUAL 2ZUYA 5TH2B 4PRPE 2LV4A 3S37L 2OR9H 4YE4H 4ZXBC 2V9RA 2XWBB 1LO3H 3ARYA 3ILPB 1SM3H 3QAZC 4WJ5A 3WDHA 4WGWB 1DVFC 1YEHH 1IT9H 3TWCL 4HUNB 3IF1B 5J12C 3QWOA 2YRLA 2DWEB 5CEXA 5CSGA 4QXUL 2DTML 1ZANH 2PYEA 3T4YA 3BKYH 2EDKA 4WUUA 1GL4B 4DZBA 1IGIL 1ITBB 1EZVX 4NQDA 5KS9F 1UJ3C 2J88H 2VISA 2R2BA 1UH3A 2QLVB 5ESAB 1P9MC 2YD7A 3VXUA 1XF4B 4LCCC 4OCNC 3LEYL 4DGIL 4Y2DC 4G8FB 5D70L 5INDA 4MA3B 3G08B 2NX5B 5J9PB 1JZ3A 3DO7A 3EJJX 1IEAB 1SVZA 4JGJA 1NBYB 1FLRL 2NY2B 3V52H 1QKZL 3QO0B 4V1DA 5IB2A 1JNLL 4KRNA 2VDQL 4U05A 1GZPB 3JUZA 4LVNC 1CE1H 1AD0B 3NFPB 5I15H 1CVRA 5E8PA 1CQKA 4J8RA 3DI2B 1A6WH 4JCLA 5FYJE 5JOFB 4JFEB 3KXFD 5F88B 3NAAH 1TQCB 1T2QH 3ZKMC 1HIMH 1UWXK 1LNUA 3EYUH 5F7MC 3C6SA 3DXAA 3X11B 3PL6B 5DTFB 3FMGH 3ARSA 2WBJA 1P7KA 3O2VL 3TO2B 4GRLC 2OLDA 5ISZE 2AI0H 4XRCB 5HHVL 4R2GC 1X5GA 4HS8L 4LSUH 2JCCB 5FUZL 4ZO9A 4ONFH 3PWJB 3UTTB 5JA9A 5MP6L 4JKLA 1FGVL 3RUGA 3VRJA 3BP6A 2RFXA 5CP7B 3CU1A 5CJXA 3JWOL 1S9VB 3GI8H 1I75A 2R0ZH 5BQ7A 1D5MA 5BV7H 2HTKD 1E6JL 3ARXA 1IM9D 1T89C 3SE8H 4OD1L 2C5DC 1NDGA 2I25N 2GCYA 1CDHA 1RHHA 5HHOB 1CFSB 1MI5E 5DI8B 4LHJB 4LCWB 4HWBH 3PABA 2OR9L 3DV4B 5E6IC 5IMOA 4LNVA 2LABA 4YE4L 4MAYA 3REWA 5EUOB 1LO3L 1D9KA 1SM3L 1AGFB 3F7RA 4HGWA 3P9MA 3MNWB 1ZGLM 1K5NA 1YEHL 5KSAA 4X6BB 1IT9L 3V8OA 5CHNB 5T1LB 5KSBE 4X7TB 3ULUH 4PS4H 5GRUH 5IG7B 1ZANL 3FHAA 4PJ5D 3SGKC 3BKYL 5FO9A 3TCXA 4L3AA 3AGVA 3C5SB 1DANU 5KTEH 2J88L 1U0QA 3EOAB 4FTVD 5HXMA 4JM4H 4QRSA 5D9SB 2DDQH 3V5DB 4K2UH 4D0BA 4NQCB 5HHXH 4F7EA 4XCEB 1QR1A 4YHIB 5H35A 4RGNC 5E8EB 1ZSDA 4G9FD 5FKPB 3V52L 3GHBH 5HYIA 2D7NA 1BREA 5D7KD 2NW2B 1IAKA 5DFWH 3QIUB 1YEJH 4X7EC 3UTPE 1IQDA 3I75B 4G6FB 4E9LA 4N0UA 1CE1L 3C60D 1MH5A 1PKQA 5KN5A 5JDSB 1A1OB 5I15L 1LP9B 2B4CC 2JJVA 3RFZC 4OLYH 1A6WL 2HTLD 4BFIA 1JGEA 3NAAL 5L2KA 1G6RA 1T2QL 3LH2H 3MRIA 1WJ3A 1HIML 3UXFA 3IXTA 2AK4D 4DGYH 1WC7A 3CH8A 1YEGH 3WYRA 4QTHB 3EYUL 2W9LA 1SYSA 4HD9A 1MCKA 2NR6C 5HDBF 2OS7A 4R9HA 3T0WA 4XVUC 3QEUA 2ESVB 5FA3A 5J0BA 3FMGL 1OQOA 3MXWH 1JPFB 1AR1D 5D1ZC 2Q86B 3HCVA 1HXMB 2ZOLB 2AI0L 3G9AB 4ZXBD 4LSUL 1C12B 3BHBB 4LF3B 1FSKB 1RZKC 3MLVH 4ONFL 1DDHA 1FL5B 2BVYA 2ENYA 5E9DB 3OMZA 5F9OH 3BJ91 3BVNB 1PD6A 4KKCD 4U6VH 1IKNA 3O9WD 1AXIB 2RCSH 1T6WA 5BRZA 4G8GE 3GI8L 2P7TB 2R0ZL 4O2FA 1ODAA 5BV7L 3VFGH 1IMHC 3SE8L 3CSYB 5JQ6H 4CVZB 2Z31A 1PX4A 1BGXH 3BESR 2D2OA 4Y2DD 2WLZA 4JFDE 1HH9A 2Y4SA 3O3EA 3VFPB 4HWBL 2ZUTA 4N0CC 4HWUA 5E03A 3SKMB 4LKXA 3L5HA 3PNWB 4XWGH 5LCVH 1JYWA 1PW3A 4Y19A 2HN7A 4PJ7A 1WAAA 3FQUA 3VFRB 3IETB 2RJMA 5IFJB 3ULUL 1ZT4A 1B0GB 4PS4L 5GRUL 1DN0B 4KHTH 4P49A 1S7SB 1VFAA 4PTTA 1J87A 3VXMD 5MENB 5KTEL 2AAVA 5C08E 5I16A 4LPXA 4Y88A 4ELMF 4FOMA 3P77A 4JM4L 2DDQL 4K2UL 5ADOH 1MCCA 4JY5H 4OGZA 5HHXL 3ZKMD 3ULUF 1NKRA 3C09B 1VESA 2V9TA 2Z91A 5IM7A 3K0WA 4WW2A 43CAA 3K4ZA 5CMAB 5D7IB 3GHBL 3MV9B 3KPSE 3LN5A 3E2HB 1A6ZB 2CDFA 2X1QA 3HR6A 4KVCH 1YEJL 4KMLB 3QEQE 4NNYA 5FKAA 3SO5A 3VFTA 3T4AB 2BJMH 5HYJD 5FB8B 4PLKD 1A22B 5DD6A 2GT9B 3BRFA 3WNNA 2X7LA 4R2GD 4Y4HB 1CG9A 1FHGA 5TPWH 3WN5B 3HE6A 4X8JA 3VWJB 3QDJE 5KVEH 1VGKB 4OLYL 2X10A 2IQ9H 1PBYA 1Z5LB 2FWOA 1KJ2B 1DBBH 1XF1A 2H3NB 2BOCA 1EXUA 1T80A 4YR6B 3LH2L 3WHE1 3IDMB 3VXPA 2ZWLT 4DGYL 3TNNB 1WCBB 1YEGL 5SV3A 4H1LA 5EZJB 5IB4B 1GIGH 4HUVB 5EOQH 2WQRA 4UV4H 4JPWH 4GXUM 3CMGA 5BCAA 1SBSH 5C92A 4YGVB 5IVXB 1T5XA 3DTXB 3KJ4C 3AROA 1Q94B 4ZFGH 4XNUH 5EIIB 3BZFA 3MXWL 3JWNC 3S36H 5EOCH 5EORH 1FYTA 3HC0B 2B7DT 3E1F1 4WW1B 5E6ID 4X6DA 4OZGF 3EOTH 3E3QC 4PJFE 4MDIB 1H8NA 3BD5A 5SWZA 4WWKC 3MLVL 5F1IB 2AVGA 3RQ3A 3G6JE 5ALCH 5D6CB 5ABDE 5F9OL 1HINH 1HILA 3NCMA 1JF1A 4ZFFA 4TTDC 3FRPG 4WU5A 4U6VL 4YIQB 2OI9C 3L3HA 3IRZA 2RCSL 3OJDA 4PYGA 1A5FH 8FABA 5JHDD 3CX5K 2NY3D 1YPZE 4PJIE 3VFGL 5C0BD 2IEPA 1EEZA 2WUCH 3VA6A 5JQ6L 4J3UA 4MMXC 3QDGA 1BGXL 1XGUA 4K23H 4RGND 1WICA 4NO2A 3E6HB 3SDYH 1KTKE 2IGFH 2IANE 2OP4H 3X14A 3OKDA 2COQA 3GMQB 3LN4A 4RRPA 4XWGL 5LCVL 3OKOA 1X5ZA 2Y06H 1YDPB 5KSVA 4HIHA 2FZ3A 3MRQB 4PREA 4KHTL 1NKOA 1KULA 5HHMB 1FCCA 4K94C 3PWPE 2YC1B 1HDMA 4RAUB 5I8KH 1MCSA 3BYTA 1S3KH 5CIPH 4PRIA 3SN6N 4XMLH 5ADOL 3QHFH 4JY5L 3B8YA 3UZQA 2O61B 4QRUB 1R3JA 4KUCF 3WIFB 4LCUA 3TBYA 5HVGB 5J11B 1SBBA 4R4NC 3LDBB 5C09B 1FNLA 1G0YR 3OXRB 5JOPE 2BVQB 3KNBB 2NR6D 1D5BB 3RBSA 4XVUD 4HS6B 5BVPH 2PXYD 5FGBC 1I8IB 5HVFB 1AC0A 1AKJD 4GLRH 4KVCL 3MFFA 5D1ZD 1M05B 3FB7B 2BJML 2N1KA 4CVUA 5I6XC 4FQ2H 5SWSD 4PJEB 4OF6A 4U1KA 5TPWL 1ZK9A 4F37F 1F3JA 1EFXB 1JZ6A 1E4WH 5GZOC 1KB9J 5KVEL 3ARBC 1UZ6F 4AYFA 2IQ9L 1RZJC 3NVQA 1KENH 1V3JA 4DZ8B 4TNWK 1DBBL 3CXHJ 3FAXA 1QA9A 2WP3O 1WZLA 3ZE2F 4H0GA 2PYFB 4JFFD 1N8ZA 1GIGL 4GLRI 5EOQL 1NEZA 3F5WA 4UV4L 5LXGH 1UZ8A 4JPWL 2DD8H 4XZUA 3LEVH 1SBSL 4L4VB 2BNUB 5A16A 1HCFX 4ZFGL 4XNUL 1XCTA 2HFFB 3S36L 5EOCL 2ADJA 1FG2B 4PGBA 5EORL 4X0KA 3QUXB 3MODH 3U4AA 4E42A 3EOTL 4H0HB 1MCIA 3UYPA 4M7JH 1DQJB 1BD2B 5ALCL 4Z18A 1F58H 1HINL 4DN3H 4M43H 4KKBC 1A3LH 2CKBA 4ODWB 1G7PA 3MRJA 4GKNA 3BRDA 1DQLH 1F5WA 5J1AB 1MCRA 1A5FL 1EK3A 1AGEB 2X4SA 2Y5TA 1LEIA 5DRNB 2V5YA 4ZNCD 2VTFA 3H9SB 3TCLA 1UB6B 4NQXA 2DIAA 4WV1B 2WUCL 2CH8A 3SDCB 2VQ1A 3V6OE 3GJFK 3D25A 1CXEA 2CLZB 4BUHA 2MQ0A 4K23L 4MCYB 1ETZA 4I5BA 1ZGLA 4ORZC 3SDYL 2IGFL 3PGFH 3DVIA 5D5MF 4F15B 2OP4L 5GGRY 3DO3A 5I1LA 4KI5C 4HWEH 3VRIA 2Y06L 1B4JH 5I66B 1UADC 3AMLA 1X44A 1FL3A 4OKVA 4OGAD 3VI3E 5DJAB 3QZWA 3ZHKA 4HAFA 4Y16B 3VFUB 5LG1A 5I8KL 5T33H 4ZXBA 2O26U 3RWGB 3T0ED 1S3KL 4XMLL 1DLFH 1UQSB 4GKZB 3QHFL 1DVFA 3AREC 4G6AD 4I48B 1V3LA 1QSFE 2EDHA 4ZAKD 3I9GH 4ONHB 4ZDHA 1M7DA 3F7YB 4HJGB 4AT6B 2SEBB 4FQXC 2JK5B 2IALA 1WF5A 5BVPL 4MCZB 5DHXB 2HP4A 1UH2A 2YEZA 2UZIH 1AQDB 2A6KA 2G9HA 2VYRE 4LCCA 1U8LA 4FQ2L 3MGTA 4YHKH 1EUTA 4WWKD 2BNQA 4OZHF 3BO8B 4ZO8A 1E4WL 4XNYH 3R8QA 2XA3A 3DV6A 1KENL 1DBJH 4HIEA 1U2CA 4XI5C 3MRDB 1C08B 3IDYC 1GZQB 3MOQA 1N6VA 4LPCA 4OFYA 2F53B 5I30H 5I76A 3ZDZF 3LAFA 3D9AH 3BISA 2KH2B 3OKEA 3VH8G 3N9GH 4HH8A 4K3HA 5KW9H 5E6YA 5LXGL 2X70A 2DD8L 3LEVL 1RJYB 3V95A 3EYQD 2FJFA 3MODL 1MHEB 4Z7WE 4KZEH 1EEYA 4H0IA 3BEVA 4N9GA 4M7JL 3HZYB 1J05A 5GGQH 4PD4J 1BZ9B 4TN9A 4Q0XH 1F58L 1HNGA 1MCDA 4DN3L 4M43L 4OZIB 3GMOA 4NKDB 1A3LL 1QPPA 4LPVA 1NC2B 2CLRB 3AM8C 5JOEA 5F93C 1DQLL 2J5LC 3K81A 3QIBB 4GRLA 3CFJA 4NCC1 1X3DA 2RBLA 4O51A 4K3EH 5DFTA 3BP5A 2VITB 4UNTA 3RZCB 2EIBA 3TPUA 3QNYB 3EFDH 3JUYA 5K9QI 1EAPA 1F3DJ 5F7EH 3PWNA 5HHNA 4UQ3A 1U93B 5EN2B 5HYEA 1A4JA 4GW5B 4R4ND 3HPJA 3GBMH 3PGFL 3S96B 4GKSB 4QY8A 4WRLA 1S7VA 1F4YH 3RP1A 2YD3A 4HWEL 1B4JL 1T89A 3S37X 2ZKHH 1KBGH 2NY1D 4MSWA 4JKPH 1FV1A 1PKOA 4KKLD 2R9HC 3H3KA 2OJEB 4JM2F 1A14H 2GITB 1GJIA 4QRPB 4MGXA 1I3RA 3B9AA 3NZHH 5T33L 3MJ7B 2EIDA 1OTSC 1DLFL 1L7TH 5DS8A 5C0JA 3LQMA 5F8RC 3FQTB 4JRXE 4D9LH 4H8WC 1RUKH 2P8PB 3I9GL 1KJMA 3N1QC 5DDHB 2H26B 3SGKA 4L4TB 3U4EA 3TVMB 2BY0A 5JHDA 4NO3A 5FEBA 2EDYA 4U7KA 2AV7B 1JNNH 3VXSE 3QDHA 4OZFB 1F6AA 4U1LA 1DUZB 2UZIL 1HQ4A 4M3KB 4LGPB 3D39A 4YHKL 1IGYB 3CFDA 3MNVB 8CGTA 2F74A 4PR5B 4XNYL 1BX2A 4JFPA 1DBJL 2EDEA 2XG4A 4KWUA 3ZKNC 4KKBD 4ODHH 4HFWB 3H42H 1OARH 5I30L 3D9AL 1ROWA 1B6UA 3N9GL 3WEXA 4EOWH 5KW9L 4MD4A 4C56B 5D1XB 4N5UA 1MHHB 3P0YH 1T2JA 1P4LA 3MBXH 1EDQA 2XTJB 3MV7A 3QQ9C 4NC0B 3QDAA 4L29A 5C07A 3CDGB 4KZEL 2CGRH 2XKNA 2ATPB 3TJEH 5GGQL 1ZXQA 4KI5D 2IPUK 5C0NC 3QDMB 4I2XA 4Q0XL 2EDLA 3PHQB 5JIHA 3WFHA 3V7MA 2XN9B 3DGGA 1O0VA 1TZIB 4Y1AD 1TXKA 5D1ZA 4G8EA 3TYFA 3U36B 4UU9A 3VFMB 2FDBP 2EYSA 4K3EL 1EVUA 2GFBB 4ENED 3MRCA 1EVTC 2D7OA 2H32B 5DURD 3OR7B 4JO1H 3TBSB 3EFDL 4FQPA 1I1AA 3N1GC 5F7EL 5AD0B 1G7HA 3QI9C 3KHOA 1J11A 5J13C 5IEKA 5FYLH 4KAQH 3GBML 4JFFA 1H3UA 1F4YL 5I75C 4U49A 3DX7A 3OAZK 3VWKB 4GRMA 1U95B 3QRGH 3T8XB 1WSST 2X9WA 2ZKHL 1KBGL 3HAEA 4XH2A 3ARGD 4JKPL 2P5EE 4N5ED 2H32H 4R4BB 4K8RD 1U3HA 1A14L 1ZLUK 4Y89A 3I6LE 5FA4A 4LARH 3L5XH 3NZHL 1EHXA 5EBMB 5IB5A 2M8XA 2AJ3A 3FT3B 3MJGX 5HJ3B 1L7TL 3IVKB 4XI5D 4XP5H 1R5WA 3TA3B 3DUUA 4D9LL 1Y0LB 5JORB 2ARJQ 1RUKL 1F4HA 2BSTB 2FEDD 1ACZA 1AO7D 3EO1B 4KGLA 3F7QA 4HKXB 4HUMB 2DL9A 4NQED 1JNNL 3M1BB 2H41A 3VXRB 3BPLB 5JXEC 3GHEH 4FP8H 2A6DA 4UBDC 2Q8AH 1OGAA 3C6LB 4TRPH 2G5BA 4Q74A 3QXTA 2VOTA 3IDGB 2VB5A 4KH2A 2YPLE 3P0VH 1H3XA 1G7LB 1Y18A 5C0AB 4MNGB 1FQ9C 4ODHL 4Q7DA 3H42L 1OARL 3IXAA 3AB0B 4L9DA 4U4BA 3DUSB 1Q9OB 3MYZA 4R97B 1FZJB 3KPLB 4XCNA 3DIFA 3FKUS 5F9WB 4R7DB 4EOWL 4H20H 3T65A 3ZTNH 3OB8A 1QQDA 5FV2A 3GNMH 2APBA 1DFBH 3MO1B 4PG9B 1QR4A 2VE6B 3P0YL 4RQQA 3MBXL 1KSRA 1FFPA 3SJVD 3RHWK 1JJUA 1MFBH 4OF0A 2YPVH 1YEFH 4HMCA 2CGRL 1KPVB 3TJEL 3V5KA 1FGNH 4WI2A 4LMQE 2NXZB 3AAZB 3F7VA 2Z9TA 3V6FA 4PJCB 4YFLI 4YHYC 3D0VB 1AD9A 3TIEA 1YY8A 2PYEB 4E41D 1P69B 3DURA 3T4YB 4Z7OE 2Y5EA 1DQMH 3GFUA 4WUUB 1XFPA 3DX8A 5GRJH 25C8H 3QG6B 4NQDB 1OTSD 3HR5A 5DVMA 4WWKA 1XGRA 2VISB 4JO1L 5I0DA 3H9HB 4C4KT 5IV2B 1U3JA 4I0PC 2NX5E 4MXVE 1DBAH 2X4RA 4KAQL 5FYLL 3DO7B 4TUJB 5IB1B 4X98A 1FNSH 1HWGB 2VLJD 3QRGL 3GB7B 2WNGA 3QA3A 5IVZA 1JNJA 3TN0B 4GJTB 4RAVA 3HN3A 4JN2A 4HW6A 4X5WA 4MAUH 1LILA 2WQ8A 3R06B 2WIMA 1RMFH 1IILE 2VKXA 3QUKA 4JFEE 4LARL 3L5XL 1HZHH 1FE8H 4URTB 4WEMB 5E8PB 3CUPB 4GBXA 3ZKND 4J8RB 2BY1A 2ITCB 4XP5L 1AGDB 3ARDB 4PRPA 2IQAA 3L5JA 4GH7B 4XAKE 2EYRB 3ME0A 4HJ0C 3FAWA 1RQ5A 3BWUC 2VWEE 5JW5B 2HLFC 4J3SA 5K9OB 3GHEL 4FP8L 2Q8AL 4W6YB 1JI1A 3WFDH 4IMKA 3QJHB 3QQ9D 4TRPL 2JCCE 3QNXA 2HFTA 1BFSA 1HSAA 3UTTE 3P0VL 5DEZA 4TVPE 1MCQA 3HE7C 4PRAA 5FGBA 3RUGB 3BSZH 4M1CD 5GHWH 1SHMA 4U1HA 1XF5A 4ALAH 1QEWB 4PRDA 1L6ZA 4DUXA 4HGMA 4Y4KC 1RPQA 3H8NA 4H20L 3ZTNL 1D5MB 3GNML 5HHOE 5GISH 1DFBL 3ARBA 4WO4A 3JTTA 4LCWE 4YHZH 3QI9D 5FYJU 5DMJB 3O3DB 5EUOE 1BVKB 1G0XA 1XIWB 3TPKA 5AG9A 4YFLF 3QUYC 1MFBL 2AJSH 2YPVL 1YEFL 1NAMA 5EU3A 1HHIA 1FGNL 1HCVA 2F5BH 3REWB 1CT8B 5EU5A 4OCSH 5KSAB 2WWMC 1IVLA 1S7TB 3DYPA 1T7YA 2NY5H 5JLZA 1RY7B 3BI9X 2W65B 1W8NA 3ZKXB 1DQML 5FO9B 2OR7A 4U33A 5GRJL 25C8L 4Z76B 4NQCE 12E8H 4FMKA 2VUYA 3UDWA 1HYSC 5I1DB 4QRSB 3RDTC 2Y6SC 4KJQD 5ISZA 4ONGH 5DRWA 1XGPA 1I7UA 3IJSA 4PRBB 1DBAL 2MNUA 4F7CA 3O41A 2P4AB 4M00A 3U0TB 3VG9B 1FNSL 1TCRB 3FOLA 5CZKA 5JNYB 5MERA 4UBDD 1HHKB 1NUDA 5CGYC 5DGQA 3NCJH 2ZCKH 1IQDB 1LP9E 2R2HA 4JAMB 4MAUL 4NWTH 4PJ9C 5DVOA 1RMFL 1OVZA 4N0UB 1CFNA 3UCRA 1PKQB 4MDJA 1HZHL 1FE8L 2C7UA 4X80H 3LKNA 2OTPA 4ISVA 5KVFH 3SE3C 5JQHC 2F54B 4PLNC 1G9MC 5LAXA 1JGEB 3RWJB 3WXWH 1YN7B 3PP4H 2EDJA 1KJVB 3MLSH 1ZKAA 2ZOKA 3G04B 2ESVE 3VXTA 1N6UA 3ULVE 1T21A 3MLZH 4GW1B 5EO0B 2N56A 4HEPG 5DMGC 4GAFB 5KSBA 3WFDL 3VD3A 5FDWA 4OAWB 4ETYA 1TDQA 3HCVB 3AREA 2YSSA 5E9DE 5HGBB 3VW3H 3FQRB 5EZLA 3S7GA 1EV2E 1G6RH 4ZFOB 3O6MH 4FQXA 1J12A 4O2CA 3TBWB 4QXTB 3MLUH 5GGVY 2X4PA 3BSZL 5GHWL 4FFWC 2P8MA 2HG5A 2WAHA 2BSSA 4ALAL 5EU6D 3ESVF 5GGRA 4PGCA 2EDFA 2DQIH 1BQHB 4KK8C 4BQ6A 5GISL 2CXGA 3O4LB 4YHZL 1T7XA 4HLJA 2AQ2A 2NY6C 4W70A 5JPMB 4YDVB 3RIAF 1U8IA 3H3PH 5IB3B 4QRTA 1G1YA 3IKKA 4NPYA 4WWID 4NBZB 5D1QC 2AJSL 1HQRA 4LKXB 2F5BL 3FCTA 3RAJH 5CWSA 5IROC 3S36X 4OCSL 3MRBA 3IYLW 5E6ZA 3QISA 2NY5L 4P5KB 5MENE 4PJDA 4X4YB 1VFAB 5EFIA 4B7IA 4XXCC 1L9MA 12E8L 1DP0A 3CFKA 2XOTA 4PB9H 2AERT 3P77B 4ONGL 4OQTA 1B0RA 4GXVH 3AM8A 4U1JA 5D7IE 4ELMB 3MRFB 3MV9E 3SKJH 2HLFD 2ATKA 4YBLC 4CKVX 4JJ5A 2FEEL 2XACC 3LN5B 5C0FB 3CFEA 5DO2C 2FHBA 3MMEB 3KLHC 2FLRT 3NCJL 5TE6H 3VFTB 3W11C 2ZCKL 4G8GA 4IIQC 4NWTL 5EO9B 2Q6WA 2D7MA 3QUMA 5T3XD 4EUPB 2AKRA 2ICWI 3GSNA 5HPMB 3BRGC 5DEFA 1Q0XH 4M03A 3HE6B 4X80L 4IOFD 2HVKA 3GMMB 5KVFL 4IMLB 3ILQC 3ARQA 4JFDA 3WXWL 4I0KA 2BOCB 2KDGA 4LRIC 3PP4L 3H3BC 2HT2D 3MLSL 1OSZA 1RZGA 1RIVH 4Y4KD 4UILH 3S3JA 4H1LB 5IVXE 4NHUB 4IRJC 3IJHB 3QXAB 3MLZL 3DMMC 4YAQB 5LVEA 3PIQB 1T5XB 5EA0H 1NGXB 4RGOH 3BZFB 1C5CH 3MLWH 2HVJA 3STLA 1UC6A 3KPNA 4X6DB 4XBPA 2J6EA 3VW3L 4OV6F 5C08A 1G6RL 3BT2H 3O6ML 2VR5A 3M17A 5BO1H 4F33B 4OUOA 1F3RB 3MLUL 3U82B 1HILB 4FXGA 4MJID 2EE3A 1A64A 4M1GH 2HKFH 4EUPG 2AEQH 3D69B 2IFFH 4OT1H 1HK6A 8FABB 2DQIL 1PZUB 2AJVH 3NPSC 5F7FA 4F7PA 4XHJC 3A6OA 4PJ8C 4G80A 4YPGA 3ALXA 2D0HA 3QEQA 3TNMA 3ZT6A 2VLKD 3RGHA 1XGUB 5D93C 3KXFB 5D4QA 4OB5H 3H3PL 4KY1H 2KKQA 4AZ8A 1KCKA 5CZXD 1FC1A 1GGCH 4MNQD 4LCYA 4NKOB 3QDJA 4F57H 4XGZB 3B5HA 3OKDB 3RAJL 3LN4B 4Z77A 3DETC 2QSQA 3OKOB 4WEUD 5KSVB 4YLQT 5HHME 4HIHB 4Z7QF 3MCLH 5C8JA 4PJ9D 3CD4A 1ZA6A 2MWCA 5E08H 4WTZA 2X05A 2UYLA 5TDNB 2ZUVA 3EFFB 1HDMB 1CFTA 3C8HA 4PB9L 5AZEH 3RJQB 1WITA 1I1YA 4WDIB 4X6CF 1KYOJ 3O3BA 5C09E 1N0LA 1T66D 2FX8H 4GXVL 4JHAH 3BUYB 4LCUB 4MX7A 3TBYB 4GQ9H 4PJFA 4O4YH 1AGCA 2DL2A 3SKJL 1OW0A 3G6JA 1D5XB 5AEAA 2WW8A 5SX4H 4HKBA 5DMGD 5B38G 4UT6H 1CDJA 1RJLB 5C9JB 1HHJB 3RWFB 1IM9B 4PJEE 3OHXA 2NY2C 1TZHA 5TE6L 5DZNA 1TVHA 1HEZA 2GJ6D 3HI5H 3QI9A 1XH3A 1YPZA 2VIRB 1FNGA 1KIRA 3UPRB 1UVQB 1Q0XL 5MI0C 3LIZH 3OAYH 4R4FH 5J89A 3MJ9A 4UDUA 4HJJH 1YMMD 4FFWD 3LPGA 3G5YA 1WQVT 4IBLT 3WO3B 2FGWH 5SX4I 1MHCB 2IANA 1RIVL 3L3JB 4GS7C 3ROLA 1TQCC 4UILL 3JZ7A 4KK8D 4L4VE 1T03H 3K8KA 4PJ5B 1RUPL 2LU7A 2WM0A 4NYLB 1INQA 3O2WH 4MXWH 1WLHA 5DJ8B 5A16B 1CICA 5EA0L 2NY6D 3D6GA 4RGOL 3MFGB 1C5CL 1XCTB 3MLWL 4FTVB 3EZJB 2VWEC 3SGJA 2MQ3A 1VCAA 2FYYB 3PWPA 5D1QD 1BD2E 1OWRM 1H0DA 3T2OA 4E42B 3WV0A 4HCRA 3BT2L 3NACH 2L0DA 4BM7A 1TVBA 2OSLB 5BO1L 1NJ9B 1UWGH 1SJEA 4UQ2B 4G9FB 5E99H 4MQ7A 4QF1A 2VDRH 2CKBB 5JXEA 1G7PB 1X4XA 1CL7H 1LEKB 1CLOH 2HKFL 2AEQL 3H9SE 4M1GL 5HD8C 2IFFL 2X4SB 4OT1L 4X83A 3V6ZA 1AJ7H 3UC0H 2DMKA 4OD2B 2AJVL 4MJ2A 1OP9A 1GHFH 2PO6C 1JF5A 3C60B 1WEJH 1G9NC 4BH8B 2X4OA 3UJJH 1GOHA 2GUOB 1NGYA 1JRHH 4OB5L 3ZDYF 4M6MH 4KY1L 4CRPA 4I5BB 3V6BR 2YPKA 1GGCL 2ITDB 2CKBH 4HIIA 2DQFA 5CJ8A 4F57L 3PGDB 2CDGA 2AK4B 3Q3GA 3D85D 5I1LB 4O9HH 5DVKA 3I02A 4KJYA 4X6EA 5DO2D 3KLHD 5ITFA 3LRGA 3MCLL 5JZ7C 3GBLA 1Y6MR 3W11D 4J4PD 1U3YA 1JZ7A 2QV2A 2AW2A 5E08L 3MSPA 3GUTB 4GG8A 4ZXBB 3O4OB 3REVA 5AZEL 1A6PA 1MFEH 1J0JA 2X2YA 1LQSR 5HI3D 3F6LA 3BZDA 5GGUB 2FX8L 4JHAL 1LMKA 5J12B 4GQ9L 4O4YL 5FO7B 4F3FA 4QNPE 1MUJA 2UZYB 3O9WB 4Z7VF 4IRJD 3JV0A 4PJHB 4XCYA 4UT6L 1UJ3B 2G75B 2DICA 4S2SA 1MHPH 4JG0H 1IQWH 2P8LB 4JFOB 3BWAA 2YBRB 4I0PA 1E4KC 2A6KB 2G9HB 3EUUA 3HI5L 1U8LB 4G43A 2A6JA 2PCPB 4Y2DB 4Y4FA 3LIZL 4QHKJ 3Q6GH 3V6OA 4R4FL 3IU4H 2Q3AA 3DV6B 5ERWA 5DC0A 2MPAH 2F53E 4HJJL 2BVPA 4I9WE 5MEPB 2W60A 4OZHB 4LPTA 2DYPA 2FGWL 2HWZH 3D2UD 1UXSA 3BXNB 4MYWB 2FO4A 1JGDA 3BZEA 5I76B 1T1YA 1EHNA 3DVFA 1FNEB 1DJSA 3P40A 1T03L 4TSCH 4C4KO 4XHJD 5J57B 3VXMB 1X5AA 3O2WL 4MXWL 4P46C 1D7FA 3AU1B 2Y9RT 1Q9KB 4XMKH 4CMMA 1MPAH 3EOBA 2FJFB 2B5IC 1FNHA 3SPVB 3V8CA 3NACL 4NUJA 4OZIE 4BSJA 4EKXA 3BEVB 1UWGL 1RIUH 4YFEA 3QHTC 4X5LA 3IKCA 1KEGH 5E99L 2R15A 2VDRL 1QSFA 1CL7L 1CLOL 1PX3A 4FS0A 4GRLB 5I8CA 5HYJB 1AJ7L 4QHUA 4OLWH 3UC0L 1OPGH 1NSNH 1J1OH 4R2GB 3FO2A 1GHFL 2H45A 3GSQB 1WEJL 3UPAA 4PP2A 3UJJL 3KDMA 1MCWM 3HE7A 3VD5A 5IHZA 1JRHL 1A4JB 4M6ML 2JB5H 5ICYB 3Q5YA 3HPJB 4XCFH 2CKBL 5C2UB 1UM4H 4X4XB 3Q5OA 4PLJD 1RK0B 1S7VB 4XTRD 4O9HL 4R96A 1H3TA 4U1GC 3VU2A 1KB5B 5HYSG 2EIEA 4QRPE 1QACA 5LGKA 3MC0A 3TIDA 1NFDE 1C5DA 3V79C 5K93A 1A1MB 5BS0D 2IJ0C 3RWCA 1S7WA 4JREC 4BSVB 1I3RB 3QUYA 5E6IB 3UROR 5K59F 1CDBA 1OLLA 1MFEL 3TYGH 5DS8B 1X7QA 5C0JB 4JZOA 4HDIA 2RR3A 4LLMA 4PYHA 3KPMB 5DGRA 5I74B 4L4TE 5E4IA 4MJ6B 4Z7WA 1T7WA 1G7MA 4KDVA 3FB5B 2BXYA 3FOMA 5FHAH 4XXDB 5IMLA 3U4EB 3C9NA 4DVBA 2GTZA 1C7SA 5JHDB 4MLIA 4BA8A 2NY3B 5H2BB 3B5GA 1MCOH 5KOVC 5C0BB 1MHPL 3BGFC 4JG0L 3L95B 1T1XB 1IQWL 2YA1A 5EB9A 1HQ4B 3RDTA 2VLKA 4YWGH 4NC1C 1EFQA 5ITBH 3CFDB 4D0DB 1YJDC 1R3KA 2F74B 1GGBH 4RGNB 5IR1B 3CSPA 3Q6GL 5CBEB 3DROB 1BX2B 3IU4L 3T0BA 2MPAL 3BN9C 4F37K 3VWJC 1QLRA 2HH0H 2RGSA 3MUGA 4ZTOH 2OZ4A 2HFEA 2OM5A 3EJZD 4LL9A 2HWZL 4AEIH 2CRZA 3RWIB 2GK2A 4C56E 3DARA 4PJ9A 5KAQF 3WEXB 3BEWA 4TSCL 1ZLSH 4L8CA 1P1ZA 4KROD 1S9XA 2D9CA 1MAMH 2CO6B 2XTJE 3SE3A 4R8WH 2V6HA 1L4IA 3FN0H 3C5JB 4O2EA 4XMKL 1MPAL 5DEGA 5DJCA 5BW7C 3EGSB 4QRQA 3QDME 4LASH 1KTLA 1N3NA 4AQOA 5FYLE 2XKNB 3MRGB 1XCQB 3CNKA 3MUZ1 1RIUL 3NCEB 2K7QA 3MLXH 2XN9E 4XWOC 1KEGL 4LDLB 3UTZB 4BK4A 4RNRB 3AXLB 4JRXA 2PXYB 3MJ8A 5GGTA 2JIXA 2VZ3A 3KPOA 3WFHB 1AKJB 1T04A 1T0MB 5D1ZB 4UU9B 4YUEH 4RCAA 4OLWL 1OPGL 2YRPA 1NSNL 1J1OL 1WBZA 5SWSB 3MRCB 4NT6A 4ZO7A 1K4CA 4R3SB 1BLNA 3ABZA 4KK6C 3LQZB 4CNIA 1G7HB 1YMMA 2JB5L 2VKWA 4XX1E 4XCFL 3TH2T 1BMGA 1UM4L 4JFFB 1LK3H 1OP3H 1BPVA 5IJVB 3V4VH 1ZAGA 2A0LC 3LS5H 4YHNA 4GRMB 5EZOH 3HAEB 5AZ2H 4XH2B 3L3OA 1RZKH 1VFMA 1FFNA 5T1KD 2BVOA 1DQQA 2KZWA 5FA4B 3IFOB 5D1QA 3H6JA 4Q97A 2UWEF 4LSPH 1ES0B 2AJ3B 1NGZA 3TYGL 5IROA 3L6FA 1R5WB 1SY6A 1U8JA 3VRLF 3TFKD 4PY8J 2D7TH 4EI5D 1A4KB 2V2WA 1U8KB 3DUUB 1OD9A 4NCDA 3KWWA 2HT4C 3ES6A 2ADIB 3HAEH 3WE6B 2I9TA 5FHAL 3VXRE 2X4QA 5K9QG 4AH2B 3ZHLA 3P73A 1R5IA 3LDBC 4P46D 4P2QD 4EIZC 1MCOL 3EYFB 3S88H 2YKLH 2P5WD 2G5BB 4YWGL 3UZVB 2FBJH 4L8DA 4MNGE 5ITBL 1Z9SA 2IAMC 1GGBL 1Y18B 4KXZH 1FG9C 3U2SB 1LO4H 4GMTH 4WVRA 4LNRA 1NAKH 2I60H 4N0YH 2HH0L 3X3FH 2FJGA 1CTOA 4ZTOL 1JNHB 4OI7A 1X5XA 1VACB 3P2TA 1PSKH 4FFYH 2YWYA 4WFGD 4AEIL 3CPLB 1K2DB 3GIVB 4RGMC 2EE2A 3B43A 3T65B 5ILTH 1ZLSL 4GSDH 1KNOB 5JO5B 1MAML 2HJLB 4Q6YA 2P5EA 2ZG2A 3T0EB 2R0LH 4R8WL 3SKOA 3K4DA 3FN0L 2V7NB 4HULB 3GMRA 4O02H 4LRIA 5DJDB 3G9VA 1TTFA 4LASL 4PJCE 4ZAKB 4X4ZA 3V5KB 3MLXL 1T1ZB 2PYEE 2XXCB 3DMMA 4OLEA 4LP5A 4UOJA 1TVDA 4WUUE 1AD9B 4NQDE 1HHGB 3DECA 4YUEL 5J1TC 4IRSD 1M71A 3IDXH 2P24A 1EX0A 3DX8B 5F6HJ 3GMNB 2VQUA 1KPUB 5KS9E 3GSWB 2DB8A 4WWKB 4Y8DC 4H25A 4ODUA 4AIOA 5F3BB 4WV1C 1JWUA 4KMQA 3SDCC 2YPLA 2CSPA 1OAXH 2GTWB 2X4RB 3LKOB 3PHOA 2W0FB 4JZNA 1LK3L 3PWVB 3MUY1 3V4VL 3IDNB 4LPYA 3LS5L 4F15C 5FYKE 5EZOL 1ED3B 4PJ8A 1D3CA 5AZ2L 4S0TD 3VI4E 4RAVB 7CGTA 3UAJC 4JN2B 1RZKL 4X5WB 2GSGA 3TF7C 4LK4A 2B2XH 2DJSA 4LSPL 2VABA 2J8UF 1TCMA 1IEHA 3S3SA 2CLVB 2PNDA 4HMEA 2D7TL 3TT1H 2XWBA 1JCKA 3ILPA 4JGMA 5C0DA 1UKTA 3IF1A 4NOBA 2JKXA 2DWEA 1IM3A 4GW4B 3CSGA 5HYQB 3TO4C 3S88L 2YKLL 4OM1H 1I3GH 1DUYB 3O3UN 4KJWD 2FBJL 3QNXB 5ESAA 4M9PA 4GOSA 1YUHA 1XF4A 3O6FC 3RUGE 3G5ZB 1LO4L 2RQ8A 1WWBX 4GMTL 2VL5B 3ZO0A 1RK1A 3CLFH 2XT1B 1W72B 4RBPH 1NAKL 3G08A 2I60L 1A3RH 4N0YL 3X3FL 1IEAA 3JWDC 1HKLH 4K94H 4JFQB 4FFYL 4LOUD 1PSKL 4F7MB 3CIQA 2NY1B 1ZLVH 4PRDB 5GS0H 4RDQF 2NXYD 5I6XB 5ILTL 1GZPA 5CJQH 5BS0A 2I5YH 4GSDL 3M8OH 4NCC2 2P42B 2QADC 1AD0A 1P6AB 3ARBB 2R0LL 1S9YB 3NFPA 4KK6D 4O02L 5JOFA 4JFEA 3SKUD 2I07B 5F88A 2AJYH 2DQCH 5EU3B 2A0LD 4PJAF 2PW1A 2VLMD 1A6UH 1IC7H 5F1KC 3RWDB 1QFWH 3U83A 2P48B 3C2SA 2EKSB 2V5TA 5IF0B 4A6YA 2FIKB 2XZAH 4MXQC 1X9QA 5DTFA 3OWEA 3TT3L 3IDXL 3U46B 3TO2A 3QIBC 3RPIB 4XRCA 3WIIH 5T3ZE 2DS4A 2CMRH 1NAMH 2G2RB 2JCCA 2YUXA 2ADFH 3RZCC 5FYJH 2HT4D 3U0PA 1R3IH 3PWJA 3IJSB 3UTTA 1OAXL 2F58H 3EOYG 1P5UA 5EDXA 1G7IB 4F7CB 3O41B 3QFJD 4UIMB 2UZXB 4LQFH 3ARFD 4R0LB 5MERB 1S9VA 4YK4B 2PO6A 2X42A 4N0UE 3WMSA 1ORQB 1PKQE 1RZ8B 3IU3B 4GRWB 3BN3B 1CFNB 3KYNB 5HHOA 1CFSA 2ARWA 2B2XL 1I7RB 2F54E 3RVTC 3RVVC 5DI8A 2DQEH 4LLQA 4ISVB 1KC5H 3CC5B 4BFGA 4ZUVA 5LAXB 4CJ1A 3TT1L 5EUOA 1MOEA 1WGOA 5C0EB 3MNWA 5A40E 4X6BA 5CHNA 4WI3A 5T1LA 3TLRA 2IMMA 4X7TA 2Z4QB 1CLYH 5IG7A 2ZNXA 2KQNA 3C5SA 4QHMA 1CBVH 5DURB 2P45B 4OM1L 1I3GL 2X1PA 4LCIH 3VXNA 3EOAA 2E7HA 3V5DA 1J1XH 1CDIA 3RGVC 1XMWA 4NQCA 1ZHKA 3DVNB 2Q8BH 4XCEA 4YHIA 4RMTA 3WNKA 1EJOH 3CLFL 5JMRA 1U8QB 1X5FA 5E8EA 1A3RL 3HTLX 3W39B 1HKLL 4K94L 5FKPA 2D0GA 3D0LB 3ARGB 2BSSB 5L8LB 2NW2A 1E4KA 4PGCB 5GS0L 1S8DB 4YQXH 3QIUA 1L6XA 3O4LE 5CJQL 1CQYA 4NZUH 2I5YL 5T1KA 2QJDA 3M8OL 2P1YA 4JFHD 1K85A 4QOKD 5JDSA 3FT2B 1LP9A 4WUKH 5F1SA 3OB0H 1JBJA 4XC3H 3OZ9H 1WTGT 4CW1B 2BX5A 3LOWA 2X89A 5DK3A 4YC2B 2AJYL 2DQCL 1WAAE 3FCTB 1A6UL 1IC7L 2D4FA 1AO7B 1QFWL 2W0LA 4LHQB 3UPCA 3F7PC 3FFCD 3MRBB 5DD3H 4QTHA 1FZOA 4NQEB 1ZHLA 3UAJD 4P46A 2XZAL 5B3JE 4PJDB 1K3ZA 1IARB 3DHJA 2EXWC 1JPFA 2Q86A 1HXMA 3LY6A 4CL7A 4Y5VC 2Q20A 3WIIL 2CMRL 1C12A 3BHBA 4LF3A 4ELME 1NAML 4QT5A 1J8KA 2ADFL 5FYJL 2P44B 1FL5A 2A9MH 1B0RB 1R3IL 5E9DA 4ELKB 2F58L 2E7BA 2J5LB 1EGJA 3MRHB 3BVNA 1FJ1B 2ZUXA 4N0RA 5DZLA 4LQFL 1KPRB 5EPMB 3TO4D 1OAYH 2CKNA 3CFEB 5CP3A 3VWKC 3MUHL 1A02N 3CSYA 5IBTH 2R1XB 4LEXH 4WHTA 4CVZA 3O6FD 4OQTH 1UKSA 5DEFB 3SJVB 2DQEL 5FUOH 3VFPA 4YBQC 1KC5L 1KF9B 3T77A 5I8OH 1RUQH 3SKMA 1M1SA 3P30H 3PNWA 4P57B 4C59B 4YEEA 5E4EB 3RVUC 1A8JH 1U42A 3TA3C 2P47B 3IETA 5IFJA 4E41B 3QBTB 1B0GA 1CLYL 1DN0A 2QADD 1S7SA 1VPOH 3QUMH 3VMNA 1K4DA 5B39B 4JVWA 1CBVL 3GSNH 4X6DE 5MENA 1QBLH 4AMKH 4LCIL 3EDJA 5I8EB 1XR8B 1J1XL 1JZ4A 3KPNB 3C6LC 3B9VA 1JPGB 1UJTA 4W4OA 3UBXI 2Q8BL 1M7XA 4MS8D 2ZZUT 3UX9B 1EJOL 1T7ZA 4QHNB 3LS4H 2VLJB 5CMAA 5D7IA 3WFCH 1QRKA 4Z5RB 5DJ2A 2X4NB 1JTPA 3AB0C 2AK1H 5IHBA 4YQXL 4R97C 3FQNB 3KYOB 4HKZA 1ZTXH 3T4AA 4NZUL 4F7PB 2GT9A 2FECL 2WWKO 5F9WC 3FRPA 3BKJH 3KXFE 4G80B 4Y4HA 4D2NA 1BFVH 2IF7A 4H8WH 2J6EH 1DEEA 3TEUA 3VWJA 4WUKL 1VGKA 3RVWC 4XC3L 3OZ9L 1Z5LA 4JKKA 4NO0D 1KJ2A 5KSBF 3ZYOA 5DJYA 4LCYB 4YR6A 3K7UA 1OSPH 4HUXA 5B39G 1R3HA 2ZNWA 3RBGA 5DD3L 5EZJA 2NXZC 1NC4D 1Y6KR 2H8PB 3DTXA 2XTLA 1Q94A 2UYLB 5EIIA 4XP9H 1JI2A 3LKPB 2GK0A 4BQ9A 4WW1A 3BPOB 2AJZB 4MDIA 4DK6A 1PZ5B 5F1IA 2Q76A 2ADGB 2R69H 2A9ML 4MX7B 4X7DC 1SJHB 3LZFH 3ZE1F 2R56H 4M61B 3WIHA 2HRPH 3S35X 2GAZB 4YIQA 3W0WD 3CX5J 4HKBB 5D2LA 2D7PA 2J1KA 3EO0B 5FECB 4D9RD 1OAYL 1AIFA 2PETA 1URLA 3OHXB 1C16A 2ZUWA 5IBTL 3TN0C 1TVHB 4HWNA 4LEXL 5IGXH 1MQKH 3RGVD 3QI9B 4M6OH 1HE7A 3S4SB 4OQTL 1FNGB 2XNAB 5M7QA 2D31B 3HG1D 3QG7H 5FUOL 4AEEA 1UZ6E 3E6HA 2X6MA 4HV8A 4LLVB 5I8OL 1RUQL 4LGRB 1ADQA 3GMQA 3P30L 1QRND 3G5YB 4NN7C 3OPZH 1IEBB 4PJ5E 3ARDC 3ZE2E 2DQUH 5A2KH 2LVEA 2J3SA 4K3JH 3MRQA 2A74B 4FQLH 4G6MH 1VPOL 2QSTA 1INQB 1BF8A 3ORJA 4FTVE 4JZJB 1J0ZA 3QUML 5SV4A 2AJXH 3GSNL 1W2KT 2YC1A 4RFEA 1QBLL 5JW4N 1JYXA 1P84J 4AMKL 2XIDA 3BIBX 3WO4C 5CEZD 3MJ9H 1H0DB 1WIPA 4G9FE 4QRUA 3ZDXF 3WIFA 5JTWA 1GC1H 5GXBB 3QFJA 5D7KE 4KUZH 4XNQB 4CU6A 1NCCH 1SJEB 1MLCB 3KNBA 3LS4L 3ETBF 3WFCL 4GT7A 5ESVB 3HB3C 2R23A 1K8DB 2E9JA 4M02A 1QO3A 2AK1L 3V6ZB 4S1DC 1M05A 3FTGA 2IAMA 1ZTXL 1QTYT 5DK0B 3BKJL 4PJEA 1BFVL 4H8WL 2J6EL 3CSBA 4HCRH 1EFXA 1HNFA 4JFZH 1NGYB 2AK4E 4WFFD 3MRLB 1X5YA 3OV6A 3HUJA 5EBWB 2WIIA 4LLWA 2DQFB 2IBZX 3RIAK 3QCVH 4MJ5A 3GSVB 4MVBC 1OSPL 2PYFA 5TGBA 3Q3GB 3QWQB 5I17A 3H0TA 1FPTH 4KJYB 5ITFB 2EEAA 5CINH 1DCLA 3JWOC 1IL1B 1H3WM 5KVDH 4L4VA 1RUMH 2BNUA 4KJPC 4XCCH 2XZQH 5AAWA 4XP9L 1I8LC 2HFFA 3FO1B 4GG8B 5CJBA 1N0XH 1I8KB 4PBXA 1QVOB 2R69L 1DQJA 4KKAC 1BD2A 4EN3C 3LZFL 2FCBA 4PJHE 4F3FB 4YHYB 2R56L 2HRPL 5EU6B 3HI6H 5J1AA 3INUH 1AGEA 2C3HA 4XCYB 2BOBB 2BVUA 2YD5A 4UUJB 3H9SA 2O5XH 4WV1A 3U9PH 4PPTA 3SDCA 5A3ID 5IGXL 1MQKL 1U92B 4M6OL 5B4MD 2A6JB 4N1CA 1EH9A 2CLZA 1CZ8H 3PQYD 4OZHE 3QG7L 4MCYA 4EZMA 2VN7A 4GAYB 3OPZL 4C55A 2DYPB 1ZE3C 2DQUL 3QQ4A 3S9DB 1JGDB 3VXME 4U1SB 4K3JL 3VDBA 4FQLL 4G6ML 4PJFF 1NGQH 1KELH 1X6NA 4DAGH 4HS3B 5DJAA 2AJXL 3G6JF 4Y16A 3VFUA 1XT5A 3RVWD 1PY4A 3RWGA 5IIEB 1JHTB 3U1SH 4CMMB 4LIQE 3MJ9L 4G8IB 4KV5E 1UQSA 3L7EB 2IBBA 5L7XH 1ZLWH 1GC1L 4BQ8A 1QFUH 4BQBA 1YPZF 4GAJH 4KUZL 4PJIF 1NCCL 1JE6A 1IAOB 3WXVH 5HYJE 4P2CG 2E7LC 3F7YA 4HJGA 4AT6A 2SEBA 5E7FA 2FSEB 5T1MB 4WU7B 4RRPG 4RX4A 5D7SH 1OQXA 5TE4H 4QHUB 5HDLA 2EC9T 3RX8A 4JQVA 1WFTA 3FO2B 3ARUA 5DJ0A 1JK8B 4P23D 3UTOA 4NOFA 4HCRL 5IEHB 3CFIC 4JFZL 3ET9F 3DLQR 2E5EA 3VFVB 5INCA 3MA7B 4ZPVB 2IPTH 3LKRB 1C08A 4OLZH 3QCVL 2BP3A 5IKCB 5F7DB 3NMEA 4OIIH 4Y4KB 2F53A 3D3VD 4FZ8H 1D6EB 1FPTL 1EHAA 4MB5A 3SCMD 1MSPA 5CINL 2JJSC 4NKQB