3CFKB

Crystal structure of catalytic elimination antibody 34e4, triclinic crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
224
structure length
224
Chain Sequence
EVKLLESGGGLAQPGGSLKLSCAASGFDFRRYWMTWVRQAPGKGLEWIGEINPDSRTINYMPSLKDKFIISRDNAKNSLYLQLSRLRSEDSALYYCVRLDFDVYNHYYVLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized prot
publication title Conformational isomerism can limit antibody catalysis.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 224
sequence length 224
chains with identical sequence D, F, H, I, K, N, P
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfkB01
3TPUA 1BVLB 3FB7A 4XC3L 4L8DA 3UYRL 5C07B 4LEXH 5DYOB 3S37H 4TUKL 3O2DH 3HMXH 1HHIB 2IADA 3DVGB 2Q20A 2OJEB 3RQ3A 5JW3H 3QHFH 3VFRB 5J12B 5CD5D 3TH2T 1I9RL 4EI6B 4MDJA 4GS7B 1F4WL 5DURB 5FM4A 1MAML 3U82B 1WT5C 5FF6A 3BMVA 3RL1A 4F33A 5F7WC 1JPFA 4GAJL 2ADJA 1TVHB 3GMQA 1FNAA 1FZJB 4M6ML 4YHIB 1KLUA 4JO3H 2HMIC 2AABL 3O41B 4OV5A 5I1KH 5JW4R 4R26H 4R3SB 5ESVA 2A9NL 1OP3H 3CCHA 5F7YC 1MREL 1OD7A 1BZ7A 2BDNH 1N6UA 5EIIB 1K8IB 3TCLB 4W6WB 3SDAA 3UXFA 3KG5A 3MRKB 4RFOL 2OP4H 1DBBH 5TF1L 2YPKA 3TCXA 3I3BA 2PTTB 3V7MA 4J3VA 2XQBL 1EGJA 1T1XB 5EOQL 2IPTH 1GGCH 3D39A 1SHMA 4JQVA 4ZO9A 1TFHA 5IF0A 4O51A 3MRIB 3NGBB 3R0MA 3Q5YA 4MJIE 4N5ED 4AY0A 4I5BB 2XWJA 4QRTB 3QP3A 1CFVH 3MGTB 2EXWC 2BOCB 2BSRA 2Q8AH 3R1GL 3G04B 2FHFA 2OXHA 3HAEH 1TZIA 5JMOC 1U8OA 5F7NC 4PTTA 4M8QA 3MRNB 1N6QH 1NUNB 5I8KH 4OLVL 4ERSL 5HJ3B 4Q0XH 1QRNB 1S7SB 4D94A 1MCDA 4KDWA 3RBSA 3UJIH 4F7MA 2AV7A 3GSNH 1LE5A 3OKEA 5C0IA 5LXGL 2ITCB 1KPRB 4XMKL 5IBUB 4Y19E 3MODH 4CRPA 1ES0A 1T22B 1VHPA 4Z7QF 3W9DA 5I1LA 1N2RA 3UPRA 1KACB 3QDMB 3L95A 5MI0B 1RQ5A 3DVFA 5TDPB 1OF2B 2OCFD 4KDTA 3TBSA 4KZEL 3WFDL 4P3DA 3C2SA 3PF2A 3LDBB 1EEYA 2VLKA 3LZFL 2IEPA 5JMRA 5B8CA 4KUCF 4LLYB 1Q0YL 2B0SL 2P4AB 4F7CB 5ERWA 1HDMA 3FQXA 5DRZB 1LO2H 3SQOH 1UVQB 4TVPE 1FSKC 2P24A 1FDLL 3S96B 4KTDL 5BOPA 3KYMB 5GISL 4I18A 2ICWI 5INDB 1JK8A 3N1PC 4V1DB 2KBGA 4RBPH 1YMMD 3UJTH 4JFPB 4AJ0A 4N68A 1F90H 2DQJL 1A6UH 3EKCA 5BZWA 4OD1H 3QDAA 3VFNB 1YMHB 4XPAH 3QRGH 8CGTA 1ZHNA 2ERJB 2PO6D 1GGYA 1KT2B 1SY6L 3GJFB 3C6LD 4FS0A 4FG6D 2AJXH 4XMPL 2W9DL 5F1IA 4M61B 3U4BH 4PJ8D 1XF5A 4J3XA 3NCYP 1I8IB 3KPOB 5FA4A 1SJHA 3UJJL 4GS7C 2X89A 5DJDB 4Z7OF 3VE0A 1UZ8A 3ZE0F 4XCEA 2VXTL 3S3SA 4KDVA 1MFEL 4NO2A 3WHXA 4LHUD 3K0WA 1FRGH 1LD9A 2JB6B 4KI5E 4NO5A 4AG4L 1NGXA 3CPLB 1NC4A 5HTSA 4I48A 1MFBL 2IH1B 4I3RL 2IPKA 4F8TA 2O93L 2Y7QB 1NCWH 2VXSH 4M02A 4WY7H 3L3KA 5I19L 4LKXB 4YDKH 4YDLB 4HCRH 3W11C 2R56L 3QPQC 2DLHA 1KG0A 4I2XA 2BMKA 3EOAA 5BRZD 3LS5L 4NFBA 4HBCH 5DJ6A 2VQ1A 5DUMH 4UNUA 5JIKA 1YQVH 1D5IL 1U95A 4AYFA 2DQEH 2C9AA 5JORB 4OF3A 5IR1A 5CZXD 5LJYH 1LE9B 3NGBC 5JO5A 5HHOB 4HSQA 4QY8A 1MCOL 3CSBA 2YD5A 2GAZB 4UUJA 3GSWA 4P4RA 5J11B 3OTTA 4XCFH 2Y07H 3ABZA 4XH2B 4PREA 4PJ5B 1LDPH 3GB7A 2NR6D 2AK1L 1T4KA 4U6HA 4LARL 4RRPG 4MCZA 1HXYA 5ESAB 2XZCH 3ULVH 2C3VA 2NTFB 2YXMA 4ZD3L 4OZFB 1WWWX 3ZKNC 4DJMA 1ZVSA 1Q8MA 4Z7WB 1BIIA 1EZVY 4O4YH 4F57H 4U4BA 4BJLA 5DHVB 4JZJA 1IVLA 3TN0C 2WINA 4RA3A 4BQBA 1KEML 4OKVA 5MI0C 1HQ4B 5FCUH 2AK4B 1A2YB 4X7TB 3LKNA 3LDBC 3IYLW 2P45B 1CFSA 4JFYB 2YWYA 3TVMB 3T77A 4MGXA 3VFMB 3SE3C 1DN0B 4M7LH 4PRNA 1S7WA 4P4KB 1ZGLA 1CIDA 1JPTL 1RY7B 2A0LC 3D18B 2W38A 3UC0L 2R0WH 4YZFF 4GW4B 4JO4H 4GKZB 2I60L 1EIBA 3PWJB 3EGSA 4M1GH 4Z78B 4WFHE 4PJEE 1J0HA 1ZHBA 1KXTB 3U79A 4OCWH 3KNBB 4NNPL 3CX5J 3SGKC 5JOPE 1ZHLB 1BP3B 2ZOKB 4JANA 5T1KB 3UTQA 2Q87A 1CL7L 2CDEB 4LLDA 1NUGA 5SV4A 5DK0B 1NJ9B 5CEYA 3V6ZB 1BQHA 1KEGH 4P2RB 3GMNA 5BOZG 1L4IA 3KLDA 3PWNA 4YHPA 4N90E 4A2MA 3UTTD 2IBGA 2AXFA 3ARGD 2DQCL 3P73A 1IZJA 3VFOA 4HDIB 3O6KL 3WIIH 1X7QA 2GK0A 5B21A 4LLVB 1BQSA 1KCSH 3HC4H 4MJ6B 4QRQB 5GRJL 1MOEA 3OKNB 5EUKA 1AGBB 3O11A 4ZFGL 5JOFA 5T5NG 1ZLVH 3ZSTA 4NRZB 4S1DC 1I1YA 1ORQB 3MGAA 4YDLC 4ELKB 1FFNB 3O0RL 2ZSVB 3SJVA 3QBTB 1DQQA 5K9QI 2FCBA 1HYSD 1QHOA 1U8QA 3HKFA 1MI5E 3ULVD 2W9EH 3OQ3B 4K3JL 3V4PL 3FFCA 3VXME 4PRBB 4OLWL 7FABL 1CDUA 1EBPA 3I50H 3WD5L 4G9FB 3WFBL 2WLZA 5C0AA 2P47B 5LGKA 3KS0J 1P9MC 2CLVB 1A6WH 5GSVB 1TJIL 5DD1L 4FQIH 2A6JB 5HI4C 4RIRB 2Q7NA 4JGUA 3TP4A 4P5MA 3VWJC 3M45A 1ZGLP 4LCWB 1NH6A 1FNSL 1JFQL 3MYJA 1ZMYA 4PRIA 1XR8B 3FO0H 4EDWH 2UV3A 1EEZB 4XAWL 1A1OB 2DRUA 4N0UB 4D8PB 2UUDH 1CE1L 3MQIA 3L3JA 5FDWB 5GQBA 1WLHA 3LHPL 1QOKA 3BUTA 4JFOA 3NFSL 3OKMB 4JDVB 4JG1H 4DN4H 2IAMB 4LP5A 3BQUA 3WS6C 4UDUB 2B8OT 3P0YH 4O2FA 5I1JL 3GGWB 1T1WA 4QNPF 4W4OC 3KLAA 1FV1B 3OKLB 5F7DB 4N9GB 1NL0H 2Z31D 2HJLB 3O45B 2MQ3A 4L8SB 5IBTL 1IAOB 3RNKB 1UZ6F 3B3IA 1P4LA 1K5NA 4Z7UF 3TVMC 3BP4A 4PP1C 3K1DA 3HN3A 5FYLD 4IRSA 3MJ7A 3MRPB 2DI9A 5I0DA 1B90A 4P4KC 1BJ1H 3QXUA 3RDTC 3W2DH 1Z0NA 3QDGE 4LDEB 5D7IA 4XVTL 4FZEL 4R7NA 1S78D 5CEZE 3QFJD 1EH9A 1X4ZA 1VFBB 1J0YA 4GAYA 3VFSA 5BV7B 1CQYA 4PJBF 5EZLA 4X8XA 5KSVA 3PQYA 1GC1H 2HRPH 4XAKE 4LMQI 1KXQE 4RISL 2YHGA 3FZUD 3WLBB 1G9NL 1CIUA 1FL5A 4XB7A 3C9NA 4DKAA 4JY4A 4M7JL 1CCZA 3RI5F 1G84A 4HC1A 1F02I 2WUBH 3Q3GA 4PJIE 3W0WE 2W0KA 4JPIB 4DAGH 2EDJA 3VMNA 2AJYL 1KTLA 2IMNA 3LIZH 5ENWA 2YSSA 1N5YL 4FHBD 4PG9B 1YJDC 2V9RA 1GZPB 3MA9L 4LGRB 4PJ9B 2FR4A 3SE4A 1S9XB 3BRDA 2YUXA 3WV0A 3KPLB 2YD3A 2Q3AA 4NRXB 5FAAA 3GMMA 5J1TC 2MTPA 2E7LC 3FT4A 4CU6A 3PABB 4AT6B 3LEVL 5KS9B 4NQCA 1CE6A 3DARA 1BIHA 3M07A 3GMOB 2A77H 1IAMA 4X6EA 3UTPD 3DVIA 4EIZC 4WFEE 4C56D 3A6BL 1OTSC 3OAZK 3U7WL 1XGTB 4L4VD 4N8VB 4JFEB 3CZJA 4XVJL 4X5LA 1CD1A 4OCSH 4LVNB 4TULL 3T0EE 1B4JL 5F7HA 4HFUL 4FA8A 2GTZA 4ZQKA 2X1XR 5GGUB 4OZHF 2OR9H 5DQ9B 2VDNH 3OZ9H 3T3PF 4LBEB 1UQSA 1E6OH 3VXQA 3OJVC 4RGND 3LEXA 3H9SE 3V4VL 2ZUUA 4ZUWA 1FO0B 1VB9A 5FB8B 4PGEB 2GJ6E 5EPMB 1FO0L 2IAMC 5DMIL 5L2KE 1FVDA 4TRPL 3LD8B 1WWAX 3QHZL 2CK0H 5DUPH 1S7XA 4DVRL 5C6PB 3GO1L 5HYIA 1UXWB 4M6OH 4FMKA 2D7TL 2OJZL 1TZHB 5FKAA 1PEZA 2Z8WC 3P9LA 3MNWA 4UT6H 4L8SC 2ZUWA 2Q1EA 2YXFA 4RMWA 2CD0A 1TENA 4Q9BA 3AS3A 3DUSA 5C08B 4K71B 4BSWA 4XBEH 5CGYC 2BY0A 2JCCB 5JNYA 2DWDB 3HS0B 3SBWA 4DUWA 3L1OL 3CX2A 5JHDB 3VGGA 3ZKMC 1A0QL 3B5GA 4NP4H 4OM0L 4QRRA 2IG2H 4TUJB 5GGVH 1IAKA 1X5XA 3O4OB 4TVPL 3TBTB 1AXIB 1AGEB 3CLFL 4GRWH 5D7JD 4U1GB 5BV7C 5AZEH 1RJYB 2X70A 5F8RC 1G9ML 1PYWA 2GSGB 1PVHA 2C1PA 3VCLB 2DMCA 4IRZL 3GRWL 5BJTA 4BSVA 3MRCA 1DVFA 1G9NC 1I9EA 1IL1B 4M48L 1IGYB 2XQYG 2XZQL 4XGZA 5IJVA 3ALXA 1T1YB 5TQ0H 3L5JA 3T4YA 3Q5TA 2BC4A 2C3WA 3S35L 5DUBA 4HWEH 1JZ7A 1NCTA 4XWGH 5D1XB 3BPNB 1T03H 1J5OL 5ADPH 1I7UA 6FABL 5GGTA 1QSFE 1TVBA 2B20A 4Z18A 3JTSB 3MRMB 4G7YL 1U8HB 4PJ9C 3VW3L 3RNQB 3MROA 1L0QA 1I85C 2PXYA 4NKIL 5C6TH 4RRPA 4YWGH 1CFQA 5L8KB 3TBYB 3VH8B 3I75B 2DLGA 2YA2A 1JJUA 4RMSA 4BYHA 5E2UL 3LKQB 1M7DB 1P2CB 2H32B 4X4XB 4LDLB 3MJ6A 3RUGF 4M5YH 2ICWB 3KXFA 1W8NA 1UG9A 4GXUN 4ZOEA 1IT9L 4Y4HB 3KPNB 1CICD 1LP9F 4ZFFB 1DZBA 4JY5H 5GHWL 2ADIA 1F3DJ 3ARDB 4QF1A 5FA3B 3SDDD 3MYZA 3QUMH 4Y5XB 3UPCA 1C08B 3LEYL 5D7LD 4WWKC 5DMGC 5BS0D 3SCMA 4KUZL 3QCTH 4LVNC 3B6SA 5JXED 5F1NB 3RWFB 2CIIB 1KUMA 4JRYD 1EERB 2FZ3B 1P1ZB 4Y0GA 2RAMA 3LSOB 1B0GA 4HWZB 1MEXH 2IMMA 1U58B 1XF3B 4XCCL 3GMLB 4GG8B 5IT2H 2YPVH 4FFVD 1M4KA 2ATKB 3L7FA 1U3HD 1KJ2H 1RVFL 5MENB 4ONGL 1JUFB 3DPBA 5F7FA 1XMWA 5I8OL 4OTXL 2D31B 2Z8RA 4D9LL 4Q9QL 2UWEA 2NMSA 3BT2H 4HWBH 1YN6A 4DN3H 4L3EB 2F19L 1FJ1A 2G5RA 3ULVF 4YDJB 4RZCA 5B3JE 5I1HH 3DO7B 3QXDB 2AJVL 1RUPH 5HGBB 4Z7NE 5LBSH 5L9DL 3EAKA 4ISVB 5GGQH 2IJ0C 3GJEB 4M7KL 4JB9H 3HNTH 2QQQA 4DGVL 4U6YB 1P69B 4H1LA 4JN2B 4PJFE 4K71C 5F9WC 5EBWB 2Y1VA 4LSQL 4KK9D 3EJYC 3DXAB 1WBZB 2NY5H 3OXSB 5A3IC 5DJCA 2K9UA 5HD8C 3I6GA 3BN9C 4ELMF 1LK2B 3GK8H 1Y0LB 2R15A 1FC1A 4JO1L 1UFUA 3F12B 4NZTL 4BUGA 4TPRL 2IWGA 4XBPB 5J4MA 1X5JA 3T09A 5E08L 3QG6B 1KN4L 5IW1A 5DDHA 5DA4A 4U1GC 1VFAB 2X10A 2VH5H 3AU1A 3E6FA 5SWQB 4K3DL 1KBGH 5DO2D 2DQHH 5A2IH 3SEPA 1AR1C 5HXMA 4PV9B 2YD8A 1U0QA 4HGWB 5IESL 5D93B 4JE4B 5DJAA 1JNJA 3MBEB 1IGFH 2R29L 5T3ZH 5EG6C 2P8MB 3RU8L 3FL7A 4RMQA 3HB3D 3IETB 5D1XC 1B2WL 1D5XB 4HXAH 4G80A 4V2CB 1F6AA 3IXTA 3D0VB 1XGYH 2DJUA 3RBGA 1QR1B 5F3HB 5KVFH 4HS8H 5C7XH 1NEZB 2CIKA 4Y1AD 3GMPA 3BO8B 1GZQA 4GW5A 1WTGT 4O2CA 5I2IA 5JDJA 1J0IA 4PRPA 4ODUB 1YEKH 3L5XL 4PJDA 1SMOA 3QIUC 4LF3A 3OG6B 4ODXB 1Q9WB 4BFIA 3UDWA 4S2SA 2XYCA 4B7LA 4GUPA 5E6IA 3O3EA 3HUJA 4OCMC 3WLWC 5E2TL 3QUZD 1T0PB 1R24B 4KK8D 3BYYA 1I7ZB 3Q1SL 4Y4HC 1WTLA 3CFJB 4AENB 4HHAB 3VI3E 3ARDC 2DQUH 4U1LA 5JW4Q 5E00A 2KL6A 2DDQH 4Y5XC 1BD2E 4FTVA 3VXMB 4GAGL 2FEEL 3O3DA 4KJQC 1MWAA 4OF5A 3WJJC 1K4CB 4GH7B 4OGAD 5IGXH 4RGMC 4L4TA 4XP9L 3HI6L 3TBWA 1TQBB 1I8MB 4QRPD 2FX7L 1DQTA 1FVEB 4HS6A 4A6YB 5FYJD 1NC2A 5I15L 1RUML 4G8GA 5FECB 4ZDHA 4QTHB 2OBGA 3U1SH 4A6YL 4K8RD 2DM4A 2ZCKH 1BVLA 4WO4D 3QEQD 2DQDH 4XC1H 4M62H 4EN3B 4FXKA 3RZCA 4KK6C 1JNLH 1OW0C 4OV6F 1MSPA 3SGJA 4CU8A 3VD4A 4WU5A 3D85A 2LU7A 3EOTH 3ZKSD 4PB0L 3T4AB 4MWFA 4S0SD 4EI6A 4QHKI 3EOYG 5SWZE 4J2XA 3ZDXE 1R3HB 2ITDB 3WSQL 2VN4A 3T08A 4O02H 1OSPH 2Y9RT 4OLZH 5C0NC 4X0KB 5HHVH 4XHJC 1IQDA 2IAND 1DEEB 3P0VH 3PWPA 1IGCL 3AAZA 2GY7B 4DKEH 1YNKH 4LSTH 4FZ8L 4POZC 4AH2A 1U8JA 4L3CB 4HX1B 1U92A 1RMFH 2OS7A 4H88H 2C3HA 4MAUL 1VGKB 3QDGB 5IVZB 1EHLL 3LOWA 4P9HH 3DGCR 1DQDH 1K3ZA 4I9WE 3QCVH 3TM6A 3KJ4B 3ILQC 3UAJD 4RAVA 2AAVA 1AO7D 2PTTA 2YD2A 1EHXA 1F11A 2EE6A 1MF2L 3AXLB 5GGRA 2BK8A 1FLTX 3PP4H 2DM2A 3MBEC 4HUMB 3GJFK 3PIQB 5IOPA 2R1YA 1CGYA 2W0LA 3W81A 2JELH 5ICXB 1VPOL 3RWEB 2YUWA 5GIRB 4NUGL 5GS0L 5EUOF 5JW4N 1OARH 4PJIB 3SY0A 5CGTA 3WHE0 2IBZY 5JA9A 2WW8A 4LEXL 4HH9A 4I13B 1J0ZA 5D9SB 3CZFA 4WHYG 4S1SH 3RGHA 2V9QA 3L6FB 3S37L 1X4XA 2CK2A 3HMXL 4ODBD 4Q6IA 4Z6AT 4YX2L 2YD9A 1WBXA 1PZ5A 2EDRA 2ITCA 4X7DC 3QHFL 1N0XL 2JJTA 2OTWB 1M05B 2G9HA 4UIKH 3U48A 3E3QE 3V0WH 1T22A 1SYVA 3QDMA 4JHWH 1RZKC 1TETL 1OF2A 4YHLH 2RQ8A 3GSQB 1UKQA 4Z7VB 3S6CA 1TPXB 5EN2A 3FONB 4EI5D 3ARYA 2BRRH 5TH2A 4GRMB 4RDQF 4JO3L 4NQUA 3D1MC 4R26L 5L6YH 5E94B 1MCHA 5EBMA 1I3GH 4F7CA 2FJHA 5IUSA 5DRZA 1CFNB 5LGJA 1TQBC 3S96A 2BDNL 4PJ8B 3VXNA 3SDCA 1GGIH 1YPZF 5H35B 5CD5C 3IDGA 5INDA 5J0BA 3MRDB 4WDIA 4OI7A 2V7NB 2OP4L 1DBBL 3T0EB 3ROLB 5F1KC 1QFUL 1EEQA 1G0DA 1G7MB 1PAMA 1T3FA 4TVSa 4JFPA 5EU7E 2HLAA 4MB3A 4LHUB 4QRUB 4X6CB 2IPTL 1GGCL 5SWSE 4GRLD 1SY6A 4UILH 5GRUH 4YPJA 5D4QA 4IOIB 3MRBB 4QXTB 2BY2A 3H9SB 4YBQD 1DFBH 4M61A 1CFVL 4D9QE 3HAEB 3TO4A 2GJ6B 3ZE2E 2Q8AL 2F54A 1I8IA 5ACZB 1YY8B 2F58L 1I7RA 5BRZB 1N6QL 4XZUA 1F45A 2GJJA 4RFEA 1OD9A 4Q0XL 1EGJH 4S11A 5HYQA 1K85A 4KQ4L 2JB6A 3GSNB 3CPLA 3VWKD 1U8NA 4EUPG 4KZDH 2IH1A 3HRZA 4JY6A 1KPVB 1R3KA 3VU2A 4N5EC 1RHHB 5L8JB 3MODL 4K3EH 3TA3A 3V5HA 2W0FA 3BKYH 5E5MB 4U7SA 5HHME 4MSWB 1RK1B 2J8UA 5KZCB 5DJYB 4F37F 2QADD 3C08H 4FQ1H 3M8OH 4HT1H 4MQXD 5JORA 1LO2L 3SDXE 4Y2DA 3ULUD 1V7NH 3O6FD 5TE7H 5HHOA 1NBQA 3UZQA 4NHUB 5IHZB 3RIAF 1E28A 3IJSB 4JLRA 5KVDH 2F53E 2OYPA 1X5AA 4CVXB 2HJKB 3UJTL 4XH2A 4CVWA 1J8HA 1F90L 2FRGP 2FLBT 3O4LA 3OXRB 1A6UL 1FIGL 4PR5B 5ESAA 4OD1L 1QSFB 1NFDF 2XNAB 1S7UB 4XPAL 3HG1E 2NTFA 3QRGL 3TYGH 4U3CA 2AJXL 4Q74A 5KJRH 2ZZUT 1S9VA 3U4BL 1KJ3H 1MAKA 1I1AA 3IFOA 4LCYB 1HNGA 3ARUA 4JKWA 1WAAE 1DCLA 3RIFK 4D2NA 1V8HA 1UJ3C 5CSGA 1JZ2A 1HILA 1HQ4A 3QJHB 2AK4A 5BW7A 3OB0H 1FL6B 1TPXC 3RUGB 3GHBL 4NZRH 4X7TA 4NNXB 4OGYH 5KSBA 2XKNA 4JJHA 4G5ZL 5IVNA 2PO6C 3C6LC 1NCWL 4F9PC 2VXSL 3BGAA 4NPYA 4YIQA 5IG7B 4FG6C 5MP6H 4IEFB 1DN0A 1KLGB 4YHMH 3SDAD 4CJ0A 4PJ8C 5BVJB 4YDKL 3D18A 1K8DB 4HCRL 3H9YA 2P44B 4NQVB 3MLYL 2EDDA 3FQUB 4GW4A 4JHAH 4GKZA 2BJMH 2OI9B 3ARGB 5IB4A 2Y36L 3D39D 1I3VA 5DUML 1YQVL 4GG6F 4RAUB 4L8CA 3KNBA 2DQEL 5DI8B 5J9PA 1ZHLA 4LK4A 3C8KA 4JQIH 5KG9A 2LQRA 5DRWB 5T1KA 1RIHL 3KJ6H 1IFHL 4XNQB 4E42B 2CDEA 2XXCB 4M7ZB 4PJCB 4KK5D 4AL8L 2M8XA 4P2RA 4ZNEA 4M7LT 5IB3B 2Q7YB 4XVUD 1NCCH 5EIVA 1SM3H 3E1F1 5DGQA 2AERT 3LRGA 4U2ZA 4JFDE 4PGJA 3NFNA 3SPVA 4QT5B 3U9PH 4MJ6A 5CZXC 4MQTB 2A1WH 3TF7C 5DZNA 5HGHA 3OKDA 3QH3B 4O4YL 4F57L 4R4ND 4LEOB 4MAYB 4LLAA 1BX2A 1T83C 4CMHB 5F1SA 1QNZH 1A9EA 1FYTA 5FOJA 4ZAKA 4POUB 3DWTA 1M6OB 3TT3L 2VLKD 2NR6C 1CLCA 3NN8B 2E3VA 4OSUH 4FABH 5DD3L 3B2UD 5DQDH 4R9HA 4P2YA 1CXKA 4LSDA 4M7LL 4WU7B 1PG7X 2XA8H 3BWAB 2CLVA 2R0WL 3DGGB 3E8UH 3IDIB 2VLJB 4JO4L 3WIHH 4MNGE 2A6JA 2R0LL 2CDGA 4JFXA 4M1GL 2NNAA 2HT3D 4ZTOL 1K4DA 1YDPB 3D6GA 5E8OA 4TQEH 3DBXA 2FL5B 1X5YA 1T5WA 1XR8A 5JDSB 1EEZA 3SKNB 5D5MF 2GW5A 2J88L 2VDOH 4DK3A 2N7AA 2W91A 3NH7H 4OZIE 5FDWA 2X89D 5IB5A 1D6VH 1YYMH 3QO0A 2G75B 3GI9H 5KANI 4JDVA 1KEGL 4QGYA 4UDUA 4HFWB 1HSAB 1H5BA 1XF4A 2XTLA 3ZE0E 3W5MA 3GGWA 3QFJB 1GOFA 3GIVB 1YNTA 3BE1H 4UMGA 1H8OA 1NC4D 4NWTH 5F7DA 3NBNA 3MV7A 1BGXH 2X9XA 2X40A 1FGVH 2LU4A 1KIRA 1KCSL 3HC4L 4D9RD 1IAOA 2E6QA 5M7QA 3BSZH 3HC0B 4HGKC 4JFHE 3CNKA 3W9EA 2L7JA 2AEIT 1XF2A 1G7LB 1DQLH 5KOMC 4PLOB 2OI9C 4MX7A 1JGVH 3ARGC 2W9EL 5IMMB 3QZWG 1VFBA 2LVCA 2DF3A 3HFMH 3IKCA 3EJZD 1A7RH 4Z5RB 2LTQB 4G6KH 2Y5TA 1Z9SA 3F62A 1MCNA 3E0GA 4WVRA 4J3OC 5T1MB 3TIEB 1PX4A 1DE4B 4FQIL 3B83A 4JPKL 3DTXA 4QOKE 2C5DC 4Q2ZB 2QEJA 2X4RB 3MRGB 3OX8A 1HYSC 3WFEL 4AEEA 3HI1A 3ES6A 3ULVC 4JPIA 4PJ7E 3HHRB 4TUOB 3RWIB 3FO0L 4NNYB 4EDWL 2EC9T 4X6DF 1LK3H 3BEWA 3MLSH 3JWOH 5JPMB 4PG9A 4ZOCA 1GZPA 3VFUA 4NC1C 3BGMA 2PNDA 1RUQH 1U8PA 5D71L 3N1FC 1S9XA 4C56B 2M2DA 4Y4KB 4JG1L 4LPTA 1FBIH 1PFCA 4YHNB 1YC7A 3KPLA 2IGFH 3P0YL 4NRXA 5FDYA 4CMHC 3STLB 5MHSE 4WCYH 1BLNB 3NA4A 3CVHL 3S5LG 4CGTA 32C2B 1NL0L 5F7EH 3PABA 5C92A 4KRNA 2VXUH 4AT6A 2QR0B 3EIFA 2ED8A 3NABL 4MLSA 4L3AA 3MRHB 4JRWA 4RGNB 1ZT1B 2VXQL 2VUOA 1TQCC 2Z0BA 1U9KA 3LV3A 4RNRA 4N8VA 4TSCH 3G6AB 3WKNA 4U1SB 1IKFL 4MJIA 1F58H 1U8IB 1DUYA 2FO4B 2DIAA 4G7VL 1YQ2A 1Y18B 3K3QA 3QNXB 5FO7B 3K8MA 2Z31C 4C83B 5IVXF 1GC1L 2HRPL 1NLBL 4MCYB 4WIQA 3GUTA 5IFJB 3UMTA 1ZA3B 4AQOA 5AD0A 3KDMB 1WQVT 3FHQA 3L3OB 1FO0A 3TV3L 4LRIA 4HIHA 4WNQA 5D70H 1P4BL 5EPMA 5H94A 3QAZC 1RU9L 5DEFB 2NX5E 1S78C 4DAGL 2BERA 4WEUD 5EOCJ 4MQSB 3PNWB 3R0NA 1NSNH 3LIZL 1TZHA 2NQCA 3CSYA 5CHNB 4Y19A 5D7JB 2DI7A 4ONHB 2AJZB 2BVTA 3MUGA 4LVHB 3U7AA 3ULUF 1T04B 3L5HA 1JHKH 5EH1A 3CFBA 2YEZB 3SJVD 1OAUH 2L7UA 3FZUC 1MIMH 1JN6A 3HS0A 5FYKE 1GIGL 1A4JA 4M3JA 5JHDA 3THMH 4PV8B 3RHWK 3I6LD 3FFCD 1FP5A 4PGDB 3VMPA 5K9KB 1FC2D 1B0WA 3KYKL 4WFGD 2FWOA 4FNLH 4EUPA 4TUJA 1RK0B 1XGQB 3MC0A 1AGEA 5C0AD 1C12B 1L6ZA 1YPZB 4XPFH 3GRWA 2LTQC 3EYVA 4GMSH 3I02A 2A77L 4PY7B 5CBEA 4I8DA 3NTCH 3D48R 4GSDL 3IVKA 4U31A 1NMBH 1UACL 1X6LA 1KFAH 3L9RB 1HNFA 3NPSC 4OCSL 2WBWB 5J1SC 4PRID 4JFQB 3MXWH 1YN7B 4K7PY 2EDBA 4HUXB 1JL8A 2VDNL 3GDBA 5D72L 3UO1L 3JTSA 1CICB 1U91B 1E6OL 4XP1H 1S9KC 5IMKB 3TGXA 1RIVH 3BQUD 5A43C 5I1GH 3SDDB 3R06A 4F7EB 4OZGF 1CLYH 2R2HA 5DC9B 5D7LB 3BP7A 3OSKA 3BKCH 1D5BB 1NDGA 3BX7C 5DUPL 4YPGA 5MEQA 2Y25A 2EE2A 1G7IB 1OGTA 3HR6A 5I17A 2RCSH 4JRYB 3MOBH 4O2EB 1AXTH 2A6KB 2ICWA 3TYFB 4ZFZB 3OJ2C 4YEFA 3WJLA 1BFSA 3EDDA 4JN1H 1IGMH 4IRSD 5D6CA 2VABA 4Z7UE 1N4XH 4NQSB 3WKMH 5I1IH 4XBEL 4RGNC 3IDYB 5F88B 1R0AH 3CXHJ 5FA3A 4U05A 3MCLH 1CGSH 4XCYB 3QIWA 4NP4L 3V7AG 5TGBB 2IG2L 5GGVL 3RX8A 3PE9A 4GRWB 3UROR 5CJXA 4LNRB 5SX4I 1JTOA 1P1ZA 3PQYD 3LSOA 5F89A 1U58A 5AZEL 3GMLA 4PJBE 3NCJL 3QEGH 2OM5A 2ATKA 3VJ6A 5ICZB 2G5BA 1A9BA 1JGDB 5D6DA 4IMLA 1QYGH 2I07B 1AGFA 5TQ0L 3IRPX 5CMAA 1UM6H 2D0GA 1NFDB 4HWEL 5DJXA 3RY6C 4YDJA 1ZGLM 5IHUH 3T0VA 4GQ9H 4XWGL 3QXDA 3I85A 1C1EL 5GS2D 5ADPL 1OY3B 1NGYB 5D7JC 4MXQD 3GJEA 4P48A 2ESVE 4CUCA 5BVPL 5E4IA 5HDQL 1VERA 4LVHC 4I0KA 1QBMH 3LH2H 1T89C 1WBZA 2QV2A 1FNLA 2Y72A 1II4E 2PYEE 3FCTB 2B4CL 1MJJB 1YMME 1LK2A 3VGDA 3K80A 4NO0A 4O5LH 1X4YA 2BP3A 1MAJA 3NCEB 1D6EA 4NQCD 4XBPA 1AJ7L 3T04D 4KXZH 1MHEB 4IRJA 1RSFA 5EU4B 3O2VL 4P3CH 1JI1A 1FNEA 4E0RB 1VFAA 1J9CT 1M71B 1KJVA 4JY5L 5SWQA 4YFDB 3QUMB 4PBVC 4PJEA 4PV9A 2ICES 2CXGA 3KPMA 3QUML 4NWUL 1N59B 4JFFE 3PUCA 5C0DB 5INCB 4HUKB 2AEQH 1DBJH 2HKHH 1U8LB 3QCTL 1SJEB 5CUSH 3ULSB 4BZ2H 2I9TA 5ADOH 3KPSE 4NFDA 4BFEA 1MEXL 5IT2L 3QUZB 4OZHE 2RIKA 3B5HA 1CR9L 1CICC 1KJ2L 1QR1A 2IQ9H 3VA2C 4YH6A 2P7TA 4K94H 4QXWA 4XPBH 3SDDC 1FYHB 3BT2L 4HWBL 4DN3L 4UTBH 2OZ4H 4WFFD 2Y23A 4N1EA 5C9JA 4WEBH 3FQNB 4ODXA 4AM0A 3TH4T 3QWQB 4MB5A 5JXEC 1JYXA 2YMXH 4X6BB 1K2DA 4HWUA 4JB9L 3HNTL 1IZKA 3QISA 1IAIH 4PJXB 4FFVC 5ICYB 5IHBA 1NBZB 1AHWB 3LKOB 4AQ1B 1U3HC 1FLRH 4DWHA 4WO4B 4PJHF 3QEQB 1OAZL 3CXHK 4HHAA 3IDYC 5HYFA 1MI5A 3ARBB 2NY5L 2X5PA 4GO6B 2OX5A 1JBJA 1QPXA 3VXMA 3ZDZF 4QRRD 5IROA 2DQGH 2E5EA 1ZWIA 1PGRB 3B8YA 4XXCA 1K4CA 4NQXB 2PCPA 1V3JA 1H8SA 1LO5B 5F9OH 1I8MA 3U0PA 1FVEA 3B9KA 4A6YA 1H3TA 4IDJH 2X41A 4U1IB 4QHMB 1DVFD 1OWWA 3BH9B 1KBGL 2Y4SA 4MNGB 4CN4A 5ALBL 3RI5K 2JTDA 3KAAA 2ICEA 4KV5E 4KK9C 2VLRE 3O9WB 3U7YH 4EN3A 5DTFB 8FABB 2IANB 1V7MH 1AY1H 3NA9L 1IGFL 2FB4H 5T3ZL 2A38A 2DL2A 3RWJB 3QFDA 4TNWK 2V2TA 1LEKB 3NIFE 1D9KA 3JV5A 2Y6SD 3BPCB 3BVNB 4HMCA 3T4AA 2XXMB 1CF8H 4EJ1C 5FXCH 1XGYL 4IIQB 1QUNA 2QL1A 5KVFL 4HS8L 4UB0H 5DO2C 2PXYD 1R3HA 5FGBC 5I8EA 2R1WA 3O8XB 4KY1H 4Y5VA 2VWEE 1AO7B 4UV7H 3BJ91 4HD9A 3AM8C 1LGVA 1YEKL 3MLXH 3LS4L 4MNQB 1Q1JH 1ZHKB 2OSLB 1NKRA 3IFPB 1HZHH 3S3JA 1OP3K 3KXFD 5ILTL 4R0LB 1KTRL 4ZO8A 1QLRA 2FHCA 4FOMA 1PG7H 3HB3C 5GGSY 5DMKA 4G6FD 4FXGB 2A83A 4P2QE 1MCJA 4JR9L 3WBDA 5IVZA 1DEDA 1VGKA 3QDGA 1LP9E 4WV1B 5E8EA 2WIIA 3NZ8B 4XP6L 2A73A 4XXDB 3SCMD 3GNML 2V9TA 4ZUUA 2DDQL 1QR4A 5B39B 2H1PL 3UTTE 4NT6B 3S5LA 5C70A 4JDTH 4M4PA 2HVJB 3OAYH 3V4UH 5IGXL 3QDHA 4HK3J 4JJ5B 1Q0XH 3PIQA 1QACA 1RULH 4M6NL 2NXZD 4D0BB 2MHAB 3QUZC 1CDJA 3KPRE 4KK8C 3MRJB 5ICXA 2KKQA 5BXFB 3RWEA 1F13A 3MOAH 1UKTA 4N1HB 3LQAC 4PJIA 3W0WA 2DAVA 2DQDL 4Q58C 4XC1L 1TCRA 1F4YH 5I66A 3UYOD 4KH2A 3CUPB 3GM8A 1JNLL 3WUWB 1FE8L 3MLUH 4EI5B 2VNCA 3L6FA 3DYMA 1MWAH 4I4WB 5E56A 3BESR 4NQDE 1I4FB 2DKSA 4OGAC 1WC7B 5D2NE 4YDVB 3FB8B 4RFNB 3EOTL 1NBVH 4CU7A 4XTRD 2HTKD 2X4OB 3MJ9H 4RCAA 4Y5YA 1LO0L 3LRHA 1ZA6B 3S88H 2HN7B 5ECJE 1AHWC 4K8RC 2FYYB 1KB5A 4WO4C 3FFDA 2EE9A 4O02L 5K59F 1OSPL 1C16B 3GSQA 3HZMB 4Z7VA 4TUKH 5FEBA 2CSPA 2P8PB 1S7QB 1XR9B 2PW2A 2XG5A 5E2JA 4RAHA 1AD9A 4Y2OA 1YNKL 4LSTL 1A6TB 3BPOC 4NZJA 2DBLH 1RMFL 3IDJA 3E2HC 2P5EE 1F4WH 4H88L 4HIIB 5CJ5A 4P9HL 1DQDL 2OTUB 1Q38A 4RBPK 5H35A 3QO1B 1MAMH 3QCVL 1IM3B 5DQJB 3H3PH 3QXAB 4GAJH 1B6UA 3T0EA 4LLMB 3HZKB 3ROLA 1N0LA 1A7QH 4KHXH 4QRSB 3H0TA 4U2YA 2A9NH 2VDKL 3VWKB 4JO2H 1GSMA 5IVXB 1F3JA 3I3EA 3OJMB 4IOIA 4K55A 3V8CA 1QLEL 4BK4A 3BUYA 2H26A 4QXTA 2R8SH 3H9SA 2Q6WB 2GJ6A 4IIQC 4ZPVB 2H6PB 1OARL 5L2KA 5L2JB 5ACZA 4LKCB 4PRPD 2XQBH 3RY5A 5D7IF 3UAJC 5I75B 2EZ0D 2P8LB 1P7HL 1CZ8L 4ENED 1IE5A 3HLAB 1S7TA 5TDOB 3STZA 3D5OF 1FH5H 4AEIH 5C2UB 5E6ID 4P46A 4R0LC 4WW1B 4Z0XB 4NN5B 3MFFB 1E4XH 4QHUA 3KLHD 1HI6B 4PYHA 3BXNB 3O6FB 3L3IB 1BPVA 3TPUB 1CFBA 1X44A 2YRLA 2FLRT 4UIKL 3V0WL 1LO3H 4KHTH 5FYKL 4MSWA 4WV1C 4U1KA 2HYMA 4JHWL 3QJFB 1A1NA 1UADC 4FTVD 4YHLL 4L9LC 4HJ0D 2BRRL 4X83A 3PHQA 2R9HD 2OL3H 4L4TD 2IADB 3CH8A 3S35X 2BNQE 3QUYB 4B53A 4XMKH 5KW9H 1NC2D 4G8GD 4HK3N 3WO4B 4MDJB 3QXVA 5K9OB 5FF6B 1Q9LA 3IJSA 1JPFB 4RMRA 2ADJB 5CJOH 1INEH 3BRFA 2HJKA 2VYRE 3GMQB 3WFDH 3RZCD 3FRUA 4UNTA 1KLUB 2CO7B 3RGVA 2BX5A 4C58B 1Q0YH 4EI5C 1QSFA 5GRUL 5LAXA 2ZPKH 3D85D 1OAYL 3X17A 1DFBL 4OCYH 6CGTA 4LHQB 5GISH 2AXJA 1FNHA 5LG1A 4JRXE 3X14A 2ZUVA 3EW3B 5GRYA 2EXYD 2QLVB 3NCCB 3D39B 5FK9A 3U9UB 2LU3A 1ITCA 4K9EC 5IF0B 3PWPD 2ZKHH 3CDFA 4GRLC 4NNXA 4P3WA 3TT1H 5JW5B 1QFWH 4S10A 2XWJB 4KMQA 4Y7MA 3CMGA 3CFEA 2BSRB 4YBQC 1BJ1J 4K3EL 4HCRA 1TZIB 1KLGA 5BVJA 4J3TA 3BIBX 1U8OB 1K8DA 4I0PA 4PTTB 4UV4H 2XZAH 3FQUA 2VXTH 12E8L 1RZ8A 3UYPA 5F6HI 3G5VA 2XTJE 5GS3A 3JTTB 2WSKA 3PDOB 4AG4H 1EO8H 2R23A 3C08L 4DUVA 25C8H 3M8OL 2AV7B 1U8KB 4RAUA 4QHKJ 3RVVD 1LE5B 5DI8A 3OKEB 1T2JA 5C0IB 3I6KA 3VWKC 1JCKA 3GSRA 3FMGL 5DRWA 1BFOB 4XNQA 1V7NL 5TE7L 2E8YA 3W9DB 5I1LB 1N2RB 4KXZI 2ILLA 3UPRB 3UEZA 3FOMB 3L95B 3LPGA 3TBSB 5IB3A 2DD8H 4P3DB 2Q7YA 15C8H 4HZAA 1G6RH 5HHPB 5D2LF 1EEYB 2VLKB 3MCKA 3RFZC 5B8CB 1M7XA 3QYCA 5ERWB 1J18A 3FQXB 2QADC 4UIMB 3TWCL 5F7LB 4WJ5B 3TYGL 4PG2A 2P24B 4MQXC 4U7KA 2D0HA 1WWBX 3ARXA 4PJFA 5KJRL 4EDXA 4PP2A 1MCOH 4NN5C 1KJ3L 2AJ3B 3DNKA 3ULUC 3O6FC 1JK8B 3GKWL 4MAYA 2FIRT 3QDMD 4U0RB 2DKUA 1KCVH 4F15B 2JJSA 5BZWB 1M6OA 2HVKA 4N0RA 3CXDH 3MXVH 5LQBH 1ZHNB 4NZRL 1T1ZA 2BNRE 1BWWA 4F9LA 4H25A 1OTUD 4WI5A 2YA0A 3X11B 5DVLA 1FG9C 1UWXH 1XF5B 4G6JH 5DR5H 3SE3A 4YBHA 3SDCD 4DZBA 4JZOB 5FA4B 1SJHB 4YHML 3DX6B 4EXKA 5CP3A 3BWAA 1OM3H 3VE0B 1UZ8B 3DGGA 1DDHB 4JHAL 2VLJA 1IAII 3T2PA 4N8CH 5I74C 5EWIH 4DVBA 1YY9D 1A6AA 2J7LA 3KPSB 1NC4B 4I48B 3G5ZA 4W68A 2FL5A 2IPKB 5JDSA 3I84A 4DKFH 2HG5A 5F1OB 3KJ6L 3L3KB 3TO4D 2O5ZH 4RX4A 1FVCB 3ZE1F 3LY6A 2F54D 1HN1A 3UC0H 3SDAC 1FL3B 4I2XB 4OJFH 2BMKB 2G75A 2E9JA 4HUVA 3GZKA 5DJ6B 5IEHB 1NCCL 3Q6GH 1SQ2N 1SM3L 3IAGC 2PYFA 1U95B 3U0TA 3GIVA 4LHJB 4NNPH 5DHXB 3OR7B 4JQVC 4DTGH 5IR1B 3F65A 5JO5B 4M8VA 1CL7H 4QY8B 3X13B 3TA3D 4UUJB 1HHJA 2A1WL 3GSWB 2HFFB 3SHSA 2DTSA 3WNPA 2P49B 5ID0B 4G43B 2R4SH 2ICCA 4PREB 4KK5C 2XI9A 4DFIA 4ZTPH 1QNZL 5DJ0A 4U6HB 5MERA 4K2UL 4MCZB 4XVUC 1G7LA 1HXYB 4NC0B 1DLHB 5ITBH 2C3VB 3CC5A 5J57B 5TPWL 1Z0MA 1PDKA 4ALAL 4Y2DD 3QR2A 5GRJH 5DQDL 4FABL 3Q2CA 4Z5RA 1ZVSB 5HHOD 3FO1A 1BIIB 2Q3ZA 2MNUA 5DRXB 2FX8H 4JZJB 1EAPA 2XA8L 3TIEA 2ZG2A 4R4NC 2X4NA 2WINB 4M1CD 3E8UL 4OKVB 3WIHL 1J8HD 4KDTC 4XBGA 3VWJA 3O4LD 5IEKB 4Q2ZA 4PD4J 2X4RA 5B8CC 1PD6A 2VDPL 1ZLSH 4MMZC 1CFSB 3HR5B 2EYSA 1EJ6A 2LVEA 3A0OA 3T77B 3ARWA 3B2UC 4OUOA 4X4ME 5SWZA 4PRNB 1J1OH 1BVZA 2VDOL 1I1AD 5K9JH 2AI0H 4M93B 4I18C 4NSKB 2WUCL 4RWHA 1D6VL 1RURH 1YYML 3GI9L 4Y4KA 1CYGA 5T1DH 4U0RC 3WYRA 4F15C 4YXLH 3QQ3B 4M1DH 1IGIL 3STLA 2AK4D 3CVHA 2DICA 3D69A 4G6AD 2HT3C 3BE1L 2YK1H 3VDCA 4NWTL 4JANB 4U6XA 1BGXL 1FGVL 4K23H 3HZVA 3UTQB 2CDFA 5FO8B 5F3BA 1KC5L 4N5UA 1LEIA 2QR0A 2CKNA 5HHNB 3AMLA 4DEPB 5KANG 4HZLA 1OPGH 3MRHA 3BSZL 1BQHB 3NFSH 4O58L 3VXTB 1ZT1A 5KSAB 4YHPB 3KYNB 5E8DL 2AXFB 3P3YA 2Z9TA 3P73B 2PR4H 1A64A 4PJDF 1JGVL 2Q76A 4U1SA 5DEGA 5E7BA 2GK0B 1IEAA 3S4SG 5F6IC 1U8IA 2FO4A 4GG6E 3HFML 1MPAH 2OMBA 4LLQB 5FO7A 5T1KD 5LVEA 3HUJF 1EJOH 3MV9E 4G6KL 1I1YB 1LDSA 1P6AB 4LRNH 1ZA3A 1CGTA 3P77B 3KDMA 2VDRH 1ZKAA 4MZ3A 4QWWD 4P2RD 3SJVB 3DJ9A 4U1JA 1DQQB 1U8QB 1FFPA 4HIXL 1IBGH 4NQDB 4QHNA 5D2NB 3WL9B 5L7XH 2A9ML 2RB8A 2WAHA 3MLSL 1ZT4A 3EJZC 5C0AB 2VSCA 3JWOL 1L7IH 4ONHA 2AJZA 3F7VA 3TBVA 5IMLB 2EKSA 3FB6A 1FN4B 3TLRA 5J3HD 1T04A 1JZ8A 1FBIL 1FYTD 4M7JH 5FV1L 4ZAKD 4GFTB 4P5MB 1P6FA 1NMCB 5J13C 2IGFL 3UZEA 4PV8A 4F37K 3MYJB 4PRIB 5JW4M 4LASH 1ZTXL 5F7EL 1RK0A 4PRAA 2VXUL 2BVUA 2EH7L 4I0CC 3MA9H 4WTWA 3L3JB 4ODWA 3U36B 4OM1L 4JFOB 3ZYIA 2AXGB 4JZJC 1AQDA 1E4XI 4OI9A 3V9FA 3LVEA 4O2FB 1QSEE 3T65A 1UEMA 1NEZG 1T1WB 4WHYH 5SWSA 4PD4K 4JFZH 3KWWA 3MSPA 5HVFB 3WNLA 4WI4A 1FAKT 5ISZE 3LEVH 1Z5LA 1IRAY 1P4LB 5TFSH 3BP4B 4IRSB 3CU1A 1XF1A 4M93C 5D7IB 3JWDH 3GBML 4XVJH 3U7WH 1MCWM 4GMTH 4R7NB 5D70L 3FQTA 4JM2A 3NACH 4D3CH 4GAYB 2XFXA 1CBVL 5A2KH 3MV7D 2QQLL 1NSNL 5EZLB 1NGWA 3PQYB 4O2EA 4NGHH 3FB5B 4XNZB 1WCBB 3V5DA 3DIFB 4DEPC 4LGPB 3ARZA 1JHKL 1FL5B 3C9NB 1OAUL 1KCUH 3UTSE 1MIML 3MO1A 1NGQH 5FKPA 3Q3GB 4LSVH 3THML 2DL9A 1ZK9A 2EC9U 3GO1H 4XCYA 2D7TH 1K6QH 1KTLB 1SEQH 4KMTH 3SDXA 5ENWB 2XN9E 5TGBA 2Z35B 3VXSE 1BVKB 1M7IA 4NKMB 3QQ4B 3ZTJG 4LNRA 3T3MF 4MXVF 3M1BA 1BZ9B 3B9VA 2FR4B 4GMSL 3DUUB 1QFWI 1XCTA 4YHYB 2APBA 5CILH 2F8OA 3IJHB 2EH8L 3T0DA 3GMMB 1A0QH 4S1RH 1KFAL 1OAKH 2I07A 4HUWA 1S8DA 3HG1A 3FT4B 4TSAH 4OM0H 5L8LB 4EUPH 4K3HA 3MXWL 3MA7B 3DROA 4KPHH 3SKOB 3JUYA 1NGYA 2B5IC 1VGEH 4X6EB 1WAAA 5AAWA 4XP1L 1S3KH 2PTVA 4QKXB 1RIVL 4H5SA 5I1GL 4U1MB 1FG2A 1ITBB 1J1XH 5I8CA 1CD1B 3BKCL 2VZUA 4HPYH 3L5IA 3MJGX 1W0WA 4ZQKB 3QHTC 2CKBH 4TTDD 2RCSL 3MOBL 1AXTL 2O5YH 2J12B 2BNUA 1UQSB 1MHEA 4JN1L 1IGML 1FZOA 4R4BA 3VXQB 1W0YT 3LEXB 1DP0A 2V17L 4ZUWB 1N4XL 3WKML 2DLIA 5I1IL 2XTJB 1R0AL 3BQUC 3QUMA 5EU6E 3S34H 5DC4B 3MCLL 1S7XB 3B9EA 5C0DA 2Z91A 4MJID 2AXHA 1HE7A 5FKAB 3P9LB 3TJHD 2O5XL 3ULSA 1I9JH 3MNWB 5DVMA 2UYLA 1OVZA 2HH0H 1JMZA 2Y06H 3DUSB 5HVHB 3QEGL 4KTEH 3FT2A 1KJ2A 3AUVA 4HBQA 4IRSC 4BSWB 5JNYB 1PY4A 4JZNA 4HWBA 3HE6B 4MD5A 1QYGL 2AS5M 2J8UF 4JFDA 4PJGE 4QRRB 3C6SA 1IAKB 1WFTA 4Z8FL 4GQ9L 4Y19D 3EZJB 2V5RA 5C6WH 4XCCH 2X70B 4XNZC 1WK0A 2A6IA 2C1PB 5BJTB 4P23A 4BSVB 3QI9B 1RVFH 2QHLA 1DVFB 5GSRA 4ONGH 3LKOA 1G7QB 4OTXH 4XGZB 2VRAA 4D9LH 4Q9QH 5IJVB 3VFVA 3LH2L 1QHPA 3WMSA 5JHDD 3ARBA 3T4YB 2BC4B 5DUBB 2Z8SA 4TVPD 2D9CA 3DYPA 4O5LL 4OF0A 3N85H 1I7UB 1HSBB 4NQXA 4Z76A 1TVBB 3DURB 1D7FA 4NBYB 4P3CL 4MXQC 1QO3A 3SE4C 4U1IA 2YOCA 4MNGA 2COQA 5AUMB 2PXYB 4KKAD 4YHYC 2ZG1A 3WE6A 1CFQB 4F80A 2N7BA 5IM7A 3O9WA 3T2QA 3MLZH 2OK0H 4FQPA 5DD6A 3D0LA 1DBJL 5J6HB 1INDL 4JPWL 4QXUH 4BZ2L 3KXFB 1I8LA 5KSBF 3NFPA 3RWJA 1KN4H 5ADOL 3KHOA 3SE8H 4OZIA 1WFOA 1LEKA 2WBKA 3BPCA 2CRZA 2ADIB 4K3DH 1XIWA 4H20L 4QF1B 2IQ9L 5JHLH 2OTPA 2E6JA 1GPOL 3QDJE 4K94L 4XPBL 3FO2B 3O8XA 1NANH 3SCMB 4KI5D 1KCRH 4OZGE 4FP8L 4UTBL 2OZ4L 4N9OB 5JLZA 4GT7A 4MNQA 4WEBL 2OSLA 3OAUH 2F74A 1RUAH 3DSFH 2FJFB 3RU8H 4YBLB 5AG9A 1FZKA 1B2WH 2HLFD 2BVPA 4NCC2 5HYEA 4OZ4A 2NXZB 2Z92B 2IFFL 3L7FB 4IOFD 1V05A 1B9ZA 1IAIL 3RP1A 4OQTA 3HZYA 5IWLA 1BHGA 1FLRL 2UWEB 4PGCA 4J1UA 1TZGH 1FJ1B 4XXDA 4YXHH 1RZGA 3QIWD 4X9BA 5B39A 1ZLUH 1JZ5A 2DQGL 1E0OB 2F5BH 4OLXH 2D7QA 1JF5A 5F9OL 3QNYB 5IB1A 5LWYH 2IH3B 4OLYH 2V5MA 1N8ZA 4KVNL 5HVHC 4IDJL 1I9IH 3V79C 5BXFA 4F3FA 1DUZA 4QOKA 4TNVK 1UB5B 2RFXA 4IJ3B 3SBWC 5KAQF 4H0HB 3LMJH 3U7YL 5E2VH 4PJ7A 2WMPA 1OW0A 4GAGH 1YEFL 3S4SA 3CUPA 2HFGL 4G8FB 3WUWA 1V7ML 1AY1L 3VGAB 1I7TA 5DDHB 2MPAH 5FOBA 5I15H 3AU1B 3BZ4A 3E6FB 1CF8L 4GOSA 3KS0H 2K7QA 1ZA6A 3VGEA 4XCNA 1DVFC 2HN7A 4UB0L 3JBG7 4B5EA 5I1EH 1BF2A 4KY1L 5DJAB 4ORZC 5DZLA 4UV7L 5IKCB 2WQRA 1C16A 4LPYA 3F6IA 4NO0D 1Q1JL 5IK3A 1VFMA 5CP7A 4UBDD 1S7QA 1XR9A 5HYJE 4KTYA 5HYSG 2JJVA 4IRJD 3LKPB 2CO6B 2Y6SC 5CIPA 1N64H 5C0FB 5FGRA 1XGUB 5F7UA 4HIIA 3EYFB 2OTUA 4WFHD 3QO1A 3GMPB 1GZQB 1TDQA 4GW5B 1ACYH 2PXYC 5DQJA 5JIHA 1WEJH 4PRPB 1A4KA 4PJDB 4LLMA 5JOPD 3QULB 3W39A 1WITA 1WVZA 1T7XA 4BFIB 2YPLE 4X9HA 4JDTL 2WP3O 3MV9B 4TOYH 2QSTA 3JXAA 3OHXA 4GUPB 5E6IB 4C4KT 3HUJB 3V4UL 4FZ8H 4OF8A 1OHQA 1Q0XL 1VACA 2UZIL 2Y5EA 4KU1A 2CUMA 2CLZA 1HHGA 1EUUA 3C5ZA 3ELAT 2Q6WA 4N90D 3MOAL 1A02N 2NY2D 4U1LB 2EIEA 1SVCP 5L2JA 1H15A 4ZG1A 5CEZH 1JPSL 3RX5A 5SX5H 4FTVB 5D7SH 1RZJH 3SCMC 4YFLI 3O3DB 1MWAB 3BPLB 1UB6B 2C3GA 3TBWB 1JNHA 4YBLC 1AGDA 4HS6B 5F97E 1DSFH 2BOBB 3SGDH 5C3TA 1NC2B 5DK2A 4G8GB 3MFFA 1JWSA 2NLJA 3SO5A 3WFCL 2NXZC 1HI6A 3R4DA 3MJ9L 4NUGH 5GS0H 5DS8A 3S88L 1MI5D 4YHOH 4FXKB 4PJHE 4XRCB 3RZCB 3QJFA 4RWYL 1C5DB 3VXMD 1MCRA 4WU5B 3DOSA 3ZYOA 4YX2H 4DZ8A 3HI5H 3D85B 3I3DA 3QUYA 5IFAL 4MWFB 2GSIA 1N0XH 3B9KD 2DBLL 4XTRC 1P7KA 1QSEB 2HTKC 5K9OA 3QWOB 4HMEA 5TJWK 1HYRC 1PSKH 3H3PL 1TETH 1KB5H 4EN3D 4IJ3C 4JREB 1HWHB 1IQDB 4NIKB 5HGGS 1A7QL 2DLEA 1XEDA 4KHXL 3PWPB 4ONFH 1LNUA 3AAZB 4YAQA 4HEME 5EBGA 3ZHDA 5EU5A 3VGAC 1D9KD 4JO2L 4AH2B 5KS9F 1U8JB 1P53A 1CFTB 1CT8A 3OPZL 1U92B 3LN5B 2R8SL 1ERNA 2V2WB 1QFOA 3PDDA 3VI4F 4NM8H 4RAVB 5H37G 1QFUH 5F96H 2QSVA 4Z9KB 1CGWA 1EX0A 5EFIA 4PRHE 4U6TA 2J2ZA 4U3HA 1R6VA 1F11B 5GGRB 2DMKA 3HPJB 3U9UA 1FH5L 3K4AA 4Z0BH 4AEIL 5IOPB 1S9YA 2R1YB 1AXSA 4U0QB 5JW5A 4LLWB 3RPKA 1CTOA 4U49A 1E4XL 1U93A 4WGVB 1A3RH 1DANT 3QDGD 1FIEA 5GZND 3WNNA 1H3WM 3SY0B 4HG4J 1LO3L 2F58H 5E2WL 4KHTL 5CEZD 3F7QA 4HH9B 3CZFB 5D8JH 1MCSA 3ARFA 2EZ0C 3JTTA 2QSCL 1SJVA 2P5WE 3PDOA 4KQ4H 4ENEC 3UDWC 4Q6IB 5C86A 2OL3L 1U8KA 4PJBA 1WBXB 1PZ5B 5E6IC 5AYQA 5C0CE 4BELD 5KW9L 5CLTA 4JGMA 4L8BA 2G9HB 1WZMA 5GS0D 1BFOA 1FFQA 5HDBE 1TIUA 3KLHC 1NMAL 1MHCB 1SYVB 3W0WD 4HK0A 2JCCF 3FOMA 3T0WA 4HKBA 4LQFH 4NBZB 5CJOL 1INEL 5EC2B 5EN2B 5TH2B 2DOCA 5HHPA 2R2CA 4HGMA 4LP4A 4HJ0C 5EBMB 1NUDA 1S5HA 2FJHB 4UIMA 2R9HC 4WJ5A 2ESVA 2ZPKL 5LGJB 1J05A 3VXNB 3SDCB 4QTIH 5HHQB 4OCYL 2AJ3A 3IDGB 4WDIB 2PYEA 1T3FB 2HLAB 3RZCC 2Z93B 5K59E 1FIGH 3AREA 3VG9B 1MUJB 3SGJC 2ZKHL 4PIRF 3TT1L 2PO6A 3GBNL 1QFWL 3X11A 4WFED 2YS4A 3TO4B 1IMHC 3L3GA 1Q94A 1KGCE 3T2NH 5J12C 2F54B 4JZOA 1BMGA 3VRIA 1HHHA 1F42A 3DX6A 4HJGB 4JFFA 4UV4L 5EZOH 3T0ED 1XT5A 3H3KA 1I7RB 4NJ9L 2XZAL 4XZUB 1W0VA 1DDHA 3PGFL 2FDBP 4RFEB 2FD6H 5HYQB 4KI5F 4G6MH 2EXYC 5IQ9A 2XY2A 3JV4A 5DF0A 3GHBH 3KPSA 1EO8L 5KN5A 25C8L 1U8NB 4G5ZH 4OZHA 3HRZB 4JY6B 1R3KB 2ZUTA 3H9SD 3O6LH 3TA3B 3V5HB 4XP5L 5GZOD 4GLRI 2GJ6D 4Y4FB 2W0FB 1FVCA 1F00I 1MFCH 3GSXA 5L2KD 5T1LB 1I1CA 1FL3A 3MLYH 4PJGB 1F3DH 5C0GA 1OB1B 2J8UB 2DD8L 5IEHA 4Y8DC 2Y36H 1OTTD 4ZMAT 15C8L 1ZLWH 1G6RL 5C9KA 3G6JB 1VDGA 4ZPTA 3RHWF 4RDQG 3QSKB 4E41E 3OR7A 2GY5A 4P46D 4Y2DB 5IJKA 3RVVC 5GRWA 4EIGB 1RIHH 1IFHH 2I25N 4JPVL 1OQOA 4LIQH 3X13A 5EIQA 4J3WA 4LCCB 1E28B 4JLRB 2HFFA 4AL8H 1AC6A 5ID0A 4G43A 1KENL 4HG4K 5L88H 3RTQB 4MDIA 1D5ZB 1KCVL 4X4ZA 5A1AA 1J8HB 4MHHG 3C5SA 5EO0B 3O4LB 5KZCD 3F8UB 1H3UA 2FJGA 1PKQE 2BCKA 1DLHA 3CXDL 1NANI 2B2XH 3MXVL 5LQBL 1GXEA 5I71B 2CMRH 4Q6IC 1S9VB 1YEIH 1I3RA 4LL9A 4G6JL 5DR5L 3QQ9C 4M3KB 2JJTC 1I1AB 3IFOB 1S7VA 1L7TH 4UAOB 1MIEL 5DRXA 2VLRA 1OM3L 2FGWH 4JDZA 5IIEA 3EO9L 3WIHA 3CJJA 2D7NA 4HQQH 5JPNB 3ET9F 4Y89A 1E4KA 2HWZL 3TT3H 3CFKB 4N8CL 5EWIL 1HILB 4R97B 3RGVD 2MFNA 5IEKA 5I1DA 4KJYB 1QSFD 5KSBB 2XKNB 3C60B 2OXGA 4PPTA 1YYLH 3MRFA 1A1MA 3HR5A 5DD3H 4NPYB 4YIQB 1EFXA 4DKFL 1OTUC 4NQCE 3JVGA 5F9AC 3FO9A 4XX1E 2O5ZL 1W72L 1MY5A 3SDCC 2KQNA 5EC1A 5CP3H 4NSKA 1A6VL 4OJFL 3L3DA 4FFWD 4PJEF 1JV5B 2R0LH 3DETD 5IB4B 1NCNA 3Q6GL 4ZTOH 2DIJA 3QQ3A 1YY9C 3X3FH 2YN3A 4L8CB 3VG9C 4YHKH 5J9PB 5DLMH 4DTGL 3C8KB 5KG9B 2ERJC 3ZT5A 3D2UA 1MLCB 3GJFH 4P2QA 5FO8A 3WN5A 3HPLA 2J88H 5FUZH 3AGVA 5HHNA 1LP9A 2HT4D 3B2VH 3TO4C 4G8EA 4OFPA 2EEBA 3RWDA 4I0PD 3QA3A 1MH5B 1MQ8A 3VXTA 4ZSOE 2R4SL 4GBXA 4UNVA 5KSAA 5DHYA 3KYNA 4ZTPL 4WRLA 4WI2A 1AH1A 5ITBL 3NFNB 2E9IA 4D0CB 3SPVB 1MCFA 5DSCA 5HYSA 5ALCH 1AP2A 3RKPA 4LLQA 1J88A 3KPRA 1YUHB 5HGHB 1A8JH 3OKDB 3U4EB 1DQJA 2VC2H 2FX8L 5AAMA 3P77A 1BX2B 2APTA 1A9EB 1FYTB 3EYUH 2OQJB 4ZAKB 2XPGA 3IFLL 2QQNH 4XMLH 4NQDA 5CZKA 5D2LE 5FHBH 1HCFX 3MJ8A 5D2NA 1ZLSL 4APQA 2EDFA 3FQWB 4F58H 3WL9A 4Y2DC 1KIPA 4FQCL 2UY6A 1J1OL 3AS2A 3C2AH 1T6VN 5IMLA 5K9JL 2AI0L 3IDMA 1FN4A 4MAYD 4R2GD 1RURL 5J11C 1RUKL 3BKML 3K8LA 4P2OA 4JPKH 4M1CC 2CDGB 4JFXB 2X42A 5T1DL 2NNAB 4YXLL 5J6GA 1K4DB 5E8OB 3WFEH 2XT1B 4M1DL 1OSZA 3DBXB 4TN9A 3LRSB 1A21A 2FNBA 2YK1L 1RZFH 2FHBA 1T5WB 2CUHA 4K23L 1UM4L 2AJUH 2P5EA 4ETYA 3VXUE 1HOCB 1OPGL 3S97C 5D71H 5HDLA 3U36A 5IB5B 1I1FB 1I1AC 3QO0B 4CDHA 4XB8A 3SGDI 2AXGA 3WNMA 3BJLA 2B39A 2VLJD 4K7PH 1ADQL 1H5BB 1XF4B 3DMMA 2W9LA 1BAFH 2PR4L 1YNTB 1HINL 1JHTA 3OG4B 3CVHH 5BW7C 4G6AC 3MV7B 4NQEB 1J11A 2ADGB 2BHYA 1KIRB 3T0AA 1OCWL 1E27A 1MPAL 4X98A 3MCG1 4C59B 1EJOL 3NABH 4XPTL 1FNGA 4RX4D 2ZCHH 3SDYL 2I26N 4B41A 2VXQH 4LRNL 3ZE1E 3G5XB 3W9EB 2VDRL 3H7BA 2EO1A 1XGPA 5E5RB 1XF2B 4NCC1 4MX7B 1QVOB 1IBGL 1IKFH 2FBOJ 3ZO0A 4G7VH 5CAYB 3IKCB 5IB2A 5L7XL 3G9VA 3P4OA 3DX7B 3FB5A 1BQLH 2Y5TB 1WCBA 1NLBH 1L7IL 3DIFA 1XAUA 3D3VE 1JGEB 4J8RA 3WFZA 5I16A 3LCYA 3TV3H 4LSUL 4KFZC 4QWWC 4X7SL 3DTXB 1MVUB 1P4BH 4PJIF 1HQRA 4HLZG 5T3XE 3EFFA 1OWRM 3OX8B 2MQ0A 1RU9H 3HI1B 3ES6B 4H0GA 2JB5L 2BNQA 2DWEB 5CJBA 1KTKE 4LASL 4IM8A 2Z35A 1BVKA 1N3NB 1SEBB 3BEWB 4NKMA 3QQ4A 1YJDH 4TNWF 2NTSP 5CD3B 4HAGA 4OCXL 2AV1A 3P9MA 1BZ9A 3BGMB 3PDGA 3VFUB 4BSJA 1U8PB 3DUUA 1CWVA 4OFDA 4J6RL 3HA0A 5J3HC 3TJEH 3IJHA 3A6OA 1GIGH 5CEXA 3QXTA 5TQ2H 4ZAKC 1RD6A 1ZAGA 4JFZL 3D9AH 4Z7VF 3KYKH 2DLFL 5C09E 2V5SA 1IKNA 2EEDA 2H8PA 3ILPA 3MA7A 2EECA 1MFNA 2ADFH 5SWZD 1JNNL 5TFSL 3SKOA 2FSEA 4JRXA 2KZ1B 4GSDH 4Y4KD 3LV3B 1UACH 3WXWH 4HH8A 3JWDL 3MRQA 4RNRB 4U1MA 4GMTL 5E03A 4D0DB 3NACL 4ZYKA 4JQXA 4D3CL 1T7VA 4MJIB 1DUYB 1EK3A 1OGAE 4X6CF 1HH6A 1UGNA 2GQHA 1URLA 3Q0HA 4NGHL 3UO1H 5D72H 3GUTB 4PY8I 1UM5H 3FOLA 2ZG3A 5AD0B 5H8DA 2JE8A 4HIHB 2WNGA 4WNQB 4KQ3H 3SE9H 1SYSA 4FQXA 2X09A 2YBRB 1KCUL 5H94B 1NGQL 4LSVL 4N0FA 1H5BC 1G0XA 1F97A 1CTNA 5B38G 1K6QL 5E6YA 1SEQL 4KMTL 3CSYB 4KJWD 3H9ZA 4Y19B 2APFA 3VD5A 3MUGB 3QEUA 2X1OA 3CGTA 3JSSA 4Q9RH 1C7SA 3CFBB 4HUUA 5CILL 4AIZB 1VADB 1JN6B 1GOGA 5I73B 4B7IA 1A4JB 3VXRE 3HE6A 3OL2A 4NFCA 4S1RL 1OAKL 1CGVA 5FUCC 4TSAL 2FWOB 4EUPB 4R4FH 1QA9A 5TF0A 2G60L 4AEHH 3T2OA 4KPHL 3O2WH 4IS6B 3NCJH 2NPLX 1WCQA 3EYVB 1WZKA 3I02B 1VGEL 5CBEB 3BN3B 3GSOA 4LSPH 4P57A 3RVTD 2PW1B 1S3KL 3QI9A 4HUNB 1UH4A 5JIIA 3IVKB 2MJWA 5EO9B 1G7QA 2APVA 2EYTB 4WW2B 4CMMB 3ZKXB 1J1XL 1OAXH 2IPUG 1FPTH 2BNRA 2CKBB 2VIRB 4HPYL 5C07E 3QIBB 3PHOA 1MJ8H 3V7AE 1MVFA 1DL7L 2CKBL 3R8QA 1C1EH 4OKDA 5GS1A 3GHEH 1HSBA 2O5YL 3PHSA 4PJAE 1D5MA 2P43B 3DURA 5BVPH 5HDQH 3MLWH 3R06B 3TIDA 3HNSL 5AUMA 1MQKH 2R2HB 3S34L 3DX9A 1XH3A 3BP7B 5SWSD 1NDGB 3K46A 4EOWH 2B4CH 4YPGB 5MEQB 4OLUH 2VMFA 4HV8A 5J7CC 1OGTB 5I17B 3NCMA 5J6HA 4GKSA 3P30H 1I9JL 4TTDC 1AJ7H 4D9QD 3T1WA 3T8XA 2HH0L 5D6CB 2Y06L 3KYOA 3O2VH 5E99H 2VABB 4KTEL 1YEEH 2APXA 4PS4H 5GRVK 3NZHH 3H2WA 4H8WL 4Y16A 1KXVC 5KTEH 1Z9MA 4NWUH 1JZ3A 3FO2A 4JM2D 2OZ4A 3QIWB 5DXWA 2J1KA 1OOAA 3FTGA 5GJTH 3P4MA 4FXLA 1T7ZA 2FJFA 4HPOH 3TJHC 5F89B 2AQ1A 1J86A 2E8ZA 2XOTA 1BFVH 4LQ1A 5E4EB 4BQ9A 2Z92A 4K7FA 5HHMD 1ONQB 1CR9H 3GMRA 4KROB 3VJ6B 3LQZB 4V2BA 1RJCA 4LIQE 2G5BB 4R7DA 5AYUL 1A9BB 2WK2A 4PJCF 4ZXBB 1UCTA 4IMLB 2ZCLL 4KRMB 4LRIC 1AGFB 5CMAB 1NQBA 1LQSR 3LD8C 4NHCH 5DJXB 1ZT7A 5E0QA 3OAYK 5D7KE 3N85L 1QRNE 4LPUA 3LPWA 4QCIA 3ORJA 1CK0H 3T3ME 3VFGL 4PJFF 3BYTA 4MXVE 3QNYA 2IH3A 4CVZA 3H9HA 3MV11 43C9B 1OAZH 4ORGA 2W65B 4GKOA 3RVXD 5B4MD 1UB5A 2VE6A 4UOW0 4AIXA 3BAEL 5I73C 4PLNC 3HG1D 4CL7A 4NO0B 3MLZL 2OK0L 1BOGA 2HRLA 4X4YA 4G8FA 3BDBA 1D6EB 4QXUL 1IC5L 4X4MA 5IV2B 3O4OC 4IRJB 4BM7A 3SE8L 1G9MC 1FNEB 3U83A 1DBMH 2I27N 1HH9A 1U36A 1KJVB 1IILE 3ARSA 4HS3B 4OGZA 1A7PH 5ALBH 4PJEB 5JHLL 1AKJA 1JHLH 1ORSA 3KPMB 2NY7H 4KKAC 1PKOA 3REVA 4V1DE 2D4DA 1KCRL 3IDNA 4YQXH 5IKCA 4HF5H 2X4PA 3NA9H 4OCLC 2I9TB 3OAUL 1RUAL 2MQCA 3DSFL 3VFWA 3BPNC 4P9MH 1VCAA 3BZEB 3LKPA 1HXMA 1GCFA 5E1HB 5C0FA 3MACL 2IALB 1XGUA 5F7MC 1N5AB 2P7TB 2NY2B 3EYFA 4LGSB 3MLRH 1PQZA 1TVDA 3PL6B 1GL4B 1TZGL 2L4OA 3KVQA 4YXHL 3LS4H 2GHWB 3QULA 2IC2A 4KI5C 5C9JB 5HPMB 2JIXB 3CFCL 4GG6A 4AM0B 3W5NA 3U0WH 5F93C 5ILTH 3MV9A 2F5BL 4OLXL 4OLEA 3WJLC 1JIBA 1K2DB 2HLFC 2WBJA 4JVPA 5LWYL 4JR9H 4OLYL 2YD4A 4C57C 4IOFC 3VI3F 1I9IL 4DUXA 3DRTA 4OQTH 3GIZL 2J3SA 3IU4H 1MI5B 3E6HA 4XP6H 2X05A 1TMCB 3V6BR 3GNMH 3LMJL 4EVNA 5E2VL 5C2BL 3VG0L 2H1PH 5DWUH 5C0BE 9CGTA 3QIWC 4YK4B 5BQ7A 1ZWIB 1UB6A 1F8TH 2E27H 2DI8A 3TFKD 2PCPB 5CJXC 4NKDA 4M6NH 3U0PB 2BOBA 3B9KB 2MPAL 3MJ9A 4P23D 5E4EC 2EIZB 2ICEB 4S0TD 5I1EL 4XVSH 5E1AA 3ARBD 5D6DC 3OGCB 4XRCA 5BZDB 4TTGA 3I2CL 3QZWB 4WHCA 2MCG1 1C5DA 3BGFB 4KUCD 1FE8H 2CGRL 4PJ5E 4MD0B 5CBAA 3MZTA 5J89A 5GPRA 3QFDB 2NYYD 1NBYA 2V2TB 1D9KB 3BMWA 2AKRA 1LO0H 1N64L 4FN0A 3VDAA 1QSEA 5I8EB 2J6EH 2R1WB 4Z7WE 3GFUA 4YHZH 3QWOA 4Y5VB 1ACYL 3O9WD 1WEJL 3INUL 2VQTA 4WTXA 1CD8A 1T7YA 5ISZA 3MBXH 4G3YH 5T3ZD 2NZIA 2V2XB 1QD0A 4TOYL 1LO4H 2AK4E 1EO5A 1QLRB 2ZNWA 1DQMH 4NZUH 4UBDC 1EVUA 1JGUH 1T5XB 4R6UA 5GRZA 5DMKB 3OMZA 1P4IL 3DO3A 5A40E 3UCRA 1MHPH 2A83B 3PP3H 4IRJC 1CFTA 3LN5A 1XIWD 5CIPH 4DCQA 3Q6FA 1F6LL 5E8EB 4ZUVA 2V2WA 4UT9L 2WIIB 2A73B 2O26U 3O8XD 3RKDD 4ZUUB 5CEZL 1X5KA 1Z6JT 5D7SL 4MNQD 5D93C 1RZJL 4X5WA 3S5LB 3HPJA 2F8XC 3P4NA 5I30H 2DM7A 2VDKH 4JFHD 3NIDE 1QLEH 3RVUD 4LLWA 1DSFL 4PBXA 5CKAA 4ZOAA 2FX9L 1MFAL 3UTSA 1F4XH 4P2CG 1ED3A 3CDYA 2D4FA 3W0WB 2NY2C 4YHOL 1A5FL 4OF6A 1NDMB 3FKUS 1TCRB 3C5JA 5I66B 1HKLH 1CZ8H 2H3NB 1BFTA 2XN9A 1RIUH 3VXSA 3ZL4H 2DMBA 2YKLL 2OL3A 3G9AB 4U6VL 4GKNA 2J5LB 2R1XA 3P2TA 5B22A 3HI5L 4LFHG 5TDNB 4YGVA 4Y5YB 1MHHB 3NIGE 4CNIA 3OKKA 1JF1A 3CH1A 1MCPL 4QOKD 1MHCA 2VN7A 1KB5B 3L5WB 5FYKH 3FFDB 4KGLA 3O3AA 1PSKL 4RMUA 4BA8A 4X8JA 1KB5L 1RZKH 3WIFA 5CS7A 5EC2A 5B38A 1AD0A 1C7TA 4R90L 4ONFL 4YK4C 5IROC 3TO2B 3EFDL 2PW2B 4XXCC 1AD9B 1TJGH 5ITFB 1KYOK 1JE6A 4ESKA 2HFTA 1T6WA 7CGTA 3IDJB 2A74A 3B9KC 5HHQA 3OJDA 4G9FE 4EQ3A 1WIPA 4NM8L 1WBYB 3AROA 5MHSD 4MVBD 5F96L 3MNVA 2ARJB 3SO3B 1OGAB 4EN3C 5TE4H 2Z93A 3H0TB 2P42B 3BGFC 5J56B 1MUJA 4LCWE 4Z0BL 3PXHA 3ZTJH 1J7VR 1F3JB 4PLKD 1OAYH 1UWXK 4AIOA 3FT3A 4ZUTA 3BUYB 2H26B 4M9OA 3PWLA 1D9KC 1EHAA 1NCUA 4MLIA 2G2RB 3ZE2F 2CJUL 3VXPB 1A3RL 4N0UE 5EU6A 4YR6A 3N9GL 4XNUL 5L2KB 3TH3T 3MREA 4X99B 4HJGA 2BFVH 2AEWA 3RWCB 1CQKA 4Y5VC 5DJ8B 4JM2F 5D8JL 1S7TB 2VLME 2I5YL 3STZB 2FBJH 3VRLF 3BP5A 2C7UA 1ZXQA 4P46B 2BVOA 1U6AH 2XKUA 4W6YB 3L3HA 4MJ5B 4QHUB 3C5ZD 1T0MB 2EYRB 5IP4A 4Y4FA 1IC4H 5EU3A 1J10A 3VD7A 4X6FA 5GZNC 5T1LA 1LMKA 4U1KB 12E8H 3KJ4C 1MCQA 4PJGA 1A1NB 3V0VB 1JZ4A 4LQFL 4UINL 5E8PA 3ZT7A 1OB1A 1G6RA 4J3UA 3G6JA 3RY4A 3PHQB 2D03H 1BBDL 5DFTA 2QKIA 4XNYL 4GRWF 1YC8A 4GW1A 3FMGH 2QJDA 4QTIL 4ODVH 3QB7C 5GS0C 3BRGC 4LCCA 5FYKD 1Q9LB 1FNFA 3PXJA 1HEZA 5IMOA 3RTQA 1UC6A 1D5ZA 3FRUB 4L5FH 3RGVB 5EO0A 4JAMA 3BEVA 3OR6A 4HKXA 1WSST 1ZS8A 4WUUE 1A6ZA 3UBXG 4PJAB 3TWCH 1QEWA 5LAXB 4JHBA 3DYOA 2B1HH 3QUYD 1HKFA 1UWEH 2J5LC 5CSZA 4YUEH 5EBLA 4JM4H 3VRJA 1J12A 1IGJB 4ZS7H 4Y5YC 1WAAF 3GKWH 3T2NL 3X14B 5JTWA 1CD0A 5H2BA 2KDGA 3FRPG 5EZOL 2I9LB 5JPNA 5MEPA 3BI9X 2A6DA 3CFKA 2FD6L 5SX4H 5FK9B 4S1QH 4G6ML 3QT2A 3V6FA 3IU3A 4KJYA 4XWOD 4NBXB 1OP5H 5DVKA 3C60A 1DANU 3EOBB 4UTAL 3GBLA 5C0EA 1TJHL 1H3PH 4WEMB 3X12A 3A67H 3CFEB 3O6LL 1W72A 5KS9E 5ANME 1RAMA 4NOBA 3QDJA 1MFCL 4MXWH 4I0PB 1E4WL 4NC2B 3AMKA 4CADB 4OZGA 1KPUA 1RZ8B 3VI4E 3G5VB 4ODSH 3T0EC 1YEGH 4E9LA 1OP9A 4BFBD 1VKXB 1JV5A 4QEGA 5FCSH 1R3IL 3SO3C 1Z3GH 3VD9A 2R23B 4JFEE 5DGRA 1NPUA 3H6JA 2SEBA 4J4PA 1CDCA 1TITA 3I6KB 3GSRB 1MLCA 3SOBL 3UP1A 4LIQL 3U30B 1CN4A 2VTFA 5GZOC 3BIKB 1H0DB 1EMTH 3U2SA 1MH5A 5L88L 1KN2H 1BWMA 5EULV 3T1FA 2VZ1A 3ARFD 3MCKB 4XNMA 1OTTC 3CFDA 1H3GA 4MA3B 2LABA 1MFDH 4LCIH 2B2XL 4D0CA 2EIDA 4KVCH 2CMRL 4P46C 1MCKA 4N0YH 4PJFB 5HSFA 4EDXB 4PP2B 1YEIL 4XX1G 1YUHA 1L7TL 3U4EA 1VEOA 3T0BA 3B5TA 4PJXF 4R2GB 5I1CL 5D1QA 3TN0B 5EORH 4Z7QE 5C08E 2FGWL 3CIQA 4HQQL 2JCCE 2OQJA 4K2UH 1G7PB 2HVKB 1S9WB 3QUKB 5JHDE 4X9GA 1T1ZB 2GYSA 3MV8E 5TPWH 4H25B 3OF6A 4ALAH 2ESVD 4BZ1H 1YYLL 3FQWA 4KRLB 1NGZA 1VESA 4FFZH 5GRXG 4DZBB 4QXGH 4IMKA 4EXPX 3F7PC 3JV6A 1RZ7H 2PYED 2X6MA 1PZUB 4DVBB 4BFGA 1A6AB 3U4AA 3ARED 3IT8D 5E9DE 2QHRH 3RGVC 5HYJA 3X3FL 4P5KA 3G5ZB 2VDPH 5ID1B 2Q86A 4YHKL 3LRSA 3EDJA 5DLML 3X3GH 3AY4A 2HG5B 4LAJH 4OZIF 3RRQA 5FUZL 1IM9A 1HOCA 3B2VL 4QLRA 2GITA 2C4FT 3R8BB 2WUCH 1I1FA 4JFFD 1A7NH 4NKOB 4HUVB 1ADQA 3O3UN 3G6DL 3LKSA 3EBAA 3EDFA 1KV3A 4FFWC 4Z7OE 3DETC 2YPLA 1IGIH 2GTWB 2PYFB 3U0TB 3HE7A 3KPSD 1EV2E 3ZTNL 1QBAA 1YEDB 5FHAH 4U1HA 2ICWJ 4NQEA 2ADGA 2NY0D 3REWA 5ALCL 5A2FA 1KC5H 4RQQB 3FQRA 5ELIA 1HHJB 4G9DA 4MA7H 3K7UA 1AGCB 2HT4C 4O58H 2VC2L 5GGRY 1T0NB 1MJUL 3BHBA 3S36H 3G5XA 4I0PC 1BD2B 5E8DH 5C0BB 5MERB 2VKWA 4NM4L 3EYUL 5DJ0B 2ID5A 3MOQA 1QVOA 2QQNL 4XMLL 1J1PH 3RJDA 3CC5B 5FHBL 3CK0L 4F58L 4OI8A 2X44D 2D3VA 3FO1B 3DX7A 3VFTB 1R5IB 1RJZA 4NDMB 2BXZA 4M43L 1EAPB 3C2AL 3KR3L 1JGEA 2X4NB 3U30C 4M7ZC 1ZE3C 4PJHA 5DEZA 4QHLA 3N06B 3VWJB 4XBGB 4HIXH 2VITA 1MVUA 5A2LH 5MENE 4IHOA 4OAWA 4XHQA 4PJ7F 3QUXA 1PG7W 4LAQH 3KGRA 4L3EE 3KPPB 2BY3A 1RZFL 2DWEA 2EYSB 2A9MH 4PG2C 1N3NA 4P5TA 1SEBA 1CU4H 2H9GB 5F7KC 2AJUL 4HEPG 5SWZB 3K1KC 5CD3A 1CGXA 1Q9OB 2RGSA 2E7BA 2VLRD 5DZOA 5HY9B 4QO1A 3ZT6A 4MAYC 4R2GC 5JQ6H 4FFYH 1V3MA 2Z4QB 4K7PL 4MQ7A 3MLVH 2JJSC 1CLOL 3CVHB 1BAFL 1JPGB 3D69B 1JTPA 3DXAE 2MMXA 4H0IA 1Z9OA 4U1NB 2PUQT 4U6XB 3MFGB 1ZTXH 4HJJH 4N8PA 3JUZA 3HZVB 2CDFB 4F9LC 4XI5D 5F3BB 1EFXD 1K3IA 1LEIB 2EH7H 2FH6A 4K3GA 4HZLB 2M26A 3LQMA 2ZCHL 2EDWA 4OM1H 4WHTB 1JGLL 3RDTB 4PRHA 3GEWB 4YZFE 1VFOA 2FEDD 4X7FC 3GSUA 2Q76B 2DQFA 4BQCA 4D0DA 5DEGB 3PV7A 1IEAB 1MCCA 5E95B 5DRNB 1TTUA 2ZOLA 5CZVH 3D2UD 4G42A 4P2QD 2FEEI 4JGJA 3BOVA 3DECA 1BQLL 1HHKB 4AMKH 4URTB 5DJZA 4MNHA 5FYLH 2EE3A 1RJLA 2LE9A 4H1LG 4GBXD 5KSAD 3T0XA 4U1JB 3GBMH 4TNVF 1FFPB 2YBRA 5M95B 2P5WA 4OIIH 4OBRA 4QHNB 4LSSL 3S3PA 3UTZA 1CBVH 4JKMA 1YZZA 2ZUYA 2QQLH 5C0CA 2BXYA 3K2UH 1IGTA 5M94B 1EZVX 1FAIH 3KPRD 1ZT4B 5FO9B 1CXHA 1YJDL 1I3UA 3F7VB 3TBVB 3BP6A 2EKSB 3WXVL 3FB6B 2YRZA 3IJYA 1TLKA 1UEYA 5H37H 3VFPB 1YECH 4AIZA 3TJEL 1VADA 5TE6H 5TQ2L 4NQDD 3IF1B 3D9AL 4APQD 3CDGA 1CLZH 3OKOA 4PRAB 3ROOB 5BMFH 2B1AL 3RVWD 1L9MA 2ADFL 4IS6A 2AEPL 4ODWB 2XWBA 1F2XK 1UCBH 3B43A 3IDXL 1AQDB 1RV6X 2PW1A 4P2OD 4GXVH 2EH8H 5EO9A 3T65B 1F3RB 3WXWL 4Q9CA 5SWSB 2EYTA 4WW2A 4LPVA 4CMMA 4F7TB 1R3JB 5GJSH 3V6OC 3KWWB 2WWMD 1JWMA 2VIRA 1R5WB 2CKBA 3QIBA 3WEXA 1G6VK 1Z5LB 2C1OA 4C55A 2P5ED 4LOUD 1UM5L 1XFPA 1EHNA 5I76B 1AFVL 2X4TA 4UOJA 4JEGB 4KQ3L 3MRRB 4Y4KC 3SE9L 3DMMD 3FQTB 4JM2B 4FQQA 2XFXB 4Y8AA 3UBXA 4QNPE 5A16A 1NGWB 1ODAA 1P5UA 3V5DB 4WI8A 5JZ7D 1ZANH 5HHMB 1LWRA 1UZ6E 2FATH 4QYOA 4F7PA 4KI1A 2V17H 3BWUC 4Q9RL 3FRPA 3ZSSA 2DLTA 3EYOA 3MO1B 5FKPB 1FGNL 3HC3L 2YZ8A 2UZYB 5ACLA 2WIMA 1ZSDB 1KNOA 4E41A 4OT1H 2LV4A 3CLEL 3SDXB 1PBYA 3CX5K 2O5XH 1M7IB 3SN6N 4DGIH 2NZ9D 4R4FL 3WFHB 1CXEA 3O6MH 4ODTH 5D1ZA 4AEHL 4OD3H 3M1BB 4KJWC 5EO1A 4IBLT 5BV7L 3O2WL 2X4UA 1GC1C 1NCBL 2DYPB