3CFKB

Crystal structure of catalytic elimination antibody 34e4, triclinic crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
224
structure length
224
Chain Sequence
EVKLLESGGGLAQPGGSLKLSCAASGFDFRRYWMTWVRQAPGKGLEWIGEINPDSRTINYMPSLKDKFIISRDNAKNSLYLQLSRLRSEDSALYYCVRLDFDVYNHYYVLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational isomerism can limit antibody catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized prot
total genus 40
structure length 224
sequence length 224
chains with identical sequence D, F, H, I, K, N, P
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfkB01
3QHZH 3RZCB 3L3IA 4ODHL 1NCAL 4X6FB 3KHQA 4KRNA 1EAPA 4JFEB 2HLAB 4X6BB 3ECBA 5DMIL 2ERJC 4JO1L 5JDSB 3BPOB 5GGQL 4P2OB 5T1KD 3H9HA 3Q6GL 5JIIA 4JKMA 5CP7B 2XZCL 3WYRA 3D9AL 2AP2A 3VWJD 5GXBB 1S9WA 3DPBA 4Z7WA 5EDXA 3SDDC 2FLBT 5DRZB 3MUJA 5I1GL 2VLRD 4FQXA 3U83A 3DRTA 1LP9E 3PHQB 3H6JA 4PBXA 1P69B 3MLVH 4NO3A 5C0BA 2X41A 1A47A 1QO3B 1YY8B 5IVZB 1VACB 3KNBA 1T2QH 5IMOA 2JJTA 3STZB 1GZQB 2A1WL 2BFVH 4Y2DB 1U3YA 3P0YL 5CWSA 5AUMB 2R2HB 5I1GH 4LVNC 2DQTH 1ZT7B 2UWEE 1QBAA 4LBEA 3LEVH 4XWGL 4C56D 3QNXA 1P7QA 5EG6C 3FN3A 2DWEB 3MLYL 4NUGH 3OKLB 3LRSA 3RUGF 5F9OL 1A6ZB 4K8RH 3IU3A 4QCIB 3LKOB 3O4LB 1AY1L 3QZWA 1YEJH 5I1CL 4M48L 1IAKB 2IAND 2G5RA 2IMMA 4IMKC 5TGBA 3VXPA 5BVPL 5J89A 1WITA 2D7PA 5E95B 3LKQB 1CTOA 4DZ8B 3QUZB 4Z7WE 2QQLH 3X3FH 3U9PH 1BAFH 1VDGA 4U1MA 3I84A 3H0TA 1A7PL 2JELH 4BH8A 3PHSA 3AS3A 2ICEA 2AJXL 5ID1B 3EIFA 3RIFK 4EIGB 4M6ML 1JWUB 5HDOA 1D9KA 4BQCA 3PHOB 3TVMC 4IRJA 5AZEH 1HH6B 3BDYH 3F6IA 3TIEB 1RZJC 4EVNB 5I30H 3B9KC 1AO7E 1ORQA 1T0PB 2PCPA 4PS4L 1XGRA 3E2HC 4YGAB 5L0QB 1MFBH 5BO1H 1IGYA 5SX4H 3G04A 3QIBC 3EAKA 2X1QA 1YN7B 4JGUA 3G6DH 1T22B 2CDEB 3GSOA 5DQ9B 3ZE2E 4XT1C 3BD4A 4XP5H 3VFGH 3NFNB 2HKFH 3VFUB 1FORH 4K2UL 5DZNA 2R8SL 1NCWL 1S3KH 2FJGB 4DCQA 3FT3A 2YD2A 1PD6A 1R3HA 3AGVA 2UY6A 4AT6B 3WUWA 4Y4KA 1T5XA 4LLDA 3L3KA 1FCCA 3T0AA 4AEIH 4HAFA 4DUXA 4OI7A 2ZG3A 1V7NL 3ARFA 4JREB 1JF6A 1QTYT 1SEQL 4R7DB 1RULL 4OV6F 4MWFB 4N8VB 1S5IH 3KHOA 4ZDHA 1ZGLM 1I7TB 1U8JA 5IMLB 4PRHD 5TDNA 1ETZB 3QULB 3LMJH 3PJSB 3BVNB 4XPTH 3L5IA 1FPTH 4JFFD 12E8L 4M8QB 5IVXA 2AQ2A 5C0AB 3QDGA 5I8CB 3KPMA 3PF2A 5IB2B 5DVNA 3GI9H 3EYQC 4NUJA 2PUQT 1KCLA 1F97A 3PQYE 1AKJD 5KS9E 4EBQH 3GDBA 3HMWH 1MVUA 2NY3D 3GI8L 2DD8H 1DQTA 4OB5H 4K3EL 4G6JH 3GMQB 4TUKL 3RRQA 1UACH 43C9A 1ZWIB 2K7PA 3FT2A 4HC1H 1P4IH 1FN4B 4OV5B 1R3JA 1P53A 1S8DA 4RX4D 1UVQA 1JRHL 3MUY1 1F2QA 3P73B 4IBLT 3FB7A 3EOTH 1JPTL 1WV7T 5CILH 4DN3H 1N4XH 4G6FD 1BX2A 2Q7NA 3BYTA 4PB0H 5EIVA 2YHGA 4JG0H 4G6JL 5MEQA 4KJPC 1RZFL 2J3SA 4U1KB 2EXYD 2YMXL 3NA4A 5F89A 1RJCA 3WEXA 3K2MC 3FZUC 3N1MC 2P47B 3T8XB 3IJHB 1HSBA 1J8HA 2DF3A 5LGHL 4G9DB 5D72L 5JUEL 4S1DC 5TPWL 3W5NA 5MERA 3IGAA 3UTTB 3UZQA 1IM9B 5D1QD 4M1CD 3IETA 3TCLB 2JJUA 5D1XA 3ESUF 1MFCL 4ZXBA 1CLZL 3PNWB 1AXSA 5E8DL 5JW5A 2D9QB 3NIDE 3BSZL 2NY5L 4OCXL 4PJIA 1BMGA 2JE8A 3SDDA 3MFFA 4P5MB 4XNUL 4Q74A 2BNRB 1PKOA 4RIRB 1XCTA 4D0BB 3VI4F 3P0GB 1B4JL 2B5IB 3SGJC 3G5YB 5B3JF 4BELD 1HZHL 2Y6SD 3NPZB 1KN2L 5ALCH 1FL3A 3AMLA 3D3VA 4B0MM 4YNYA 4AL8L 1MCWW 3U0TB 5D7JC 3RX5A 2ZOLA 2E7CA 3SKJH 4JZOB 5F7DB 1HDMB 4NRYA 3J8F7 4XGZB 4XMKH 4YE4H 1IGIL 1N3NB 5E7FA 3EOBB 3MOQA 5MI0C 4ZPTB 2EYRA 3VXMA 5HHPB 4DW2L 2MCPH 2OP4H 1F90H 2R1WA 3MGOA 3UJTH 5DHXB 3X3GL 4FFZH 4TVSa 3E6HB 3ARYA 4HEME 3AAZB 4Q9RH 1OCWL 3NVQA 2K3TA 4PRPD 2JELL 3U6RB 4NQXB 2QV2A 4HWEH 1UFUA 3MLTB 4MA7L 1U6AL 5KVDL 1SEBA 4YDVB 2P24B 4WJ5A 1U8KA 1I1YA 2GTZA 3RJDA 1JYVA 3G08B 3DUSA 5GRJH 3IKKA 1T1XB 1LK2B 4WWKB 4U3CA 4PLJD 5HGGS 2DQCH 3MRQB 4YHPB 5D1ZB 3QPQD 3HAEH 1RZGA 3DX8A 3LS4L 3VG0H 5I74C 1MIMH 5TDNB 4CRPA 1MSPA 4UU9A 1CVSC 3BMWA 4QTIH 3U36B 2OTUA 2OR9H 4QXTB 4V1DA 1MFEL 3BAEH 1ZHKA 1G7LB 2C7UB 3MV9B 2HJFB 1HNFA 5A2KH 4OI8A 1OAZL 5FKAA 2P5WA 5F7YC 4M62L 1GPOH 3O11B 1FBIL 5C09A 3QRGL 3MLZL 3NPSC 3AFLA 4NQEB 4JHZA 5ID0B 1XIWC 4JFEE 4LHUB 3MODH 4RGNC 5EU5A 5FM5O 4RDQF 1AXIB 1F3DH 4MVBC 1F11A 4OD1H 1IM9D 4R6UA 2A6JB 2BNQA 1OAXL 1OL0A 1TQCC 1ZLWH 4PJ9C 4FABH 5EH1A 4KMLB 4OZFH 4R2GC 4JE4B 3VE0A 4GFTB 2OS7A 1UZ8B 1K9TA 3BP6A 4ZSOA 4J1UA 4IOSD 2IC2A 2V6HA 3TYGL 1BHGA 2WBJA 5JLZA 3NOIA 4X4MA 4LHUD 2IWGA 4U3HA 4F9LC 1MQ8A 1LDSA 1D5ZB 1KFAL 1CVRA 4PJBF 2JJWA 1R5WB 4H20L 1CTNA 3HRZA 1I7RA 3OHXB 3BQUC 3QEHA 4NQXA 3GIVB 5I1IH 1QBLL 5J7CC 1YEGH 1YUHB 2FEDC 4Y2OA 4PGDB 3PXHA 4NRZA 4Y4FC 5CSGA 4Z5RB 2X4PB 2Z91A 2DWEA 1W0WB 1EHLH 3RGVD 4YHMH 5GRYA 1QYGL 2KH2B 4I4WA 4OFYD 3L7EA 1A9BB 2AVGA 3KPOA 1IVLA 2I9TB 2HFEB 4D9QE 2OMNA 2C1OA 2NLJA 1DQQA 2DJUA 5LWYL 2I60H 3HNVH 5I1LA 5FDWB 1FH5L 2X89A 3LQZA 3S36X 1R3IL 4PD4K 3TH4T 5H2BA 3KJ6H 4TSBL 4RGNB 2GJZA 3OKMB 4WFEE 2OMBA 4O58L 4IMLB 4ZNEA 3L3DA 1PAMA 1Q0XL 4F3FB 4G6MH 2W60B 1NGWB 4PRHB 3QRFM 3RVUC 3KPPB 3PHQA 4J4PA 3D3VD 1DANT 1KLUB 1U41A 2B2XL 2HT4C 5GISL 4LKCB 2YD7A 4QRRD 4LMQI 1XCQA 3QUYB 4GKZB 4KDTA 4CJ0A 4LLQB 2IAMA 4K23L 5KS9B 3U2SB 2J5LB 1C7TA 5KZCD 4GQ9L 5FKAB 4HIXH 1WCBA 4ZUUB 1EGJH 3SE4A 4LLUB 2AEWA 3HR5A 3QQ9D 5TF1H 1T6VN 4ZODA 1OAUH 3EDKA 2V5SA 1LMKA 2NR6C 1I1AA 1UKTA 4RISH 3WN5B 3U4AA 5IEHA 1MVFA 2P5EA 1T0MB 3QDJB 3I50H 1CCZA 4UV7H 1PKQB 1RJZA 1DQDL 3FFDA 4I3GA 5ALBH 2R23B 2VDOL 2DL9A 1S7VB 5LQBL 3Q5TA 4N5ED 1HQRB 3T4YA 1D5XA 1LK3L 5IESH 1JTTA 3I9GL 1Q72L 3CDYA 43CAA 1IC7H 4HIEA 4UV4L 1MJJB 3SCMC 2HKHL 2BC4A 2PXYA 3MRJA 3G5ZB 3IB4A 3EFFA 3F7RA 4X4ZA 1FIEA 4BZ1H 1WUNT 3R0NA 2IPTL 3K4AA 1Q94B 1NLDL 1G7QB 2V7HB 3SCMD 5EU6E 2X4OA 5DJ2A 2LE9A 1LO3L 4H5SB 3MJ9A 2ICWJ 4IOFD 4RMTA 5I75C 4KUZL 2JCCA 3CMOH 5EPMB 4PY8I 3EYUH 3HN3A 1ZVSA 1XF3A 4DVBA 1N5YL 3IFNL 5EBWB 5AWNL 2FATH 4XWOC 5D5ME 4D2NA 3PIQA 3HC4L 3LPWA 1QR1B 4I5BB 2FX9H 1F5WA 1KIQA 1DUZA 1BOYA 2APFA 2IAMC 5JXED 3V6FA 1WTGT 2PF6A 4J3OC 4JLRB 1DL7L 4FXKB 4MNQB 4U6HB 3F65A 5K33A 1MRFL 4CBPA 2D0GA 2ZCHH 1QBBA 4WFFD 1LO4L 2BSRB 1VADA 3LPGA 2EDHA 1NGPL 5C86A 3EJYC 3RY4A 2GJ6E 4M1GH 2NCMA 4MNQE 5GGVY 5D2LF 1OP5H 5KTEL 4ZQKB 4JY5L 2JCCE 1BWMA 2XPGB 5E94B 1I3UA 3QQ3A 1NDMB 3O0RH 2DLGA 5I1AB 2NY7L 5ESAB 4LLVB 4PLKD 1KEML 3TO2A 4ELKA 3QXAA 2XI9A 4QTHB 2A6DB 3PWNA 3VFVB 4BFIB 3JVGC 4C83B 1VERA 3HNTH 5JPMB 3FTGA 3MJ8B 4NBYB 1ZHLB 4HWBL 2BZDA 4XNXH 4KJWD 4TVPH 5EZOL 4JY6A 1FVEA 3LZFL 3QH3B 5AZ2L 2Y23A 4X7FC 4LFHG 1QQDA 1OSPH 1T22A 5C08D 4QKXB 1F3JB 3I6LD 5FYLD 4DGYL 1RUML 3CFKA 4XNXL 1LP9B 2W9EL 1IC4H 1KLGA 4RGOH 5EU4A 3K1DA 1NANH 3STLA 4H0GA 1EMTL 3RVVD 2FRGP 5DJ2B 1J18A 4LCCC 2R1YB 3P11L 3RWGB 4IS6A 5D9SA 2BJML 2A9NH 3P4NA 1P5UA 2I9TA 5IEKA 1KCRL 4UIKH 3RFZC 1RURL 5C2BH 1T1YB 2AK4D 1FN4A 5DJAA 5IB4B 4OV5A 2R39A 5KVGH 4JRYA 4MJ4A 1KTRL 3CX5J 5DT1H 4KPHL 1YMHA 1CR9H 4F80A 3LQAL 1UXSB 2VZ1A 1PG7W 2ZSVB 3PABA 5HYSA 2ZOKB 4U1HA 1RHHB 3MRPA 4FZEL 3V6ZA 1YECL 2DB8A 1HYSC 1IM9A 1FO0A 3Q3GB 4JJ5A 2YD8A 4RMWA 4KXZH 1ZLUK 3ETBF 1T21A 4I18A 1YQVL 2FHFA 2OI9C 1CGTA 2AQ3A 3L5XL 5GGSY 2C3WA 2XXCB 3TJHD 5KN5A 4WI2A 3MZGB 3VFRA 5IVXB 1INDL 1HSBB 4ZO7A 2AEQL 1OQXA 4MNQA 4S1SH 3BP7A 3L6FA 5EBLB 3VXRE 4I1NB 4XC3L 2AKRA 3HC0A 2BVPA 2Z8WC 4LNRA 1LP9A 1H3TA 4QGTA 1F4YH 4L9DA 1JGLH 5I15H 3TWCL 4F15B 4OM0L 5GRXG 4G6FB 1MRCH 4HQQL 3BH9A 4N0CC 3NTCH 4F57L 4ZFGH 4JO2L 3KR3H 5SV3A 3P0VH 3X13A 2Y5TB 4UIMB 4V1DD 4XB8A 3QDGD 5AG8A 3UTPD 3MUGA 3QEUA 3QCTH 3TYFB 1NFDF 1FLTX 5JDJA 4KUZH 4H88L 3WKNA 3V8CA 3SDCD 4JZOA 4UNUA 5GJTH 1I8MB 4NZTL 4QRRE 5IQ9B 4GRWB 1RVFH 1DSFL 4I48B 5HHXH 3ULVL 3QXAB 1OPGH 1UJ3B 2DWDB 1JGEB 1NGXB 4HK3N 1SJHA 4M6AA 3K4DA 4XNYH 4L4TD 4K3JL 3ARZA 2V5RA 3B9KB 1LK3H 1OW0C 3NABH 3VDAA 3QJFB 4Y19D 1QFWM 4WO4A 1DQDH 3TIDA 4U1IB 5C07A 3MRDA 4ODTL 4OZHF 2YPLB 1HI6B 2DBLL 1SM3L 5IEKB 3RKPA 2KQNA 4APQB 4YBLB 4EN3D 4X6DE 2VXSH 5SX4I 3CH8A 1MWAH 1QVOA 2VRAA 5DXWA 2CIKA 2E9JA 3MROA 5A43C 1U58B 5DYOB 1NBQA 3X17A 2UZIL 4DVRH 3ZLQC 4OGZA 3SDCA 5TQ0L 5HHVH 2J7LA 5E0QA 5JXAL 5L6YL 3ULVC 5B39G 1T6WA 5I75B 5F1IB 4TVPD 2DLFH 4TSBH 2EDNA 5GHWL 4GRMB 3MOBH 3E3QC 2AABL 3OTTA 2NW2B 2R69H 2F15A 5K9QI 1P7HL 2ILLA 1GGTA 3JZ7A 2KL6A 5F7DA 4XXCA 2HFFA 3LDBB 3MBED 4JRXB 2MQ3A 4RBPK 1YY8A 4OCYL 5IVZA 2JB6B 4HK3J 2D7MA 2Z91B 5FXCH 5LVEA 1LWRA 2Q7YA 1KCUL 1KIPB 1I3RB 2NY5C 1QG3A 3UPRB 1F8TL 1YEGL 4PJHB 1A9BA 3PL6D 3ZTJG 5K9OB 1UYWH 4M00A 2ZKHH 1WBYA 3MRMA 3BKMH 1TXKA 4LEOB 5C3TA 3DVNB 2VDNH 4TRPL 2QQKL 3HI6L 4GOSA 3TJEH 5EOTB 3N06B 5DEGA 4WNQA 2E5EA 4O02L 3GJEA 1LDPH 1F58L 3SCMA 4HZAA 1K5NB 1CICB 3ZHDA 5E03A 2RHEA 3RUGA 3QUYC 4NCC2 3DXAE 3SDXF 3CFDB 4WI5A 3RBSA 4KVNH 3O9WD 2HAZA 4Z8FL 2C26A 3G5VA 3HCVB 3RZCC 3W5MA 1AGFA 1FQ9C 5BMFH 4JM2D 1WFNA 2ZCLH 4NZUL 5LGJB 3WLWC 3U7YL 2KUTA 1I4FB 4JFXA 5SWSB 3VGHA 2MHAB 4PRAA 2VLKD 3HC3H 4MJIB 2NR6D 3WNLA 1MQKH 2ZNXA 4RGNE 4NQEA 5HYEA 1QEWA 3I6LE 1FJ1B 1G9NL 2ZUWA 4MXVE 3AS1A 3MCKB 4Z76B 3QUMA 3O11A 5C09B 3E8UH 1G0YR 4MQXD 2HMID 1HQRA 3T4YB 1FFNB 1GAFH 4HXAH 1LD9B 5HDBF 3MGOB 4BKLB 4M62H 2BVQB 1Z2KA 5F1OB 4CUCA 2WW8A 3VFRB 4NFCA 3V4VH 2X1PA 2ZSWA 1WJ3A 4U1NB 2IBZX 2B7DT 4L9LC 3UO1H 2IF7A 1YY9C 2OR9L 3PWLA 5DSCA 3F7QA 3GJEB 4Y4KC 5J11C 2J8UA 3ZDXE 3HAEA 1DVFC 1PFCA 1VKXB 3MRQA 1FGNL 1LILA 2DAVA 2P5ED 3QNYB 1JNLH 4FQXC 5ABDE 1WISA 1JHKL 2OQJA 2PETA 1IGJA 4YUEH 1D5ZA 3SJVA 5E1HB 3LS5L 4UOJA 5E9DD 2KQMA 4EQ3A 1YDPA 1TJHH 2GITA 4WCYL 1A2YB 1JZ8A 1HHJA 3OKYA 3W9DA 3FB8B 1RIVH 2A6JA 1MAKA 3D0LA 5JMRA 2MFNA 3PWUB 1OF2B 2XZQL 3LEYH 4QXUL 4MZ3A 1XEDA 2V2WB 2HRLA 4KDTC 2NY2B 4NSKA 3V5KA 2VR9A 5DJCA 5DJXB 4GRLC 5L7XL 1IGIH 4LL9A 1FYTD 1EAJA 3MMEB 5T1KA 1X5GA 3PQYB 4JDVB 4FFYH 3MA9L 4Y5YA 4D9RD 5TE7H 3C09B 3S96A 5GGVH 1D5IL 5JW4N 1AFVH 4LLVA 3V9FA 1RJLA 1NPUA 4XRCB 4F7TB 3FO9A 5CGMA 3PWNB 4ZUVA 1I7RB 3OHXA 5I74B 1YPZB 4KKBD 5KSBB 4UINL 1A6VL 2F54D 3SHSA 3QDMD 3TZVD 3UBXG 2FYYB 2WWKO 2HFTA 3O9WC 1MY5A 1X4YA 4QRQA 1LP9F 1H5BC 4WRLA 2BSSA 5I9QB 1GGBL 4LLQA 4EDWH 2QSCH 4NBZB 3WO4C 5DI8B 5EFIA 2HG5A 1RHFA 3CXHJ 4OIAA 1MCIA 2XWBA 3FCTA 5C9KA 3QB7C 4NO2A 3EW3B 1F4XL 4KMQA 3VD7A 4F3FA 4R7NB 1KLFA 4M7JL 4P57B 1WBZA 2MTPA 3BP4B 3ET9F 3ARSA 3ZKSD 1A7NL 2JCCB 5LAXA 3ARUA 4JPIB 4XP1L 3IDIA 4JFDE 5DTFB 1DQML 4OLWL 2LTQB 4Y5XA 2O61B 3HI6H 3GBMH 1SMOA 3TJEL 5HVFB 4ODWB 3FJTA 3NCYS 2C5DC 1N4XL 4D8PB 1FAKT 1CL7I 2IFFH 3TFKD 5EA0H 1B88A 3BGFB 1Z5LB 4O5LL 4ZNEE 4M4RA 4PREB 1Y18A 3TNNA 5TJWK 4PJ5D 4ZO6A 3VXSE 4QTHA 3GK8L 1FL5B 3C5SA 2JB5H 4I3RL 3TLRA 3PGCA 4R96A 1GH7A 3RUGE 4O2EB 4EI5D 1S7UA 2AI0H 2EDOA 1WWBX 2IJ0C 1ES0A 3NCCB 5EUOF 4KJYA 1EVUA 5ILTH 5D7JD 3AREB 4EOWL 4IRZH 1J5OL 3O8XA 4NKMA 4WWID 4XPTL 1XH3A 1KLGB 1AXSB 5JW5B 1TJGL 1ZHNA 3BZFA 4DK3A 3G5XB 1S5IL 3VXTB 1I9IL 3FKUS 1F00I 4MCZB 4M93C 4MD4B 1VGEL 1PY4A 2GAZA 5IP4A 5C0JB 2YR3A 5GS1C 1FV1B 1ZXQA 2JK5B 5D2NE 4MJIA 2MPAH 1FVDA 3IJHA 4UZGA 3OPZH 4WHCA 2CKBH 3SKNA 5KN5B 2XTJC 1GC1L 4KAQH 1A7RH 4I9WE 1DE4B 4YHKH 4IIQC 3SDYH 3W39A 2WLYA 4UAOB 1HEZA 3KNBB 4U1GB 3K8KA 4NJ9H 2VISA 2VQ1B 2AKRB 3ELAT 4BJLA 5TDOA 5ADOH 5F8RC 3MLUH 5A2JH 1EJ6A 2VSCA 2AJYL 4K9EH 4ODSH 5AUMA 1F4WH 2ADGB 1VCAA 5FO8B 3PGFL 4PRNB 4TTDD 4NJ9L 3OKKA 4PRIE 2CXKA 4WHYG 4UTBL 3RWHA 3G6JF 1BZ9A 2ATPB 3MYJA 4P2QB 1OARL 2NX5A 3BJLA 5I8KH 5CJQH 4YDLB 1E6JH 4Y1AE 5CJ8A 1IKNC 3GNML 3LKPB 3LN4A 1M71A 1X5KA 2NX5D 2VLJB 4WEUD 4NQTA 4Z7WF 3ZO0A 2OXHA 5DMKB 1B4RA 1YEKH 2PXYD 4EXKA 2EKSA 1WIPA 2WBJC 1UGNA 4HFWA 2P5EE 1HXYB 2R2CA 4JPWH 4XPBL 5AYUH 3C6LD 3MLTA 3IDXH 2EE3A 3U9PL 1MRCL 1OT2A 3QUKA 1PY9A 5F7WC 1I75A 4YHIB 3SE9L 2NY1C 3IJYA 1U8NA 1N59B 1UA6H 2HVKB 2VDKL 3GO1L 2XZAH 1MJ8H 1NAKH 1NEZB 2WBJB 5DA0B 3VGGA 4BYHA 3FHQA 5JW3H 3REWA 5FO7A 1BVKA 4NGHH 4AYFA 1UQSA 1MUJB 1H8OA 1INDH 2C9AA 5F6IC 1IL1A 2J12B 3M07A 3M1BB 3VFMA 1CFTB 3LEVL 4XWGH 1A0QL 4AEFA 1XZ0B 2R0LL 1H3XA 5IFJA 3RU8L 1ZHLA 4CN1A 2IFGA 3HMXA 4P2OD 1I3GH 3LIZL 4KQ4L 4QRPA 4KRPB 5HHPA 1FYTE 3IXAA 2V2TA 2R2HA 5DLML 4ENEC 1R6VA 3QIBB 5E6IA 5FCSH 2ESVE 3UPAA 4M7KH 2R2EB 3RUGB 5GGRB 2FB4H 3C08L 1A02N 1ZVYA 3HPLB 1EO5A 3GBML 3IXTB 3DVIA 3TA3B 3U79A 5ENWA 3TVMB 1DEEA 1YQ2A 2J6EH 4XP1H 4Z7VE 2CLVB 4O00A 3S7GA 1ZANH 3NIGF 1XR9A 2P8LA 1IC4L 2OL3H 4G80A 5L2KA 4MMXC 4Z7OE 2AJUL 2G9HB 3TBWB 5IWLC 1KBGH 4UI2A 5AZ2H 3KLHD 2VXQH 2ZG1A 5CSBA 3KDMB 2H32B 4WDIB 3AREC 3FQTB 2B8OT 4IRSD 2AK1H 4JZJB 3WFEL 1BIIB 2PW2B 3KXFD 4AH2B 3BZEA 1SJEB 3OKLA 4F8TA 4O4YH 4YK4B 2X4QA 1INEH 4LHUA 5I1HL 4G8IB 1XF4A 3WUWB 4URTB 4MJ2A 3H9SB 3WXVH 2EC9T 4Y4KD 3OKMA 5DDHA 5IFAH 5EU5B 1RZ8A 3B9EA 3A67L 4Y19A 4JM2C 3BGFC 4Q6IA 5F96L 2C3GA 2GSGB 4X7SL 2C1OB 2VXTL 1I85A 2GY5A 4LSVL 2XFXA 3MACL 3RGHA 4QHMA 3U0WH 3WXWH 3CVHA 3OR7A 4MQXC 4NWTL 4U1MB 3G5VB 3HCVA 3P30L 2P49B 1H3WM 1U8QB 4M4PA 1B0GB 3MRDB 5DJ0A 3RHWF 3U9UB 1OLZA 1G7PA 2R29H 1RMFH 1HYSD 1KJ2A 2Z8VC 1QRNE 1G9MC 4HKJB 4OGXL 5IBUB 3QDJA 2FX7L 5DGRA 4N0UE 4JZJA 3T3PE 3RTQA 3SDAD 3SDAB 4AEHH 3QWOB 4GO6B 3QQ4B 1IEAB 4CN6A 5FECB 2XN9D 5K9OA 1TJHL 4RMVA 1D7FA 2CJUH 1CDGA 4RAUB 3UPRA 4NM4L 1XH3B 3RHWK 4MB4A 4PR5A 3EDFA 5I9QC 1H5BB 4LEOA 3MA7A 2Q3AA 1P1ZA 4X7TB 5CGYC 4Q9CA 1XR9B 1A3RL 1KCKA 4NQCA 1S9YB 3RVWD 2X89D 3GRWL 3MXVL 1ACYH 4OGAC 5FUOL 2GSGA 1U8LA 2J6EL 1TVHA 4MB5A 4G8FA 5IMKA 3ULVD 2CUHA 4RFNB 4OI9A 4R0LA 3GMPB 5ALBL 5INCB 1AHWC 3R8QA 5MEQB 2CDFB 4MSWB 1GGUA 3DTXB 4LKXB 5DLMH 4F33A 3B5HA 5HVHB 2CDGA 3H3PL 3EO9H 3DRQA 1ZT4B 3ILPA 3O3EB 5HYJB 3GUTA 3C5ZA 4EIZC 4K3GA 5GS0L 4GMTL 5MHSE 3K74B 4PD4J 5DHVH 1MCJA 4JFQB 1IEAA 2JIXD 1AGBA 3QDAA 1YMME 3N85L 4P5TC 3GMLB 3SQBA 1JNNH 4M9OA 2YRPA 4XPAL 5C7XL 3TN0B 3VA6A 1YEIL 1IBGL 1NCDH 3MA7B 3NIFF 2M1KA 5E6ZA 2XZAL 4PJIB 4IRSC 5C0CA 1R3KB 4ZXBC 5HI3D 3V52H 3P4NB 4O9HL 5EU6B 4MJIE 4EI6A 4WU5A 1VFBB 1XR8B 4U49A 4M3KB 5ITBH 1CQKA 1F58H 4FG6D 3WNNA 3TO4A 1ZTXL 3VGAB 4HH8A 4POZC 4PJAE 4MAYD 1FIGL 2FHBA 5IBTH 3I6GA 6CGTA 1F3DJ 1E6JL 4QXGH 1QD0A 3QAZB 1IKFL 1BZ7B 4U6XA 4D0CB 3KPSA 4KXZI 4UTBH 3ILPB 3O3EA 4OSUL 5HYQA 3FB5B 3LH2H 3VXRA 3VRLF 3I3DA 5DD3H 3P9MB 4QYOB 5GGTH 3HLAA 5DFWH 5ACLA 5GGRY 3K46A 3IAPA 1BOGB 5K9JH 4FRWA 3JUYA 5CZXD 1Q0YH 4OZFB 3LAFA 2FO4A 1Z9OA 4RIRA 4F7MB 3GMOB 2IBBA 1F42A 2L7UA 1A7RL 5D6CB 3T2PA 2YSSB 4KC3B 3MOBL 1X4XA 4Y19E 1DZBA 3MV7B 1CK0H 4ODXA 2A0LD 3QCVL 4NO2B 2OJEA 4N8PA 1NCUA 4XTRD 3P4LA 5C0EA 4OT1H 3GM0A 4YGVA 5FYJU 4DJMA 4D0BA 2GAZB 5B38G 1IBGH 3BP4A 5I17B 4Y4HA 4HULB 1HCFX 1HH6A 4EVNA 1O0VA 2IEPA 1MHHB 2EE6A 3B3IB 1JUFB 1KPUB 1FAIH 4X4XB 4PJ8D 3KLSA 3KDMA 5J57B 4N0YL 3KPQB 2ATKB 5B3NA 3OXRB 1T1YA 3S9DB 1EPFA 3WNPA 5GS0H 4TOYH 1FBIH 1JK8A 3HE7A 3F58L 1HHGA 3EJZD 4NHUA 2FH8A 3MV9D 3GUTB 4P2QD 1O5DT 5D7KE 4GLRI 1MH5B 4W70A 1YEFH 1CS6A 1NGYA 4ODTH 3WHXB 3KWWA 3KJ4C 4XI5C 4S11A 2DQEH 4P5KA 4GKNA 4KRMB 1G9EA 3C5SB 1TZHA 4C57C 3PDDA 1SBBA 4OUUB 2COQA 4HLJA 4OKVB 2GK0B 5TQ2H 5BZDA 2F58H 4YDJA 1E4XH 1ZT7A 4NN7B 4FXGA 4XRCA 1D6VH 5INDA 4GQPH 5FB8B 3BZ4B 3WHE0 1A4KB 3GRWH 4XCNB 5TF0A 3FO2A 3TO4B 4M1DH 4YO0B 5FKPB 2VH5L 3RVVC 1F3RB 4QEGA 4PUBH 2FIKA 2ICWI 3B9VA 1N59A 2NXYB 4PYGA 1ZV5A 1R24B 4NDMA 3V4PH 3F6LA 2EDYA 4JHAL 4PJ8A 5CLTA 2E9WA 2R0WL 4R26L 4H26B 4QRRA 1I8KB 4AM0A 3KPQA 2YPKB 2R0KL 3C5ZC 4U6TA 3B4NA 1F4XH 5A3ID 4X9IA 3FO1A 4DW2H 3KAAA 4PJ7A 4WENB 2GCYB 2R4SH 1ZA3B 2ZCKH 2QBWA 2R29L 4XVJL 3U7AA 1EEQA 3GJFA 5SV4A 1X5JA 1Z6JT 2BHZA 2K1MA 2NXYC 1RZKL 3QO1A 1QSVA 4ZPVB 3I75A 2XWTA 3QNXB 2DTMH 4UB0L 3SQOH 4N90D 5DMKA 5D6CA 1H15B 2BVOA 1SVZA 5DTFA 2VLME 3LKOA 3O4LA 5DQJB 4JCLA 2PTUA 3DVNA 1EBPA 3TA3A 1GHFL 2AERT 4QY8B 5FYKE 3L3KB 2UWEA 3C6SB 2NQCA 1DN0A 3OGCA 3DUUA 1K4CB 4XNUH 2CKNA 5LAXB 2ENYA 1EEZA 1KF9B 1EFXD 2ITDA 5C0JA 3VWKA 1BZQK 3BXNB 3QEQA 4C56A 1FG2A 5GS2H 2IBGA 3P11H 1S9VA 2D3VA 5TH2B 3F7VA 1WCQA 3PE9A 2LVEA 1KELH 2ICWB 4GG8A 4RGOL 1BREA 1T4KB 3T2NH 4FTVB 5EZLB 4FZ8L 4QRPB 3HRZB 1OSPL 3IDGA 3L95A 3PL6C 2EDBA 4LPYA 1QFWH 4PG2C 3O2WL 4NUJB 4G43B 3O6FC 4QF1B 1J0YA 5DFVD 2VDRL 2EEAA 2CK0H 4KV5E 4JGJA 5J12B 4LSUL 3VXSA 2XG5A 1A14H 3SY0A 3WJLA 5KSAB 4HPYL 2QHRL 5IT2H 3PP3K 1DEEB 4PV9A 3EGSA 1K5NA 4G8GA 5F71A 1BECA 1BIHA 1TETL 5CINL 3PWVA 3QIBA 5E6IB 2FL5B 1BF8A 1FVCB 1QR4A 4PGBB 1ZT1B 5E99L 1YEEL 1BD2D 4HXBH 4U6YB 1CE1L 3RGVA 4EDXA 2WSKA 4TUKH 4DKDC 4LSPH 3MRGA 4JY5H 3MLPA 4C56B 4OGYL 1J0HA 4O2CB 5HHNB 4XB7A 5I8EB 3HPJA 4R97B 3QUML 1IE5A 3B83A 3WDIA 2W91A 3QIWC 3T3ME 3MRHA 3CH1B 3NCJH 5IKCA 4KV5F 1ZLVH 1QNZL 3DARA 4WI3A 3ZKXB 1VFMA 3UROR 2PO6C 1XGQA 3OZ9H 3W9DB 5IFJB 2BOBB 1OAQH 12E8H 1IAIM 4ZO8A 2MQ0A 1G84A 5LJYH 3MYZA 4WUKL 4L9LA 1EO8H 1MCPH 4U05A 1MHCB 4XCCH 5I2IB 3BZEB 4H8WH 2KZ1B 3N1QC 1A7QL 1HN1A 3ARQA 4K94H 3S34H 2DQGL 3DV4B 5D1ZA 1XF2A 1YEKL 3CCHB 1QPPA 5GS3A 3P4MB 4YR6B 3PUCA 5BMFL 3QISA 1AP2A 2D7NA 3WIIH 3GNMH 5L8JB 4U1NA 1CFNB 1P6FA 1L0YA 3AVEA 1HXYA 5IG7B 5MEND 5HI5C 3SDCC 5DK0A 4CDGC 3B2VH 3C60A 3PABB 4YFLF 3QI9D 3IGAB 1NSNL 4MNGE 5I73C 2VMFA 1J10A 1QSEA 3DIFB 1M7IB 4EI5B 2VAJA 3EHBC 5EO9A 1K2DB 5EC1A 1Q72H 1TMCB 4G9DA 1NMAH 2UV3A 2PR4L 3T8XA 1IGFH 3MR9A 1J8HD 5F88B 3X14B 4HF5L 2ZKHL 4NM8L 1E28A 5D96C 1LE9B 5D7IE 5J8OA 5DD5L 1L7IL 1YY9D 3ILQD 3H9SA 3QXTA 1AE6H 1NEZG 3Q5OA 3SE3C 1FFPA 1MOEA 4QOKE 3D3VE 5F9JB 2X4QB 4HIXL 1RUPL 3SO3C 5H8DA 1ZGLB 4PJ5E 5IUSA 3VXUB 4ETQB 3H42H 1RD6A 3M45A 1A1MB 3UAJD 1T7XA 3BPLB 3B9AA 1VA9A 3MLSH 4HUUB 1XF4B 2AABH 4J3TA 4HX1B 3LVEA 1YN6B 3JVGA 5GHWH 3UYPA 2C3VA 3TPKA 5D7IA 3OKOA 1DTUA 3FRPA 3RWJB 4HG4J 3N9GH 2ZP0T 4YEFA 2XQBH 3EFDH 1AY1H 1RFDL 5GZOD 1CI5A 1MLBA 5C7XH 1XIWD 3L5WA 3HI5L 2F74B 1JI1A 2UZIH 5CJBA 2DIAA 2G75A 5LWYH 2YZ1A 3MLSL 3DX8B 3HAEB 2P8MA 2BCKA 2NY6D 5D7SH 1G7IB 2JB5L 4I3RH 4PFEA 3RVXD 4J6RL 1U8HA 4BSJA 5JQ6H 5IWLA 3VXUD 3ZZ1A 5D93B 3L3IB 3QDMB 2VQUA 3H3PH 1AGBB 4WUUD 1TPXB 4G7VL 3GSWB 1YJDH 2HLFC 5DI8A 5EUKA 4HF5H 3GGWB 5IVXF 2R0ZH 1IGFL 2LU4A 4HUWB 1RK1A 3NABL 1LNUA 3VI3E 4BUHA 5CD5D 5GGUA 3VWJB 3ZDYF 35C8H 3O8XC 3AUVA 4UT9H 2A6IB 1EA9C 1JN6A 5L2JB 2XZCH 1SJVA 5FEBA 3ULVH 4R0LB 3X13B 4TNVF 1RVFL 4O2FA 4HK0A 1Q9OB 1RUAH 1FNEA 5KOMC 3FO9B 4XC1L 5IB5B 1KIRA 3WFDH 4P57A 3VXTA 1NH6A 4O51A 1CLYL 5IR1A 2NPLX 4F7PB 4F8QA 3TPUA 2A2QT 3DROA 5HTSA 4JM4H 4AEHL 4HC1A 4PP1C 1RSFA 4NCDA 1V7ML 3MRBA 1TVDA 4EDWL 1UH4A 1WBXB 4N9OB 1YNKL 25C8H 1EJOL 3D39A 1XGTB 2BNUA 3ARFD 4MQ7B 4K71C 4P5KB 4APQD 1S7RB 1T20A 1GPOL 2FYYA 1XGYL 4DEPB 4NPYB 1DQLL 1HK6A 3MFGB 4NN5B 3OR6A 1LNUB 5K93A 1KSRA 5FYKL 1FSKC 1NAMA 3MRJB 3L7FA 1S9XA 4UT7H 3WFBH 1I7ZA 1OB1B 4LLMA 1W2KT 1K8DB 1QSED 4BZ2H 3QZWB 1OVZA 2P5WE 4Z0XB 3ULUD 5DJ8B 1HKLL 1IKNA 2G5BA 2NY0D 3LQAH 3QDHA 1MHHA 5CZVH 5IQ9A 3DVFA 5IFAL 3VGFA 3CXDH 3MBEA 3RNQA 4F37F 1G7IA 4MXQD 5DO2D 3ULUC 5D7LB 2YD1A 4KRPC 4MSWA 5AD0A 3T0DA 5J1AA 4U0RC 5L2KD 1I1AD 5JIKA 4OGAD 3VFWA 2YC1A 3SOBH 3T0BA 2HTKD 3LHPL 1VB9A 4CVXB 4LKCA 5GRJL 2EYSA 1IZJA 2X6MA 1IAOA 4HAGA 1KN4L 2WQ8A 3LEXB 1BJ8A 5CUSL 5GGTA 4HWEL 1YN7A 4OZHA 2GSIA 2VDRH 2BDNL 3T1FB 5E8NB 5A16B 2VXQL 2OLDA 2A6IA 1ORQB 5DA4A 1X9QA 3NH7H 1S7WA 3FB5A 5KANG 3GMNA 1E4KA 4PJAF 4KY1L 4KJYB 1CBVH 1J88A 1JNLL 4QRPD 3U4BL 1HI6A 4X6CF 2V9QA 3HNTL 1FNFA 4NIKB 2DS4A 2XWJA 1A3LL 3DYMA 1Q8MA 3V5HA 4OJFL 3MRLA 2FEEL 4X98B 4OFYA 2GEEA 3EOAA 3IS0X 2HFEA 2ADJA 1D5XB 4F9PA 3LSOA 5DK3A 2G5BB 5EOCJ 4MA8L 3BMVA 5TFSL 2BSTB 2B1AH 4ZFOL 3IVKA 1UCBL 2P44B 4TQEH 1HH9A 1MJJA 5MENE 3HE7C 1KN2H 4LHQB 1J1PL 5ERWB 1RPQA 4I0PA 5JMOC 5J13C 1ETZA 5A2FA 1M7IA 4Y4HD 2NY3C 4LLUA 4KKLD 5T3XL 2PW1A 5C0CE 3JXAA 4PPTA 4HIIB 3BIKB 4U1GC 4PGEA 5IVNA 2DKMA 4FQ1H 4XTRC 2R0LH 4PJDE 4GUPA 3IDGB 4LIQL 1WFUA 3HR5B 4KJQD 1Q9KA 3IS1X 5HYIA 3RPIB 4ZS6C 5C0GA 3O6LL 3BOVA 1MRFH 3GSRA 4PJIF 4YHOH 1WEJH 1ZGLA 3U4EB 4Q6YA 3NCMA 5E5RB 1YA5A 5FYJD 3GSNH 4PJFB 2ZWLT 1NCTA 5DQ9A 3GSXA 3ZE1F 1FE8L 3T0EB 3DX7B 3QFDB 3IDXL 4NQVA 1HXMB 5AYUL 4XPBH 4ZUWB 4ZQKA 1HYRC 4HWUA 4MS8C 3ZDZE 2EYSB 3LD8B 4R4FL 4PGBA 1CGWA 4RWHA 4PUBL 1OTUD 3O3AB 2EYTA 1C5CH 3QQ3B 1H3VA 4OZIB 3V4UL 4JFZH 4MS8D 1XGUA 5C09D 3C8HA 2J8UB 4L4VE 4KZDL 5BS0D 2YUWA 5J1TC 1AGEB 3ARRA 1F8TH 5HDQL 4WU7B 4JLRA 3P9LA 4PLKC 1UWXH 4PGEB 3GIZH 2N7BA 1Y6NR 3CX2A 3V5DB 4MQ7A 2CLRA 5IESL 4OCYH 4WUUE 4OB5L 3HZMB 1KB5L 2OSLA 3O2VL 1AQDB 5IW6B 1ZE3C 2P8LB 3FO1B 3PIQB 1CD8A 3MRBB 2DQEL 3KVQA 4ONHA 5FA4A 4Y16D 3D85B 3VFSB 2Z31A 3IT8D 1P4BL 3KG5A 4KAQL 3SDYL 2F5AH 5IQ7H 3EJJX 1FJ1A 1RZIB 5CEYA 1QSFA 1T4KA 4XPGL 1J0JA 4BK4A 4TVPE 3F58H 4PJFA 4U7KA 2QR0B 3SKOA 2CPCA 1PEWA 1QQDB 1S78D 3BKJH 4BKLA 4JRYE 2EZ0C 3BN3B 2FIKB 4G7YL 3QFDA 4YDIH 2IBZY 3HI1A 2VJXA 4UQ3A 1TJGH 3T77B 1JPST 5GISH 5EN2A 5HJ3A 4BA8A 4XCNA 1IGCL 1MCEA 5IR1B 1UKQA 1WC7A 1L0XA 1MWAL 4TPRH 3IFLH 1YNTA 3NA9H 4X4ME 1AHWA 2BVEA 1OAYL 4NRYB 4J2XA 4U1JB 4M8VA 1Q9KB 3OAUL 2YKLL 2ZOLB 1I9EA 3VWKB 3VWKD 4NO3B 3NGBB 5J4MA 4C83A 1DBMH 2IH3B 2CRYA 3ULVF 2F53B 2UZYB 2FJHA 1E4XI 3ULUH 5K9JL 4NFBA 4LNRB 4Z7UB 2VIRA 4AIXA 4K3JH 2DJSA 4O5LH 5J13B 5DJDA 1JTOA 4PJXA 3DETD 3CLEL 1RUQH 1QBLH 5GSRB 1MPAL 5DS8B 2OL3A 3OKNA 4G8GB 2BXZA 5BO1L 1MFBL 1HE7A 1MHPH 1TQBB 2AK4B 1K4DB 3SDDD 4JKKA 5DJZB 3OKOB 3B8YA 4P3DA 1JYWA 2DQDL 4H0IA 4K9EC 2VDQL 3FONB 3FAWA 4J8RB 4ODBD 5JXEA 1IT9L 1XAUA 1AR2A 1UJ3A 5F7NC 3TYGH 2OX5A 4JO2H 2Q8AH 3AS0A 2F74A 3QSKB 1I9JL 2OM5A 1UZ8A 4RDQG 4UOW0 5D1XD 3VMPA 1F4YL 5J0BA 4QHMB 4JM2A 1QSFD 2A9MH 4JPIA 1S7XB 3MRHB 5EUOE 4PG9B 3SBWC 2J2ZA 1J12A 1EEZB 4GXVL 2WANA 4OZHB 5HBBA 2HVJB 3L1OL 2LAGB 2ZPKH 5ISZA 1ODAA 5IB3A 3JWDH 1CYGA 3HE6C 3GIVA 5FOBB 4KK5D 2E6JA 3RPIA 2OSLB 4KRLB 4APQA 4EUPA 4UBDC 3EYSL 3FQXA 4U7MA 3L6FB 5EBLA 4KI5C 3O4LE 2BY3A 4P4KC 4JN2B 4LDLB 3ZHLA 4E42B 2D03L 4M1CC 1V3MA 5BW7A 3HFMH 1ZLUH 2YA1A 4NFDA 4RFOH 1CDHA 3TBSB 1BF2A 4NKMB 2FD6L 5DHVB 3R8BB 4TQEL 4HGMA 3WIFB 1WVZA 1HH9B 1KC5L 1NCCL 1MJUH 3S98A 2X4RB 5E24E 1NGZA 3S3PA 3VDCA 5IB1A 3O41B 1NUDA 1HXMA 4G6AD 2PO6D 1U93B 2VL4A 3JTSB 3UTSE 4ZD3L 3ZE2F 1AGCA 1J05A 4EN3C 5GRUH 2WLZA 5FHBL 1GOFA 4OFDA 4OLXH 4HS8H 4WI7A 3U4BH 5EU7E 5D7IF 3B8SA 1DLHA 1NCBH 1DBAL 1TNNA 3OB0K 3LEYL 3DYPA 2WWMD 3EYFB 4I48A 1U3HD 3BISA 8FABB 4KGLA 4LASH 3DECA 4Y1AA 5E00A 5LGKA 3BDBA 3CC5B 3KYKL 4L8CA 3GSNA 1AJ7H 4KH2A 3GBLA 1TITA 4HCRA 5CGTA 1A64A 4ACPA 4FFZL 3WD5L 1PQZA 1DFBH 4OZGE 4QYOA 5DVOA 3WE6B 1RAMA 4N1CA 3NIDF 4OQ1A 4XNQA 1JHKH 4ONFL 5DYOA 4U6XB 4D0CA 1Z3GL 4OIIH 2WBWB 1QPXA 2W9DH 4LLDB 1S8DB 2HP4A 5I1LB 2F54E 3HLAB 4FQLH 5BZDB 4FQHB 1KB9J 1IGMH 5I8OH 1VGKA 4IJ3C 3L3GA 3Q6FB 3MV7D 4NC1E 4PJEE 3SKJL 3ARDD 3EO0B 5HI4C 1G6RL 3FT4B 3QWRD 5C09E 5LCVL 2I27N 4DGIH 5J6GB 4LCWE 1BFTA 4M1GL 4ONGH 1NFIB 2R1XB 3WIHL 4LLYB 1B6DA 4N9GA 2HLFD 1TVBB 4DGVH 3V6OA 3VXOB 3I02A 1DQLH 1U8HB 3UAJC 4KFZC 3BP6B 4ZTOL 3PDOA 4X0KB 2CH8A 3ZT5A 4P2OC 2LABA 3AROA 5EC2A 2ZG2A 3H3KA 1VFOA 5I1HH 1WZ1H 4QHLA 4EUPB 1EJOH 1LEGA 4WFGD 4MXWH 5F44A 4XVSL 4OZGB 3RTQD 5DMJB 2AV7B 4UUJA 5FK9B 5C9JA 3WFEH 3IFNH 5CMAB 1T0MA 4HIHA 4I2XB 4XMPH 5EBWA 4JM4L 1K3ZA 4MX7A 4NT6A 3UTTA 2Z31C 1VENA 4JFHD 4TTDC 4L8SA 4XBPA 4K94C 1CU4H 5FO8A 5D5MB 3I2CH 1JPFA 3LCYA 3RA7H 4WEBH 4XP4L 4IIQA 2AJUH 3W0WA 2GJ6D 2YK1L 4KVNL 4OCWL 4Z8FH 2IPTH 4RSVA 3VXUA 3G5YA 4MXVF 4OZ4A 2GJ6A 3D5OF 1LDPL 5F72S 3KPSE 1YJDC 3SJVE 2C1PB 1IAII 3BEWA 3KYMA 1DQQB 4YDJB 2X4OB 1NDMA 1OHQA 2VE6A 4WEMB 3FMGH 1PSKL 2JIXB 4LRNL 1MCNA 5CILL 5GSVB 4X4YB 3EOTL 4NQCE 4DN3L 2QSVA 1RZJL 1UYWL 3TBTA 1DQJA 3GHEL 1JHLH 3BDXA 3C2SA 1A9EA 3OXRA 3RL1A 3AY4A 1D3CA 1KCUH 4HJ0D 4NQDE 4PJ7B 1LQSR 1H3UA 4ZNCD 5EORL 3HG1D 1SVCP 4A6YB 1KPUA 4J6RH 1WWAX 4LAQH 1MCBA 3O2DA 3RPKA 2JJVA 2QKIB 3GMRA 4JN2A 2ATKA 4JFPB 4GW5A 2WWMC 1BVLB 5EU4B 1S7QA 3Q1SH 4R2GD 1MHEA 3L3OB 4HH9B 5TDPB 4P4KB 5GPRA 4NGHL 2WINB 4JFOB 3G08A 4FXKA 5CKGA 3N9GL 1UZ6E 5E9DA 1U3HB 2PTVA 1IM3B 3QG6A 5F7EL 2Z4QB 2VDKH 5HHVL 3SY0B 5ENWB 4ETYA 4GAGL 1FL6B 2WAHA 4JB9H 5H35B 3O3DB 5I0DA 1T66D 4LVEA 5CJOL 5ETUB 3CGTA 4HJJH 1QA9A 1BX2B 5FO9B 3P3YA 3TVMA 1UH3A 4XHJC 4YHML 3BGAA 4PRID 5IW3A 4U31A 3QEQB 3QUZD 1SM3H 5FHAH 2CDFA 2QQNH 2ICWA 1FNGB 2OI9B 5F7LB 2JTDA 4Y1AD 1Q9WA 4H25B 3JTTA 1WWCA 1MI5B 3DJ9A 4TNVK 5FGBC 1IRAY 4IDJL 4JQIH 4UDTB 3EKCA 3MV9A 4HWZA 5HGBB 1KFAH 2H26B 1UZ6F 4L3CB 1PG7X 2F53E 4J4PC 1EZVX 1OP3K 1GC1H 2X9YA 3K81A 4U6HA 4LVOC 5CD5C 3GSVA 1TZIB 3W81A 4DZ8A 3MV8E 5DQJA 4NNXB 3QUXD 5IB1B 5JZ7D 4X98A 4X6BA 3MFFB 4YHPA 1A5FL 3ARGD 4E5XA 1G7HB 5DC4B 4D0DB 1IC5H 2J8OA 2LFGA 1NAML 1A7QH 4J1UB 1N6VA 4AK1A 3NTCL 1QFOA 2AXJA 4N0RA 3RVTC 1QFWI 4RQQB 5T1DH 5KVEH 5I19H 4I0CC 1KTKE 4XZUA 4QHUA 1YEJL 3N1FC 4POZD 4S1SL 5DJ6B 1QFUH 5HYJA 3MBEC 4PJAA 4G8GD 2HWZH 1FG2B 4N8CH 5TE4H 4M6NH 2HRPL 3OKKB 4M6OH 1SHMA 4N0UB 1UADC 1ZVHA 4CMHC 3P0YH 5BS0A 2BFVL 1UKSA 4LSRL 3TT3L 1A4JB 3ZTNL 4Q7DA 5CBAA 1KEGH 4F7EB 1YPZE 3JV5A 3QDGE 3VFNA 2P45B 2X4PA 4I3SL 4UQ2B 1U3HA 4PJ5B 4JO3L 1KJ3L 1R3KA 1U91B 3P4MA 5DVKA 4YR6A 3DVGA 4YHNA 4S1RH 1IARB 3IF1B 4ELMB 1P1ZB 4Q58C 1HIMH 3LSOB 4AENA 1OAKL 4C54A 2EYTB 2RCSH 1A6WL 4ZUTA 1NAMH 4DTGL 4N8VA 4WHTA 5E8EA 5FGCE 2IAMB 3U2SA 5KS9A 4CGTA 5HGBA 4FXLA 3UJTL 3C5ZB 5I71B 1S5HA 1TTFA 2O5YH 2MCG1 4HWBH 3I85A 3GM8A 4HUVB 3ME0A 1IQWH 5JHLH 1NCAH 1N2RA 1C1EL 3JV6A 4ODHH 3HKFA 1XGQB 2V5MA 3MRNA 1PZUB 5C0GB 2JJSA 2QTEA 4DUWA 2BOCB 2IMNA 1P84J 4P5TD 3CZFA 2NY4B 5ALCL 4GRLA 4PRNA 3TO4C 1OWRM 4AG4L 1Q38A 3KPSD 1A6VH 4UINH 1UWGH 3H2WA 2GW5A 4NQDA 2B39A 4UDUB 2DLEA 4FTVD 3OF6D 1Q9LA 1MFDH 3CUPB 4L8BB 4MCZA 3LKRB 3DXAD 5ANMB 5LGJA 4UB0H 5ID1A 5D7LD 5CJOH 1NC2D 3AU1A 3MA9H 5DK0B 2NY3B 1P9MA 1FV1A 1I8IA 5E2VL 3ULUF 2IQ9H 3K7UA 4MJ6A 4MD0B 1MFCH 3BPNB 2BRQA 1B2WH 1JK8B 3HE7B 4CU8A 3GJFH 1QZ1A 1BQHG 2J5LC 4JM2F 1J1XH 4K7PL 2ENSA 3DV6B 3GHBL 3CX5K 3GKZA 3X11A 1BVLA 4KK6C 3HC4H 3SE8H 3RDTB 3RKDD 5FYLH 2YD4A 5D1XB 3AB0B 2NXZD 3U30C 2CO7B 3VXQA 1S7RA 4YWGL 3ULVE 3V4PL 1WWWX 2PTTB 2EDQA 3QR2A 5EZIL 4F7CB 4HS3A 3LS5H 1X6LA 3GZKA 1B90A 1V3JA 5FV1L 2FR4B 1AI1L 4YHYC 3E0GA 3HS0B 5KSBE 5KVMC 2M8XA 1N0XL 2MOVA 3GHEH 4L4VA 5F70A 2X1XR 5GGRA 4J3XA 3L5HA 3T4AA 3F12A 3PWJA 2DQIL 3FB7B 5FFLA 3DI2B 4UV4H 1EH9A 4HC1L 1XIWA 2D31A 4JY4A 5J3HC 1TENA 3VXNA 1JN6B 5L2JA 1FNEB 2LU3A 3NCBB 5B38B 4Z77B 3T3MF 1G0XA 5T1MB 3U0TA 2J8HA 2VLRA 1VEOA 3O2DL 3A6OA 5GS1A 1A7BA 3V7AG 1OGTB 3REWB 4PJAB 2YK1H 3NN8A 1JHTA 4GBXD 1NEZA 1YEFL 4DOHB 1MFAL 3I2CL 1DLHB 4QHUB 2YA2A 4RMSA 3CZFB 4BQ6A 3JSSA 4HXAL 5DUPH 3VGAC 5T3ZH 3E8UL 3GJFB 5T5FH 3BEVB 1OF2A 4K23H 4PGCB 2VWEE 3MRNB 1G9NH 3RY6C 5B4MC 3SJVB 4X9FA 4AH2A 4ELME 1FAIL 3JV4B 1L0QA 1JP5A 2WUCL 3AAZA 1Y6KR 3WS3B 4DEPC 3OG6B 4HUMB 1RULH 3UYRL 1U93A 1OGAD 4G6ML 4YO0A 5FKPA 1TQCB 4NZUH 4LF3B 3WS6C 1T66C 1FH5H 2X4RA 4G80B 5L2KB 5IBLC 1FP5A 3EOYG 3QIWA 5FIEA 3UJIL 3BO8B 1XIWB 2J88H 4JY4B 1RJLB 4X7EC 2VXVH 1X5FA 4RFEB 4XBGB 5LCVH 1D9KC 2IG2H 1G6RH 1MCCA 1G1YA 1KGCE 3JV0A 5IHLB 1D5MA 4RAHA 5BXFB 5HHOB 2HH0L 2VDNL 3CFEA 2GHWB 5EOCL 1B0GA 5DJ0B 1MFNA 2ZUTA 1FRGH 2UUDH 2AGJH 1B0WA 4X8XA 4MDIB 5F8QC 3KPLB 1N6UA 4H20H 4P23D 3TBVB 3VJ6A 1L7TH 1ROWA 1FIGH 5IBTL 1JPFB 3VWJC 2VABB 4MJ5A 4PJEB 1N2RB 1NKRA 3JV6B 1MCQA 3FCTB 5IJVB 3LY6A 1U8PB 1IQWL 2B1HH 5JHLL 2YD3A 3O6FA 3TFKC 4OFIA 5DRNA 4LLWB 4ERSL 4PB9L 4XCFH 5D93C 3N1PC 3HUJE 1EHNA 2IPUG 4DN4L 3LKQA 1DBAH 3F7YA 4OCRL 3RWCA 1DUYB 4GKOA 4GRWF 5I1CH 3OG4B 1N26A 5DD0H 3O9WA 3SKMA 1I7ZB 1J86A 3L3JB 2DLIA 5DFVC 1ZEAH 3WFHA 5IHBA 1JNNL 3SDAC 3B6SA 5JO5B 3S37H 5ITFA 4X6EA 2EH8H 3VRJB 1R0AH 1NFDB 4H8WC 1HHKA 1OP9A 4LLYA 4JFYA 5E70A 4EKXA 4RAVB 3VI4E 5BZWA 4N8VG 1KJ3H 3VXRB 1HHHB 4JR9L 2FD6H 2DKSA 3T09A 5IMOB 1CD1B 2Z8SA 1WAAE 5T3ZD 5I18L 3EO9L 4MNHB 4RX4A 5J6HB 3N0PB 4MA3A 5A40E 3DTXA 4F33B 4JR9H 4NO5B 3SO3B 4LSTL 4HCRH 2FJGA 5F7KC 3KLDA 4XBPB 1IILE 4FNLL 1F3JA 4NO0A 4HMEA 4E0RA 5L8KB 1P6AB 4I2XA 4GKSB 4ISVA 2QADD 1PYWB 2QSTA 5CSZB 3D9AH 2HN7A 4BQBA 1A7OH 3JWOL 4DKFL 1JPSH 3MXVH 4PRDA 2X42A 3VFOA 1QLEL 5DR5L 4CDHA 4L4TB 1S9YA 1ND0A 5D6DA 1W0VA 2DM3A 1NLBH 1IM3A 3QG6B 4WW1A 4RFEA 4XBGA 5B3JE 4MD4A 1D9KB 4Y2DD 5E5UB 1KIUA 4NCC1 4WW2F 3SDCB 4D3CH 4TULH 3EUUA 4L8DA 3VRLE 2X4NB 3V95A 4N9GB 4YPJA 1IC5L 3ALPA 2A83A 3HZVA 1EXUA 1J7VR 5A3IC 4FG6C 2HT2C 4GBXA 2VLMD 2E7HA 4GW5B 1U3JA 3TIDB 1YPZA 4UT6L 3PP4L 2OP4L 2MCPL 4P2YA 4HS6A 1ONQA 1E6OH 3E6FA 2YUXA 5GGSB 5IBLD 1C8PA 3FFCA 1EGJA 4LBEB 4U0QB 4AMKL 3IAGC 1RV6X 1VESA 4NWUL 1X5ZA 1GVIA 4ZFFB 1I1AB 5EOCH 3WN5A 3BW9A 1CE6B 4R3SA 4PJGF 3FT3B 2H2PC 4P9HH 4XAWL 3GSVB 4U1IA 2JB6A 5T33H 2X1OA 1EVTC 5DD1H 4JQIL 1KNOB 2ITCB 4OTXL 2IG2L 1CIUA 2VLKA 5CWSB 2VLJA 3PQYD 1U8OB 2KZWA 1FNLA 4ZSOE 4M7LL 2KPNA 1FYTB 3QFJB 4GAJH 5DEFA 2ZUQC 3FQNB 3QI9B 3R1GL 1HKFA 2V17L 4PJ9D 3BD5A 2YKLH 3HE6D 3FO0L 4KKLC 4F37K 3I6GB 2LV4A 4NQVB 1OW0A 4P23A 4TPRL 1FNGA 5C2BL 3UZVB 3BEWB 3KYMB 2GI7A 4OCXH 4S0SD 5B39B 3BSZH 1TIUA 2W0KA 1MH5A 5E2UH 4R4NC 3FB6B 1E28B 4S1QH 4HG4K 5ACZA 5JORB 4NKIL 5KJRH 1T5WA 3F7PC 1MREH 3BZDA 4UTAL 1UB6B 2EDEA 1Y6MR 4P4KA 4P4RA 2I25N 4S2SB 5KSAC 5JUEH 2EH7L 1X5HA 2VZOA 4FQCH 3RDTD 4TSCH 1TZIA 3G9VA 3VFNB 5J12C 4PLOB 2OL3L 2CMRL 3GMRB 4JFPA 4HLZG 2HJKB 3O6FB 3O2DH 1BZ9B 2ATPA 4E42A 2FBJL 1OGAE 1VHPA 4YGVB 4KK8D 1MCWM 3HE7D 4JHWL 4PB0L 2ZSWB 5C71A 2DQIH 3WSQH 2FB4L 3C08H 3MYJB 5KSVB 1BD2B 4YFDB 3QEGL 3BPNC 5I76B 1JRHH 2GYSA 3ARGB 1A4KA 4FQIL 1ZLWK 4XNMB 3QA3A 4X80L 1JFQH 1UACL 5JOFA 5BXFA 2IPUK 3ZT6A 2GUOA 4WUUB 3IFOB 1RK0B 3UTPE 4PJHF 1WC7B 4EBQL 1HINH 1WBXA 1BVKB 4FP8H 3WL9A 3S5LG 4OCWH 1QEWB 4JG1H 4WDIA 5L0QC 3EO1B 1TCRA 4LCWD 4P3WA 4WIQA 2LU7A 4OUUA 3FTGB 3CC5A 5K9KB 1KYOK 1U8OA 4XCYB 5K9QG 5KJRL 3CFIC 2G9HA 3TBWA 4YHOL 4S1QL 2YBRA 4X7CC 3W9EA 4LGPB 2GCYA 3FB8A 1G7HA 2NY0B 5E2UL 2ESVD 3I6KA 1L9NA 3RZCA 2UYLA 3HR6A 4KRPD 4YAQA 1PGRB 3H9SE 5CJXC 4FQ1L 1C16A 1MEXL 3O45B 1QLFA 2X2YA 4XXDA 4WFGE 2FECL 2QADB 3GSQB 5FGBA 1OGAB 4F58L 5DMGD 4NHCH 1NAMB 4WO4C 4MD5A 3ESVF 5CIPH 3DMMC 3BWAB 1M71B 1UWGL 2EDWA 4GAJL 5ESAA 4CAGA 2JLLA 2XKUA 4P3CH 1CIDA 3ARFB 4KTEL 1LK2A 2B1AL 3WSQL 1S9KC 1YMHB 1KTLB 2R8SH 2FLRT 1CZ8H 2G2RB 3PGFH 4ZMAT 3VXOA 1R5IA 3MV8B 4L29B 1PDKA 4JJHA 4U2YA 5DD1L 1F4WL 4X99B 3VFGL 5GS0D 3QNZB 4YXLL 2PYEA 1T2JA 1DVFD 1RUKL 5DK2B 4P46C 1QRND 1J0KA 4XP6L 2W0FA 5C08B 1UQSB 4PJ9A 4QHKI 4GAYA 4JFDB 4NN7C 4C58B 1NMCB 2MPAL 5L9DH 3CLFH 5I30L 1ZLVK 3EYQD 5C8JA 5AZEL 4M03A 5IJKC 4XI5D 1XF5A 1EGJL 5C0BE 2XN9E 1MAMH 4L8SB 1U92A 4I77L 3PQYA 1MVUB 3D87B 4D3CL 2VYRE 1A6WH 2RCSL 3VXQB 3BPOC 4PJCE 4KKBC 4DWHA 1NBZB 5FAAA 5F3BA 2WUBL 4QY8A 3W0WE 4Y8DC 4DFHA 4ZOCA 5I1EL 2P8PA 3KPNB 5JPNB 4HDIB 4OD2A 4EOWH 1AGCB 1NFIA 3PP3H 2NXZB 3U36A 4ZD3H 2ZUVA 2PYFB 2Z92A 4KQ3L 1AGEA 3WO4B 1WAAA 3EDEA 3D0VA 3U46B 2I60L 3FOLB 1I8IB 4RGND 5LXGL 1WICA 3MOAH 4ZUVB 3V0WH 4XNZB 1PX3A 1MJUL 5GS2D 2GJJA 3MRCB 3WKML 2OR7A 4LSTH 1G7PB 3HZKB 5I1KH 2DMBA 1IGJB 3U48A 1T2QL 1G7MB 3EJZC 5FYKH 4P2CG 4LSDA 4RFOL 2G60H 5TE4L 3HFML 4P9HL 5E4IA 3G6JA 4LVOB 3TNNB 4A2MA 4Y7MA 3NN8B 2KDGA 1M4KA 4HBCH 2WV3A 3S4SA 1OSZA 1XT5A 2WWKT 4AIOA 4OLEA 5DVLA 1ZT4A 4PJCF 4MLIA 5T1DL 2J1KA 3MJ7B 4NYLB 1EDQA 2Q86A 1V7MH 4GG6F 4FFWC 3STBA 1PX4A 1A7NH 4HS3B 4TULL 5EN2B 4C4KT 5GGQH 2Z4QA 3M17B 3FRUB 4OCRH 2VC2L 1XR8A 3FFCE 1UM5L 3OL2A 2EXWC 4GG6A 4PB9H 4XCFL 5FYJL 1OTSC 1RK0A 3X11B 1T1WA 4HMCA 32C2A 4P2OA 4QHKJ 2ICEB 2FWOB 4RRPG 3QNZA 2R1XA 3HUJA 5E4EC 1QSEE 3V7MA 5ADPH 3MODL 3JUZA 3W2DL 5C0RL 3HTLX 1L7TL 1ED3B 4WTXA 3GGWA 1W0WA 1PKQA 4IHOB 4PGDA 1KTDA 1GOHA 3HUJF 4BH7B 4R96B 4G7VH 2HH0H 2ED9A 4HV8A 5GS0C 3JV4A 1W72B 5DUBB 1F4HA 5I1KL 5JOPE 1D5IH 5IEHB 5HI3C 3WFCH 3BX7C 1GZQA 3IU3B 3AXLA 4L9LB 1JBJA 4OZ4B 3TEUA 2A6KA 1J9CT 3E3QE 3AC0A 2V7NB 4OLYH 5JLZB 3DX9A 1XF2B 1AR1D 1BFVL 5D2LB 3BWUC 3FAXA 2ICES 1AHWB 1CXEA 4KI1A 1UWEH 3TZVB 4XAKE 3LN5A 5FF6A 1NQBA 4Q9BA 5LBSH 3CVHL 2F54B 4LVHC 3CFCH 2DQJL 4N68A 4MNHA 3HMXH 3S88H 1JZ2A 4PRHA 1Q94A 2EDXA 1UB5A 5SWSA 5BVJB 2VWEC 2NW2A 1LVEA 1INQA 2F5BL 2P4AB 5ISZE 1RUPH 5T3ZL 3QIWD 4JFYB 2APTA 5DUPL 4HUNB 4PRPB 5DJDB 1AE6L 3IDJB 3M8OL 1SBSL 2AXGA 4NN6C 5FA4B 5SWZA 2Z31B 3DSNA 3MPCA 3C6LC 3PV6B 1T7VA 3K0WA 5DSCB 1CICC 2Z0BA 5D70H 4BQ9A 4PJXB 1D6EA 4YEEA 2FDBP 3FMGL 1ADQA 1BJ1J 2Y36L 4OBSA 3GIZL 4LOUC 3LRGA 4RMRA 4HD9A 4P99A 4Y89A 3IXTA 1S7VA 3QHTC 5B21A 4RA3A 3ZYIA 4LCIL 1NSNH 4LCWA 5I16B 4C59B 3B2VL 4W6XB 4HGWB 4P3CL 2VXVL 1T04B 1U8IA 2J88L 4KZDH 4YX2L 3DX6B 1HZHH 4U4BA 1G0DA 5DHYB 5HYFA 3ARDB 3UYOD 3KPNA 4MWFA 1T1WB 1DP0A 5FYJE 4LPWA 1MLBB 1JF1A 1KIRB 4PJ7F 2X4UB 4YWGH 4F58H 1SYSA 2MJWA 2MHAA 3QXUA 4PRAB 1WZMA 3VGDA 4U7SA 1T7WA 1EO8L 3RQ3A 4IJ3B 3WNKA 3GSNB 1FDLH 4G9FA 5C6PB 3HC3L 3QO0A 4PJ8B 3V7AE 1OOAA 5D7LE 4H1LG 3LRHA 3GHBH 3RVXC 3GJFK 1J1XL 1JGVH 5C0AE 4NKDA 5SWZD 4HZLB 2PO6A 2XACC 3MJGX 4HKZB 3AM8C 5E08H 1QNZH 1P7KB 1Z0NA 2B4CL 3DGGA 4ZOAA 5EUKB 4HWBA 5I66A 5JNYA 4LMQE 5CEZE 3W0WD 1CE6A 4R3SB 1QLRB 4GW1B 2BXYA 4HJGA 3BZ4A 1XF1A 4FP8L 3L7EB 1N64H 4KZEL 4LCIH 1RJYA 1U8MA 5KBNC 4D0DA 1A8JH 2XWTB 5FYKD 1GGIL 4P4KD 5KW9L 1U3ZA 3TO2B 4ELKB 4APQC 15C8L 5BW7C 1CDCA 5CP7A 4FQIH 4J3WA 4RZCB 4OZGF 1U9KA 3SKMB 3WUWG 3MNZA 5HI5D 4ZUTB 1K6QH 2BNRE 4H1LA 1G6VK 4KKNA 4PJCB 2OYPA 5DD6B 2YEZA 1G7MA 2DMCA 3INUL 4FQXD 3IDJA 4NC1C 2AK4E 4HPYH 4ZTPH 1E4JA 1N7MH 4BFBD 3DMMA 1V3KA 3BE1L 3WD5H 4X6FA 3HMWL 5ANME 3KYKH 2GKIA 3U9UA 2CMRH 1KPRA 3PGDB 5HHME 5DJCB 3VMOA 1OTSD 5FYLL 2HN7B 4XNQB 3HMXL 5MP6L 5F9DC 1HHIB 1ND0B 2FX8L 3PG2A 2FNBA 1MREL 2VXUL 4DTGH 5BS0B 1VFAB 5CCKH 5MEOB 3LMJL 3V0VA 1DN0B 1OAKH 3CXHK 2CIIA 4ISVB 4YPGA 3FFCD 4YHZH 5FM8A 3BI9X 5BQ7A 3DX9B 5I16A 2X5PA 4F15C 4ZYKA 3S36L 3VXMD 2BVPB 4QXWA 5MEPA 4V2BA 3MLWL 1KC5H 3TCXA 3H3BC 3AXLB 4XPHH 2H3NB 4IDLA 4HIIA 4QXTA 1MWAA 2HJLB 3RNQB 4AEIL 4BZYA 4W68A 4CVXA 1GHFH 3BIBX 3WLWD 5JPMA 3B9KA 3TT3H 4IOFC 2NY6C 2XRAL 1J87A 4JRYB 1FO0B 3F5WB 4PJGA 2FSEB 1HWHB 3CVIL 4D9LL 4HPOL 5EO1B 3DO7A 2A6DA 4S0TD 1UXSA 2ZSVA 3BKCL 4MJ6B 1M05A 3O6KH 2X7LB 2M2DA 1QFUL 1MJ7L 3TESA 3JWDL 3OBAA 3S35L 3RI5F 1JCKA 4XVJH 5EOQH 3NZHH 3U82B 2A9ML 1RIUH 1NBZA 3Q6FA 5KVEL 3O4OB 3BH9B 3IDUA 2PXYC 2VR4A 4H88H 3BYYA 1EX0A 2C1PA 1FZJB 1BGXH 2Y5EA 4ZUSA 2R0WH 4WTZG 1A7PH 2XTJB 4PJBE 3LN5B 4X8JB 1BD2E 3NGBC 4OF6A 1A6AA 1L4IA 3BIKA 3MXWH 2FIRT 4Y5VA 4Y5XB 3TWCH 2O61A 2YA0A 2OJZH 3WL9B 1AIFA 2H9GB 2P7TA 1QHPA 5GS1B 1EHAA 5IW1A 3ZHKA 1KB5B 1I1AC 1RU9H 1QLEH 5DR5H 4OF3A 4JO3H 4E41A 5ISZD 3VD3A 4PLNC 2QL1A 1T89C 1TTUA 5JW4M 2GTWA 1D6VL 3FRPG 4X6CB 4GAYB 3PDOB 4JFDA 3L5XH 5HYSB 5JIPA 2X4UA 2N56A 2NW3A 5KG9B 2ZZUT 2P1YA 4P23C 2DQTL 1J8HE 4PG2A 4KI5D 5F88A 2CXGA 4LSRH 5IROA 2OL3B 3OKNB 4V1DB 2AEPL 5GRVL 4L3EA 2XRAH 3V0WL 5EU3A 4MHHG 1AQKH 3AY4C 5ICYB 1KJMB 3D85A 4H1LH 2NY4D 2HWZL 4QOKD 1ZMYA 3WLBB 3BFOA 4N1HB 1S7SB 5KVGL 3TN0D 1D9KD 3O45A 1H5BA 4N0YH 2Y07L 5JPNA 1G6RB 2EKJA 4LHJB 2Y7QA 4Y16C 2WUBH 5EBGA 2WIMA 4H0HB 4IS6B 5D9SB 5E56A 3L5WB 1EMTH 1ZEAL 3FZUD 1MWAB 4Y5VB 5EBMA 5CCKL 1DQJB 3RWFB 2VTFA 2XQBL 3EFDL 4ZSOB 4BSVB 2BY1A 3O3AA 1IZKA 1I7TA 1U8JB 3QFJE 2C3VB 1TJIH 2W0PA 2LTQC 1BQLL 5LKNA 4IOIA 5J3HD 5L9DL 3CDGB 2D31B 3Q1SL 5DMIH 4HMDA 1BQSA 2VN7A 3D39E 4JDZB 4Y5YC 4XP6H 3WBDA 1XCQB 3QUYA 1R5IB 1HEZB 2HJFA 1GZPA 1JWMB 3W39B 3S4SB 4JJ5B 1AXTH 5FUZL 3IFPB 3EO1A 4YXLH 4CJ1A 3FT2B 4OLZH 5HHOA 2F8OA 5EIQA 4PJDA 1KPRB 3PGDA 4HT1H 3FONA 3U7WL 2YPVL 3P77A 3D6GA 4KGJA 4LRNH 1QFPA 1CGVA 4F9PC 4WNQB 1C5CL 3HB3C 2NLJB 3KPRD 4YAQB 5KW9H 2PYEE 1ZTXH 1C12A 1LEIB 4F2MB 3D0VB 5GZND 1PKQE 4X5XB 5D5MF 2JCCF 1R5VB 3H0TB 4BH8B 3ZYJA 5DRNB 4EJ1C 3UJIH 4OLVH 2IGFH 3DROB 1JWUA 4G42B 3WN5C 3BUYB 5E8EB 3VFPA 1I8MA 5IIEA 4JRXA 2HJLA 3IETB 3RX8A 3TCLA 2BY2A 1JGVL 2DQGH 4HK0B 3KLAB 3FQXB 2VITA 2DM2A 3V6FB 3MCKA 4Z76A 3CFBB 2N4IA 5IHZB 5CZKA 4WUKH 4G5ZL 2YRLA 2WUCH 1KLUA 1AO7A 3MRRA 4Z78A 3CFEB 1DCLA 2BMKA 1NBYA 1KJVA 1FO0L 4LU5H 2OTWA 3QCUH 3UTZB 4GMTH 2IPKB 3WNOA 2NZ9C 4LCYA 3VD4A 4NO0B 4E0RB 3M17A 5KSBF 3RWDB 2W65B 2A6KB 3TBYA 1AH1A 3FO2B 1UCTA 4MJID 1F6FB 4Z7NE 4QRSA 2VLKB 3WIHH 3UP1A 4LP5A 2EICA 4FXGB 1SYVA 5H94A 3OGCB 3ORJA 4QRUA 3HG1E 2VDML 3MQIA 4J8RA 5DJ8A 3WNMA 2DICA 5TFSH 5DUBA 2R23A 2EECA 2HTLC 3FQNA 1JYXA 5KS9F 3VGEA 1IC7L 4AQ1B 4U1LA 1UM6L 4LCUA 3TV3H 1VKXA 1CXKA 5HGHA 4WTWA 3LQAC 3S37X 1MY7A 2YXMA 1ACYL 1FG9C 4FQXB 5CINH 1H0DB 1A3LH 4NC0B 1KT2A 3WDHA 4R9HA 1Z0MA 2W9DL 1BEYL 4B5EA 3NAAL 2PNDA 3D2UB 3HNSH 4UV7L 4GH7B 5C0AA 4TYUA 5C0NC 4XP4H 1NBVH 3B6SB 5JO5A 1HHHA 1OP3H 1CFQB 1XGTA 4P2RA 3IU4H 2FWOA 4GQ9H 2Y6SC 4U6VL 1HHKB 3MGAA 3E6FB 3KLHC 4WY7L 1J8HB 1ZA6A 3PV6A 4HKZA 1K85A 1FSKB 3FQRB 4LDEB 5DHVA 5CBEB 3PNWA 1XF3B 4DVBB 4LASL 3QDME 4GBXB 3S88L 1BFOA 4XVSH 2UY7A 5C07D 3SE8L 4QNPE 5EZLA 3VXSB 1QHOA 4FZ8H 3BPCB 4R4BB 1WZ1L 4E41D 1QR1A 4DQOL 4K7PH 1U91A 4JRXD 3QFJA 1HOCB 1RMFL 4R2GB 1LO2L 5CAYB 3LKSB 1Q0XH 5FHBH 3FO0H 1NJ9A 1BFVH 5IBUG 3CXDL 4NNPH 2V17H 3CVHB 3OR7B 2AXFB 4P59H 3MACH 5L2KE 2ITDB 5DJXA 1G7QA 2V7HA 4ONGL 4NJAH 4MCYA 3U0PB 4X7SH 5AD0B 3DRTB 1K4CA 5HI4D 1Z9LA 4JVWA 4LPTA 1QRNB 4O2CA 3U30B 5IOPB 3DOSA 2EEDA 3MV9E 5T33L 1IAIH 2VDLH 4ODVH 3S3SA 3KYNA 5F3HB 2D03H 4U33A 4GUPB 1FL3B 3D3VB 2YN5A 3VG9C 4BH7A 4KI5E 4Q97A 3DI3B 4POYA 4P4RB 4S2SA 3V6ZB 3MRRB 1ITBB 2O5ZH 3FFCB 5D71H 3SQOL 4K07A 4UT6H 1INEL 2DTML 3QUXB 1GRWA 2SEBB 3WS6A 4OD3L 5BOZG 1CGUA 4CKVX 4JFOA 1L6ZA 4IHOA 2E7MA 2X1WL 3RDTA 3W9EB 4ZPVA 1KJ2H 1D5BB 1TPXC 4G43A 2BOBA 4MNGB 3ZE0F 3QXVA 2EE2A 5SWSD 5CS7A 4XC1H 1Q9LB 4D94A 5JHDD 4ZFOB 4PTTB 1QLFB 1SY6A 1MCDA 3SDXB 5T1LB 3OKDB 1H8NA 3ZE0E 1WTLA 4FABL 3SEPA 1FC2D 5HYJD 1RIHL 4JHAH 4Z6AT 1KG0A 4L5FH 1Q1JL 3MUGB 3QEUB 1S7TB 3JWOH 4DKFH 2OK0L 2FEEI 3CSYA 4G6AC 5HHNA 1CICD 5D2LA 2RBLA 1HDMA 4HSQA 5F9WB 5IOPA 1A1NB 3LKNA 4S1RL 1I1RA 4X7DC 1NC2A 4HCRL 4M5YL 3DURA 4M7KL 1BP3B 1G7LA 5B38A 1YUHA 2XT1B 5J1AB 1TCRB 1UJTA 3CLEH 3EHBD 4W6WB 4I3SH 1ZKAA 3R4DA 1E4XL 3QEHB 4NOFA 5JA8B 3SN6N 1N6QH 5IV2A 5JQ6L 5FYKU 2OTWB 3MRKB 3X12B 2IH1A 3WKMH 4HIHB 5HDBE 1FZOB 3QXWA 3V0AC 2FR4A 2GQHA 1R0AL 5CEYB 2I24N 1MHEB 4N8CL 3JWNC 1YEDB 5SWZB 3REVB 2PYED 3L3HB 4NC2B 3ARED 2DQCL 5LG1A 4FQ2L 2HLAA 4XXDB 2W1NA 2CSPA 3H7LA 5I1EH 2ZJSH 3RWCB 1IAKA 4LSQH 1EEYB 1FLRH 4DN4H 4Z7UE 1JUFA 1BLNA 3K1KC 5DEGB 1H3PL 4GKZA 5I73B 1MCKA 2I26N 4WU5B 2YRZA 4YDIL 3MSPA 2D7QA 4PP2B 3UTTE 1T3FA 5HY9B 5T5NG 4EI6B 3K80A 2R15A 2VDQH 1OCWH 4OQTH 3DHMA 1PZ5A 4PTUA 3TYFA 1J1OH 3X3GH 4PRIA 5HGDA 2DQUH 3EZ8A 1AC6A 1MIEH 4NQSA 4CW1A 3BUTA 3UTOA 4GSDL 4O2EA 4YZFF 1CG9B 1D5MB 3PWPE 4PJXF 1MI5A 1MPAH 3T08A 2A73A 2D0HA 4MAUL 1RUQL 2HT3C 2XIDA 1P7QB 4FTVE 1FRGL 1KB5H 4PREA 1XF5B 4PRBA 3BP7B 1A6UL 3IXAB 4JRYD 3P9MA 3WMSA 4IDJH 2NZ9D 2VLJE 4KTEH 3H7BA 1B3JA 4GMSL 1BOGA 2BNRA 1XZ0A 3V4UH 4GLRH 3MCLL 3QIWB 5E6YA 1OWWA 3V79C 2FJFB 1FL6A 2Z9TA 5BV7H 4LP4A 2DQUL 4OQTA 1NC2B 1AD0A 4PJCA 4X5LA 4NNXA 3NA9L 2CRZA 3LV3A 3DXAB 1VFBA 3S34L 4AM0B 3GSQA 5HVGB 1IGCH 2P8MB 5SX5K 2EO1A 2O26U 1H3PH 1QSFE 1EV2E 1CLZH 1X4ZA 3QDGB 3G04B 4GW4B 5E6IC 5I8CA 3B3IA 3VDBA 5KAQG 3OJDB 3TJHC 4OD2B 1WEJL 4I18C 4M8QA 3BKJL 3PHOA 4XPAH 2OQJB 3QULA 5ILTL 1DUZB 5TPWH 4K7PX 5D72H 1Y18B 5C07E 2CLZA 3O3BA 1GOGA 3NBNA 2GTWB 1FZOA 3QH3A 4AT6A 2HA1A 1KOAA 4J7RA 3VU2A 4AIZA 4PJBA 1AGDB 4HWZB 2FO4B 2SEBA 4JREC 3BHBA 4WHDA 1FCGA 1SJXA 3GK8H 1CXIA 1BVZA 5F9JA 2ADGA 3CSBA 1YEEH 4HXBL 1RZ7L 3T0EE 5CFHA 1JFQL 1HSAB 4M3JA 3ROOA 3K2UL 3VFOB 4KWUA 3NIFE 1E4WL 1IEHA 1U3HC 2AJZA 5EA0L 5ICXB 1JGUL 3THMH 4EXPX 1FNHA 3OXSB 4LSSL 1V05A 1P4IL 2H1PH 5D6DC 4AQOA 4PTUB 2A73B 1W8NA 3I3EA 3U46A 5IB2A 3UBXA 1RZ8B 3RZWA 1FE8H 2X9WA 8FABA 5DJ6A 4HHAA 4YIQA 3C8KA 5EIIA 1K8IB 2H32A 5JR1H 2BDNH 1YDPB 4B7IA 3HG1B 3H9ZA 5MENB 1B2WL 4XVUC 1SJEA 3O6LH 1NMBH 2NTFA 5IMMB 1KN4H 2QSCL 1RQ5A 4RAUA 1X5AA 4NNYA 1QP1A 4HKJA 3OX8B 4L4TA 4XPFH 3CUPA 5EOTA 2XG4A 2ED7A 3F62A 3I3BA 4HEPG 4ORGB 4ODVL 3P77B 1MAJA 2JJSC 2R4RH 2L0DA 3DVGB 3U0WL 4JVUA 1HKLH 1H0DA 5DEFB 4AG4H 4OAWA 3VRIB 1FZMA 1MCFA 3DURB 3CDCA 5CEZD 5GGVL 2VB5A 5F96H 2E27H 4Y19B 4MQSB 2R9HC 3CZJA 2H9GA 4JPKH 4PP2A 4XAWH 1DDHB 1CLOL 5HPMB 1U8LB 3NFPA 5DURD 1C1EH 1X7QA 1DEDA 3MJ8A 1V8HA 3GB7B 5E8PB 2IANA 4KKCC 4KROD 4HS6B 4Z95H 3SDDB 4X0KA 5KSAA 4M6MH 3JBG7 5IMMA 3REVA 4RMQA 5AG9A 2E7LC 1FNSH 2AJVL 1YEHL 3O3UN 1YC8A 4Z78B 2FHCA 3CCHA 1LEGB 2VDPH 3S5LB 3IU4L 2R56L 1P2CB 3LKRA 1MF2H 4LDOB 3ABZA 4P5TA 1KBGL 3FT4A 3QUXC 2P24A 4WJ5B 1AD0B 1NBVL 2WZPD 5BJTB 3MRLB 3V6OE 3SOBL 3AREA 3RKDC 4KHXL 5EB9A 1YMMD 4F2MA 4OLXL 1JPGB 5GRUL 4JQXA 1OGTA 2AJSH 4HHAB 1A21A 4UT9L 3IFOA 4YBQD 3KYNB 4LLAA 3DXAA 4FNLH 4LQFL 1AR1C 1GC1C 4KKCD 2XQYG 3VXNB 1IMHC 1XGUB 5C0BB 1T1ZA 3KPRA 5HGAB 5AYQA 3DETC 4M6OL 4MZ2A 3QQ9C 1YJDL 5I8EA 4NQDD 1I1FB 1J11A 4XGZA 1EFQA 1URLA 4PRPE 2HFFB 2V9TA 5DJYB 4HZLA 8CGTA 2C7UA 1SYSB 3S6CA 5D1QC 3ISWA 3TZVC 1HOCA 5I19L 5DFTA 4G9FB 5CEZL 5D5MA 4OBRA 3T4AB 4Y4FB 5HYQB 4GBXC 4ZFOA 3V8OA 1UEYA 3HI5H 4AIZB 4UIMA 1BFOB 2X4SA 4X9BA 3EFFB 5JIHA 2EXYC 2H45A 5TGBB 4J12A 3QAZC 4LCWB 5C6TL 2EIDA 3VD9A 3VFPB 1CLYH 5TDPA 2X4TB 1B0RB 3J7HA 3VRJA 3DUSB 4ODUB 1K2DA 3K4ZA 2XA8H 2IGFL 3KLAA 2PYFA 5E2TH 4OCNC 2DN7A 2B1HL 4EN3A 4R7DA 2DQDH 4GJTB 4AY0A 3ULUE 2RB8A 4CU6A 3QIUC 2XQYK 3U0PA 3LOWA 3TT1H 5IV2B 1MCHA 4XVTH 3D2UA 5GJSL 3LH2L 3T0WA 5JW4Q 4KROB 1BJ1H 3U7WH 4NM8H 5KOVC 5IJVA 3DO3A 3NCYP 1NDGB 1IKFH 1JNHA 4AJ0A 3STZA 4XVTL 1S7UB 1PYWA 3NCFB 4G3YL 1HSAA 3NPSB 3NFNA 4MLSA 1FL5A 2IPKA 4CNIA 2HFGL 3UJJH 5BQ7B 4HJJL 1KG0B 3R06B 5BRZB 4IRJD 4B41A 5B8CC 5J06A 4QOKB 1VEPA 3FRUA 4GAGH 2UZXB 1WIOA 5CHNA 2RGSA 5DJZA 3NMEA 1TQBC 4LF3A 1A1NA 4LAJH 3OB8A 5E9DB