3CFKB

Crystal structure of catalytic elimination antibody 34e4, triclinic crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
224
structure length
224
Chain Sequence
b'EVKLLESGGGLAQPGGSLKLSCAASGFDFRRYWMTWVRQAPGKGLEWIGEINPDSRTINYMPSLKDKFIISRDNAKNSLYLQLSRLRSEDSALYYCVRLDFDVYNHYYVLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized prot
publication title Conformational isomerism can limit antibody catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 40
structure length 224
sequence length 224
chains with identical sequence D, F, H, I, K, N, P
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfkB01
5CD3A 1WEJH 4JFEE 1EBAA 4LLUA 4DZBB 4Y5VA 4RZCA 1PKQB 2DWEA 1OAKL 4JO4H 3PHQA 3SDCC 3CLEL 3Q6GL 1D9KA 5EC1B 1HKLH 1WBXA 3O6LL 3VXRA 4RGMB 3S88H 5JMOC 1EHLL 2NY4C 1TTFA 3UDWA 1QFWI 4HUMB 4RAHA 1MCQA 3MGTA 5E8EA 2X44D 4MJIA 5TQ2H 4PJ7A 3IF1B 4TNVK 5DGRA 2YRZA 4Z7QF 2R1YA 2NTFA 1N59A 4G7VL 3MLYL 4JJHA 5I1GH 3PP4H 5EBLA 1KN4L 1NBVH 4PJCE 1GAFH 4S1QL 2VUYA 4PUBL 3RUGE 1ZT1B 2B1AL 5FM5M 2FZ3A 5GJSL 1KG0B 3CFJA 3MXWH 4P3DB 1FSKB 2G60L 2MHAA 1EHAA 1TIUA 2CKBH 3HUJA 1YEEH 4JFFA 4JR9L 4GAJL 4XXCA 4FA8A 3RTQB 1EFXB 3ILPB 5C9JB 4X5LA 2FWOB 3C6LA 4XCEA 4I3GA 3BRFA 3WL9B 3STBA 3QJFB 5ACLA 4OSUH 2JJTA 2HKHL 3BXNA 3TJEL 3VCLA 1H0DA 3FFCB 4BM7A 2OXHA 3EO1B 4AEFA 3FOLB 3VFPA 4N5EC 1BGXL 3GMNB 2DQTH 2EYSA 4P2OC 1SVZA 3G9AB 5ALBH 5FA4B 4J3SA 1HILB 2OJEA 4DKFH 1DLFH 2W0FA 3GBNL 2PYEE 2FX8L 4Q6IC 3MJ6A 1CTNA 3BGMA 5CP3A 4KROC 4MDIB 1QHPA 1ODAA 2OBGA 1R3IL 2EDBA 4YUEH 2P42B 2B0SL 4PJHE 4X4ME 3RL1B 3VXSE 2HN7A 2O61A 4N68A 4NT6B 3C5SA 1Q0YL 1D5IH 3ETBF 4OI9A 2P8MB 3UTTD 4S1SL 4XMLL 1ZLUK 2ZCLL 3QQNA 4NNPL 4HIEB 3ARVA 5T1DL 4PJFF 3O6FD 5GGSB 4XVJL 1CGSL 3PQYB 4JFQB 3QIUB 3QNYB 1E27A 3GFUA 4HFWB 1KFAL 1XT5A 4Q9QL 4DKEH 2IGFL 4H26A 1U36A 4P3WA 2EDWA 3G5XA 1VERA 1NFDF 1R3LB 4M93B 2W60B 3UJIL 3PWVA 2MPAH 1CLZL 3F7YA 1T6WA 1XCQA 5AG8A 3SCMC 3GSNH 4HEPG 3TPUA 3KNBA 4Q7DA 1CLOH 2QSCL 5DJDA 2CLVA 1QR1A 2YD1A 5IFJA 2Q8AH 3NIFF 3S34H 4XPBL 3BEVB 2AJYH 5BXFB 4G9FA 2ZG3A 1WBZA 2CD0A 4QKXB 5J7CC 3D1MC 1B4JL 4PJEF 4NQEE 3QBTB 3T3MF 5IF0A 1WIUA 1WWBX 1JHKL 2FECL 3EO0B 3SE4C 2PW2A 2A9NH 3U7WH 1CL7H 5I75C 4PJDB 5E03A 1T20A 4WHCA 1M1SA 1Z9OA 5DVKA 3V4VH 2AV7B 5D1XA 3B5GA 5L2KB 3SDAC 2J4WL 1MLBA 2AJVH 1OP5H 3GMLB 2BSTB 5HI5D 3VD3A 3TESA 3O2DL 2EKJA 2FYYA 2V2WB 1HSAA 2DJUA 1R5WB 2Y7QA 1ZLVH 2DLFH 3GSUA 1TPXB 3NIGF 3IKKA 1KGCE 5MERB 5TH2B 4XWOC 4WWID 2VOTA 5DK0A 2X4SA 4OD1H 4PJFA 1F4HA 2XKNA 2PR4L 3TCLA 3U1SL 4NN7C 5JOFB 2DYPA 5SX5H 4HC1L 4Y4FC 1ND0A 3V4PH 4HUNB 1MFEL 3SKNB 2V9QA 5TDNA 5CLWA 2FX9H 2A77H 5D7JD 1ACZA 2NNAA 1NGPL 4LIQL 5C0CA 1NFDA 1LMKA 4LNVA 2CRMA 2J88H 1IQWH 3KPLA 3F12A 1UM4L 3NIDE 4GAGL 1FZKB 2HTLD 3VD9A 4GG6B 2QQKH 2QSVA 4JG0H 3F5WB 3X13A 3D18A 5KTEL 1S7WA 1INEL 1L6XA 4X7TA 5CEYA 3D85B 5EO1B 3V7MA 4PJEA 4HWBH 1L0YA 2M26A 4TVPL 5DC0A 5T33L 1NKRA 3CXDL 4I18A 3H3PL 3E6FA 2XN9E 4NKMA 5T3ZH 4OAWA 1Y6KR 4GW5A 3KYOA 4M8QB 3BH8B 4R3SB 1MELA 3KPSB 1RAMA 4ZXBA 2OZ4L 2FDBP 1R6VA 2AXFA 3WFHB 4F9PA 4S1RL 4DGVL 5I1JL 3QQ9C 3DXAA 3VGEA 4RMVA 4ELME 4F15C 2X1QA 4OCXH 3UBXA 2W0PA 1SEBB 5IBLD 1U93B 3MRBB 1JF6A 4NFDA 1T1YB 4JY6A 4N0FB 4XXDB 1RUMH 3JBG7 4XH2B 3BKJH 3OPZH 2RQ8A 4OQTH 4LLWB 4YBHA 5HYSB 1QRNA 3X3GH 1JP5A 3VXMD 3MBXH 1JBJA 2NY4B 4I0KA 2IFGA 5FHBH 4KZDL 2ADFL 3F8UB 1IGTB 4Z95L 3MRPB 5LBSH 3DUUB 4U1SA 2NY0D 4V1DD 2XA8H 5L88L 5FEBA 4LKXB 2FATL 1MJ8H 5GS0D 3SJVA 5J1AA 3V6OC 3BH9B 3CZJA 1DP0A 4I9WE 2C9AA 4PRAA 2BNRE 4LSQH 2QKIB 3ZTNH 5JORB 4F57H 5IMLB 1JGDB 2AJUL 2WUBH 3TH4T 4GAYA 4NRZB 1MUJB 5I1LA 5IOPB 5GS2D 4H5SB 4IIQA 1BF2A 3CH8A 2QQNL 5E2WH 2OR8A 2XTJC 1MWAH 3VGFA 1CZ8H 1D9KD 3LEVH 2VE6A 5DYOA 3MZTA 3MUGB 5MEOB 4KQ4L 4KMLB 1CD1A 3MRDB 5FB8A 5J6HB 3AAZA 3DV6A 3DO7B 1OD9A 1J86A 4ZDHA 3H3BC 3TM6A 4MJID 4JPIA 3VXPB 5C0AE 5IG7B 3K4DA 3ZYJA 1GOFA 3DX7B 1QD0A 3STZA 4PB0L 4M1DH 4JJ5A 3IDJB 1D5ZA 1U3YA 3HLAB 3ULUC 2WBWB 1X4XA 2XKUA 3NA9L 4PY7A 1NC4D 2Z31D 4KVNH 3ZDXF 1S7VA 3FT2A 4JVWA 1J10A 4P2OB 1FVCA 3BYYA 1KNOA 4IHOA 3QDJA 4ZS7H 4G6JH 3DBXA 2OK0L 2OX5A 1H5BA 5JIIA 2GSIB 4YHKH 1FVDA 2ZSWA 2VO5A 1SM3H 4KROB 5HI4C 4ORGB 1KXVC 5CEZH 3FRUA 2F15A 1UACL 4RNRB 5I8OL 2VL5B 4NUJA 1VESA 1T4KA 4NKQB 3AY4C 1MFCH 3LHPL 4ISVA 5BOZG 2EC9U 4JZJB 5INCA 5CBEA 5IT2L 2ICWA 3TN0D 3D25B 3VRIA 3H7BB 1A2YB 4M7ZC 5KZCB 4NQCA 5FHAH 5ICXA 4ZTOH 3OXSA 3QIBD 5JW3L 2DJ4A 3G08A 1K9TA 4K8RH 4DCQB 1FIGL 2YPVL 3GJFH 5KOVC 1JNNH 5AAMA 4WTXA 2DQHL 1LO2L 1ZVYA 4WO4C 5DD6B 3IJSA 3WLBA 1BD2A 2X9WA 3O3UN 1AGBB 3PGFH 4Y5XA 3SCMB 1BX2B 2XFXB 5DA4A 3D0LA 5DK2A 1I1RA 1OARL 4LHUB 1FNEB 1Z3GH 4QT5A 4PRBB 3AUVA 1AHWC 2BHZA 3MCLL 5F7YC 3QI9A 1MFBH 4PLJD 5IMKA 2IANA 1A9EA 1CXEA 1X5AA 1D5MB 5CD5D 3K2UH 1MAML 4BSVB 4HUWA 3IRPX 4IMKC 5B4MC 1VKXB 1XR8A 3HNSH 4OLWH 4P5MB 1PX3A 2LV4A 5A3ID 1KLGB 2GJ6A 4YJZL 5ICYA 4G43A 5KS9E 2BVOB 3CDYA 1B0RB 5DDHB 5KG9A 4ZAKA 1P4IL 1R3KB 2Z92B 1XF4A 5I75B 3ZT5A 3S36H 3OX8B 5GGQL 1S9VB 3H2WA 4HIIB 1TCRB 2H41A 1T21A 3MRIA 4H88L 3TIEA 1VPOH 2YPKB 3SKOA 2WZPD 2WIIB 1FV1B 1NEUA 2X4UA 3V6ZA 5EBMA 4YHIB 3RWGA 3QUXC 2K7QA 5CJOH 4KMTL 5FO7B 3RKDD 3VXTB 1OP3H 4ODUA 2YD2A 3KXFA 4FFYL 5D1ZC 1N64L 3MC0A 1BM3H 3QHZH 1MNUH 4PTTA 3EOTL 5T3ZE 4TQEL 1WZKA 5LGHH 1ZHNB 1AKJD 4NN7B 1BOYA 1SMAA 5D1QC 4FXGA 3VXUA 4FQJH 1QP1A 2NW3B 5EUKB 3ZYZA 4U6XB 4UB0H 1MJUH 4K3EH 5GZOC 4MB3A 5LWYL 1N6VA 3PHSA 3KYMA 3VGGA 1CXHA 3EJYC 4KXZH 4DN3L 5HVWA 4WWKB 4UTBH 4NZRL 3RIAK 2EZ0D 2G9HB 1FNSL 4Q2ZA 1INDH 2ESVB 1P9MA 2ZCHL 2GFBB 4QRSB 2EDHA 2E7LC 5AWNH 1GC1C 4AM0B 1PG7X 1EEZB 4JFOB 5GSVA 5E56A 3WIHH 3FONA 4W4OC 4W4NA 2GITB 3MJ9L 3T4YB 2ZSVB 3LB6C 3W39B 2A74A 1CICA 2CLZB 3OKEB 2NY6C 3F7VA 2E7MA 1RZFH 5LGJA 1G0XA 4M00A 4MNQA 2Y25A 4AH2A 1V3KA 5BZWB 1NGQH 1UZ8B 2DYPD 5ESVA 1NGXA 2CK0H 2Y6SD 4WU7A 3SGEI 1S7RA 5JZ7C 1ZA3B 1LO3L 2DD8H 1A3LH 3CMGA 4HJGA 5IK3A 1DFBL 3SY0A 2V7NB 5CP7B 4WEMB 3X3FL 3O6FC 1N0XH 4D0DA 5HY9B 5I17A 3VGHA 1NUNB 1VFMA 3ZHDA 4F15B 1Q8MA 1MHEA 2G5RA 4F58L 5K9OA 4I5BA 4U1HB 1HHJB 4BZYA 2YRLA 2I07A 3O9WC 2V2TB 2P4AB 3EYVB 7FABH 1GIGH 3QJHB 2NY7H 4NYLB 3CPLA 1A6VL 3TJHC 3WFBH 3WNOA 3O6ML 1BREA 3KPMA 1XFPA 2EDOA 3IFLL 3R4DA 4IRSA 2XQYG 4L9DA 3U36A 3OGCA 5FGSA 3MV7A 4ZXBD 5B3NA 3KPTA 4R4BB 4HKZA 5HHMD 4LL9A 5GHWL 3H9SB 3G5VA 5EZJA 1IEAB 2ARJA 1UH4A 4ODTH 3NFNB 4C56B 4OTXH 1SBSL 2DWDB 1F45A 1A7NH 2Z91A 1UCBH 4YDJA 1ZVHA 4LGSB 4OM0H 3AMKA 2XTJB 4QRRB 2FECI 1KIQB 1V7ML 3TCXA 2VH5H 2VXUH 3MGOA 3P40A 2H26A 4QHMA 3KHQA 3BN9D 1YY9D 4M1GH 3VFVA 1A6UL 4WUUA 5IHUH 4P23C 2OS7A 3ARDA 3OJ2C 4ZUVA 1BFSA 2ZJSL 5JW4Q 1EA9C 2XZAL 3KDMB 3I84A 1GCFA 4X8XA 5TFSH 4ODVH 5HVFB 2M1KA 4XP6H 5FCUH 3PNWB 2VABA 3B2VL 3M1BB 1RUKL 5DD1H 3S6CA 3VWKC 3FL7A 2OTUA 5HGAA 3O0RH 4GKZB 5CSGA 2IAMA 2H9GA 4HPYL 2ZZUT 3OAYK 5E5MA 1TJIH 4FQXC 1D5XB 2QADD 4QRPA 5HHPB 1F00I 1U2CA 1TNMA 1S7UB 4W81A 4X9BA 1CD9B 4YE4L 2I27N 1FE8H 1C08B 5E00B 4X6FB 3D48R 5DHVA 5D6CB 5AYUH 1EJOH 1NJ9B 3L6FB 3VH8G 1BQLH 1JV5B 4QTHB 5IVZA 4EDWH 1QYGL 3PXHA 5I0ZA 3FN3A 4KUCF 3IAGC 2AVGA 2JK5B 2W07A 1OGTA 1EFQA 3GSXA 4YHZH 5I1EL 2QHRH 3PV7A 1OAXL 3M17B 3WKML 4NPYA 3ZSSA 5GGVH 2CDEA 3FHAA 1GC1L 4PRIB 4WO4B 5DK3A 1RZ8B 3HNVH 1A1NA 1I7ZA 4PJ8A 3LDBB 4CU8A 2J8OA 2P47B 1JK8A 3C2AH 2APFA 2ITCB 3IDYB 3PIQB 1AHWB 3AS3A 3DYPA 5EU7C 4LVNB 5K9JL 2R2EB 1MSPA 4KK8D 1FVEB 5FECB 1NGWA 4QGYA 1U8QB 1H3VA 3QO1B 1A7QL 1X5LA 1L7TL 4Z7OE 3MNVB 2H32B 3QFJD 4G9DA 4JQIH 3W11D 5EOQL 4JQVC 2YWZA 4ZPTA 3WUZA 1W0WB 3C5ZA 5GRZA 3PGCA 2NPLX 1TVDA 3CZFA 4NQCD 1EHNA 1MREL 4O2CB 4OFVA 4X9FA 4QY8B 1P2CA 1INQB 1LEGA 4S1DD 2P45B 3QCUL 5CJ8A 4H0GA 3DROB 3QEGH 4DEPB 2DTSA 4Z7UF 3T0EE 2IPUK 2XT1B 2X4QB 1YN7A 3MRHA 3QUXB 4Y88A 1DQDL 3HG1E 5EPMB 3QDMA 5IROA 3QI9D 3C9NA 5DJYA 4OLVL 1P7QD 4Y5VC 2YC1A 2EYRB 4LCWE 3SGJA 1SEQL 2RGSA 1NUFA 4HUVA 4QCIB 2UUDK 3IXAB 3CSYB 5F7MC 2IC2A 2VDRH 1MJ7L 4ZAKD 5E2VH 1IGIH 2EDQA 4PRPD 4KHXH 3GJEB 1TETL 3UDWC 1OSZA 1WBYB 1UB6A 2B4CC 1CDUA 4ZMAT 1NGZA 5DJ2A 1QO3A 5GJTL 2X4RB 1GGBL 3RVXC 2EDJA 4XNYL 1RJYB 4ZUWB 3BKMH 3NZ8B 4DZ8A 5E8PA 4YDKH 4OKVA 1EEQA 2FL5B 5EZLB 3LSOB 3KXFD 5TE6L 2FO4A 4P9HH 5F96H 4YPJA 1M05A 4IS6A 1CFNA 3PWLA 3RFZC 3U6RA 1F2QA 3JTTA 2DL2A 1JHTB 4TSCH 3BT2L 4XXCC 3FZUD 1WZMA 2NW2A 1R5IB 3MZGB 3GSVB 1KIPA 4NCC2 4GW1B 3C6LC 4KV5F 3GMPB 1SY6L 5C0EA 1J05B 4JO1H 5DXWA 1JRHI 2NX5A 2AJ3A 4XMPH 2JJTC 4N0YH 3QUZA 4NZTL 4D9QE 4YFLF 4RSVA 1E4XL 1RFDL 1H3UA 3SE9H 2FEEL 3NCFB 1JE6A 1YNTA 2IBBA 5JR1H 1OD7A 4YO0A 4BFGA 3PGDB 2AI0H 3QQ3B 3DETC 1OPGH 1R24A 3O9WB 3MV8E 5DUML 4FTVE 4ZUSA 1KXQE 2VZUA 1QQDA 5K9QI 5SWSA 3MLZH 5F9JB 2ZPKL 5E0QA 3BMWA 1FFPA 1QNZL 4WW1A 1S5IH 4Z6AT 2KL6A 4EZMA 4U0RC 1JZ5A 3WJLA 2CDFA 5CAYB 1UT9A 3LPGA 5MENE 4W6YB 5CGMA 1ORSB 3UJTH 3MV11 4PJHF 1CN4A 4HS8H 5DVLA 2J3SA 2F54B 2NXZD 4HAFA 3GKWH 5JQHC 4XPAL 4U4BA 2Z4QB 1ZGLM 2F53B 3HRPA 2AEPL 2VLKA 4QEGA 2YD6A 1S7QB 2BDNL 1DBJH 4OCLC 2IBGA 3BKCL 1ITBB 4M61B 2VUOA 3ARFD 1PKQE 3BUYB 2VN7A 4ONGL 5D2LF 5F9OH 4KDVA 3BQUD 1JI2A 4P23B 5T1KB 4M7JH 5DRZA 4R4ND 3D2UA 3D3VA 2UVEA 1AGEB 3MFFB 5KW9L 4KI5F 3UMTA 3QWOA 3QCTH 1A6AB 1KC5L 4JM4L 5JPMB 1GPOH 3NCJH 5J3HD 4Z77B 3V4UH 4R7DB 4CNIA 1HWGB 3I6LD 1YEIL 3RDTA 4P2RB 1FYTA 3IDNA 4PV8B 2KH2B 2WQ8A 5T1LD 5C0RL 4FQIL 4FQXB 5DQ9A 5C0GB 1HYSC 2IWGA 1UXWB 4XHJC 4RGNB 1T1WB 3CC5A 4KDTA 2KQNA 3U9PL 1ULVA 1I1AD 2XWBB 2BFVL 4G8IB 5D1XC 1MHCB 2BVQB 1EVTC 1VGKB 5C8JB 4CVXA 1F6AA 3IKCA 4L4VA 3QCVH 4UNVA 5DMJB 1IILE 4JFDD 4EQ2A 4TTDD 4WUUD 3ARDD 5J9PB 1I8LA 2B4CL 1NC2B 5EIVA 1K5NB 4K2UL 1QFPA 2FJGA 4CJ0A 4K3JH 4M5ZH 2PYEA 3VGAC 5EWIL 4ZFGL 3ZE1F 5C2UB 1IC1A 4Q6YA 2V5SA 5HDBE 4R90L 3C8DA 3L3IA 5DRNB 1JPFB 4ZYKB 2BC4B 5DJZB 4PJHA 2XWJB 4JY4A 3IETA 4J4PA 3QA3A 4HXBL 3JWOH 4D9LH 1PLGL 2X1WL 3KR3H 1LD9A 3FFCE 4X6CB 1FLTX 3GMMB 3EGSA 1BBDH 1NLDL 5FUOH 3HR5A 3S37X 1YN6A 1YMMB 5E8OA 5C07B 3QEQA 3TBVA 4PG2A 2LAAA 5CEXA 4HCRH 5D2LA 5DUBB 5JHLL 3TGXA 4TUOB 4RX4A 4M7LL 5H94A 1NKOA 1XGQA 3LEYH 3C60D 2PCPA 3WCYA 4BYHA 3ORJA 1IJ9A 5FO8A 3FMGH 2I9TA 1A4JB 5EN2A 2YPLB 4R26L 5JDSB 4EN3D 2R9HC 3GIZH 4XPHL 4HS6B 3VFOA 4NQUA 3HC0B 3HE6A 3JVGA 2HT4C 4I18C 1HIML 3FO1B 2VLLB 4Z0XA 4G80A 3PWNA 4NBXB 4DK3A 1DE4B 3PQYE 4G8GD 1J8HA 5BS0D 3MCKB 4QHKI 4XVSH 1MCRA 1LE5B 1Q1JL 5IUSA 3LKQB 4NJAL 4F9PC 2P5EB 1W72B 1LNUB 1WFOA 5T5FL 5CD3B 1UM6L 1CU4H 3GK8H 4XCFL 4LLUB 1C12A 1UWEH 3QRFM 5LQBH 2DWEB 4HT1H 3BFOA 3B9AA 3PHQB 1WT5A 4FZEL 1ACYL 4J6RL 4YIQA 1RZJC 3M07A 1MFDL 5DRWB 5I76A 4ELMF 1WBXB 3HC3L 3VXRB 1E6JL 5DMKA 3VG0H 1LP9B 1UYWL 1B0GA 3MGTB 5E8EB 1TENA 5F7WC 4PJ7B 4MVBD 1MFNA 2R1YB 3FJTA 4M6MH 2NXYB 4PJDE 4DQOL 1N59B 2EYTA 1YZZA 1QVOB 4YH6A 4M7KH 4NWTH 4HK3J 4TNWK 2CXGA 5EBLB 4PGEA 5C09E 1YC7A 1I1YA 5C70A 4OD2A 2VSCA 2Q6WA 1FZMB 5L2KE 1HCFX 1JTOA 4YXLL 2FZ3B 2QADC 3CFJB 2GTWA 5C0DA 1FC1A 2MHAB 4IIQC 5BRZB 3HUJB 4JFFB 4KUCD 5IM7A 4MLSA 3BJLA 2O5YL 1KJMA 1NMBH 5KOMC 3C6LB 2NCMA 4HBCH 4XCEB 3SO3C 1AXIB 2FX7H 3ABZA 2GHWB 3BAEH 4XVTH 5MHSD 2EXWC 3BXNB 2NLJA 1P4LA 2HH0H 2I9LA 3EDDA 3VCLB 4EIGB 4RWYH 1H0DB 1DN2A 4GAFB 4QWWC 2W91A 5F1NA 3VFPB 4UV4L 1T22B 2EYSB 3N1MC 5D7LE 5C0IB 1XGRA 4G7YL 2E9BA 3GBML 1IZJA 2YN3A 2OJEB 1XZ0A 5F7DB 4KRLB 1QFHA 3WN5B 1W0YT 4GG6E 1H5BC 3BGMB 1TFHA 1HOCB 3ARBA 4ELMA 1OLLA 1NCCL 3CSBA 3NFSH 2HN7B 4HIJA 2XG4A 1K8DB 4U0RB 4MYWB 5KSVA 5CJ5A 2A9ML 3LZFH 2NX5D 4XPGH 5JXAH 2YS4A 2BOCB 2C4XA 4YDIH 3QUZD 5EDXA 3UTZB 4MQTB 4P0DA 5J06A 4BFIA 4KJQD 1MCPL 3HI6H 4XBPA 4JREB 1NCDH 3GMRB 4OGZA 5D96C 4UQ3A 2Y1VA 3QG7L 1CXIA 1D6VH 2DQIL 4LNRA 4X9IA 2L7UA 4H26B 3MLVL 3WLWD 3P9LB 3NPSC 3RI5F 3ULVD 3QNXA 5IR1B 3P2TA 4S1DC 1RU9H 2HKFL 2D4FA 2OL3B 4DVBA 1DTUA 1XCQB 3E8UH 4QYOB 4Y5XC 1CR9H 5D7SH 1OAZH 1ZLWK 1HXMA 3TPUB 1UJTA 1MCCA 4B7LA 5DJDB 4XVUD 2CLVB 2EH7L 4XGZA 1QR1B 5IFJB 4JFED 4CMHC 4JZOB 4POUB 3QI9C 4OLXL 1LE9A 1JPSL 1UQSA 4ONHA 3DMMB 3KJ6H 4G9FB 1FBIL 1UWGH 2BNQA 1WBZB 5TE4L 2CUHA 4JQXA 4ZODA 1UH3A 1JPST 2QQLH 3TEUA 4YLQT 5IF0B 1F3JA 1AQKH 4ZAKC 2PW2B 1NFKA 1Q9WA 4QXUL 5CLTA 5BW7A 3TA3B 1T20B 2W9DH 5EO0A 3DUHA 4X0KA 4HUKB 5IV2A 4EXPX 4IDJH 5C0AA 2WLZA 3WHXA 1HHGA 4MJ5B 1KTDA 5D1XB 1RZJL 3W0WE 5GGTH 1MLBB 2VDPH 3VMNA 4UT7L 2FYYB 3B9KD 3GSNA 4KVCL 2VQ1A 2Y7QB 3GDBA 3ULSA 3O8XD 2EDRA 3G5YA 1B6UA 1CDGA 4PLKD 1AI1H 3QUYB 2AGJL 3CVIL 4IRJA 2F5AH 2P1YA 3LIZH 4FQ2H 4G42A 2X4SB 4YDVA 4PJFB 4RGOH 5T3XH 2XKNB 3FZUC 1ZT4B 3KPRB 3TCLB 5IIEA 4GS7C 1S9YA 2XXMB 4NC1C 1ND0B 5HHOE 4ONFH 1CFQB 3IS0X 2P5WA 2Y36H 1ZANH 4LSTH 1KLFA 3CH1B 4MS8D 1JCKA 3TNMA 4PGDA 2NNAB 2VZOA 1LK3L 4YHPA 1CLCA 1NFDB 5C0CB 5DURD 1P6FA 3MRNA 3QDGB 2R4SH 2P49B 4JPKH 3KPLB 3F12B 1AR1D 1J8KA 1JWMB 3KPNB 1ZLSL 1XR9B 4X5WA 1P9MC 5J13C 1JNJA 1Q9OA 2HT2D 4MNGB 3GMQB 3JV5A 2QSTA 1R3HA 3FB8B 3EJJX 3T77A 3X13B 3CD4A 2NY2D 1E4XI 3D18B 1S7WB 3QO0B 1CICC 2FEEI 35C8L 4DAGH 4U1JA 1MIMH 5DJ8B 1UWXK 4PJEB 2ZOKA 1RZGA 5J1TC 2EE9A 3GZKA 1D6EB 4R97C 3BX7C 5IB1A 3VXSD 4HZAA 4H0HB 1EERB 1IAKA 4NKMB 2D0HA 4GW5B 3LKOA 3KYOB 3P0VL 1PAMA 4FFWC 3QRGL 4F2MA 2APXA 4XCNA 2CMRH 5L8JB 3EYOA 2AXFB 4AMKL 4PREA 4U3XA 1AD9A 2CIKA 3O81A 4NO5B 5F7HA 3DXAB 2BY3A 5F44A 2NXZC 3VFWA 3UBXB 4ZQKA 4JGMA 5GRVL 4POZC 4Y7MA 3TV3H 4NWUL 4RX4D 1BHGA 2DM4A 2XOTA 4MMXC 3E3QE 4JY6B 5GRJL 1CD8A 1CFVL 2WQRA 2J7LA 3N9GH 1RHFA 4O4YH 1EX0A 3FN0H 1A3RL 1A4KA 2OLDA 1QRNB 1QBAA 3F62A 5JW5A 2JCCB 3PWUB 4PGZA 3MRJA 2P7TA 1OGAA 4HWBA 3EJZD 4D3CH 3VWJD 5KSAB 3EYQC 4IRSC 5C9KA 2C3VA 4UIKH 5ALCH 1D5BA 4OIAA 1EPFA 1ADQH 3RL2A 5J1AB 1J1PL 1N4XL 4XAWL 1ZLUH 4NQED 1TVBA 1EXUA 4JKLA 4MA1C 3ES6A 4PRAB 5J3HC 5F70A 3ARED 1IBGH 2IQ9H 2DIJA 1KYOJ 3MRCB 4XWGL 4FS0A 5JO5A 1F8TL 2YOCA 5KVDL 2WAHA 3UTSB 1S8DA 1OTTD 1ZHLA 2HFEA 4CKVX 4ERSH 4OM1H 5CSBA 5I1LB 4GLRI 3IVKA 3V0WL 3N50A 4I3SL 2H2SC 1KBGH 4V2CB 4FRWA 3TZVA 4FFVC 1QSEB 4Y0GA 2VE6B 5DYOB 4NP4H 4RAUB 1CD1B 4HH9A 2OMBA 5FB8B 4AIZA 2ORBH 3AAZB 2W0LA 3R8BB 4OQTA 1LVEA 2NY3C 3SO3B 2G5BA 3OF6D 3ROOB 4RIRB 1AR2A 2DM7A 3C2SA 1KGCD 1IMHC 2K7PA 3STZB 6FABH 1X5XA 4JJ5B 2H32H 4F7EA 1D5ZB 2NTSP 5ESAB 2FD6H 1A7PH 5DEZA 4AK1A 5JPNA 2IAMC 3TF7C 4PY7B 1S7VB 2DS4A 2CXKA 3FT2B 4KQ3H 4NUGH 4ODHL 5DWUL 1FVCB 1KNOB 1T3FA 3ALPA 1CI5A 2M2DA 3TYGL 3BISA 2BRRH 3QDJB 3TC9A 3VXNB 3DBXB 1UA6L 2ESVE 5FUCE 1H5BB 4Y4KA 5C0BB 4E0RA 4GKSB 1FVDB 2ZSWB 4CN4A 1O7SA 3KYKL 1MWAA 1LWRA 1U8KB 1N8ZA 3MLTA 1K8IA 4UTAH 2LVCA 1OCWL 1BEYL 4XP4H 3T04D 4LSUL 4ISVB 4QO1A 3VXOB 4APQD 1JN6B 3GBLA 4W6WB 5GRXG 5INCB 3T1FA 2HFFB 4D0BA 2R29L 3RZCA 3VRIB 1U8OA 3QPQC 5CBAA 5HVHC 4LRNL 5ICXB 3OXSB 3STLA 5CUSL 3G08B 3NPSB 2XN9D 4JFHE 4QXTA 1Z2KA 4PJ8C 4BKLB 4Y5XB 1MHHA 3BSZL 4DVRL 4CMHB 5T3XE 2IANB 1A9EB 3PWJA 2BXZA 1XGYL 1CDHA 2YD3A 4CDGC 2GT9B 5E2UL 3PJSB 4HUWB 1G7IB 2QEJA 3WFEL 3P0YL 4G43B 4NO0D 1V3LA 3BPCA 3R06A 5ADOL 2MCPH 3KYNB 3C5ZC 4HK3N 3S5LG 5ADPL 3V6OE 4Z7OF 3P11H 5B3JE 1T21B 3MRIB 3H9SE 3TIEB 1URLA 4ZNCD 3SKOB 2AJSH 1YNKL 3GJFA 4KWUA 3V6ZB 4C56E 5HPMA 1G9NH 4EI6A 3RWGB 3T0XA 4I9WD 4AENA 4FFZH 3VFGL 2BNRD 2L4OA 4Y8DC 2XTJE 4ODUB 5IROC 1RUQL 1BIHA 4M6NL 3FTGA 3SGJC 2FB4H 4PTTB 1KCSH 2IBZX 2XY1A 5I73C 3GSRB 1DSFL 4JLRB 3G6JF 4ETQA 5F7UA 5DQJA 2R2HA 2R56L 4GS7B 2VQUA 2C5DC 3QNZB 2DF3A 2QSQA 4FXGB 3VXUB 3LY6A 4R6UA 3WO3B 2WWMC 4QNPF 2PNDA 3ULUE 2DQUL 1F11B 5FYJU 2X1OA 1LEKA 2OTWB 5C0AD 5IB4A 4OGYH 3KYMB 3KYAA 4HZLA 1FCCA 1X3DA 5I74B 5F3BA 4JANA 2C1PB 4Q2ZB 5CGYC 5J13B 2Y07H 1Q9LB 5TPWH 1XGTA 2X05A 3SDDA 3E6HA 2C4FU 5GSVB 4K23H 5ANMA 2H2PC 3FONB 1SYSA 4YZFF 4Z76A 4PTUA 1AGFB 3WS6A 1SJEB 1CICB 2XQBH 3F7VB 1DUYA 5LGJB 1T5WA 3G9VA 1N0LA 4LVHC 1DVFD 1XF1A 4K7FA 3ZE2F 1JGVH 5ESVB 1NGXB 1VFAB 3CFEA 1S7RB 4XNUH 2F19H 3MNWA 4XAKE 1B9ZA 3OHXA 5IK3B 5BZDA 4LFHD 1F3DJ 3BPOB 5HDOA 4D0DB 4PRIE 1RIVL 5KVFL 2X40A 3PDOA 3UTQA 1MHEB 4I5BB 3LVEA 1A6ZB 1RJZA 3WLWC 3RIFK 2I07B 2GY5A 2D03H 4PRDA 2VDNH 2OSLA 2EDXA 2NY1C 3WIHA 1MFAL 4U1GC 4OB5H 3DIFA 3G6JA 3CPLB 4OBRA 2JB5L 3OR7A 2ICCA 3NAAH 1QBLL 4NJ9L 1NCAH 5E6IA 4D8PA 4HS3A 2YEZB 5FYLE 2FHFA 3O3BA 4MQ7A 1FZOA 4UUJA 3V0VA 1GHFH 2VR9A 4IRSB 3RGVD 1X5KA 2YMXH 4OFPA 3O6KH 3OGCB 3WJLC 3MV7B 2OI9B 2ADGA 4UZGA 4HKZB 1NAMH 5E08L 3ZZ1A 3CFBA 5ACZA 2IH1A 2PXYA 1N7ML 3ARWA 3G5VB 3INUH 4WI8A 2XKSA 1KCUH 5EZJB 3FN9A 4X4XB 5CJXA 2ARJB 1A1OA 4CN1A 4D9RE 1G9MH 3VRLE 3F65A 4UNUA 2E5EA 1IC7H 2HTKC 1CE1L 2P43B 4FQCH 3WSQH 3C5JA 5HJ3A 1NCBL 1VHPA 4JB9H 4EOWH 4JDVA 3RHWF 3U30C 3BKYL 2H26B 4QHMB 4GQ9L 4JHAH 5AG9A 3VFVB 3IU4H 4KHTH 1WQVT 2NY3B 4N90E 3DO3A 1M71B 2PUQT 5E8NB 4XZUA 1AH1A 4UOW0 5DLMH 1QLEH 2VABB 4RDQG 4EQ3A 5T3ZD 5D9SB 4KTEL 1Z9LA 4JY5H 2OTUB 1ZEAL 3EDJA 4JAMA 2IAMB 1CFTB 2H9GB 3RDTC 3OKLA 2MSPA 3Q3GA 2GUOA 5E5MB 3UPCA 2FGWH 1S9XA 1RIHH 1A9BA 4D0CA 4CDHA 1GGIL 3MRMB 2IG2L 3SGDI 4KDTC 5BVPL 1E4JA 4H8WH 4DFHA 4NGHL 4P59L 1SBBA 1UB5A 4RBPK 4RFOL 5IVZB 1M7IA 5FGCB 1I8LC 4WEBL 5KJRL 4PRHB 4ACPA 4K7PH 3N0PB 4M9PA 3O2WL 1P4BH 4LSSH 3WS3A 2NY2C 1QR4A 4NSKA 3WXWH 4B41A 3GSXB 4DUVA 3N1GC 4WHDA 4BJLA 4ZS6C 3P30L 1S7TA 2HJKB 4J4PC 5GIRB 4ESKA 3T3PE 1A1NB 1DUZA 1I7ZB 4PJ8B 4X99A 4JPVH 4AQOA 4JO3H 2C26A 4G5ZH 5HDBF 1K6QL 1JK8B 3ZDYF 3K2MC 1DBML 3S35H 4Y4KD 3RWFA 3ARYA 4M62H 2N7AA 4PG2C 4GRWB 5H35B 3TYFB 1QRKA 2DQGH 4XBGA 5CZXD 4G9DB 1ZHKA 1NMCB 4PJ9B 1T03H 2AERT 3EFDH 1YEKL 5JUEL 4JVUA 4KI5C 1MI5A 3DGGA 3C5ZB 3PGCB 3GI9L 4KKCD 3HE6C 3DVGB 3H8NA 3CZFB 3JVGC 1F4YL 3LOWA 1Z5LA 1P2CB 4NOFA 3ULVL 1MLCB 1VFBA 1LEGB 5FCSH 1L0QA 2F54E 2HRLA 4MZ2A 2ICWI 2ZUWA 5FYJH 2BVYA 4Z7NF 2F53E 2AK1H 4Z7WA 3S5LA 2DBJA 3ARPA 1MCLA 3QDMB 3C9NB 5IFAL 3AB0C 5DJYB 2YC1B 5HYQB 5I73B 4MQSB 5CWSB 5LXGL 4OJFH 2WW8A 1MCNA 1WT5C 5ABDE 4KK6C 3M8OL 5IEKB 4HPOH 1N6UA 3VFTB 1ZT1A 3TBYA 2OM5A 3A67L 1DQML 5F9DC 4WU5B 1OSZB 1L6ZA 1UB6B 2XYCA 4LPCA 1NGZB 2EKSA 4NO3A 4XBEH 5DJ2B 1QO3B 2XV6B 5DUPL 2FH8A 2YBRA 1EFXA 3ILPA 4P2RE 1C1EL 4K8RD 4OGAD 2DQFA 2D31A 5BQ7A 4DZ8B 2OMNA 1REIA 3HI1A 4RGNE 3WL9A 4OKVB 3RX5A 3NBNA 3QDAA 3P77A 1IEHA 2FO4B 3DI2B 1LHZA 3CU7A 1N6QH 1F4XL 2PO6D 1X5GA 1CFNB 3FFCA 3PWLB 3L5XH 4O2FB 3JTTB 3RJDA 4ZFOL 3MRFA 4YHLL 3GMNA 1XH3A 2OL3H 4LVHB 5ERWA 2YD8A 2NW2B 3H42H 4K07A 1KIPB 1GGCL 1Y6NR 3HI5H 1G84A 5C0EB 4P49A 2SEBB 2ZKHL 3JV6A 4J3VA 2AJ3B 4MDIA 1RMFH 5E9DA 3EDFA 3QIWA 1I75A 3B9DA 1KCVL 2FJHA 4X6CE 3G6DL 4RDQF 3BZDA 3ZHLA 1CTOA 4YO0B 5EU6A 5J6GB 3IDXL 4GBXD 5GGSA 1IFHL 1R24B 1ZKAA 3OAYH 1YMME 2NZ9C 5CILH 5EU7E 5C07E 3NGBC 1EHXA 5KVMC 1NDMA 2NY1B 1U3HA 2R8SL 4U1GB 4ZUSB 4LHUG 25C8L 1G1CA 5CGTA 3BZ4B 5IGXH 4EI5D 4KJYA 5SWSB 3ZYOA 3BP7B 3ARBC 2W60A 1FFPB 4WW1B 3WD5H 5DR5H 5HHVL 2HLAB 3BZFA 3FAWA 5HGDA 2YPLE 4O9HL 1TJHL 2CDFB 4XC3H 2XNAA 2VC2H 3JWNC 2AABL 3L3HB 4KAQH 1FYHB 2COQA 1WGOA 3BEWA 4O02H 5E70A 4NCC1 3BEVA 4H1LA 4IRZL 5EORH 2A1WH 5BXFA 2J6EH 2RR3A 4XP9H 4ZD3L 5HHXL 4QLRA 2VLKB 1AXSA 1PW3A 2P5EE 1NDGA 2B1AH 1V3MA 3MCG1 2WP3T 3L3DA 3T0ED 3OAZK 4GAJH 3HG1D 2LU3A 4TPRL 3OZ9L 1BAFL 5DRZB 3D2UB 2AV7A 3D3VB 4XB7A 5L2KA 4LCWD 1RVFL 3VXRE 5L9DL 1F2XK 3GMLA 3QWOB 1LP9E 1HH9B 4JQXC 2VXQH 5I8EB 4G3YH 4JPWH 3CK0H 4GXUN 4CNIB 3RDTB 1FYTB 3IDNB 3O4LA 4PJ7E 1NL0H 2NY5H 3AXLB 1EV2E 3VJ6B 3NABL 1N2RA 5DQ9B 1IC4H 2X4OA 2DKUA 5EU4A 4CBPA 2VDLH 3CFCL 1ETZA 3CC5B 5GRUH 1JPTL 3Q1SL 5JOFA 1C16A 5I1CL 3SKNA 1F6AB 3ZL4H 4L4VB 3T65A 5D71L 1BFTA 4M4PA 4TRPL 3SHSA 4F8QA 1R3IH 2X4NA 1PQZB 3HUJE 3IFOB 4PGBA 5BRZE 3B4NA 3L5JA 1X6LA 4JFFE 2AAVA 4LSRH 2JIXD 1LEIA 2FJGB 4DGIH 1OSPH 5HDQL 3HFML 2Z8VC 4IRJC 3GIVB 2BMKB 3V8CA 5CSZB 2GJZB 3L3IB 5DD0L 5FYJE 4JY4B 1A0QH 4U2YA 3IETB 4OLEA 2BJML 4TVSa 5ICZB 1V7NL 4RAVA 1LD9B 1ERNA 1WEJL 1F97A 3VGDA 5EO1A 4NFBA 1F90H 4ZOCA 3EGSB 4X80H 3LKSA 4JO4L 5LCVH 3HR5B 4D9QD 4HG4J 1YN6B 4YDLB 5E8OB 5ITFA 3QEQB 3TBVB 1IAIM 1W0VB 3B2UC 5MP6H 5CEXB 5D2LB 3KPSA 1HKLL 1UENA 1NMAH 2X42A 5TDOA 1DQJA 3S88L 3WFHA 3F58H 1XGQB 1G6VK 3PV6A 3A6BH 3QXTA 3MV8D 3FQWA 4FTVD 5FO8B 2I9TB 4EJ1C 2O93L 2Q7YA 1Q0XH 1S7XA 3E2HC 3PDDA 1T1YA 4N0FA 1ZSDB 4G6AD 3U4BH 2ENYA 4OZIB 1T7YA 3SEPA 4JFXA 4X6BB 3JUZA 1JF1A 5I1GL 1JZ4A 4Z0XB 4X7DC 4LLWA 1NBVL 1G7HA 1GAFL 3TH2T 3U9UB 1J8HB 5C08A 4M9OA 5MEND 4HUXA 1W8OA 3JSSA 4QHLA 3MRPA 1K4CB 2EIZB 2DMCA 1JZ2A 3MXWL 5SV3A 1AJ7H 5JW4R 2CKBL 4LKXA 1YEEL 4TULH 3AB0B 3HMWH 3MLPA 1EZVY 3HR6A 5DS8A 3LRSA 1FC2D 4HCRA 4JDTH 3HZYA 3TBSB 5F7LB 3RU8L 4HMDA 3QFDA 5JORA 4N9GA 3GO1H 2VAJA 4OSUL 1YYLH 4NRZA 2ATPA 4P4KB 4UBDD 4G9FE 3LQAH 4H5SA 1B0GB 1FL6A 3LCYA 3BOVA 3SKMA 4ZSOA 1B0WA 2P46B 2QHLA 5EO9A 3IGAB 5KSUA 2DQTL 2HWZH 4S0SD 2AJXL 2EYTB 5ALBL 5GGUA 4DKFL 3OXRA 3VXMB 1DLFL 4PGEB 3MV9A 3L1OH 1TXKA 4KJWC 2Q6WB 1UM4H 4GXUM 4WDIB 3IDJA 3TFKD 3MOAH 4YUEL 1U8JA 2YA2A 3WHE1 2GTWB 5C0DB 5DVMA 5D2NA 1WAAF 3D87B 1CFBA 3TZVC 1D5IL 4P2OA 5IM7B 3HB3D 1T66D 1VB9A 1XGUB 2JE8A 4BZ2H 5T33H 1EMTH 3R0MA 4JRYA 5EB9A 5C2BH 1S78C 5GISH 4PJFE 3RTQD 2KUTA 3KPRE 3OJVC 5DFWH 1OL0A 1EFXD 3MBEB 4DKEL 1KJ2H 2I9LB 1KTLA 3LKRA 5IJVA 2VL5A 5HI3D 2MPAL 1CFSA 3UX9B 3P4NB 4Q9CA 3G04B 5F1NB 3ZMRA 3GSNL 5E2TH 5C0CE 1NFDE 1CLOL 4PPTA 3QDGE 1XGRB 4JZJA 4KKAD 3L9RA 1JUFA 4U2ZA 3IDGA 3FFCD 2Q8AL 3EW3B 3S34L 1A2YA 1I7UB 4WI7A 3ECBA 2AJYL 4MNGE 2DRUA 3QXWA 3MUZ1 4NHCH 3ARBB 4GSDH 2Z93A 3NIFE 5DD6A 1ZT7B 5LKNA 2P44B 4WIQA 5FOBA 4HIJB 1BX2A 2XFXA 5IQ7L 5CS7A 2A9NL 3BE1L 3U7WL 4LHUA 4CAGA 4PJEE 1CL7L 4FQ1H 1SJHB 3T3ME 2BX5A 3DHJA 1HINL 4BFIB 1TZIA 4J3WA 1LO4H 3V4VL 3RZCC 4U6YB 4UQ3B 3HA0A 2OQJB 4BSVA 2WBKA 4GKNA 4P5MA 2X4TA 1KXTB 1KLGA 1CG9A 2ZNWA 2BVOA 3N85H 1B0RA 3QNXB 1R3KA 3DXAE 3PQYD 3UO1H 4DVBB 3QIUD 2RCSH 2DLFL 3C08H 1VGEH 3K7UA 3BVNA 1S9VA 1WAAA 3WJJA 3FO0L 3UPRA 1JVKA 3IRZA 4ZO6A 3GHBH 4OIIH 4I4WA 4X8JA 3QIBB 1UQSB 1FV1A 2C3HA 2BNQB 1QRNE 3JV4A 4YHIA 4HIXH 2JCCE 5GZND 5FO7A 4G6MH 4Y19A 2FX9L 2A77L 3V5KA 1MRFH 1F3JB 4PB0H 4I8DA 1RJCA 3B9VA 3U0WH 3LH2H 3G6AA 1CDCA 1WZ1H 2DDQH 2JB6A 2J88L 1IQWL 5EO0B 3V9FA 3F6IA 2DICA 3NN8A 3MLRH 4X0KB 3REWB 1ZHNA 2J5LC 5IV2B 1PG7H 3VXQB 5F1KC 1E4KA 2QQKL 4JZNA 4K8RC 4OGAC 3UTSE 4JG0L 2QR0A 4TNVF 2Q8BH 2YD5A 1WSST 4X83A 3GSNB 2VQ1B 5IVNA 4MQXC 5C09D 3ULSB 3MRLA 5ITBH 1QSEE 3B8YA 1QBMH 3G5YB 4F7PA 3LV3B 5L2KD 4HWBL 2F5BH 5HGHA 4HJ0D 4WWKA 2FHBA 4IRJB 2G9HA 2BSSB 5T3ZL 4YK4B 4QRSA 4G42B 1OB1A 4YDVB 1N5AA 1MCWM 5IIEB 2B1HH 1OP9A 1YPZF 3T4YA 2CLZA 3OKEA 4MXVE 2P5WB 5C0ND 4URTB 2RB8A 4OCXL 2VKXA 4PGDB 1MCHA 1UZ8A 1V8HA 1LO2H 3BUTA 3H9ZA 3MRNB 3RVUD 2HAZA 4YFLI 1RUML 5DD3H 5E1HB 3QDJE 4HXAH 1CT8B 3BKJL 4X5WB 3OPZL 2OJZH 1IM9A 1Q9OB 1JWUB 1C5CH 1XAUA 4OQTL 5DFTA 5GGTA 2CSPA 5CP7A 3SDDC 3X3GL 4AEIH 1J1OH 5D7LD 1JGLH 1R3HB 3H9HA 5DRXB 5C0BE 5KSBB 1F13A 5FHBL 3T77B 3TNNA 5GSRB 3WS6C 1MHPH 5LBSL 2YSSA 2FSEA 2XA8L 4U1JB 3E2HB 3DOSA 1RZGB 1MJ8L 3ARZA 5DO2D 5EOCJ 3EYVA 1IAKB 2BZDA 4LPYA 3SOBH 4LSQL 3D85D 3QJHA 5H37H 3ZTNL 4F2MB 4NYLA 1TZHA 4F57L 4OFDA 4XCNB 3EYOB 2Q86A 2WUBL 3GNMH 4FG6C 4PREB 1AD9B 4AT6A 4X6DF 3MLSH 5E2WL 3VFWB 1MWAL 1BD2E 1CZ8L 3LEVL 4R4BA 5HTSA 5E8DH 1KLUB 3KAAA 3ARGC 5HD8D 3CJJA 4A6YH 2YKLH 2Y9RT 3QAZC 4BH8B 5E7FA 2IANE 5KVEH 1BWWA 1SYVA 5JW5B 1MRCH 4M1DL 5F1SA 3MRJB 4MSWA 5E6IC 2P7TB 4QRRA 1OGAB 2APVA 2GJ6E 1YPZA 3K8LA 4KVNL 4LSPH 1D5BB 3RL2B 4NO2A 2NY4D 5IBTH 4EDXA 4M48H 1TVBB 2EEDA 5FUZL 3ES6B 4O5LH 4ZS7L 3ZDXE 3QXDB 4G6JL 2CR3A 2PXYC 5IHBA 3BI9X 3TBTB 4R96B 5JO5B 4YHKL 1SM3L 3MJGX 2QTEA 3U4EA 2HFEB 4EKXA 5CEZL 4GKZA 2X89D 3TZVB 4BQ6A 5FKAA 5DD5H 3W0WD 4OV6F 1D5XA 1MFCL 4HH9B 4M02A 3VRLF 2IPKA 1ZLWH 2D3VA 1S7UA 1HHIA 2PN5A 1JTTA 2G5BB 4KH2A 1WISA 2APTA 4Y1AA 1YMHA 4GRWH 1C08A 5J11C 1T5XA 5FHAL 2HJFA 3VXUE 5D6CA 4ZTOL 3L6FA 4O51A 4K8RL 4F7EB 1JV5A 4QTHA 2DL9A 1JNNL 1ADQA 1JTPA 4MZ3A 5JPNB 3PGFL 4IMLA 5HHOD 2FEDD 4X6DA 4OZGB 1I3VA 1T3FB 1Z3GL 4F58H 4Y16A 3VD5A 2PYFA 1MFBL 4TVPD 4W70A 5DZLA 5IEHA 2DLHA 5J12B 3PXJA 4E0RB 4L5FH 4P2OD 3K2UL 2EE2A 1A22B 2W65A 3HNSL 4OLWL 3H0TB 1H9VA 1KYOK 1MIEH 4LASH 3MLTB 4KMQA 1K8IB 1TMCB 4JG1H 1K2DB 1WITA 4U1LA 1I4FA 4KROD 4MNQE 3PIQA 3S36L 5D93B 2R2EA 1CXKA 4RCAA 4OFYA 5IESH 4D0BB 4N0UB 3MRGB 3QO1A 3RZCB 2BOBB 1VPOL 2X70B 3QWQB 4LCUA 5CBAB 2H32A 3DJ9A 3V6BR 3O2VH 5DHXB 3STLB 4GMTL 5C86A 3BP6B 5CJOL 4QXTB 2MKWA 1SBSH 1GH7A 1QFWM 4P3CH 2ERJC 3MACH 1MHHB 1R0AH 2X1XR 2YA0A 1BM3L 5KZCD 3QHZL 1MNUL 3X12A 2FLRT 3IFNH 3QXAA 1JL8A 2NR6C 2YA1A 1BECA 1WFTA 2CRIA 1FZJB 5LGHL 1HNGA 3T3PF 3PWJB 3TVMA 3SCMD 3REVB 3QUXA 1LDSA 1FRGH 4M1CC 2HVJA 3HHRB 2XZAH 4FQJL 4TN9A 1R5VB 4PJXF 1UH2A 4UB0L 1MJUL 3BPCB 4K3EL 2B2XH 4XMKH 4PYGA 3QULA 1FO0L 5D8JH 3MV7E 2D7MA 1UWXH 1KB9J 4UINL 4UTBL 3IXAA 1INDL 4GJTB 1DDHB 2CUIA 5AWNL 8CGTA 1I3GH 3NH7H 4KKBC 3B8SA 4OUUA 3WIHL 4EI6B 4YE4H 4AENB 2AEQH 4G8EB 3O45A 4ZNEA 1MCJA 3PP3K 1M7DA 3UC0H 1MCOH 3FTGB 3SDAD 2PKDA 3RVWC 2F8XC 1NGQL 3CFDB 2CK0L 2B8OT 4G8FA 3X11B 4ETQB 3Q0HA 5EZLA 2DD8L 2R2HB 2WUCH 1T66C 4XWOD 1BZ7A 1N0XL 3WKMH 1J1XH 4XT1C 4AY0A 3OB8A 2BRQA 4U1IA 1RZ7H 3VFRA 4EEEA 1LEKB 4LKCA 4Y4FD 1R5IA 1AO7A 1IGYB 1PD6A 4HZLB 4GW1A 1UZ6F 4ZO7A 5F3BB 4OCMC 3GMPA 4XTRC 4D94A 3O3AA 4HAGA 4NQXA 1JYNA 7FABL 2V17H 4PRPB 3SDDB 3E6HB 4L8BB 1GIGL 1NBZA 2NY7L 1HHKB 5ANMB 4QRQB 3WFBL 4Z76B 4PTUB 4KFZC 1AE6H 4WWKD 1A7QH 4HSQA 4JRXA 1DUYB 2ESVD 2R0WL 2YRPA 4BK4A 1T5WB 5FGCE 3EYFA 3QQ3A 4PJXA 1JHLL 4PRHE 4PR5A 3CFEB 1YJDH 1RURL 3RY4A 2G2RB 3MNWB 3S36X 3RVTC 4LARH 4ODTL 5BZDB 4OTXL 2VZTA 1YNLL 1T2JA 3QIWC 4LLVA 3MLWH 1UCBL 1H8NA 4OM0L 3UTQB 3PABB 1UJ3A 4U7SA 1FFOB 1B4RA 1DQDH 2VH5L 4HHAA 4XB8A 1JZ6A 2VXUL 3ARGB 4I0PB 1CL7I 4JN1H 1ORSA 1ZMYA 4JFHD 4H25A 4M1GL 3QQ9D 4PRDB 5IHUL 2F54A 3QAZB 4HMEA 1U3HC 1RJLB 1WFNA 1QTYT 2HMID 1V3JA 4JM2F 3KPPA 4P9HC 4GRWE 5BJTA 5CJQH 5TFSL 4ODVL 3G6JB 1CGVA 5FCUL 4X7CC 5DD1L 5E6IB 3GRWA 3PWPA 4PYHA 5K33A 3RA7L 4MQ7B 3O0RL 1VDGA 4M61A 3V0VB 4BFBD 1Z0NA 4GMSH 3OJDA 5IFHH 2Z8WC 5BO1H 4OF0A 1IKNA 1TJIL 3U2SA 2RFXA 2GIYA 2EC9T 5BMFH 2IH1B 2PXYB 2EIBA 3T0VA 2QL1A 1FORH 1L7IH 5KANG 1A1OB 4MA7H 1FE8L 4OD3H 1X7QB 1EAJA 1KCRH 5HJ3B 4YX2L 5TJWK 5TE6H 5AYUL 1EJOL 1T0MA 4R7DA 3H9SD 5AUMB 4P2RA 1BQLL 1CYGA 4EDWL 3QDME 4U0QB 1HI6A 3X17A 4UV7H 3KS0J 4C56D 5C0GA 2GQHA 1UXWA 3DSFH 1YEFH 3QWRA 4BSJA 4U7MA 4EBQH 2XTJD 1X5FA 4XZUB 4G8IA 2QHRL 1MHCA 1NQBA 2BVQA 5J11B 4XRCA 5GGVL 4AYFA 3VFSA 3LN5B 5F9WC 3WNPA 3ARFB 1JPGA 3HNVL 5E99L 1BJ8A 1NC2A 4JAMB 1K5NA 2C3XA 3S37H 1NAMA 3Q3GB 2GUOB 3C2AL 1KB5H 1S9XB 1LP9F 1A9BB 3ULUD 2UY7A 4NCDA 2BC4A 4OF8A 5C0JA 5CIPB 2F58H 2XWJA 3RVUC 3C8KA 3J8F7 4PJ7F 2OTPA 1KSRA 4I77H 2ZNXA 4JM2A 4JQIL 3NCCB 2IADA 4HKJA 2ITDA 1VADB 2PW1B 3GMMA 3KGRA 4P2CG 1F58H 1L9NA 3RIAF 2I5YH 1YMMA 5L8KB 5HI4D 2CQVA 3WS3B 4MJ6B 3K4AA 4OIBA 1FL5A 1QSFA 3D69A 1I8IA 2FRGP 5DC9B 3QEGL 1S7TB 2K9UA 3OR6A 5I19H 4XAKD 1M7XA 5JDSA 1DUZB 4POYA 3CGTA 4X99B 3HAEG 2AEPH 4Q0XH 2IPUG 4BQ9A 2DQEH 1KUMA 3MJ7A 3RWFB 4PRID 3QQ4B 3FO1A 2W1NA 4WO4D 1LILA 1RPQA 4ONGH 4ODWB 2VDRL 3MCKA 1LE5A 3LKQA 1TLKA 5E2VL 1IGIL 2AK4D 4XBGB 1ZHKB 4KHXL 5SWSE 5KW9H 2HFGH 1MI5B 2APWA 5GS0H 1YYMH 4NOBA 4RMUA 3DGGB 2VDOH 2A38A 4AEHH 5IB3A 5B4MD 5I15H 5FYLD 3MA9H 3N1QC 3VG9C 3BKML 4PV9A 5DRWA 1Z5LB 1Z0MA 4R0LA 1VFBB 4YDKL 5ISZA 2D7OA 1RK1A 2OP4L 1LP9A 3MRQB 2L7JA 4MD4A 3JWOC 4P9HL 5F96L 1IT9L 5GS2H 4K9EC 1BMGA 3ZYIA 2VLKE 4Z7WB 2KBGA 3S5LB 4KRMB 3HRZB 3GI8H 4D9RD 4TSCL 4KGLA 3QUXD 1QVOA 1RHHA 5D1ZD 4XPFH 4JO1L 1BWMA 1GGTA 1FZMA 3D3VE 3TBYB 4XMPL 1HQ4B 4KV5E 4N0YL 4L8CA 2VLME 5GPRA 4N90D 3CX2A 5BRZA 3GHEH 2EKSB 4NO3B 1A5FH 3T4AA 3SE9L 2BY2A 4P4RB 5JR1L 1CDYA 3FHQA 2YBRB 1ZLVK 2N7BA 1FYTE 1QFUL 5D1QD 5F7FA 2AI0L 2EDLA 2DQFB 1OPGL 2D31B 5BQ7B 2K3TA 5GZOD 1BVKB 3HI1B 5F7EH 4PJAF 3RRQA 3CLFH 3EJYD 1KIUA 2FEDC 3P77B 4RISH 3ZKSD 3DUSA 1F4WH 3MLZL 3NACH 4L4VE 3EZJB 4KPHL 4BQ8A 2C7UB 3WIFA 5D2NC 2BY1A 1S5IL 1JGEB 3MRFB 1DR9A 3LS4H 3P4OB 1T22A 4R4FH 1XH3B 2JJVA 5ERWB 4R8WH 5C0IA 3UYRH 1J7VR 1TQBC 5F7DA 3LB6D 5L7XH 4DOHB 3UJTL 2NY6D 4HS8L 1ED3A 3WN5A 4U1KA 4NZUH 1ZGLP 3IXTB 2VLRA 3QDHA 3JV6B 1JYXA 2FO1A 1HOCA 3GKWL 4NNYB 5E9DB 3QIWB 5JMRA 5JZ7D 2XPGB 3SDXB 1K8DA 1DBJL 4DKAA 1VCAA 2FJHB 3X14A 5JOEA 2BOCA 5DFVC 5EU6B 5F9OL 3UTZA 3CFKB 4QHKJ 2WINB 4JZJC 3QEQE 1NDMB 1U3HB 1YC8A 3GMRA 1CQKA 3MGAA 4M7JL 5D2LE 1IGCH 4F7TA 4KJYB 1U42A 3P9LA 3HC3H 3QCTL 3O9WD 5B38G 5IR1A 4OCNC 2OL3A 1GPOL 3NCJL 2A6IA 4KI5E 2KPNA 4QYOA 3V4UL 3BZFB 5HGDB 1OLZA 2XNAB 4LAQH 3VA6A 4RBPH 3E3QC 1G6RB 1A1MA 3TJHD 1WVZA 3OKDA 2H6PA 3UZEA 4G6KH 5D7KE 4JZOA 4OZIE 3BEWB 1A64A 2WSKA 4GH7B 3TT1H 2H3NA 4H1LB 2JELH 3DMMA 5IMMB 3MSPA 1J8HE 2R0KH 3BP5A 4PJAA 1AXSB 3QCVL 1NDGB 4WFGE 4YXLH 3EAKA 2F54D 1TNNA 1UM5L 3L3DB 3TA3A 4P5TA 3WJJC 2F53D 4KXZI 3DLQR 4K3JL 1JFQH 4M5ZL 4MWFA 3HZMB 3OJMB 2D7TH 3FFDB 4MJ5A 4PJBF 4JO2H 5F9WB 3ZE1E 1H8OA 2XACC 4F7MA 4P23D 3JWOL 5T1KD 4Z78A 4D9LL 2XZQL 3KR3L 4ZOEA 2X4PB 3O4LB 2VLJA 3QUYA 1BBDL 5FUOL 1N2RB 4FXKA 3SPVA 3VWKD 2X4OB 5EU4B 1EVUA 2V9RA 2JCCF 1ETZB 2J6EA 4CU6A 3QPXH 4LPWA 4HCRL 1ZT4A 3KPRA 4WEUD 4XCYA 4P2RD 1C16B 1W8NA 1EO8H 5GGVY 43CAA 3LS5H 1E4KC 1NLBH 2DN7A 3L5IA 4PJIB 4FQXD 2ILLA 1CFQA 3LEYL 3T65B 3CH1A 1UFUA 2J8HA 3WFDH 4RGND 4Q9RH 2X4NB 4PGBB 4YHOH 3GIZL 3QDGA 2HG5A 3I50H 1LEIB 1JWMA 3KPNA 4WWKC 1YECH 3I9GH 1XR9A 4FZ8H 4HGWA 5FUCC 1QSZA 1MCBA 4MNGA 3GMQA 1NC2D 4LU5H 1BPVA 3FB8A 3B9KB 5I1IH 4XVSL 1U9KA 2HT3C 4J1UA 1JNLH 3QO0A 3QG7H 4RAVB 2A0LC 1CU4L 4NKDB 5DJ8A 3WNKA 3GK8L 4NBZB 3BIAX 1UWEL 5IW3A 4HT1L 3LKSB 1AGCB 3SGKC 1D6EA 5IBUG 1X5JA 3DNKA 5ITFB 5I8KH 3C6SB 4WTWA 3PL6B 2BP3A 1IVLA 4MXVF 2IALA 1BJ1J 2EH7H 5TDOB 1DQJB 2O5XL 3HAEA 4CN6A 2DI7A 3PV6B 2AJZA 5C07D 4NO5A 4PJBA 3FQWB 4X7SH 5DURB 2HMIC 4M03A 2Q7YB 1S7XB 5DGQA 1U41A 4OGXH 4QTIH 4L4TA 2JKXA 4M6ML 1G0DA 4JFXB 3VG9B 1JF1B 3HS0B 4M7KL 4NWTL 4MA3B 2YPLD 1G7HB 4WW2F 3MRKA 4WGVB 1QPXA 3JWDH 5C08B 2JCCA 4HUXB 3PWUA 4LPVA 4WV1C 4QHLB 4E42A 4QHUA 1EGJH 5KSAA 2ARJQ 2Q3AA 5DS8B 3FQRB 3LRSB 2LABA 3DPBA 2P5ED 3HZYB 3QT2A 3PF2A 3LRGA 3QFDB 4HBCL 3MRCA 4MGXA 5GGSY 4HG4K 4N9GB 2FX7L 4JFPA 2P8LB 1BFOA 4IOSD 4QHNA 3UTSA 4ONOA 2ATPB 5KAQG 2D7PA 2BNQE 5H37G 3SGDH 4XVTL 2UZXB 2HH0L 1NAKH 1FL6B 3CIQA 4K3DH 4RWYL 1QSEA 3SKMB 4ZSOB 3VXRD 4XNZC 4RAUA 5EO9B 2GCYA 5KSUB 2BNUA 1MF2L 3BW9B 5GGUB 3ROOA 3OXRB 4FOMA 4RIRA 1WF5A 4O58L 5MI0C 1AY1H 3MV9B 3N06B 2Z9TA 1XF5A 3RVXD 4K55A 3S98A 2NXYD 3VWJB 4GT7A 1U8JB 4OI8A 3UXFA 5ESAA 3NFSL 5D2NB 3RVVC 1SVCP 3P9WB 4C83B 3EBAA 4YHYC 4S0TD 3LZFL 2QQQA 3I6GA 1TQBB 3BDYH 4XPGL 3VXNA 1QLFA 3OAZH 4JRYB 1JRHL 2R1WB 3HI6L 4JFFD 1G7MB 1NCDL 4GKSA 4I1NB 4XHQA 5C0BA 4MAYA 1D6VL 3WFZA 2FH6A 4WW2A 1U8KA 5IB5A 4BFEA 5DA0B 2EECA 3C6LD 3LD8B 1KTLB 3LKRB 5IJVB 1JI1A 1U8NA 1RUAH 2P5WE 3ZDZF 1RU9L 1CFSB 5KN5B 2Y06H 3E8UL 5FYJD 1CR9L 5D7SL 1OAZL 3VXOA 3UTPE 1I8KA 4DN4H 5HSFA 4E41A 1JN6A 1O7VA 3HCVB 3L9RB 2HFFA 1JUFB 2VTFA 3IDGB 1MCWW 2LVEA 4YNYB 3PG2A 4Y16C 2WWKT 1EO7A 4OCYH 3U46B 7CGTA 3ECBB 4BK5A 2ICES 5E1AB 2FLBT 2GSGA 2LU4A 2F74A 3KJ6L 1UWGL 3RX8A 1U8HB 3DETD 4LP5A 5KSBE 2Z93B 5FOBB 3RWEA 1CE6A 2QQLL 3LDBC 4BKLA 4C59B 1FNGA 5IVXF 4IEFB 1AQKL 4C4KO 3SE8H 3IDYC 4K94C 4P9MH 3W2DH 2W9DL 4LVNC 2CDGA 4GXVH 3KVQA 4KDWA 1KULA 3ZKNC 1TZIB 1I9IH 2GAZB 3T2PA 5B38A 5C7XH 4IDJL 3W82A 4M4RA 2GT9A 2V7HA 3PJSA 4KKLC 1QKZH 4UILH 1KJ2A 3QSKB 2OZ4A 1G7IA 4GKNB 2X4TB 5GGTL 2VDPL 1CG9B 3DYMA 4XWGH 5F71A 3RZWA 4JEGB 1RSFA 3LAFA 4NRYB 4PD4J 3KYNA 3PDGA 3B3IA 4LLMB 5JXEA 3BVNB 3LMJH 5MEPB 4UNTA 1AI1L 2P24A 3UPRB 3B43A 2F5AL 5A1AA 1ROWA 3LIZL 1ZS8A 4FQ2L 4I4WB 4X8JB 5T3XL 4RGOL 3TVMC 1CGXA 3CVHB 4DEPC 4R9HA 3JV4B 1PY9A 4JFZH 4ONFL 3L5WB 1AXTH 2V5TA 4LMQI 1YUHB 1CWVA 4Y19B 2R2BA 4NZDA 2Y36L 3V5KB 1ZANL 4PBVC 1OGAE 4LSTL 5ETUA 4CVWA 2XZCL 3DMMD 3DURA 3G6AB 3AU1B 4G9FD 3T2NH 5L2JA 3GSRA 3I3BA 1PDKA 4DJMA 2R4SL 2JB6B 4JPKL 4JLRA 3NN8B 2DLTA 3DX8A 2HJLB 5DWUH 3HZKA 1FFRA 3QNZA 4UAOC 2V5MA 1QLRB 1D3CA 5EULV 4JZNB 3WBDA 4NO0B 2AXJA 1HYSD 2DLGA 4XHJD 4NQSB 2QR0B 4B53A 1F11A 4UMGA 2I25N 2OTWA 1BQUA 4DAGL 3OB0K 5K59F 3MRLB 5D1XD 5AZEH 4F7PB 1RY7B 4Z0BH 4TNWF 4YC2C 1IC5H 5HGHB 5IVXA 2VITA 1OCWH 2C1PA 5CZVL 1SJVA 1Q9LA 1OB1B 4CMMA 2ADJA 1J5OH 2WV3A 5F7NC 3IDIA 1N5AB 4U7KA 5J1SC 2CMRL 1AGFA 1SJEA 5DZOA 5EU5A 4JHWH 4LRNH 2DMBA 3ULUL 3TO4A 5KAQF 3KPRD 1X4ZA 1VFAA 3BYTA 4FQPA 3T0WA 4OT1H 3TV3L 4NHUA 2VN4A 4OZGE 3N9GL 3CDFA 4O4YL 5EUOB 3FN0L 1WFUA 1IM9B 1YEGL 5C0CD 1G9NC 3ESVF 3H9HB 1FFNA 3FT3B 3TNNB 4KK5C 4FABH 5E2UH 5ID1A 2YSSB 2FSEB 1LO5B 4D3CL 4LOUC 1A6ZA 4UIKL 5ALCL 1E6OH 1ADQL 1J88A 2H8PA 3KPQA 4MX7B 4YGAB 3WMSA 2J1KA 2R9HD 1IBGL 2IQ9L 4N0UE 2G75B 4L8DA 3P4MA 1TZHB 1A3QA 5FDWB 2Q86B 4WV1B 4MDJA 2HT4D 2YEZA 4ERSL 4U31A 4OM1L 4AT6B 1FL3A 5EBWA 1YQ2A 3TH3T 1KBGL 1UJ3C 2WBJA 3OAUH 1K3ZA 4GG8A 4PB9H 4YFEA 1BBJA 5I1KH 4NP4L 2DQJH 3TT3L 4P2QA 2ORBL 3HKFA 3MLXH 3DXAD 1ES0B 2N1KA 4GUPA 4X4XA 1NCWH 5E6YA 3W9EB 4XCCH 3IAPA 1SYVB 5CIPH 5CEZE 1J0ZA 4PRNB 3QEHB 6FABL 4MSWB 2MQ0A 3VFMB 4ZUTB 3GGWB 3VD4A 4BSWB 5FYLL 3EHBC 5ID0B 4OZFB 2FD6L 1A7PL 1YPZB 4XNZB 1TZGH 3ISWA 1QRND 4GRWF 4KQ3L 4NO2B 4NUGL 2ZOLA 4HJJH 1P7KB 4EDXB 1IKNC 3V6FA 5F21B 5E4EC 2UWEF 1KJ3H 1M71A 5E8NA 2BRRL 3PUCA 5MI0B 4Y2DA 4P48A 3BD4A 3SJVD 5EOTB 1EAPA 4KK9C 5D9SA 2FBOJ 4N0CC 3L3JA 3U4EB 3EYUH 3ILQC 3CUPA 3QR2A 1ZTXH 3FOMA 1CFTA 4UTAL 5FKAB 4YHYB 4A6YA 2FGZA 3T0DA 4XP4L 4UT6H 3UTSD 4RA3A 3MFGB 2IPKB 2DLIA 4UDTA 4RGNC 1HHIB 5K9KA 3MRMA 5AAWA 1OF2A 1T7WA 1XIWB 1B2WL 4LSDA 2O26U 4Y1AB 1YMHB 1T5XB 1FDLH 2HJFB 3LQZA 2CGRH 1JGUH 4XP5H 4O51B 4GRLB 5L0QC 2H1PH 1RZKC 4NQDA 1T89A 4ZPVA 4MCZB 4PRHA 4IMLB 4YXKH 4X6DB 2EXWD 1H3WM 4R7NA 1DQLH 1Z9SA 4Y16B 2PYFB 2X2YA 3CU1A 5GS1B 1G9MC 4QWWD 5IEHB 5ECJE 43C9A 4U6VH 1IGFL 2HJKA 5GIRA 3T8XA 1KTKE 1MFAH 5ANME 2W65B 1HZHH 1C8PA 4JM2C 3QDJD 2JB5H 2MMXA 4OCWH 3FQXA 4YHNA 4U05A 3VE0A 4U1LB 5C0BD 1I4FB 5I1AB 3WUWA 4U1MA 5FO9A 5H8DA 2GK2A 3P11L 4OFIA 5H35A 3TYFA 5F88A 4YWGH 1I7TA 2VDQL 1LO0H 2UWEA 2VXVH 2AJSL 4LCUB 1N7MH 4KU1A 4PJ9A 3V95A 5SWQA 5DMGC 1G9NL 3ARSA 1XGPA 1U8LB 1UC6A 2HRPH 3DVGA 2YZ8A 5SWZA 2R1XB 4OBSA 3X12B 2FB4L 1KCSL 4NDMA 3OKKA 5TGBA 2RAMA 3QXAB 1DN0A 2V2XA 1MLCA 4JGJA 3AFLA 4H8WC 4MXQC 5I0DA 3NZHH 1BD2D 4LP4A 3TVMB 1X5HA 1OTSC 1XF2A 1U92A 2HVJB 3G6JE 2CKNA 3AROA 2HLFC 1J18A 5C0FA 4KRPC 2W59A 3S8WA 2IAND 1H15B 4HLJA 5HYQA 3QULB 4MMZC 1CK0H 1NSNH 4QNPE 1C5BH 5CWSA 4OGYL 2EDYA 3OBAA 2ARWA 4J3XA 5B8CA 5EG6C 5IEKA 2EE3A 3HE7A 3O41A 1N3NA 2GJ6D 2UV3A 5C6TH 5HHNB 5JHDA 3VFTA 4JCMA 1MCDA 2Y07L 4R0LC 4UAOB 5TPWL 1BIIA 2C3GA 4WU5A 4OUUB 2IQAA 4K23L 4OCSH 3U7AA 2DIAA 1AIFA 1DL7L 2YK1H 1EEYA 3IDUA 1J0HA 4CADA 2XQBL 3O45B 3ARXA 1M7DB 4YZFE 1P7HL 4YC2B 2NXYC 1JGVL 4G8FB 5KJRH 1IGMH 4XNUL 3O2WH 2F19L 1CBVL 3ZE2E 1G7JB 4FXLA 1P1ZA 3HC4H 4X98A 1IRAY 1PSKH 1BZ7B 4KY1H 4FP8H 4O2FA 4X9GA 2NYYC 4U1IB 2QLVB 1CF8H 3VFRB 4LKCB 1SMOA 1AO7B 3VXUD 2D4DA 1G6RH 3VDBA 3O3AB 4NQXB 4I3RH 2D03L 5I1DB 2VDNL 2SEBA 4KZEL 1ZE3C 1RD6A 3VW3H 3L95A 4H1LH 1DANU 4OB5L 1KB9K 1NBZB 3NAAL 4JRXB 2AV1A 1GHFL 1UXSA 3EYFB 2YMXL 5J6GA 3O6KL 4PJXB 4U3CA 4TSBH 4Y4HC 3TPKA 1NAML 4PR5B 4AL8H 5DI8B 4ORZC 1CICD 4C55A 5TE7H 3INUL 5ESQA 3WN5C 3BZ4A 1KCUL 4MNQD 1G9ML 4PP1C 3BP7A 3ULVH 5FXCH 2CJUH 1JMXA 3BHBB 4FQCL 3WSQL 3RPKA 4LRIA 4LLVB 3WE6B 4JB9L 2HLAA 2A73B 3BJ91 4YHMH 1UJ3B 4FFWD 4EOWL 4HKXA 4HHAB 4F7CB 3L3HA 5SX4H 2ICWJ 2P8PA 4ENEC 3AS0A 4H25B 4MXWH 3IU4L 2JJWA 1KJVA 4KHTL 4JREC 5FOJA 2VSDA 3KPPB 5BJTB 3MYJB 4POZD 4X4ZA 1BVZA 3UTTA 5MEQB 1A7RH 4IDLA 3PWPB 3OKMA 4JY5L 4I48A 2IH3B 2DMKA 3BPLC 1MI5E 1JZ8A 4LQFH 1F3RB 5A43C 3B83A 1NCUA 3OJDB 1MQKH 4O2EA 4MA8H 2FGWL 3QUMH 2RFXB 1E28A 5E4EB 3U2SB 4LCCA 1RIHL 3UTOA 5EA0H 2DKMA 2ZWLT 3EYQD 4IRSD 3DMMC 2VXTH 4L1DA 2ZUTA 2AP2A 4H8WL 3MV7D 1HH9A 3RJQB 2EIEA 5I8EA 2O5ZH 2ZUXA 4HFUH 1LK2A 12E8H 1CVSC 1T0MB 2LFGA 3CCHB 4Z7WE 4OZIF 1W72L 5EZOH 4YBQC 3RAJL 3AXLA 3OKNA 3VJ6A 1HI6B 1NBYB 3TA3C 4K7PL 2BHYA 2V6HA 4P5TC 1P4BL 4LSSL 2CUMA 1ZA6B 4NKIH 3IDMB 2H2SD 3WXWL 1FNHA 4FFVD 3R8QA 4V2BA 1ZGLA 4XX1E 4XRCB 3VFSB 2VDKH 3H6JA 4DW2H 1VEPA 2ZKHH 2YD4A 5L0QB 2NY3D 1KN2L 1JPGB 4LGRB 1PQZA 3IFOA 4PG9A 4JPVL 4JO3L 4G5ZL 1KPRA 4IOFC 1NAMB 1TCMA 1FAIH 4CVZA 3QUYC 2XICA 3S35L 2EH8H 4M62L 4D2NA 3GIVA 2BMKA 4NM8H 2VDML 3CSGA 2GJZA 3MQIA 5CSZA 3Q6FA 3ZDYE 4Z7VF 2IAMD 5SV4A 5IW6A 1RZIA 5C0JB 2DQGL 3C8KB 1YEDA 4GKOA 4OZ4A 5ICZA 1U8MA 4JM2B 4LPXA 4Q58C 1T03L 4K9EH 4QRPD 3EFDL 4C4KT 1NBQA 2IADB 3LKPB 3FQNA 2ITDB 4HKJB 3ALXA 3EYSH 1MH5A 2ZCKL 3PP3H 4HQQH 1W0VA 4JN2B 1IAIH 3GSQB 4DOHE 1U8IA 5DMYA 1FL5B 1QSFB 3D69B 1I8IB 4PRHD 5D7JA 5BVJA 15C8H 5FYJL 1G9EA 5E9DE 3OR6B 4M7LT 2AK1L 4NIKB 1KT2A 2ZUQC 4YQXH 2JIXB 4RWHA 3SDXE 2NY5C 1KB5A 5FDYA 5IMOB 5DT1H 1RIUH 3KPOB 4Z7NE 1ZSDA 3QPQD 4OZIA 1G7LA 4X6BA 5EU6E 3MJ7B 3RWJA 4JKPH 2JLLA 1OAYH 4MJ4A 2Y72A 4HPOL 4P46C 4PJ8D 3SDYH 3U9UA 2ID5A 4TUKH 4UIMB 4LMQE 4FN0A 2C4FT 4HWZB 1MEXH 4ZFZB 1K4CA 2EIZA 1HEZA 5F6IC 4KRPB 3RIFF 3DSNA 2GY7B 4XBEL 4P57B 4YXHH 5IB3B 3TBSA 3BDBA 4PJ9D 1FH5H 4PV9B 2XY2A 3DGCR 4R0LB 3BRGC 5ISZB 4Y5YA 1RK1B 3C5ZD 4P4KA 3AMLA 4MD4B 4J7RA 1N6QL 4Z7VA 2KZWA 5KSAC 4QOKB 1AFVH 3IGAA 2A6JA 2BHUA 2OL3L 2FNBA 3OGOE 3H42L 1YDPB 1RHHB 3VXMA 5FKPB 1BQHG 3L3OA 1U95A 4LLDA 5MENB 3QDMD 4IJ3C 3EOAA 2Z8RA 5I1HH 4WDIA 4V1DA 3QG6B 1HXYB 1RMFL 4L8CB 2VWEC 3F7RA 1WIPA 4FNLH 4ODXA 3T4AB 3O4LE 1XGUA 2WWMD 4YBLB 2J2ZA 3BWAB 5CILL 4JDZA 4ETYA 2X7LB 2R0ZL 3QH3A 2FIKA 3MBEA 3S35X 3U7YH 3WFCH 5IGXL 4MD0A 1T7VA 1FGVH 1SHMA 2PTUA 3DUSB 4PJIE 3LKNA 3IFPB 2X9YA 2EDNA 5CGYD 3WIFB 3S97C 3P4NA 1U91B 3QZWG 3WD5L 3G04A 5DR5L 2CIIA 4DTGH 5FGRA 4F37K 4XC3L 1PYWA 1S7SB 2VC2L 2H2PD 2IFFH 3AC0A 4Y4HB 1F3DH 4CW1A 4KAQL 1VA9A 4O02L 1ED3B 5F89B 1I7UA 4U1KB 5EORL 1AC6A 2A1WL 2VLRB 3N1PC 1J0KA 3LQAC 2J6EL 4XP9L 4MAYC 4L3CB 3CVHH 1UADC 2IPTH 2E6PA 1NC4A 2Z31A 1ZT7A 1F42A 4F9LA 4WW2C 2VZVA 2BCKA 1KENH 1TDQA 4X7FC 1T1ZB 2RIKA 5DEFB 4DKDC 2R2CA 4HLZH 1SJHA 3X14B 4OLUH 3ARTA 3BRDA 4L9LA 1BVLB 1HH6A 4TSAH 4U6YA 4G6FB 4F7TB 2OQJA 1CQYA 3KPSE 1QEWA 1A7OH 1Q9KB 3RU8H 4O00A 1UKQA 2VXQL 4G3YL 4JPWL 1ZHBA 2NY1D 1VEOA 3BPLB 5KVGH 2A6IB 3CK0L 4E5XA 4WTZG 2Y4SA 1A1MB 1NL0L 1T0PB 2NY5L 5T5NG 3TN0A 3OKDB 5SWSD 2H6PB 1U6AH 1IC4L 5KSBF 3AM8A 2VDLL 5IHLB 5F3HA 3QIBA 2H3NB 2X10A 4ZTPH 5GRUL 2WLYA 2AJXH 1I9RH 1WC7B 1CLYH 5C08E 3BP5B 3LN4A 4PJAB 3MXVH 3ZL4L 1II4E 2EO9A 2VQTA 3U0PA 5JA8B 5JXEC 1G7QB 2HTKD 4P5TB 3WNMA 1RULH 4LSRL 4DGIL 1OSPL 2VLKD 3REWA 5AZ2H 4NQVB 2QV2A 3K74B 3VXQA 4MWFB 1RK0B 2OR9H 5JIHA 4WCYH 2B5IC 2UZYB 4XI5C 1WK0A 1YEJH 2R69H 3IJYB 1A0QL 3NTCH 4DK6A 4F7MB 4Z78B 3D2UD 3FKUS 3D3VD 4ZSOE 1F90L 3LV3A 2VLJB 2VJXA 4X80L 4K7PY 2VLMD 5LCVL 2NZIA 4FXKB 5DJ6A 3SPVB 3UPAA 4C58B 2BSSA 5L8LB 3UCRA 5MP6L 2RBLA 3U0TA 3MV9E 4XCYB 3RDTD 1FYTD 3MYZA 1NMAL 43CAB 3F58L 5DC4B 5EH1A 3A6BL 2J8UF 3R0NA 1I9JH 2C3WA 5D2NE 1Q0XL 3QEUA 2HG5B 1AKJA 2YWYA 2YD7A 5GS3A 5I74C 3U4BL 5HHQA 5IQ7H 4L4VD 4PJ5B 3BE1H 4HGWB 1CT8A 5DMIH 1U8PA 3ZO0A 1JWUA 1HINH 4JRYE 1OTUC 1QA9A 4RFEA 5KSBA 2YUWA 5DRXA 1N5YH 5C09B 1GJIA 4J1UB 5GSRA 2PYED 2ZUQB 4LHQB 1AJ7L 5TF1H 4TULL 3TO4C 3HMWL 4LSVH 4ZS6D 4OZFH 1CS6A 3CDGB 1VENA 4UT9H 4J4PD 4CVUA 2VISA 4JDTL 4P46B 3FO0H 1WCBB 1Q38A 4M5YH 1M4KA 2IALB 3GO1L 3HAEB 1YYLL 3SBWA 4L3EB 3BPOC 2AJZB 5F6IB 3EDEA 3LQAL 1N26A 3QEQD 3SQOH 4PJBB 4OZGF 5D5MF 1KLUA 3BMVA 5K93A 1NANH 1HCVA 4L4TB 4LLYA 2HWZL 4JKMA 4LCYA 1FPTH 3D39B 4BH8A 4KI5D 5D7LB 1GZPA 3MTRA 4QF1A 3L1OL 4BH7B 3MRKB 2EDKA 2GK0B 3HE6D 2PF6A 2R0LH 9CGTA 5D7KD 2UZIH 1WTGT 4NBYB 4I13B 3MOAL 4E42B 4QHUB 2R15A 1Q94A 5TQ0H 2LTQC 4DGYH 4RMSA 1I7RB 2WBJC 1J8HD 1QZ1A 2J8UA 1C7TA 2OI9C 2A6KA 2EIDA 1WAAE 4I2XB 4BZ1H 3IS1X 3QXDA 4WFGD 4BZ2L 3TIDB 1FCGA 5INDB 3TBTA 4YEFA 1EMTL 4IJ3B 4R96A 5C2BL 3V5DA 4JFPB 5GISL 1BFOB 4QHNB 1OQOA 2ATKB 5B21A 4KK6D 1KJ2L 5C1MB 3MREA 2YZ1A 2DTMH 5IJKA 4Y19E 4PFEA 1BQHA 1JF5A 4OLYL 1IEBA 4XNXH 2GI7A 1OOAA 2GCYB 4P4KD 2YXFA 1MAKA 3L3KA 5E2TL 2BNUB 2WP3O 4K94H 2GJJA 4M3KB 4Y2DC 3P9MA 3SDCB 4Q9BA 5T5NF 1XF5B 5CINH 3VA2C 4KTDH 2DI9A 1ONQA 1EGJA 4NHCL 4N5UA 1JNHB 1HKFA 4GSDL 2E27H 1NUDA 2MFNA 3D9AH 4J8RA 4YR6A 1BFVH 1T2QH 1AP2B 4RMQA 2BVUA 5FGBA 4OZGA 3T0BA 3I6GB 4FQ1L 5B39B 4PBXA 4JHBA 5D5MA 2EXYC 1EJ6A 1QLFB 3S4SG 3WXVH 3QB7C 1LO4L 2I60H 4OLZH 1DBBH 3QZWA 2VAAA 2YUVA 4MAYB 4F80A 1DEDA 1WTLA 5E4IA 5HXMA 3H0TA 3HPJA 4WW2B 5IB5B 1A14H 4PJGF 4WHTB 3N85L 3W0WB 1YY8A 1U8NB 3T2QA 1K2DA 5A2IH 4BQCA 3UO1L 1T89C 3F7PC 2RCSL 3C08L 5JQ6H 2CO7B 1VGEL 3MBED 1I8KB 4E41B 3HNTH 5FYKU 1FP5A 5ENWA 4N0UA 3GHBL 3MRGA 1T80A 3RWHB 2BOBA 4OIIL 3FB5A 3K8MA 2X70A 5EUOE 1ORQA 3MROA 2VXSH 2GSGB 2F74B 5EC2A 3CMOH 4UDUA 3BP6A 4HIXL 2NZ9D 4G6ML 5HHOB 2VIRB 5D72H 5EU3B 1CE6B 2B39A 3MV01 4JRWA 3RWEB 1QFWH 1FNGB 1MRFL 5I30H 5LVEA 4WHYH 4HF5H 3U0WL 3LH2L 3T0AA 4L29A 1WZ1L 4LVOC 2DDQL 3ARBD 1Y18A 2CDGB 1MRDH 1FZJA 3MLRL 5B38B 5E7BA 3MODH 1PG7L 4ELKB 1TQCC 5FUZH 3REVA 2V7HB 1KJ2B 4HGMA 4WTZA 1NMCC 4PJ9C 3ZKMC 1R5VA 4RQQA 4H0IA 2Q8BL 4ZFFA 1KELH 4ZUUB 3B3IB 1GVIA 2YUZA 5ITBL 4OUOA 1QBML 1J0JA 4P99A 2HYMA 2F5BL 2P24B 4ALAH 3R1GH 3U4AA 1FLRH 3AS1A 8FABA 1HNFA 1J11A 1ZS8B 3QFJA 1H3XA 4LEXH 1DDHA 2E3VA 3KLSA 2B5IB 2Y5EA 3ZE0F 4RMRA 3VI3F 4R2GC 1HDMB 4ZOBA 3A6CH 2B1HL 4QXGL 5L6YH 1IARB 2VRAA 3KHOA 4G8EA 4XX1G 2R2BB 4RFNC 2XRAH 4LLAA 4QRRE 3UJJH 5ETUB 1YPZE 4PP2A 3DURB 1M6OA 4PJGA 3CFDA 1BLNA 2BNQD 5L2JB