4MDIB

Immune receptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mdiB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mdiB01
5D1XD 3HC3L 4P2OC 1F90L 4PRID 1TZGL 2R0KL 4M6MH 1U41A 5DC9B 5TFSL 3OAUL 1WITA 3SDCA 3WXVL 2E9JA 4XNQA 5DTFB 3SDDB 3AU1A 3Q6FA 3UPRA 5FM8A 2D2OA 3FQRA 3MRMB 4HFUH 1D9KD 5IV2B 4CJ1A 4MXQD 3TZVD 1PEZA 2NY2C 3IVKA 1J0YA 2W0FA 2AXJA 5J13B 5BW7C 4BKLA 1JGEA 4X6DE 4U7MA 1H3WM 3A6BH 4DGIL 4DEPB 5CKAA 3B9EA 3RL2B 2FO4B 4QXUH 2AJZA 4XVUC 3TIEB 4EI5D 1OQOA 3P9LA 3BKJH 2D7MA 2IMMA 3ZHKA 1INDH 1ZXQA 3RWFB 1XF2A 4OZFB 4FP8H 3DSFL 4L1DA 2WK2A 1JGUL 2F54E 3FB5B 4KK9D 4X7SH 3E2HC 4NO3B 2ESVB 3NZ8B 2V5YA 2FJHB 2FATL 3OG6B 2AJVL 4R9HA 3VGBA 4AH2A 3HI6H 2UWEB 4IDJH 2XN9E 2M2DA 3GSXA 3OKDB 3JV4B 4H1LA 5DI8B 2HKHH 3M8OL 4PJCE 1BBJB 3SY0B 3CC5A 5C08B 4QRTB 5C1MB 4NZDA 5DK3A 4ZO6A 1Q1JL 3FQUA 4ZFOB 5CD3B 1VA9A 5C0BA 4DAGH 4U6HA 3GJFH 5D1QD 4OD3L 1I7TA 3G6JE 4KI1A 4Q9CA 4R4FL 4JREC 3KPLA 4GRWE 4G42B 3SE3C 4BSVB 5IMLA 1HNFA 2NY5H 4P2OA 2EXYC 3MRIA 3FQNB 4OF8A 5K9OA 4NQDB 4M7JH 2AXFA 4FQQB 4I18C 3DROA 4XP1H 3KWWA 2X42A 1JIBA 3QHFL 4IOSD 4K3HA 4WWID 4WDIA 2H2PD 3O2WH 1VEOA 1K4CA 3RAJL 2LE9A 2JTDA 1U8NB 2F5AH 2Q86A 1QRND 2X05A 3BZEA 4XNXH 3BGAA 5DS8B 3W5MA 1NC2D 1HSBB 1UZ8B 2YC1B 2HJLA 3EO1B 5BW7A 4ODVH 3GSRA 4GQ9L 2RJMA 4GH7B 3EHBC 4NRYB 5K9JH 3OX8A 4R7NB 4U3XA 4OF6A 1HZHL 3AREC 1PZ5B 3I6KB 3VWJB 4KFZC 3OGOE 2E7LC 5CEZD 3HR6A 3VXNB 2VLMD 5FO8B 1T1XB 2HMID 4MNGA 5D2NB 1I9JH 1J1XH 1AC0A 3K8MA 3MLUH 5KS9E 1A2YA 3PJSB 2OJEA 4V1DD 1A8JH 2XWJA 3IAPA 1ZVSA 4FZEL 4ZODA 5FYKH 3WLBA 1I7UB 1KELL 4BA8A 4K94L 1GOGA 2H26B 1FNSL 3K74B 2R8SH 1AKJB 1LE5B 3S6CA 1KPRB 4KMQA 3TBSA 3OKMB 1U8HB 3SKMA 4X6CF 5B39G 4YE4H 3QUKB 4E42B 1L7IH 5CD5C 3MOAL 4QHKJ 3EYFA 1KB9K 2YD4A 4GBXD 4YNYA 4TVPE 4KY1H 2EXWD 1RZFH 5F89B 4AG4L 1BIIA 1A1MB 3O4OB 4PJXA 1IGFL 3MRGB 2BNRB 3SE3A 3QRGL 3HN3A 3VMNA 2GSGB 4PJEA 2ATPB 1TFHA 1R5IA 4KKNA 1FN4A 3OGCA 5BZDB 4NKMB 3WFHA 3I6LE 4L9LC 4X4ZA 4NWUH 4ZTOH 4I18A 3LIZH 5DO2D 2Q1EA 2VIRB 4JCMA 1GYAA 2EIZB 3V0VA 1LD9A 4Y5VB 3VFRA 1KNOA 5EFIB 4JRYA 4LOUD 2V9TA 2ED7A 5EBMB 4XPBH 4N0YH 4P5TC 1YEIL 2CR3A 4N90E 2DQFB 1QSFA 3RIFF 2AXGB 3SGEH 5DMYA 4DN3H 5IW6A 5HDBE 3QB7C 3D85B 5E2WH 1ZANH 4P46C 1JWUA 3AREA 3DX6B 2C1PA 2GEEA 1DBKL 4KK6C 3H7BB 5T3ZE 5GS0D 2BVOA 2E7LA 4BH8A 3T65A 3G6DL 2CUMA 4P23D 1AGBB 1U3ZA 5C6PB 5I0ZA 4S1RL 3HMWL 3N9GH 4GKOA 4MQ7B 3MXWL 4MDIA 3TYGL 4U6YA 4A2MA 1A4KB 3S88L 3OF6D 2DBLL 2Z91B 1CDCA 1HSAA 5L9DH 3T2OA 3GKWL 3QO0B 2HVJA 3LQAL 1HKLL 3QI9B 3LS5H 1QSZA 5DA0B 1R5VA 3U1SL 1YPZA 3RY4A 1CK0L 1NGQH 5D72H 1MELA 3JWOC 2VLRB 5H37H 4JPWL 4KKLD 2JJWA 5B39B 4HUWA 4Q0XH 1LVEA 4NYLB 2JE8A 3UAJC 3F65A 2DQCL 3FFCE 2BVUA 4N0UB 1X5LA 4ZSOA 3EZ8A 5ICXA 2DLTA 2Z31B 2I60H 3PWPD 4HJJL 3HI1B 3CNKA 1VSCA 3BP6A 5E1HB 4O9HL 2QSQA 4JEGB 3IXTA 5IM7B 4L9LA 4Y1AE 2DL2A 1MRDL 1AGFB 4K9EC 4NOBA 1RUAL 1T1WB 5IEHA 3RUGB 1OARL 5I66A 3RHWK 3VGHA 1TQBB 5DUBA 3RWHB 1LNUB 3NCBB 3BN9D 1HYRC 3STLA 4BJLA 2H6PB 2HT4C 2WW8A 2LAAA 1Y6KR 4IRSB 2Q3AA 4OZIE 1ITCA 1A9BB 3LZFL 43CAA 5SX4H 5DJ6B 4YBQD 2HTLD 5EU3A 1N7ML 3GSQA 4X5WA 1Y6NR 5BMFH 4P5TA 1BX2A 2GY5A 4JRXA 2V17L 3BI9X 1S7WB 4U49A 4JJ5A 1FGNH 1L0QA 1FLRH 3O3DB 3Q5OA 3P4NB 3RPIB 1O7VA 4AEHL 5D1XC 3ZHLA 1U8QA 2VLKA 5GGSA 3VFMB 3FN0H 1VADB 2XWTA 3HMXH 1RK1A 1UM5H 4HLJA 1KIPA 5ILTL 2AJUH 4G80B 1B0GB 1D9KC 3T0BA 2ARWA 1DTUA 3O4LE 4P2YA 1HHGB 4HWBL 4DCQB 1J88A 3TZVC 2R39A 2C4FT 4PJ5A 2VJXA 1EZVY 1LO3L 4D9QD 1PG7H 1U9KA 2VL4A 1IJ9A 1MFDH 3T2NH 2D9CA 4FFWD 2NLJB 4BZ2L 4D94A 1L9MA 2FSEB 4G9FB 1EEYB 3RQ3A 1I3UA 1TCRA 5HYQA 3W0WD 2BOCA 1FHGA 3VFNA 3B6SA 1XGRB 5E9DB 5E8OB 1MHEB 3MV01 1NBQA 3D18A 4N9GA 2DTML 4JGMA 3G5VA 3NCJL 1C5DA 2Y06H 2YRLA 4R0LB 4XPHL 3MUY1 1P6AB 3UTTB 4ELKB 1UACH 2ZSWB 5AZEL 4OD1L 2LQRA 2CKBB 4KK9C 2VDML 1C5CL 4HEPG 5CZKA 1DSFH 1IAOA 3BGMB 4NJAH 3RI5K 1IM3A 1I9IH 3IKCA 2A6JA 2HJFA 3GI8H 3A6OA 3EJZC 3ULVE 3CUPB 4G8GE 3IJSA 2OI9B 1RY7B 2FECL 5SWSB 4F7EA 3Q5TA 4MCYB 5FOJA 1A7QL 3VFTB 1EHLL 4M5ZL 5D71L 2YWZA 3T8XA 5IHUL 1IC7H 4EXPX 1GGTA 2ADFH 5HHQB 4PREA 1TZHA 4NBYB 3O6FB 3TNNA 2BVEA 4BFBD 1U0QA 1H8NA 3C9NA 2YPVL 3G6AB 4RFOH 2GI7A 4MWFA 2CXGA 1IC4L 1QP1A 5D1XA 3U46B 4ZFOL 1KEML 4EDWH 3GMRA 3KPSB 5C0AE 1I1FA 3QDMD 1INQA 1PQZA 3I02A 3T4YB 1D9KA 4L8DA 3SJVE 4ZFGH 4IS6B 3DIFA 4DVBA 2NY5C 1J5OH 4X99A 4OZGA 3TZVA 5JOFB 1FVCB 2CDEA 4HIXL 5D7SL 4NO5B 4X6CA 2Z92A 2CIIB 2JCCB 4K55A 1IAIL 1MFEL 3MUHL 4UIMA 3GKZA 4JFDB 1FYTA 4IBLT 5F1KC 1ZLWH 1N59A 1BVKB 1BQLL 2QADC 3QZWG 4HUUB 4HQQL 3C2SA 1EHXA 5KVMC 2VN7A 4Z95H 4K7PL 1EO8L 1F13A 2HMIC 1J7VR 4E5XB 2YEZA 5KZCD 2P8LB 2X4PB 2NY4D 3QEHB 4MXWH 4WV1B 2E9IA 3CLEL 1LEGB 4MLIA 4WEMB 1F6FB 3QHTC 3D25A 2HVKA 1DLFL 4RGNE 2B5IC 1CFSB 2ICWJ 2EDFA 3QDAA 5AD0A 4MAYB 3AUVA 1FFNA 5AAWA 5DJYA 5CHNA 1W8OA 2UYLA 3VH8G 3RY6C 4P0DA 2EECA 3IDGB 4R7DB 1DP0A 3TYFB 2UZIL 2FR4A 3IFNL 5J3HC 2VDLL 3LPWA 5FKAA 4U6TA 1GIGH 1A7BA 4X6FB 1S7XB 6FABH 3C6SA 4PJGA 3DO7B 4LSVL 4JAMB 1MWAL 4WUUB 5ADPL 4GBXC 4NN5B 5FO7B 1AXSB 4PJ7E 2NX5E 1G7JB 1LWRA 2NXYB 1ZA6A 2VKWA 2ED9A 4S1SH 5IVXE 4JO4L 3P77A 5CBEA 1FBIH 3SKNA 4OCRH 2LU4A 4UQ3A 4I0PD 4N8VA 3BVNB 4WU7A 1R24B 1QBML 3WNKA 3GJFA 5C0EB 1VFUA 5HJ3A 3VFVA 4UU9A 5EBLB 5DO2C 4QCIB 2W60B 1E4WH 4K23H 2JB6A 2HWZL 3D0VB 3GB7A 2R2HB 1QLFB 1IGJA 1VPOL 1CGWA 3O6MH 2RAMA 5AYQA 1IGYA 2DQJL 1MCPL 1S7RB 2MTPA 4JZNA 4JY6A 2BVTA 1S3KL 3RNKA 2RCSH 4PTTB 5GRVK 1G6RH 2DQTH 4IRJD 3TWCL 3W39A 5J57B 5CJXA 1NC2A 1WCBB 4PJIB 4WCYL 1IILE 2VDNH 4GUPA 4E41E 3BPNB 3FO0H 3LSOA 2JLLA 4APQD 5MENB 4M5YL 2WV3A 3ARGB 5GJSL 1WZKA 3WEXA 3ZZ1A 5LBSL 3FHQA 2X4NA 3K4ZA 5GSRB 3V5KB 5GS0C 3QZWB 1KULA 3P9MB 5BV7C 3TESA 3MNZA 4PRAB 5GS1B 5HHNB 2HFFA 3BQUB 3ES6B 3QUYB 5TDPA 1QR4A 1CXEA 4JG0H 2DWEB 5F7MC 5JW5B 5FFLA 4MSWA 4OUUA 5F9OL 3RNQA 2D03H 2O5YH 3MGAA 4H0HB 1HHHB 1SM3L 5HHOB 4FQIH 4V1DA 3U7YH 4EBQH 3O6KH 2E27H 3UYRH 3NABL 4KPHH 1TENA 2LU3A 4K07A 1X5KA 5BVJA 2XWBA 2BC4A 3RY6A 3IFPA 4HKJA 3EDJA 1T2QL 4Z7VE 4KKLC 1IAKB 4QXTB 2EYSA 2A1WH 2R2EA 4R26H 3MRRB 5LVEA 5EOCL 4JPIA 3L95A 4LMQI 5GRJH 4GBXA 1FL3B 4KU1A 1L9NA 1MCCA 5EUKB 1WEJL 4NT6B 4EEEA 3Q6GH 5DHVH 2EH8H 1GC1C 1NAKH 4FQ2H 1AGCA 3QPQD 2HFTA 3VI4F 5I16A 4BUHA 5KJRH 1D5XA 1XCQB 3ZDYF 5LXGL 5DRWB 3U7AA 3G5XB 1C1EH 3S35L 3SGKC 5I1AA 1BVZA 5TE6H 1S9VA 4PJ9C 4OCSL 1LP9E 4NCDA 4MMZC 3BN9C 1U8OB 2I26N 2KQNA 3KAAA 3U7WL 1MCOL 3UBXB 1M6OB 4HH9B 4WY7L 2WSKA 2R2BA 2HTLC 3QFJE 4D8PA 2F53D 2VDPH 2HTKD 1MHCA 1P1ZB 1OTUC 1JMZA 3MOQA 4L29A 1F6AA 4P2QD 1IL1B 1QSED 4PD4J 4DW2L 4GO6B 4X5XA 1WK0A 3ARRA 1CR9L 5MP6L 3TJEH 4PGDA 1QFWH 5JHDE 2EE3A 1Q0YL 4NQSA 3F5WB 3QYCA 1CT8A 3KPNB 1H0DB 1H3XA 3SGDI 1MF2L 1QO3A 3UTZB 1YEKH 1XF4B 2D7TL 4F3FB 5DC4B 3MBEC 1CQYA 4JANA 2IG2L 2K7QA 4NM4H 1NFDB 5IK3B 4ERSH 2WWMC 3MV9D 5FUCE 1OLZA 3ZTJH 3O3BA 4JHWH 2ZCKH 4FFWC 4OFPA 4MMXC 3R06A 4JO1H 5CILH 5FECA 3G08A 3MJ8B 4JR9L 3SE4C 3AVEA 5HPOA 5IQ7L 4AM0B 1H8SA 3LQZA 5CP7B 1GXEA 2L0DA 5A40E 1BD2D 4GRLD 4OTXH 1X3DA 3T08A 4P4KD 4ORZC 1NDMB 2A6IB 4KI5E 4PGEB 4QTHB 3RU8L 3QDHA 5I19L 4TULH 3QUXC 1T21B 4KTEH 4K8RL 2F74A 1N6VA 3P2TA 1TVBB 3OJ2C 5D7LB 1EK3A 1P7KA 5MERA 5DD6A 3QUMB 4L3CA 5FYKU 3ULUH 4RMQA 5DR5L 1OSPH 1I7RB 4G8IA 4U6VH 3ILPA 4HXAL 4OV5B 1ZTXL 3WDJA 3SGKA 4XBGB 4YFEA 5JR1H 3V9FA 1CYGA 4C56E 4PJ9A 3ULUD 3FAWA 1FZKA 1G1YA 4XMKH 1NLDH 2AV1A 3UC0H 4PRNA 3HR5A 1N2RB 3GSVB 3CU7A 3DX9B 3QPXH 5F7LB 5EIIB 3U4BH 1EHAA 3VRLF 1WBYB 3GSUB 3T77A 4JB9H 1ZWIA 4CNIA 2DS4A 1NBZA 1A14H 5DJ8B 4LLDB 4DKFH 1A5FL 3KYKL 1S5HB 4B5EA 1FFQA 2V5RA 2Y6SC 3CXHK 4JM4L 2VB5A 4YPGB 3QDJB 4KVCH 5D6DC 4PGBB 5C86A 4ZFZA 1NGXA 2R29H 1DZBA 4P5MA 4PJCB 2UWEF 1ZGLP 3QG7H 1TVDA 1ZHLA 1UH4A 1C08A 4P59H 3NMEA 2MNUA 2PW1B 5C71A 1UT9A 2OS7A 1ADQL 1KTRL 3L7FA 4QXGH 1T89C 4MX7B 5GS2H 3MBEA 4FG6D 2DQGL 1KYOK 1IARB 4LVOC 4XC3H 3NFSH 3RBSA 4HFWA 2DJUA 1MEXL 5T1MB 5E99H 3O2DL 4GAJL 5J6HB 1VFAA 4K3GA 5MEQB 3S98A 2BNQD 2X4TA 3ARDB 3SE4A 2EO9A 1I8IB 4MD4B 5H2BB 1QKZL 3OAYK 4Y2DC 4YAQB 3CFDB 5H94B 4PJAB 4MJ6B 1NAML 1NCUA 2AJYH 2YZ1A 5DJZB 3QUXA 3EYOB 1KENH 3MNVA 2NY4C 2FGWL 2GSIB 4P9ML 2XTJE 3MREB 2A6DA 3D2UD 4TSAH 3PUCA 4NJ9H 5C92A 5JZ7C 1RUQL 3THMH 3HE6D 4PJDA 5DJAA 4JFQB 1YN7A 2PYFA 4OGYL 1KJVB 3QNYA 4N1EA 1AE6H 2CLRA 3MRPA 1YNKH 2VLRD 3GHBH 3L6FB 3LEVH 4YBLB 4ZD3H 1CGVA 3OXRA 1CXIA 3WXWH 5GGVY 2XZCL 1OW0C 4Z77B 4DTGL 5D8JL 1YN6B 1FL6A 2V7NA 3IDIB 3EO0A 2QSCH 2FX8L 2GJ6E 1VGEH 1OGAB 2P24A 1QZ1A 1EVUA 3RKDD 5L2KE 2NY6D 3UBXI 1XGTB 4XPTH 3D39B 2OSLA 4I0PC 4P4RB 4CDHA 4ZUWB 3MLRL 5D6DA 4JQXC 4OV6F 5GGRA 1F4XH 5IGXL 1D5MA 3QFDB 1Q9WB 5EWIL 2UVEA 1XGQA 5HGHB 5DA4A 5F9WC 1F00I 2I25N 4KDTC 1T89A 2HT3C 5I2IB 3ULUF 4NSKB 4KJPD 4J2XA 4D9LH 4IRJC 5DVKA 5JXAL 4EQ2A 1TVHA 4XBPB 3MNWA 4QHUA 5HD8D 5FYLH 4CMHC 4XCNA 1DANU 4XNZC 4APQC 3LDBB 1MUJA 1UXSB 5MEPA 4KV5F 2WIIB 3WKMH 2DDQL 4M8QA 3PE9A 5CLWA 5HGGS 4HGMA 4M9OA 2GAZA 3GIZH 4P2RD 4LNRA 4Y2DA 1AD0A 5EBWA 1NUDA 5IHZA 4HJGB 4GXUM 3TF7C 3R8QA 1DQDL 1NSNH 1SY6H 5JDJA 3TBVA 2I5YL 25C8L 4WNQB 5I1IH 2Z9TA 1ZGLA 1JF6A 4NNXB 5DD3H 1QBLH 3U0WH 1WAAF 4N0CD 3TPUB 1H15B 5ICZB 3RVWD 5J13C 5GISH 3VGDA 3IXAA 1RZGB 2XI9A 2IBBA 1V7ML 2CUIA 4FABH 4N0FB 4G9FD 5JOPE 3DRTB 3NIGF 3CSYB 2VR9A 5E9DD 1OW0A 3N1GC 4IMLA 1JPFB 4OLXH 1UJ3C 3UTTD 3NZHL 2ERJC 5IFHL 3ZDXF 1XIWB 3O0RH 3SO3B 3LN4A 1FNGB 2J2ZA 4G6AD 3EFDL 4NOFA 1ROWA 3CFIC 2X7LB 4I0PA 5DWUH 1KGCE 3GMPA 32C2A 2BMKB 4XMLH 4N5EC 4AQOA 3GHEH 3SDXB 5JIHA 4NKDB 2EDWA 5SWSD 2Q8BH 2FH6A 3C87A 4HWZA 3PHQA 1Z0NA 5CJQL 4KDTA 3MV8B 2D3VA 4FXGA 5DJCB 3V5DA 3E6FB 4NFCA 5IW3A 4YR6B 5H8DA 3N1MC 4Y8DC 3C8KA 4ZMAT 4FN0A 1EEUA 3HLAB 4YUEL 5ENWB 4F33B 5DK0A 5FCUH 1H5BC 3JTSB 3NGBC 4APQA 4DK6A 1OB1A 3V52H 1UH2A 4U05A 1KFAL 1C7TA 1U8MA 2J8UB 4KWUA 5F7YC 1G6RA 1YJDL 2OR9L 4Y1AB 3KPSD 5KVEL 3QCUH 5JQ6H 1IAIM 4HIEA 1YMHB 5FB8B 4WO4B 1BHGA 2IPKA 4DUVA 2D0FA 4HMDA 1GL4B 4M6AA 2P8PA 2MPAL 3RUGF 5GZNC 1TJIL 1PYWB 3QDGD 3BEWB 4I48A 4ODSL 1QYGL 4QOKE 3EOTH 3OXSA 3KPMA 3VI3F 3PWNA 1VFBA 3OBAA 4L3EA 5BRZA 1HHJB 2IALB 4PRBA 3K8LA 3E1F1 3RVXD 3I3BA 5E4EC 1SVCP 3AB0B 3F7RA 3KJ4C 2AQ1A 2QHLA 1MIML 2ZPKH 5DJ0A 1KJ2H 4GRLC 5EUOE 1KCSH 3DGGA 5I71B 3NAAL 2Y23A 4KGJA 2CDGA 4P4KC 4X4XA 5E1AA 2R1XA 3IFOB 1UJ3A 3AS2A 3JUYA 3RBGA 4OLEA 3IAQA 3DPBA 2E8ZA 2VABA 5HVHB 1DDHA 5F6IC 5CAYB 2OBGA 3DMMD 4MAYD 2VQ1B 3V6BR 4YC2B 5ADOL 5C8JB 5BO1H 4LLWB 1MJ7H 5F9DC 1OTTD 1ONQA 1B2WH 3WS3A 4AT6A 4JDZB 4AJ0A 2X09A 4OQTH 4RIRB 4JQVC 5DHVA 3V8CA 3ULUC 12E8H 1T22B 2AQ3A 2EKJA 1DEEB 3QT2A 4U1LB 5EORL 3UTSB 1GPOH 1KN4H 4LCCB 1G0YR 3S4SG 3VFUA 1N64H 2F53A 3E8UH 1A6WL 1T2XA 1ZVHA 4K2UL 4Q9RL 2OZ4H 3HAEH 1KCLA 3QJFB 4P2QA 3MA9L 1H5BA 3AY4C 3WNPA 1UB6A 2G75A 1QSEA 1FL5B 1KCVH 3OMZA 3QQ9C 4UIKH 1U2CA 2X1QA 2WINA 4PR5A 5IMKA 4CAGA 2HFGL 1A1NA 5EU6E 5EZJA 4JKLA 2YBRA 4LRNL 3V0AC 4M1CD 4Y5YC 3UTPE 1IT9L 3BZDA 4XP4H 4PJFB 3I50L 2GJZB 3ZKMD 3SDAB 4HD9A 1S7TA 5LQBH 4HBQA 3CMOL 3QQ3B 4MCZB 5JIPA 2FEEL 4OM0L 5JPNB 1GAFH 3MV9A 4EN3C 3DV4B 1UEMA 3CFEA 3NACL 4M93C 4LPTA 4XRCA 1ZT4B 1RSFA 1T0NB 4LSUH 4U1IA 5TE4L 2LABA 4PB9H 4WGWB 1RJYA 3PQYD 5IIEB 2DQEH 2F58L 4NO2A 4WW2C 5E2VH 1BD2A 3HG1E 4GRLA 1J05A 2OX5A 4ACPA 4P4KA 1MCKA 5TGBB 3BWAB 2A73A 1WBZB 4NQCE 4TQEL 2AEIT 1FNEB 4LPXA 3BDYH 2AK4D 3PDOB 4NZRH 1YEJL 2YPKB 5EZIH 5GZOD 5GIRB 3MJ7A 3R0MA 4QGTA 1FCGA 1ZLUK 1UEYA 5TPWH 5FA4A 5K93A 1CU4H 2DWDA 5TDNA 4QYOA 2DQUH 3HE6C 1JYVA 4LARL 1SJHA 5L0QC 5ALBL 3U4EA 4JZJC 4BSJA 2CD0A 2JCCF 4M02A 1KSRA 4JN2B 5E00B 4JQVA 3S9DB 2OL3H 3TT3H 3VGFA 1VACA 3PWLA 3TH2T 4DN4L 2HLFD 5E4IA 3IJYA 3LKSB 1ZT7B 3BXNA 1RHHB 3GGWA 2C1OB 3ECBA 1T0MB 3LH2H 5CS7A 5E7BA 5IHLB 1AIFB 4TTDD 2J88L 3CIQA 1YMME 4J3VA 4PRHE 2VXQL 3WE6A 3ZLQC 4Y8AA 4EI6B 4YHLH 3S4SB 3I9GH 3AY4A 3VXPB 4RGNB 5I15H 3DX7B 2NY6C 4HMEA 3LS4L 5J12C 5TF1H 2APWA 4XVSL 2UUDK 1FE8L 4CJ0A 1DQJA 4TYUA 3INUL 4LU5H 1J0ZA 5L8JB 1SEQL 4LRIC 2NR6C 4JFZH 4Y5YA 1T1YA 3N85L 4KUZL 3HC4H 5ITBL 4PY8J 3WIHH 1WAAA 2R1WA 4MJIB 2LTQB 2R56L 4GT7A 4AMKL 5DSCB 4KJPC 2A74A 2VTFA 3VA2C 2VISA 1GOHA 4TN9A 3ILQD 5HD8C 4CU7A 4EN3A 5KVFL 5M94B 3T3PE 3MGTA 1VEMA 3TP4A 1CDUA 5IESH 2BNQA 1KOAA 4XP5H 4JFFA 1JPGB 3MRQA 3NA9L 3HA0A 4RZCB 3IF1A 5BJTB 1I3GL 1LO0L 4H88L 1EERB 2EDXA 4WW2A 1JNLL 3HRPA 5AYUL 4GQPH 4TVPL 4XCYA 5HHPB 5HYIA 4WFHE 5ACZA 1HI6B 1X4XA 3ZE0E 3KPPA 2A9NL 4OCXH 1ZS8B 4UZGA 1QHOA 1BOYA 2H2SD 4KZEH 4LIQH 4ZYKB 2NY0B 1SYSB 3D2UA 3HC3H 2BDNL 4N0CC 1TZGH 2R0KH 3RVWC 3HE6A 4RNRA 4Y4KD 2FWOB 4Z7UE 5TFSH 3OAUH 5D2LB 3VXUB 3WXVH 3WIFA 2VITA 4C4KO 3NPZB 4JZJA 1UQSB 2JIXB 2JJSC 5HXMA 5IVOA 3VWKB 3BPLB 4JFOB 3VGEA 5IKCA 3GSNB 4S1DD 1I1AB 2CJUH 4YHIA 4R90L 3PWUA 4ISVB 4LVHB 5AUMB 5D7LD 3KXFD 1YY8A 5T1LB 3GMOB 4HUXA 4M1DL 4FQ1L 3S3JA 3P9WB 2VH5L 4XP9H 1EHNA 3LKRA 4G6AC 5T3ZL 5E6ZA 4DGIH 1N8ZB 4NP4L 1W0VB 1BIHA 1BEYL 3L5IA 4FTVD 1CDGA 3HCVB 2QKIB 5J11B 5L7XL 1N3NA 2D31A 5DRZA 4HV8B 3H0TA 1EO5A 3DSFH 4Y5XB 4NRZA 1LO5B 4LRIA 5AZ2L 1UM4L 5EU5B 3RWCA 3BHBB 4CW1A 4R96A 1Y0LA 4HJ0D 1IEBB 2FATH 3KJ6L 4R8WL 3GMMB 1EUUA 4DZBA 1C7SA 2AJVH 5HVFB 2VLKE 2YD8A 8CGTA 3WHXA 2VSCA 2IFFL 2OTWB 4ZTPL 3M8OH 1K5NB 5DJDA 4WFED 1SJVA 3CFKB 4P3WA 2BY2A 2FBJL 5GPRA 5IG7B 3QDJD 5GGUA 1UFUA 4P2RA 1KXTB 1Q1JH 1I4FB 5IW1A 1WJ3A 3GNMH 4G7VH 4LCWA 4IDLA 1KJMA 2NY1B 5ABDE 3Q1SL 4JFYA 5SWZB 3WFBH 2HJKA 4MXVF 3GBLA 3DVFA 3LRSA 1AO7B 5I9QC 4MA1B 1RZ8B 4PTUA 1IQWL 5C7XL 4BH7B 3X14B 4WTXA 4ALAL 1SY6A 5GHWL 1RJLB 3QHFH 3ARDD 1NGYB 2Z4QA 5DJXA 3WFZA 4NO0B 2EZ0D 1OAXL 5CIPB 4NC1E 2P5WB 2YPLB 1OP5H 3RVXC 2EEAA 4H5SA 4ETQB 4CU8A 4HPYL 1EFXA 3RAJH 3VXSD 1B3JA 1F3JB 5JHDB 5F6HI 3QIWB 4OCMC 5JLZA 5ID1B 1FDLH 1U8PA 4F7CA 4U1KA 4RAVB 2X6MA 1E28A 1X5YA 3CX5J 4UUJB 3S8WA 3T0AA 1R3JB 4GQ9H 3RIFK 2IANE 1A6AA 4X98A 1VGKB 4S0SD 4LLUA 1V8HA 1CF8H 3CSPA 1VFMA 1G9NC 1HWGB 3DMMC 2EDOA 4NKQB 4JY4A 5I1DA 4X8XA 3JBG7 3TBTB 5DJ2B 1BWMA 1NFDF 1WWAX 1ZA3A 3NFNA 3OKYA 4CGTA 1D6EA 1BZ7A 1CLOL 1M7DA 1B6DA 3S37X 2QQKL 2B8OT 2FX7L 4LDLB 3SQOH 3ZKND 3GJFK 5HYJB 1XGYL 1E4XI 4NUGH 1KELH 1HH9A 2Z93A 4I5BA 3SDYH 4YWGH 4K94H 2C7UA 4PRIE 4HCRL 1FNSH 3EJYC 2VMFA 4DKDC 3MYZA 3FO1A 4JG1H 4EQ3A 1OGAD 3KHOA 3H9SB 4LVNB 3EGSA 4JLRA 3BZFA 1CL7I 4ZNCD 3RPKA 3OG4B 2B1HL 1J11A 1V3KA 3D39D 3MRBA 4LAJH 3MOAH 5I74B 5BS0B 1C12B 1OAKL 3WKNA 2GCYB 5GRWA 2ZUQB 3NCMA 5E94A 1N6QL 1ZLSL 1HN1A 3JV5A 3GUTB 1OCWL 4K71C 4C56B 4EOWL 1RZJL 4X6CE 5FF6B 3QJHB 2Y5TA 1RJZB 3DXAD 4AG4H 1K8IB 4GMSH 4EUPH 1IGFH 2FZ3A 4RDQG 2NY3C 1EAPA 5I8CB 3OR7A 4KGLA 1T20A 4NN6B 3TBWA 3QRGH 5EH1A 3ZKMC 3EYQC 4CVXB 3QDGA 2VE6A 3ULVL 4XPFL 2OQJA 1QR1A 2QQLL 3MLTA 2XKNA 3T0VA 4OGXL 2PTTB 3QO1B 5B8CC 2DICA 3U36B 3I6GB 3VXRB 1FO0L 4N1CA 4CN1A 3ARPA 1WWWX 1DANT 1GZQB 4HK0B 2W9EH 2IH3A 4H25A 3W11C 3P0GB 4YHNA 2BSSB 3BO8A 3S34L 1P2CA 3O8XB 3U0TA 1X5GA 5E8EA 1NBYA 1M1SA 1DQQB 4LP5A 1KJ2A 3V6ZA 3D69A 1KPVB 1DBML 4ZAKB 5A2LH 2Y72A 4JM2C 5ITFA 2V2TA 3DMMA 3CH8A 2ATKB 3F12B 3G6DH 3LY6A 1IBGL 5DFWH 3BGFB 4XAKD 4S1RH 5E5MA 2YR3A 3HMWH 2YUVA 5D93B 5HHMB 3GK8L 3CFBA 4GXVL 5IBUB 4Y2OA 4YEFA 3S97C 3TYGH 1NCCL 3VG0L 4O2CA 1QBAA 2DBLH 2HLFC 4JFEB 1R3LA 2F19H 3GKWH 2DMBA 2X89A 1H3GA 4ODUA 2F15A 4PJAF 3U1SH 1KLGA 2Y1VA 4JJHA 4OQTA 3OJDA 3HNSL 3P4OB 1FORL 5KOMC 2G2RA 3BH8B 3MCLH 5DVOA 4LQ1A 4JPWH 1A1OA 1JE6A 2GITB 5CWSA 4U6XB 1JTOA 4V2BA 5CJBA 1QRNE 3QXAA 5C0NC 4RX4D 3QRFM 4YQXL 2OZ4A 3HAEA 4P57A 4KKAD 5E56A 1U42A 2Z0BA 4PP2A 4WI7A 3MV8D 4HJJH 2P5EE 4LGSB 5DRNA 3RDTB 5BZWB 2MWCA 4PG9A 1E4XL 4POYA 1MRFL 4O9HH 2G5BB 4UDTB 4G6FD 4IMKC 2XXCB 3CPLA 2OJZL 4TSBL 5CEZE 5IMMA 1MRDH 4JGJA 3BP5A 1MVFA 2KH2B 1RUAH 4O2EB 1HQ4B 3LKQA 1OARH 5B8CA 5EOTB 3FOLA 3AAZB 1IC5L 4GW5A 5KBNC 3IETB 3F7QA 1CFQB 3OHXB 4U1SA 3T1WA 3PQYA 3BFOA 1S9YB 4WO4D 2V17H 2AXHA 3QH3B 3NIDF 2ZUYA 2W65B 5DZOA 4U7KA 2CPCA 1XGPA 2OXGA 4AEHH 1UCBL 5F1IA 3CGTA 4JM2A 4Z7NE 4DZ8B 4Y4KC 3B9KD 5C07E 1BFVL 4Z76A 5ICYA 1FZJA 5JORB 4LLVB 4CN6A 4L4TB 1TQCB 3HE7D 4L8CA 4HWBH 1INEL 1RIHL 2FHBA 4JVPA 3RWGB 4C55A 1G7HA 4S1DC 2HYMA 1JPSH 1FPTL 3KYOA 4B50A 1LO3H 2VDOL 4GRMB 3AS1A 5T33H 3P73A 4BZ2H 3FTGA 3D6GA 3PG2A 3TH3T 3NFPB 5KSAC 1JK8A 2ARJA 1AQKL 1A7NH 2E6PA 2VLLB 3NCJH 3ARQA 4XPHH 1I85C 2W38A 5IB5A 1CD1B 2ENYA 2VXVL 5I6XB 3MLSL 1NGPL 3VG9B 1JUFB 3TLRA 2BFVL 1U3HB 5MEOA 4TUOB 1I8KA 1CLYL 5DYOB 1E27A 1WUNT 3KYMA 1C5CH 2H8PB 5EDXA 5JUEL 1A3RL 4H1LG 3TA3C 1EAJA 1CFTA 2I9TB 4KK8C 4IMKA 4XHJC 1GCFA 1UB5A 3BDBA 3MUGA 2V7HA 5DMGD 3WIHA 4MQXD 4LBEB 1C16B 2YD6A 4GG6A 1CE6A 1U91B 1Y6MR 3DLQR 3FQTA 4KK5C 1A7QH 5J6GA 1EHLH 4M5ZH 1TJGL 4XH2A 5D71H 3QNZA 1PAMA 4HBCL 5IQ9B 5LWYL 5FO9B 3FT2A 1BREA 3WHE1 1DUZB 1QBBA 1AD9A 4J3UA 4Y7MA 3N1FC 5EU7C 3BPCB 3SCMC 4F7PA 3WIIH 1NGWA 5F7NC 2V2XB 4CMMA 3SDXF 1ZHNA 4F15B 3U30C 1T5WA 2YPVH 1R5WB 3SDAD 2MKWA 1LEIB 2MQCA 1RZIA 2IH1A 2DLHA 3B8YA 3LV3A 4R2GB 1MCWW 4UINL 4XXCC 1KEMH 2ZG3A 4XNQB 4OCLC 4Y4KA 3AU1B 3Q6FB 4XNUL 3UPRB 2LU7A 3FQRB 1AC6A 1BWWA 4ESKA 2H32H 2EZ0C 3RFZC 1S7VA 5KSBA 4RMUA 5I17A 4YDLC 5D6CA 4R6UA 1LHZA 3PWPE 2W0FB 3IVKB 2J8UF 4HIXH 5D7SH 3QEUB 4BKLB 1JGEB 1IGML 1IAIH 1MFEH 3VXMD 3KXFA 5E6IB 3DI2B 5LGHH 1BQLH 4UT6L 5KSAA 4HQQH 1YECH 3H3KA 2AJZB 4PJBE 2DQHL 4UTAL 3JSSA 3P9LB 5CGTA 4FTVA 4K7PH 1EO8H 1XF2B 3T1FA 3I75A 5F96L 5C2UB 3HPLA 3QWRD 1FIGL 4KDWA 4HLZG 4EIGB 3CLEH 3ZKNC 2L7UA 2ZG2A 1DLFH 4TNWK 3R1GL 3TA3A 3VDCA 4AH2B 5GSVA 3V4VL 3GSXB 5C6WH 4H1LB 4OIIH 1FV1A 2FD6L 2RFXA 4YK4B 4HWEL 3L3GA 2NXZD 5A2JH 2P47B 5T1DL 2UZIH 3ORJA 3RGHA 1F4HA 1SYVA 3CC5B 2DLGA 2VDLH 1A6UL 1CXHA 3O9WC 3FQUB 4K94C 2H45A 4LSVH 5C0BB 3ESUF 3EOYG 1MWAH 3VCLA 1DFBL 4U6HB 1JGDA 5ADPH 4D9QE 2BVPA 1I7TB 3EBAA 1BGXH 3VFSA 3IFLL 3SCMA 3KPLB 1VENA 2GFBA 4JO4H 5IMLB 3DETD 4PYGA 4P2OB 1ZLWK 3W0WE 3MRIB 3H3PL 4TNVF 5K9OB 4XXCA 1QBMH 1MSPA 2AXFB 3DROB 1Q9LA 1UM6L 2V2WA 2X9WA 3BD4A 2HWZH 3GMQA 4WDIB 1G6VK 1VPOH 3L5XL 3RVTD 1K4CB 1MCPH 1PG7X 3VGAC 2Q86B 1S3KH 3MQIA 1IGCL 2NY2B 2X9XA 2Q8AL 3VXSA 3BZEB 3TWCH 2HJLB 4F58L 1V5JA 3OKLA 4WCYH 3GSRB 3U2SA 4ZFFA 2GW5A 1BQHA 3EYSH 4M5YH 5GJSH 3OX8B 2CO7B 5BXFA 2AK1H 5C0CD 4PJFF 5EIQA 5LBSH 3PL6D 3VXUD 4L3AA 4IRZL 4S2SA 1HKFA 5FYJD 4MNGB 1U8KA 4UT9H 5DURB 2A83A 4PRDA 1A2YB 5B4MC 5F9OH 2OJEB 4FA8A 5HI5C 1J1OL 2XWJB 3E2HB 5E6YA 1SM3H 1ZVSB 2X4UA 2GT9A 3WLBB 4J3WA 4PP1D 5IFJA 3NABH 2VRAA 4UV4L 1REIA 2ZKHL 3TBSB 5T1LD 3SKMB 3ESVF 3QDME 3LQMA 5SV4A 2OMNA 4ZS6D 2D4DA 1T2QH 5F7EL 4YHZL 1QPPA 3KGRA 3MV7E 3O9WA 2QL1A 3EYFB 4KHTL 5EOCH 3TJHD 4LPYA 3TVMC 3BZ4A 4QF1A 4YNYB 2HRLA 4I3SL 4YDIH 1WEJH 1BIIB 4PJXB 2VUOA 3DXAA 4JREB 4IHOA 5SWQA 3V79C 4X0KA 1R5IB 3UDWC 1FN4B 3OGCB 1PG7W 4TUKL 4ELMA 3WFHB 5C2BH 5LXGH 2Y9RT 4ZUSA 4I18B 3OB0H 1ZHBA 5TDOA 1DLHA 1TZIA 2V9RA 4EUPA 1LD9B 3OPZL 3VFRB 3VI4E 1KNOB 1P5UA 1I9RL 1FFOA 3U7WH 4JRYB 1MCOH 3L3HA 5C9JA 3MC0A 2BZDA 3ZDYE 3VMPA 4KZDL 5C09A 1CE1L 4WY7H 3RWEA 1BBDL 5E0QA 1QSFB 2NY1D 4WI9A 4YXHH 1RU9L 5SWZD 5IW6B 3DUSA 1JWUB 2ZCHL 2E7HA 4DW2H 1AO7D 1N0XL 3AREB 4FZ8L 1LDPL 2C1PB 1CR9H 3TBYA 2BVOB 5MP6H 4BH8B 1TETL 3T65B 1GZPA 3B9KC 3WUWA 1NCDL 1Q0YH 3JWDC 1YYLL 3RL1A 4HIJA 2IAMD 2YPLD 1LE9A 4MDIB 4U6YB 3HE7C 2D7TH 1AY1L 1HSAB 4A6YA 2HVJB 2IG2H 4J6RL 4LVEA 1R5VB 5L2JA 1KXQE 4P9HL 1YPZB 1I1YA 1OL0A 4HEME 4JR9H 2PR4L 2VZ3A 3R0NA 5IQ7H 4FQJL 4KKBD 4WHDA 1OOAA 3BISA 4G6JL 2VXTL 4HUWB 4OBRA 3RU8H 5I19H 3FO2A 1R6VA 3TVMA 1WWBX 2HT2C 4OQ1A 5D2LF 3LB6D 4ZSOB 1KLFA 3QEQA 4OSUL 5ICXB 5HYJD 1E4KA 3T2QA 4ZUVA 2J7LA 5DR5H 2P43B 4PLOB 3BP6B 2K9UA 3DHJA 3UDWA 4HXAH 3IXTB 1ZTXH 4L9LB 3QULA 1A7OL 1JI2A 4GS7C 2CK0L 5IEHB 2JJUA 3T4AA 4U1JA 1ODAA 3H9SD 4QRRA 5CINL 5I66B 5DUBB 5DMGC 4MQXC 3STLB 2BRRL 3V7AE 4OFYD 4AQ1B 43CAB 3PDGA 5EU3B 3RKPA 3GSQB 4X5WB 1X5HA 4P5TB 4OZHA 4NQEA 4XB7A 4JRXB 4MA7L 3ETBF 4JJ5B 1QQDA 4FNLL 4OAWA 1IFHL 3X11A 1QNZH 2W9DL 5DVMA 2MHAA 3KYKH 1U8QB 2VLKB 4JM4H 5GGSB 2R2CA 3MOBH 4UNUA 2XWTB 3VRLE 1RK1B 3B9KA 5GGRY 5EZLA 1OM3L 1KIPB 4DKEL 5IWLC 5CGYC 1ADQH 2JJTC 3HE7A 4NNPL 4Z5RA 2DQGH 1DN0B 4PJ5B 2ESVE 1MAML 4LEOA 3EDKA 5EC1A 2W9LA 4OF0A 1MEXH 3MUJA 5KG9A 3ZMRA 4YDKH 2UWEE 3O2DH 4GAJH 2NY7L 5C0DA 1CGSL 1TCRB 5HYQB 3JV6B 1DQLL 3KR3L 3WJJC 4HWBA 2BOCB 3KLDA 4X9GA 1QKZH 4R97C 4XCCL 3B6SB 4YDJA 3VFNB 4F8TA 5ESQA 4TOYL 2BJML 2FCBA 3D18B 4N9GB 1NAMH 5C3TA 4JZOA 1C5DB 3G5VB 3REVA 1CDIA 4BQCA 5IVNA 5HHMD 2F53E 1FH5L 2FGWH 4ENEC 4P9MH 3LKNA 4P2QE 3R4DA 5DMKA 1NEUA 1IAOB 4GAFB 3BRFA 5CLTA 1IM3B 1RUQH 3IKCB 2A6JB 2HJFB 3T04D 4OGYH 2DKMA 2CRMA 4MS8D 1NLBL 4RQQA 3HRZA 4FS0A 4XPAL 3E6HA 1QLRA 4GJTB 2NXZC 1MREL 3VGGA 4F7EB 1YDPA 3F7PC 4H20L 1CXLA 1AFVH 3GRWH 3VFWA 4PJHF 2XZCH 1WWCA 1Q72L 3WO4C 4DTGH 3T8XB 4YO0A 1E6OL 3CX2A 4KJQD 5D8JH 2WBJC 4PREB 1TZHB 1ORSA 3TNNB 4N8VG 3C9NB 5E2TH 4EJ1C 1PDKA 3DETC 4MWFB 5D1XB 4PRIB 5I1JL 1A6ZA 4DUWA 1DBAH 1BD2E 3GMRB 3MLRH 2QV2A 1I1FB 1INQB 1BFTA 4PBVC 3I02B 4U33A 4WUKL 5E70A 3JV0A 4QRSA 1D9KB 4L8DB 4MNHA 5IWLA 5EWIH 2JJTA 3DIFB 3RVTC 4DVBB 4X99B 4OZGB 5CP3H 1MFBL 4G6KL 3TZVB 5F7WC 2CDEB 3M17A 1DBBH 5JXAH 2YA2A 4X6CB 4KAQL 2Z92B 3N0PB 4NHCL 2AEWA 4UIMB 4DGVL 1RMFL 1FYTB 2H32A 3VXMA 1N59B 1CFNA 5DEZA 4KQ3L 3WJJA 1MCSA 4YHPA 1YZZA 4M43H 1GH7A 1E0OB 4IOFD 3BKML 3PL6C 4C83A 5D5MF 3NH7L 4WHCA 2YEZB 2EEBA 1WIOA 1AR2A 1DQDH 4L4TD 2VL5A 3K80A 4KV5E 3QWRA 3KPRD 2QJDA 3KPOA 2I5YH 25C8H 3D25B 2HVKB 5INCA 3RVUD 3WHE0 5AD0B 1NDGA 1X5AA 1A47A 4X80L 1FFNB 5DJYB 5C0FA 5CHNB 2UYLB 4JPKH 5F88A 1GGCL 3X17A 4FQCL 3RWIA 3GO1L 1YC7A 2FR4B 5ESAA 4ZS6C 4J23A 5FKAB 1WAAE 4NM8L 3C6SB 4PJGB 2B0SL 2NPLX 3M45A 1FNAA 2AI0L 3TJHC 2XTLA 4Z0BL 2APVA 5CSZA 3NZHH 2WBJA 1OD7A 1NGZA 1ZA6B 4RRPA 5D70L 2YA0A 3T2PA 2JJVA 5IR1A 1BMGA 3P77B 2BNQE 5CBEB 3EFDH 3SKNB 2CXKA 4KHXL 4UQ3B 4OJFL 3F7YA 1HOCA 4N8VB 4WU7B 1MWAA 1UKTA 3MTRA 4Y16D 3GJFB 3VFVB 1DUYA 2NMSA 5HJ3B 5MHSD 4UU9B 3ZDXE 3QUZC 2JB6B 1BLNA 3QUKA 1IGJB 4RFNC 1IGYB 2FH8A 3DECA 1X4ZA 2VDKH 1EMTL 1BPVA 4JZNB 4JY6B 4OM1H 3RRQA 5CJQH 3RNKB 3W39B 1H9VA 3HKFA 1NC2B 4ONOA 4GUPB 4YUEH 1A1MA 3LSOB 4BK4A 2UVFA 3IAGC 3ALXA 2QADB 3WEXB 1OGTA 1I8LC 1WV7T 3H7LA 2VLRE 4IOIA 5C0CA 1UKQA 1Z9MA 4R2GD 1YEDA 2X4NB 4LKCB 3WSQL 3SDCD 1YJDH 2OR9H 3PL6A 1OLLA 3MNZB 3QXDB 4CN4A 5KVEH 2F5BH 1NFKA 1HINL 2HFFB 4PPTA 5TDPB 2FDBP 4N0UE 1LO2L 2IAMC 4MSWB 4OUUB 5GGTH 3RNQB 3BWUC 1WIUA 3ARUA 4BFIA 1HXYA 3C60D 2MPAH 4V1DB 3EZJB 1TJIH 1MFCL 2B5IB 1V05A 1ZMYA 5ISZD 4K3JL 4E0RA 4PLNC 1QYGH 1ZVYA 2E7CA 3HPJA 2AKRA 5BVJB 4U3CA 2XWBB 3PNWA 1UXWA 2BC4B 2PW2A 1JYNA 1JVKA 3IFPB 3IJHA 4HKJB 3RUGE 3B4NA 5EO0A 1GGBL 2IWGA 2VR4A 4OUOA 2EYSB 5IT2H 2FJGA 1MIMH 2R2EB 1ND0A 3U79A 3GZKA 3SKJL 3VI3E 4JPIB 1N4XL 3L95B 1R3IL 2PYEA 4GBXB 4XWOD 4NUJA 4S11A 3ZT7A 3BD3A 3LB6C 1HQRA 1JHKL 2DQIL 1AGCB 1SEBA 5I16B 1HNGA 3ZKSD 4PY7A 1D5XB 4AIZA 1B6UA 2MCPL 5ADOH 4P2RE 1RV6X 4QHMA 5I1AB 1MVUA 4UV7L 1S9VB 2CIKA 5AG9A 2VZSA 3QUZA 3TGXA 2CK2A 3MLYH 3P40A 3BESR 1JZ8A 3WLWD 1K2DA 4HZLA 3Q48A 1JI1A 2R2BB 4D8PB 1H3PL 5T1KD 1NMCC 3UCRA 4AENA 1MHCB 4JFXA 3MLPA 4L29B 1V7NH 1F6AB 1A6WH 4K2UH 4Q9RH 2ICEA 3MA9H 2HLAA 4G9FE 4X5XB 1I8LA 4WVRA 2HKFL 5M7QA 3MRFA 5JW4Q 4PGDB 5E9DE 5BV7B 3WNMA 2VC2L 2HFGH 4YGVA 5K9KA 1CT8B 2OP4H 1QO3B 3AXLA 3UTTE 1IT9H 1CG9A 2IAMA 3I50H 5DMIL 4JANB 4JQIL 5DFTA 5I73C 2C26A 3QQ4A 4OM0H 1JF1A 5F3HA 2F54D 3O3BB 2PXYD 3L5HA 5FECB 3G08B 3NACH 4LMQE 5DUPH 4ZNEE 1FNFA 4PJHA 5TE4H 4UI2A 3LQZB 5SWSE 4WI6A 5BOPA 4Y4HD 2F58H 1HILA 2X44D 3ABZA 3T0EC 3FO9A 4DOHE 1YEFH 3FQXA 5DURD 4P3DA 3CK0L 2F74B 4GRWH 4TQEH 5FK9A 4ONGL 4M62H 3VE0A 1P7KB 5MERB 4Z8FL 2EDRA 5DD6B 3JWOL 2D0GA 1YEJH 4GW4A 4L3CB 4LDOB 2BRQA 3BEVA 1FG2A 4M7LH 4G8IB 1AXTL 4QRPD 3CDGA 3ILPB 3ARWA 4GW1A 4LARH 4F9LC 4GLRH 3ZE2F 4MS8C 4XGZB 4BQ8A 1G9EA 5ALBH 3KPSE 1A9EA 2W92A 3L3IA 3F7VA 4PJ9B 1FZKB 5ANMA 2AV1B 4PRNB 4DN4H 4S10A 3MLVL 1JV5B 3HR5B 3IDUA 3C5ZD 3RJQB 3MV11 4KJQC 1F8TH 4L5FL 3T77B 4RWHA 3U4AA 2JCCE 1ZWIB 2VXQH 4CNIB 1NBZB 1WBXA 1MCIA 1CXFA 2QEJA 4Y4FC 3K46A 3LS4H 4XVSH 5D5MA 3WFEL 1FE8H 3TCXA 3CX5K 4ZFZB 1NGXB 2WUCL 2YD2A 3INUH 4P5MB 1W0YT 2AGJL 5HYSA 4L4VA 1ZHLB 2EDNA 4TRPL 1C08B 5DD0L 3L7FB 3N85H 4KUZH 4DQOL 1OAQL 5ITBH 4BUGA 4NZTL 4JRYD 1V3MA 2R1YA 3MBEB 4HWUA 2WWKT 2R56H 1YA5A 4AMKH 2QLVB 1BM3H 4RMSA 4HFWB 3B5TA 2KDGA 1BAFH 3CSBA 4NZUL 5FM4A 1VFAB 5KVFH 3U82B 5ALCL 2X4TB 2J5LC 3LD8C 1ADQA 3ARED 3NA9H 3D1MC 2Q87A 1I3GH 1LO0H 4H88H 2BXYA 2EYTA 1OWRM 1JNLH 3ME0A 5AYUH 3KPTA 3NCEB 4KH2A 3T0EA 2IBGA 3BKYL 4TVPH 1IQDA 3OR6A 1K4DA 2DTSA 3QUXB 3O2DA 3PGFL 3Q0HA 1J8KA 3MNVB 2A9NH 5F1SA 2BVQA 3MLZL 4OGZA 1PKOA 2A6DB 2V5SA 4Q2ZA 4NPYA 3RVUC 3OKKA 4PJDB 2BDNH 3FRPA 5DJAB 1YN7B 1NAMA 2PYFB 1N0LA 4J4PD 3DYPA 3FZUC 4F9LA 3QNYB 1JHLL 5F7KC 3K8KA 4YDVA 2CLRB 3MRPB 3IDNA 4Q6YA 3OXRB 5CD5D 3I6LD 4QHLA 3O45A 4M3KB 1RI8A 2I9LA 5D7IA 1INDL 2VXSL 5EO1A 4R90H 1FL6B 2V7NB 4E5XA 1T7VA 3EO0B 4PJIE 5I6XC 4HC1A 4WV1A 2LAGB 3IDMA 2P24B 4X6BA 1DBJL 4FQ1H 4LL9A 2VH5H 4Y4FA 3VMOA 3C5JA 5T3ZH 3GRWA 1KCUL 4NP4H 5DEGA 4HG4J 2ORBL 4NCC1 2OSLB 1BEYH 4JPVL 5JOEA 4YIQA 4Y16C 4QY8A 1P69B 1MI5D 5L7XH 5GGRB 4WU5A 4FXKA 4NQUA 2XIDA 1TNMA 4XNMA 3KNBA 1D5MB 4GRWF 5AZ2H 5A2KH 1UM4H 1NPUA 4URTB 1XGQB 2AK4E 5HHVL 2VAAA 5J1SC 1Z3GL 4XZUA 3MJ6A 3KJ6H 4LVOB 2X1OA 1Z9LA 4R8WH 4WFGD 3WJLC 4P5TD 1TVHB 1CVSC 1RAMA 1C8PA 4JRXD 1JP5A 3SGEI 1BZ9A 3BE1L 2J6EA 3MNWB 4QHUB 4N9OB 2IFFH 4EKXA 4JHAL 4XCNB 1MUJB 5MEPB 4ZTPH 4OLUL 4M8QB 2EDTA 2NY5L 3D9AL 5CP3A 4EVNA 4B53A 2GAZB 2VWEC 4KK6D 2FBJH 4QNPE 4LNRB 4Y2DB 5J89A 3SDCC 4ONFH 1AD0B 4PJEF 3QG6A 5EBWB 5BCAA 5IHZB 4X4MA 5D7KD 3FQWA 3LEYH 1T80A 2J4WL 1WQVT 3Q1SH 3CVHL 2X4OA 4I9WD 3UTQA 3TBVB 3ARTA 3KPRA 3C60C 5KN5A 1Q9KA 3J7HA 4PJ5D 1ZGLB 4MA8L 1AHWC 1U92A 4NIKB 5CEZL 4ODVL 3IXAB 4PG2C 3PDDA 1IQWH 4JVUA 5C7XH 1U6AL 4I2XA 1IKNC 3MGOA 4ALAH 5JA8B 5GHWH 1JL8A 4MXVE 1OAXH 4U1GC 2DMCA 1S9XA 4HPYH 2IBZX 5IMOA 4IMLB 1YY9D 1NUNB 5EO9A 3ZYJA 3ES6A 4Y19D 3BN3B 4PBXA 3UO1L 4W4NA 3HC0A 3ELAT 3EIFA 3LN4B 4WENB 3BAEH 5HHOA 2E9BA 1OT1A 3STZA 4MDJA 3QWOA 3U6RA 4CRPA 3K2MC 4I0PB 1NCAH 3GMPB 32C2B 4MAUL 4Y16A 3G9VA 1CLOH 3BP7A 2D7NA 4YE4L 1YPZF 2FX7H 4YHYC 3F58H 1MCQA 1XGYH 3FB6A 3VH8A 4HWZB 3PHQB 5F9WB 4FXGB 5SX4I 3V5DB 4L4JA 4J1UA 2BY0A 3WJLA 4ZOCA 3UEZA 5JMRA 1NFDE 3C8KB 4HCRH 5HSFA 5IB3A 1YNTA 5DK0B 4KXZH 4CMHB 4XNZB 4O2FA 1B0RA 4APQB 1OB1B 1IGTA 4LIQE 2NW2A 1U8MB 1G6RB 4M03A 1OP5K 1KN2L 3HZVA 1OAKH 5J56B 3LRGA 1CGUA 3MMEA 1XR9A 3LIZL 1N6QH 2BSTA 5T3XD 1ZLSH 1WF5A 4HIEB 2AP2A 4B7LA 1GHFL 2VUYA 4EOWH 4FQHA 1RZJH 2IPKB 3TCLB 4X4YA 2P8PB 3HI5H 5D7LE 3Q5YA 3C60A 1A22B 4I48B 5EC2A 1AHWA 1Z9OA 5GS0L 5BV7L 5ISZA 3CMGA 3OXSB 3KPMB 4XPFH 3ULVH 1XGUA 4PG2A 3PWNB 3V4UL 2QQLH 3IDYC 4FTVE 3L3OA 1TIUA 1FYTD 2KQMA 4KMTL 4L3EB 1KIUA 4ONHA 4DN3L 5BRZB 2PXYC 4UBDD 4OGXH 4GAYA 2K7PA 1IKNA 4PRBB 1KJ3L 5GGTA 4DWHA 5E2WL 2XPGA 1RZKC 3CH1A 3VFOA 2P4AB 4P99A 3V6OE 1FO0H 2BHYA 3ZTJG 2FB4H 5DJ0B 4XX1G 4Y4HC 3AFLA 3IU4L 3B2UC 3DGGB 2CLZA 5E1AB 2CDGB 3LHPL 4NGHL 4X4XB 2R1XB 3L3JA 35C8H 2KL6A 1UJ3B 4IIQC 3N9GL 2ERJB 2VABB 4F3FA 1DDHB 5HGBA 5CUSL 3S34H 1JF5A 1G1CA 3UZVB 1VB9A 4NKOA 2R15A 4WI2A 1DBMH 5FV2A 4HS3A 1EGJA 3D48R 3J8F7 3G9AB 3QDJE 3EJZD 1J1PL 1JPST 3H8NA 1I1RA 1ONQB 3WS3B 2ZP0T 4AT6B 1IBGH 4LCUA 2IQAA 5DHVB 3GK8H 4GXVH 4ZUTB 1GC1L 5EU7E 5HHXL 1CD0A 1NCCH 3FOMA 2BNUA 2BY3A 5HGAA 3VG0H 2Z35A 3C6LD 2NTFA 4NQXA 2R23A 3C5ZC 1UWEL 1DVFC 4XB8A 1XH3A 5T1KA 3VFUB 2F53B 4UNVA 3GI9L 3HNSH 4P2QB 5GRXG 3T09A 1H5BB 1FORH 2I60L 1UB6B 3NGBB 4RMVA 4EDXA 3KLAA 2G75B 1QSEB 2NNAA 1HH6A 2Y36L 2WINB 5IMKB 1KG0A 2D9QB 1A1NB 4X6DA 4ODXA 4KRMB 4PJAE 5EZJB 2X41A 1F2QA 2FJFA 2YBRB 4YQXH 3NIFF 2VXUL 2ZJSH 3QR2A 3DGCR 2A6KA 1NKOA 2YD3A 4KRPC 2YXMA 1S7TB 4GSDL 1MRFH 3OKOA 3MV9B 2JELH 3H3BC 2OJZH 4GXUN 2B1AL 4TSBH 4X7TB 1FGNL 2F54A 3CFEB 1FLRL 2PXYA 2QADD 4XRCB 4U1IB 4WWKD 3TO4D 5E4EB 3CVIL 3KJ4B 1RJYB 4AL8H 5I0DA 2DOCA 4NO2B 5D1ZD 4Y4HA 1BD2B 1QACA 5DDHA 4GRLB 1J05B 2XN9A 4P4KB 4IJ3B 2AJ3A 2A73B 1MLBA 4PJCA 4IIQA 4C54A 5HVWA 1IKFH 2CRIA 5TQ2H 3MJ7B 2E5EA 1OGAE 5FA4B 3RA7L 5F6IB 1UCBH 2DWDB 3MYJA 4QRPA 5TDNB 2NX5D 4QYOB 4OZGF 4G3YL 3G6JA 1LO4L 3D39E 1SJHB 4J4PC 2N7BA 1BFVH 1KB9J 2DLEA 3U4EB 3DRQA 3MFFA 4QGYA 2B7DT 2CR6A 1VACB 3PWLB 5J3HD 1FLTX 1CICC 2QQNH 5FYKD 5CGMA 3IJYB 1INEH 1RIHH 3BXNB 3GGWB 1WZ1L 3C5ZA 1QRKA 3WV0A 3ECBB 1DVFA 1FPTH 2VDOH 2XYCA 4HUVA 4HSQA 1S8DA 4JY5H 3WE6B 1N26A 2LV4A 4K3EL 1CI5A 1UADC 4LEXL 3WNOA 4NJAL 3ZTNH 1AQKH 4E41D 3P0YL 3EYVA 1YQVL 1DQJB 4RCAA 1MJJA 1TLKA 1JZ6A 4F7MA 4Y5YB 2VXVH 4LSQL 3MLSH 1T1YB 1NGPH 3FB8A 2UZXB 2BFVH 5C0IA 1CLYH 2R1WB 4K7FA 4UTBL 4LPCA 1A3RH 2A74B 5JUEH 1IC7L 1A21A 2VISB 3IDIA 5KS9A 1MAJA 4PJGF 5F1OB 1UGNA 4EN3B 3MGTB 2W0LA 2BNQB 1PKQA 4JFFB 4M93B 4UAOC 3BMWA 3RZCC 4XAKE 3MRQB 1DQTA 4RFOL 3IF1B 3KHQA 5GJTL 3OZ9L 3HNVL 4ORGA 1ACYL 4WW2B 1T04A 1J86A 1TJGH 1LMKA 1T4KA 3G5ZA 4XCYB 4HBCH 5ACZB 3BYYA 3ZDZF 3KPPB 4GKSA 3B9VA 1WTLA 1LEKA 4ZFGL 4MGXA 3D2UB 1HXMA 3HE6B 4RNRB 4UINH 3VFPA 3O41A 4J4PA 5L0QB 4TNVK 2EDEA 4XNUH 3WIFB 2VITB 1DE4A 2X10A 1ZLVH 4JZJB 2N4IA 1RD6A 3SDXE 3C8DA 5FGCB 5AAMA 4XPGL 3U48A 1CICA 3EFFA 4P49A 3S5LA 5IKCB 1R0AH 5JA9A 4YHIB 5DGQA 1YY9C 3MV8E 3JVGC 3WS6C 4QWWC 3PWUB 1YY8B 4G7YL 3HNTH 4HUXB 1CDYA 2IPTH 3LKRB 4UT6H 5A43C 5KVGH 4YH6A 2NY6B 5GGVH 5J12B 3RGVD 2DQHH 4UTAH 2J8UE 1T83C 5KVDL 3ARFC 1D6VL 4WI4A 2WLYA 4NC2B 1QFPA 1N3NB 2D31B 1JWMA 5DRZB 3RWDA 3H0TB 5C9KA 1MI5A 4PJ9D 3DRTA 4NRZB 4HGWA 1FIGH 3NOIA 3RWCB 1A7PL 2VDRL 4CW1B 4R96B 1Y0LB 4NDMA 4DZBB 5ID0A 3TC9A 4S1QL 3V4VH 3VRIA 3WHXB 1OTUD 1OWWA 1XIWA 5INDA 3KLHD 1GSMA 4ZXBD 1X5JA 4WTZG 4HWEH 1VERA 5FCSH 4S1SL 4DVRH 1N6UA 5DJDB 4Y89A 3RZCA 3LAFA 1CLZL 1A6UH 1QFWI 5GGUB 4PV9A 1W72L 4P2RB 3QSKB 2BMKA 2R0ZH 4LCWB 5IW1B 3MFGB 4JO3L 1DFBH 4HS8L 1KJMB 5C3LD 3IFLH 2O5ZL 4J3OC 4TSCL 2HJKB 4KUCD 4Q74A 3MBED 2RCSL 4PS4L 3DTXA 1P7QA 3LRSB 3FFCA 2OXHA 3H3PH 4PTUB 2WWMD 4PJ8C 2VDNL 1RZJC 1UM6H 4LHJB 2NYYD 2CQVA 4UBDC 5DJXB 4JDVA 2Z4QB 4F7TA 1MY7A 3VD5A 4H5SB 3L5XH 4D0CA 2DIBA 1EFXB 1TTGA 5IB4A 3KVQA 3ULVC 2Q8AH 1IGCH 3EUUA 1UYWL 3O3EA 3UTSE 5JLZB 3JVGA 2ADIA 3WS6A 4C4KT 2BOBA 4F7CB 4U1KB 3QUXD 4F58H 4Y19A 5LGKA 4JG0L 1E28B 4Q58C 5I30L 3FAXA 4QTIH 4OZIA 4NQVA 2FGZA 1RURH 1A6AB 4X98B 4Z7VF 15C8L 4LLUB 4LPVA 4ZUUA 1ETZA 4LPUA 2DLFH 4N8CH 2E27L 4KPHL 2Y25A 4JY4B 5I1DB 1L7TH 1T83A 3O6LL 3ARFA 2KPNA 4ZPVA 3TN0C 4IRZH 3NFNB 1ZA3B 1MCJA 5DHXB 5ERWA 5FHAL 1D6EB 1BZ7B 4BELD 1S7SA 5A2IH 2XG4A 2J8HA 3P3YA 4OCWL 3MXVL 5I8OL 4PJFE 1J1OH 2A1WL 4X83A 3C6LC 1OD9A 1RFDL 5JTWA 1S9WA 5EG6C 3GSOA 5FM5O 3CZJA 4O02L 4DOHB 2Z93B 1HH9B 4I5BB 4CVUA 1RQ5A 2C7UB 4UV4H 1IM9D 2ZKHH 5F7FA 5DVNA 3FO1B 2X4SA 3O4LA 3BJ91 1BQUA 2KKQA 4OB5L 1LP9F 4D2NA 2H3NA 3EGSB 4FQ2L 4JLRB 3BZFB 1J12A 2Y6SD 3MRBB 1HCFX 5F7EH 3HAEG 4CVZA 5E94B 3P30L 3QAZC 4HCRA 4HUNB 1FJ1A 3TO2A 2Y5TB 3B3IA 1NL0L 3SOBL 5ELIA 2AW2A 2FZ3B 3MJ9L 1EAPB 1Q0XH 3VXME 4MJ4A 3OR7B 4UB0H 1T20B 3TBWB 5I9QB 3QDGB 2VE6B 5HYFA 3O2VH 5CJXC 4TUKH 2OQJB 1QR1B 4PJ8A 3QIUD 2O93L 4RAHA 3MLTB 4OF3A 3AMKA 2XKNB 3EOBA 3DV6A 5DEFA 4LHUD 3ZKQD 2YA1A 4WEUD 5GRYA 4KROD 4PGJA 3OPZH 4WWKC 3TO4C 4HUMB 5J4MA 4J8RA 4XCFL 2J8OA 1I9RH 1TDQA 1U3JA 4M7KH 4Y2DD 2OLDA 5DT1L 5EOQL 5D1ZC 1GOFA 4HX1A 3TJEL 1NEZA 3MO1A 2IH3B 4H25B 4G8GA 1CE1H 1HCVA 4N8PA 3B9DA 4HK3N 4LLQA 1BBDH 4YHNB 3GJEA 5C0JA 1YEKL 1RU9H 3BO8B 3BSZL 1P2CB 1R3KA 4NKIL 3U0TB 4PBWD 5DZLA 5E8EB 2ZNXA 1NBYB 5L8LB 1FO0A 2ZCHH 1KJ2B 1N0XH 3D69B 3NTCL 4NM4L 3V6ZB 4FZ8H 5JZ7D 1LDPH 4K7PX 4KUCF 3W2DL 5ITFB 2GJ6D 2V2TB 3DMMB 5JPNA 1JFQH 1TETH 4WI8A 2DM3A 3TN0A 2DD8H 1NCDH 2EE2A 3DVIA 4GMTL 4LK4A 1VESA 5F9JA 5L2KD 5E5MB 5IFAL 3MLXL 1MAKA 3CFBB 4M7ZC 1OF2A 4O2CB 1AY1H 1KIRA 1R3LB 3C6LA 5F72S 5C0AA 1D5IL 4MJIE 4J6RH 1EX0A 4KTEL 4LDEB 1XFPA 2Q7YA 1KLGB 4P9HH 1BJMA 3SJVA 5DK2A 3E3QE 3OJDB 5J1AA 3NCYP 5HVGB 1KTDA 1V3JA 2ZUVA 2G2RB 4O4YL 3ULUL 3OB0K 4FQJH 3BIBX 1A1OB 4U6VL 5CWSB 3T0DA 1UWGL 4G6JH 1ZHKA 2VXTH 2I27N 3U83A 4PJDF 1EEQA 5JR1L 3QXAB 4K71B 3HAEB 3UBXG 4P57B 4JFPA 3EDDA 4PP2B 5EA0L 2KZWA 1S7QA 5I1HH 4OSUH 4FFVC 3UC0L 2NY3B 2HT3D 4HDIA 5DRNB 4LSRL 4PG9B 5C0CE 2FHFA 2E7MA 5GQBA 4JB9L 3CPLB 3VXUE 1DN2A 5IMMB 5D2LE 3BP5B 4TVSa 1Y18A 2CK0H 3MUZ1 5FYJE 5I75C 3LKQB 5B8CB 5CINH 2HH0H 3LPGA 3DJ9A 3FOLB 4WHTA 4WWKA 3TO4A 4GW5B 1I3VA 5A3IC 2BRRH 4U1SB 2EDDA 3PQYB 2NCMA 1J0HA 2VAJA 5D1ZA 3EO9L 3PP4L 2XY2A 1I75A 3N1PC 2PKDA 1NCBL 3D3VD 2K1MA 3DO3A 3AM8C 1VEPA 4MA7H 4LASL 2AK4B 4FNLH 1YEHH 1TJHL 2QTEA 1F11A 2W9DH 1MLCA 4TNWF 1XGPB 2V5MA 5F1IB 3KPQA 1RUPH 3ET9F 2R4SL 3EDFA 4JM2B 4PJ7A 2NX5A 4HIHA 3MRHA 2YSSA 3VD7A 1UVQA 2NZIA 4L3ED 4H8WL 4R4BA 5BRZD 1OM3H 3NN8A 4Z76B 5ICYB 1FZJB 3O3AA 2V5TA 5IVXA 2QSTA 4DKEH 1KT2A 1T6VN 4CL7A 4L8CB 1MJUL 1ORQA 4NNPH 5J9PA 1G7HB 4CADA 4MA3A 3KYOB 3U9UA 1MAMH 3OQ3B 3CFJA 4YFLF 1JN6A 3P73B 3FTGB 3I85A 3QNXA 1CGSH 4BSWA 4RWYL 4UOJA 3EOAA 5ESVA 1DQLH 1JK8B 1G7IA 1MQKL 3KR3H 2ZUUA 3VXOA 5HTSA 2ARJB 4X8JA 3HZMA 3K0WA 3RGVC 5JNYA 4E41A 4TOYH 1MCRA 4N5ED 1AE6L 5ACMA 4U1MA 1H3TA 1ZSDA 2HRPL 4MNQD 5IB5B 5IVZA 2JIXA 4ZD3L 2EDYA 5MEOB 1I8KB 1E27B 1S7UA 5SWZE 3KYMB 5L6YL 2EIEA 3CLFH 3W9EA 4OGAC 4U0RC 1AO7E 1CFTB 2ILLA 1JPTL 2EICA 1NLBH 1R3HA 3KLHC 1UB5B 3MLWL 4ZXBC 3MUGB 4XPAH 2V7HB 1T1ZA 1MREH 4ZOEA 4QOKD 1BQSA 4M8VA 4H20H 1Z2KA 2P5WE 1CE6B 2YPLE 3FQTB 7FABH 2APXA 5J6GB 1XCTA 4XH2B 3QNZB 1A7RL 1KTLA 4UDUA 5JIKA 3FT2B 2G9HA 1AD9B 2AABL 2A9ML 2P7TA 3AM8A 3CCHA 4F7PB 3HFMH 4Z7VA 1NGWB 4CMMB 1ZHNB 1T5WB 5GZND 1QFUH 4KI5C 2VZOA 1RZIB 2IH1B 3LV3B 3MR9A 5I1JH 1I9EA 5AG8A 4G5ZL 4Y4KB 3K1KC 1EJOL 2ICWA 2OTUA 4D3CL 2DL9A 3EYUL 2C3VA 2NYYC 4WUKH 4NNYA 1PGRB 1K5NA 1S7VB 1KPUA 5KSBB 4NQTA 5I17B 3IDXH 3GIZL 5D6CB 3W9DA 5HYJE 1MFBH 4G6KH 5DD1L 5J0BA 1BQHG 5H35A 3RWJA 1HEZA 4QLRA 4KAQH 4G8FA 1LP9A 4NHCH 5JPMA 1EXUA 1MOEA 4DGVH 3KXFB 1RMFH 2VQUA 1IVLA 5KSAB 3H9SE 3C2AL 4KQ3H 5ANME 4M4PA 2EYRA 3C08H 3QFJA 3BKMH 5BS0E 2HG5A 3RGVA 4FTVB 2OYPA 4FABL 3T1FB 2EIDA 3NH7H 5GGQL 4NO0A 4Z78A 3HPLB 3ZO0A 1XF5A 2M26A 2CKBL 4ZQKA 1PBYA 2B2XL 4NN7C 1JZ3A 4MZ3A 4FMKA 1T03H 5T5FL 3TA3B 4XP6L 3UTPD 5GSVB 4L8BA 4XTRD 4X80H 4RBPH 1HYSC 1FV1B 2RFXB 3L3GB 5JO5A 1GGCH 1RUKL 4ZXBA 2B4CH 3GO1H 1SYVB 2VO5A 1J87A 3QQ9D 4Q97A 3SKOA 3VXRE 5FHBL 4OCNC 4HS6A 4LCYA 2B0SH 4XMLL 1HHKA 2AI0H 3VCLB 1FFPA 1JGDB 2WP3O 4Z0BH 1CBVL 3HUJF 2BVPB 4LFHD 3SCMB 1JRHH 3HG1D 3L5WA 2GFBB 3VRJA 3U30B 1F45A 4HULB 2FRGP 2O5XL 2H1PL 4KHXH 4NQCD 1M71A 3HMXA 5DHYA 4MJ5A 1KCRL 4EUPG 9CGTA 5C0RH 3QIUC 4EN3D 1Q9LB 2YS4A 1X6NA 2V2WB 3WNLA 4JFFD 4TTGA 1BFOA 3V52L 3GMQB 4DUXA 4KROC 5HHME 4I0KA 5GS2D 1GGIL 1EMTH 2OR7A 4YDLB 3VXSB 1F4WL 2GCYA 4JFEE 5D96C 5F97E 1UG9A 3U2SB 3OKLB 4PB0L 4ZFFB 1RJZA 4B7IA 1BQHB 4C57C 4MQSB 1IGIL 5BXFB 3WUWG 5IB2A 2YUXA 5EUOF 4S2SB 3BW9A 1U8KB 2A83B 3PHOB 4PRDB 2W0KA 4Z7QF 1G9MH 2X4UB 2GT9B 1G9NL 1MFCH 4OLVL 1AGEA 4XVJL 3L9RA 5IFJB 4K3JH 3G04A 3MROA 2DQDL 1PY4A 1IM9A 1JCKA 3BUYA 4RGMC 3WD5L 2XKUA 3RTQC 1KPVA 1GGBH 1MY5A 4DGYH 4RSVA 5IBLC 3V6FA 4Z7OF 5BO1L 4L8SC 3O9WB 3SKJH 4M7LT 1N4XH 1R3IH 3BZ4B 4QF1B 3SGJC 4OQTL 4F2MA 3IDJA 4XHQA 2NR6D 4OZ4A 1JHKH 4U3HA 3W82A 2DQIH 3DXAB 4IHOB 5SWQB 3RZWA 4HKZA 4X0KB 1P6FA 4ELMB 4LPWA 4ZUSB 2R69L 3QIUA 1NFIA 1FZMA 1ZHBB 2OZ4L 5TDOB 1DLHB 1TZIB 4O51A 4EUPB 3FN3A 4LHUA 4L4TE 5CCKL 4LSTL 1FFOB 4XAWL 3L3HB 3DVNA 3VGAB 5C9JB 2HP4A 5I1EL 5C09B 4LCWD 2XA8L 1BJ8A 1H3PH 3RWEB 5FYLD 5JW3L 5I8KL 3DUSB 1T5XA 1UZ6F 2QHRH 3P11H 4AYFA 2HKFH 3TBYB 4I1NB 2OR8A 2R0LL 3MACL 1GAFL 2GJ6A 1GZPB 2H9GA 3WUWB 3V2AR 4KTYA 1S78D 1G7LA 2XOTA 2DIJA 3MRDA 2IC2A 4B0MM 3QHZL 3RL1B 4HIJB 1XR8A 5L2KA 1LE9B 3BOVA 4XI5D 4TPRH 4NFDA 1EFXD 4HG4K 4KJYA 4F9PC 3S3SA 4A6YB 5DMIH 1AJ7H 1JHTA 2A77L 1IRAY 3BDXA 4WW2F 5L2JB 5E24E 1VKXA 4I4WA 4PIRF 2C3XA 1G0DA 1I1YB 4BFGA 2X70A 4HHAA 3V5HA 3RTQA 2B20A 2YD5A 4Z7WF 4HWNA 1RVFH 5IROC 3KYAA 5EU4A 4L8SA 4PYHA 2HFEA 3QXTA 5A16A 3V4PH 3NBNA 3FO2B 3TVMB 3SGJA 3PWVA 2VSDA 4ONGH 2APBA 3QEQB 4Z8FH 3JWOH 3GSWA 4CVWA 4ZUVB 4JKWA 5I8EA 3TH4T 1CDHA 1CD9B 3RX5A 1ACZA 2FLRT 2AERT 1AR1C 5T5NG 4G6FB 4PGZA 2CMRL 4M48H 3T4AB 4U1JB 4QRRB 4BM7A 3KYNA 4QRQA 2GUOA 5I15L 4NBZB 3MLVH 2DF3A 4FQXD 3UJTL 1QFHA 4HPOL 2PCPA 4QHNA 3U9PL 2BP3A 3H42L 3ZE2E 1F58L 4OZHB 5ISZE 4NQEB 2HA1A 3D3VA 5F8RC 4KQ4L 4JFZL 2MMXA 1QQDB 1WSST 4GG8A 4ODWA 4OAWB 3PIQA 1A3LL 3WIHL 3X11B 2ZSVA 3ARXA 2MHAB 2R9HD 3ZKXC 3B2VL 2PO6D 3WFEH 4YX2H 3B9KB 5EZLB 2WUCH 2AGJH 4TRPH 5DD0H 3DHMA 4MJ2A 3HE7B 4DQOH 4Z5RB 1OAQH 3C5SA 1NANH 4GKNA 4NZTH 4F9PA 1L4IA 1D5BA 4IJ3C 4LEOB 5EC1B 4WHYH 4G43A 5KG9B 4OCXL 1FAKT 4NZUH 2OM5A 2VYRE 5FGBC 1XF3A 5C0DB 4X9HA 5ALCH 4LIQL 2DJSA 1RUMH 4YDJB 1SBSL 1U58A 3I2CL 5IUSA 5ESQB 1BOGA 2X4QA 5IROA 3HUJA 4U31A 4JZOB 1QG3A 3BKYH 4H0IA 3REVB 2Q76A 5C0BE 1BVLA 3PGFH 4MNQA 3QUML 3BUTA 3MLZH 2ITCA 2QSVA 3WFCL 3LKNB 1LK2A 4NBXB 3LVEA 3OKEA 5FUZH 5DMKB 1CZ8H 2CJUL 2WMPA 2VLJD 2X89D 5IEKA 1P53A 1XAUA 3QEUA 3RVVD 1HIML 3IU3A 5CJ5A 3EJYD 4EZMA 4OLWL 4XTRC 5BOZG 4LP4A 1JHLH 4RQQB 5E6IA 3HRZB 4GS7B 2UY6A 4XP9L 3E6HB 1QLRB 3OSKA 1EBAA 3DURA 3HS0A 2BY1A 1YDPB 4QOKA 5CMAA 3VFWB 3ISWA 4RRPG 4YO0B 2VXSH 2Q7NA 1NCWH 3FONA 3S36H 5F21B 5KSUA 1ORSB 2B4CC 2DRUA 1NBVL 5D7JC 1DBJH 3BH9A 4G9DA 2NY3D 5FGSA 4P48A 5EUOA 3QCVL 2E7BA 1G84A 1KCUH 2XACC 3EYQD 1DQML 1YEGL 4YHKL 2ORBH 2FEDD 1A6ZB 1HK6A 4YGAB 4JPVH 4AEEA 1UH3A 2UZYB 1F4YL 1M05A 4MNGE 4QRSB 5IB1A 3QCTL 4MNHB 1J18A 5J06A 5ACLA 3X3FH 5HHVH 1Z3GH 2DYPA 1N5YH 3W11D 3GNML 3M17B 4G7VL 4QRPE 1AGDA 1F2XK 4GFTB 5E2JA 1T6WA 3BE1H 1Q9OA 4JHAH 5FGBA 4NRXA 2H32B 3VXMB 3WFBL 2D7OA 1CFNB 1IZKA 1LILA 1AXIB 2XQYK 4OLUH 4WTWA 3FCTA 2L7JA 3D9AH 4YHPB 2ENSA 4R97B 2YKLL 4D0BA 4W6YB 4JM2D 5HY9A 4C83B 1JNNL 2XRAL 4MVBC 4XCEA 1EH9A 2VL5B 1OP3H 2J4WH 3CVHH 4PJXE 3KPOB 5INCB 2X4RA 4M61A 5EU6A 2EDHA 4MA8H 1NDGB 1FDLL 4PJEE 5CEZH 2P44B 4LKXA 3NPSC 1L6ZA 5C0FB 1DJSA 3FT4A 1U6AH 5F88B 2P5ED 3RWIB 2NXZB 4TUJA 2YOCA 1CF8L 5ESAB 1G9MC 2GIYA 1HE7A 4JRYE 4KKCD 3WO4B 2CRZA 1L0YA 2WBWB 1I8MA 4H26A 5CSZB 2WBJB 2Y5EA 5C0ND 5I1LB 5LAXA 1FFRA 4RMWA 3UO1H 1NGZB 1YEEL 1QSFE 4OD2A 4QO1A 4X6EA 3SQOL 5D7JA 1KB5H 3UJJL 5IR1B 4HZAA 3HG1A 1PKQE 1A4JA 2W59A 2WM0A 1NJ9A 4NUGL 2MKLC 3SDYL 3F7YB 1HOCB 4YWGL 4NQCA 2VKXA 1MWAB 2Q20A 5JDSA 1DUYB 4MAUH 4JG1L 4R3SA 1T3FB 3DUUA 2O61A 4P5KB 4XMPH 1BLNB 2M8XA 2ID5A 5JHLL 1KF9B 3IKKA 5C07D 4ZS7H 1MRCL 2J3SA 2ADGA 2Y07L 1CGYA 4Q7DA 2ZCLL 2JB5L 3JWNC 5DLML 4GMSL 1YPZE 1LQSR 1OGTB 3PHSA 3UXFA 4Z7WA 1QVOA 4IOIB 5C0CB 2D7PA 1EZVX 1YEDB 3QQNA 1F90H 3LEXA 3PL6B 1KN2H 1NH6A 4MB4A 1YMMA 4PRHA 5IBTL 3RJDA 1S78C 1J8HD 1GHFH 3DSNA 1Q94A 1RPQA 4XI5C 4ZSOE 4BFIB 5FDWA 1HXYB 3BJLA 4X9BA 3VJ6A 5E08L 4P2CG 3VXTA 2W9EL 4E0RB 5DMJB 1CD8A 5GS0H 5BV7H 2P45B 4HIIA 3HPJB 2AKRB 5FXCH 3UZQA 3V4UH 3PNWB 1UXWB 2PW2B 4KMTH 1UA6L 1ITBB 3IJHB 2GHWB 1KJ3H 1MI5E 5KSAD 5EO0B 4A6YL 4ZOAA 2FJGB 2HAZA 3VFGL 1ND0B 5K59F 3IU4H 3LHPH 4NGHH 5E8NA 3MA7A 2PYEB 2XZZA 3PGDA 5EZOL 4JM2F 4WFGE 1RK0A 4NUJB 1HQRB 4JRXE 1JGUH 2CUHA 5HPMA 5CUSH 1SEBB 2F19L 2C3GA 3GMLA 1K85A 3VDBA 4PY7B 4C59B 3TA3D 4AIZB 4Y88A 4KK8D 4QHMB 1J1PH 3A67L 2AVGA 4XHJD 1MVUB 4JRWA 2CIKB 2ICCA 2IJ0C 3MCLL 3QUZB 2FECI 2C3HA 3ARVA 5D7KE 4RFNB 4Q6IC 3DVGA 1GC1H 3HTLX 2AEQL 5HHXH 1TCMA 4MD5A 4Z7UA 4I9WE 1T7ZA 4KK5D 1UWEH 4FQXC 1K2DB 4HZLB 4PJ5E 3H9YA 4AENB 4JFXB 4NC1C 3GI9H 4OD3H 3SCMD 4F8QA 4OFDA 1U8IA 2RGSA 4R4FH 3UYPA 1GRWA 1MFAL 2ICEB 1U95A 1T66C 2HLAB 1DL7L 3K2UL 3BKCL 2R9HC 5DQJA 3MRFB 5HYSG 2Y36H 3P4MA 3QXUA 3B83A 3BYTA 2PO6C 1MCFA 4YGVB 3WFDL 2OTPA 5K9KB 4LQFL 4OLZL 2PTVA 2ZUWA 3AXLB 4Y19E 1CG9B 2IAMB 2VXUH 1OP9A 4AY0A 4NWTL 4BYHA 4GAGL 1WGOA 3LKOA 4GG6F 4GSDH 4Z7NF 3QQ4B 5F9AC 3ARBD 2IADA 3OKNA 1IAII 2VZ1A 1JF1B 3JWDL 5F3HB 2XFXA 2B1AH 3NIFE 1FZOA 3M07A 3HZKA 1X5FA 1AQDA 4HH8A 4PJHB 4P46A 4PRPD 1HZHH 1K8DA 3CVIH 3M1BA 3EDEA 1HILB 1RULL 2VOTA 1PX4A 2BXZA 2IFGA 5IBUG 3FO9B 1IEAA 1W0WA 2ITDA 3FQXB 4P3DB 2C3WA 1HHIA 5E2UL 5FK9B 3VE0B 5SX5H 3T0XA 3FRPG 4GW4B 2GTWA 3MRCA 3BEVB 1FG2B 4MXQC 3RA7H 4ZPTA 3RX7A 1DN0A 5KSBF 4FZEH 1JPSL 5KSVA 3CDGB 5LJYH 1F02I 3RVVC 4G3YH 2DMKA 2BCKA 1LO4H 4GW1B 5T33L 2E8YA 1A9EB 1SJEA 1U8JA 3L3IB 4U1HA 4DK3A 3F7VB 5T3XE 3JV6A 1PZUB 3N1QC 5ANMB 4Q6IA 4GKZA 2WQ8A 1A7NL 4EI5C 3AMLA 3B5HA 3O9WD 2LVCA 4OZGE 1WZ1H 4FQXA 2MOVA 3X12A 3TNMA 1NMCB 1UWXH 5GRUL 1MIEL 3BP4A 1RHFA 2X9YA 4YXKL 1WBXB 3DBXA 1FYTE 5BQ7A 2JK5A 4K3EH 3CDFA 1NC4A 4LEXH 3FT3A 1F4AA 3MCKA 4PGCA 2FEDC 5D5MB 3P0YH 1YQVH 1G7QA 2PO6A 2PETA 1FNLA 2CH8A 1GVIA 3MRKA 5CEYA 1NQBA 2IANA 4L4VB 5HYSB 4UQ2A 4LSQH 2R1YB 1U36A 3GIVB 4AK1A 3RIAK 4UTBH 3TIDA 4BQ6A 2ZNWA 5C09D 5I73B 1K6QL 1EIBA 1YEIH 5D1QC 2C4XA 3WIIL 2VR5A 5LKNA 3L3DA 1JNHA 4LSPL 1MCDA 5GJTH 5GGSY