4MDIB

Immune receptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mdiB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mdiB01
2QTEA 4JANB 4J6RH 2EC9U 1VKXA 3SE9L 5FYKL 1AI1H 2Z8VC 3FTGB 4KFZC 1YDPA 1YN7A 5HGHA 4F7TA 1OB1A 1ZKAA 4PUBL 3LDBC 4XP9H 4N90D 4DGYH 3PHQA 5F3BB 1RJCA 1A0QH 1MRCH 3IDMB 5FEBA 4Y5VB 5EZLB 4LCWA 4N1EA 4MJ6A 2W0FA 4P2OA 1A8JH 3QR2A 1SEBB 1JNNL 5KBNC 2YD4A 1AO7D 4PGCB 2VITA 4DTGL 3BPOB 4M7LL 1RY7B 3RU8H 3WKNA 4JN1H 1G0DA 1QFWL 4Z6AT 1EAJA 3IETB 3ARDB 3MLTA 5BV7C 5LGJB 4POZC 1BQSA 3I9GH 3OX8A 3UTPD 2XWTB 2AJ3B 1HQ4B 1AJ7L 1DN0B 3H0TA 4XC3H 5E2VH 2PETA 1F4AA 2Z4QA 1MFCL 1LK2B 5I73C 2AGJH 3PGDA 4AQOA 5DJ8B 4M7ZC 3RGVC 5JW3L 3BZFB 3V5DA 1T0MA 3DMMD 1KPVB 3KJ4C 5IP4A 5INDB 1YEDA 3I75B 5D1ZD 3PWPE 1KCUH 1MY5A 4QRPB 5DEFB 4OLXL 4W4OA 3TA3B 2BERA 3N9GL 1HEZA 3OGOE 1N7MH 1G7MA 4K3DH 1DANU 3SOBL 3SDDC 5C6PB 4LARH 6FABL 2ATPA 1TQCB 1KJMB 4X7DC 2IMNA 5CKGA 3ULVF 1UWGH 1T5XA 1U6AL 1XIWB 4KVNL 2DQJL 3DSFL 3SO5A 5AG8A 1W72H 3BQUA 5F9JB 4L8DB 1J7VR 2DYPA 3CX5K 3C5JA 2DM4A 4LDLB 4M5ZL 1A6AB 1P4LB 4NO0D 5C0NC 2YZ8A 4HJGB 5EIVA 3ELAT 5D70L 2A9NL 5EC1A 1CGUA 3DGGA 4DGIL 3EDDA 3L7FB 2IBZY 3QULB 3PP3K 1XR9B 2YXFA 3VE0A 3DXAE 4NYLB 2MKLC 3HZKA 4XI5D 4KHTH 5TQ0L 3MLUL 2AK1L 4OJFH 3FB5A 3QQ9C 5TGBA 5GGVY 4OGAC 1TQBB 1DL7H 4ORGB 3ZE1F 2NPLX 4NKIL 4GW1B 2NX5D 4JY6A 2Z92A 4HPOL 1FE8H 4OLYH 5C09D 4P4KA 5EOCH 1YMMB 2I26N 2GQHA 3L5WA 1ZLSL 1CXEA 5E94B 1FN4B 4LLWB 3UTZA 1U2HA 4HLZH 1JPFA 1QNZL 2NY2D 3JBG7 4JRWA 4DUXA 3PL6D 1BZQK 3LS5L 3BP4A 4GW4B 1FZJA 2IG2L 3DGCR 3ROLB 4K3GA 2H32A 3P30L 1MSPA 4UU9A 4LIQE 3OXSB 3CVHH 4JFPB 2VXUL 4MJ5A 4C56A 3C60C 1DDHB 2H41A 1C5DB 3OJDB 5F9OH 3C09C 5BMFL 1L7IL 1CFVH 5DHYA 4PJ5E 1FNSH 1RZIA 4H5SB 2WBJA 1EVTC 1RZFH 3MLSL 5E8EB 1M7IB 1AC6A 4JDVA 4Q9QH 2AXHA 3UPAA 4KKLC 1JZ4A 4YGAB 3WFHA 2H9GA 4HQQH 4M43L 2E7LA 4H8WL 5EA0H 5IQ7L 5EO0A 4G5ZL 2SEBA 1FNHA 2OLDA 1E4KC 5KAQF 1BQHG 4YGVB 2NY1B 3IGAB 3O6LH 1RUPH 3GMQB 4GXUN 1TVBB 4R90H 3DXAA 5E5MB 2DWEA 2R8SH 1EO5A 1VGEL 5C0FB 1A1NB 3IFLL 4XPTL 4MQXD 3S3JA 1S5IL 4Y4HD 2MQ3A 1FZKA 2DKMA 4FQXD 1EHLL 3BD5A 1DBJL 2VXTL 3MTRA 5EDXA 3CU1A 4AG4H 2ZG2A 3HZYA 2NR6C 3VWJC 2DJ4A 4LCCB 4KI5D 4BZ1H 3I85A 4RDQF 4FQQA 4HUWA 2BXYA 1MI5B 1MCWW 1RUAL 1UEYA 3P4MA 5I30L 3T0BA 2YMXH 4YXHL 2CLRA 1I1RA 1B0GB 4N5UA 3C5ZC 5AYUH 2VABB 3MMEA 1DBBH 3QXAA 1ZHBA 4LPYA 2DAVA 1UM5L 1QSEB 4BH8B 3X11B 1Q1JH 2NZIA 3NA9H 3O3AA 3PGCA 1S7TA 1NMBL 3B3IB 1UADC 1MFNA 3AMKA 1LD9B 3AAZA 5DK0B 4PLNC 4MMXC 5EU5A 3ARVA 1IM9A 5GJTH 2Z31A 2F58L 3JTTB 5I1EL 1H8OA 3QUZC 5TDNA 3HUJB 3U9UA 1G9EA 4GQ9L 4PJ5A 4PP1D 1HIMH 1UB5B 3R8QA 4GMSH 3QH3B 3Q6FB 1K9TA 3V6BR 1DTUA 1O7SA 3BPCB 3RWFB 3G9AB 1T4KA 1WZ1L 5HHPB 3SKJH 1HHGB 3CSYA 4HUUB 3ULUE 4JRYE 5FYLH 4M03A 1MHPL 3WFZA 2VQ1A 1TPXB 4WO4C 3Q6GL 1AFVL 4JGMA 1OGAE 1IVLA 5I1GL 3S6CA 2DQEH 4KQ3H 1I1FB 3W39B 1FYTE 3CDGB 4HKJB 2IBZX 4IMLB 2AEIT 4LQ1A 3TCLB 2IANB 2JE8A 2E7MA 1YEKH 1IARB 3EDEA 4ZMAT 2W9EL 3MJ9L 2IH1A 1ZVSA 1E4WL 1W8NA 3EO9L 1YEIL 4HHAA 5JQ6H 1LEKB 35C8L 4OFDA 2M8XA 5IR1A 1U8MB 1A3LH 1ITBB 4JQIL 4P5TA 4KZDL 3HZVA 3IDNA 1YNKL 1A1MB 1NCCL 1FVCA 3DV6A 5MI0B 3C9NB 1J1XH 1LHZA 5EBGA 1XCTA 1A2YA 4KPHL 4JZOA 5E2WH 5FGSA 3G5XB 3TT3H 1GIGH 5HHOB 3EKCA 5E7BA 4PJ9A 3SO3B 2CMRH 5JLZB 4X4ZA 5A16A 2FBOJ 1RZKL 5LXGH 1C7SA 4WTZG 4P9HH 1FFQA 3ARDD 4E5XB 1OT1A 1BQLH 2EDEA 4M61B 3QZWG 3S35X 1CDUA 5ADOH 3ROOB 1F02I 1VFUA 1FNEB 4KQ4H 4MXVE 2IPTH 4CJ1A 1U8OA 3CGTA 1BF2A 1ZK9A 1L7TH 2X9YA 3GHBL 3GMMB 1NEZA 4PRDB 4JRYA 2Q8BH 5JPNA 3IDUA 3JSSA 2APBA 4GFTB 5HYSA 4HLJA 3EYOA 1MFDL 3BDXA 4Q9RL 1U8PB 3WNPA 1NCBL 4HGMA 3S8WA 2DBLH 1OGAA 3GMOA 3RKDC 2HLAA 3CU7A 3NH7L 4KK5C 4F7CB 5LGHL 2FECI 3FT2B 5J8OA 4PJGB 2BOBB 4L3CB 2YA2A 2YD9A 1FYTA 2JB5H 2X10A 1QBAA 5SX4H 3ZYZA 2ADFL 1X5ZA 2WIIA 4G6ML 1KB5A 2MJWA 4QRPD 3SE3C 1P6AB 2GTWB 5L2JB 3PWUA 4KMTL 5I66A 3DNKA 4P49A 4Z77B 3S37H 3E1F1 1I1AA 5ETUB 4OF3A 1TETL 3VXSE 3OKDB 3TH4T 5HY9A 1A6TA 4P23A 5BV7L 2Y07L 1XIWD 3KJ6H 1EFXB 5DURD 3RAJH 2AJVL 2DLFL 3FO9B 5F7NC 5L6YL 2GIYA 5FGBC 4LCIH 1QFOA 4HIIB 4BFBD 4HAGA 5F70A 3SKNB 1KJVA 5JR1H 2QHRH 3FRUA 1G9MH 4JHBA 1AH1A 4X6CF 5HI3C 4OLEA 3QXDB 3NAAL 3NPSC 1V3MA 3HNTH 1JZ7A 2ATKA 2ED8A 4M00A 2EXWC 2DJSA 1RI8A 5GHWL 3STLB 3BT2L 5FUCC 3LKOA 4PTTB 3RGHA 1D5BA 1R5WB 1AQKH 1ZLUK 4BFGA 5IG7A 1MQKH 3RTQB 4M1DL 1KACB 2P43B 1MHEA 4JDTL 4R4NC 4UZGA 4NRYA 1YEEL 5EBLB 1YJDL 2Y4SA 3JVGA 1CD9B 3RJQB 1R6VA 3X13A 4P2RB 3BGFB 3ZTNL 1R5IB 4RWHA 1WZKA 1ZT1B 3MC0A 1BLNB 4J4PC 2H32H 1MRFL 2HT4D 4MNQE 4EEEA 1IGMH 1XF5A 2VL4A 1ES0A 1ADQL 3QDJD 4LOUC 1AHWC 2CGRL 4L9DA 3ARQA 3HE7C 1DQDH 1QBML 4XNXL 4C55A 4Z8FH 3IFPA 2MTPA 2QQKL 2CIKA 1UQSA 5T5FH 1I8MB 2ZSVB 4A6YB 3UTTB 2IADB 2W0LA 3VXSA 5AEAA 4ODXA 2RFXA 3EYQD 1I7RA 2OK0L 4E0RB 1K2DB 1R3LB 1CTOA 3NABH 2RBLA 3BWAB 4IEFB 2HKHH 5D7SH 4Q58C 3LQAC 1P5VA 1IKNC 2N7BA 4OCRL 3CLFL 4WU5B 5JHLL 1RZ8B 4X6FB 3TN0A 1B4JL 2HRPL 3OZ9L 4KROC 4Y4FA 4K3JL 3ZL4H 4ZUVA 3TIEA 2BVQB 2GT9A 5EIIA 1C7TA 1ACYH 2J6EH 4YWGH 2NY5C 4OFVA 4KK8D 4XTRD 4I0CC 3QRGH 1BJMA 5C0DB 1NUNB 1GPOL 2HLFC 4L4TD 1FAIL 2EKSA 1B0RA 5IW1A 3X12A 1EV2E 4AT6B 4NC2B 2J5LC 4NN7C 3SE8H 3T8XB 2XRAH 2YD6A 4GXUM 2NW3A 4NP4H 1KIRB 4XP1H 4ZD3H 1KC5L 5ILTH 2JKXA 2C1PA 5I16B 4NKMA 1G7QA 4U05A 5D72L 2NW2A 3BW9B 3ZTJG 2A77H 2YRPA 2V5MA 4HUVB 3L1OH 4G42A 2NXZC 3WFBL 1SJXA 3CNKA 4P57A 4LBEB 2F8OA 4HUXB 5I8KL 4ZNCD 3TO4C 1MI5D 2FHCA 4NWTH 1KTLB 3GNMH 5LG1A 3RZCD 4MCZA 4UT7H 3T77A 5E5UB 2GTZB 1OTUC 3SCMC 3MLYH 4M1CD 3PV7A 1Q94A 1FL6B 3T04D 1HCFX 3D39B 2UWEE 1IC7L 3HLAB 4N1CA 5EU7C 3T2NL 5CLTA 4Z78B 4G8GE 5K9JL 1CZ8H 4M7JH 4RFNC 4F8QA 1A4JA 5LGKA 5A40E 5H35B 5CHNB 4U1HA 3LAFA 2VLRE 1MCOH 4S1RH 3X3GH 4ZYKA 5I18H 3F6LA 5I1HH 3B8YA 3PWLA 3G6AB 2ZWLT 4Z7WF 2OMNA 3F6IA 4F3FA 1DLFH 2ITDB 3DOSA 3VFTB 4KTEH 3ZKXC 3GSOA 5I1AB 3BH8B 5DJZA 2ZCKH 3WEXA 3FOLA 4K2UH 4QXWA 1I8LA 4MZ3A 5TJWK 5F97E 2A6KB 1HZHH 4L8BB 2Q87A 2WZPD 1XGPB 5IM7A 1IGYB 5DWUL 4NZUH 2PCPB 4N0UB 2X4QA 3CDFA 4JFXA 4HBQA 1YYML 4NCC1 3LD8B 4X4ME 2IGFH 4C83B 1QA9A 4U1SA 1OSZB 3GI9L 3HUJF 2OZ4A 3TYFB 1EBAA 1TJIL 1XCQB 4KUZH 2IAND 4R26H 2EDTA 3D5OF 4XC1L 1J0ZA 3MRCA 5CKAA 1JNLL 2P8LA 3MYJA 1HH9B 1ZGLM 4PJHB 5FKPA 4DVBB 5CJOH 1I1YA 5L9DH 4LP4A 4BZ2H 3I6KA 2X7LB 4JHWL 4EN3A 3IVKA 3AU1A 1U8HB 1WC7A 4XAWH 4U7MA 2KZ1B 1NFIB 2CLVA 1X3DA 2JCCF 1NFDB 2YK1L 5SWZB 3T4YB 4Y19D 1YEGL 3DX6A 5E2UH 4PJ8B 3U4EB 3MLWL 1MVUA 1RFDH 5F3HA 1GZQA 5HHOD 3G08B 3DVGA 4D0DA 1TTGA 1A02N 2YUXA 3EAKA 3IFNL 4J1UA 4RAHA 3U1SL 1VPOH 4L5FH 5MERA 1XR8A 2D7NA 4ZFGH 2O5ZH 2VTFA 3VH8A 1T89C 3G6DH 4UT9L 5CJ5A 2VLRA 4NDMB 3CFBB 2D9CA 2VERN 1SJVA 2IH3B 3HMXH 4K7FB 3ULUH 3QIBA 5DQ9A 3F7VB 3IDGB 1JNJA 1C5BL 3O4OC 5C86A 3GEWB 5T3XL 4F7EA 4LSRH 5CUSH 1IAII 5HYFA 4G9DB 2R56H 1AD0A 5BZWB 1G6RH 4UOW1 5HPMB 3CXDH 1HHIA 1KB5H 2WLZA 1INEL 1U42A 3VXUD 5HDBF 4X4MA 5JZ7C 5IV2A 4KZEH 4QHUA 4LSUL 3BMVA 1OAKL 2XN9E 3MACH 5LWYH 3MV9B 4TSAL 2Q7NA 5EORH 4UT6H 5GGQL 3NCYS 1UM6H 1W0VB 3MROA 4ZDHA 5DDHA 4JVPA 4CN6A 1CGXA 3BP6B 1F8TH 1RJZA 3QUYA 3NZ8A 4LPVA 2XA8L 4N90E 4DKDC 1OAYL 4JG0H 1BQUA 2EH7L 2X41A 1F4XL 1U8QA 3MYZA 4PY7B 3UAJC 1T21A 4POUB 5T1DH 3BKML 4HK0A 2EO1A 5FM5M 3B9KB 3BUYB 4OZFG 4ZO8A 1B2WL 2UV3A 5EWIH 3OKOB 5MEOA 5GRUL 4NM8L 1NCNA 5IVXA 4WFED 2D3VA 3HI5L 3TESA 1TZGH 4P9HC 1BBJB 3PDOA 3G5ZA 5IK3A 2JJSA 1Q0XH 4BSJA 4FXLA 1ZHLA 4NHUB 1M7XA 3OAUH 3V4VL 1TXKA 4MLSA 2ADGA 4PPTA 4KKAD 3ME0A 3MFGB 4JREC 1GC1H 4RAUB 3UYRL 4HKZB 1BX2A 4B41A 2VIRA 2FB4L 2XXCB 4HS3A 2XZQL 1PFCA 5KVEH 4K3HA 1QP1A 1H9VA 3RTQD 4DUVA 2EIBA 3VJ6A 5HJ3A 4LF3B 3NBNA 4W4OC 3WE6A 5I75C 3NPZB 1N0LA 1BMGA 4XHJD 1PG7W 2V2WB 2OSLB 4QT5A 1D3CA 1FG9C 3VXRB 1QPPA 4JN2B 1EHXA 3L95B 1MFAH 4D0BB 1ZTXL 2B20A 2XN9A 4P46B 2W65B 1RJLB 2UZYB 4OM1L 5EN2B 3QHTC 4GBXA 3TV3H 4Y7MA 5KVMC 2BOCA 3CMOL 1JWSB 3WIFA 5JOPD 1QHPA 4GW5B 5ICZB 2QV2A 1FSKB 4Z7OF 5GS0C 3CPLB 2XFXB 3BQUC 4CKVX 1MOEA 1K4CB 1IGIL 4PJ7F 1UACH 1CVSC 3M17A 5ANMB 3VFWB 1TZHB 1A9EB 1PZUB 3VI3F 3LEYL 4QHMA 4JVUA 3GJFA 1MWAA 1ZA6A 4FQHA 4UDTA 5ICXA 4K3EH 3ZZ1A 1XFPA 4G6FB 1ZS8A 3LRSA 4YHYB 4S1QH 1JHKL 5E2VL 3QIWB 1S7VB 4DZBA 3RZWA 1IT9H 1G9MC 4HX1A 2D9QB 1BM3L 3TZVC 3O6KH 5C0GB 5HHVL 1K4DB 5I1DB 1NBQA 3LKRB 1NLBL 4YFEA 5FCSH 5ICYA 4R8WH 4GH7B 4N8CH 1NKOA 2PYFA 4HGWA 4NRZB 1XGRA 4M02A 1II4E 5EU6E 1N3NB 4K7PY 1ZT7A 4NT6A 4YAQA 5HYJA 3OBAA 3GSWB 3L3JB 3ILQC 4X99B 3IU4L 4AM0B 1X4YA 1WGOA 4XNYH 4FTVE 3FN0L 3NFSH 4NKOB 1NJ9B 5ITBH 1EIBA 1Q0YH 2A1WL 5F1SA 4ZUUB 1JPSH 1OPGH 5IIEA 1N7ML 2BNRE 4E9LA 5EULV 4YXLL 1X44A 1IGJB 3K7UA 5KVFL 4NSKA 1U3HA 3QUMA 3CFDB 5FYKD 4WTXA 1CL7H 3BVNB 4OAWA 3LY6A 4P3CH 4AK1A 2OQJB 2YEZB 1OY3B 2IAMB 3HE6A 4OUOA 4UOJA 2BSSB 4OT1L 1CS6A 3D39D 4LLAA 3LQAL 5DSCB 4OZIF 1CFQA 1OLZA 2JF1A 4EJ1C 3WNMA 1ZOXA 2FSEA 2WANA 3ZDZF 1Q9LB 4NRXB 1A7NL 3W9DB 2FBJH 2ZOKB 1CD1A 4IDJH 3INUH 2E7LC 5SWQB 1NAMA 3K74B 4YHPA 3WDHA 2NY5L 3KS0H 3UZVB 3SDYH 1AXTL 3GB7A 5F8QC 2FEEL 5GRZA 1LP9F 3CFCH 3SKMA 4RFEA 3C2SA 2WWKT 32C2B 5TF0A 2XQYG 5DD6B 2NLJB 2EYTA 1JWUB 2MCG1 3QCVL 4NUGH 1AGEB 1DL7L 1XGQB 5T1MB 4TTDD 1F58H 1CGWA 1INQA 3IRZA 2X44D 4FN0A 1UCTA 5EOCL 2XWBB 4E41A 5J11B 4TSCH 3MV8B 4WV1B 1DCLA 2FATH 1KULA 5CIPA 1HOCA 4WEBL 5EU6A 5JORB 5DFVD 3FQXA 1MHHA 3P77B 5EU3B 1WLHA 2BX5A 2OJEB 1J8KA 2DD8H 3TPKA 4FTVA 3NIFE 1MPAH 3AFLA 1RAMA 3B4NA 5A2IH 3DETD 1JGLH 2R1WA 1I3RB 2BNRA 1KJ2L 1RIHH 4IRSB 3UJIH 4M8VA 4YC2B 3AXLA 5M94B 3FB6A 4TUOA 3VD9A 4BQCA 1QLRB 3U4BL 3H3PL 2NNAB 3VG0L 1UXSA 5DZOA 3QDMD 5SWZD 2AEPH 5DXWA 3OHXA 3B9AA 4HQQL 4PRBA 4PJ8D 4J8RB 1MFBL 2OTPA 3PL6A 3QPQC 4JJHA 2DQCL 4K94L 1U92A 1OQXA 4QCIB 4UV7L 5DJYB 2PXYD 1MIML 3PHSA 4R90L 4XNZC 1RUML 3PE9A 4ZXBB 5KVGL 2KBGA 1F4YH 1G7JA 3UJTL 5CILH 4DCQA 1L0QA 2DLHA 1R3HB 1WFTA 3ARPA 5EBMB 2Y6SC 2OR9H 1PDKA 2X89D 4U6XB 2V9TA 3DPBA 4CRPA 3DX9B 4OD3H 2I07A 2M1KA 4L9LA 3BO8B 3WO4C 1U8JB 4M8QA 4APQD 4DFHA 1CLZL 5AYUL 4U49A 4FFVD 5IKCA 4ODWA 4BFIA 4UQ2B 4BH7B 2R0LH 1UGNA 2BHUA 3K1DA 3VFGL 4P5TC 3O0RL 4JFYB 5FO8B 4X7CC 1YA5A 3QO0B 3BIBX 2GY5A 5DMIL 2AERT 5IEKA 3KLHD 1A1OA 1DQLH 1AKJB 1Z3GL 2YBRB 3BOVA 3O3DB 3R8BB 4O58H 2A0LC 2DWDA 4PLKD 5ID0B 2CDGA 1S9WB 4UOW0 2HJKB 1LO4H 4PJ9C 4Z0XA 2PTUA 5EFIA 3FN9A 1KCRH 5DA4A 1S7SA 4GRWB 1GAFL 4AL8L 2ESVB 5EO9A 4FXGA 3SDAC 1BQHB 4GMSL 4DN4L 2CJUH 4MD0B 3B9KD 4QRUB 3X3FH 1H3XA 4XBEH 2VZSA 3SKJL 1P7QB 3UTQA 5AUMA 2XI9A 5E08H 3ZMRA 3U36B 3B8SA 2V2TB 4MNGE 3W5NA 4MWFA 1HKLL 2DDQH 3MXWL 4ONFL 4KQ3L 4WNQB 3VFSA 5L7XL 4OV6F 1MUJB 4KKCD 3I02B 4HDIA 4WGVB 3ULUC 3EOTL 2EDYA 3X14B 4LMQI 5ESVB 5C8JA 1WV7T 3MRRB 1FJ1A 3LQMA 1EMTL 5AWNL 3OV6A 3F7RA 3BMWA 1VFAA 4WHTB 2OTWA 3WSQL 1IM3B 1QG3A 3I3DA 4OIBA 5JQ6L 1WFOA 3DVNA 3QUXB 4WDIA 1M05B 4Z0BH 2UY7A 3LN5A 5DJCB 2QSQA 2IMMA 5DJ6A 2A6IB 4YDVA 4HF5L 2A73A 4E42B 4YPGB 3VXOB 2J4WH 1CR9H 5DJ2A 3IKCB 3VXRD 1PG7H 1M71B 1XF3A 3RNQB 4JPVL 2XNAA 2R1YA 3HR5B 5L8KB 1CGSH 4P46D 3D2UA 3TT3L 5I8CB 4JANA 5JUEH 4RGMC 4P23C 2ZCHL 3G6JF 3HNVH 1G7IB 1FNFA 3O2DA 4QRPE 3GJFH 3MRHB 3MRQB 3C60B 3F7PC 3MOBH 1FORH 4LLVB 1ZSDB 4JO4H 4WCYL 5LCVL 3ALXA 2ZUQC 1EJOH 2G75B 2ITCA 5F9DC 2DIAA 3S36L 3T0AA 2F54A 3ARSA 3ZLQC 3N85H 4X6CE 4IRJD 5F3BA 1Q9OB 5C6TH 1Q72H 4UDUB 5EZLA 4TPRL 4G6FD 4YO0B 5JDSB 3DARA 3RL1B 5F89B 3QIWD 1VGKB 4G3YL 3DUUA 4F33B 1FQ9C 5HYEA 3LHPH 4AEIL 1PAMA 1X9QA 1NC4B 3P73B 4MNGA 2OTUB 4OGYL 3OJVC 2X4SB 3C8DA 1AGBB 5KOVC 1GC1C 1NC2A 1KCSL 3JVGC 1RQ5A 4PLJC 1CE1H 5J4MA 2FIKA 3IETA 5LGJA 4QTHA 4FA8A 3QUMH 3LVEA 2AJ3A 3V6OA 1DN0A 2XG4A 4LSVH 1OHQA 5HYSG 3FRPA 2CR6A 5GS0L 5E70A 5BRZA 3UBXI 1CICC 2H2PD 3WNKA 4MSWB 2VSCA 3KJ6L 2DQDH 1YMME 1JYXA 4R0LB 4LVHC 2IAMD 3KLAA 3UYPA 1FGNL 2NZ9D 3VGAC 5FECB 2PR4H 2JJUA 3QZWB 5J6HB 4RX4A 5DVOA 4Y16D 2IFFH 4EDXA 2Y5EA 3VCLA 2QHRL 1TJHH 3OTTA 2R0ZH 2NY3B 1J0IA 2HG5B 3CK0L 3TA3A 3TN0C 4D3CH 2CUIA 4G80B 3S35H 3WHE1 5EZOH 3LB6C 5AG9A 4X98B 1U3JA 4U6YA 3OKLA 5IT2H 4X6CA 1KJMA 3GRWA 4IJ3B 3T2PA 3MLZH 6CGTA 1RSFA 3H9SD 4QF1B 3TBYB 4GAYB 5DK2B 5DMGD 2X4PA 3CSBA 2H8PB 5E0QA 2F5BL 3GFUA 3C8HA 4YPJA 1UM4H 5F9JA 4L8DA 1A6AA 2CDEA 4LGRB 5I19L 2PTTB 5DI8B 3SY0B 4KAQH 5IMLA 4PJEF 3W0WB 2NQCA 1LDPH 3D85B 1BAFH 4G6KH 1XR9A 1VENA 1QRNA 4JM2B 1DQML 2E5EA 4NYLA 1U0QA 2C4XA 3KXFD 4QXGH 4NZTL 3MRLB 4M62L 4XVTH 3EFFA 1MCBA 1J87A 1J1PL 4YDLC 4IRSD 4K23H 1NCDH 1OAXL 4NGHL 4XCCH 7FABL 5F7WC 4ORGA 1PGRB 1BFVL 2HKHL 3N1QC 5F7LB 3IAQA 3AB0B 1YMMA 3OB0K 2FD6H 2JIXA 3EJZC 2ZG1A 1FN4A 3QFJB 5E8NB 4LLWA 2HP4A 3KHOA 1NMAL 3FAWA 5T5NG 4RFOL 1KEMH 3ZKNC 5CMAB 1QSEE 4X8XA 4LRIA 5GIRB 5JQHC 3FQNB 1G7PB 5I2IB 4GW4A 2ADJB 2IJ0C 2X4TB 3ROLA 4W81A 1I8LC 2ZUTA 4QRQA 4POZD 3KYAA 4L3EB 2W91A 1C08A 3SE8L 3TWCH 3OKEA 5E8PA 3UZEA 1DDHA 1MCPL 3VXMA 4OIIH 3MJ8B 3VRJB 1C5DA 3OJDA 4ZD3L 5HVHC 3HUJE 2GSGA 2VDNH 4H5SA 2A77L 1M7IA 2A83B 4U1NA 4XVJH 1Z9LA 2EIDA 3E3QE 4KWUA 3RGVD 2VLJB 2YWZA 5DUMH 3O6FB 4LAQH 3VXPB 1CI5A 4Q6IC 4YBQD 3GNML 1FNLA 4FFYH 5DVKA 4EN3C 3GKZA 4YGVA 4GG6B 3IGAA 3IKKA 2ID5A 4Z7QF 4LIQL 4TVPE 5F6HI 5E5MA 5C0FA 4M7JL 4OFPA 4I2XE 4NBXB 4JCLA 2GYSA 3W5MA 4XCNB 4D9LL 2E27H 1OCWH 2AJSL 3SDDD 4F58H 4KI5F 1IC5L 4YNYB 1JZ6A 5FO9B 4R4FH 3X3GL 4M1GH 1N59B 2PW2B 2WK2A 2Y23A 4LCCA 4OBSA 1J0HA 5SX5K 2EE2A 1HH6B 2WINA 4MD5B 4MS8D 1ZLWK 5IGXL 2CKBH 4LRNH 5GSRB 5GS1C 1J5OH 4K2UL 1B0GA 5C0ND 3TO2B 5EZJB 3O9WB 3FMGH 2VABA 2DM7A 4YQXH 3QNZB 3QIBC 1QSEA 3GSRB 2MKWA 2AQ2A 1UH3A 4OD2B 2VH5H 1DBMH 3B3IA 1LD9A 5DK0A 4YXKH 2G2RB 4NJAL 2ZCLH 5I1CL 1UWEH 3U0WL 2C7UB 5HDBE 4KUZL 1VHPA 3QQ9D 1BFTA 3WBDA 3ALWA 2FEDC 3JTTA 3BZEA 3HUJA 4RAVA 3L3IA 4B0MM 1FFOB 5CJOL 2AK4B 2HVKB 1ERNA 3MJ6A 4N8VA 3ARUA 5D7LB 3SPVB 2ICWB 3QH3A 3QEQD 5B3JF 5HDLA 3V52L 4XRCB 3BPCA 4QRTB 3VGBA 2EYSA 3RWFA 2MPAH 2E3VA 1MY7A 3UO1H 1U91B 3HFML 5HHPA 2W9DH 2DQGH 1HHGA 4HUUA 4HAFA 5C0AB 2V5SA 5L8JB 1J0JA 3QUYC 3TYGL 4ZTPL 4HGKC 3A6CL 5C0IA 5GRJL 1IQDA 4P9MH 3O2DH 3OG6B 1WSST 2AKRA 3FQTA 4PJGE 2KPNA 2GK0A 3W39A 2K9UA 2DLGA 3CDGA 4HKJA 1MREH 1MRDL 4IMLA 1HYRC 1JPST 1AE6L 2ADIB 4I2XA 4I77H 4L5FL 1F3JA 2JELL 4ZTOL 3C60D 4LKCA 2NY7H 3G6DL 4LLYB 5D5MB 2I5YH 1U93B 2YKLL 4J3VA 5FHAH 1LEKA 5KSAC 4Y1AA 1U8MA 4CVZB 1EO7A 1YEHL 1MF2H 4UTBH 2JJSC 2VR4A 5BVJB 3W82A 1KBGH 4KKLD 4KTDL 1A1MA 4TUKH 4JPWL 5BQ7A 3BD4A 4QO1A 3SQBA 2MMXA 2NMSA 2UZIL 3K4ZA 1IGFL 4DK6A 1KN4H 4FMKA 5DTFB 3CXDL 1AXSA 4XP4H 2X1PA 3TVMB 1KB5L 5JLZA 5KVDL 4XMKH 2ICEA 5C0JB 2KZWA 4Y89A 1J0KA 1VFBA 4P3WA 5EORL 4X7TA 5BS0D 1CF8H 4ODHL 4E5XA 2N4IA 1I9IL 4JVWA 1F8TL 3PHOB 4K9EH 1ETZB 3QHZH 1MCSA 1FNEA 1JUFA 2ARJQ 4GBXC 3NCBB 1WITA 4L3AA 1FP5A 4PRDA 4PJXF 5INCA 4PJ7E 3V4PH 2OBGA 4WW2F 3LEXB 3ZSSA 1U8PA 3C5ZD 4P2RE 3ZE0F 4YK4C 2F5AL 1F6AB 4ZFFB 5I8OL 5GRYA 2FR4B 4BELD 4PJGA 3SHSA 2BOBA 1KJ2B 4L3CA 3RWJB 5KSBB 4YBLB 3S96B 5FHBL 4RFNB 5HHME 3GUTA 4DOHB 5JOPE 4S1SH 5J89A 5D1QB 5L2JA 1FZMA 2NY3D 3WFEL 3ARGA 5C0CB 2E9IA 1RIUL 4F9LA 1PEWA 5CSGA 4N0FB 1T0NA 1KELH 4H20L 3D18A 4YIQA 3QHFH 4XCFL 3UTTE 1B6DA 3D48R 3OKDA 3EYVB 2D31B 3S34L 2ZOLB 1T5WB 1SVCP 3H3KA 4QRSB 1GC1L 1P4BH 5C3TA 5E1AB 1S8DA 2LVEA 1KT2B 3B43A 5KVEL 3RL2B 1BFSA 1EFXA 2LU3A 4WIQA 4TTGA 4HZLA 2F8VA 3FO9A 1S9VB 3QWRD 3MFFB 4WO4D 3V6ZB 1LE9A 43C9B 5E6YA 4EUPG 1WZMA 3VFOA 2W9LA 5TE7L 5MEPB 2XWJA 3W0WD 3BSZH 3SGEI 3MGOA 3T0EB 1YMHA 3AREA 5T3XD 3QXDA 3M1BA 4CVXB 4LFHD 1Z5LB 5B8CA 3STLA 3MLVL 4OZFB 5DMKA 3HE6C 4OZIE 4K8RC 4YHZH 4PTTA 1UACL 5IJKA 4NOFA 3RVXC 4Q0XH 4LASH 4MD4B 3OPZL 5CINL 3ZDZE 1KENH 2R1XB 5D1ZC 4PJ7A 5EBLA 3TJEH 4NIKB 4ONHB 5JPMA 1CVRA 5HVWA 5E6IB 4P2RA 1N4XH 1KTDA 3PP3H 3U7WH 4AIXA 3F7YB 4OZ4B 3QFJD 3MR9A 4TOYL 1TVHA 4YX2L 3GBMH 3O6KL 4LHQB 4O2CB 3WFDH 3LSOB 5C0RH 5CGTA 2HTLD 4N0YL 1NUFA 3UDWA 3WFCH 5ALCH 5DT1L 5IHZA 3VG9C 4N8CL 3GI8L 4EI5B 5CBAB 1DP0A 1N5YL 5J1SC 4HFUL 2DLTA 2ICWJ 5IHBA 2E8YA 4XMPL 4OTXL 5F9WC 1JRHL 3KPNB 4QOKE 4MJIB 3RWGB 4JFZL 2ZSVA 4A6YA 3UTTA 5ALBH 1SY6H 2IADA 4XNYL 1I3GL 1OAQH 1Q0YL 1JPSL 1K2DA 1R3LA 2G5RA 1VKXB 1YNLL 2HWZH 3BWAA 1CD0A 4J7RA 2XACC 3QDGB 2HVJB 5I6XB 4WU5A 4LHUG 1RZ8A 4PD4K 4X6FA 4XI5C 4F7TB 2VLJD 2F53D 5F7YC 1OB1B 4MB4A 3NACH 2A6DA 3V4UH 2BVQA 5EOQL 5FB8A 2E9JA 4N0UE 1BEYH 3PHQB 5MP6L 4H26B 2HMIC 5IWLA 3KYOB 4LCWB 1MCCA 3T3PE 4XVSH 2DQHL 1JYWA 3BKCH 2W0FB 4U1KA 2FGWH 4P2OB 1Q9WB 3CFIC 4AT6A 1QBLH 4XWGL 3IDXL 2VITB 3KLDA 3DYPA 2EYRA 4L1DA 4OZIA 3INUL 5DD0H 3RVVD 1UA6H 1GGBH 2NY2C 4AMKH 1T7VA 3PL6C 2GEEA 5CEZL 4LBEA 4HUXA 3CFCL 2AXJA 3GSNH 1UCBL 5TE4L 1NFDE 1KXQE 5SWZE 1KTLA 4NUGL 3OX8B 3B5GA 4JB9H 3PNWA 1D5XA 2OP4H 1AY1H 3H0TB 2NXYB 2OZ4L 5F1IA 3HLAA 3WS6C 4TSCL 5IB4B 5HI3D 2NYYC 1QTYT 1TTUA 1NLDL 3T3MF 1WCQA 5H35A 3PGDB 1H3VA 1RJYA 2EXWD 3AY4A 4KMQA 4QOKA 5EBWA 1JF5A 4OD1L 2XQYK 4JRXD 2DD8L 1T0MB 4FQJL 4L9LC 3DO3A 3G6AA 1JGLL 2VDKL 1RMFL 5D7LD 1YEDB 3V5HB 4R4ND 2ITDA 3VFTA 4KKNA 3BH8A 2R9HD 1NCWL 3MX0A 3NIGF 1Z9SA 3PJSB 1HEZB 4MQXC 5C0AD 5L88H 4Y4HC 4L8BA 1XGPA 1IGYA 4N0UA 2MCPH 2ATPB 4LDOB 4OSUH 3IDIA 4GOSA 4J23A 2H45A 3OAYK 4PJFB 4XPAH 4C83A 1JHTA 4LOUD 1OSZA 1QFUL 3MV9E 2Y36L 3LS4H 3HE7D 3ILPB 3A6OA 3TYFA 4I3RH 2R2EB 1XCQA 3EFDL 5F1KC 4HLZG 1OP5K 2VKWA 2DYPB 3L5JA 1T7YA 3MZTA 1YNTB 2BSED 4EQ3A 5D4QA 2VQUA 2BZDA 1ZA3B 2WV3A 5EC1B 4AH2A 2B1HH 4UV4H 2X7LA 4AEFA 2IQ9L 1DEDA 1U8HA 3DI2B 5IW6B 3ARFA 4XHQA 2C3WA 1WT5A 3UC0L 1P6FA 4MLIA 2BRRH 1NFDA 5CILL 4JO2H 4OCYL 5DQDH 4KROD 3T4YA 5CZVH 2OR9L 3VW3L 1A5FH 5F71A 4TSBH 4XP5L 2FEEI 3U4EA 2QHLA 3G08A 3TVMD 4MQ7B 4PP1C 4ZS7H 4NCDA 2HLFD 4YFLI 4HWEH 5GS2D 2D7TL 3B2VH 3C8KB 2Z92B 5GGRY 4P4KB 2X1QA 2D7PA 3IU3B 3QXWA 1MVFA 4KVCL 5IBTH 3CFBA 2C4FT 4GJTB 5EUOF 2LTQB 2IH3A 4K7FA 4KH2A 1QYGH 2RGSA 3F7VA 3G6JE 5IVOA 1JGUL 3BP4B 1ZEAL 3BP5B 4JY5H 2CQVA 1RZ7H 1JGEA 4UU9B 5KTEH 3HCVB 4MJ5B 4FQ1H 4C56B 4RDQG 2P1YA 1OTUD 4IS6A 1NSNH 4XWOC 1NAKH 1HXYA 3VXRE 4BZYA 4J2XA 2YN3A 2WBJB 1YEJL 1A7QH 4EBQL 3MV9A 4JKKA 4X6EA 1PSKL 4Y5VC 5FFLA 1W0VA 4I3SH 4LSTL 2DDQL 2H9GB 3BP7A 1A6WL 4W4NA 3BP6A 3N0PB 3OAZK 5EO0B 1DFBL 4NOBA 4OB5L 1HHKB 2HJFB 4KK9C 1QO3B 1K8DB 4Z7UB 5ANME 3DROA 3ARRA 4P4RB 4PY7A 3DHJA 2ED7A 3RHWF 2HAZA 3U30B 4ONGH 3BPOC 2IBGA 3V95A 2DWEB 1UWXK 2XTJB 1R24B 5GISH 1KCKA 2AVGA 1JHLH 1CLCA 3BUYA 3P9LB 3FO2A 3ARDC 1CXIA 3VFMB 3HZYB 3MO1A 5DO2D 3MV01 3H42L 3DHMA 2J4WL 1CR9L 4O51B 4HXBH 5F9AC 1IL1A 1PG7L 1BBJA 1NGYB 3EOAB 2ENSA 4MXQC 3KDMB 1D6VH 4HUWB 1O0VA 4JDZA 3P4MB 4NHUA 2Z8WC 3MMEB 1P9MA 4WHDA 2PUQT 4NM4H 2WM0A 1MWAL 1HNGA 2EIZA 4RAUA 5DGRA 2HJLA 3MOBL 1FORL 1LEGA 3G6JA 1S7TB 3W2DH 3AS3A 1PW3A 3RBGA 3P11H 3BJLA 4PY8I 5FCUH 1CK0L 3MBEB 1Q72L 5B39G 5E6ID 4HW6A 3TA3C 2Z31B 2KQNA 4X9GA 5TDNB 3U9UB 4DUWA 3K46A 3I50H 4PJ5B 3HKFA 3L95A 4D0BA 3U46B 1IBGH 3EBAA 1GGIH 1JP5A 4P46A 2W65A 1RJLA 3RVUC 2DL9A 3B5HA 1N2RB 4A6YH 3UJJH 5FYJE 1XIWC 3CSYB 1ZLUH 4O9HL 5ICZA 3S5LG 4X7SL 2BHZA 4JPKL 2VXQH 3V7AG 1VESA 1I9JH 2VXVL 2XT1B 3GBNL 5ANMA 3VFWA 1X5FA 5L2KE 1A9EA 5GGTA 1KIUA 1N8ZB 1KTRL 2EDDA 4EOWH 1R0AH 3HMWH 5EG6C 3D9AH 4RBPK 4G7YH 2HYMA 5KJRL 1VB9A 3OKKA 2OR7A 3QDGD 4LSVL 1X5XA 4OBRA 4LSSH 5C3LD 4PJCF 5DR5L 1S7VA 4OZGF 3ULVL 2Q7YA 4QHKJ 3TCXA 1ZVSB 4K8RL 1FLRL 2ORBL 1K4DA 5JZ7D 1RVFH 1TQBC 5MEQB 4RMVA 4HCRL 3MV8E 1DQTA 4LCWD 3HZVB 4GAFB 1FVCB 1N3NA 4P2OD 3HC3H 1NAML 1A14H 3L3JA 4AM0A 4X99A 5IFAH 1A2YB 1TMCB 1A6UL 5DJ0A 3S9DB 5F72S 1WICA 4ZUUA 1EPFA 3SE9H 3S35L 5FYKH 3RY5A 1IGJA 3QXUA 4Z7NE 4LRIC 2P24B 2MFNA 3R4DA 1EDQA 3FFDB 4JQXA 2H3NA 4PUBH 3CFDA 4GRMA 4HIHB 4GKOA 1MNUL 4XB7A 3F65A 5E99L 1S3KL 2YEZA 3MJ9A 1JBJA 5CP3A 1FRGL 1B90A 5CGYC 4LEOB 1DZBA 1QVOA 1IAKA 1JNNH 4PJAF 5HYSB 3SGDH 3EYOB 3QAZB 4NRXA 3BFOA 5TDPB 4ZUWB 3CX2A 4DTGH 3ALPA 3GMOB 3AM8A 2QKIA 4M7LH 5B3NA 5L2KA 2CD0A 2W07A 1QFWH 5DYOA 1P4IL 3MV11 3VD7A 3WL9B 32C2A 2NY1C 5DD6A 4B5EA 2VZ3A 2NLJA 5SX4I 1JWUA 3L7EB 2ZJSH 3PWUB 4GKNB 1RK0A 8FABB 1XGQA 4D0CA 5FDYA 4JHAL 1I1AB 1KB9K 2XWBA 3BJ91 5I1LB 1HQRA 3MV8A 4TRPL 4U7KA 2PO6A 4S10A 1MFCH 4LCCC 1DVFA 1A6TB 2X09A 1K3IA 1FV1B 5JORA 4PGBA 5JW3H 1OARL 1YN6B 1V7MH 1GHFL 5GS0D 3BQUD 4TNVK 2DYPD 4U1IB 5DC0A 4F7MA 2QADB 4I3GA 1UYWL 1QRKA 4M1CC 5FM5O 1KJVB 3RIFF 2E7CA 4NQCB 4UINL 2FCBA 3FRUB 4OIIL 3VI4E 4OLXH 1J1OL 2BDNL 3EIFA 3N9GH 4AENB 5CD5C 5B21A 2ESVE 3VDBA 2NNAA 2ATKB 2P4AB 2JJTA 1AGCB 1AGDB 4LPUA 1ZLVK 5B3JE 4J8RA 2IPKB 1U6AH 4LAQL 3BZ4B 5KANG 4KVNH 5DVLA 2DQJH 3DSFH 3HS0A 4WTWA 1KCVH 4FFYL 1MHEB 5HGDB 2P5EA 2W60A 4QCIA 1SJHB 4M5ZH 4PP2B 3ILQD 4P4KD 3E3QC 3X13B 5IVZB 1VEOA 2MNUA 5D70H 2JTDA 3ZHKA 4DGIH 4ZXBA 3PGFL 3RWIA 1XF5B 3P0VL 4O5LH 1HHHB 3MLUH 2AK1H 1A7PL 5EBMA 4DK3A 1QR1B 1FFPB 4C56D 1WTLA 4U6XA 3RWEB 2RFXB 1U8JA 1A64A 5ACZA 3HN3A 3WD5L 2WBJD 1MJ8L 1XAUA 4HPOH 5K9OA 4MX7A 2EDQA 4YQXL 5DVMA 1ZLSH 4JFYA 5FO8A 3QO0A 3TN0B 5MI0C 4Y4FB 3JUZA 1AKJA 3TIEB 2YBRA 4ZO9A 4R3SA 1QNZH 2GT9B 3MRNA 2P8MB 4RISL 2O5YL 1WVZA 3JWNC 4I8DA 4RIRB 5ID0A 1S9WA 3LS5H 2C3GA 2HJKA 4X6DF 2O5XL 2VL5B 2IG2H 2HKFL 3SO3C 2MOVA 2EKSB 3P30H 1T03H 1B0RB 3X12B 2ESVA 3DXAD 1BQHA 2VXUH 2XTJD 4X4YA 1ADQA 3K8KA 4MD0A 4OCWL 1E0OB 2WUCH 3UO1L 4TN9A 1L7IH 5BMFH 2VB5A 2C1PB 4DEPC 1G7QB 1T66D 1P7QA 2NW2B 2VDOL 1Q38A 4Y8DC 4EDWH 1ZANL 3MLSH 3U36A 4G42B 2V2TA 4P57B 3O2DL 4Z7UF 3TIDB 5LJYH 5I8EB 1MUJA 4H8WH 4M93B 3L3KA 3ZE0E 1MREL 3DTXB 3X14A 3IXTB 1D6EA 3T77B 5ESVA 2IF7A 3MRRA 4N8VG 3FONB 1IC1A 4I77L 3IB4A 1MJUL 1C1EL 3MLXL 1YEFL 5CJQL 4HK3N 3FFCB 3JWOC 4W6YB 1VGEH 2GAZA 4C4KO 3QUXA 5CCKL 4XPTH 1S5IH 5J13C 1X7QB 4MGXA 3UCRA 1EHLH 5DJCA 1DBJH 2VXTH 5CBEB 4J12A 1LDSA 3ARGC 2A6IA 3Q2CA 4QHLA 2Z31D 3L3HB 4JR9L 1NCTA 4F9LC 3PWLB 4X7FC 1BWMA 4PJ5D 1EVUA 3QPQD 3HR5A 3O41B 1J05B 1RUAH 5CD3B 5I30H 4XP4L 3R1GH 5HGAB 5DJZB 4YXHH 3WEXB 3FOLB 1ACZA 1SHMA 3QO1B 3MRHA 2Q1EA 3MRQA 3K2MC 3EO1A 1RULL 4BSVA 2AXFA 4LLVA 1UM5H 4JFXB 1ZSDA 4QTIH 2FNBA 1CF8L 1OL0A 5DRNB 1NMBH 3SJVB 5TFSH 1QA9B 1IGTA 3CCHB 4UDUA 4QY8B 4IDLA 4YO0A 1JCKA 3RL1A 2F58H 5I1EH 2P8LB 5F89A 1VGKA 4PYGA 4UMGA 1T3FB 3W11C 4JFEE 5FKPB 3DJ9A 2QL1A 4GQ9H 3S36X 1I1YB 4LL9A 5B8CC 2PYEB 4EN3B 3AU1B 2EDOA 1UKTA 1NC4A 3P73A 2IWGA 1WZ1H 5IJKC 1WC7B 4H0HB 2OTUA 3QNYA 4PJXA 2E6PA 4F57L 4HJ0D 2X4SA 4TQEL 4P5TD 4WW2A 3W0WE 2HT2C 3RTQC 3JV4B 3U83A 3DSNA 1OGTA 3GZKA 3P9MA 3Q6GH 1AFVH 3B9VA 3REWA 2JK5B 1YQ2A 3BGFC 4XHJC 2A0LD 4AQ1B 4L8CA 3GRWL 1MVUB 3O2VH 12E8H 3DVGB 4NCC2 2FX8L 4PJ9D 4RMRA 1CGVA 3L3DB 1ZVHA 1XR8B 1D5MB 1G7LB 3UDWC 3JTSA 2W9EH 3MJ9H 2VAAB 4H1LH 3G5YB 5D7IF 1E4WH 3A67L 1YEIH 4KC3B 4MSWA 35C8H 4WTZA 5FYJH 2ZKHH 1WFNA 1EFQA 4GT7A 5FECA 4JQIH 5DQ9B 4KZDH 2OJZL 3HG1B 1U8LA 1NCCH 3QZWA 3TBSA 5J6HA 1PKOA 4WFGE 1X6LA 5IUSA 4LPXA 4JRYD 4KPHH 4KDTA 3BSZL 3VFPB 2DIBA 5F8RC 4X0KB 2L0DA 1HHIB 3MPCA 4G80A 4Z76B 2GCYA 4L3EE 1OGAD 2J2ZA 3DI3B 4RGOH 5IV2B 1RZKH 5GSVA 1BVKB 1FYTD 4XAKD 4PTUA 1JN6B 4PRIB 1A9BB 3DVIA 2WBKA 2NY4B 2H8PA 1FVDB 5IBUG 1IGCL 2P42B 4JFEA 1LVEA 3PWJA 2R29L 3AGVA 5A1AA 1I1AD 4WWKB 2PTTA 1N4XL 3WJLC 5JDJA 2FO4A 5DI8A 3SY0A 1MCLA 4XP6H 3GHBH 5JHDB 2NTFA 4HK0B 3WDIA 1CXFA 5I1IL 4XMLL 1MFDH 3D85A 2I60H 3N1PC 4P23D 4GG6E 4Q9RH 5F96L 3WFDL 4OLUH 3CLEH 5C0RL 2BVOA 1NCBH 4JM2A 2YSSB 3WFCL 5ALCL 3NH7H 5LGHH 3CAFA 1NKRA 3SDCB 5IVXB 3CJJA 3LPFA 3QQ3A 3HC4L 3MJGX 4G6MH 5IK3B 3G5ZB 5ALBL 4EUPB 1WJ3A 3T3ME 1H3TA 4KMTH 5JXEA 4WUUA 1ZHLB 4FFZL 4R4BA 2HWZL 2IEPA 2X1WL 5DUPH 4ZG1A 2ADGB 1TETH 5IW3A 3DRTB 1NMCB 5E8NA 1BX2B 5E8OA 4HS3B 1X4ZA 2Y07H 1BIHA 3V4UL 1A6VL 2VLKB 2DLFH 1BEYL 4MMZC 4NNYB 5CMAA 3C6LB 4FXKB 5L6YH 2P48B 5GIRA 3VJ6B 5FA3A 1KOAA 3FQNA 1G7PA 3PABA 1JK8A 3F5WB 4PLJD 5I2IA 2X4TA 4TTDC 4L3EA 1RUKL 3V8OA 2EXYC 1EZVX 4PGEA 2QSVA 3LD8C 3NAAH 2LQRA 4S0TD 2AK4E 3DWTA 3FT4B 4GRLB 1GGBL 3MRGA 4AMKL 5GHWH 4FZEL 2B0SL 1P84K 1U95B 3BT2H 2FJGB 1MFEH 3M17B 3O6FA 3VXPA 4UB0L 2GJ6B 3VXSD 3BESR 2CK0L 4D94A 4M1DH 4JDTH 1MWAB 1ZA6B 2ED9A 4FQHB 1XZ0B 1YEEH 1YJDH 2GJZA 4GG6A 4KRLB 4HT1L 1AY1L 1ZS8B 3LRSB 1BF8A 3ZTNH 4ODBD 3TN0D 2GITB 1HYSD 5HYIA 4NC1E 5J3HC 4HX1B 1F3DJ 4Y4FD 3FOMB 5T5NF 1MRFH 2GUOA 5EZIL 2ZUVA 3LB6D 4GRWH 4YNYA 4LHUB 4PJ8C 3SDXF 5FO9A 4ZFZB 1ADQH 4YJZL 5K9QG 4IIQA 4XNXH 2PYFB 1QBMH 4U1GB 4MDJB 1MJ7H 2VISA 1QFWM 3NGBB 3O8XB 1CIDA 1HH6A 2QQKH 5HYJB 4M4RA 1YPZB 2QBWA 1Z0NA 2X5PA 2DMBA 3WKML 4MJ2A 5EUOE 4HKBA 1D9KB 2HN7B 2OK0H 2B39A 3TO2A 3O9WA 2Z91A 3BXNB 4OF6A 2A2QT 4YHKL 3X17A 3QNZA 4TVPL 2YRZA 4NSKB 3S4SG 4OCRH 3CLFH 3GSRA 1U3HB 4OSUL 5JHLH 4HD9A 3C5SB 1B4JH 3QPXL 2HRPH 3OZ9H 4OD2A 4K3JH 1FL5A 2VOTA 2CIIA 2G2RA 1CN4A 4LQFL 5IB2A 3IJSB 2C7UA 1CL7I 1FIGL 4Y2DA 1EERB 1DUZB 5EUKB 1REIA 4OI8A 3TBVB 2QQLL 1FAIH 4TULL 2ENYA 2AK4A 3CH1A 1CFQB 3SPVA 2ICWA 2Y5TB 2VDPL 3VFVA 4DFIA 4XRCA 2R0WH 3UP1A 2B2XL 1LILA 1KC5H 3CC5A 1U91A 3GIZL 4KRMB 1CD1B 5D72H 3KLHC 5K9QI 1VEPA 4OQTA 2QSTA 1OD9A 2V2XA 2VMFA 4Z7VF 4CDHA 5I8KH 4MXWL 3SKMB 4RFEB 1A5FL 3ZKND 3B83A 4CN4A 3T2OA 5D1XB 4Y8AA 1A22B 1NL0L 5DFTA 3H2WA 5CEZD 2FHFA 1QSZA 2ADIA 5F9WB 3B9KC 3RY6A 4I4WA 2YHGA 5C0CE 3Q3GB 3VGGA 1FDLL 1INQB 4MYWB 4E41B 3S88L 1U93A 3NZHH 5K9JH 4KRPB 5CIPB 5ESQB 1PKQB 3VRLE 5EU6B 3FO0L 1F2XK 2Q86A 1LWRA 1JGVH 4XPHL 5BVJA 3N1GC 3KPQA 2EE3A 3QWQB 1T7XA 5EUOA 4DQOL 2R1WB 1X4XA 2BNRB 3JWOL 4C57C 2K7QA 5DTFA 4H8WC 4EN3D 4V1DB 2F19H 3FB6B 3AS1A 5A2FA 1CLOL 3BEVB 3B6SB 3WN5A 3T0EE 3QRFM 1ZGLB 1HDMA 1YYMH 4JJ5A 3WXVL 4KJPC 5FXCH 1RUQL 3OHXB 2FJHA 3WHXB 2EE6A 4PRBB 1KTKE 1CLYL 2V5TA 1TJIH 4XPFL 5MHSD 4P46C 4M6MH 5AZ2H 3UTSA 4XC1H 3VXQA 1JNLH 4M5YL 4ONGL 4MA8H 4OKDA 5CGMA 2VLRD 3SKOB 1MJJB 1BJ8A 3LEXA 4JHWH 1QSVA 4AEHL 4BQ8A 4OCXL 3QIBD 5GZOD 4RGNB 2FR4A 1PLGL 1WWWX 2YK1H 4ODTL 3RWCB 3S96A 1EEQA 3ARZA 3CDCA 1DQJB 3TM6A 4C59B 3LKPA 1YEGH 4YHYC 3GSXA 1JYVA 1J88A 5D1QA 3VA2C 5C0CA 3MLWH 1D6VL 4HMCA 3T4AA 2FEDD 4O02H 4MJIE 4N0FA 3IFNH 4M8QB 4HWBA 3U1SH 5C0BB 4ESKA 1PX3A 3EYVA 2ZOLA 1T5WA 3I84A 4NM4L 1S9YB 4UT9H 4UNVA 4RMTA 1F4WL 3RL2A 1KXTB 3QDGE 2DL2A 2NY4D 1S9VA 3QUYD 2QR0B 3MUY1 4YHML 4H25A 4QXUH 3V6ZA 4L8SB 1C5BH 1UKSA 5DRXB 2CDGB 3VFUB 43C9A 5T3XH 3H9HB 4Z0XB 2EH8L 5EFIB 5MEPA 3I50L 1E6OL 2R4RL 4FXGB 4BSWA 4ETQB 1DN2A 4QNPE 3T0EA 4RNRB 5DJXB 1INEH 4A6YL 3KPLB 4LVNB 4CVXA 1V3JA 1P84J 1JTPA 2F74A 4LSUH 1OAKH 1Z5LA 4GXVL 3ZYOA 4OZFA 2IAMC 5GGQH 2HFTA 2VXQL 1I9JL 4U31A 5AAMA 2FJFA 4MWFB 4PJAE 2I9TB 1PZ5A 4MD4A 8CGTA 2R1XA 3HMWL 2XA8H 2GW5A 5EC2B 4ONHA 3PDDA 2DLEA 1OAYH 1FJ1B 2EH7H 1F4XH 3KYNB 2XOTA 3NIDF 1VFAB 3AM8C 2OTWB 1SYSA 2VO5A 1DE4A 3BKMH 4R97B 1UH4A 1NGZB 4O2CA 4P2CG 5T1LA 3KNBB 4WDIB 4LKXA 4PJCA 3LN5B 3EDKA 4OZGA 3CIQA 1INDH 1B2WH 2CRYA 4U6TA 5GRUH 4NM8H 4EI5A 5CBAA 4YDVB 5DD3H 1G84A 1ED3B 2ARWA 1YZZA 3HC3L 3KPNA 4H0GA 4MJIA 3U6RA 3T0DA 5J11C 3OB0H 2XN9D 5E6ZA 3D2UB 2B4CC 4GBXD 1T7ZA 4ELMF 2J88L 3V4VH 3QDGA 2HVJA 3MCLL 3BX7C 1IFHL 2EDFA 3UYRH 2ZSWB 4U7SA 2FB4H 1U8KA 3DBXB 2XZQH 2ITCB 5FYKU 2F54B 1PYWB 3S5LB 2UUDK 4IRSC 4H26A 4U0RB 4YC2C 5DD5H 5JOEA 3KYOA 1BJ1J 4J3OC 4PJFE 4CBPA 1F11A 4OF0A 4HS6A 1Q9WA 3A6BH 2Y25A 2APWA 5CJ8A 3DUUB 1ZTXH 2JJTC 4NJ9L 4OM1H 3LH2L 1D7FA 5IHLB 2C3XA 1BHGA 4JFFB 3CMOH 4MNGB 4PJAA 5L8LB 2OYPA 1PY9A 3QEHB 3IRPX 2ZZUT 4CMMB 3FB8B 4DGVL 5HYJD 1IGIH 1NC2B 4NQXA 2FIKB 4RMQA 2XYCA 4CVWA 1MCFA 4QTHB 2ZJSL 3LEYH 4MCYA 3ZTJH 1TZIB 1T7WA 1Q9KA 5E2JA 4ZXBC 3RWHA 1JHKH 3TNMA 3PDGA 1U3HD 5IB4A 3NN8A 5BRZB 4MAYB 3HHRB 1BM3H 5DRZB 5SX5H 1Y18B 3L9RA 5HHVH 4OV5B 1NLBH 2W38A 5I71C 1V7ML 1YPZF 1ZLWH 4EQ2A 3ULVD 3KLAB 3HE6D 1CU4L 3MA7B 4K8RD 4X5WA 4YBQC 4JO3L 3S97C 3RVXD 2CDFB 3ZE2E 2ZPKL 4U33A 4EDXB 1AQDB 1OM3L 4JCMA 3U0TA 3IU4H 3V5HA 3VCLB 2CK2A 3FN0H 3K1KC 1VCAA 3RNKA 3MRPA 1U9KA 2A1WH 3PJSA 3QFDB 1OTTD 1YJDC 4C56E 1MQ8A 4YXLH 4KXZH 5KVFH 4U6YB 3OKLB 4KKBD 1T2JA 4X6CB 4HH9B 1Z6JT 4OFKA 4PJFA 4LSDA 1BZ9B 2X4PB 3ILPA 3MGAA 1CDBA 1KCVL 2R2EA 4MS8C 4HIEA 3VDCA 3BAEH 5D7JB 4H0IA 4OT1H 2CDEB 1YNTA 5EB9A 3LQAH 4HH8A 4E41D 1GGTA 4F2MA 1ZA3A 4EI6B 2XZAL 4KRPD 3JZ7A 2PW1B 5IMLB 2YS4A 4Z7UE 3ARTA 4WI9A 1JYNA 4FP8L 1A7NH 4MAUL 5EU6D 5IW6A 3E0GA 1JPTL 3HB3C 1QRNB 2PF6A 1G0XA 2XTJE 2NY5H 4O5LL 4FTVD 4JFDB 4XCEA 1A6ZA 1AXTH 4CUCA 2E7HA 1H3UA 5GS2H 3EFFB 3V0AC 3H7BB 5D2LF 5SWSB 2BNRD 4JFQA 2HMID 2P8PA 3QCVH 3J8F7 4MQ7A 1G9NH 1RHHB 4YFLF 4LHJB 3QUXC 15C8L 2IBBA 3C8KA 1EGJA 1UC6A 2JIXB 4PV9A 5H2BA 4XXCA 3IU3A 3E6HA 1ROWA 1BECA 4WEBH 1IAOA 1FO0L 2X42A 4IBLT 1J8HB 1GGUA 1E4XL 3H8NA 3BP5A 4GS7B 1T03L 1PVHA 4QRQB 4YR6B 3HCVA 1KJ2H 1S7RA 1C08B 3DYOA 3VXMB 3OKEB 5E8PB 3RIAF 3TH2T 3CSGA 3H9YA 2VN4A 5LAXA 1FGVL 3TBTB 4Z18A 4TNWF 2WUCL 4D9QE 1CIUA 4GAGL 2GSGB 4WY7L 4RGND 4JPIA 3U4BH 3H3PH 4EDWL 2NYYD 4UIKL 3TGXA 3VG0H 1F90L 4LSQL 4U1NB 2A74A 1EH9A 5KS9F 2Z93B 1ORSB 5K59E 5KG9A 1MFBH 3LPGA 2D0FA 3MRKA 3MLRH 4ZUTB 1HHKA 2DQCH 2HJFA 4K94H 1QO3A 1K8DA 4Z7UA 2VDLL 4P4RA 2YPLB 4UV7H 5HHXL 1MIMH 2CO7B 4OFIA 43CAA 1J86A 3PV6A 1R24A 3BN3B 1RUMH 5KVGH 3P9LA 2EDRA 4OGZA 4NZJA 2CRMA 3UJTH 3VFMA 3UYOD 3STZB 4U6HA 4I0PB 1VDGA 4QLRA 1WK0A 4O51A 4DVRL 4FZ8H 4ZPTA 1WWBX 5GGSA 2WINB 5IEHA 1NGYA 3EOAA 5FA4B 4D8PB 1EEUA 3KDMA 4OZFH 2H2SD 5HSFA 3R1GL 4NN5C 4LNRA 1T80A 2XIDA 4Z7WB 3DX7A 1NANH 1CLZH 5GGTL 4WI5A 4WGWB 3VGDA 1KV3A 1MCEA 1PG7X 4R0LC 5BXFA 3VFGH 1N64H 2EDLA 3O0RH 4G8EA 2AQ1A 4QTIL 4AY0A 5DMIH 1Z3GH 5TFSL 3MBEA 5GGVL 4KDTC 3MUGB 2NY3C 4LSPH 1XGUB 1CDYA 2DBJA 3RUGF 5IMKB 3BZEB 4RAVB 3L3IB 4AL8H 1GAFH 2VLLA 4N8VB 3U46A 4DN4H 3IJHB 4IJ3C 3VU2A 2BY0A 1VFOA 4HUMB 1N2RA 2EYSB 1A3RL 4WJ5B 1MH5B 4CW1A 5FO7B 3RP1A 5C0IB 1RZJC 1IQDB 3QJFA 2X1OA 1HKLH 4YDJB 4D9RE 3MXWH 2GJJA 4ONFH 2JCCB 4F8TA 3L3OB 2AKRB 3FQTB 4JGJA 2GK0B 2XY2A 1N8ZA 5IB1B 5L7XH 3D2UD 5TH2B 3O2VL 1N0XL 4XAKE 12E8L 3S3SA 3EOTH 3SQOH 4I2XB 2MHAA 3WYRA 1EMTH 1F3JB 4L4JA 4JM2C 3HA0A 5AWNH 2KQMA 2E9WA 3EO0B 5KW9L 2XY1A 4LKCB 1UH2A 4XWOD 1T2QL 3WSQH 1X5KA 2R69L 3TFKC 2F54D 5D7KE 5ERWB 2OXHA 4Y1AB 5MEQA 5FYJL 2ZKHL 4ALAH 3SEPA 4HF5H 5JXEC 2AJZB 4OZHF 5BQ7B 2V5RA 3AB0C 4JPVH 4G7VL 2ARJB 4KK9D 2CRZA 1AXSB 3IFOB 3IF1A 3KYKH 2ZCHH 4NQCE 3RRQA 2ICEB 4RGOL 2HTLC 5A2JH 3E8UH 1VFBB 4I13B 2P24A 4XZUA 4X7TB 1NC2D 5TDOB 1QKZL 3FFDA 3I3EA 4XNMB 4WCYH 5LCVH 4GLRH 3S36H 4HIHA 4DEPB 2ZP0T 2DKUA 3EOBB 4OCSL 2B4CL 4FQCL 2FL5B 4YEFA 1JUFB 4TPRH 3PIQA 4KI1A 1GXEA 3M8OL 4LEOA 4D2NA 4MXQD 5CZKA 4YHOL 4XP6L 5BRZD 4G3YH 5INCB 4XPBL 2EO9A 5TDPA 2I60L 4ZUWA 5BZDB 1BZ7A 4OLUL 3CLEL 4G8IA 4AEIH 2AS5M 3O6FC 4OGYH 1FBIL 4GUPA 3IAPA 4XNUL 4NNPL 3RQ3A 3PWVA 1F5WA 4RX4D 4CMHB 1KCSH 5J13B 3WL9A 1TITA 3GUTB 5GGUB 1FZMB 3CZJA 1ND0B 1EK3A 3L7EA 3ARGB 4GKNA 3TA3D 2YC1A 3TH3T 4P3DA 8FABA 1LO5B 5F1OB 1T0NB 2MWCA 3D18B 3GHEL 4PRNA 4YIQB 5J0BA 5DUPL 3KPMA 4PJIF 3F12B 4NQEB 1AR2A 5I1LA 3RVUD 4LLDA 3FO1A 3RVVC 5GS0H 1QQDA 3GSVA 4IIQC 1WEJL 1S8DB 5IBLD 1IQWL 1FV1A 3QIUB 4HZLB 1HWGB 3KPRB 1YN6A 4HG4K 1FGNH 4U1IA 1LE9B 4MHHI 4M4PA 2XG5A 5IBUB 3O9WC 3VFOB 1HSBA 3MRMB 4NBZB 4NQCA 1OOAA 2XWJB 5CEYB 3MGOB 1EJ6A 4U0QB 5B38G 1YMHB 3RI5F 3CK0H 3AREB 1QRND 2ZUYA 4AENA 3K4AA 3OAYH 1CBVL 3GBLA 3QBTB 3M1BB 1SJEA 1AGDA 1AGCA 5B8CB 4WFHE 5DMKB 1OP5H 2BCKA 1MFEL 1XEDA 4MA3A 2IPKA 3BZ4A 2X4NB 1IKFL 1A47A 2F5BH 4JHZA 1URLA 3UPRA 4PJDB 5HGDA 2ERJB 2VDQL 4PJ7B 1CFTA 1SJHA 2R9HC 3WIHA 4PP2A 5JPMB 5I19H 1YMMD 5IVZA 1KTDB 2JIXD 3K81A 4Z7VE 1JZ3A 2PN5A 3MR9B 1I9EA 3W9EB 1TVHB 1TIUA 5TF1H 4O4YL 3DO7B 2IQAA 1RIVL 1DQMH 4TUJB 3GJEB 5HHMB 2N56A 3FFCE 1PEZA 2C1OA 1EEZA 5IHZB 1HHHA 4NZTH 1MJ7L 3OMZA 4M62H 1CFNB 4NC1C 4L4VA 3RY6C 1QR1A 3SDXA 1FFPA 1J1PH 3OG4B 2EICA 1IEAA 5FDWB 3VXMD 3RA7L 3RWEA 1U3ZA 1OAXH 4NGHH 1GZPA 5CGYD 1M7DB 7FABH 1LO2L 3BH9A 1BFVH 1ZE3C 2O61A 2UYLB 5CAYB 4OGXL 5CEZE 2E7BA 1NMAH 1SVZA 1V8HA 2A6DB 4M48L 4RFOH 5FB8B 1D5IL 2A9ML 2GSIB 2P8MA 4W6XB 5JXAH 2VNCA 4M6NL 4RIRA 3SJVE 3TVMC 2YOCA 2YPLD 2VL5A 2NY1D 4PS4L 2BP3A 4U1KB 4PG9B 1F42A 3FQWA 1OLLA 4X80L 2RCSL 4Y4KB 4OFYA 1MCPH 1I7UA 2R0WL 3AC0A 1G9NC 2EYRB 1SEQL 5C07E 4OZIB 5D9SA 2PYEE 3OAZH 4EZMA 2B1AL 3KR3L 3U0PA 2HT3D 2PKDA 3TIDA 1ZV5A 5I8EA 4Z7VA 3DTXA 4S0SD 2FWOB 3IXTA 1UWXH 1LP9B 4M3KB 3PNWB 3B9DA 3FONA 5KSUB 3EYUL 4JFOA 1D5XB 4JZJB 4LIQH 1JNHB 5F1IB 2AI0L 1QSED 3FFCA 3EDJA 3NZHL 4GKSB 4XT1C 5MHSE 4YBLC 5CD5D 1H3WM 1X7QA 4D9LH 2AJSH 4FQ2L 5DRWB 1I9RL 3S4SB 1IC5H 5CBEA 1RJYB 4QOKB 4X4XA 1JGVL 5D1QC 5EBWB 3BWUC 1BOYA 1KPRA 3L3HA 5FKAA 3K2UH 5ENWB 4JE4B 2JLLA 4FS0A 3HG1E 4NHCL 5IGXH 2AV7B 1CDHA 3O41A 1J05A 5CD3A 3U7AA 1E4KA 2I27N 5HGAA 5T33H 3LZFL 2F19L 4K94C 3MLPA 1EBPA 2FECL 1LE5B 3QO1A 4QGYA 2BVYA 4N1HB 5I1JL 1ZXQA 5FUOL 1UJ3B 5DO2C 3IDIB 4ZAKB 3ISWA 4PRPE 5DRNA 3SJVA 4HV8B 1JHTB 1BOGA 1S5HA 4NJAH 4CL7A 3CCHA 4PRIE 4TVPD 5I1CH 1RZGA 3VWJA 3VRIA 3NTCL 3T0EC 3U0WH 4QY8A 4M6ML 4WRLA 5AZ2L 1P7KB 2ZNWA 2AV1A 4LU5L 2I25N 3DUSA 1V3KA 1T3FA 5C07A 4MA8L 2B5IB 2Q6WB 4AH2B 2PYEA 3GMNA 3MV7B 5FUZL 3V52H 4CVUA 4Y1AD 1EEYB 3HFMH 3ARFB 5DMJB 2P7TB 5JHDE 4EVNA 1QSFB 3JV4A 1W0WB 1YYLL 3TYGH 3CFJB 3CZFB 4ZTPH 4ELKB 3A6CH 3NIDE 5GRJH 4KMLB 5IFHL 3D3VE 4RBPH 5E6IC 1IE5A 2JK5A 5IVXE 2FZ3A 1EX0A 4S11A 4NNXB 4O02L 3L3DA 1MRDH 1UXWB 2Q76A 2A6JB 1AE6H 3QUZA 5C08A 2JELH 4DKFH 4ZTOH 1D5MA 1G7LA 2VAAA 3G5YA 4EI5C 4OCMC 2YKLH 1RZJL 3R0NA 2BFVL 5HDQL 1H3PL 4MJ4A 4HG4J 3ABZA 1WISA 1YEHH 4OKVB 3VWKB 4N0RA 4KTDH 4QXUL 3HG1A 4JPWH 3ULUF 4GSDH 1I7TB 2VLKE 4PRHB 3M07A 2XKUA 1MEXL 2UZIH 4HWNA 4I18A 4W6WB 1IGFH 1JGEB 1R5VA 4OUUA 5I6XC 3NCYP 3VFPA 4Z5RB 3UEZA 4IS6B 3RDTB 4LPWA 5JMOC 5LQBL 3VFNA 2OM5A 4X0KA 4Z76A 1HXYB 4PRPA 5KVDH 2OI9B 3T0VA 1BVKA 5I76A 4X6EB 1JN6A 4PRIA 4BQ6A 4ODVL 5GJSL 1A9BA 4WI6A 3JV6B 4ODHH 4P2OC 3BP7B 5DHVB 1I9IH 3ARGD 1FVDA 2E9BA 4I9WE 2ICES 1MLCB 2P49B 1BD2B 4WWKA 3DROB 2GJ6E 5FM8A 1KN2H 1FO0B 5JHDA 4LDEB 3ES6A 4RWYL 1EFXD 5IROA 3V5KB 3FO2B 1DJSA 3MUJA 3D3VA 2YSSA 2F5AH 1INDL 5ABDE 5I8OH 3MO1B 2VLMD 3SDCA 3VFRB 4XH2B 2BVTA 5DD3L 5FHBH 1CGYA 2QSCL 1YC7A 5JOFA 1IL1B 1S7UA 2CXKA 2NXYC 1CXKA 4EUPA 3WFEH 3ARED 4JDZB 5J12B 4O00A 5HYJE 5J57B 1RIUH 2YD8A 1YPZE 3MNZA 4H20H 3W11D 4YUEL 4XCFH 1BIIA 3DRTA 3HPLA 3OKNA 4MXVF 3S34H 2C3VA 2L4OA 5K33A 2AJXL 1YUHA 2EIZB 2YPKB 4ELMA 2HJLB 4UQ3A 1LEGB 3G6JB 1CE6B 3WS3B 3CDYA 4TNVF 1N6QL 2VLKA 3OF6A 5E03A 2HT2D 4NNYA 3C6LA 3ARXA 4FXKA 4KGJA 5BJTA 4DWHA 5DD5L 3F5WA 5HDOA 3K3QA 4LCYB 1RPQA 4P2RD 3D87B 1P1ZA 4ZOBA 5C92A 3A6BL 5TE7H 4NO5B 3ULVE 4HS8H 1BGXL 3IAGC 1ZLVH 1HXMB 2JB6A 5HHMD 1T6VN 4JO1L 2Q3ZA 2D4DA 3F8UB 3FT4A 4GRLA 4XNQB 1XH3A 1EXUA 1U95A 3MLVH 2FJGA 4PJDF 3EYFB 2G60L 4EKXA 5HGGS 2H26A 3UTTD 2GJ6A 5F44A 3OPZH 5CINH 1V7NL 2X05A 2FX7L 1QLFB 1XZ0A 5BO1L 3OKKB 4RRPA 1H15B 1CT8B 2AJYL 4JZNB 4KRNA 2GITA 2Q7YB 4TOYH 2VR5A 4YX2H 3FOMA 5A3IC 3SGJA 3L5IA 4E41E 4LHUA 4N0YH 3ZE1E 4ZFZA 5DT1H 4WHYH 3GI8H 1N5YH 1PKQE 4MDJA 4HFUH 3O8XA 4XMPH 4OTXH 5CJBA 3DMMB 3THML 1JRHH 1HILB 1YPZA 4JFZH 5J56B 1SBBA 4P4KC 4OQTL 1KIQA 3GMRB 1I3GH 4XXCC 5DJ0B 3R06B 1D9KA 2HN7A 3LKNA 2EZ0C 3BXNA 1YNLH 2VZOA 2LTQC 2Y9RT 1VACB 4HKXA 4V1DE 4BA8A 4G6JL 1JE6A 2EC9T 4J4PA 3C5SA 1FCCA 4WUKL 3HRPA 3KYMA 2H3NB 4I5BA 5JIIA 1VEMA 4GRMB 5EOQH 3IJSA 3P3YA 5MP6H 1YC8A 5D96C 1I8KB 3ZSTA 1DUZA 5C9JB 4WEUD 3BAEL 5EUKA 3MREA 3QCTH 3TBVA 2DQHH 2YRLA 1QVOB 1IAKB 4HSQA 4NO0B 2WBJC 5J1TC 4HCRA 4XWGH 2Y5TA 3IDXH 1WIOA 3QJHA 1FCGA 2AJUL 4QOKD 3SGDI 5D93C 3U48A 4PJEB 2QKIB 5J9PA 5L2KB 1K6QH 3ZKMC 5AYQA 3MNVA 1IAIL 2YA1A 5CEZH 5DYOB 4QGTA 5TE4H 1UCBH 4RGNE 5E4EB 3U30C 5GRVL 1QFWI 1NBYB 2FYYB 1LK3L 2XZZA 4JLRB 5D1XA 4NWUL 4HULB 5HYQA 1RK0B 1G9NL 2XTJC 5D2LA 1FH5L 1QOKA 4D0CB 2EXYD 4JY4A 3MUHL 4XBPB 3Q3GA 5K9KB 2OZ4H 1F3DH 1T66C 5C09B 1HQRB 2PO6B 5ESQA 5C0BE 1NLDH 1DVFB 1PKQA 5E8DL 1FC2D 7CGTA 1JL8A 4CNIB 4PGBB 3UTOA 3TF7C 4OD1H 3WIIL 4FQJH 4F7MB 2BSRB 2LABA 2VDKH 1RMFH 3TO4A 3EYSL 3KWWA 4V1DA 4UNTA 1NCWH 1NGXA 2UY6A 4FG6D 3SCMA 3ARFD 3BRGC 3PP4L 3BEVA 3B6SA 3P0YL 1C12B 3MBEC 1ZGLA 2RJMA 3CVHA 5J3HD 1I7ZB 3RUGE 2UWEF 4HWBL 4P0DA 3UPCA 2Z31C 5IMMB 3WHXA 5F7DB 2CO6B 1DANT 1QFUH 4K7PL 2Y36H 1KLGA 3HS0B 3WMSA 2V17L 3IT8D 3MLRL 5ESAB 2P5WA 4LCUB 3EFDH 2P5EB 4PGZA 2W60B 4LVEA 4LNVA 5E00B 4PBVC 3QT2A 1I3UA 2EEDA 4W68A 3SKOA 2ZNXA 1MJJA 2WQ8A 3ARBB 2LE9A 2IQ9H 4LLUA 3PWNA 1W0YT 2BNQE 5I0DA 3T65A 3GO1L 3RWIB 1EAPA 3UC0H 3VWKD 4FQXB 1GOHA 4PJBF 4OCYH 3EJJX 1V3LA 3RWCA 4YE4L 1KSRA 3UZQA 4FZ8L 1DQJA 2H6PB 2B8OT 2HTKC 3VW3H 1MELA 4XP5H 5I71B 1MCWM 1E28B 3P4NA 5JW5B 2HFGL 2D7TH 1HE7A 3BN9C 5C0BA 5ACZB 3C08L 5H94B 3QQ4A 4NN6C 5K9OB 4MX7B 3MV9D 4Q7DA 1S9YA 4HJ0C 1N64L 2IPUG 4NFDA 4KVCH 4N9GB 4GG8A 2QR0A 4R3SB 3MRNB 5DC4B 2VN7A 5EOTB 4L8SA 4IOIA 4X83A 5DRXA 1C8PA 3VFUA 1JGUH 4LSPL 1AR1D 4NPYB 3H9HA 1ZEAH 2F54E 2WP3T 3V7AE 5DGQA 3KPOA 4MA7L 4X4YB 4ETQA 3RUGA 3WJJA 4K55A 4RNRA 5DJXA 4U6VL 3KPLA 1RURL 1FVEB 4EUPH 2WWMD 1YEJH 4EBQH 3FB7B 1PSKH 4JFFE 2AEQL 2IC2A 4RZCA 4LSTH 2I9TA 3O3BA 3IXAB 1A6WH 1OT2A 5HTSA 1KGCD 5H37G 1ORQB 3L3KB 1DFBH 4OB5H 5EC2A 1D6EB 3QAZC 3SQOL 1PQZB 3DYMA 4KK6D 2P45B 3I2CL 5TQ2L 3KYNA 1T83A 2BNQA 3ZHLA 2YPVL 3V6OE 2GAZB 1NGZA 2L7UA 2YN5A 3KNBA 2CUMA 4A2LA 2WUBL 2EIEA 3DV4A 3GMLA 3FZUC 4K71C 5BRZE 1W2KT 4ALAL 4QHLB 4KJPD 4PJIE 1ED3A 3H42H 5D71L 3QXTA 3RPIB 5B39A 1I1AC 2FLRT 2OL3B 4ZQKA 2Z9TA 4OZHA 4IOFC 2X4OB 1V5JA 4KY1L 3KYKL 1RK1B 4F80A 3Q0HA 3MA9H 1MWAH 3E8UL 3P2TA 3EO1B 4BSVB 2AXFB 2ZSWA 4PYHA 5EU4B 2QADC 3DBXA 3NMEA 3UBXG 1IC4H 3GM0A 1KFAL 2DQFA 4H1LG 1PYWA 1WTGT 5DK3A 3S5LA 1CK0H 5IMOB 1O7VA 3CUPB 1IGTB 1P2CB 3HAEG 3EJYD 4Z9KB 4NQDE 1I8IB 4FNLH 4UIMB 4XVUD 2YWYA 1WBXA 3KLSA 5DS8A 1RU9H 1KIPB 3G5VB 3ZT5A 5JW4N 2R4SL 3FCTA 4JFFA 3BIKB 4N0CC 1ULVA 5JA9A 3HNSH 3QNYB 4PJXB 4WW2B 3MRDA 3QEHA 4O9HH 4MZ2A 4HXAL 1VADB 4CMMA 4X7SH 1OGTB 3FB8A 2D4FA 4JPKH 2Q8AL 5BW7A 1S9KC 1QRNE 3P9MB 2VXVH 3GBNH 2BY1A 3REWB 4MA1C 4JFDE 3K8LA 4L8CB 1P5UA 1TFHA 1H8SA 4AIZB 1DBAL 1TZIA 5SWSE 3CVIH 5KJRH 25C8L 5FOJA 1Y6MR 4YDIL 4Z95L 1MCRA 5DR5H 1SMAA 3JTSB 3ULVH 1OAUL 4MAYA 4K8RH 4NN5B 1FLRH 3LPWA 5DRZA 2ORBH 1Y18A 4PJIA 4R7DB 4OV5A 3T1FA 4HCRH 5DURB 4Y5XA 2V7NB 5D8JH 4JAMA 3RVTD 3MA7A 1U8LB 3EHBD 3TBSB 5C6WH 2CDFA 1NAMH 1JVKA 1J8HE 5CSBA 1AQDA 5FYJD 4FABL 1A6UH 2YD7A 4PR5B 1E27A 1HYSC 1R3JA 3QFDA 4Y4FC 2GCYB 5E24E 3VXME 5L2KD 1OF2B 2EKJA 5GSVB 4HH9A 1XGYH 1KJ3L 4PTUB 3TZVA 4IRZL 2R0KL 1EGJL 4NQDA 1BZ9A 1MNUH 1BJ1H 5HXMA 2BXZA 2J1KA 4JFEB 5E99H 1S3KH 4TYUA 2QQQA 5CIPH 1WCBB 3PWJB 5D7JA 1FRGH 2FO4B 4EI6A 3MV8D 2PO6D 2PW1A 3F58L 3E6FB 4LLMB 2NTFB 1OAZL 1DVFD 1KG0B 2YPLE 4HIXL 5TF1L 5I15H 2P46B 3WLWC 5CEXB 3QXVA 4Q97A 2BVOB 1JZ2A 5F7EH 1QEWA 4WHCA 4UTAL 2I24N 1MCKA 4M93C 3PWPA 4JFDA 3QDJB 1JZ8A 3QQ3B 3H7BA 1P4IH 5SWSA 3ARYA 2LAAA 2YUVA 2GK2A 1KEGH 2BVPB 1RHHA 1X5YA 4OCLC 1UFUA 4WUUB 2NY0C 1HI6B 4R4BB 4X6BB 4JHAH 5B38B 1R3KA 1MAJA 5E1HB 1KLUB 2BSTA 4TRPH 2R2HB 3CXHK 4Z7WE 4GAJL 5E8OB 1G6VK 5ISZB 5TE6H 4X9HA 5JXAL 5D2NB 3J7HA 4B53A 1OARH 1J8HA 1GHFH 4P59L 1Z9OA 2P5ED 5FA3B 3D0VB 3PABB 1JK8B 1CG9A 1N5AA 1UYWH 2J8UB 4YR6A 2RIKA 3PQYB 4L4TB 2BY3A 4UINH 3ARBD 2J6EA 3AUVA 4PGEB 3TBTA 4ZXBD 1J1OH 2V7HB 2CLZA 2BDNH 3CSPA 2EC8A 1IJ9A 1OQOA 3MRGB 1H5BB 2XA3A 3Q5YA 2BHYA 1X5LA 3HI6L 3BKYL 1SM3L 2Z93A 1ORSA 3AS2A 4ZO6A 4HMEA 1F6LL 2B7DT 3NCJL 4WI2A 2FDBP 4OF8A 1JPGA 4ZUTA 1EO8L 4ERSL 3RZCB 5IB3B 1AGFB 1CWVA 2JCCE 2GJZB 4RSVA 2YPLA 1DSFL 2EDHA 3GSNB 3NIFF 5DLML 5DVNA 2GI7A 1JTTA 3MJ7B 2NTSP 1CXLA 1AKJD 2DMKA 2GUOB 3PGFH 4PRAB 3VD4A 5FAAA 2XKSA 3P0VH 3EOYG 3STZA 1J10A 4I0PA 3O6MH 4IIQB 1A7PH 2VISB 4Y1AE 2VJXA 5I74B 3K2UL 2ESVD 5FA4A 4GMTL 4KJYB 4D8PA 4BQ9A 1FPTH 5DD1L 5T33L 2YD1A 4HKBB 2BC4B 4Z7WA 5DQJB 1P7QD 2Z91B 4YLQT 3WD5H 1MJ8H 4HPYL 1PBYA 3O2WL 5GZOC 3QCUH 5F7HA 3HB3D 5D6CA 1FL5B 2CIIB 4I18C 4K07A 4RISH 2O5YH 1AIFA 2VC2L 5IB2B 3MUGA 1NDGA 3VGFA 4Y2DB 1XGUA 2O5XH 5E2TL 2HKFH 5IMKA 3RBSA 1EHAA 1ODAA 1VA9A 3CH1B 3IDYB 3O3UN 3LEVL 3T1WA 3IJHA 1HK6A 3QUXD 4HWUA 3VFVB 4KJQC 4OCWH 1N6VA 1Z0MA 3CC5B 3QI9A 2NY4C 2VDOH 3QWOB 4WJ5A 3OB8A 1MH5A 1ZANH 3EDFA 3RJDA 3AMLA 2XV6B 5FO7A 4M6OH 2K3TA 2PTVA 3LN4B 2V2XB 5TPWL 2BVUA 5JMRA 4WWKC 4OLZL 4YDJA 4Y19B 2JCCA 3L3OA 4U1LA 5IB1A 5TH2A 5IROC 2X4RB 4DJMA 4R6UA 4I4WB 1MJUH 1C1EH 5GRVK 3EO0A 4DKFL 3MLXH 4ZUSB 3FKUS 3SDAA 1YEFH 5CJQH 3MRJB 3LN9A 3SDCC 1A7RH 1WBYB 3NCCB 5F88B 5CCKH 4NQEE 1OTSD 5ERWA 3TEUA 4UILL 3CX5J 2Q86B 3KPQB 4GSDL 2AJZA 3TNNB 4JR9H 3LMJL 3NA4A 2Z35A 5EUOB 4M7KL 2JJVA 3KPRE 4J3TA 3HMXA 2ARJA 2VLME 4LEXL 3MRIB 3ZDXF 1BP3B 1NMCC 5BOZG 3RHWK 1LEIA 3IFOA 1NC4D 5JW4M 1WFUA 3BPNB 3VXUB 3WN5B 3DIFB 2UUDH 3C6LC 5IOPB 1HDMB 1RULH 5TDOA 3TT1L 3OKMA 4XNMA 1G6RA 4JJ5B 2KUTA 1B4RA 2FJHB 3PUCA 1LO0L 3EOBA 4HJJH 5L0QB 2FL5A 3LIZL 4I48B 3QEUB 3SGKA 4QKXB 4KDWA 3UTSB 3NFPB 3VXQB 1HN1A 1Q8MA 1HINH 1JV5A 2V9RA 4Z7OE 2VDML 1KN2L 4GRLC 4PJDE 5DZNA 3FQRA 3L6FB 5BZDA 3VI3E 4LFHG 1CYGA 3O45B 1T1XA 4KHXL 4F57H 4TQEH 1S7QA 3BKJL 5HI5C 1JWMB 3WLBB 5F7MC 3WUWA 1CDIA 1CCZA 4LVOB 4UUJA 3LKPB