4MDIB

Immune receptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
189
structure length
189
Chain Sequence
b'DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mdiB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mdiB01
2PTVA 4PGDB 3ULUF 2I07B 3MOBL 2A1WL 3WKML 2QSVA 1OOAA 3SKMB 3IDYB 1NLDH 1P9MC 4XVSL 4CW1A 2IH1A 1SM3H 1OAYL 1JF1B 1WIPA 4HZLA 2O5ZL 3RRQA 2DMCA 1A2YA 5ACLA 5BCAA 4JAMA 1WTGT 1ZEAL 5DK2B 4HKZB 2X9YA 4BELD 1RPQA 1DBJL 1T4KB 1VACB 5F7EL 3O4LB 3K74B 2FNBA 4ZFOL 1S5HB 1YEEL 3O41B 5EO9A 2A9NH 5K9JH 3TN0B 1MRFH 3BKJH 5F1NB 5B8CB 4KRNA 5JR1L 2R4RH 1WBZA 5GZOD 4M93B 1T66D 1U8PB 2BSED 1ZOXA 5TF1L 4LNVA 1J05B 1GZPB 3SJVA 1GHFL 1R5WA 5FGRA 1BD2A 1CDJA 3WNMA 1AGDB 1QSEA 2FJHA 5GGSB 1OF2B 4NWUL 4WI9A 1J9CT 4WWKD 1KGCD 4ZUSA 2D31A 4ZOBA 5F9JA 2EEBA 3TV3H 4POYA 2WM0A 5KW9L 2LVEA 4XH2A 4IOSD 3S36H 4FFWC 3TA3C 3BKML 2NY3B 5FKAB 3CGTA 2R69L 4LOUD 5DD5L 2PNDA 4NM8L 3MLSH 2X4PB 1T1YA 3BP5A 5GHWL 2P44B 1UZ6E 2BOBA 1ZSDB 4NYLB 3E6HB 3SO3C 5I2IB 2Y1VA 3PWNA 3C8KB 2FHFA 4XCCH 3UBXA 4N0YH 3ZT5A 1RUMH 3WCYA 2VXUL 3HZKA 1R3KB 4DN4H 2FGWL 4HC1L 5MERB 1WZKA 2QQLL 2VDPH 3BP7A 1JHLL 2IANE 1RU9L 5EU3B 4KRPB 4OAWB 1A5FH 2DLIA 1BAFH 1FV1B 3G6JF 2H41A 3EYUL 3RVUD 3D39E 3EDKA 5E08L 2R2EB 1XF5A 2OBGA 3QZWG 4LHUA 4LCCB 4JFDD 2ADJA 1T20A 2PXYC 3TNNA 2PETA 1BQLL 3NCBB 3NFSL 3UAJD 5IR1B 3NACL 3TYGH 3AREA 2AQ3A 2LTQC 4PG2C 3V5HA 1CWVA 1FFQA 5EZOL 4TQEL 4KI5D 1QO3A 5DEGA 4I48B 2ZJSL 5DJ2B 3EYSH 1B3JA 5HI4C 3UP1A 3T0AA 2GTZB 4PUBH 3GJEB 4XVUC 4N8CL 3WIIL 1EHLH 3QCVL 5DVLA 5IJVB 5JHDB 1NMAH 3DUUB 2HKHL 1JZ7A 2W1NA 5D1XB 1B4JH 3ULVC 4YE4H 5IVZA 4RAUB 4LLWB 5GISL 1QLFA 3KLAB 3O8XA 1D5MA 1T7WA 1LQSR 3O3DB 1OTUD 2MNUA 1JV5B 4H1LH 4NQUA 1IC4H 4WTZG 2IPTH 3EJYD 4MA3A 5D1ZA 4G43A 1MHPH 1F00I 4D9RD 3ARVA 1E4XH 1JTTA 4G6FD 1BEYL 3UZEA 5DJ0B 1K4DB 1UFUA 4QTHB 4TVSa 1DDHB 2IAMB 4DGYH 3AC0A 2PR4L 4WCYH 43CAB 4PGEB 3WJJA 4G9FB 1H3TA 2BP3A 3TCLB 4PRPB 5KZCB 3VJ6B 1NEZA 4QRTB 1BFVH 1HKLH 4OD1H 2H45A 5EZIH 1IT9H 3WFDH 3GMPA 5D93C 5DTFA 4PP2A 3ZHDA 1KCRH 4JPIB 3HPJB 3QNYB 4IRJB 1QFUH 2VLRD 1EJOH 3EYQC 1UACL 1S9WA 1UH4A 2XRAH 1A6WH 5KTEL 4AJ0A 2DDQL 3QUYC 5E9DE 1IBGH 3IGAA 1FZOA 5E6IA 2OJZH 3EDFA 5CZXC 5IMKB 4GO6B 4FQXC 8FABA 1W72H 3MNVA 4KK5D 1W0VA 3D69B 4PRDB 1CGSH 3CVHB 3UTSA 1FH5H 4X98B 4P5MB 2P43B 1J18A 4YXKH 4Z76B 3REVA 4A6YH 3G6AB 1NC2A 4PV9B 5L88L 1Z9LA 4LRIC 4Z95H 4RNRB 1UYWH 1MCWM 1BJMA 2MTPA 3T0EB 3T77A 4ZNEA 3O11A 4LLVA 1F8TL 5FO7B 2ZKHL 4GG6E 3FRPA 2Z31D 3MRRA 4XNMB 3PWJB 3G04B 4DTGH 1KTDA 1NGPL 2WK2A 4KY1L 1VB9A 3QSKB 2VLJB 2NR6C 4NBXB 4RQQB 3RGVB 3GHBH 4YBQD 3NPSB 1OAUL 5B3NA 1XT5A 5AD0A 2X7LA 4Y4HA 3LKSA 1YNKL 5I8KL 3WLBB 2HRPH 1NLBH 2WBWB 4X6BB 5EZLB 3TZVB 2JK5B 2D03L 5DMKA 3SDCD 2BVQB 4XNZB 1RZKH 5EIVA 1G9EA 3ZE0F 4PGZA 2P5WB 3ULVE 5ISZB 4NP4L 3QIUB 3WFEH 1FORL 5DZNA 2FEEI 3BAEH 5EA0H 3FT4B 3CU7A 5ALCH 3FB5A 4JFFB 3RDTA 3RP1A 4PRHD 2QSQA 1BBDL 1A6VL 4HS3B 1P6FA 2DOCA 4UUJB 2AJSH 3M17A 4PTUA 1N0LA 4QYOB 4XRCB 3T0XA 3L3OA 4ZODA 3AS3A 3B2UD 4XZUB 1ZHBB 1S5IH 4JG0L 4WW2A 3MCKB 2FBJH 1G7QB 3MYZA 5BRZE 1PKQE 1A8JH 1IKNC 1S7SB 4CN1A 1S7RA 2YD7A 4QRRE 5I66A 3NFNB 3PXJA 1KB5A 4OD3H 1QNZL 4LNRA 1ZAGA 4EKXA 3BGMB 3NIDF 1I7UA 2C1PA 1B0RB 1KIQA 2BC4B 4LVHC 4KKBC 3PJSA 4HUKB 5EFIA 4NQCB 3O4LA 4P23B 4XTRD 1KN4L 3CFEA 1FYTA 1FZKA 3GRWH 2LAAA 1V7MH 1QRNB 4BZ1H 3C5ZD 2EIDA 1EHXA 3BISA 3V4UL 4HW6A 4J4PA 4CBPA 5SX5K 1KLUA 2HT3C 4LVOC 5JIKA 3SE9H 3BKYL 1JMXA 3DWTA 3FQRA 1J0KA 1LO3H 2QKIA 1AQDB 1BQSA 1T5XB 4TUJB 4X7TA 3BPNB 5HPMA 3BIAX 4PFEA 3HR6A 1A0QH 2AJUL 5AAMA 1Z9OA 3KPRE 4KPHL 4OLYH 5INCB 3FCTA 1KB5L 3MRNB 1YMHB 4OCWL 1G7LB 3JV6A 3T2NL 4P4KD 2GK0B 2UV3A 3WS6C 4ODTL 4P4RA 4H0HB 3I3DA 4LEXH 3RWJA 4Q2ZA 1MQ8A 2IG2L 2HJLB 1ZSDA 4NYLA 3V4VH 3BO8A 3U0WH 2ZSWB 4K23L 3BRGC 4PGBA 3V5KB 2DQHH 1MHEB 3LKQA 2E6JA 1GGIH 4YO0A 1HHJA 4S1QH 5K59F 4D0DB 3O6KL 1Z0MA 1HOCA 2CD0A 3ARGB 4FMFA 1B90A 1T7XA 2VDLH 3RPKA 4CJ0A 2R2EA 1H8SA 4Z8FH 5E2WL 5T5FH 4ERSL 1J12A 4HFWA 2G9HB 4O5LH 4OGZA 2BJML 3CX2A 3O6ML 4LQ1A 3PIQA 3BDBA 2YD9A 3GJFB 5DVOA 3BGAA 4FXGB 5ELIA 3RTQD 3NCEB 1TZGL 1E4WL 2WWKO 5MENA 4QRQA 5DT1L 5DFTA 1EX0A 5DMIL 2YN5A 5AAWA 1XGUB 4LSSL 1WBXA 3VXUA 4CRPA 4OQTH 5T3ZH 4C56D 5GSRA 1FL5A 4QRPB 4P9HH 2QQKH 2DYPA 4L4VB 4TTDC 5C0RH 5D7IA 4G9DB 2DQIH 3RHWF 1JF6A 4J6RH 1HSBA 5TE7H 3DUUA 4K7FA 1FVEB 2G75B 3KPQA 3GNML 4NN5C 3QPXH 3ARBA 3GSNL 1MCPH 3DRTB 1LD9B 4X6DB 3IKCA 2IFFL 2AABL 4F8TA 1NBZA 5EC2B 4WW1B 5JHLH 5E0QA 3HMXH 1T2JA 3RIFK 1I4FA 2Y06L 1S9KC 3JXAA 5I1DB 4IRSA 2NQCA 5HYEA 5FV1L 1CLOH 4PJ5A 5E00A 1F58L 1I8KB 3GMRA 5AYUH 3DXAE 1FHGA 3HE6C 4Z7VF 3W0WB 1CK0H 4K9EL 4L1DA 1NFDE 3OZ9L 4KVNL 3HI1B 1IM3B 5K9KA 4UU9B 3VFUB 2XZQH 2ICWB 2E9IA 4IRJA 5ID1B 2CXGA 3MLUH 2YRPA 3SDAA 5J9PB 3WO3B 1MIML 4PJBE 4JPWH 5ESAB 3Q0HA 1J0IA 4Y0GA 2YC1A 5GS0H 1SM3L 1RJZB 1KEMH 3MLTB 4PJAA 4U3XA 3VFGH 4L4TD 5H8DA 2AJ3A 4M00A 4XPFH 2HH0H 1I85A 1DN0B 1BFSA 1CDUA 4P5MA 3CSYB 3MRFB 3TO4A 3VFOB 3VG9C 4YJZL 1AH1A 4DN3H 3SDXF 3BEWA 1V05A 5F7YC 3FB6B 4POUB 2A9NL 4PJ8A 5E5MB 1MRFL 1RZGB 3BKJL 4GH7B 2XWJB 3I6GB 4A2MA 1QBAA 3PWJA 5E9DB 1UZ8A 3OX8B 5GGRY 4M6OH 4APQC 3LRSA 3T4YA 1XF2A 4D3CH 1T03L 2YBRA 5GZNC 3BN9D 2ARJQ 5IB3A 3VRIB 4ORGA 2VSDA 3SPVB 5IB2A 3O9WA 4AQOA 4AMKH 1KELH 5DJ6A 3NH7H 5I71C 2RB8A 1SY6H 2YPLA 2JK5A 1PX3A 3DX6A 4GS7C 4GG6B 3S36L 4BH7B 4LDEB 5D1ZC 3GMQA 4JO3L 4S1SH 3QHFL 5HHOD 2V5RA 5ACZB 4QOKA 3SJVE 3QIUA 3TLRA 3RZCA 9CGTA 4LBEA 5EO0A 3RY5A 3MLSL 1NBYB 3HRZA 2CDEB 4HD9A 1U92B 3WJJC 1B88A 1RVFH 3GMOA 4CN4A 5C0JA 4N0YL 25C8H 1MCJA 1RUML 4X7SH 3O81A 3TBSA 3TF7C 3VXRB 1AGEB 1Z3GH 5ICYB 2VDPL 4KK8D 4QEGA 2EDWA 3IB4A 1A5FL 3KPSA 1BAFL 3CMOH 3KXFD 3MCKA 3LPFA 3HUJA 3MBEA 5F9WC 4LSUH 3RIAK 3S8WA 4FQQB 5CZKA 1HEZB 5L6YH 3ZKNC 4JHAH 5C07A 1F5WA 4GRMB 4GKNB 3TYGL 1U8KA 4PTTB 1F3RB 4YGVB 5HI3C 1HSAB 3QUZD 2H8PB 1IGMH 2V2XB 5EUKA 4NKMB 3EYSL 2Y23A 2P4AB 3IJSB 3TN0D 3X12A 1NDMA 3JTSA 1OSZA 5D93B 5BRZB 5D7JC 1QRNA 4RFEB 1EHLL 3IXTB 1UZ6F 4QRRB 5D70H 3GSUA 5GGQH 2A6DB 4NFBA 4B7IA 1B4JL 1UJ3B 4GSDH 4YE4L 2FH8A 4UIMA 1AKJB 1SJXA 2A9ML 1IC4L 2IPTL 1IAKA 1MHPL 3VFSB 4FQXB 4NQDE 1AQDA 3QUXA 1E4XL 2SEBA 3HNVH 4BFGA 3OKEA 2AI0L 1FZJB 5INCA 4AENA 1T0PB 4U3HA 4DGYL 4WCYL 1GGYA 2NZ9D 4J2XA 2NY3D 1M7IB 5I1AA 3DROB 1VSCA 1X7QB 3FMGH 3IAGC 1HKLL 4OD1L 4OFDA 4Z7UB 5EZIL 1FO0H 3MRKB 5SX5H 1KCRL 3QWRA 4LPYA 5D7KE 1QFUL 2W91A 3AY4A 4DZBB 1OD7A 2ZUXA 3CDFA 2XRAL 5CSGA 3V5KA 1A6WL 1KACB 3D9AH 4KRPD 3AFLA 4BH8B 2OJZL 1J1OH 1W72L 1MRCH 1ZT7B 4BQ6A 1WICA 1CGSL 5BMFL 1FH5L 3O3BA 3VWKA 2V2TA 2UYLB 4BSVB 2XACC 1IILE 5L2KA 3CLEL 1X5XA 3P4OA 3DECA 3ME0A 2BSTA 4L9LC 4Z95L 4XP4L 1UYWL 3K3QA 2L7JA 3VXOA 1MCQA 3U7YH 2H2PC 1Q0XH 5DGQA 4DTGL 3QFDB 4U1SA 4RAVB 1OWWA 3TWCH 4RMWA 2O5YL 3GHBL 1CCZA 1XF3B 3NAAH 1CIUA 2IPUG 3RWDB 3WS3B 4X7DC 1MHCB 5LQBH 3QNXA 1C08B 2HRPL 4JE4B 1NLBL 4X6CB 3RWFB 1ZTXH 2R0KH 3DRTA 3RKPA 1Q9WA 5EBMB 3LN9A 4EVNA 1RZKL 1ZA6A 4DK6A 3NTCH 2H26A 3MREA 3K2MC 3VFMA 5DMJB 5D1QC 5B38A 4JRWA 3QDMB 1TVHA 2IAMD 5H2BB 4MVBD 2VXVH 5IHZB 3U1SH 3UTPE 2J3SA 3BAEL 2BNRB 1ORQB 3ARXA 5EA0L 2H32H 3BPCA 1P5VA 4MQ7A 1JPTH 4WRLA 5KZCD 1NAKH 2DWEA 1M71A 2R0WH 3U2SB 1U8IA 2PO6D 2YA2A 1R3HB 3FHAA 3GB7A 5AYQA 2AJSL 4GG6F 1KXQE 3EZ8A 4GUPA 3HI1A 3BQUC 1S5IL 4IS6A 2FBJL 1CZ8H 2VN4A 4CVZA 5C09A 2IPKB 3B6SB 4U1MB 4LVOB 3LPGA 1K2DB 4CADB 4WGWB 1R5IA 1FRGH 2A38A 2XQYG 3U6RB 1ZT1B 4GBXD 1N3NB 5SWQB 4OD3L 1OQOA 5MHSE 3MRQB 5IMMA 1N4XH 5C0GB 1RIVH 2MWCA 5D6CB 4I4WB 1S7TA 1KPRB 2XPGB 3HZMA 3GSVB 4YHKH 4F7EB 3CSYA 5FHAH 3R8QA 3JUYA 3MRFA 3T1FB 1V8HA 5DHVH 3KYNB 1NFDB 4MLIA 1HH6A 5CMAB 1WFUA 3TFKD 8CGTA 3GRWL 2MCG1 5E5MA 4ZFOB 2FH6A 4M7JH 3MACL 4BZ1L 5C0DB 4PJBB 4K9EC 3I6GA 2V7NA 3T3ME 2EYTB 4I18A 2VLJD 5GS1C 3OX8A 5E1AB 3UJJL 4RGNC 1S3KH 4XCNB 1LK2A 4ZQKA 1LO0H 2ZPKL 3GBMH 4PLJC 5CD3A 1AIFA 5FECA 1LO3L 1U8LB 5E4EC 5CJXC 3VRIA 1A0QL 1UH3A 5DO2D 3TZVD 5HYFA 1RUAL 3Q1SH 5DC9B 3TIDA 4BSJA 4WHYH 5IKCB 3LEYH 4HMDA 1VERA 4BH7A 2P5WD 1BLNB 2XG4A 5ISZD 5CSZB 2X9WA 4ZTPL 4HF5H 3QULA 3VI4E 2B0SL 4K55A 3BVNB 4LEXL 3S4SB 1QD0A 3D3VA 3BUTA 4NRXB 4YHMH 1JHTB 4JFFD 3GMLB 2GAZA 3V4VL 3JV4A 4OGYH 4DVBA 2QTEA 3BZEB 3JZ7A 4NRZA 2DQHL 1W0YT 5C3LD 1VDGA 4H26A 1GGIL 1OAZH 1WIOA 2DQFA 4C58B 2NW3B 4S1QL 2PTTA 1MSPA 4PJHA 1CD8A 5EWIL 2B2XH 1BJ1J 4QCIA 3IFPB 4NN5B 1XGPA 1AP2A 4Z8FL 2JCCE 5T5FL 2Z35B 5E4IA 3HMXA 4ZXBC 3L3KB 4O5LL 4ORZC 1JWSB 3DLQR 2BVOA 3B4NA 5C0CE 4JZOB 4XB7A 1MHHB 2WWMD 4I9WE 4GRMA 2P5ED 3WNOA 3VFVA 3X17A 5GGTH 1X3DA 1XIWB 5B4MD 2E7LC 4NQCD 2JIXB 3OKKA 5DD0L 4P23D 1HSAA 3D0VB 4OF8A 1QUNA 4FA8A 3HE6B 4NKMA 3KLHC 4U1KA 5T3ZL 3SDDA 3WHXB 2BFVL 2QQKL 3MV9A 4PJ8C 3PWLB 5JW3H 4Y1AA 5CEXB 1F4HA 3I6KA 3W81A 5C0RL 5I16B 5KAQF 4J6RL 4KXZI 1RJLB 3NCYS 2IFGA 1UJ3A 4PJXB 5HD8D 5MENE 3MJ9A 3LQZB 3QPXL 5K9OB 1MCPL 1W8NA 2UZYB 4DZ8B 4MDIB 1VESA 1MCWW 4CUCA 1AD0A 3FZUD 4RGNE 5JHLL 1J0YA 3VWJA 4JDVB 2EC9T 5DJZB 3O9WC 3RL1A 3HMXL 1FZJA 1A6ZA 2AVGA 3LN5A 3VG9B 3BT2L 2B1HH 4NHCL 3JV5A 4PPTA 5AYUL 2AS5M 4Z7NE 1IM9D 1QQDB 3AAZA 4Z7UA 4L9DA 2XKUA 1U36A 4GW4B 1CK0L 5F7MC 3FAWA 3BDYL 1JGEB 2HA1A 5A3IC 4MZ2A 1OTTD 1CDIA 2XZQL 4KFZC 1WAAA 1AR1C 4NQDB 4HULB 4QGTA 2QSTA 3HFMH 4JPWL 2I27N 1JK8B 1SY6A 4PJ5E 5GS0L 1RK1A 3MLYH 1KEML 3ARGD 4OZIA 3WSQH 3QQ4A 1KG0A 1HK6A 4XPFL 5I71B 2HH0L 5H37G 3MBEC 2NXYB 3BGFC 4BSVA 2COQA 4QHMB 4U6YA 2CRZA 1UXWA 4P57B 3S5LB 4DN3L 5JDJA 5DI8B 4AG4H 5I19H 4YPGA 1NAMA 3RJQB 4EBQH 1L0QA 2BCKB 3EO0B 4NO3B 1A7QH 2JJSA 3PF2A 2O93L 2IAND 2EYSA 1RJCA 4PJAE 4WEBH 1HDMB 2NY1C 3QT2A 1KTLA 4ODXB 4D3CL 5E5UB 5HHPA 4NQVB 3ARFA 1NFDF 4QHNB 2L4OA 5F1KC 3SE4C 5HVWA 2XFXB 4AMKL 1KELL 3NH7L 4X6CA 1SY6L 3QBTB 3RY6A 4F58H 4PJBF 1PDKA 5LVEA 1XR9A 2CDFA 2GT9B 3OGCB 1CT8B 5I9QC 3QUXC 1G7IB 1DEEA 3ZTNH 5DJAB 1MJJB 3QDMA 3NGBC 2DIAA 2UY7A 3T0VA 4I13B 3WD5H 1GH7A 1JMZA 2GEEA 4LDOB 2BNRA 2C3WA 2YEZB 3DIFB 2AXJA 3E6FB 3GM0A 3W0WD 3PWPA 3OKOA 2HTKC 4X7SL 5HXMA 1GPOH 2BZDA 3SKOB 1Z3GL 4LSQH 5DQDH 5D7JB 4I1NB 3F6IA 5GRVL 4WEUD 3CMOL 4QOKE 2LV4A 5DDHA 4N90D 5HY9B 4U1MA 4LSUL 1WGOA 1VFMA 3W9DB 1K2DA 2XQBH 3CDGB 4N5UA 1ZT1A 3AUVA 5E5RB 2KZ1B 4JHAL 3MRQA 3OKNA 3ABZA 1RZKC 1L0YA 3IVKA 2EDXA 1FNSL 2DTSA 2XPGA 4FFWD 5I1KH 3KPSE 3GSVA 3TA3D 5IFAH 3T1FA 3SY0A 4FN0A 3MRLB 1I8IB 5ILTH 2C7UB 2FYYA 4FABH 3HUJE 3L5XH 2A83B 3SO5A 2R23B 4PR5A 3H3PH 4N8VB 4JKLA 1P7QA 5E9DD 4UNVA 1BJ1H 5D70L 1HHGA 4GSDL 5KJRH 5KAQG 2DIJA 4ZOEA 3D0LB 2K7QA 3VD9A 4NQXB 1CGWA 3BD3A 2EDRA 3NZ8A 3R4DA 3OXRA 1QA9B 4GW1B 2ZUVA 2XV6B 4WI8A 1XF4A 3HNVL 5FOJA 3DV4B 2VR9A 1TITA 2KPNA 4Y2DC 3L5WB 4KMTH 2UWEE 4LGPB 4F7MA 1EIBA 4RMVA 3U46A 2PKDA 2PXYD 1K5NB 3MZGB 3V0WH 5ADOH 1BLNA 1QR1A 3FMGL 2NY6B 4L9LB 4PJEA 5EO1B 3B5GA 1RQ5A 3WDIA 1GGTA 1FO0L 2EC8A 2E7BA 4UBDC 2ERJB 1DQTA 1UWXH 1CICA 2EH7H 2GJ6B 1JHTA 4OCSH 1JPSH 4BFBD 5HI4D 2EIBA 4FFVC 3VXRD 4P2CG 3UPRB 4XVUD 2DM7A 5GRYA 4EIGB 4CGTA 2P8LA 5IB4A 4ZUWB 5EULV 3P4NA 1J1OL 3U4EA 5IBLC 4I3SL 4CMMB 1MRCL 3MLWH 5LWYH 3ULVD 4G8EA 1UT9A 1N2RB 3DJ9A 4LSVH 3W9EB 5C1MB 4CU8A 1U8QA 3U9UB 1A4JB 4HFUL 1MJ7H 4GRLA 4YHNA 1I1CA 4HT1H 5IHLB 4N0CC 3MCLH 2WQ8A 5CILH 5D1QB 3PDOB 2YWYA 3STLB 3V6ZB 2I9TB 3QDGA 3U7YL 1Q0XL 4YDVB 4Q58C 3C87A 3OAYK 4AEIH 4AK1A 4K7PX 5IMOB 2XNAB 3LSOB 4LFHG 3TWCL 1ZWIA 4JY5H 1IEHA 5BRZD 1FNEB 1H0DA 4U7KA 2R2CA 3NAAL 5L2KE 4LHQB 1WBYA 2W0FA 4QRRD 2JCCB 3BQUB 3EYQD 4GLRH 3NOIA 3CUPA 5I6XB 4O2CA 2CKBH 2FO4A 5LQBL 2C3GA 1AKJD 2VERN 4PREA 4B41A 3QI9B 2ADFH 1ZTXL 3QUYD 1FLTX 5K9OA 5CZXD 2DLFH 4FQXD 5CIPB 3HRPA 2I5YH 4JKKA 3NTCL 3KPMB 3BI9X 3GSNB 3QUKA 1IGYB 2R0LH 3C5JA 3L9RA 4E41A 4L5FH 5D4QA 4JDVA 4LLDA 1KT2A 4MX7A 2VXVL 1UWEH 3OQ3B 4X4XB 3U1SL 3CSBA 1D5BB 1SYVA 1JPTL 4EI6A 1NAKL 5B39G 1CL7H 5I1EH 3U0PB 4MGXA 1HQ4A 1F4AA 3QEQE 1IEAA 1S7XA 3WIHH 2AQ1A 2HLAA 2WUCL 4LKXB 5LKNA 1PZUB 1QOKA 4F7PB 1UB5B 3MRIA 4P9HC 2ARJB 1G6RA 5GS1B 1CZ8L 2NR6D 4U1LA 3MZTA 4RGNB 3ZDXE 3KPRD 3TT1H 1U8JB 1FRGL 4PRIA 1JK8A 3O2WH 4IOIA 4D8PB 3SOBH 3LY6A 5E4EB 1N4XL 4O2EB 2ZCHH 4X4MA 1RIVL 1Q9KB 3NCMA 3K8MA 1LEKB 5FDWA 4YHKL 2N1KA 3WL9B 3K81A 2YXMA 4Z77B 4OD2A 5IEHA 5E6YA 1V3MA 5C09E 4HH8A 4MJ6A 3KYKH 1MELA 4M7JL 1ZS8B 3P9MA 2BCKA 5FV2A 2EDDA 4P5KB 5JIHA 5MI0C 4F57H 3HTLX 2NY5L 1W2KT 1FNAA 1NC4D 4LRNH 4MNQE 4R96A 4Q97A 4NRYA 1ZGLM 3BH9A 2J5LC 1S3KL 1CD1B 3ORJA 4J8RB 1LO0L 2B8OT 3GBML 3K8KA 1EDQA 1VCAA 2Y7QA 3HKFA 2VIRA 4HLZH 3ZHLA 4C59B 5GS0C 3IJYB 3Q1SL 1BZ9B 3FL7A 3DGGA 1CLZH 1DBAH 4PJ9A 5TDOB 1E27B 3LEYL 5GGTA 4ZXBB 3DX9B 5BZWB 4ISVA 3H7BB 5ITBH 2FJFB 2VJXA 4N1HB 4IJ3B 3EIFA 4EN3B 1MJJA 4KK6C 1OGAB 3MLRH 4KKBD 5MEQB 2ED8A 3FT3A 3MV7A 4YHML 5IB1A 5J11C 2EIZA 2KDGA 3GK8H 4OGYL 4WW2F 3B9KA 3F7VA 4J1UB 3SCMC 2J88H 2VUOA 3GI8H 1C16B 3O6LH 1OAZL 2DKMA 5JO5A 4G6JH 5JIIA 2CR3A 4LHUG 4OZGA 3T3MF 3MFFB 5FOBA 3WFBH 2HT3D 3L7FB 2GY7B 3PP4H 4Q9BA 3S35H 3TBYB 3CFJB 4TUKL 2VE6B 5T3ZE 3QRFM 2YK1H 2VISB 5C9KA 3ROOA 4Y8DC 4JPKH 3DXAD 3PWUB 3WIFB 5GS2H 3PL6B 4QO1A 5AWNH 3U4BH 2DS4A 5JQHC 5GGTL 3E0GA 5DA4A 12E8H 4ZO6A 3ULUH 2VR4A 2V7HB 2GK2A 5JNYB 4MJIB 4PG9B 2HMIC 4R3SA 4X9IA 4GFTB 1CFTB 3VI4F 1CBVL 5DFWH 4G7VH 4DUXA 4PJIA 3IU4H 3GUTB 1LEIB 3D2UA 3GMMB 3MYJA 2AEIT 2OP4H 4XPBH 3MJ8B 4IIQA 3S96B 4K94H 3C6LA 3TBTB 1KLGA 4OM1L 2OTWB 4PJDA 3ARYA 4QHKJ 3K2UH 3P4MA 3PQYE 4TNVF 2F5AH 3Q5OA 4JY6A 1QA9A 4Y5YC 3TH3T 3BIBX 4GW1A 4Z5RB 4H1LB 3CFIC 4O2FA 4RA0C 4Y1AE 3BGFB 3KDMA 4PRNA 4YK4B 3D48R 4M8VA 2PCPB 2D7NA 4B0MM 4OB5H 1K5NA 2B1HL 3X3GH 2JE8A 5EO1A 1WCBB 2EDNA 2F53A 1MWAA 4JFOB 1CD9B 1IC5H 3MUGA 3WUWB 2OI9C 4GAYB 1Q9OA 2GJ6A 1CGXA 3I02A 3EFDH 4YHPB 4F3FB 2NY1B 3Q3GB 1JGLL 3VGHA 4GW5A 3PXHA 2AK4B 3HFML 4YXLH 2Z93B 4TTDD 3ARPA 3GIZL 2P49B 4NHUA 1J8KA 1LK3L 2UWEB 3WXVH 4JY4B 3L3HA 3MLYL 1A1NA 4CMMA 4GAGH 3OJDB 3WSQL 3C2SA 3Q6GH 1W72B 5EBWA 1HWHB 4YDJB 4PD4K 1EO5A 1KTRL 1F3DH 5I9QB 4AG4L 5I19L 4FTVE 4A6YB 4NO2B 4BQ9A 4EBQL 1LGVA 1WZMA 3NGBB 1T1WA 7FABH 1QPXA 3HC4H 1A7QL 2JIXD 1EXUA 5FGBC 2OM5A 1PSKH 1QLRA 4WEBL 4ZUUB 3BW9A 3HE6D 2LABA 4Z7NF 2XNAA 5HYQA 4HIHB 1MWAL 1BWMA 1XCQA 4OM0H 3RHWK 1KFAL 1MJUH 3GBLA 3PHQA 5FKPB 5FYJH 5ANMA 1C1EH 2XKSA 4KGLA 3T0DA 2GJZB 1H3WM 2KUTA 5CS7A 2ZCLH 3MV8E 4HPYH 1BJ8A 1YQVL 4DJMA 4ONHB 5DD1H 1F97A 2F5BH 2MQ0A 1NCTA 1F4YH 4F58L 2RQ8A 3QI9A 4U1GC 4N8VG 3KPLA 1A47A 3S6CA 5T1KB 2IMMA 5FA4A 3GFUA 3ZTNL 2X1OA 3T0BA 3DVFA 1X5LA 2X4RB 5DRXB 3OAYH 3MJGX 3WD5L 3FAXA 4X4XA 4LHUD 1D5BA 2R2BB 4XC1H 2NZIA 5C08A 3GO1H 4LCIH 3UDWA 5GS3A 1TJHH 1MAJA 1GPOL 3A6OA 5JDSB 4JM2A 1PKOA 1AXSB 3I2CH 2ITDB 2YD8A 4JGUA 4LSQL 5DQDL 2P8MB 1VKXA 5I8EA 2X4QA 4XX1E 4CVXB 5MEOA 4HS6B 4NQDD 4PJAF 4RMSA 4APQD 3DVGB 2X4OB 4RISH 1BECA 3EGSA 2CK2A 3IF1A 2P7TB 1NGXB 5GZND 4ZFZB 2XQBL 4DGIH 2DLGA 5CKGA 3VXSA 4ELMA 5IEKA 2VDRH 4D8PA 4X9GA 1RUQH 1RIUH 2OR9L 3CCHA 4PD4J 1CDYA 4Y2DB 3QEQB 2G5BA 4KXZH 1OAQH 1WSST 4YFDB 3RL2B 5D1ZD 2IQAA 2YMXH 4Z77A 1A6TB 5ILTL 5D7KD 1YEDA 2CDGB 1EVTC 2RFXB 2VL5A 3L5XL 4RMTA 4X80H 1Y18A 3H3PL 5EU5B 2APFA 2IPUK 5L8JB 2V5SA 5F88A 5F1IB 3IDXH 1FVDA 2CLVB 5A2LH 1JWMB 5F7DA 4NBYB 1SMOA 3BZ4B 4HUUB 2F74B 1L0XA 2P24B 1T04A 4YR6A 1NCUA 4XBEH 5C2UB 5DS8A 4NQSA 1KJVB 2FECI 3DX8B 1GZQB 1BX2A 5E03A 4KMTL 1DUZB 4HUWB 2GUOB 5F3HB 1MI5A 3V0WL 4JFEE 3ZKND 5ADOL 1E4KA 1QSFE 4JGJA 1RJYB 3LVEA 1KCKA 4YC2C 4MNQB 4NT6B 1OGAA 2BVTA 5T33H 1JGVH 1F11B 5HI3D 2LFGA 3MROA 1HHHA 3QEGH 5DJXA 2EH7L 2HJFA 1SBBA 1JPSL 5HGHB 3BZDA 3HUJF 3DTXA 4OZ4A 1CU4H 3MR9A 4RMQA 5D7JD 5A2KH 4YLQT 3PP3K 3VFRA 1KIPA 3PABB 4HUVA 3MLWL 3BP4A 5LWYL 1T83C 3REWB 2XI9A 3ULSA 4KHXL 3R06A 4LSVL 3WNPA 1ZHNA 1R5VB 3UTPD 5D5MA 4ZUVB 4JHZA 4P3DA 4HT1L 3MCLL 5CILL 1F3JB 3VMNA 4P5TB 2PW1A 1X5FA 2QR0B 2Q87A 2UWEF 3F7RA 3DVNA 2BERA 1F6AA 4MJIA 4PG9A 5D2LE 1YYML 4HG4K 4JY5L 3IDJB 2Z8SA 1Z9SA 3PG2A 4MAYA 4ONFH 3QIBB 5DQJA 4OF6A 3D18B 4P2OC 4HKJB 3RDTD 5MHSD 1XR8A 3QP3A 2CKBL 5IMLA 4XMKL 4L8BA 4ZOAA 3VGGA 4WUKH 2Y5TB 4RIRA 2OTWA 2ADFL 4F9PA 2DLFL 4J12A 5HYJB 1FJ1A 4LP4A 2I5YL 2EH8H 4M4RA 2CO7B 5CGYC 3VFWA 2A73B 4F7CA 1IE5A 3DUSB 3FO1A 1BIIA 1UWEL 2WMPA 2V2WB 1UC6A 5K93A 1BOGB 1I1YB 4YFLI 3ECBB 3B9EA 1HI6B 5I1EL 2J8UA 3C08L 1I9EA 1QEWB 3AMLA 2BY1A 1Q72H 3BN3B 1LHZA 2QJDA 4YEEA 3WIHL 3LMJH 3DMMC 4KDWA 4UIKH 4MJ2A 3WUWA 4GAYA 4L3EE 2JB6B 3PQYB 2YD3A 4PP1C 3O3AB 4Z9KB 3D85A 3MMEB 3VXNA 2VXQH 3E8UH 3RWEA 2J5LB 1MRDH 5ESVA 3TT1L 4H25A 2Z93A 3TO2A 1DQQA 1KB9K 2Q8AL 3RKDC 2H9GB 3O2WL 3SOBL 3CPLB 5F6HJ 2Y36H 2ZCHL 4OI9A 1HZHH 4QHLB 2XXCB 1HNGA 3GGWB 4Y16A 3RU8L 4HUXA 4NUJB 5IF0B 2ESVB 4HJ0C 2RCSH 2VR5A 5D1QD 5KSAB 4U7MA 5CHNB 2C1OB 2F54B 4KDTA 3HR5B 4NO2A 3KYKL 4P46C 2E9BA 4F57L 2DLEA 4HG4J 3PUCA 3QR2A 4YDKH 3LEXB 4KMQA 4X4ME 4N8PA 4D0BB 4LRNL 5EIIA 4HIHA 1UCTA 1VGKA 1LNUA 5FKPA 3BQUD 4K7PL 2JJTA 1CE6B 5C0CD 4I9WD 3C6LC 5C7XH 4FTVB 5JW5B 3M8OL 3VD7A 3JTTB 1DUYA 1CFNA 1CLZL 2VN7A 4OBRA 4KTEL 4WFGE 2ADGA 3VE0B 3QQ3B 2W9DL 5CWSA 4BJLA 5ITBL 1U95A 3QH3A 3V6OC 4L8DA 3MRMA 4CJ1A 2AEPL 4XCFH 3FONB 2KL6A 1I3RB 3ARRA 4OZHB 1HXYB 1C8PA 5EOCL 4YHOH 2R2BA 3GBNL 4F7TB 3IRZA 3BH8A 1CG9A 2E7CA 3GK8L 3O3EA 2IALB 2OQJA 5ALBH 2J88L 3MV8B 3UTZB 4H1LG 1X5ZA 3UTOA 2FJGB 3GI8L 3A6CH 3ROLB 5MEND 1ADQA 1WZLA 2ED7A 2I60H 2X4NB 1IL1B 3HG1B 5HDLA 3QFJA 3QEHB 3RQ3A 5BVPH 1YMMA 3WFBL 4LMQE 4RGND 3U83A 1EH9A 1KB9J 1PY9A 2DI8A 4PLJD 3S35L 1NGXA 4P2RB 4RRPG 3K4DA 4JRXA 4QXTB 3B3IB 3CLFH 5FYLH 4Y5YB 1NGQL 1CGUA 2ICWJ 4R7DA 2VLKE 3ES6B 2VRAA 3PDGA 1WC7B 3C6SB 4PJ7E 5IOPA 5ADPH 5AWNL 1OM3H 5DJ8A 4YDLC 12E8L 1U9KA 4UAOC 4OCNC 4U33A 4GXUN 3V8OA 3LN4B 2W9EL 4JRYE 2CDGA 2RFXA 3SKUD 3UBXI 1RSFA 2CSPA 1B0WA 3OF6A 4G7VL 2O61A 3IU4L 1P6AB 3CH1A 4MZ3A 3K80A 2OI9B 4K2UL 5DWUH 4PJ5D 2OP4L 4XPBL 5IVXA 4AT6B 3DYMA 1HQRB 4K94L 1BZ7A 4N0FA 4QXGH 2HFTA 3G6DL 2NNAA 2VDNH 1A6AB 2F5AL 1KEGH 3RWHB 4EUPH 2DQGH 4HGMA 1GIGH 2VC2H 4ODSH 1HHIB 1GZQA 1N8ZA 4NO5B 4MCYA 4ZXBD 3P77B 3LB6C 3VXQB 1P4LB 1UCBL 4BQBA 3I75B 1BM3L 4NKOB 1B9ZA 4OB5L 2V5TA 4L29B 4PLKC 3X3GL 2X70B 4WU7B 2CUMA 1FFOA 2A6KB 4JANB 2A0LD 5ETUA 4PJDE 5IW3A 4MMXC 1UM6H 3WFZA 4N9GA 4EOWH 5F7WC 4BK4A 1IC5L 3IDUA 3RUGA 2K1MA 1FO0B 1ITCA 4P3WA 2XA3A 5I75B 1HXMB 3V6OE 3KPNB 3EFDL 4E0RB 4OFIA 3KLHD 4FQCL 3WDHA 4NZDA 1FAIL 2APWA 4UILH 1FG2B 4Y5XA 5H35B 4PJ8D 4JKWA 4YXLL 3DHJA 4JM2C 4FQIH 2WBJC 3I84A 4ZS7H 1SJEB 1TZHB 3AS2A 3KHQA 2FL5A 3L1OH 3U0TB 4JFEB 4U1JB 1QSFB 3Q6GL 2OJEA 1JNLH 1NUNB 4XPAH 3VH8A 5JA8B 3T65A 1SVCP 3VGAC 5F89B 3HE7A 4ZG1A 3O9WD 5EB9A 5KSBA 2FO1A 7FABL 3HC4L 3MCG1 4S2SB 4BZ2H 4LCWA 5DJCB 3NCCB 2C3XA 2C4FT 3RY4A 1PSKL 1OARH 4QOKD 4RFOH 1ZT4B 4DUWA 2N4IA 4OM0L 4HS8H 2P48B 1U8NA 5LAXA 3TYFA 2R8SH 1MJUL 2Q3AA 3ZKXC 5FYJL 5HHNB 5A3ID 1C1EL 1RZFH 1ORSB 5EUOB 3MXWH 5ICXA 5IK3B 2ZCLL 4HPYL 4X7CC 1AR1D 1AGBA 3ARDC 1H15A 5DD1L 4JFPA 4V2BA 4YHLH 2F5BL 1F4YL 2Y5TA 1RHHB 3UMTA 3KPSD 4WHTA 2EDEA 3LV3B 3VXMA 4PRBA 4WJ5B 2XWBB 4I2XE 1CF8H 3MBED 3IDIA 5ANME 1XGYH 4ELKB 5EC1B 1P84K 5CZVH 4U1NA 1NDGA 4XC1L 2FZ3A 1I1YA 3GO1L 3Q6FB 3VXTB 1HI6A 5FYJU 1E4KC 1TJHL 2H32B 2ZSVA 4RZCB 3CJJA 4M6AA 4QHUB 1INEH 5SX4H 4JO2H 3CFKB 5DEFB 1NGZA 4AQ1B 3F8UB 4OKVB 3H3KA 1EFXA 3MPCA 4C4KO 4Y5VB 3WFHA 5KSUA 2FDBP 2NY1D 1E28B 4U6XB 3OKYA 3MMEA 3M1BB 4RISL 4Z7QE 5GGRB 3IT8D 4NQEA 5TDPB 1T1ZA 5FF6A 4ZS6C 4CNIA 1LE9B 4DGIL 4Y4KB 2YR3A 1D6EA 2VDRL 3WE6B 3EDEA 4XBGA 1RUQL 5IQ9A 4MNGE 1BVZA 5FO9A 2P8PB 5J56B 4BFIA 1OAQL 3LKOA 1MCIA 5IF0A 2ESVA 2YMXL 3QUXD 1DSFL 1DTUA 4MD0A 4ESKA 2YSSA 3G5VB 4ZPVA 4X0KA 5DGRA 4G6AC 2YPKB 5DHVB 2VITB 3HR5A 4YIQA 3RWCA 4XI5C 5EU6E 5E8EA 3QIWB 4NSKA 4PJFA 4M6NH 3UCRA 3IDNB 4J3VA 1FNGB 3IDXL 1Y6MR 2HTKD 1NMCB 4GKZB 2ITCB 4LF3A 4KDVA 4MD4B 1F90H 1LWRA 1AO7B 2IBZY 1ZHKA 3FOMA 2Z91B 5CFHA 1S7QB 5JIPA 3U9PL 2NXZC 3UJIH 2FWOB 3ZYIA 1CDBA 4XVTH 5D9SA 4MLSA 2I9LB 4QRSB 2X41A 1A1MB 4LVNB 1A3LH 5C8JA 5JW5A 1JPFB 3MRGA 3QJFA 4FQHA 3QHZL 1LEGB 4I0PA 4HCRH 5T1KD 3WJLC 3V52L 1OT1A 3QQ3A 3KYOA 4GKOA 5IG7B 1DVFC 1V5JA 1CXEA 1ZLSH 1MCSA 3DUHA 3L6FA 1P84J 4ZUTB 4G5ZH 3TEUA 1CLYH 2VKWA 5T33L 5TE6H 1JGVL 3DV6A 5L2KD 1PQZA 3QEGL 1YY8B 1U3ZA 4L3AA 5L2JB 3OR7A 1KJ2H 4ZTOH 1K85A 2DAVA 2EDYA 5JMOC 1CU4L 2PW2B 4GRWH 3DRQA 4M61A 5DJYA 3X3FH 5I1GH 3MRBA 1PZ5A 2IF7A 4P2OB 5KSVA 1KCVH 1M7DB 5IQ7H 1KC5H 4ONOA 4H0GA 5EU4A 1DLHB 4HK3J 5KVDH 3BE1H 4M4PA 4P2RA 3GSQA 2NTFA 3T2OA 1J0JA 3BD5A 2PYFA 4OLVH 5KOMC 5F96H 1AE6L 5D96C 3DARA 4Y2DD 1HILB 3QEQD 5TDNA 4R97B 1TQCB 3R1GL 4XPHH 1SEQH 1ND0B 4LPVA 2ADIA 3KJ4C 5BOZG 2R2HB 4MQXC 3RBGA 2WANA 3MRCB 3BP6A 3BKCH 4UBDD 4XTRC 2MHAA 4RWYH 4TSAH 5D5ME 4ONFL 3DMMB 2YRZA 4Z7WA 1FIGH 4R2GC 3H42H 4FFVD 1A1OA 3ZO0A 3V0VB 3T09A 4AL8H 3FO2A 2VLKB 4HX1A 4PJ7B 1BFTA 1I1AC 1OB1A 5CINH 3HCVA 4IDLA 5IBLD 4LCUB 2EH8L 1FFPB 2JJTC 1U91B 3OB0H 5IBTH 4YZFE 5C09D 3VFNA 1D9KA 5AZEL 2XT1B 1HHIA 2LE9A 4JRYB 4LGSB 5I8OH 1I7RB 5CAYB 3MA7A 4AYFA 4YPJA 3G9AB 5FM4A 4N0CD 5CLWA 4HKBB 5GSVA 2CRMA 2IBBA 2WNGA 3VRJB 4MNQD 3NFPA 4JANA 5JXEC 3ULUC 1Q72L 4P46B 5IROC 4JGMA 3LMJL 3UROR 4UIKL 1I8LA 4GXVH 4OI8A 2VXQL 3E8UL 5D2LF 3UC0H 2WINB 4OZFH 3IDGB 4K94C 1FFNB 5FK9B 2Y9RT 1JN6B 3PGDB 2D7PA 3FQNB 2E7MA 2GSIB 3IFLH 3LIZH 5E8NB 1HZHL 4U1JA 1FG9C 3VMPA 2E6PA 4TSCH 2RCSL 4B5EA 3H7LA 1TENA 4Z0BL 5T1LA 3QQ9C 1OCWH 2AGJH 4XMLH 3MUJA 3CX5K 3W39B 2Z92B 4WV1C 4LCYA 1DFBL 4YDKL 3G5XB 1V3KA 2ICCA 4IMLA 2NLJB 1JNHA 4U0RC 5T3ZD 5HHNA 4HUNB 1UKSA 1BZQK 5EUOA 5E56A 3X14B 2R0ZL 5CP7A 3N9GH 2VDQH 5E70A 1T21A 1UKTA 4XX1G 5C7XL 3B9AA 4HIIA 3RVTC 1KNOB 1RAMA 5IESH 1WEJL 2BXYA 1OSPL 1ZE3C 5FXCH 4WJ5A 3OL2A 1KIRB 1F13A 3P30H 2DB8A 4XCFL 5HJ3B 2WP3T 3V5DB 4UOW0 4TSBH 3L3GB 1EAPB 5HHME 4XWOC 1NCWH 4YDLB 4Z18A 4JDTH 4YHOL 5EN2B 1C7SA 4UAOB 4MA7H 3H9YA 5ITFA 2BSRB 3QXUA 4QLRA 2CIKB 4EI5A 1BGXH 4JLRB 1YN6B 2A74A 2I60L 3PQYD 3KPOA 3AM8C 2NY2C 3PV7A 5BVPL 1N0XH 1E28A 1ZMYA 1MLBA 5BW7C 3ULUE 3QO0B 2DQUH 4NZRL 2VTFA 3T8XB 4I2XB 4ETQB 4Y5XC 4BQ8A 4RGOH 5BS0E 3CLFL 2CRIA 2DQJH 3MO1B 1A9EA 1T22B 2HYMA 2OK0H 2VXTH 4YAQB 4JFHE 5GS0D 1X5KA 3C9NB 4X99B 1J5OL 3QDJA 5ADPL 1OM3L 1UXSB 1A3RH 1MFCH 2R1WB 3DX7A 2P8PA 3BOVA 1WFNA 3W5NA 3WBDA 2RAMA 5GJSH 1DBMH 3QFJE 1U8HA 5CJ8A 1BVLB 3FO9B 2ZP0T 4Z7OE 3CX5J 4KK6D 1JUFB 2AV7B 4H5SB 3JVGC 4JRXE 1J10A 1ZVYA 4JZNA 3QIWA 5HPOA 5DWUL 2YKLH 4DQOH 1GXEA 3U79A 1T1XB 4ODWB 3SCMD 5F9AC 3GSRB 4EXPX 1HKFA 2ITCA 1NSNH 2AKRA 4MD4A 3EFFA 1ED3B 2CQVA 4MNGB 2F15A 2VDNL 4FFZH 3OHXB 2WBJB 4Q9CA 3RWGB 4HWBH 4O51A 1UKQA 2DICA 2JJUA 4XP5H 2DQGL 5EBLB 1GIGL 2VC2L 4FTVD 3MOBH 4ODSL 5E24E 4XXDA 4KQ4H 3KNBB 2I9LA 1UVQA 2FD6H 4OV5A 4X4YB 1UQSB 1MCRA 4XVSH 5EU6B 3VGAB 3PE9A 1OAYH 2JF1A 2BOCB 4HSQA 4PJ7F 1GYAA 4EOWL 4JZJC 4ZUTA 1I9JH 4RMRA 4FQLH 4O58H 5GGUA 3FT2A 4N0UE 1A7PH 5F7EH 2HMID 2X2YA 3MV8D 4X6EB 2AK1H 4UILL 3VXPB 3VFTA 3F5WB 3HC3L 3NIGE 3BXNA 3FFDB 5J4MA 4ZS7L 1FNHA 1AQKH 1F4XH 3L1OL 4XBPB 1KJMB 1WFOA 4JDZB 4HH9B 3ARDB 2AXGB 4ZDHA 1EZVY 1JPGB 2NX5A 5C0AA 4DAGL 1JNLL 4G8GE 3RUGE 5F3BB 4LSTL 2A6JB 3O4OC 5FYJE 1G7JB 2EYRA 3J8F7 2JELL 4O00A 1BFOA 3VGBA 1RULH 3GMNA 4HK0B 4NWUH 1AGCB 1HILA 5CBAA 2C3VB 1EBAA 5IVNA 4PJIF 4D9QE 3BKMH 2YS4A 1OARL 5EPMB 4TOYH 4NCC2 4RFOL 3VCLB 2CJUL 3BUYB 4HS8L 4PJDF 1U58B 5EOTA 3H9SE 4F37F 1RZFL 3UPCA 5GHWH 1ACYH 1RK0A 4PJGA 2H1PH 1IAIH 2VB5A 1VEMA 3MJ7B 4YHLL 4HDIA 5D7LA 4BQCA 3TJHC 2XWTB 2CKBB 4LCWE 1RZ7H 4HWZA 1RU9H 1B2WH 1OGTA 2DL9A 1CF8L 3V4PH 1KCLA 4LPTA 2DM4A 4ZO8A 2A6IB 1MAMH 4JHBA 1XGYL 1QZ1A 5CZVL 3QWOB 5C0BE 2BVPA 4YHYB 2HFEA 5E2UH 3FFCE 1INEL 4JO2L 2H2SC 4UDTA 4XVJH 3VXME 2Z31B 4R7NA 4TQEH 3RPIB 3BHBB 2YWZA 1BQHA 2P1YA 2R1XA 2APTA 4PS4H 1S9XA 2FEDC 4RSVA 3L5HA 4WO4A 2JJWA 2G60L 3FQNA 5E8PA 4JFED 2PYEE 3P11H 4UQ3B 1QSFD 1XZ0A 4K07A 2HKHH 1A3QA 4LLYB 2AEWA 5INDA 5DSCB 3CFBB 4UT7L 3SDCB 3X11B 1T6VN 4BKLA 2ATPB 4QF1A 1MCKA 3IDMB 4N0RA 1KJ2A 4NKDB 3KWWA 3WDJA 2YUXA 5HYSA 1AY1H 3FQTA 4IM8A 1T2QH 1T0NA 1WTLA 2RHEA 3KYMA 3QXDA 5I15H 1MFAH 4WU5B 3ZE1E 5EH1A 4OUUB 1F90L 3QZWB 1Y0LA 1N7ML 1ES0B 5I1CH 2F9BT 3UJIL 4UT9H 4GKSA 4G8IB 3F65A 3SGDH 5JOFA 4XVTL 3IJHB 1EGJA 1A3LL 1GVIA 2PF6A 4PJFE 4P2QE 1YNTA 4HCRL 4WUUE 3EYFA 5I76A 4MSWB 3B5HA 3T4AB 4Y4FA 3MFGB 1ZLSL 1YN7B 4MCZB 4HJGA 4NNYA 4JM2F 5LGJB 1CLYL 4R0LC 2MMXA 1T2XA 1U8MB 3JWDH 2W07A 4Y19E 4OT1L 2ARWA 5IB5A 1KJ2L 3KJ4B 4ZTOL 2IADA 2ZKHH 1NCCH 4G80A 4PJCA 3OKLA 1IC7H 3PGFL 4EDWH 1I9IH 1XCTB 3WLWC 4RFNB 3TIEA 2GSGA 2W0PA 4HGWA 4R2GB 2FIKA 3HAEA 1KCVL 4D0CB 5IQ7L 1TNMA 1KC5L 1RZ8B 4M9PA 4YHIA 2QL1A 5KVDL 3BE1L 1I1AB 5HHMB 3PGCA 3MO1A 5J7CC 4OLVL 3HZYA 4Y2OA 1EGJL 3CXDL 5KOVC 4WWKA 3UTQB 3GSWA 1MCFA 2D03H 1A22B 4XPHL 2BVUA 1IVLA 1SEQL 1U93A 2NY0D 4L3ED 4LLMA 3ILPB 2MOVA 3CVIL 3KPPB 1OL0A 2EDOA 4P4KB 5AUMA 4RWYL 5E95B 1AGFB 5E99H 5DYOB 4DGVH 2E8ZA 1FIGL 1NCDH 1QSVA 5BS0B 3H42L 3QAZC 4MDJA 2R56H 3ARTA 2OCFD 5DUPH 3MGTA 1FC2D 4AL8L 3P0VH 3UZQA 5CINL 5KVEL 4OSUH 1NBVH 3OR6A 1WISA 1BQUA 1IAOA 3FOLA 5I8OL 1KPUB 5EZJA 1SYSA 2Q6WA 1ETZB 1DQJB 5IWLA 1JL8A 1QNZH 2HFFA 2OSLB 2D7QA 4LAQH 4JFDA 3H9HB 3QA3B 1DE4B 1MY5A 2BHZA 1XFPA 4MHHI 4WV1B 2UUDK 1PEWA 1T89A 4GXVL 3SQOH 1NGWB 5DD6A 3UC0L 3SBWC 1DANT 3BMVA 1AHWA 4U0RB 3MRJB 3F5WA 5D5MF 4P2OD 4WFGD 1BOYA 3F12A 2HFGH 1KJMA 3IFLL 5FO8A 3LIZL 1V3LA 4NC0B 5CJ5A 4L3CB 3BKYH 4CDGC 4L8SA 4TSCL 5CGYD 4HHAB 2Q8BH 5IW1B 1OCWL 3L3DB 2CUIA 2AGJL 4YZFF 4IHOB 4XMLL 2W38A 2X4UA 3TP4A 5C0NC 1S9VA 1FYHB 2C3VA 4NM4L 4R26L 2BRRH 1J8HB 3MLVH 2N56A 1S9YB 2WLYA 3EO1B 5EPMA 2BDNH 4OIBA 5JPMB 3QXVA 3G6JB 3IU3A 4NFDA 1U58A 3VA6A 5IV2B 4PP1D 4G8GB 5EORH 3TESA 2WIIB 4KZDH 2VLKD 3OKMB 4K23H 4XCYB 3L3JA 2VLRA 5JPNB 3RKDD 5IESL 3KLSA 5ABDE 3TBWA 2IH3B 2J8UF 3DSFH 3HPLB 4NNPH 1AXTL 4JRYD 1CFQA 4TSBL 1OW0A 3L95B 1UB6A 1T3FB 5GRZA 1M1SA 4HJ0D 5E2WH 2DWDA 4JKMA 1XH3B 4OF7A 3TBVA 3H9SB 1HHKB 3O6MH 4MA7L 2Z0BA 2APVA 4NC2B 5ERWB 4OLEA 4P46D 3C60A 3KAAA 3TVMC 1BGXL 1TZGH 4NOBA 1CLCA 1WWAX 1N59B 3CZFA 3TGXA 1K8IB 4AEHL 1EEZA 2AAVA 2HJKA 2Z31A 1N0XL 3X13A 4HWBA 3RNQB 4IRZH 4NO0D 3PHOB 5J6GA 3V6FA 5C0IA 3OWEA 3D2UD 4PY8J 4U49A 4E42B 4O9HH 2XN9E 1OLZA 2VXTL 4J3UA 2OK0L 4IMKA 5IM7B 5C0BB 2MSPA 5C6WH 3C6LD 1MCOH 1MLCB 1X9QA 2ZUUA 5F8QC 3MV11 1RZIB 5CEYB 3OAUL 1MFCL 3H0TA 1YECL 3FFCB 5D71H 5EBGA 4XPTL 1HH9B 3B2VL 15C8H 4CN6A 1I1RA 2FATH 3CFBA 5GJSL 3SDYL 5I1LB 3X11A 3SDXE 1LP9A 3D1MC 4I3RL 3FQUA 1C5CL 1WVZA 3WXWL 2F58H 3IDMA 4JZJB 2OL3A 3PNWA 4ZFFB 2XTJC 2YKLL 4DQOL 1S7WB 1X5GA 3SEPA 1F58H 4QRUB 1R0AH 2PYEB 4NN7C 5LXGH 1CVRA 4PRHA 1JWUA 1NSNL 1ZHLB 2J6EA 4O02H 4J7RA 4URTB 1FZMB 3FTGA 4FFZL 5F8RC 4HXBH 1MH5A 4HWBL 2BNUB 1JGDA 4XP5L 2G2RB 2R15A 2YN3A 3UTTA 1YYLH 3KXFB 5A16A 4YX2L 4KQ4L 2FD6L 1MIMH 3PWVB 3O4OB 2AXHA 2ILLA 5KANG 5LJYH 4MNHA 1EK3A 3LKPA 4JFQA 5DQ9A 4C57C 2BXZA 5LGJA 5DLMH 2VAJA 5K9QI 1EO8H 1I9JL 1P1ZB 3C5SA 2X4TA 4KHTL 3HC0B 4U4BA 4FQLL 4UTBH 1SEBB 4HIXH 4O58L 5HGBB 5LGKA 4AIOA 1D5ZB 1A7PL 1FL6A 3GM8A 2AK1L 4Z7OF 3QUZB 3QO1B 1IZKA 4IDJL 2Q86B 2GKIA 4F33A 5D2NC 5FGCB 4WTZA 1AQKL 1F4XL 1WFTA 4CAGA 1XAUA 4P2QB 1QSZA 3C5ZA 1ZLUK 3S37X 1TLKA 1VFOA 3QG6B 1LO5A 3O2DH 4M48L 3CK0L 1T03H 3QRGH 3FB7A 4HAGA 3BEVA 4HV8A 2OYPA 4QT5A 3V0AC 1RULL 3AU1A 4Y19B 5I17B 1G7MB 3THML 3LB6D 4XAKD 3BJ91 5E94B 4NZTH 4F8QA 5BQ7B 1H3XA 5HVHC 3EBAA 4Z78B 3LDBC 4PLKD 1BREA 4JO3H 3QHFH 4TOYL 5SWSE 1PX4A 3ILPA 2NX5E 4DKFH 2CLRA 5TH2B 5I30H 3TNMA 1ACYL 4X5XA 1N5YH 2H1PL 3IFOB 1IAIL 5J6HB 2BSSA 4JM2D 1X5AA 5FA3B 2WBJD 2XTJE 1RZ7L 1G7HB 3NIGF 3FQXB 4UQ2B 4C83A 1G7PB 1NEUA 3DBXA 4AM0B 2EDJA 4DOHB 1BBJB 3LD8B 1B2WL 4FNLL 5CJOH 3TH4T 3V4PL 3UYPA 3MBXH 2VLLB 1MAML 4PV8B 5EU6D 1MFDH 3RUGF 1IGFH 2V9TA 1AI1L 4ZSOA 4PJGE 4WFEE 1ZK9A 2DRUA 2MQ3A 4GG8B 3QXAB 3BWAA 2DQDH 4RX4A 5E2UL 4Y4FC 2BY2A 4PYHA 3EYOB 1JZ2A 4RBPH 1MUJA 4XVJL 3RTQA 4M7LL 1PG7X 4HLZG 1P7KA 2K3TA 4LP5A 1NGYB 5IFHH 3WEXB 3IS0X 3U36B 5CBEB 4PS4L 3EOAA 3MRJA 2VAAB 3F7YA 4U1IB 5GIRA 4C56A 1U3YA 1ZA3A 3ARDD 3P11L 5D2NE 1F45A 4M1GH 2Q7YB 4F15C 1YPZE 1M6OB 2A9MH 3S3JA 1ZLWH 4XNQB 4YBLC 1MFEH 2UUDH 1TCRB 4HHAA 1H5BB 1K8DB 3WNKA 2VABA 2VMFA 4M3KB 2AI0H 5DHYA 3OXSB 4R0LB 4XXCA 1VFBB 1AY1L 3MSPA 1T2QL 3NN8B 1K3IA 4W81A 2E9JA 1AD9B 3A0OA 4HUMB 5I15L 1MFAL 1EMTL 5GRUL 1B0GA 5TGBA 5I73C 2PO6B 2VNCA 5I1CL 2EKSB 4UT9L 4DCQB 1L9NA 4F2MB 1S7UA 3OJ2C 2HN7A 2QHRH 5IFJA 5F72S 4ZS6D 3DO7B 2NY4C 2Q1EA 5F93C 2ZOLB 2CRYA 3N0PB 5JPNA 1VENA 3ZTJG 1JZ3A 4GRWE 3WN5A 3ZE2E 4POZC 4GBXB 2DTML 3CZJA 2BVEA 3SKNB 2V6HA 5BMFH 4RDQF 4L4TA 5F7FA 5TF0A 4PY7B 5CP3A 3CLEH 3JWDL 4G6AD 1HHKA 2X4SB 4XP4H 4XI5D 3STZB 5BVJB 2ZNXA 32C2B 2EDQA 1S78C 4GAFB 4ZNCD 1NCCL 1IC7L 4EDWL 1I9IL 1J11A 5FGSA 1K3ZA 1T89C 4M8QB 3VGEA 1XGQB 3ZE1F 3QYCA 2O5YH 1LDSA 3TPUB 4UOW1 2W65B 3F6LA 2NXZD 3EW3B 1YC7A 5ICZB 1FNLA 3GSXB 1DBBH 2ENSA 4ZO7A 2J8OA 3U30C 3AXLA 4Z7VB 4PJCE 3ISWA 4JFYA 5GRVK 2VQ1A 1I7ZA 3DNKA 3CFDB 4LKCB 3F7QA 4PJFF 2EE9A 4Q6IC 2HT4C 1DVFD 4U6HA 4X4ZA 2H3NB 4MWFA 4V1DA 4XB8A 4MA8L 4DKDC 1I9RH 4NZJA 4LPWA 5HHOA 4OTXH 2Y4SA 4L4JA 1WT5C 5C0FA 5JORA 1R24A 5E99L 5HDBE 3VMOA 5ID0A 4DGVL 4KJQC 5KN5B 3GJFH 1NCDL 2Z4QA 3VFPA 2R56L 5SWZE 4JHWH 2XN9B 5DUPL 3RWIB 3P0VL 3WO4C 2NCMA 4UDUB 2D4DA 2QSCH 2EC9U 1CFSB 1VFAA 3EYVB 1NBVL 4OSUL 1C5DB 5FIEA 4UTAH 3FB8B 2QBWA 1OPGL 4PGDA 2C9AA 2I07A 3SDXB 3P2TA 4EUPB 2QQQA 3SKMA 5KS9E 2GITB 3BZFB 3RBSA 2KQMA 1SJHB 2FLRT 1JF1A 1CXLA 4LAQL 2FIRT 2P5EB 3GSOB 2ZCKL 5DK2A 1K4CB 4HKZA 2BY0A 3LRHA 4AH2B 5HGBA 3R0MA 3SQOL 1T4KA 2GTWB 3KVQA 4MQXD 1VACA 5L7XH 1R6VA 1S5HA 3O41A 3QUZA 4Z0XB 3QO1A 3C60C 4PGCB 1B4RA 2Q76B 2ICEB 1T5WB 1IZJA 5F1NA 3TN0A 5B8CA 3MACH 4R2GD 3BIKB 5FCSH 4Z6AT 3LKRB 1A7BA 4DEPC 2HFGL 2M8XA 1U8PA 1J05A 1GZPA 3UJJH 5D8JH 1I1AD 3PV6B 4W6XB 4MB5A 5HHMD 2ZPKH 1AGDA 3SN6N 5GGSA 3CMGA 2Q8BL 1OF2A 4IMKC 4JO1H 3OTTA 2C26A 1RUAH 1SMAA 5IHUH 5GS2D 4NC1C 3G5YB 4Z7WF 2BRRL 3MLVL 1ROWA 3LAFA 3ZSSA 4R90H 2GFBB 5JXED 3ULUD 2BDNL 5FKAA 4ZTPH 1YUHB 2C5DC 3TVMB 1IM9B 2B0SH 1ZLUH 2X4PA 4M5YL 3MRDB 2DQEH 1Q8MA 4FXLA 4LU5H 5BS0D 5EORL 1R3LB 3O6FC 4PIRF 5ECJE 3E6HA 4KZDL 5I2IA 4JFHD 3C8KA 1ZKAA 2FSEB 2H6PB 2XZCH 1R3KA 5MERA 4KKLC 4OF5A 1U3HC 4NDMB 4UQ2A 2GCYB 5I1IH 1G9MH 5EU3A 4OAWA 3O2VH 2HVJB 2DKUA 3QFJD 4ZAKC 3DSFL 4NNPL 1FV1A 5EWIH 1K6QH 1QPPA 5D6DA 5SWSB 5KG9B 2MCPL 2YUVA 4JRXD 4PV8A 4DKAA 3D25B 4RDQG 3HZVB 4LCCA 3DVIA 4U1HB 3QQ9D 3UX9B 3B5TA 1EBPA 4C54A 5IR1A 1UADC 4XP9L 3ZT6A 4M02A 1OAKH 4A2LA 2V17H 2XTJB 4JQVA 5DD0H 2IANB 1X5IA 1KBGL 2VKXA 4I48A 4IRZL 3EUUA 4NN7B 5DJ2A 3QPQC 2XYCA 4CMHB 3MGOB 4N1CA 2BMKB 2GTZA 3D39B 1MJ8H 5JLZB 2BFVH 3GJEA 1RMFH 2R9HC 4O9HL 3HHRB 1W0WB 1ACZA 5IJVA 5JHDA 1MCOL 3RVTD 5D1XA 1VADB 4RAUA 5D71L 4LLWA 3KLAA 3O3DA 4JFXB 15C8L 1JV5A 2FATL 3MRHB 2E7HA 4ZPTB 1H5BA 2F58L 2LU7A 4XGZB 4XWOD 5DJ0A 1K4DA 4QTHA 4XNUH 1DDHA 3P9LB 4XCEB 2IAMA 1J8HD 1TETH 1JIBA 1WWCA 1VFBA 43CAA 1Q94B 4PGEA 4G9FA 4M6MH 3TCLA 3BT2H 4PRPA 3NN8A 4NHCH 1R0AL 3VJ6A 5LXGL 4QRTA 2BNQE 1IGJB 4NC1E 4O02L 5D2NB 1FLRH 2NY2D 4G8GD 3O2DA 3G5ZB 3BDYH 4HXBL 4JPIA 4KK9C 5FYJD 4AEFA 1YPZB 3S34L 5J1AB 3HPJA 1LP9E 3QNYA 1YYLL 4ZYKB 5L9DL 1X6NA 5J13C 3V7AE 2ZUQC 4NUGL 1T0MB 2FX7L 5IMKA 5BJTB 1D5XB 4MB4A 4D9QD 3MJ9H 1PY4A 3D69A 4PRDA 4R4BB 3CVHA 1SQ2N 4OF3A 1MF2L 5DLML 4X98A 1EO8L 2DM2A 3H9SD 4UTBL 4HIXL 3BPLC 4YNYB 4Z76A 5HVHB 35C8L 3LDBB 2RR3A 2NYYC 3TA3B 3G6AA 3UTTE 2D0HA 3L3IB 2YRLA 4PV9A 1GGCH 4RNRA 3T0EA 3STZA 1XGTB 5BVJA 4GMTH 3B83A 5FO7A 4LCWD 5HHQB 3AREC 1UG9A 4WI3A 4XNMA 2YOCA 4FG6C 3SO3B 3G04A 3P0GB 4GRWB 3O2DL 2VLJA 4RQQA 3RGVA 1ZGLB 3TPUA 4NCDA 2W9LA 3QRGL 3MA9L 5C0BD 1A6PA 1GC1H 4PLOB 4P48A 3FFCD 3WLBA 5MEPB 1QBMH 4X6BA 5EZLA 4EDXB 3TZVA 4NZTL 4QY8B 3O8XC 3TC9A 4LKCA 2CIIB 2XIDA 5T1DL 2BVQA 1JRHH 3CVHL 2PXYB 2P5WA 2C4XA 5ISZA 4DKFL 3JWDC 4PYGA 4U31A 1BD2E 5I30L 1QSEE 1REIA 2LTQB 3SE8H 1S7VB 4CVWA 3FT4A 2BX5A 1N5YL 2Z8RA 2PYED 1NAMH 3CC5B 4XC3L 3UJTH 4JFFA 2D0FA 4K3JH 1CN4A 1KJ3L 4HS3A 4UUJA 5F1SA 1E0OB 5F97E 4QYOA 4XRCA 1GJIA 5DK0B 3K4AA 4HJJH 4XZUA 3S88L 1ZHBA 5CJOL 5DVKA 1OAXH 1G7QA 2XY2A 3MBXL 2HTLC 3MOAL 5F7LB 5FUCE 1GAFH 1MFDL 4F15B 1IGFL 1S7SA 2XKNB 1FL3B 3K1DA 5E6IC 4EQ3A 4G8FB 3NFNA 2DQDL 1NCNA 1S8DB 2IMNA 4KUZH 3BGMA 1JFQH 2B4CL 1FNSH 3TM6A 1B0RA 1TVBB 2BC4A 1NJ9B 4AH2A 5IFHL 4CKVX 4FZ8H 4NQCA 2LU3A 2YXFA 5BZDB 3GKZA 4P23A 1IKFH 4Z0XA 1FN4B 5I73B 1PKQB 2Q76A 1MPAH 5DC0A 5KS9B 4K3HA 4OZFB 4P2QD 1OLLA 4ZSOE 5BXFB 4WUUD 4I0KA 1IJ9A 1RUKL 3TJHD 5JOPE 2NY4B 3K7UA 4M1GL 3PV6A 5F9OH 5EOQH 4IOFC 5IT2L 3OPZH 4JJ5B 3QUYB 3S37L 3QUMB 1KCSH 2NY7H 1MFEL 4Y19D 1T5XA 4TUJA 4Y4HC 3WFCH 2VZUA 1NUGA 4M43H 3IETB 2NPLX 4TVPH 1R3JB 4FQ1H 3MRNA 4PJGF 1YMHA 2GFBA 1G7LA 4F37K 4KVCL 3AS0A 4NNXB 2GK0A 2H2SD 3RJDA 3JWOH 1LE5B 4WNQB 4I3GA 3QEUB 2HJLA 2X05A 3K1KC 1HYRC 2QHRL 1P2CB 2ZSWA 3RDTC 2FEDD 1MHEA 5BO1H 1QVOB 3KPRB 3DURB 2GCYA 1NFIB 1QFOA 1YDPB 2HVJA 4FRWA 4I3SH 4D0DA 1H3GA 4GQPH 5GQBA 4H20H 3U30B 3ARGA 4WW2C 3FQWB 1BF2A 1YPZF 4Q6IB 4HFUH 2G9HA 3MLZH 1I8MB 3GJFA 4G6KL 4FXGA 5DD3H 2EIEA 2FR4B 4L8CB 1NL0H 4EUPG 1XGRB 5IHBA 1XGUA 1TZIB 3UTSE 4MMZC 4HZAA 1NC4B 3MLXH 4NPYB 3WO4B 3PDDA 4QRPA 4KJYB 5DMGC 4L4VA 5AZ2H 3UYOD 1JYWA 5B8CC 1FGVH 5IW6B 1TCMA 1AC6A 1DBBL 4G9DA 4OFYD 4S10A 5I0ZA 4ODVH 4J4PC 4ZNEE 1FVEA 4KH2A 2G75A 4AIZB 2AV1B 1IFHH 2D4FA 4WDIB 1LD9A 1P9MA 4X6DA 4GRWF 3ZE2F 3QCTH 1RY7B 1NCBH 4OKDA 5EC2A 4WW1A 1I9RL 1WJ3A 2Q7NA 1TJIH 4OTXL 5I1JH 2VZTA 2AXFB 4LVHB 5I1DA 4U3CA 1JHKH 1Q94A 1AR2A 1I8KA 4JHWL 2E8YA 1A9BB 3W0WA 3T0WA 1N6UA 4G6MH 2QSCL 5C9JB 2WUCH 3WLWD 4DFIA 1IM3A 4UTAL 1YNLH 4V1DE 4DEPB 4UU9A 3VFUA 2ICWA 4MAUL 5ID1A 4AY0A 1U8OB 2JTDA 5J9PA 5IVOA 1NMBL 5ESAA 3WNLA 5FB8B 1MIEH 2ZG3A 1RJZA 5BJTA 3MLTA 1D5XA 4JN2B 3MNWB 3FRUB 4XP1H 1MQKH 1QBBA 3GI9H 3DXAB 3LH2H 2X89D 5F7KC 4PJCF 5D6DC 1DN0A 5I1HL 1Z5LB 4NOFA 4OGXL 4X5WB 3VFOA 4HWEH 1A4KB 5L7XL 1M05B 4HKXB 2BVYA 3FB6A 4NIKB 3NZHH 4PRAB 1RZGA 4M7LT 5HDBF 1DZBA 1TQBC 3TH2T 2NY5H 2XWJA 3O6FB 5E9DA 1UWXK 4WI6A 5D8JL 1VGEH 4WFHE 1ZGLA 3MRPB 4ONGH 1U3HB 5B39B 2EKJA 1G6RH 4ZAKB 3O4LE 3EOBB 5EU7C 5FYLD 4JO1L 2FHBA 3SPVA 1FYTE 5D1XC 4R4NC 5GRJL 5IHUL 3LZFH 5KS9F 2X1XR 3ARBC 3EAKA 2J4WH 1ZV5A 4GG6A 4R90L 4CW1B 2IH1B 2EEAA 4NWTH 1VEPA 4HZLB 2B1AH 5ACZA 1A2YB 4TTGA 4NZUH 4JAMB 2DQEL 4LU5L 1NBYA 4IRSC 4PG2A 5F44A 2CDEA 3B8SA 2XN9D 1U92A 3UXFA 2XZCL 1P5UA 1IEBB 2ZWLT 3VXRA 5C92A 1AGEA 5ICYA 2W59A 3GKWH 5I1IL 1G9ML 3AVEA 3INUH 3O2VL 4LPCA 4IRJC 2IEPA 1K6QL 3SDAC 3SJVB 1R5WB 4TUKH 3VGDA 1JYVA 1BD2B 4FQQA 1QSEB 2FJHB 1HEZA 5CD5C 2OZ4A 2HRLA 4KI5F 1HINH 1EEYB 5C0ND 4ZUSB 2A0LC 2V9QA 4GKNA 5F9JB 5F7NC 1OAKL 1I85C 1YZZA 2V17L 4PTTA 1FE8H 4YGVA 4XNYL 4XH2B 3TO4C 1A21A 3QB7C 2H8PA 2V2XA 3F58H 5BZDA 3RX5A 3IJSA 4LPUA 3T0EC 1MJ8L 1CBVH 5BRZA 1PKQA 1RMFL 4W6WB 1T1YB 3DHMA 3BP5B 3WV0A 4RFEA 3IXTA 2BOBB 3ARQA 4GQ9H 4QRRA 3PWNB 2A6DA 4OM1H 3HZKB 5J13B 5E8OB 1AKJA 5CEZH 5GGVY 3RGVC 2ZUQB 3BP7B 3V8CA 3QUYA 3QUMA 3VXUE 5HYSG 4S1RL 3VFSA 4FQXA 3ULVL 1BVKB 4YUEH 4XNUL 1TETL 1XF5B 3BPLB 5D7IE 5EU7E 4M6ML 4LHUB 2B4CC 1M7IA 3DROA 5JHDE 3CSGA 4MXWL 1X7QA 1QYGH 2ADJB 1T20B 3IRPX 4LRIA 3TVMD 3TNNB 5IUSA 2CK0H 3QIUC 3RZCC 1VEOA 1FLRL 1IC1A 1PVHA 3MRKA 4M1DL 3AREB 4XHQA 1X5HA 3V5HB 1PAMA 1QO3B 5DEGB 2DQTH 4DZBA 1ZGLP 4GXUM 1JGLH 4APQB 4PB9H 4JVPA 3GIZH 4G9FE 1LK3H 2WLZA 4BH8A 4PRPE 3MJ9L 4M62L 1L6ZA 2WAHA 1IGTB 1ZT7A 5SWSD 3ET9F 2NX5D 3ARWA 1OWRM 4YFLF 3O8XB 1D5MB 2UYLA 4GS7B 5D1ZB 4MA3B 1EO7A 4G43B 1I8MA 1GGCL 4W4OA 4GMTL 2FR4A 1TFHA 2DBLL 2XTJD 2O5XH 2IQ9H 4X8XA 1VA9A 1JI2A 3QFDA 5HDQL 3WNNA 1MWAH 4RAVA 3D39D 5AG8A 3AS1A 5HVGB 1KFAH 3GMPB 2OTPA 1XF3A 4PP2B 4UINH 2AP2A 3RWDA 4GAJH 5IW6A 2C3HA 4WFED 3WS3A 1LP9F 1GC1L 2AERT 1YQVH 1MHCA 3T0EE 5BV7H 1C08A 1FAKT 1S9WB 2D0GA 3RWFA 1QBML 5F9WB 1IKNA 2G5RA 2VZ3A 4ENEC 4GT7A 4XT1C 1LDPH 1JRHL 5EBMA 3IGAB 1FZOB 4OZFG 4JQIL 2ED9A 2WP3O 3Q5YA 3MNVB 1W0VB 3BPNC 5EG6C 3UTSB 5H2BA 2LQRA 5IHZA 1XEDA 3SE8L 1ORQA 3REVB 2GHWB 1NAML 3UJTL 1NC2B 4V2CB 3U2SA 4K3JL 3SGJA 3ZL4L 2YPLE 3T77B 1R3HA 3O11B 4LLVB 1MCEA 3MRRB 4HJJL 4JG1L 1KCUH 4K7PY 1KTDB 3AY4C 1EHAA 1OAXL 1GCFA 4NQTA 2IPKA 1GAFL 3OG6B 3B6SA 4OBSA 3ZT7A 1C5BH 4CADA 3Q48A 5TFSH 3U6RA 5AD0B 1N3NA 5SWQA 1UA6H 2X7LB 4Y4HB 3IKKA 3LKSB 4KUZL 5C0GA 2ENYA 3MNWA 4LVEA 3S36X 1JFQL 2OR9H 5D6CA 4I4WA 4X6FB 5CIPH 1KPRA 3VWKC 3U48A 4X5WA 4F7EA 5DMKB 4FZ8L 3KYNA 1NFDA 3NMEA 5CMAA 5DZLA 3U4AA 1IKFL 1M05A 4Q9QH 3WS6A 4OCXH 4ZFOA 3O0RL 1MPAL 5C0DA 4PJBA 5JZ7C 5EOCJ 5C07E 1JZ8A 2EYTA 3FB5B 4YQXH 5L8KB 3RDTB 4HLJA 5E1AA 4KV5E 5F9OL 4XCNA 2YPVH 5EOQL 2CGRL 3OPZL 3MRPA 3M17B 4PTUB 5B39A 1KCSL 2NY7L 3L3OB 1U8LA 1CQYA 3WFCL 4WW2B 3U7WH 4M43L 3VG0H 4TVPL 7CGTA 4UNTA 3RAJH 1QRNE 1S7RB 5IKCA 4FQ1L 4Y4FD 5I66B 3K0WA 1KB5B 4LNRB 5CSZA 5A43C 3L5JA 4ALAL 1NUDA 3JWOL 2MQCA 1P4BH 1I7UB 2C1PB 3BVNA 3S4SA 1KIQB 1KULA 4NRXA 3PJSB 3GMLA 5EFIB 3BZEA 4WHCA 2NTSP 1IEBA 4FFYH 1AFVH 5BO1L 2XTLA 3CH8A 3CFEB 5EIQA 1FYTB 1FZKB 4JO4H 2NW3A 2A2QT 4HC1A 1O7SA 1L6XA 4H20L 4MQSB 5GGVH 4KHXH 1KLUB 3IFPA 4MQTB 4J3XA 2B7DT 3HN3A 2Z35A 4OCMC 3FO0H 3L3KA 3MLZL 3FQRB 3VW3H 1JWSA 2QKIB 4P0DA 5SWZD 5HPMB 4JZOA 4X7TB 1MHHA 2EO9A 5DD3L 1EEYA 3V7MA 1MNUH 1NL0L 2FRGP 3V95A 3FCTB 1XIWA 4WENB 2JIXA 4QXUL 3D0VA 1YYMH 1TTFA 3JV6B 3HE6A 3MLXL 1AJ7H 3NCYP 3WHXA 3VDBA 5FUZH 4P4RB 5AZ2L 1CTNA 3PWLA 4FP8H 3RWJB 1FGVL 3WHE0 1HCFX 4Q2ZB 2XXMB 5CEXA 3M45A 4IBLT 5I16A 4XP6H 4ODVL 1RJLA 4MXVE 1G9MC 3BO8B 2NY4D 4I18C 4XMKH 3T2QA 5C0CB 4YXHL 3ZZ1A 4PJXA 1ERNA 1TPXC 4PGBB 3LQZA 3LKQB 1IFHL 5E8OA 4B50A 4POZD 4GOSA 4YO0B 4TULH 1HHJB 2Z9TA 3QCTL 4MDIA 4DZ8A 4CL7A 1NCBL 3V7AG 3ALXA 1HOCB 1BVKA 1TJIL 5I1JL 5DJZA 2VDOH 4QRPE 4L4VE 3V79C 3U7AA 3KGRA 3C8DA 1JHKL 2OXHA 4HFWB 4KJWC 3QDAA 2D7TH 4KROC 2WV3A 1ZLVH 4JEGB 3PIQB 4OCLC 1F3DJ 3C08H 1QQDA 1S78D 1DQDL 4G6ML 4GW4A 5MENB 4QRQB 4X6DE 5IBUB 1TQBB 3EOYG 1JGEA 1YNLL 1Z9MA 2AJXH 4TNWF 1WBXB 3B9DA 3VXUB 4U6TA 4NQDA 3ELAT 4APQA 2Z8VC 5GSRB 1FL5B 2IBGA 2Q8AH 2DYPB 1MIEL 4JCLA 4K8RL 4G7YH 5D7IB 2X40A 1BF8A 1HSBB 4XP1L 1IGTA 3W0WE 1MQKL 4K7FB 3GI9L 3LH2L 3KPQB 3BSZH 1CYGA 2HT4D 3ARBB 3RU8H 4F80A 1OD9A 1NCAH 4QHMA 4HWEL 3IKCB 3W5MA 4P57A 3S5LA 5DI8A 1NBZB 1QFWI 1YJDH 3NZHL 4N90E 3EO0A 4KJQD 1I4FB 4NO3A 4IRSB 2BK8A 4PJ5B 5E00B 3KS0H 1HDMA 3GMRB 4HEME 1HYSC 3CDYA 1VGEL 4ODXA 3SDDC 5M94B 4ONGL 2R29L 1MCDA 4BA8A 4NQVA 1G6RL 4K7PH 1EUTA 4QHNA 5K9KB 1QP1A 1JZ6A 2C4FU 3AMKA 4LSPH 1QFHA 2XFXA 1UJ3C 3SDAB 3LZFL 3M8OH 2J2ZA 2J4WL 1CGTA 4U7SA 2CKNA 4KTEH 3T08A 2YC1B 5K33A 2GT9A 2W9DH 3OGCA 4NWTL 2RIKA 2YHGA 1CT8A 1WQVT 2B1AL 2X5PA 1G7IA 2AEPH 4PJAB 5DJAA 3VWJC 3A6BH 4OQ1A 2AJ3B 4NZUL 3UBXG 5GXBB 5EOCH 3ARZA 3GBNH 3N1PC 3TO4B 3L5IA 1ONQB 2YEZA 4JKPH 3DIFA 3E6FA 3C60D 1IQWH 3BEWB 3SHSA 3ESUF 2AJVH 4L1HA 2HVKB 2OMBA 3SKOA 3HI6L 4PJ8B 3GKWL 2HLFC 3RX7A 3INUL 5D7JA 5T3XH 3C09C 1UZ8B 3IAQA 1QR4A 4KGJA 1DQLH 1GC1C 3LRSB 3T4YB 1CVSC 5HY9A 1XF2B 5J57B 3D3VE 3LQMA 3W9DA 3OAZK 2YBRB 3CDGA 4LFHD 3GIVB 1NGQH 2WQRA 5IB3B 1HINL 4ORGB 4HGKC 2VL4A 3VXRE 3O9WB 4BYHA 5IB2B 2BNQD 5DJ6B 4LMQI 4X6FA 2YPLB 2D7OA 1JNNH 4OLWH 1FE8L 3DX6B 4PJHE 3MRLA 1EVUA 1I8IA 3GMQB 3R8BB 3ZTJH 2C7UA 3F58L 2W9EH 4QOKB 2A83A 4W4OC 3RZCB 2R23A 3I85A 4LBEB 4N8VA 2XG5A 5EO0B 4U2YA 3O6FD 3STBA 2JJSC 4K2UH 3HRZB 3MLPA 4GQ9L 1OP5K 2VH5H 3GMOB 5FM8A 2FEEL 5C0JB 1ADQH 5I18L 4KKLD 3G6DH 3TBSB 1U3HD 5CEZL 3D0LA 3SGKA 3EHBC 4NQXA 3T2PA 4ZAKD 3ARFC 1F4WH 3KPSB 5CSBA 3UTTD 4UOJA 5DA0B 4I77H 1DQMH 1Z0NA 5TE4H 4YUEL 1NEZG 3DV4A 5LG1A 3MV9E 2VQTA 3HUJB 3MBEB 3RY6C 3L5WA 2YZ8A 1UCBH 1BM3H 1QYGL 5J12C 4L9LA 2CK0L 3UZVB 5C07B 1U8KB 1UGNA 3NBNA 5MP6L 4HPOH 3Q2CA 2DQTL 1OHQA 3QPQD 4FQCH 2WUBL 5EUKB 1FAIH 2D7MA 3SGJC 3UPRA 4PB9L 3X12B 5D72H 2R9HD 4M9OA 4J3WA 1NDMB 3JTSB 1OSZB 4NFCA 4ZUWA 2AJZB 3GSUB 4Z7UE 3SJVD 1N2RA 4UIMB 1BD2D 3W9EA 5IJKA 3B8YA 1QSED 3U9UA 1A4JA 4ACPA 3FRPG 1IAKB 1WAAE 3QUXB 5TPWH 5D1QA 3PDOA 2SEBB 1PJ9A 3STLA 3V6ZA 3OKEB 2I9TA 4S11A 2D3VA 4AENB 4PB0L 2O5XL 2IQ9L 3JWOC 4YDVA 5D7IF 4OZIE 5I1AB 5IMOA 3LSOA 4XMPH 1FNEA 1I3GH 3BJLA 4JFZH 4KK9D 4UINL 4GAJL 2JCCA 3BQUA 2P47B 3OG4B 5BV7L 1G0YR 5C0CA 2FX8H 1ODAA 1RI8A 5LBSH 4YWGH 1FC1A 2GW5A 3S97C 1LDPL 1VFUA 5CIPA 3KPMA 4AEEA 3GSNA 1IGYA 2X1PA 5D7SH 3O3BB 3VWKB 5HTSA 3I6LE 2V2TB 2NYYD 5L2KB 4ZMAT 4RX4D 3P4OB 3U0PA 1TXKA 2BSTB 4X6CE 2XZAL 4PBXA 3NCJH 2GY5A 5JOPD 2OXGA 3ARED 1D7FA 3VXOB 4LKXA 3H6JA 4FG6D 1CICC 4F7PA 3VGFA 1UB5A 2ARJA 1KCUL 3QDME 4C4KT 5T5NF 5GS1A 4U1SB 5JQ6H 1CDHA 3LEVL 1C5BL 1U8JA 2BNRE 4DKEH 5TFSL 3MQIA 4HQQL 1UA6L 3PWPE 5CJXA 4O2EA 1N6VA 3LRGA 1X6LA 1Q9KA 3QNXB 3O8XD 1BWWA 4K71C 1LEKA 3DI3B 4Q0XL 1DJSA 4GRLC 1Q9WB 3WL9A 4EVNB 1ZA6B 2ZUSA 1DSFH 1YEHH 2H26B 3MREB 3VFMB 1UWGH 3UO1H 5B38B 4Q9QL 1TVHB 3DYPA 1JF5A 4OCXL 5IGXH 1ZS8A 5E7FA 4P5KA 4N5EC 1XIWC 4TVPE 1LO2H 3BPCB 4MQ7B 3RA7H 1MCCA 4LGRB 2DWEB 4YQXL 1M71B 4P9MH 4EIZC 4R9HA