3HMXA

Crystal structure of ustekinumab fab/il-12 complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
305
structure length
295
Chain Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQKDRVFTDKTSATVICRSISVRAQDRYYSSSWSEWASVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
molecule keywords Interleukin-12 subunit beta
total genus 44
structure length 295
sequence length 305
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxA03
3A0OA 4M6NL 2QBWA 4ODXA 4PJCF 1LDPH 3NCCB 4JRXE 2ICWI 2NY5H 3QO1A 2PW1A 3WN5A 5C0BE 2WBJC 4P5TC 1T0MB 1F00I 4XAKD 3CFJA 4O2EB 1KTDA 3U9UB 5I1EL 1G6RA 3MRNA 2X1XR 3DJ9A 5GS2H 1MLBB 1QNZL 4PP1D 1VPOH 4HAFA 1R3IL 3BYTA 1KB5B 4CJ1A 4PJIE 2UWEA 1NGPL 3T0EB 1E4XH 5GISL 1H3TA 2CK0H 4JLRB 3QUML 3MLSH 4OCNC 5FCUL 2MMXA 2GSIB 2NLJA 1RK0B 4XVJL 1CR9H 3LY6A 3RTQC 5EU4B 3GI8L 4KI5F 2VZ3A 4G6JH 1HE7A 5D7IB 4PJAA 2HLAB 4CNIA 1VKXA 3BE1L 5IROA 2HVKA 4TN9A 4DZBB 1F3RB 4PRPD 2VLME 4DTGL 1HIMH 3QFDA 2EYRA 2GJZA 3S97C 3ZE2E 2GQHA 3E6HB 3WKML 4NUGL 1M05B 1FZMB 3JWOL 5DQJB 5DURD 1DBBH 4WCYL 1PKQA 5DA0B 1TENA 5F9WC 2Y6SC 4KU1A 1MFAH 2YRLA 2WWMC 1X44A 3MFFA 3GI9H 2AK4A 3HLAA 3FOLA 4MVBC 4DKFH 1UB6A 4M43H 5MI0B 4CN6A 4R4BB 4Q0XH 2EKSA 4P5KA 4BKLA 5I1KL 3VDCA 5IFHL 5TE6H 3LKPA 1SJVA 1I7ZB 3QXUA 2R1WA 1JHLL 2Q7NA 1JYNA 5GS0C 4GRLA 3SE8H 4DN4L 4WI7A 3VFGL 1KSRA 1VFBA 3C08L 5JOFA 4FTVD 3P4MB 3SPVB 1VGKA 1KIPA 5C70A 5J9PB 2W9EH 4LFHD 4N8VG 4P3CH 1AQKH 4KJPC 1EIBA 5JIPA 4ETQB 2ZUTA 4X5WB 1HHHB 1A9BB 1TZHB 1WCBB 4WHTA 3U83A 2F5AL 3P77A 4HGWB 3MOAL 4GOSA 2R23B 3PQYE 4AG4L 4KRPB 4M1CC 5I0ZA 2HT2C 4UB0L 5E4IA 5AEAA 2VLRA 1DZBA 1G6RB 3TO4C 3W82A 4NO0A 5IUSA 3EYVB 4OLZH 5MEPB 5TF1L 1D3CA 1MJ7H 3CSPA 1H5BA 5EDXA 1KB9K 1YC8A 3IGAA 4AT6B 6FABH 5GHWL 2GTWB 5F8RC 4PPTA 1INDL 2NY2D 1BEYH 5C08D 3K2UL 4HIXH 4FZ8H 4YFEA 5I1LB 3EYUL 4NUJB 4N0UE 4XHJD 5FB8A 3VFNA 3M07A 1CFSA 4QO1A 1M7IA 3ZHDA 2UYLA 2HLAA 4CNIB 2Q20A 3BN3B 4G8GE 4JY4B 4O2CA 4PRBB 2MTPA 2FGWH 4JFQB 2F8OA 3LVEA 4TUOB 3T04D 5HYJB 5B8CB 3BWUC 3V52H 5BV7C 3NIGF 1DBAL 3DRQB 4J4PA 1OARH 3WIHA 1JGDA 2Z8SA 1QYGL 3LOWA 5ESVB 4OLXL 4FQCH 4YHOH 3RUGF 3WE6B 1F13A 3V8OA 4MCZB 3GMMA 2ZOKB 1G7LA 2FX7H 4QRPE 1YMHA 4LCWB 4ENEC 5C3LD 1BQHA 4R4BA 2DLFL 1L7TL 5TDPA 2R69L 5DI8B 3ECBA 3F6IA 4X4YB 1NCAL 3B3IB 1RIHL 3LN4B 2XN9D 2AAVA 1A9EB 3BGFB 3HRZB 3C60B 1OAYH 4O2FB 2X09A 4J4PD 2YPLD 3L95A 2AJVL 3QIWC 2NY0D 3MYJB 4URTB 4D8PA 3LQAH 3RNQB 1U8MA 4P23A 4PGCA 4DGVL 4XCFH 4XNXL 3KWWB 3TO2A 4TSBL 1DN0B 1WFTA 4OGYL 3LV3A 3QUZA 4U0QB 5FEBA 1E6JL 3RA7L 1KCVH 1FLRH 3UBXA 2VDMH 1HSAA 3P77B 2P4AB 2XICA 4EQ3A 3RDTD 2V7HB 3MUHL 1T22A 5C0AE 1I8IB 1QP1A 1BFOB 3CJJA 3RWIA 3C8HA 2CDEB 5FYLD 2V5SA 1L9MA 3UTOA 2GTZA 1DVFD 4XMLL 1AD9A 1RUPL 4C4KT 3DMMC 4OFPA 5F6IB 1A3LH 3NCBB 1A6WH 2DQIL 5F96H 4GLRH 3Q6FA 1PG7H 4I1NB 1OD7A 2BHUA 5L7XL 5EZOL 1WEJL 1Z9SA 3QRFM 2DQCL 2EDFA 2QQNL 4R9HA 4UINH 4QHUA 1A6UH 3RDTA 2PXYD 5D7JB 2Z92B 1MCJA 2FO1A 4NCC1 4OZFG 1MWAB 1Z5LB 2R2BA 3RWDB 4RAVB 2QHRH 1VPOL 1BJ1J 1JPGA 4MVBD 1UM6H 4GXVH 4G9FE 2X40A 5KAQG 5E2TL 1LO3H 4Y19D 2G5RA 2QQLH 1HCVA 2NY4C 3CX5K 5I30L 3ULUE 4FHBD 4U1KA 5TFSL 1CGSH 4NHUB 4CMHC 1CLCA 2C7UB 5ESVA 1FNHA 2HKHL 3QNZB 2O93L 5JDSA 3D9AH 4LASH 2DI7A 5CWSB 1WBZB 3CLFH 4Y5VB 3VFUA 3DVFA 3S34H 3KPOA 4HX1B 5CJXA 4JM2D 3P9LB 4OLYH 4PP2A 1QZ1A 1U93B 5C0AD 5BS0A 4XP4L 3X3FL 4U6XB 3SJVA 2FLRT 1ZSDA 4Z6AT 1F4YH 2KL6A 5EORL 3CLEL 3OXRA 3TVMB 5A2FA 3L95B 3MNWB 3QHZH 4X7EC 1Z9MA 3EYQC 4ODUB 3D85A 1X5FA 4ZODA 3ZDZE 1MFBL 4H25B 3PABA 1A7PL 5DD3L 3VXRD 2DM3A 4Y16D 5JW3L 2WUCH 4YX2L 3VXMD 4LCIH 4PJBA 1ADQL 3O4LB 2RJMA 4TYUA 4JFFB 1C1EH 1O5DT 1IKFL 4FQLL 3ZSTA 1HILA 5AZEH 2VLJA 4Y5YB 3HI6H 5KSVA 5T1LD 3IFNL 1RK1B 4JDVA 3UJIL 5A1AA 1C7SA 2YUXA 1BMGA 4OLUL 5KTEH 1H8OA 3G6AB 4KRLB 4Y1AE 1RVFH 2GAZB 3LKQA 3LS5L 3BPOB 3AY4C 3FB5B 1EO8H 2CDGA 4FFWD 3OKNB 4OFKA 4TRPH 4Y2OA 4FNLH 4J2XA 1FFRA 3CVHH 3TZVA 2WINB 3U79A 4NZRH 3N1FC 2EO9A 4L4VD 4IRJC 1PLGH 5SX4I 5MEOA 3PL6C 1PG7W 4MXVE 2ZNXA 3BKML 4DW2H 1J1XH 2F9BT 2EE2A 4LIQL 3UZQA 5DXWA 2GCYB 4HHAA 5CBAB 1K5NA 1UJ3A 4LCCC 4NWUL 2X44D 1QBLH 1RHFA 2ESVD 3O4LE 1W0YT 2BX5A 4YDLC 4X0KB 5IBLD 1K4CA 1KB5A 4LHJB 1FYTB 1A3RL 2W59A 3ZDXF 3BISA 4HIXL 3QXAB 5AWNH 3IJHB 1U8PA 3PXHA 3L7EB 1QSFA 3ARPA 4JFOA 3EO0A 3TJHD 3VXUB 4G8FB 4K9EH 2X05A 3RUGE 2A6JB 2NMSA 3AU1A 4PJEB 2YWZA 1MRDH 3OPZL 1JPST 3DX6B 5C07A 5KVDL 5HDQL 2X4PB 2MQ3A 4LSUH 32C2A 5BV7H 4POZD 2DQTL 2OTWB 3RGVB 1F4AA 2A6DB 4QRPA 1UXSA 2RB8A 3GIZL 1D5ZB 1UADC 2FYYB 4XP6L 1S9YB 4JFHD 1WJ3A 2WWMD 3U30C 5JDJA 1G7QA 1XGYH 2CLZB 1TJIL 5HGAB 1Z0MA 4FG6D 1WBXB 3O4LA 1U2HA 3NCYP 1IILE 1FQ9C 3JV6A 1YPZA 1MCSA 4BH7B 1DUYA 2VXSL 1IGYA 3B8YA 5BV7B 3CXDH 4E41B 4XCEB 1U8NB 3T0BA 1OW0C 5GSRA 3GBNH 5FKAA 3RY6A 1T0NA 1RAMA 4QEGA 2P42B 5EBWA 2G2RB 3OKNA 4BSVA 3RVTC 5E2UL 5GSVA 1H3PL 2AJXL 1HHHA 4O02L 1TQBB 3DYOA 4HEPG 2OL3B 2R23A 2EYSA 3NFPA 5IQ9A 4ZFGH 4YH6A 5IFJA 5CEYA 1JNNH 5IMOA 5DD6B 1RZJC 1DFBH 3PWLB 4C55A 1U8OA 2FX8L 4NP4H 2W9DH 3PQYA 5ICYB 3LDBB 3MCG1 1FVCB 3VMNA 1XFPA 1MAMH 3VRLE 2A83B 3FHAA 4AT6A 2FHFA 3ALXA 2VLLB 4M6AA 5EN2A 1NBQA 1XIWD 3L7EA 4PJDE 1YNTA 4P59L 3BXNA 1L6ZA 3BJLA 4KK5C 3RX7A 4TSAH 3ARBC 2OL3H 4QXUH 4JCMA 4KKCC 5C07B 3SCMA 4YE4L 2F5BL 1HEZB 1M7XA 3O8XB 4X9IA 1FJ1B 4R3SA 3ZE2F 5CINH 1X4YA 3GSNH 3G5XA 3PWVA 2VB5A 5LQBH 4J6RL 3SE9H 2EEDA 2HG5A 2Z9TA 4NWTH 3WJJC 4GRMB 4HUUB 1LO5A 1ERNA 2FYYA 4WFFD 5F44A 4OSUL 5JIIA 1SY6A 2DTSA 3LZFL 3L3GB 4OLYL 1P4LB 1AE6H 4LGPB 1IGMH 3PGCA 2OX5A 4GH7B 4HWNA 3EBAA 5GGUB 4HWEH 2HT4C 5EFIA 3F7QA 5BO1L 4O9HL 3MJ6A 3S35H 4X6DA 5IMLA 1YPZB 2PXYA 4XI5D 2A9ML 4HS8L 3T1WA 3D3VA 3C60A 3KJ6L 1T3FA 5C6PB 1GVIA 3U0PB 3B2UD 4NZJA 1RJLB 4D94A 4QXTB 4FXGA 3GMPB 1G6RH 4Z7QF 5F71A 1TVDA 1MCOH 3CDGA 4PGCB 1IAMA 4EI5D 4UI2A 1YEKH 1Q94A 2H32H 1KCSH 4H1LG 4S0TD 4CUCA 2X89A 5ESAA 4C83B 3T0XA 3CZFB 1IC5H 3QO1B 2B5IC 3K2UH 3QZWA 1F6FB 2VZSA 3KR3L 1K2DA 1C12A 1PW3A 5HY9A 2VDKL 3RWIB 5E08H 5DHXB 4PGEB 4RZCB 1FVDA 2NXZD 3EO1A 4JFHE 4AEIH 5L8JB 2UWEF 1LNUA 1UXWA 1DL7L 3BD5A 3O6KH 5DK2B 4NPYA 4JY5L 3FO2A 5IF0B 2NZ9D 4LHUD 1UEMA 5D96B 4FNLL 3GZKA 4OF8A 1JGEB 5BQ7B 2LAGB 4Y2DD 1NC4B 2VSCA 4YDVB 5D7SH 4MAYC 4OLEA 4UT9H 4QRRD 2VTFA 1RZFL 2OSLB 4ZG1A 2BNRE 4FQCL 1HNGA 5D7JA 1GGTA 4LCYA 3FONA 1RZJH 5I76B 3W5MA 1CDBA 2DIJA 3IDIA 5CSGA 1NDGB 3IF1A 3VCLA 1ETZA 4OT1L 4AEHL 5D7LE 3I3DA 3SGKC 4HXBL 2GJZB 1NANI 2EH8H 3QDAA 3EDFA 4ENED 3C8DA 1DE4A 4FQIL 4Z7VB 4P2QA 1ND0B 5INDB 1CDGA 1R0AL 4EIZC 4PLJC 2Z0BA 4P3WA 1AIFA 3ULUH 1F4XL 3S9DB 2ZPKL 5IBLC 2Z8VC 1ZA6A 2X4UA 5DJ2B 5BS0B 1GZQB 3V0AC 4ZAKC 1QBMH 1PEWA 4X6DB 3C5ZA 1KTLA 4NKOB 4KKLD 5C0CA 3D3VB 4KKBD 4FABH 4WUUA 3PL6D 3T0EA 2GIYA 1OQXA 3HNTL 2Y9RT 1N6QL 25C8L 3MCKB 1XGTB 1RK0A 4WW2F 5IR1B 5BOPA 3V7AE 5DK0B 4JFDD 1UWXK 4ZDHA 2YBRB 4X83A 4HS3B 1XGQB 1M1SA 2E9JA 4TNWK 4JFFA 3VXME 1AGBA 2QLVB 4DZBA 3VXSD 4OCSH 4H5SB 4FQXC 4U1GC 2EIEA 4WWKD 3TT1H 4Y4KD 3VRJA 1RIUH 3RVWD 2DDQL 3ZDYF 5I75C 1LO2H 3EOTH 3I85A 3RVXD 2FL5A 5HPMA 1FSKB 2VLRE 1NAKH 1JGEA 2N7BA 2MCG1 15C8H 4YDVA 1FORH 3MC0A 5I1HH 2ARJQ 1YJDH 4GRWH 4KGJA 2OSLA 4EDWH 2BDNL 3GB7A 4HUKB 2IPTL 3QIUB 4LCWE 2VKXA 2YD7A 3M1BB 4U1JB 2UYLB 1IAII 2X9WA 3ZL4H 1N3NB 3OWEA 4NQEB 5AZ2H 1U8IB 2EDBA 2CPCA 5H35B 2FZ3B 3VG9B 4JFQA 2W9DL 2P8MB 3DMMD 1LGVA 1S7TB 4KMLB 3SGDH 3X3FH 4BUGA 3BSZL 1EUTA 4HEME 4YFLI 4TUKH 4ZFFA 4NFCA 5B8CA 3ARGB 4PRIA 4UDUA 4JM2C 4PTUA 1F4YL 4F15B 4N0FA 2NXZB 3JV4A 4WV1C 2X9YA 3L7FA 4IBLT 4K55A 3QCVL 3IJHA 3AB0B 2CLRB 2AP2A 2VDOH 5EC2B 1H3WM 4KTDL 4AL8L 2PW2B 3EO0B 4WW1A 3ZO0A 3PIQA 5CSZA 2XV6B 3JV5A 2VLRB 3C2AL 4PGBB 4M9OA 4X8JA 2LU7A 3VE0A 5C0RL 3EYVA 3ZTNL 3SGDI 2HH0H 1MNUL 4NSKB 4DCQA 1YJDC 4KTEH 1PZ5B 3D39E 4NKMA 2OTWA 4OD1L 3QYCA 5D1ZD 5IGXH 4MX7A 1D9KC 4M62L 5C0FA 3PV6A 2WM0A 4EQ2A 5KTEL 1DN0A 5DZNA 1RUAH 2R2EB 2XG5A 3SGEH 3R06A 2ADGA 4PRAB 4Z8FH 2WZPD 4PRBA 2FEEL 3BP5B 3CVHB 1L0QA 5I19H 2CRZA 4JDZA 5E1AA 4TUOA 3BIBX 1SQ2N 5FKPA 5GZND 4NO2B 2BC4A 3VRJB 4GQPH 5IWLC 4G6KL 1LQSR 3PWUB 3T0ED 4DK3A 2NY5L 4XCEA 3Q6FB 3KPTA 3X13B 3VGAB 2FIKA 2FLBT 3VI3E 1ZLVH 3RJQB 1RJZA 3X14B 2R0KH 4F7MA 3CVIL 1CDYA 3GMRB 2MKWA 1YMHB 4LCWA 4UILH 3LN5A 3FMGH 4ODXB 1MCDA 1VERA 5EOQL 5CKAA 3O9WD 3LN9A 2A0LC 1J1PL 1KCUH 1IRAY 5CEYB 2FZ3A 1S7TA 4U49A 1TTFA 4IIQC 4HPYL 1TMCB 3ARGA 4LNRA 1N5YL 1TZGL 3TNNB 2CR6A 1YEJL 4XVJH 3S96A 3RZCD 1R3JB 1A14H 1WGOA 4H20H 3NACH 3EYFB 1JHTB 3WS3B 4K7PY 3RUGB 2CRMA 4JLRA 3AM8A 5IOPA 4YHYC 3P4NA 3QNZA 4PP1C 4CW1A 3Q1SH 4S1DC 3REWB 4MZ2A 2HWZL 2PW2A 4WW1B 1OP5K 3ELAT 2WIIB 4JQVA 4K8RL 1D5IH 4XBGA 4ONFL 4P5TD 4FMFA 1R3LB 1AO7D 5ERWB 2HFEB 4XP1H 1MRFL 4N8VA 3O8XA 3JV0A 3DV4A 4EI5B 1Q1JL 5C08E 1JTOA 3H0TA 4QRUA 2DBJA 1EAJA 3VWJB 2EXWD 3LRSB 2IAND 3QJFB 4UOW0 1PKQB 3SY0A 1ORQB 3DX8B 4PB0L 5DZLA 5E7FA 3ARDC 4YDLB 2Y72A 4XCFL 3RIAK 4JPKL 1QBML 1I1CA 1R5VA 4IHOA 1A21A 3VFGH 3EFFA 3R06B 2DLIA 1C7TA 5H94B 1DSFH 3HN3A 5BVPH 1P7QD 2BVYA 1INQA 2PKDA 4JDZB 5DJDA 3VU2A 1T89A 5JHDB 2BC4B 5T1KD 4PJ9B 5KVGH 1PY9A 1U8HB 2HJLB 4OCXL 4Q6IC 3VRIA 2UV3A 3A6BL 3HPLA 2ZUSA 4LAQH 4YNYB 4TULL 2BCKB 2D4DA 1FH5H 3BPOC 3MBXH 1RUML 3FO0L 3KPOB 3WDIA 3E8UL 4PFEA 3SKJH 4PJFB 4YHPB 4F57L 3A6CL 2E27L 4F9LC 2O5ZL 5F9OH 4E5XB 1SEQL 1BBDH 1NBYA 5IHLB 1BECA 4PJGB 4PJEE 4DEPB 2HAZA 1PGRB 2PNDA 3GJFB 1S7UB 1MY7A 3BYYA 3ARED 1PKQE 5F7DA 1QSFE 5ADPL 1KG0B 3B2UC 4G9FB 4JDTH 3S36L 1A6TB 1BREA 1BEYL 3HS0A 4HHAB 2GCYA 5CBAA 4RAUA 1VSCA 1K5NB 5DVMA 5J4MA 5ALCH 4KAQL 1QFWI 3BKYH 2QHRL 4EIGB 4FFVD 4R26H 1JHTA 4GAGH 4Q9RL 4DFIA 1S5HA 1J0IA 4D9LL 1UA6L 2I25N 2YA1A 3BIKA 4TUJA 4X7TA 4OF0A 4YUEL 4NWTL 1ROWA 4PRPE 5GJTL 2RGSA 2W0KA 4CW1B 4XTRD 5E99H 2HKHH 1E28B 3AROA 4HXAL 4LKXB 1FO0B 3FB7A 1P4BH 2FSEB 3GJFH 3QWRD 4OZGF 5TGBA 2QADB 4LU5L 1CFSB 4NC2B 5A16A 3PHQB 3U9PL 4U0RB 1RK1A 4JDVB 2GSGA 4JY4A 1KIUA 3H9HB 2DS4A 4Z78A 2IPUG 4NHCL 5HHME 4LSDA 4JPIA 5BRZB 2ZCHL 4U6YB 3WFZA 2FBJL 1QSED 2EDNA 4BZ1L 5HXMA 3DOSA 1A5FL 4KROC 4K8RD 1XF3A 5TQ0H 4U6VL 2AXGB 4Z7VA 2GKIA 3I3BA 3HC0A 1HKLH 1FG9C 4FFVC 1NGQL 1F6AA 4XPAH 1SYSA 2A6IA 1I1FA 1MFCL 4KDTA 4WU5B 4UTBH 4WW2C 2GY7B 1OOAA 3HG1E 3SOBH 3TVMD 1G7LB 5C0RH 4X7FC 1GC1L 2YR3A 5B39A 1HZHL 3C5SB 2QV2A 4PS4H 5CFHA 5F9AC 3AREC 1AJ7H 2YPLB 4XRCA 1FYTA 4R8WL 5CJQH 5IGXL 2XQBL 4BSWB 4HIIA 5KN5B 2BCKA 4XP9H 1NGZB 3PHOA 1DQLH 5GSRB 1TJHL 1KN2H 4KV5E 1CD8A 3QULA 4G6AD 5I71C 4K2UL 2ENYA 1G9MC 3O6KL 3KWWA 5I16B 1TCRA 5DFVC 3CFIC 3N9GL 4LPXA 1WAAE 2Y36H 1LD9B 4HJ0C 3GSQA 2A77H 5IFJB 4ELMA 2J6EL 3RBGA 3BD3A 3MV9E 3WFBH 2A2QT 2DLTA 3Q2CA 4RAUB 4D3CH 4YXLL 4PRHE 3UO1H 2J12B 1MIMH 1IC7H 3MJ8A 4WUKL 4QTHA 3KGRA 4MQ7A 2XPGA 5EUOA 4XB7A 3AS2A 4M1DL 3WUZA 4JFXA 4NFBA 4FQJL 2CXGA 3SDYL 2PR4H 1A3RH 1AXIB 1WBXA 4AJ0A 2GUOA 1NCCL 43C9B 5FGCE 1NQBA 5C0NC 1CGSL 1FBIL 3TYGL 2VDLL 4WGVB 1N3NA 3QEGL 4MJ6B 3CC5A 1F4HA 1J7VR 1RZKH 5D72H 2AJUH 3UTZA 2X4RA 1FVEB 1JGUL 1K4DB 2V7NA 3O6MH 2D7QA 1KOAA 3ZE1F 4JRYA 4N5UA 1OTTC 1VFMA 1D7FA 2HVJA 3L3GA 1T5WB 1SYSB 3B9VA 2HRPH 1I1YA 5GGUA 3DMMB 5F6IC 5FO7A 5D96C 4PP2B 1ZEAL 3INUL 1BQLH 1VEMA 4U1LB 5I8KH 3MRNB 2H2PC 3WXVL 2YPKA 4XVTH 3GO1H 2FO4B 1YQ2A 2BFVL 2IAMD 2Z8RA 4FFYH 5LXGL 4ONHB 4JRXD 1X7QB 1LO0L 1I7TA 4P46B 3D0VB 4MQSB 5HSFA 1FAKT 2IH1A 3E1F1 4F15C 2XQYG 4D0DA 4CL7A 3PWNA 4PB0H 1FNGA 2W0FA 3T2NH 4F7CB 3AXLB 5KVMC 1A4JB 3NFSH 4MNHA 1AGFB 1MQ8A 2O5XH 1DR9A 1UB5B 2DWEA 3MZTA 1ZMYA 4HWUA 1KB9J 2WNGA 5TQ2L 3CUPB 1SJHA 2NZIA 4O02H 3BP5A 1FO0H 4XMPH 1MCLA 4R6UA 5E6ZA 4RZCA 4PGEA 2IC2A 2JJVA 3HUJF 2I27N 3VI4F 1L7IL 2OR9H 2NW2B 3OAUL 4HIEA 4HKZA 2IGFH 1F8TL 1PSKL 4WFGD 3ZMRA 3OAYH 1QKZL 2C3GA 3MRKB 1I9JL 3LKQB 3A6CH 4LQ1A 4OD2A 1BBDL 1RJZB 4UOW1 3TH4T 3X14A 4HWBA 1ZE3C 1E27A 4ZQKB 3ILPA 4DJMA 4NC1E 3HR6A 4DGYL 1OAUL 1UACL 4XZUB 4YPGB 3HMWL 5J06A 5IHUL 1CD1A 3QDGD 1RV6X 5K9QG 1IAOB 4MXWH 2Q87A 2FR4A 3SHSA 3QUZC 1EMTH 2H3NB 4QF1B 1X5XA 1KXVC 2IG2H 1BAFL 1AFVH 4MJIA 2V7NB 2YD8A 5GJTH 1KIPB 2BVOA 4HJGA 5F9WB 1F6LL 5J9PA 4JRYB 5GGSY 2ZG3A 1BFSA 3GM8A 4YBQC 3P4NB 4Z0BL 4ETQA 4PLKC 4I8DA 2F19H 2VIRA 4XAWL 3CZFA 4LSUL 2UY6A 5IBUG 4JFOB 3DMMA 5FO7B 2HTKD 1U6AH 1ZA6B 1C12B 3LIZH 5HY9B 5DVLA 3GMNB 1V3KA 3C5ZB 4HDIA 5HDBF 3EO1B 1FVDB 1WWCA 2R2HA 4PR5A 1T1YB 3S3JA 1AGDA 1F3JA 4EZMA 1XGYL 5IMMA 3OR6A 1NEUA 5A43C 2WAHA 1EHLH 4NPYB 4H88L 3DVGA 1NMCB 2GFBB 3BOVA 2I07B 5I8EA 3LRSA 4XPAL 4FQPA 4I5BA 2X4OA 3GI9L 1KIQB 2OYPA 1Q9KB 1HXMA 3FONB 2BY1A 1GC1H 2EDWA 5CGTA 2NTFA 4GLRI 1JF1A 2CKBB 4MWFB 3M8OH 3PWPB 4QRQB 5TH2B 5K59F 1DVFC 4ODTL 4P23D 5JTWA 3O6FA 5ABDE 1JVKA 4HIEB 3D39A 3D3VD 3HPLB 4NQTA 4KI1A 5I73B 1MRCL 2AKRB 2HJKA 4X6CE 5I1JL 2KZWA 1N5YH 3B9KC 5JORA 1CR9L 2Y36L 3ZKSD 2MNUA 4PJXB 2NR6C 1MREH 2APWA 5FK9A 1U3YA 4X4YA 1TVHA 2E6PA 3M1BA 5FA3A 2EEAA 2EYSB 3QI9C 3L3OB 3GBMH 3OF6D 1D5IL 3EYOA 3MYJA 2H3NA 4KPHL 4QF1A 4WNQA 1H5BC 1C5CL 4MJIB 5I66A 4XMKL 2OXGA 3PHSA 5DK0A 1CD0A 3QJHB 4WO4C 2WWKT 3QG7L 4NN6C 4AIOA 1FDLL 5EU6D 5EC2A 1N64H 5CSZB 4RGNC 1EV2E 4N1CA 5A2JH 3IU3B 4NQDB 1I8IA 2ZPKH 3TLRA 4HDIB 2D0HA 5A16B 4OSUH 5F21B 5CJOH 1AGDB 4WI9A 2XQYK 3CH8A 3LEVL 5EU5B 5M94B 2YD4A 2HG5B 3NZ8B 4F2MA 3WLWC 4MX7B 1JE6A 3CFBB 3VXPA 2VZ1A 3BQUC 5ANMA 1GGCL 3GSUA 4OAWA 1UJ3C 2AJYL 4LCCA 4P9MH 2A9NL 4I3SL 4LSTH 3PJSB 3S3SA 5JW4Q 2NTFB 1G6RL 1D9KB 2XG4A 1MWAA 2GY5A 3BEWA 4LPCA 3DVNB 5B39B 3SO3C 3AB0C 4KJWC 4NM4H 1BVKB 3DYPA 1BX2A 2ED7A 4N0FB 1T3FB 1F3DJ 5GS3A 3PWUA 4X4ME 1NANH 2XI9A 4G80B 3CFKA 3MV9B 3X13A 5F8QC 4PV8B 1NFKA 1WITA 2WP3T 1IKNC 5J6HA 1P7QA 1Q72L 2P45B 3BQUB 1J10A 3QUXA 4D9RE 3MLRH 15C8L 2UZYB 2UUDH 2CJUL 1MH5A 3TH2T 1PEZA 4I0PD 4EDWL 2CGRH 4C56A 1K2DB 2XYCA 4UV4L 4OZGE 3KYKH 3WJLA 3K80A 3FO9A 2H8PB 1UXWB 3IXAA 5EZOH 3KPPA 4UV7H 3PV6B 1A7BA 3FN9A 3QJHA 1KULA 4PRNB 2EDDA 4M00A 3QDMB 5LCVL 4N1HB 3GSVB 4MAUH 3U7AA 3P0VL 4M93B 1IMHC 4L8BB 2WIIA 3IFPB 2VLJB 4Y5YA 1S3KL 1HXYB 4LCYB 2HFEA 3ZKNC 1I8KA 1T20B 1NFDB 4N8VB 4NO2A 1NDGA 5DJ6B 1E4JA 5D9SA 1NUNB 1UT9A 5ID0B 3VGBA 3H0TB 2Y5EA 5ISZD 4KK5D 4S1SL 3G6AA 5E9DD 3ARBD 1KB5H 3TPUB 3UTZB 1A7NL 3FB5A 4YXKH 5IIEB 1KTRL 3CFBA 1X5YA 5LJYH 3WLBA 3D0LA 1XIWC 4WUUD 1BP3B 12E8L 1YQVH 5ANMB 4OD1H 1FGVH 1I4FA 2WINA 2HVJB 2NY7L 1X5LA 2PYFA 5F1KC 1MSPA 5EUOE 2J8UA 2FIRT 4LRNL 2NX5D 3I2CH 5H94A 4PJ5A 4QLRA 5ECJE 1GZQA 5DYOB 1T7YA 4ZFZB 3VD5A 5JUEL 5JW4N 3OB0K 4PD4J 4LNRB 4WHDA 5EO1B 3ULVF 3RWGA 3C6LC 4ONHA 5IWLA 4GO6B 4KRPC 4P5TA 2FCBA 4OFYA 4MA3B 3D0VA 2BRRH 1J5OL 3MV9A 5CP7B 3UO1L 4PV8A 5GGTH 4LQFH 4JKPL 2VISA 1QSFB 2VO5A 4L3EE 4S1RL 5IR1A 3TZVD 1IT9L 2BVPB 2I5YH 4YLQT 2YD3A 4NFDA 1CXEA 4ZDHB 2XTLA 1VACA 2VWEE 5GHWH 2JELH 1XGQA 1QSEE 1ZOXA 4NCC2 4GAJL 4QXGL 2GT9B 1J0YA 1JN6B 3BDBA 1JZ5A 32C2B 4RIRA 5GRWA 4G9DA 2VZTA 5BRZE 1D5ZA 2NY4B 4FG6C 5IROC 1J0HA 1QFHA 2FH8A 2FJHA 5CHNB 5F1SA 2VNCA 4NZTH 4ZO9A 3E6FB 4OFVA 3HHRB 2Z31C 4Z7WB 1FO0A 1T03L 2IBZY 2W1NA 3OJMB 3QIUA 5ESQA 2HWZH 4J12A 2BVTA 3T0WA 4APQD 1I8KB 1T20A 3MRHA 2ZKHH 4KPHH 4K94H 5C0AB 1IGYB 5EU6E 4QTIH 5ID0A 1QLFB 4Z78B 3CD4A 3H3BC 1I7UB 3RWFA 5FYJE 1EUUA 2RIKA 2YMXL 1A7PH 3F58H 3EW3B 4BSVB 1JFQL 2P43B 3TO4B 3P9WB 3SGJC 3TBWA 4MA1C 3L5IA 5M95B 4L4VB 1RJCA 3MXVH 3O2VL 2CLRA 1EEYA 5GGTA 3O4OC 5SWQA 4KTEL 1T80A 1XF5B 1S7UA 3WN5B 1A0QH 5IQ9B 2IMMA 3FRUA 5CLTA 1NGWA 1KJMA 4ODWA 2DLEA 5BZDA 4PJFE 4JZJB 2I24N 1FCCA 1E6JH 4HF5L 3RA7H 4YQXL 3VGEA 3GNML 2R2HB 4PR5B 1T1YA 3PUCA 2MCPH 1C5BH 1E4WH 5D7IE 2DQTH 4KMTH 3OR6B 3VH8B 3QQNA 2UWEE 4KFZC 3U2SA 5IQ7H 4X7TB 4XVSH 4EJ1C 2VISB 1NDMA 4JFFD 4IDJH 3V6BR 4QCIA 1Q9KA 4PRHB 1KLFA 1VFOA 3E8UH 5DQDL 5ELIA 5KJRL 5JQ6H 3G6DH 4QKXB 3H9HA 1P6FA 4K07A 3MRCB 4ZUSA 4QHLB 1A4KB 2ZJSH 3PWPA 4QRQA 4U3HA 3PGFL 4U6YA 4MJIE 5ADPH 5F93C 3E6HA 3QDMD 3RBSA 3UTQA 3SQOH 3IFLH 1XF3B 3BPLB 3RY6C 3TEUA 2ORBL 3AMKA 1S9KC 3QWOB 4RGOH 5E2VL 2XIDA 3TBYA 4U4BA 1R3IH 3EFDH 1KCUL 3W0WE 1W8NA 5CILH 4BFEA 4GAGL 4F3FA 2ICCA 2OZ4L 4WRLA 2AK4B 3V2AR 3QUMH 4NQDE 3WDJA 5H37H 6CGTA 5D71H 2B5IB 3S4SA 2WBJA 5L2KA 5FK9B 2NR6D 2X1QA 3C5SA 2JCCE 5IB4A 3SDXB 3LKPB 4G6ML 3CMOL 4WU7B 4XNUL 1RURH 2QQKL 3O9WC 1PX3A 4W81A 3B9KD 5BV7L 1FC2D 2HA1A 2AVGA 4GRLB 4CU6A 2IMNA 3DI2B 3S5LG 1VFBB 2X4RB 1YDPA 1OCWH 5T5NF 3KXFD 3P4MA 3K4AA 3LCYA 3TBWB 4P2YA 2N4IA 2EYTA 1B4RA 4Y5XB 2E6QA 5ADOH 3QDGA 3VGGA 1WISA 3TN0B 3REWA 2VQ1B 3RNKA 1S3KH 3FRUB 1KCRL 3T0EE 3IU3A 4NQDA 3MLUL 2P5EE 1FN4A 1R3LA 1DTUA 2E8ZA 5ERWA 3MFGB 5JHLH 2KDGA 3CK0L 1AR1C 4GW4B 4FFZL 5L0QB 2D3VA 2YUWA 3VH8A 5IHZA 3VXUE 4EOWL 4JPKH 1VFUA 1UENA 5GRYA 1NGXB 2YD5A 3M8OL 4JFXB 4CBPA 4RMSA 4F2MB 4HT1L 3NIGE 5DMGD 3TESA 2W0FB 4F7CA 3BDXA 4XNYL 4TVSa 4WI3A 1VEPA 4NN6B 4X6CF 2KQNA 1XT5A 3MCLL 5F3HB 2DQUH 4MNHB 3I2CL 2ILLA 1OM3H 3QAZB 3VFNB 4GMSH 1UB5A 1MPAL 3PJSA 5KW9L 5AYUH 1UM5L 3CUPA 1IFHL 3JXAA 1INQB 3RDTC 3WD5H 3FZUC 3QFJA 2J6EH 3MUY1 3TYFA 1LDPL 3MJ9H 5GGTL 1DE4B 4P2QB 4BQ6A 4I18A 5E2WH 4WDIA 4G80A 1WC7B 3QEQD 5E8DL 4P59H 4KUZL 2HKFL 3UBXG 1KBGL 4OZFH 5EH1A 5KS9E 4LAJH 5DRXB 3VXSA 2AJSH 1BQHB 5TDPB 4E5XA 2P49B 5ITFB 5DI8A 2YPKB 4Z7NE 3B3IA 3LN4A 1ZGLM 4NQCA 5J57B 5DJYA 3RTQD 3NCEB 2R29L 5AG9A 1MJ8L 1T83A 5E5RB 3BEVB 4M3JA 4ODSL 4X7CC 5B39G 3CFEB 4C58B 1URLA 2PN5A 3FFCD 4FQHB 1R5WA 1KF9B 5GGQL 1FNGB 2BMKB 3GI8H 3VFRB 4WI8A 4HLZG 1IC4L 2HFFA 1OTTD 2YD6A 2BNQA 2K7PA 2X4TB 3LPFA 1E6OL 4MNQD 2VAAA 3EGSA 1HSAB 5EG6C 4HH8A 1Y0LA 1BVLB 1TFHA 3AY4A 1TJIH 1CDJA 3KJ6H 2FX7L 1SBBA 3RIFK 4LPUA 2Y06H 2R69H 4LLMB 1T6WA 3U4BL 3FHQA 4J8RB 4GRWE 3MOBL 4JPIB 2ADJB 3K1KC 4JGMA 1RQ5A 3FRPG 4OD2B 2X10A 4PTTB 1AI1L 2EE9A 1QFWM 4Z7OE 2VXSH 4I5BB 4OGZA 3QZWG 1CI5A 4NM8H 4MA8L 2Y7QB 5HVHC 3RDTB 4WFGE 3QQ3B 5E4EC 4IIQA 1NCUA 2VDNH 5T1KA 1F3DH 1DQQB 1CFBA 3VI4E 3U48A 2ID5A 1EERB 4NQEA 4RDQG 4OM0L 3CCHB 5E08L 2B8OT 4KKAC 1E4WL 2P8MA 2AQ3A 3MLRL 2WWKO 3P9MA 3I9GH 4LHQB 4Z77B 4MS8D 4CN4A 4UQ2A 3GDBA 2HT2D 3VXNB 1OHQA 4KZEL 5L88H 4PRIB 3RJDA 1ZAGA 1QSVA 2DD8L 3PL6A 3X3GH 1EEUA 2DMCA 3EYSH 3N9GH 2BVOB 4XVSL 1P69B 2BSED 4A6YL 2C7UA 4BSWA 4O58L 2OM5A 3WEXA 2AKRA 3C09B 3HFML 3OAUH 4ONGH 1A47A 1I3GH 1FNEA 3MRQA 2PYEE 5DRXA 5T5FH 4F7PB 2HYMA 1BVZA 4PGBA 4ZNEA 2XZCH 4M6MH 1D6VH 2DBLH 4FQXA 3GSQB 3STZB 1MCNA 4HFWA 3DPBA 1CL7I 4DCQB 5FHAH 4P2RD 3EYOB 2GFBA 3IDGB 4RGOL 3KHOA 1NBVL 7CGTA 2V9RA 3CFCL 2XPGB 4GAFB 1EFXB 2BVEA 5FGSA 4P9HH 4NZDA 1BAFH 3UXFA 5J12B 4C57C 4L3CB 2PYEA 3LKSA 4M61A 2R2EA 3WS6A 3KPQB 3O0RH 4JG1L 3OKOB 1B9ZA 4JHZA 5CJ5A 5ESQB 3PGDA 5TH2A 2AK4D 2I60L 4KK9D 4X9GA 2VLKE 3L6FA 1DQDL 4L9LB 4JJ5A 1XR9A 3ZT5A 4B7IA 5AAMA 1MWAH 3LHPH 1OCWL 3NIDE 4CKVX 4J3TA 5HVHB 5F7EL 2E7MA 4LEOB 4PJFF 1DQJB 4OZHE 2GAZA 3EUUA 5J1AA 1QLEL 4LOUC 4JJHA 4HMCA 1K4DA 5IW1A 1S9XB 2EECA 1YMMB 3V79C 5TJWK 1CFTB 4MD4B 2Q6WB 4YHML 4NQXB 2FATL 3LN5B 2VH5L 3H6JA 3E2HC 4JN1H 4L4VA 1SBSH 4ZOCA 3MNZB 1NC4D 1C08B 5C2BH 3L3OA 1CK0H 3ILQC 3TNMB 4LPWA 5E8EB 4PRHD 1AGEA 2B7DT 4RMVA 3EDEA 2WUCL 3U4EB 4TSCH 5DHYA 2WBJD 4I3GA 4N9GA 3OQ3B 5D8JH 3H8NA 2ESVA 2ENSA 2JELL 3K3QA 1DJSA 3S96B 1V3LA 1R3JA 1WAAF 4K7PL 4ZPVA 5J8OA 4L5FL 1I7TB 3RUGA 5IOPB 2APVA 4JM4L 4HKJA 2FECI 3DROA 3IB4A 4YXHL 3PWNB 2X4QA 4LEXH 2OI9C 4PJ5D 4EBQL 4KK6C 4HQQL 4YGAB 1G9MH 2XXCB 3HB3C 3MRPA 5J3HC 3AU1B 3QUXB 2D0FA 5KW9H 4PRHA 4RFNC 2EDTA 4DK6A 4RFOH 5JPMB 4RGNB 5D7SL 4YHLL 5BMFH 4U1MB 4ZUSB 5EOTB 1A4KA 4DOHE 1OAZL 2DN7A 4DW2L 3VWJA 2ZKHL 4LIQH 4K94C 4N5ED 3BPNC 1N2RB 3QJFA 2Q7YA 2UY7A 3SJVD 1DEEA 4H26A 5D70H 4PRNA 2H32B 4Y4HC 4ACPA 3K8LA 2EDHA 4F3FB 3AREA 1Z3GL 3HZKA 2BOBB 1FDLH 1EAPB 1YMMD 1YY9D 2DKSA 1VADA 4H0HB 3I84A 3PGDB 5TFSH 3UPRB 5CLWA 5IB4B 1F4XH 1MNUH 1N6UA 1IC1A 3L6FB 3DX7A 1MI5D 4L9LA 4R0LA 4TPRH 4JJ5B 1FNSL 3RAJL 1HQ4A 4Y4HB 1TXKA 3VRIB 4O5LL 4KC3B 5K9JL 3N85H 5KVFL 2A73B 4D9QD 1YEIL 1RZKC 1QQDB 5FKAB 2R1XB 1KC5H 2MCPL 1UEYA 3JZ7A 2G2RA 4PJ9D 1CGYA 2CKBL 1I75A 3GIVB 4P3DA 5HGBA 4NN7B 3T0VA 3TJHC 1P7HL 3GIZH 4M9PA 1V5JA 5DUPL 3HMXL 3RPIB 4ZUVB 2VIRB 3QXTA 3GJFA 2OL3A 1RULL 4Z7VF 2OQJB 1WBYA 1MRFH 1WWWX 1WZ1L 5I6XB 4GG6B 2OTUA 3ZT6A 1A6AB 4ESKA 3U9UA 1FN4B 3C5JA 2ESVB 1UWGL 4EXPX 4YR6B 4Z95H 4JPVH 4JO3L 1P5VA 2H6PA 2X4SB 3O41B 4JPWH 1X6NA 4P5TB 3DVGB 2LE9A 1T7XA 3O2WL 1L4IA 5CBEB 5CP7A 5IFAL 4X99A 2I07A 4FP8L 5AG8A 2ZG2A 4P4KD 2X4OB 3EOTL 4LKXA 5IT2L 2R56H 4OLVL 1ZLUH 4OLUH 1IBGH 1RZGA 2W9LA 4Q74A 4PJAB 1H3PH 4J3UA 1I85C 3N1GC 2GSGB 4OM1L 4NNYA 2VE6A 3RPKA 4UT7L 1FE8H 4Q6IA 3MACH 4Q97A 1KYOJ 2EYRB 2IBZX 3WN5C 3T3MF 5IBTL 3O6FB 3G5VA 4BQBA 1GGBL 4HUUA 1MREL 2R0ZH 3D39B 3KNBB 2FJHB 1XAUA 3C5ZC 3HKFA 1J1XL 1V3MA 4NBYB 1I1AD 1I1FB 1CFQB 3PP3K 4LVOB 3V95A 4U3XA 1CDHA 4XVUC 4G9FD 1IJ9A 2PETA 4G3YH 5C09D 4JFPB 4F80A 3SKOA 4WGWB 3L3IB 5BCAA 2HTLD 4M7KH 1S9VB 1GL4B 3FRPA 2CKNA 2VDOL 5KZCB 2ESVE 3O4LD 1MQKH 1WT5A 5TDNB 3ARUA 1WTLA 5C0AA 3MJ9A 4JHBA 2MPAH 3ZKND 3L9RA 4P2OD 1B0GA 3C2AH 3M45A 4LLYA 4FXGB 2Y1VA 5TF0A 2HMID 4LP5A 1KEML 2RR3A 3RY4A 1QTYT 5LGHL 2BMKA 5F97E 5HBBA 4P3DB 4EOWH 4LLQB 5KVDH 1B2WH 4X5WA 2OJEA 4K3DH 2I9TB 4WHTB 5SWQB 4KDTC 4P23C 5FGBC 1CQKA 3QZWB 3D5OF 3GKWL 4K3EL 5DA4A 1XF2B 2GT9A 3VWKD 3ZKXC 5EUKA 1P2CB 1RUAL 4DGIH 2AJYH 4PJDB 4LLMA 5DK2A 1S78C 4I48B 1A5FH 3QQ4A 3RVUD 4LSQH 5EU5A 1KUMA 2DMBA 4AIXA 5IVXB 1BWWA 2XACC 1ZT1A 4X99B 4PTTA 1RUKH 2OJZH 4PJIB 3TFKC 2JCCA 3MV7E 4OGAC 2WANA 1MFNA 2Y7QA 3MXWL 5TPWH 5C86A 3GSUB 2YPLE 1CK0L 1U8KA 3EHBD 5SWZE 4PJCA 5FYJD 3VDAA 2VL5A 3WFEH 1PAMA 5GRZA 1JCKA 2NY3B 4HWBH 4LSPH 4NRZB 4OZFB 3KPSD 3IF1B 1ETZB 3MV7A 1IZJA 4P2QE 4QHLA 2L7UA 4PG2C 1NAML 4QXGH 4YWGL 3JWDC 4YFLF 3BUYB 1TJHH 1JGDB 3FB6A 3PWPE 5D6DC 3QEHA 3MLSL 4TTDC 3KNBA 1S5IH 3OHXB 2PTUA 1EEYB 4U33A 3SGKA 1FNEB 5I1AA 4R2GB 3THMH 1JWUA 5DLML 3RVVD 4JZJA 1N4XH 4HLJA 4NKOA 5T33H 3SDXA 1SY6L 5CJXC 5D5ME 4PJXF 1HIML 4O2FA 2GK0A 2D0GA 4P46A 3T8XA 1A6PA 4LLYB 4ONOA 4XP5L 4OQ1A 1AHWC 4XP1L 4EUPA 4ZSOA 4D0DB 1NMBL 2ADFH 3K4ZA 4MQXD 1BFVL 3V6ZB 3CU7A 4NQUA 5ENWB 3QDMA 1INEH 2G9HB 4WWID 4HS3A 2VQ1A 3LD8C 3MBEC 3EZJB 5D7JC 4J6RH 4NM8L 5GS0H 1XF2A 3L1OH 3MRCA 1U36A 1C5DA 4H5SA 4L4TD 4WWKA 4ODVH 1FPTL 5KVFH 4HCRA 4HKZB 3ROOB 4I48A 5E8NA 1EGJL 1NGXA 1NSNL 1DQJA 2NYYC 2DAVA 4XGZA 4FTVE 3S35L 4W6YB 2J8OA 3ALPA 4FN0A 2OK0L 4LARH 1I4FB 1U8KB 1I3VA 4PJCB 1ZLSL 2Z92A 4NJ9L 1C08A 1CD1B 2NXZC 2YRZA 4OZFA 1UWGH 4LQFL 3VFSA 3EIFA 4FFYL 1Q8MA 5DHYB 5DMIH 1M6OA 3VXSE 2WBKA 4GMTH 5EO1A 1B3JA 2DJ4A 4MQXC 3N1QC 3JV4B 4AENA 4I18B 4MA3A 4R4ND 2IBBA 5CCKL 1V3JA 3OHXA 2DDQH 1YNKL 3T09A 2VJXA 4RDQF 2L0DA 1BOYA 4U6XA 1FBIH 3HNVL 2Y25A 4AMKH 3GMNA 5JPMA 2FHBA 1XR8A 4JO2H 2IAMB 3F7VB 5D71L 1JIBA 3P30H 5DJYB 5ACMA 1UQSA 3NIFF 5IMMB 2DWDB 3NAAH 1ORSB 3BEVA 4GQ9H 4I4WB 1PZ5A 2CH8A 4RIRB 4NKMB 4R90L 2DQEH 4CVUA 4G9DB 1JZ2A 1I9JH 4R97B 3BHBA 2NY3D 1F90H 5IHBA 1KIQA 3BGMB 4ODHL 2UZXB 1G1CA 1X4ZA 2Z35B 5I8CB 1TIUA 4N0YL 1HH6A 4NUGH 4R4FH 4MGXA 1NL0L 4NJAL 5I15H 2P46B 1JF1B 4GKSB 4UIMA 3ZZ1A 3MR9A 4MWFA 1MEXL 1P9MA 2C1PB 3OG6B 5FKPB 3TA3B 4EXKA 1FIGH 1KCRH 1QFUL 4LL9A 3ALWA 3C8KB 3MA9H 3GJEA 4MA7L 1RFDL 2K7QA 2ADJA 3U7YH 1Q0YL 4KK6D 4HBCL 2KBGA 3IKKA 3WKNA 1ZHLA 2ARWA 4PJXA 5IB3A 4G8EA 2EZ0D 4UZGA 3HC4H 1H3UA 4ZUVA 2H45A 5T1DH 1ZLWK 1N26A 3CPLB 1WBYB 3CCHA 4G6FD 4KWUA 1KJMB 5BZDB 2VKWA 1MCCA 3P9MB 3P2TA 4Z77A 3NCMA 3CFEA 3HZYB 4Z8FL 1R5IB 1S7SA 2IGFL 3C2SA 4X0KA 4RRPA 5J1SC 5I73C 5D1XA 3VD9A 4AENB 3A67L 3V0WH 3R1GL 2PCPA 3GHBL 2EH7H 2FX9L 4G6KH 3MMEB 5TF1H 5FGRA 1YYMH 3CNKA 3HE7C 3ARVA 4R2GC 2C4FU 3OGCB 5E7BA 3TT1L 5E8DH 1NUDA 3DX6A 4ZO7A 3FQXA 1GAFH 4FQXB 3STZA 3RU8L 4E9LA 4Y4FA 4V1DB 4AQOA 3LS4L 1T83C 2OMBA 3DBXB 3OTTA 3D18A 2D7PA 1J1PH 1SM3H 3RGVA 1I1AC 3QIBB 4QRPB 4DQOH 1PD6A 4PUBH 3G5VB 4JHWH 3VXPB 4C4KO 2XWBB 4NZUH 5DJ8A 3B9KA 3KVQA 5IVXE 2C26A 4HIHB 2RAMA 4OTXH 2AJUL 1TJGH 1IEAA 2EXYC 1DBAH 3FQRB 4OF7A 3FFCE 1HK6A 2E9WA 5C6WH 5E4EB 1G9NC 1I3UA 3IDUA 4YHOL 3L3IA 5DURB 4LIQE 1BVKA 4KVCH 3H42L 4QNPF 3JSSA 5SV4A 3WO3B 4H8WC 4KRMB 4K8RH 2VXQL 3FO1B 5TDNA 1BX2B 2DOCA 4WCYH 1HHIB 4MQTB 4NQCD 3OGOE 1B0GB 1GZPB 4XAKE 1U3HA 5J1AB 2Q1EA 3U4BH 3AM8C 4HUWB 1C16A 4NN5C 2GITB 4JPVL 3HAEB 2E7HA 3ZE0E 5C2UB 1Y18A 2VLJE 1YMMA 3BQUA 3C60C 1CCZA 1P5UA 3RWEA 1A7QH 2D7TL 3IYLW 4F7PA 3L1OL 1OTSD 1UWEH 4PJGA 1QR1B 3VD4A 2P24B 3T2NL 2ZUYA 5E00B 4C56B 5E8EA 2ZOLA 3KYAA 3VXQB 3MPCA 2V17L 5HVWA 5CD5D 2XT1B 3WFHA 3MRMA 3PP4L 4PJDA 1NLBL 4OM1H 1EFXA 3WLWD 1MVUB 2J7LA 1S5HB 3ARDD 3O3DB 1LWRA 1OPGH 3WFDH 2MQCA 4K3GA 4HKJB 2J3SA 1G9NH 2QSVA 1U9KA 3A6BH 2X4QB 2PYEB 4M61B 4QXWA 5HHNB 1L7IH 3MLWH 4JQIL 4Z7NF 1E28A 3OGCA 5F3HA 1OGAA 4TOYL 3IFPA 2FSEA 1AY1L 3JUYA 2EDLA 1KV3A 3B9AA 5DJCB 4NBZB 2R8SL 1NFDA 4FQ2L 5C0GB 4GMTL 1ZVHA 1CWVA 2W91A 5HDLA 3SKMB 4V1DA 1YN7B 4LBEA 2YRPA 4QGYA 1QSEA 1OAUH 3TPUA 2F15A 3CZJA 3QFJB 2F53B 4UILL 1MQKL 2P8LA 4GT7A 2DQDH 4IJ3B 4HPOH 2AXGA 3QG7H 2F54B 4R4NC 4MD4A 2Q6WA 2CDFA 1IM3A 4PREB 4Z7VE 3SGEI 3QCTL 1F6AB 1W72L 4JZNA 4PJXE 2H32A 3FKUS 3P4LA 2IG2L 1P4LA 4K9EL 3BD4A 3HNVH 1CTNA 1OAXL 4JO2L 4PJ5B 4X6BB 5GGQH 1AD0A 4LCUB 1VADB 4GG6E 3FQWB 3O0RL 2J8UE 2ZCLL 3D85D 4HV8B 4XBEL 2VR4A 3Q3GA 3TV3L 2D9QB 4KJYA 3ARBA 4UNUA 2YPLA 4XRCB 3D2UB 4U7MA 5FYKH 4KK9C 3ARGC 5IJKA 4YC2C 5D2LE 5KN5A 5LAXA 1NGZA 1BQSA 5FYLL 3CDGB 1QR1A 2NY1D 3KYOB 3HI1B 3QHFL 1Q94B 1X9QA 4NJAH 3B43A 1V05A 1VACB 1ZGLP 5EU6B 3MGAA 5F7KC 1DEDA 5HD8C 1LD9A 1U8JB 2OQJA 4P2OA 5B4MD 2GW5A 4OD3L 1OAQH 4JFED 2B1HL 5EOCH 3TJEL 1R24B 4ELMB 3VXMB 1A6AA 2APXA 2XWTA 3SE4A 1BVLA 1CFNB 3C5JB 1NCBH 1GJIA 2GYSA 3RZWA 4LCIL 5EUOB 3O41A 1MCIA 1N2RA 4L4VE 4TSBH 3JWDL 4OQTL 3V6OE 3UTPD 1DQML 3IDMA 1OP3H 5D1ZC 1Q9OA 3IFNH 3UJIH 3K74B 2AJXH 1JNHB 2DM2A 2DD8H 3SDAA 3X3GL 1T7VA 1EAPA 5FYKD 1S5IL 1RVFL 1SJXA 4I13B 5I76A 1RZGB 2P48B 4GXUN 1S7VB 4R0LB 1WSST 3BN9C 1J0KA 3EZ8A 1FH5L 2QR0A 3CVHL 3CC5B 4Q6IB 5T3XH 5T33L 1CE1L 4M6NH 4N0UB 3GSRA 3R1GH 2BRRL 2P8LB 1F58L 4IOFC 3D69A 2P5ED 2C3WA 3TO4A 5F7YC 1MIML 1D6VL 2DBLL 2XNAB 4U1NB 1F4WL 5D2NA 1AIFB 5MENE 4JAMB 5DC0A 3LEYL 1IQDA 4JM2A 3MRQB 5K9OB 5ALCL 3VMOA 3WUWG 4GG6A 2ZUUA 2OTUB 4PJDF 4U1LA 1LO3L 1KTLB 2AV1A 1XR8B 4QRPD 2VC2H 3F7PC 4HV8A 4WUUB 2X4SA 5EPMA 2DWDA 5DJ0A 1CXKA 4I4WA 2VN4A 3TA3D 5I1IL 1LILA 2CQVA 1KCKA 2DF3A 3QEGH 2BZDA 2JJWA 4L8CB 4WFED 2BVQB 3AXLA 1A4JA 5GRUL 2JK5A 1NCWL 3U9PH 1AGFA 1MHPL 3QUMA 1IGML 4PJ8C 2OJEB 1A22B 3LKSB 3ARZA 2WW8A 5HHXL 1NFDE 2OLDA 4Y2DB 4KKAD 3OKOA 1SJHB 2JIXD 3WKMH 3QPXH 2VXQH 3RHWF 1NKOA 1M4KA 3UJJH 4OFDA 4FXLA 1NEZG 1KELH 4OF5A 3CH1A 1B88A 1W72A 4ZAKA 3T4YB 4XPFH 2HFGH 2B2XL 1NCTA 1JGVL 3QWOA 4WJ5A 3MNVB 3NPSC 3HG1D 4CMMA 3NCJH 3MRKA 2NY0C 2X7LB 3I6LE 4JVUA 3SKNA 1ZT1B 2ZNWA 1CFQA 3BKCH 5IW1B 1S9XA 5MENB 1C1EL 1OTUC 4KQ4H 1A7RL 5KSUB 1P84K 2JTDA 3ILPB 3SDAB 2E7LA 3FJTA 3MNZA 4U1HA 4KHTL 4XZUA 3V7AG 3MRBA 3MX0A 3V5HA 2H2SD 3BIAX 4JM4H 5CGYD 5HHMD 2FEEI 4C56D 1KN2L 1IBGL 2YD2A 4DAGL 1YEDA 4HQQH 3KPRE 2NX5E 1R5IA 4D0BB 4KHXH 3IKCB 1JNNL 2GJ6D 4RISL 3D48R 3F5WB 4JFZL 4Y88A 3TN0A 1EEZB 5C0CD 5JLZA 3NPZB 4JAMA 2AK1L 1I8MA 1NH6A 2FWOA 4H1LH 3ULVD 1JWMB 1KJ3H 4WO4A 3G6DL 3VE0B 2EICA 3FN3A 4K94L 4HUXB 5MHSD 2ZJSL 1WCQA 3ZDXE 1IEHA 4XPGL 5B21A 5EOTA 5J56B 3HMWH 4NKDB 2DQDL 4HGMA 4JQVC 2VXUH 4MMXC 4QXUL 3D18B 5IVXA 4MAYD 3O11B 4DKAA 4U2YA 4YHKL 4RMWA 4ZSOB 3IS1X 1W72H 2JCCB 3SDXE 5GZOC 3B5TA 2BHYA 3OJVC 2JK5B 3NH7L 1MRDL 1DQTA 1SYVB 5HI4D 4N0RA 1T5XB 4X8XA 1G7HA 1Q0YH 3LB6C 2YUVA 4PY8I 1IEAB 4JEGB 1LP9A 3I75A 3MV7B 5L2KD 3HR5A 3SDCC 1XGRA 4WWKB 3IU4L 2BRQA 1ZLWH 3WNOA 2OTPA 1S7RA 3LIZL 3LDBC 1EFQA 4LRNH 5I18L 2UZIL 1N5AA 1YMME 1RULH 3NN8A 2A73A 5DFTA 5DMGC 2HJKB 4UMGA 1S7WA 1WC7A 2UUDK 5DD1L 1G7MB 3MUGB 5JORB 1XH3A 4DKEL 5KS9F 3HPJB 4JY6A 5E6IB 3GMRA 3NFNB 2CR3A 3HI5L 3VXSB 4ZD3L 3X11A 3W5NA 3WIIL 1HOCA 3VG0H 5KJRH 5FA3B 4G8IA 1FSKC 1ZANH 4NNPH 3OMZA 5B4MC 3UC0H 3IFLL 4HWBL 4PG2A 4WNQB 3E3QE 1N8ZB 2C1OA 3PQYD 3WS6C 2R56L 3H7BB 3IKCA 2L4OA 1SVZA 3EYFA 3WS3A 2HFFB 2BNQB 4PG9A 3ZTJH 2MHAB 4PBWD 1A6VH 2VAAB 4UT7H 3EGSB 1EEZA 4JO4H 4MD5A 2XWJA 4LHUG 2DQGL 4GMSL 35C8L 1L0YA 4OKDA 2JE8A 1BFTA 4KJQC 5DQ9B 1YEEL 1OGAB 3DETD 1DFBL 1JGLH 4PGDA 4PRIE 1RUPH 3Q0HA 2G75A 1EJOL 4HJJH 4ZFOL 2DQIH 1F8TH 2BK8A 2CIKA 4W6WB 3PG2A 3TZVC 3BRDA 1CFVL 2ATKB 1RIVH 4RMUA 3ROOA 2VXTL 4F7TB 3DXAD 1RZ8A 5HHMB 2NY2B 2F53A 4ZXBA 3LMJH 3RQ3A 4KRPD 1JHKH 1GRWA 5IJVB 4DOHB 2HT3C 5GXBB 4N0CC 2FB4H 4V2BA 1ORQA 4PLJD 4Y5VC 5MHSE 3C5ZD 4IIQB 3UTTE 1LP9E 1G7HB 1T66D 4QRSA 2Z35A 1RD6A 1HH6B 4ELKB 2XRAH 4BYHA 1HKFA 4HMEA 5HTSA 4GKSA 4UIMB 4K7FB 4NNXA 5C09B 3VFSB 1AFVL 4X6BA 3BEWB 4JFPA 1MELA 3UAJD 1BJ1H 1HHJA 4X6FB 1Q0XH 1UZ6F 2HH0L 3UBXI 4PJ9A 5KSAC 4KJYB 1U8HA 2HJLA 4HIJB 2AK4E 4K3DL 3D2UA 4HKBA 4YNYA 2P5WE 3DWTA 5CJOL 3DUSA 2H26A 4FTVB 5LAXB 3WEXB 2VLKA 3GNMH 1KJ2L 1UH4A 2QSQA 1GPOL 2FECL 3LEVH 1EGJH 4YEFA 5HYSG 4PJFA 4YHPA 5GGVL 4C56E 1IGFL 1ZHLB 4YHZH 3OZ9H 1T6VN 3CAFA 1N6QH 2A9MH 3GGWA 1MFEH 2AABH 3KHQA 3GHEL 3VWJC 2X2YA 3DI3B 1MH5B 3D39D 5F7DB 1UQSB 1SHMA 1UZ6E 1R24A 3LH2L 3MLVH 5CEZL 4UIKL 1DBKL 4M5YH 2JKXA 1ZLUK 3HS0B 1CFNA 3IDGA 5TE7L 2NXYD 1MFBH 4WEBL 3P40A 1N8ZA 1YEGL 2C1OB 1MCRA 4GRLD 1YEHH 3H7BA 1I1RA 3N0PB 1W0WB 3QFJD 3WFEL 4YX2H 5EULV 4LNVA 3BGMA 4OCSL 1J0ZA 1ZHKB 1KTKE 1A7RH 4JHAL 3KXFB 4GXUM 4PJIA 4CN1A 1S8DA 2VDNL 2VDKH 3BWAB 3EDKA 4L8BA 4Y16B 4PGDB 5TGBB 4NOFA 2EIDA 5LGJB 3MROA 4YHIB 2G75B 1T04B 3X12A 1QBBA 4KQ3L 1XR9B 4K71B 2Z31A 2ATKA 5I1JH 5D7IF 5DMKA 4I77H 3KPMA 1R3HA 3MUZ1 4MSWA 3O6FC 3GEWB 5BRZA 4RWYL 1OSPH 2R1YA 3V52L 5ICXA 3D0LB 1DLHB 3FB6B 2WIMA 3QEHB 3DVIA 4NQXA 4HIHA 3Q1SL 4G8EB 1BZ7A 3MGTA 1MF2L 1VGEH 2PYFB 3ZHLA 4RFNB 2D4FA 4P4RB 4JM2B 3G9VA 5I1AB 1R6VA 3TNMA 4GBXC 4P2CG 4EDXB 2P47B 3LB6D 4WI6A 3U4EA 3MREB 4JVPA 3QCVH 5ADOL 3RKDD 2Y06L 5FM5O 3FB8A 2AV1B 5IBUB 3VWJD 3P11H 2XY1A 1S7SB 3D25A 3MV8E 3OR7A 3RWGB 1HHIA 4NKIL 1J8KA 4G43A 2GK0B 5D1XB 1RMFH 3QHTC 3T8XB 2E5EA 5SWSE 2EDJA 5FV2A 4EUPB 5IB1A 3RRQA 2GITA 3DLQR 2BVQA 4HULB 1KLUA 2BVPA 1AO7A 1TCRB 3MV01 5DD5H 4YO0A 3QUMB 2BERA 3NMEA 3GGWB 3O2DA 3OB0H 1B90A 1A7OL 1DSFL 7FABL 2I9LA 4JR9H 2R4SH 2ZOLB 4U1GB 4Y4FB 1C5DB 3SBWA 1LEIB 3GSWB 3UYRL 5KVGL 4UT6H 3MRMB 3FCTB 1CGUA 3PNWA 4HCRL 2XWBA 4ZS6C 1QLEH 1XF1A 3KJ4C 1X5GA 2Q7YB 1U42A 1MVUA 4Y16C 5D1XC 2VN7A 3MQIA 5T1LB 3S35X 5F70A 3SE3C 3O9WB 1YEFH 4RX4A 3AREB 2P7TA 1S8DB 2VDRH 2GUOB 4M93C 43C9A 5KSUA 3HZKB 5E2WL 2BOBA 2JJUA 4UTAL 5LBSL 2CIIB 5GRVL 2V9TA 5C0GA 5T3ZH 5D8JL 5A40E 1QLFA 5F7MC 1MCQA 2KPNA 2HP4A 1M6OB 3FAWA 5D7LA 3RWFB 1YZZA 3UJTL 4HUWA 2HRLA 4MXVF 3RWCB 3QIUC 5GGVY 3I3EA 3HUJE 1T1WA 5DMYA 3QT2A 1DLHA 3FAXA 4YBQD 2VZOA 5KBNC 1FNLA 4X5LA 1UM4H 1YN6B 3VFOB 5I1IH 3FFDA 3F5WA 1T5WA 4UV4H 4ZUWB 1TZGH 3RPIA 4QOKB 5C0JB 3UROR 3QUXC 1A14L 1KPUB 1QRNE 5E00A 1P4BL 3BKJL 3BSZH 4LU5H 2APFA 2NY6D 3ARFC 4M7ZB 3O2DH 3VXUD 1ODAA 1MAML 1F90L 3VFVA 2H6PB 1OGAD 4PJIF 5EU7C 4JZOB 5F3BB 3NVQA 5CBEA 4LDLB 1U8LB 3NA9L 4Z0XA 3QDGE 4I0KA 3RVXC 2XXMB 2ICWJ 1NDMB 3HI1A 3HC3H 4YE4H 1AO7B 2Q3AA 4QCIB 3ARXA 3G04A 3L5XL 2EE3A 1N0LA 3PE9A 4PLNC 3B9DA 1X5ZA 3PDDA 4E0RB 3BZ4A 2I9LB 3F65A 3MXVL 3O2VH 4OB5H 2AEQH 3MR9B 4HFUL 3GSWA 5FECA 3MLPA 4KHTH 5GIRB 1JHLH 1PZUB 1S7RB 5EO0A 5EIQA 4XWOC 2NW2A 1NFIA 3ORJA 5H37G 5T1DL 3UX9B 3I9GL 4X6DF 1K3IA 3FOMA 4JZNB 5EO9A 2F53D 2G60L 1G7MA 2EDOA 1Q9OB 1MFEL 1U3HD 4FFWC 1AQKL 5FA4B 3W0WD 2FHCA 3QIWD 1JNHA 1MVFA 4Y5YC 5E9DB 2WBJB 3SKOB 5DC4B 3LH2H 3K7UA 3MLVL 3QPQD 5J0BA 2IAMC 4YPGA 1CL7L 1P4IL 5F7LB 4ODBD 3SDDB 3GHBH 4WEBH 2FR4B 2R0WH 4D3CL 2VLJD 4JKPH 3L9RB 3QFJE 4WUKH 3K2MC 4RCAA 3CXHJ 1IT9H 2XTJC 5DJAB 1G0DA 3OKLB 5BJTA 1YDPB 5K9KA 1ZVSB 1M71B 5D70L 4HJGB 5SWZB 4OZHB 1AXTL 3RI5K 1K8DA 4PYHA 3CXHK 1CLOH 5EBLA 5D2NB 3MMEA 4MD5B 3U82B 4FZ8L 4G6FB 3RNKB 1VFAA 2YS4A 4GBXB 5FXCH 1ZWIA 3AGVA 4I2XA 3QNXB 1UZ8B 3TA3C 4YDIH 1EVUA 5EUKB 2YD9A 1JI1A 3VFVB 3MRGB 1VA9A 4GW4A 1QBAA 3V5DB 4GKNB 3NBNA 5MP6H 5EZIH 2P5WD 4Q7DA 3QQ4B 5ILTH 3TV3H 1QHPA 4YDJB 4DUVA 4XNZC 5L8LB 4PRPB 5SX5H 1JK8A 4L8CA 1FL6A 5J6GA 3B9KB 4M6OL 2H9GB 4IEFB 4NC1C 1HXMB 4X80L 4XPBL 1TQCB 2W60A 2VL5B 2W65B 5KOVC 4CRPA 4ELKA 3S8WA 5JO5A 5GGSA 4NRZA 4I2XE 5AD0B 3KLDA 5DJZA 1LMKA 3T2PA 1EPFA 5E56A 1PQZB 1JTPA 3GSRB 3VDBA 1ZTXL 3GUTA 3FO1A 1CLYH 3SOBL 2R4RH 5LGHH 4M43L 4MCYB 1GZPA 5I1GL 4CMMB 4U1NA 3EJZD 3GBNL 3B5GA 5K9QI 4EEEA 2NW3A 5L9DL 4K7PH 4IRSA 4X7SL 5HHVH 3SKUD 5D2LF 4X98A 4XI5C 3SDAC 2W92A 4YXHH 1TVHB 3MZGB 3U36A 3MRBB 3EAKA 2CK2A 4OCXH 1U8QA 1FO0L 5D1QD 4LGRB 5DEFA 5F7WC 4ZFGL 1AR1D 1G9ML 5DJ0B 4HCRH 2C5DC 1YEDB 3IJYB 3WFHB 4FQHA 3BMWA 3B9EA 5K9KB 4TOYH 5I66B 1TTGA 4G5ZH 2AXFB 4JREC 1RUKL 2OJZL 4OZHA 1DVFA 2AV7B 4IM8A 5CD5C 3DURB 1ZHKA 4BM7A 4GRWB 1EEQA 5ENWA 5EBLB 2OBGA 1AKJD 3MJ9L 3KXFA 2D03L 5JLZB 2DLHA 5EU3A 2LVCA 1RUQH 3QCUH 4ZYKB 4F9PC 3BWAA 2K3TA 1QEWA 1Y0LB 4B7LA 4WO4B 4JREB 4MB5A 2YZ8A 1T7WA 2R39A 3CH1B 5I74B 1X5IA 3EYUH 3T4YA 3ZYIA 2Y07H 3UYOD 1IVLA 2PUQT 3MNVA 4B50A 3U7WL 1DN2A 4WENB 4YZFE 5FCUH 1TPXB 5EZLA 3NZ8A 2ERJC 1JPFA 4HZAA 1FL6B 5J6GB 4OGXL 3W2DH 2HN7B 4H1LA 1KJVB 1TCMA 2F19L 4PJBF 4XH2A 1RURL 1U41A 3ZL4L 4LCCB 4XX1E 4LLWA 4FMKA 4WUUE 1DQQA 3ILQD 5DVOA 1P53A 1MHPH 5FGCB 4DTGH 1QYGH 1ZA3A 1U0QA 4UBDD 5H2BA 2XA3A 3HR5B 3OAZK 4FQ1L 4LCUA 1KGCD 5HD8D 4UQ2B 3VXNA 3GK8L 3WIFB 3RVTD 4D0BA 1NAMB 3HE7A 3TP4A 5E95B 4JCLA 4ZNCD 3KPSE 3MLYL 4N0CD 3HC3L 1GC1C 2AEIT 5C0ND 2FEDD 3HNSH 5HYSA 5MEND 2BFVH 2AJVH 3LKNB 3ZE0F 5IG7A 5J6HB 3HPJA 5C07E 3IAQA 5TE4L 5J89A 3X11B 3MV7D 4YFDB 1VCAA 1IGTA 1QD0A 3H9SA 3JWDH 4ODVL 1IAIL 4P2OB 4CAGA 3HE7D 3V6OA 2GJ6E 3QEQA 2XWTB 4ODTH 4E42B 3VGDA 2O5XL 2A1WL 3IDXL 4TNVK 4YWGH 1CF8L 3FO9B 5IB2A 4K2UH 4KQ3H 3KPPB 5ETUB 2KH2B 2W9EL 2EDKA 4GJTB 3OJDA 2B39A 2F5AH 3IDMB 4M5ZL 4L3CA 2AQ1A 3C60D 4S11A 3BGFC 4AG4H 4C59B 1LP9B 2DB8A 3KPQA 5L6YL 1ZT4B 3UTPE 3I75B 2AEPH 3QIWB 1CN4A 3O6FD 5J13C 1HXYA 4WTXA 2CIIA 3TF7C 5GS0D 1YY9C 4QOKE 5DJ6A 1TTUA 5D9SB 3W11C 3C8KA 2CMRL 5C6TH 4LEOA 3SDYH 1I3RB 4POYA 4IRZH 1KIRA 4N0UA 1OAKH 5CEXA 3MUGA 5FHAL 1XH3B 1AO7E 3VW3L 5C09E 1XGPA 4NKIH 3LKOB 5AWNL 2VC2L 4YHKH 5I2IA 2X1OA 5IB3B 3CFCH 1IM9A 4JRWA 1KEMH 2VDLH 4QOKA 5C0JA 1K8IB 4OLWL 1TITA 4R7DA 2B4CH 5HHOA 5A2LH 2J8UB 2P5WB 5H2BB 4KUCF 4M7JL 1J1OL 3L5WA 3NACL 3HZYA 5GRUH 1BZ9A 3FT2A 4RX4D 4XP4H 5D6CB 2X41A 4P46C 5EPMB 1U6AL 1NSNH 2QSTA 2EEBA 4PBXA 4HKBB 3RFZC 1FYTE 2VXVL 3DROB 3BT2L 3QPXL 4LVOC 1OP3K 4MB4A 2OK0H 1KN4H 4P2QD 5D2LB 1PYWA 5DGRA 2MJWA 4QT5A 1TETL 2Q8AH 5C8JB 1X3DA 4JRXB 3MRLB 1XIWA 1IGTB 3S37L 2PTVA 1P9MC 2FATH 4EVNB 2FD6L 4AH2A 3DO3A 5DD3H 1WQVT 1A1OB 1SBSL 2B1AL 1JN6A 4U1MA 3TVMC 3O4OB 2R4RL 4GG8A 3HTLX 1KFAL 4P9HC 4AQ1B 3ETBF 3Q48A 1XZ0A 2ZUXA 4KDWA 4UQ3A 4H26B 1ZK9A 5GS1C 3AC0A 1AC6A 2PO6C 3OKMA 5LWYH 4XXCA 4LLUB 1OGTA 2VUOA 1ZT4A 4XPTH 4XCCH 1QPXA 5E9DA 4LEXL 4NIKB 3D3VE 4U1HB 1YYLH 4PJ7F 3UPRA 4YHIA 4DWHA 3V5HB 1YEEH 4HC1L 2C9AA 4U1SB 1HQ4B 1BQHG 2Z31B 4Y4HA 3QWQB 4ONGL 5EU7E 5MI0C 3BMVA 2XOTA 4MSWB 3S5LB 1I7UA 5DJAA 4XNQB 1QQDA 2VXTH 1C16B 3TT3H 3FQNA 5EBGA 1I8LA 1QACA 1WT5C 4XWOD 2GEEA 3LQZA 3LKOA 2HJFA 2DJUA 5LCVH 4XP5H 4Q6YA 3E0GA 1IM9B 4OI8A 4M4RA 1QBLL 3F7RA 3QIBD 4M8VA 4KTDH 3LAFA 5IVNA 5DO2D 5CGMA 1G7JA 4TSAL 1ZWIB 1BFVH 5D7LD 4EDXA 1UM6L 4YAQA 1JWMA 4RA3A 4M02A 3H9SE 4Y4FC 1JRHL 3ABZA 4HUXA 4P9HL 4J1UA 3U7WH 4YR6A 4XPHH 5D6CA 3OR7B 3GSNL 3I6GB 1SM3L 1N64L 1MAJA 1E0OB 1XCQA 5EC1A 1EJ6A 2R9HD 4JHWL 1I9RH 5CZXC 1VESA 3U2SB 4TPRL 4OGXH 3W2DL 4OV5A 4XAWH 4OIIH 3JBG7 1JWSA 4NCDA 3FT4B 3H9YA 1DP0A 3T08A 1S78D 3ARTA 3BE1H 4UOJA 4WW2B 3FTGB 5B3NA 1BM3L 1T04A 2G60H 1XEDA 2Q86A 3K46A 2QSCL 4RFEA 4NNYB 3OSKA 5HVFB 1R3HB 2XFXB 5TQ0L 2MFNA 3SDCD 3O3BB 1QSEB 4PYGA 1UJTA 3REVB 4YHMH 1EFXD 3GUTB 1D5XA 1J86A 4MCYA 1YEGH 5C2BL 4U0RC 1IM3B 1Q9LA 1GYAA 3D2UD 3TBYB 2DMKA 2I26N 5IVOA 4JPWL 2QADD 2I5YL 3Q5YA 3VMPA 3BQUD 4WFHD 3BGAA 5E6IA 5F7HA 1HWHB 3NFNA 1FP5A 5AZEL 3PXJA 4I18C 4KGLA 3JTTB 4I0CC 1JTTA 4YIQA 3FQWA 4L5FH 3D25B 3SEPA 4WU7A 2NX5B 1SMOA 1U8QB 3Q3GB 4XP9L 1JMXA 3ARBB 4U1SA 5CJBA 5E8PA 4YBLC 3C08H 4J3SA 1RU9L 4GS7B 4PJ8A 2DQGH 3S5LA 4IOIA 4S1DD 3IJYA 4RGND 5IB1B 3MA7A 3FQNB 1YEJH 4P5MA 4TRPL 5DRWA 3MACL 4Y4KC 4H20L 2BXYA 4ORGA 4LLQA 4ELMF 4WWKC 3VFOA 4RQQA 5ILTL 4PG9B 2MHAA 5EU6A 2I9TA 1WIPA 5FHBH 2IWGA 4NRYB 5EU3B 2XWJB 1ZKAA 5C3TA 5D93B 3HA0A 4LVNC 1FZJA 1IC7L 4XCNB 1QEWB 4FQ2H 4XHJC 1MJ7L 3R0NA 1A1MA 3P0YL 4K23L 4PB9H 3UYPA 3QUKB 4HUNB 2DKMA 2JB6A 3U0WL 5FOJA 3MJGX 4QHKJ 2VL4A 4NYLA 2J6EA 2F5BH 1ITCA 2JF1A 1RI8A 4KKNA 1U8LA 4GKZA 3O9WA 4ZXBB 2ATPB 3S88H 3NABL 1RMFL 2P7TB 1A7QL 2D7TH 2NZ9C 2BHZA 1KJVA 2HTLC 4XH2B 3GSOB 3FTGA 1A7NH 4O5LH 4FZEL 1S7VA 4IMKA 1P6AB 5DD5L 1RZKL 2Q86B 5JPNA 4EN3C 12E8H 2QR0B 4JB9L 5HHVL 5IB5A 4AEFA 4L9LC 5FYKL 5D7LB 3DGGA 5IM7B 1HN1A 1CT8A 1NLBH 5BO1H 2R4SL 1JL8A 2E3VA 4LFHG 1T7ZA 1T1WB 4HIJA 3BUYA 3S37X 5C7XL 4O9HH 4B41A 3EDJA 1G9NL 4O51A 4UUJB 1YN6A 3QHFH 2H26B 1D9KD 4FTVA 2XNAA 5A2KH 4ZUWA 5DUMH 3BO8A 3LKNA 4H0IA 1NC2A 4J3XA 5E24E 1IQDB 3R8BB 1FAIH 3MLZH 3B4NA 5HHOE 2E27H 1JNJA 1KPVB 3MLXH 1EXUB 3JTTA 5ITFA 8CGTA 3ARSA 3RVUC 5C08B 4LMQI 1ZXQA 4NQCB 3SDDA 2NPLX 5HHOD 4I3RL 3IAPA 4DGVH 4Y4FD 4XNXH 2Y6SD 3TIEB 3GMLB 1GAFL 2EIZB 4OLVH 3O3EB 1LE9B 4Q9QH 4WY7H 5E2VH 2YEZB 3ULSA 4RNRA 2F58H 3QIUD 2X4TA 4RQQB 3NTCL 5IEHB 1VFAB 4Y2DA 1ZGLB 3RHWK 3T3ME 5FIEA 2IFGA 5IBTH 2DM7A 4I2XB 5LGJA 5DEGB 1HYRC 4H0GA 1BIIA 3MRGA 1JUFB 5F96L 1QRKA 3RL1B 4Z7UA 1W72B 4ZAKB 2RFXA 4NYLB 3OKYA 1NFIB 3JWOC 4FXKA 4J8RA 3V9FA 4AEEA 2DKUA 3KPMB 1ACZA 4WJ5B 5E8NB 4HWZA 3QQ9C 3SCMD 2IALB 1KIRB 3SKNB 5L8KB 1GOFA 3H9SD 3C6LD 1OT2A 3P0VH 1FFPA 4HXBH 2E6JA 4HAGA 1FFOB 5I2IB 1CS6A 2VERN 1BZ7B 3MGTB 4OD3H 5EOCL 4U6TA 1K8IA 2W65A 4LPVA 1JZ8A 3B2VL 5MEQB 3L5XH 5J13B 3NCFB 5AD0A 5DD0H 4NQVA 4OCWL 5I30H 3ARRA 1NCDH 3VA6A 5JMOC 2B0SH 3QXVA 5JNYA 2ICEA 5F9DC 1UWXH 2AEQL 3PL6B 4U7SA 1ZVSA 1YQVL 5DRNA 1BOGB 4JFDB 1IZKA 4CDHA 3NPSB 2X5PA 5F1IB 4X4MA 3LQMA 4RGNE 2HMIC 4P4KC 1I8MB 5L2JB 2NY1C 1KLUB 2ARJA 5FYJU 4OV6F 4PJHB 4IRSB 1I9IH 2V2WB 5HHXH 1HYSC 4YO0B 1EX0A 3PWPD 2X70B 5FGBA 4ZUUB 5ITBH 1I9EA 3STLA 2IAMA 3F7VA 3MOAH 3RKDC 1NMAH 4S1QH 4HFWB 4GKNA 4GBXD 2M1KA 1Z9LA 1KXTB 3QO0B 3O11A 4CJ0A 4Z9KB 1CGTA 1X6LA 1BPVA 1Y6KR 2O61A 4PGZA 5J11C 5SWZD 5IV2B 2DI9A 4P57B 1L0XA 3N1MC 4QHKI 1DVFB 2CMRH 1CXFA 1UVQA 3IDNA 3IETB 1ADQH 4HS6A 4KQ4L 3HG1B 3DUHA 4XWGL 3VJ6A 2R0KL 1JF5A 2W60B 4UBDC 2LV4A 3P0GB 5I8CA 4PJ9C 1HHGB 5JQHC 1CDIA 3B8SA 2AJSL 5JO5B 4HMDA 2F74B 5DJZB 3KXFE 1WIUA 3FT3A 3TA3A 4YDKH 4MNQE 1JUFA 3AFLA 3C6SB 4ODSH 5FYKU 2CXKA 3GJEB 4BFGA 1K9TA 2N7AA 5LVEA 3NN8B 3VGFA 4XNQA 3RWCA 4U6HA 3H3KA 4XBEH 1BD2A 4LHUB 4NKQB 2NW3B 4MZ3A 4JFZH 3TN0C 4L8SA 1FFNA 4H1LB 3OG4B 2DIBA 4X98B 1Q9WB 3BT2H 3IDYB 5T5NG 4Y19E 1KJ3L 1WTGT 4RRPG 1EGJA 1G7JB 4JZJC 4NWUH 1MCWW 1AGEB 1H8NA 3MLTA 2NY5C 4YAQB 5L0QC 1G7PB 1BQLL 3DUUB 3IRZA 5EBMA 1RY7B 1CU4H 4N9GB 5FF6A 4J1UB 2CLVB 3S37H 2YUZA 2PTTB 4N8CL 4FQIH 2DICA 5FCSH 4FOMA 2X89D 3QXDA 5F3BA 3TPKA 4Q9BA 2OP4L 2PCPB 1UH2A 3OXSA 3ARFB 1NCBL 1PFCA 4MNGE 5HYSB 1A0QL 4HK0A 4P0DA 2BY2A 5CUSH 5SWSB 1QG3A 1QOKA 3AS0A 4YGVB 1YNLL 1ADQA 3SDAD 3MV8A 2X70A 4ZUUA 4HT1H 1AQDB 1KNOA 3EKCA 4D0CB 3IDYC 2CIKB 3TCLB 4LDOB 4PJAE 5BVJA 4M62H 3ESUF 1A2YA 4XCCL 3MCLH 4W68A 5DR5H 3IVKB 2UZIH 3DBXA 5EZLB 3QIBA 5EO0B 4CVXA 1KLGA 3TBVA 2YK1L 4MB3A 2OR9L 1I85A 3HFMH 2NY6B 2VITB 4NJ9H 1DEEB 1Q9LB 4MS8C 3MBXL 1XF4B 3MLZL 1UG9A 3KLHD 4WTZA 3WNMA 3ROLA 4K8RC 2Q8BH 2O5ZH 1J8HE 1F97A 4CMHB 1ZA3B 4NNXB 1PBYA 3HE6B 3VXTB 3WCYA 5A3IC 1VB9A 3UTTD 4Z7QE 4TNWF 3DX7B 5B38A 3CVIH 2NQCA 2DM4A 4WTWA 3DTXB 5HGDB 4MNQA 2VLKB 1U3HB 5E2UH 2R1XA 3CSGA 4LSSL 3MA7B 4R2GD 1YJDL 3QXWA 1FYTD 4LVHC 3BX7C 2OMNA 3GIVA 5HGBB 1JP5A 3DNKA 4O00A 2BNUB 3QR2A 4YPJA 1KXQE 4DEPC 2GJJA 5MP6L 1LEKB 1ZHNA 5E94B 3RL2A 3UTSD 4HXAH 5GZNC 2P24A 4R7DB 5HHOB 1WWBX 5FO9A 4D9QE 1KJ2B 4L1HA 4XBPB 3VXQA 1GSMA 2X6MA 4G6JL 5IK3A 1F02I 1UZ8A 2BJML 5BRZD 3VGHA 4LDEB 4L29A 3FT2B 3IRPX 5FF6B 2Y5TB 1OF2A 2EDRA 4QWWD 5F7EH 5HI3D 3MRJA 1JPTH 4G7VL 4Z7OF 1OVZA 3T2QA 3H42H 3NA4A 3EYQD 3OXSB 1CTOA 3ZDYE 2AJZB 3IXTA 4GUPA 3V4PH 5HHNA 1Q1JH 4XT1C 4LVHB 5CJ8A 1F42A 3P73A 2H9GA 2IJ0C 4OBRA 1MFCH 1QFUH 4QT5B 3BDYL 3NCJL 1OY3B 4ISVA 5J1TC 3MRDB 4NO5B 3MA9L 5DJCA 2L7JA 5GJSH 1RFDH 2HTKC 2B0SL 3VRLF 5GGSB 3WSQL 4MA8H 2NY6C 1A1OA 4TSCL 3SKMA 1A2YB 2VE6B 1YN7A 5DUBB 2LAAA 3IVKA 4GG8B 1I3RA 1ZS8B 1CT8B 4BH8A 1FGVL 2R1YB 4X7SH 5DT1H 3STBA 4CVXB 1KLGB 1YUHA 3TBVB 5KSBE 4JM2F 3W0WA 1MIEL 2Q76A 5BVPL 1AC0A 5HJ3B 3SN6N 4GG6F 4OUOA 3FZUD 2CDFB 4PREA 5GZOD 2J5LB 4EBQH 4IOSD 4WIQA 3LS5H 4YHZL 1S7XA 4HKXA 1O7VA 2IQAA 1X5KA 3HAEH 2AABL 1A6ZB 1FZOB 4LLDA 2V6HA 1JGLL 5DGQA 4LLUA 1OGTB 2XZQL 4LF3A 1AD0B 4PJHF 3MREA 3JVGC 1BGXL 2AI0H 4M8QA 1S9VA 1BZ9B 4YZFF 5GRXG 2AK1H 1YC7A 5EA0H 4F57H 4G43B 4QY8B 1DANT 5F9OL 1MLCB 5HYFA 3CSYA 1JMZA 1T2XA 5EWIL 1UCBH 4MMZC 4JDTL 4XC1H 4RWHA 2EIZA 1FV1B 2AXFA 1RHHB 1TVBA 3DURA 4DVRL 2EDXA 2EKJA 3MRLA 1U95B 4HPOL 4N90E 5JXEA 1U8JA 3RZCC 1CD9B 4YUEH 4D9LH 4F8QA 1T21A 1WIOA 5DEGA 1T1XA 4LLVA 5J12