3HMXA

Crystal structure of ustekinumab fab/il-12 complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
305
structure length
295
Chain Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQKDRVFTDKTSATVICRSISVRAQDRYYSSSWSEWASVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-12 subunit beta
publication title Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 44
structure length 295
sequence length 305
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmxA03
4GS7C 4O2CA 1WBYB 3BKYL 4MNHA 1KB5A 1CR9H 3PABA 1UQSA 1P53A 3NMEA 2G75B 3C6LC 3L7EA 4GXUM 4NFDA 5TDPA 1MLBB 5GGTH 3BYTA 3C5JB 3QI9D 2WZPD 1YEGL 4K94C 4P2CG 2IPTH 4L3ED 2A2QT 2HJFB 1JGDA 2AK4E 4OZIB 4XAKE 2RBLA 3WUWA 2CKBL 5ID1B 1ZT1B 3CGTA 3QO0A 5DJDA 5IV2A 5GS0C 3QJFB 4M43H 5CBEB 2EYTA 5D7JB 3VWJD 4HDIA 4AH2B 2ICEB 3BRDA 6FABH 4MD5A 4DN4H 3CJJA 4ZO9A 2V7HB 3DUSA 3LKSA 2M8XA 4OM1L 1IKFL 1JWMB 3SE3C 2M26A 4MSWA 2DQCL 4OCWH 25C8H 2I9LB 3BKJH 4D0DB 2K7QA 1IILE 1B6UA 4DGIH 1GGBL 1Y0LA 3G5YB 2ADGB 3VW3L 4CUCA 4NUJA 4I3SH 4ODHH 2FYYB 5DRNA 4PRPE 3IFNH 3DI3B 3KJ6L 4RAVB 4X9IA 2FJFB 4JFDA 1IAII 3UEZA 1U3HD 4ZDHB 4XH2B 3RPKA 5JW3L 2GI7A 3TJEH 5TE6H 3GSOA 1T2XA 4XB7A 5EO0A 1YY8B 5FYJU 1Z9SA 2ICWA 4H0IA 3OG6B 1XCQA 4I3RL 4LOUD 5IW3A 2A6IB 3FHAA 4KJYB 4PP1D 4XAWH 2E27H 1IT9L 1LE5A 3DX8A 5C0IB 3MUGA 4Y5YC 2WK2A 1SYVB 1QFUL 2OI9B 4HKXB 5D7LD 1I7ZA 2JB6A 3TNMB 1D9KB 2VLJD 2OL3L 1MCCA 3RU8L 4QOKD 4UV7H 1FORH 1NGXA 2RQ8A 2YPLD 1VB9A 3ARSA 2CSPA 1F6FB 3N85H 4I0PA 5GJSL 3SDDD 3VXRD 5F7DA 1TTUA 3TT1L 2VTFA 3OHXB 4R4FL 2ZKHL 4UAOC 4BFIA 1I4FA 1RZKC 1AD0A 1BQHG 3GI8L 1ND0B 3MLTB 1ACYL 2PXYD 3BN9C 1S9VA 4OAWB 1S9YA 2WP3O 3MLUH 4IRZL 4P2OB 4YFLI 4KXZI 3RKDC 3WIHA 2CGRH 1YY9D 3D3VD 3BH9B 4LPTA 3MLVL 3S35X 4RNRA 5IT2H 3NOIA 1MJ7L 4Z95L 1MFCL 4F15C 4X5XA 3V0WL 4MXWL 3O3EA 3HC0A 1KCSL 5JQ6H 1R5IB 4GRLD 1MI5A 4FP8L 3EOAA 1BVLA 5TQ2L 2UVEA 2G60H 1MNUH 1HSAA 5TPWH 5T33L 4HGWB 1NAMH 4S11A 1T21B 2CLRA 4F2MB 1RUKH 1E0OB 1I9JL 3SDCB 4JGMA 2Z31D 3DTXA 5IB3A 4NQUA 2QADC 4UIKL 1B90A 4Z7WE 5F7LB 4BH7A 1PW3A 4CW1A 3C09B 2DICA 5BRZE 4JLRB 3RPIA 1HE7A 4G8GE 2G5BA 2BNRE 3RY5A 5DQJB 3ARFD 1A4JA 2JJSC 2NY5H 2F58H 3K8MA 3BO8A 3GB7B 2P8PB 3JUZA 1I8IB 2DWEB 5FM5M 3KPMB 1OARH 5AZEH 4P23B 2A77H 3WJJC 4JM2A 1J0JA 4OF5A 2NY4C 5FV1L 5AEAA 2R29L 3PV6B 3ULUE 5L0QC 3W39A 1JNNL 5JPNB 5EBWA 4HX1B 1BLNB 5EWIH 2YD1A 4BK4A 3FN0H 3IJHB 3LKQB 2WBJB 2PYEE 4EI5B 3MRGA 1HYSD 4D9RD 5GGTA 4M6MH 3MJ7B 4LNRB 5DEFB 3L9RB 3PQYA 2CUHA 1RZJL 1VFBB 4RGNE 4YDVB 5E5MB 1G7HA 4QHLA 3VXPA 2ITCA 4YHOH 2QHRH 4OCSL 4H8WC 4P4KD 3WO4B 4I2XA 4P9HC 3GMRA 4MDJA 5ECJE 2NY0C 5HD8D 1K4DB 5CBAA 5D7SH 3QCVH 2W0FA 5DA4A 1UXWA 2P5WD 2BVQB 1YNTB 3QHFL 2K3TA 4MD4A 3FFCA 3ILQC 3RWJA 2EIDA 5IGXL 3WBDA 4OZGF 4TQEH 5C2BL 4BUGA 5AYQA 3H9SB 3M1BA 1BOGA 3T4AA 1NLBH 2QR0A 2VN7A 1F3DJ 2YSSB 4NC0B 1JN6B 1Y6KR 1D5MA 1I9RH 2AJZB 4P46D 4FFZL 5I1GH 5J1TC 4DZ8B 1Q9OA 1OP3K 3NACL 1NLDH 1QSZA 2KDGA 4IMKA 2A38A 4ZPVB 5JPMA 2WWKO 4IHOA 5F7EH 4YHYB 1Q0XH 4NM4L 3IAGC 1JMZA 3KGRA 3ECBA 1M7XA 2J8UB 4LHJB 1U9KA 3HE7D 4U6YA 2E7CA 1U93B 4B41A 1UGNA 4UNTA 4M00A 4X6FA 4NN5C 1VEMA 2CXGA 3UBXI 3VGDA 3V0VA 1WC7A 4U6XA 2V9RA 3PHQB 1DBKL 1FPTL 4FTVA 4OD1L 4LGPB 4WY7L 5IMMA 1DR9A 4JPKL 1BWWA 5D7IB 2ZUXA 1WLHA 1DQLH 1FNEB 3MXVH 2ED7A 2PO6B 4YX2H 2YHGA 1H15A 3S5LA 3MO1A 3L5IA 5SWZD 3JUYA 1AHWB 1R3KB 1MOEA 2XZZA 3DYPA 3VFRB 4LHQB 5FKPB 4PJIB 5I1DA 4PY8J 4UDUA 1ED3B 4OD3H 5IBLC 1HCFX 1QLFA 4JKMA 3MRQA 4PRNA 1NCCL 3HNTL 3FB6A 1ITBB 1NFDF 2AXJA 5CHNB 3IDYB 5C7XH 4XTRC 3T0ED 1V7NH 1MHPH 1A6AB 2DKMA 2YC1A 4LL9A 2FX9L 3QP3A 4DFHA 1C5CL 3FQTA 1BJMA 3HS0A 4R97B 3VFTB 3VJ6A 2C1PB 2HJKB 3PF2A 3QJHA 1BFSA 4HXBL 1TZIB 5F8RC 4LDLB 3SE9L 1BX2A 1NAMA 2GQHA 5F3HB 2VDNH 1PKQB 5DLML 4X80H 4Z7VA 1UG9A 1V5JA 4AZ8A 1D6EB 4QHKI 1EXUA 4XCCH 1VGKB 5DSCB 2J88L 1SHMA 3TVMD 2EDHA 4MNGB 3SCMA 4LLQB 2R69H 4M1GL 2V9QA 3PWPD 5E2TH 3STLA 5I1AA 1AR2A 3FOMB 2XY1A 4RGMC 1V3JA 4MJIE 4U1NB 4EN3C 5DUPL 2BHZA 5KAQG 5IW6A 1X5JA 1K6QL 3W0WD 3ROOA 3GIZH 3HE6D 4QRRE 5E8EA 5C9JB 4OZFH 3VFPA 5GGSB 1UA6H 3SDAC 5FEBA 5FYJE 4XPHH 1P7QB 5IJKC 3IDMA 4N8VA 3BPLC 3QCUH 1CFTB 4OFYA 4U7SA 5T3XD 1IAKA 1J05A 4IDJL 4PLJD 1IM9D 5FAAA 2W9EL 5EORH 4EUPG 1WFTA 3L5WA 3RI5K 4YDLB 5I8OL 1BM3L 4HD9A 1I1AC 2HTKC 5J11B 5DVOA 3N9GL 1L0YA 4NWTH 5HYJE 2X4RA 2P8MB 5SWSA 3V5DA 3QG7H 1Q1JL 4YAQA 2ATPB 4JFOA 3BD3A 4UQ2A 1NL0H 3BP5B 1UZ8A 2NZ9C 4K71C 3RWGB 5BVPL 3OKMB 2IADB 3KXFD 2XN9A 5DC0A 3OR6A 3S4SG 3UTTE 3L3KA 4F9LA 2F19H 4MAYC 2HLAA 4HCRL 3AFLA 4OB5L 3U79A 3QNYA 2YXMA 1DLFL 3MOBL 4KKLD 1EJOH 5KW9L 3GSXB 2NY2C 2LVCA 4WFHE 1HHIB 1LD9A 3U82B 3PP3K 3PDOB 4RZCB 5MEPA 5I1CL 4PY8I 3ZDZF 5KJRL 2ARJA 4IOIA 1OAZL 3B2VH 5FFLA 3BQUC 3EIFA 5B4MC 5E8PB 4FQ1H 3L3GB 5C70A 1ZVHA 2Z31B 4KI5C 1KYOK 1YN7B 3ZSTA 3KPSA 5KSBB 2WINB 3NA4A 2BNUB 1FC1A 4PJEB 3BKYH 4YFLF 4M61B 1JK8A 1RJLB 2A6KB 1Q9LA 4JFFA 4PTUB 5HDQL 4OZGE 4ODUA 2BJML 4MHHG 2E6QA 5KOMC 1YEGH 4NN7B 3ZHDA 5L8JB 4ZNEA 3LRHA 2UZIH 5E2VL 4KMQA 4GOSA 4YIQB 2LU7A 1LP9B 2CKBH 1CVRA 1VKXA 1GGTA 1YEEL 5IB1A 2XACC 4QRUB 1S7RA 1EGJL 3B3IA 3D85B 3RWHB 3SGEH 1Z0NA 1GPOH 3EOBA 1I8KB 3T0XA 3QRFM 4JZNA 1IKFH 3PHSA 5H37G 1HXYA 2DQCH 4PRHE 1CF8L 3BWUC 3F7YA 1GGBH 2H41A 2V5MA 3VW3H 5T5FH 3O8XD 2FEEL 4PD4K 3JV4B 4ELMF 1MHCB 1S5HA 3KJ6H 3NPSB 1A9EB 4G42B 4ZUWB 3VXUD 4NQDD 3OX8B 4EEEA 5JW3H 5HYQA 5DC4B 3ZKSD 1KYOJ 1AY1H 3CSYA 4P3CL 1H3UA 3DUHA 3K4DA 1YYML 4NYLB 3RWFA 4I3RH 2X70A 3L7FB 1AGDA 3G08B 4Q9QH 2XQYG 2ZUWA 3WE6B 1IT9H 1KLFA 3G5ZB 5JDJA 1MY5A 1VFUA 4LCYA 5HVFB 4F37K 1C12A 1NFDE 1DSFL 1QG3A 5T3XL 1MCJA 1R5VB 2OL3H 4TVPD 3Q2CA 5K9OB 3RU8H 1ONQB 3MV9A 4JDVB 4XMLL 1A3QA 1EERB 3EJZC 5F21B 2YWZA 3ARDD 3HE7B 2PW1B 3WLBB 2Q7YA 3RZCA 1JWUA 3RX7A 1OTSC 5I16A 2ZKHH 4OZFA 1EEYB 5TGBB 3Q6FB 3QIBA 4Y1AE 1TPXC 4B50A 3R06A 5L8KB 3GI8H 2VDKH 2IAMB 1ACYH 5FOBB 2HKFL 4PJ9D 3TV3H 1YUHB 2PTTA 4OIBA 4A6YL 4AIZB 3QQ9D 4IRZH 4L9DA 3WIIL 3ARPA 3KR3H 4PD4J 2FGZA 5HDBF 1H3XA 3P4NA 3VD4A 1Z9MA 3OKYA 2ZJSL 3FO2B 4IJ3B 3EO0B 1MFCH 4Z95H 1CXEA 3V0WH 4MXWH 1KCSH 3N1FC 2IH1B 2W9DH 2B4CC 5TQ2H 4AK1A 1A7BA 1Z5LB 4RFEA 1LQSR 1ZLWK 4OD2B 4S1QH 5DVKA 1G84A 1I9JH 3GBLA 4KUCD 2ATKB 3MREA 4WI5A 3MBXL 4UIKH 1ZT7B 4P2QA 5C0AA 4CNIB 1OAUH 3OBAA 4WFGE 2UWEF 2YXFA 1TQCB 4F7TA 4POUB 2GKIA 5E0QA 5IROA 1ZA3A 1EHAA 1W0VA 2GJ6D 3HMWL 3WUWG 4Z7QF 5L6YL 4C54A 4NN6B 2BOCB 5I17A 4HAFA 4B53A 3O4LA 5FYLE 3T3PF 1QBML 3RIFK 4X7SL 5DJ2B 4QRTA 4U1GB 1U58B 5E95B 2NTFB 3RFZC 1BVKA 4PJAF 4LK4A 1JNNH 2DQDL 3QEGL 1MUJA 3NCCB 1LK2A 4IRJB 2VR5A 5C07A 3WL9B 3SGDI 3RWCA 1TIUA 5JLZA 4NHUA 3W0WB 1T5WA 5GGQL 1K5NB 4F7CA 3KLDA 1BMGA 1RZJH 4NQCE 3ZDZE 3CVHH 1NEUA 1IEAB 4Z7NF 3BZFB 1OL0A 2L7JA 4HIHA 1GL4B 2VDLL 2F53A 4TTDD 1LHZA 2CKBA 4OCSH 1KJMB 1UKTA 2IQ9H 2N56A 3BEVB 4KK6D 5DK2B 3PGCA 3VA2C 3L6FB 2ZSWB 2NW3B 1RI8A 1U8QA 4Q6IC 3TIDA 3SJVE 5DYOA 4X6CA 5FK9A 1YMMD 3RVTC 1W72B 5EU6D 3QHFH 1OD7A 2H32B 1JI2A 5IGXH 4YFDB 5H35B 5IQ7L 2W59A 1KCVL 5C6WH 4NRXB 3VRJB 3EYQD 3O3UN 2ZOLA 5CEXA 4ETQB 1WIOA 1T6VN 1MJUL 4UB0H 4MJ4A 2W60A 5ETUB 4HAGA 3HNVL 1QNZH 5I1LB 3D0LA 3DUUB 3WHXB 3GM8A 5M7QA 1G7IB 2AV1A 2VZ3A 4CADB 5KZCB 1U3JA 4PJ7A 9CGTA 2CLVB 4LLDB 3IF1B 1QYGL 3EYUH 5AUMB 2AQ1A 4U3CA 1JF1A 1VDGA 3B4NA 4NM4H 5C0JA 4HH9A 4P2RD 1L4IA 5MEND 4Z76A 2DYPA 3OAZH 4UT7L 4YK4B 4IRSB 2LABA 1FIGH 5F7KC 5B8CA 2DI8A 1DBKH 3WEXB 1FPTH 4OD1H 2APTA 3I3BA 2Z93A 3G9AB 4I5BB 1F2XK 4JPKH 2OL3A 1CQYA 3WIFB 4LRIA 3TA3B 2F74B 2YEZB 2C1OB 3C6LD 5KS9F 4GRWF 3HLAA 4MX7A 4NKOA 2HT2C 2NX5A 3FO1B 1UJ3B 1BFVL 5K9KB 3CFDA 1EFXD 1IM3A 1HH9B 2J3SA 4FQXB 4XVTL 1D6VL 3NZ8A 1T3FA 5JXEC 4FRWA 1NCCH 2VLLA 3K74B 4HJ0C 4Y2DC 2H6PB 4YR6B 5I1EH 2X1XR 2EDLA 3ZE2F 3FB7A 5ITBL 5HHME 5I8EA 4W6WB 1C5CH 2EKSB 4AQOA 2X6MA 3MV7D 2VISA 3VXMD 4UTAL 5CGMA 5I0DA 4PRIA 2YZ1A 4HXBH 2IALA 3SE9H 1SBBA 2JB5L 1QBAA 4FS0A 5JQHC 3I85A 4Y88A 3IDGB 5DLMH 3GIVB 3MX0A 4L9LA 3PG2A 1ZGLA 3O11A 4V1DB 2J88H 2NNAA 4WO4B 3P30L 3VXOA 3MBEC 4M1GH 4MVBC 4LVOC 1X5XA 5HDBE 1X7QB 5JOFA 5T1LD 3CPLB 2LAGB 3CFJB 2UVFA 4Q9RH 3IFOB 4XNXL 5DUPH 4L8CB 4XP1H 5TF0A 1K6QH 4X8XA 3BWAA 5F7HA 2PTVA 3L1OL 3S96A 1GOHA 3ARRA 1NSNL 5IVZA 5HY9A 4IDJH 4YXHL 3RVVC 1H3GA 2W9EH 4Z7WB 3U0WL 1IGYA 4LSUL 5BRZB 5I8OH 4OLZL 1BM3H 2DQHL 2BXYA 2UWEE 5ABDE 4Y16B 5FUCC 3N9GH 4HKBA 4NM8L 1AO7E 5DD0L 1NFIB 4OUUB 1DBML 5GRYA 4Z7QE 5IW1B 5DJ0A 1Q1JH 3TP4A 2WV3A 5BVPH 3BN9D 2E7HA 4M3JA 3T3PE 2E7BA 3MNZA 4PJ9B 4KMLB 2R2BB 1JYXA 5IK3B 3AM8C 3RKDD 2P7TA 1BF8A 3QAZC 4PJAE 4R7NB 1IGCL 3GUTB 4HCRH 1TVHB 3NABL 3PGFH 5D1QC 5EO1A 3IFPA 1DLFH 3MOBH 5D5MF 1SYSB 2PYEB 1UYWL 4XNMB 2LTQB 5HGGS 1S5IL 5I1CH 2V7NA 4RGNB 5KJRH 2VMFA 4Z7NE 5E8DL 4RWYL 2X4QA 3KAAA 3RKPA 4KRNA 1EO5A 1Q72L 5JDSB 2F15A 2P43B 5IM7A 2HN7B 2QADD 4W81A 3S5LG 2NXZC 2Z8VC 4KFZC 4ZFGL 2AEQL 4JFXA 1HOCB 2VLJA 1AGEA 1NFKA 3N1QC 2YPLA 3T4YB 3DGCR 3P9WB 3RI5F 1JRHI 5D2LA 3VXRA 1IZJA 1EV2E 2EICA 3Q0HA 5KBNC 5GHWL 2XWTA 1FFOA 1FFNB 5E2VH 5MEQA 4XBGB 2NY4D 3IJYA 4P3DA 1K2DB 1KTDB 3DMMA 1IFHL 2C7UA 3EGSB 1FVDA 4LLUB 5HHNB 3MA9L 1EGJH 1FRGL 3X3FL 5E2UL 4U1JB 3V6ZB 5C0DA 2R8SL 3DX9A 5TQ0L 1P1ZB 5ITFA 2X4NA 3D3VA 3M8OL 1YQ2A 4XRCA 3PL6A 2GJJA 2DIJA 2EDEA 1CF8H 2C4FT 1QVOB 3DGGA 3S3JA 3RL2B 4F33B 3INUL 2EIBA 4OM0L 4BYHA 1F02I 1CL7L 5EOTB 3S36X 4OKVA 2NY0D 1FNSH 1NPUA 2FHCA 2CD0A 5IHLB 4MNQE 1YMMB 3CFCL 5KS9E 3QSKB 4GRWE 4P3CH 4L4VD 2YBRB 5I2IB 1GGYA 1DN0B 1YYMH 2MKLC 2Y06L 4N8VG 3SBWA 5J0BA 4GAJL 2XZQL 2FX8L 4HC1L 5JIPA 4K23L 3S36L 3HR6A 1BP3B 4LLYA 5EUKA 4PG2A 1OB1B 3C6SA 3ZYJA 2BSSB 5C0CE 1DSFH 1DANU 5SX5H 3QO1A 2FIKB 5T3XH 3VXSE 4XMLH 5E03A 3NIFF 4U1KB 3JTTB 1Q9WA 3ZE2E 1OD9A 1FYTE 3HZYB 4WU7A 2GK0B 3QHZL 2W0KA 3CFEA 5DQDL 2GCYA 3Q3GB 4UOJA 4GG8B 3WS6A 5BZDB 1A2YA 4HUUB 5F72S 5DJXB 4Q2ZB 4U6HA 3UTSA 5IHZB 4X4XB 5E8OA 3K1DA 1JGUL 3V4UL 2XIDA 1T1YB 4QHNA 4Y4FC 1JNHB 1V05A 2HKFH 3ESUF 3ARBA 4A6YH 5KG9A 3WIIH 1V8HA 2ITDA 4Z9KB 5DA0B 4L8SA 3ULVL 2ZJSH 2P5ED 1UCBH 3HI1B 4MJIB 4U7KA 4JFHE 1XZ0B 2V6HA 3QDMA 3MRIB 4QRRB 2EYSB 3L95A 5DMJB 4Y19A 4JKWA 4F7PB 2XPGB 1JPGA 5IBLD 3IRPX 5DK3A 3E6HA 3EDJA 4I3GA 2NY6C 4HBCL 3FONB 2GK2A 5CFHA 4N5UA 5DMKA 5F93C 1CT8A 3RWIB 1YJDC 4XTRD 4FQLL 2XKNA 3CDGB 4JFEE 5E9DD 3IGAB 3MBXH 4HCRA 1UH2A 4ZODA 3GJFK 5T3ZL 4QXTA 2D4DA 3ILPB 5KSVB 4BA8A 3GBMH 4F37F 4XP4L 4LCWD 4KRPC 3WN5A 5IEKB 4YC2C 3VXMB 4KV5F 1SJEA 3UPCA 2R1YA 3HMWH 5FCSH 2E6JA 2FHFA 3V6OC 5L6YH 1I3UA 2GSGA 4QHUA 5JOEA 1CFNB 1DLHA 2BZDA 1CDJA 4EBQL 2A9NH 1MEXL 3PP4H 1HI6A 3LSOB 3UTTB 1T7XA 3BD5A 1P2CA 2DQDH 3C5SA 4QTIL 1E4XI 3LD8B 1E6JL 4ZS7L 2FJGA 3CH1B 3BGMA 4YBQC 1JUFA 3TGXA 4EN3D 2R2EA 3CFIC 1H0DA 3GSRA 3QRGL 3ROLB 4PLKC 3CUPA 2WIMA 4YPGA 4GAYA 5GGQH 1BQLL 4UQ3B 5SWZA 1T83C 3SDAD 1UADC 5EBMB 4I4WA 4OCRL 5DJ8B 3OKKB 5EH1A 3MOQA 1FG2A 2VH5L 2VDLH 2ZUUA 3BSZL 4PG9B 4N1EA 3BZEB 2CQVA 1GJIA 4MB4A 1NCNA 2ICWI 5MP6L 3D1MC 1EGJA 2YMXL 1LE9B 1JZ6A 1UWXK 1I1AD 2HTKD 1JHKL 3DVNA 1IC4L 3TF7C 5DJAB 4NKIL 4WGVB 4OZGB 2V9TA 5IQ7H 1ZVYA 1KCVH 3O6FB 4I18C 1ZHBA 3WLWC 1NMCB 3PWNB 1FNFA 3HG1D 1MJUH 5DTFA 2NZ9D 4ZG1A 1SJXA 3GMMA 3HNVH 5A43C 1HSBB 2JTDA 4GW5B 4Q9BA 2ERJB 1QQDB 4MAYD 1FGNL 2VDML 5DR5L 3RIFF 4XWGL 1DVFA 5T1KA 3GGWB 4M8QB 2MKWA 1KIRA 3TVMA 4G5ZL 2H1PL 3GKZA 4F15B 4OZFG 4YFEA 1MVUB 1MLCB 4NCDA 3FFDA 4OCNC 3VH8A 3BVNB 3QDGD 1QRKA 1A0QL 4Z0BL 1BQUA 1WBXB 3EYSL 4U1MA 1C08A 4RDQF 5B4MD 5GS2H 1LILA 5CD3B 2DLGA 5D93B 1RY7B 4KI5D 2X4UA 1INQA 1C7TA 1K8DB 1G1CA 2QADB 4U2ZA 1N59B 4JAMB 5DGQA 2FJHA 4YHNA 1O7VA 5A2KH 1QBLL 2BC4A 4U1SB 3GRWL 1VA9A 5D2NA 3VFMA 3O6ML 2ZPKH 1UB5A 2WM0A 2Q8AH 4BQBA 1N2RB 3MUHL 1CIDA 4PJHB 2EDFA 1BFVH 1A7NL 4O2FB 4XVTH 1D6VH 5TF1L 5FYKD 3RUGF 3LV3A 4LMQI 4PJ8B 4YQXL 1MFEL 1NFDB 3KXFA 4A6YA 3WXVH 4EZMA 2IANB 4W70A 5T1MA 1JP5A 3W82A 1X4ZA 2ED9A 3NIFE 2RJMA 5ITBH 1WSST 3MYJB 3MLRL 1F90L 3VFOB 1U8NA 2VLKD 2CDEB 2YA0A 4JZOB 4UTAH 1P7KB 2CLZB 3WKML 2ADJA 5IMLA 5CGTA 3UXFA 1U41A 2BDNL 2FSEB 4Y1AB 3U7YL 5FO8A 1RJYA 1FP5A 5E94B 1NBZA 4OF6A 4LSRL 2R0LL 4P4RA 1T22A 4OFKA 1JV5A 4NFBA 2W0PA 1XF4B 3P30H 2XI9A 4P0DA 2E8ZA 3OZ9L 1UT9A 4XBEL 1F11A 1G6RB 3MFFB 4XNXH 1PQZB 3TBVB 2D03L 3H3BC 3U46A 3WUZA 4LLMA 1FNAA 3W11C 1T7VA 4LSSL 3K7UA 3C8KB 5CAYB 4HHAB 2RHEA 5ELIA 3ZE1F 4E42A 5I76B 2Q76B 2BNQA 4HUXA 1I1FA 4PV9A 1HHJB 4YXHH 3U0WH 1I7UA 3VXTB 4LSUH 1EBAA 3REVA 4OLZH 5L2KA 2DQHH 4WFED 4H1LB 1W0WB 3V5HB 4HJGA 3D87B 2L7UA 3VFNA 4WW1A 4NM8H 4NN5B 1OTSD 4KV5E 1OLZA 1DBMH 2QSQA 4Q0XL 2APXA 4JANB 3WKNA 5HYSG 3X14A 5HVGB 2IBBA 1Z0MA 5C08A 2BMKB 1XT5A 3O9WB 1P9MC 4WENB 1MJJB 1BHGA 5ANMB 1IGCH 5EC1A 3MCKA 3NABH 3JWDC 4NQDA 1WF5A 3MRCA 1UYWH 1J5OL 5ADOL 5JW4N 2DMCA 3HFMH 4LVNC 1B3JA 3RX5A 3KPOA 1S5IH 1ERNA 4NQCB 5F3BA 2DB8A 1RFDH 2EH8L 3QEQA 4FOMA 4XXCA 4MA3B 5E8DH 3X11B 4ZS6C 4RWYH 1YEJL 1T0MA 3CSGA 1Q72H 5E9DB 1X6NA 4ZFGH 4ODTL 4PJCA 4XVJL 2AEQH 1BD2E 3V5KA 3SJVB 1X5GA 1IQDA 1KJVB 4HS3B 2LE9A 3QG6A 1MCRA 3EHBC 5DHYA 5DRXA 1F4WL 3RNKB 3ZKND 1T6WA 4L4TE 3ARDA 4X99A 2A9ML 3OWEA 5GHWH 2J2ZA 1WBZA 2L0DA 5JIHA 1B9ZA 1LNUB 5F1SA 5HHOD 3RJQB 1IFHH 1YC7A 5FYKL 3MA9H 1S7SA 2RFXB 5EA0H 1FRGH 5LBSL 3X3FH 1JL8A 2Y9RT 4QT5B 4ZPTA 5E2UH 1S9WA 4DEPC 3PE9A 4MMXC 5TQ0H 1DEEB 1HEZB 1XGQB 3TN0A 4M48H 4LAJH 4UZGA 1FVEB 5DUBB 5DVMA 1IEBA 4NNYA 4FNLL 1SM3L 1T66C 5ACZA 3AY4A 4W6XB 3INUH 4RGOL 1CL7H 1CFBA 4PJGA 4POYA 2R1XB 5IKCB 4Y4KA 4ELMB 1P4IL 3L3OB 3RGVA 4PJ5E 2Q3AA 2P42B 2A6JB 1AQDA 4AEEA 1J86A 1S7WA 2BOBA 5FF6A 3RVTD 1DN2A 1HQRB 2A73B 3OKNB 3E3QC 4PP2A 3CFCH 1SEBA 3V95A 5GGRY 5HVHC 4KTDL 1MREL 5CZXC 3ZE0F 3RTQA 3O3DA 2XZQH 2FX8H 4HC1H 4K71B 2GAZB 3S37X 3KYNA 2HH0L 4JM2C 3TZVB 1PSKL 4K23H 4J3XA 3BZ4A 3U4EA 3EDDA 4GBXC 3RUGE 3SOBL 5IMKB 4ZUSA 3QDJD 4MAYB 1S7XB 3U9UA 3DXAD 3B83A 1TDQA 2NY2B 5IEHA 4ACPA 5HHMB 5LVEA 4IMLB 3KPRA 1N7ML 5BVJB 3QQ3A 3QHZH 5JHLL 5CLTA 5DQDH 5IBUG 1UVQB 3BQUB 3S37L 1ORQA 4MMZC 2VXSL 1RZKH 4F58L 3FAXA 1XGUA 2EZ0C 3D39D 1JGUH 2YWYA 3V4UH 1J1OL 4JDZB 2B0SL 1DP0A 4JB9L 3QXTA 2E9WA 4AENB 2GEEA 3OB8A 5F88A 4GJTB 3RHWK 4R7DA 5A3IC 1QR1A 2D31A 2HT2D 3QQ4A 3KYKL 2AJ3A 5EU6A 3KS0H 5C09A 1CYGA 1W2KT 1KTKE 4FQPA 1NCDL 3HZMA 3QHTC 1HQ4B 1F3JA 4G3YL 4MWFA 4HBCH 5JXED 1ROWA 1P4LB 3ZE1E 1I7RB 2I5YL 4IMKC 4HJ0D 5IB4A 4Y2DD 4IIQA 3IB4A 3LPGA 1RULL 4WI9A 5MI0C 4FQLH 4JN1L 3FN9A 4NGHL 2IG2L 4XP4H 3DV4B 1A3RL 1W0YT 3ULSA 4HUVA 4QRQB 5EFIA 3MRJB 4K7PX 3LCYA 4N5EC 4P2RA 5EZJB 2HT3C 3EDKA 2VZVA 3HUJF 5DZLA 4AEHL 1GOFA 4PFEA 4QF1B 5GRZA 4PJXA 5LGJB 2VWEC 1IBGL 1PYWA 2F5BL 4EBQH 3Q5TA 1MEXH 2D0HA 4UU9A 4BH8B 3MBED 4PJAB 5AAMA 4MVBD 4PRPD 4HS8L 4QTIH 4DK3A 1NANH 4ZS7H 5DJZA 4BQ6A 3GMOA 2Y36L 1MFDL 4I48B 3QRGH 3T2OA 3SKMA 4XBPA 4DOHE 5GRUL 4U1HA 4K7PL 1MH5A 3UYPA 1BQLH 4X6DF 3MGTB 2MHAA 2C3GA 4Y5XA 4OCRH 4HIIA 5FKAA 2VH5H 4YO0B 3BSZH 1ORSA 3QWOB 1WZLA 3B9DA 3ES6B 2X41A 2DAVA 1A1OB 4OLXH 2QKIB 5JHDE 2F54E 5MP6H 5CSZB 1KN4L 2YMXH 4F57L 1ZS8B 3SDXF 4K9EL 3MLWL 5E4IA 1JHKH 2BVPB 2WP3T 3AREA 5BS0D 1IC4H 3HR5B 4NO0A 4NKIH 2E3VA 1WFNA 4R2GC 3ZHKA 2VLRA 4J1UB 5IB5B 4RA3A 5B22A 1TPXB 4BKLA 4GSDL 4JVWA 4GKNB 2J12B 3B5GA 4JRYD 3UC0H 5DJ6B 4G80B 4XI5C 4NFCA 3SCMC 2CO7B 4U0RB 1DUYA 4M5ZL 1FGNH 3VWKB 1CLOL 3FO9B 4JDTL 5D1QD 2IMNA 2P48B 5DR5H 4XWGH 2NY5C 3KLAB 4G5ZH 5J6GA 5C0BD 5CP7B 3LKPB 5T1LA 2LV4A 1WBYA 4HC1A 5IVXF 1A0QH 1CGXA 4Z0BH 2ESVD 3EYSH 3DRTB 2O61A 1QSED 2G75A 2NXZD 4PRBB 4Z6AT 1NDMB 2HKHH 1PX4A 1EAPB 4WUUE 2APBA 4MNQB 3RAJH 5LXGL 3RVWC 1ZT1A 2IPKB 4GRWB 4OLUL 1QBLH 5FCUL 5EIIA 3GRWH 1QFWL 3NCMA 5GGRA 5D7JA 3ZE0E 3O6MH 2ICEA 3KNBB 4G8GD 3G5XA 2V5SA 2BNRD 2VXQL 1A14H 1N5YL 3DI2B 4R6UA 2Q1EA 3FQRB 1W72L 3KJ4B 1A7NH 1JWMA 3H7BA 4KKBC 5TF1H 4HG4K 1A7PL 3BT2H 3U4BH 3CAFA 3AROA 3G5YA 2ADGA 1MFEH 5EBLA 3S8WA 3OTTA 4KH2A 4QCIA 3C5ZD 1A6PA 1DBBH 5DO2C 3DVIA 2FYYA 3QA3A 1YQVL 3QFDB 4U0QB 1FYTB 2H3NB 4EDWL 3GZKA 3MLRH 1F90H 4JRXE 4OBRA 3LPWA 1X4XA 1ZA6A 4K3DL 4ZDHA 5C0GB 4R4ND 2BDNH 3U7YH 4JHAL 2ZG3A 1FVCB 5CJXA 1B0GB 1YY8A 1CGSL 1SJHB 4LSRH 2DDQL 5F9OL 1A6ZB 4XNZC 1UZ6F 4UT9L 4XPBL 1I8LC 3JWOL 5F9JB 1KACB 3N06B 1R3IL 4NKDB 5C0IA 1YMHB 3B6SB 4D3CL 3LN5B 4J8RB 4OJFL 4HKXA 5EZIL 3BPNC 4XBEH 2ENSA 4O58L 3MV8B 1RJCA 3TNMA 2Q6WA 1N8ZB 2WWKT 4BZ2L 3H9ZA 1KLUB 1PBYA 4LSSH 3L5XL 2CIIB 2UUDK 1U6AL 4HBQA 1GHFL 3RDTD 4NQEE 3SO3C 5J13C 4P5MB 3MRPB 4HG4J 4QRPD 4OAWA 1I1CA 1KUMA 3MRLB 4GRMA 4P2OA 4N0YL 4CVZB 3LOWA 5IP4A 3BH9A 4Q0XH 5GRWA 5KSAB 4ZFFA 1RZIB 2B7DT 3HUJE 3D39B 4Y4FD 5J9PB 4Y2OA 1R5IA 5DJCA 2YK1L 5BW7A 3QR2A 1JGEB 4JKLA 1RV6X 2FD6L 4R3SB 3OKLB 3OG4B 4HGWA 3VH8G 5JW4M 1T21A 4F2MA 5D5MB 3OJDA 3SDCA 4WV1C 1J5OH 1AIFA 3STZB 4AM0A 5F1IB 1LO0L 3GDBA 4L4VA 4X6DE 4CMHC 4CN6A 4GG6F 5J12C 2YUVA 2NY6D 1KFAL 4M7KL 3IDNB 2EH8H 1HN1A 8FABB 5DQJA 1I7TA 4FXKA 4F8TA 1PG7W 4YHMH 1YEJH 1QTYT 5T5NG 3WNNA 1XF3A 1T0NB 3GB7A 3B8YA 1ULVA 3OAUL 4R96B 3KPMA 3DHMA 4ODTH 5I75B 1IAIM 2D7PA 2DLEA 4XVJH 3SDXE 4P23A 3FQUA 3GK8L 4KRPD 3LAFA 3GBNL 2EDNA 3RZCC 4YDJB 2JJTA 1BIIB 3QUYB 1BFOA 3PV6A 4Z7OF 3QIBC 1F4WH 1BLNA 1JGVL 4XB8A 4AJ0A 1PFCA 3LKQA 1K3ZA 2WBJA 4EI5A 3S88L 4LNRA 5FDYA 3FT3B 1NEZB 3QFJB 5FB8B 3BHBB 5HGHB 4HK3N 5E5MA 3MBEB 1Z6JT 5FYKH 4LVOB 5LBSH 4YBQD 1QBBA 4D0BB 3A67L 3RGHA 4PLKD 2AKRA 3GRWA 1QSFB 3ETBF 3JXAA 4LF3A 1A4KB 4KWUA 3ULUL 1K4DA 2DJUA 4ODXB 4FFYL 2P5EA 5JO5B 3H42L 5IVXE 4FNLH 1B2WL 1CXIA 2FZ3B 2QHLA 2DQTH 1YNTA 1VHPA 4RGOH 1HNGA 5DZOA 1MRDL 4KQ4L 2DM4A 1P4IH 3RP1A 1BZQK 3H9SA 1DQQB 2AK1L 3HKFA 2JJUA 3BYYA 2GFBB 2JLLA 2OXGA 3I02B 2Z91A 3BH8B 2YSSA 1JN6A 3BUYB 1UM6L 5IROC 2AJZA 1AD9B 4DZ8A 4WHDA 1VEPA 5MEOB 3WLWD 1CD8A 4KTDH 1MREH 4KK8C 4TULL 4ZPVA 1CTNA 4O02L 5I8CB 5HDLA 1HWHB 4YHKL 4S2SA 1PSKH 4XP9L 4F3FB 1XR8A 2J8UA 1ZHKA 1N3NA 5CEZE 1T4KB 1U93A 3ZKXB 2I07B 4P2YA 4JR9L 4RMUA 4EVNB 3OXSA 1U8IB 4M03A 3IAPA 3PHQA 5DEZA 1NGQL 5AYUL 2JCCE 1KTLA 1N7MH 4OUOA 3GMPB 3O4OC 1T5XA 4YEEA 5JHLH 1ZKAA 3WHE0 1RD6A 2DF3A 3BMVA 1FNEA 5FUOL 2I60L 3S37H 4JCMA 4OZIF 4WFHD 4JN2B 3TBYB 3HAEH 2VXSH 5HI4C 1TTFA 3T08A 1INDL 1WAAF 4F58H 3HPLB 3D48R 4QGYA 3DLQR 2V5RA 3V4VL 1WZ1L 1UZ6E 3VFRA 1J1OH 2B0SH 5L2JB 2VYRE 5ISZD 5FKPA 1QHOA 4PJIA 1G0XA 1DBJL 4D9QD 2G9HB 5DD6B 4PB9L 2EECA 4LLWB 2Z0BA 4QLRA 4GKZB 2EH7L 4RAUB 4N0UB 1S7TB 3KYKH 5CHNA 5BQ7B 5CJBA 5CMAA 1FN4B 1FQ9C 3IKKA 1FJ1B 1X5AA 1XIWB 1NCDH 4NZUH 4WHYG 4YNYB 4JO3H 3BW9A 2E7LA 4AIXA 4S1DC 1QEWB 1K3IA 3VU2A 1UWGL 2I5YH 4YGVB 2X7LB 4ZXBD 1TZIA 4JN1H 5TDOB 4NGHH 5F3HA 5AG8A 1G9ML 2IG2H 1PKQA 1CQKA 1S3KL 1IRAY 1D6EA 5CCKL 2EXYC 5DSCA 4G9DB 1R3LB 5B8CC 3S97C 4MNGA 1T1XA 4R90L 3ZL4L 1KGCE 1BPVA 2PUQT 4HMCA 4UT6L 4PRHD 1VACA 3QDGA 3FOMA 3AC0A 5HJ3A 1QRNA 4AEHH 4U1NA 4PJFF 1GZQA 1IBGH 4LRIC 3UTQA 1IC5L 3QCTL 3ME0A 4KHTH 5GGSA 5C9JA 3HRZA 5GIRA 2H2SC 4HS8H 4XHQA 1OGAE 1P7QA 3CLEL 4TNVK 2EE9A 1TCRA 2BXZA 3G5VB 1CU4H 4JFPB 2N7BA 1R5WB 1CE6B 2Y36H 1MFDH 1XGTB 4YGAB 2ZP0T 2OR8A 5GRUH 3W11D 3CNKA 3RHWF 5KVGL 1P5UA 3BXNA 4GG6E 4WVRA 4KJPC 3VGFA 1DE4B 3C8DA 4M1CC 2VC2L 2P8MA 4PS4L 1AKJB 3TCLB 4PJBB 5KVFL 1KN4H 2ATPA 2HVJB 3BP5A 5FYJL 4K9EH 2FHBA 3DX6A 3MLWH 2R0WL 4Z18A 4CRPA 1JZ5A 4Z7OE 4LKCA 1MQKH 1QFPA 3C2AL 4ELKB 2QL1A 4LDOB 2ADIA 2VLKA 3BESR 4GSDH 3WFEL 4ZSOA 4HMEA 3CMGA 4L9LC 4OFDA 1YPZF 4HSQA 4HT1L 3GSXA 4J3SA 1HHIA 4TNWK 4RBPH 3DURA 2VLMD 5D9SB 4RZCA 2IFGA 5BXFB 2YA2A 5AZ2L 1CI5A 3HA0A 3V9FA 3VFSB 1NUNB 4M5ZH 1CLOH 4JDTH 3DRQB 5D1ZD 4NKQB 4WWKB 1GGIL 2KQNA 2A1WL 1CN4A 3Q6GL 1I3GL 1YN7A 5FIEA 4PBWD 5KSBA 2NCMA 4PJEA 5ICYB 2CIKB 1X5LA 4M61A 1RJLA 1EUTA 5KOVC 4YXLL 4ZS6D 1MAJA 3KYAA 4PJ7F 5F9WC 1Y18A 4Z78A 5FA3A 4GW1A 1JF5A 2E8YA 4PJ5B 1V3LA 3QWRA 4N8CH 1S7QA 1NGWA 2V2TA 2PF6A 3FB8B 2X4OA 5LXGH 4YIQA 2VIRB 2UY6A 2FBJH 1LP9A 1MCLA 3ESVF 1RZJC 4YC2B 3EHBD 1OGTA 4OLUH 5FCUH 4LCIL 4OGXH 1QFWH 2Z8SA 1LO4H 3D85A 2K9UA 3GSVA 5ENWA 4YJZL 2VXQH 4LCUA 3HAEA 4PREB 2GYSA 1N5YH 4G6AD 1W72H 5DD5L 1WZKA 3WFBH 1U3ZA 4Z7UA 1FFRA 2EDDA 4JO1L 3KYMB 2QQQA 4OZ4B 1A7PH 4EKXA 1A1NA 3TIEA 5FYLD 4U1LB 4QRSA 3R4DA 1T03L 4Q97A 3P2TA 1SY6H 4LGSB 5DUML 3JV4A 1YQVH 1MI5D 1PJ9A 1MHCA 4OGYL 5EOQL 2A6DB 2NMSA 3L3HA 5HHPB 4EDWH 4ZUWA 1T66D 3M45A 5L7XL 2EDBA 4D0CB 4K3DH 4OZIE 3PIQB 2Q87A 4JHAH 2XTJC 1WAAE 4WEBH 5IF0A 4TSCL 2UV3A 3QXAB 1CGSH 2DDQH 1RZ8B 4NYLA 2Z92B 5F9OH 4JY6B 4XPBH 4UT9H 4HW6A 3CSBA 3L7FA 3G08A 3JWOH 1CD1B 5HVWA 1AGCB 5C3TA 3WE6A 5KN5B 1R3IH 3G5ZA 4W68A 4HEPG 1I85A 4D3CH 4NC1C 1M71B 2BY3A 3K8LA 4LEOB 1ZANL 4OJFH 3WMSA 3WNLA 1UEMA 5EZIH 5CZXD 2MTPA 2GSIB 4E0RA 2H26A 2HT4D 4O58H 1KV3A 1L9NA 3C60A 4Z8FL 1IL1B 1R5VA 5K9OA 5ERWB 1ONQA 4JDVA 4BZ2H 2QSCH 4JPIA 3DMMC 4MCYB 4XPAH 3L5XH 4GBXD 3FTGB 3WLBA 3P4MA 1KC5L 1G7LA 1C5BL 1GHFH 2NR6C 4I13B 3Q6FA 1H3WM 4HPYL 3S98A 4TSAL 1NBYB 2FEEI 2DJ4A 1DBAL 3QUKB 3CFBB 3DECA 4JY5L 3PL6C 5HYFA 3SGJA 5GSVB 1U8HA 4C56E 2FECL 4LPCA 2AAVA 5FOBA 1A3LL 5B3JF 1EUUA 1GSMA 4N0YH 3LQMA 3MLYL 2BP3A 3EO9L 1EHXA 2EZ0D 4YHPA 4TUKH 1XFPA 2R4RL 1FZMB 3EO0A 3ARQA 4PJFE 4Z5RA 1N6QH 4LVHC 2IH1A 3U0TB 2YK1H 3LRSA 3FFCD 1J8HA 5GRJL 1Z5LA 2CDGB 5A3ID 3VRIA 2FD6H 4G6FD 4OD2A 2X1WL 5DD3L 4ZUVB 3SBWC 1CFQA 1DDHA 1JFQL 3JVGA 2ATKA 3CC5A 4MDIB 2F8VA 4V2BA 1ZT7A 5IR1B 1LO0H 1CGWA 3UJTL 1DANT 2VZSA 4ZQKA 4PG2C 1KFAH 1RZ7H 3FCTB 4WTZA 5F9AC 4G9FE 3IU3B 1U8MB 3UTZA 4G43A 5I66B 1XF5B 4Y5VB 1KEGL 4P57A 1ADQH 4CMMB 1A7OL 3T65B 3AMLA 3JV5A 4ISVB 2BOCA 3OAUH 4NRYA 4LP5A 2IQAB 3QDJA 1DJSA 1MPAL 2ZCLL 4RSVA 1D5ZB 1NJ9A 5DJ2A 3DXAA 3K2UL 3WS6C 3G6AA 2QTEA 4UTBH 3ZTJH 2NTFA 3VFGL 2DBLH 3NTCL 4N5ED 4FTVD 5IOPB 1T04A 1JGVH 2HT3D 1HH6B 4NP4L 1EHNA 1OAXL 3SKUD 1T22B 2Z35A 5IQ9A 3W5MA 1YPZE 4HV8A 4O2CB 3ARBC 3S88H 1AFVH 4MNHB 4LLVB 1KB5B 1JCKA 1VESA 3D2UD 1K5NA 3PABB 4CVXA 5HD8C 5TDPB 1IEAA 5BOZG 3BZFA 4L8SC 5FYLL 4MD0A 4PUBL 4NSKA 2RR3A 3A67H 1JGDB 1M7DB 4MAUL 2DQEL 3D5OF 3E2HC 3OB0H 5CKGA 2HFFA 1HHKA 2YOCA 3ULUH 5A16B 4MA1B 2NW3A 5IV2B 2IC2A 5DJDB 5C9KA 1J0IA 2DQIL 4FFYH 1CXFA 1B2WH 1W72A 5H35A 1BQHA 3DUSB 4NRXA 1NC2D 3VRJA 2O5XL 2AK1H 4MSWB 1SY6A 5ETUA 3OAYH 3R0MA 5JNYB 4Y2DA 2BSRA 1Y0LB 4E41E 2AK4A 3WN5C 1UM6H 3IU4L 1G7QB 1G9EA 4LU5L 3WHXA 3M07A 4R2GD 1DTUA 3BRFA 3F8UB 1G7IA 4H20L 4APQB 1J0YA 4URTB 3GMNB 2E5EA 2VKXA 4JFDB 4LLDA 4TULH 3IF1A 4O02H 2WBKA 5AUMA 3T0WA 1AO7D 4O51B 2H8PA 4EXPX 4YHKH 4XI5D 3BJ91 3SCMD 3TC9A 5JOPE 4XP9H 4XT1C 1Y6MR 5ESVB 3GSOB 1E4KA 4FQQB 1AJ7L 2ICWB 2VE6A 1XCQB 2JELL 2FB4L 5CSGA 5HPMB 32C2B 5GRVL 3WEXA 4PRPA 1NGQH 5AYUH 1LE5B 2AEPL 3DX8B 1WIUA 3OPZL 5FUOH 3WIFA 1I7ZB 2I60H 2JB6B 3TA3A 3QIUB 2YEZA 2C1OA 1FNLA 2YD3A 1ZSDB 2CK0L 1ITCA 5AD0B 1NGXB 3Q5OA 3O6KH 2Q8BH 3U1SL 4XMPH 5FO7B 3TWCL 2FH6A 3VFUA 2NPLX 3V4VH 4I0PB 1WZ1H 4XMKL 4DUWA 3FO1A 4MXQC 5HHQB 4R8WH 1UJ3A 3TO4B 1PY4A 3BIKA 1OHQA 3RVWD 1HH9A 5KANG 4D9LL 1EVUA 2P47B 4R0LA 1DBJH 4BFIB 1I4FB 5SWSD 4EUPH 4PB9H 1AD0B 4GKOA 1NGZB 1E4WL 3TT3L 2H6PA 4HKJB 1S9VB 4ORZC 1S9YB 4L5FL 2AQ3A 2VO5A 1X5YA 2F5AL 1ZOXA 4KKBD 2YD2A 4YZFE 5D7IE 3BDXA 4HWUA 1UWGH 3FT2A 1DVFC 5DK0B 3AUVA 5F8QC 4NQEB 5DO2D 5F6IB 5D7KD 4LASL 1MI5B 5I18L 1G9MH 3EOAB 1BVLB 3IDGA 1FSKC 4HUWB 1S3KH 5GS1A 1FDLL 4L3EE 4M3KB 5B3JE 5CCKH 2CLRB 2DMBA 4NO5B 3HC3L 4WO4A 2VN4A 1RURL 4R90H 2FATL 4LSVH 1S7UB 2CO6B 4ZOCA 3IVKB 3LQAL 3KPSD 4UT6H 5FOJA 1QO3A 3UZQA 2CPCA 4JPVL 1JYWA 1KELL 3CPLA 2QQLH 5D96B 5ALBH 4BH7B 4CW1B 1ADQA 1IGIH 4PLJC 4FXGA 4JFFD 1IC5H 2X10A 3QCTH 5J4MA 4EDXA 3EUUA 3BO8B 5D2NC 5HVHB 2D3VA 4PR5B 5HGDA 5CEYB 5EOCJ 4C4KO 4Z7WA 4JM2B 4X6DB 2VZ1A 5KVGH 5BRZA 4G8GA 5ILTL 4KJWD 2BNRA 4Y16A 2VAAB 5EBWB 5J8OA 3F6IA 3G9VA 5FM8A 1CICC 5C0RL 2VC2H 4PS4H 3P0YL 3EBAA 3TYGL 1WK0A 5KVFH 3PQYB 5FYJH 5EPMB 2AEIT 5C0CD 5HHVL 4QHLB 2R2BA 3C5ZA 3VXSD 2DQUL 4P5KB 1HNFA 5GJTL 2CJUL 3GO1L 1Z9LA 3C2AH 3GJFB 4I2XB 5D6DA 3GUTA 3MZTA 4LPXA 1TVHA 7CGTA 4JHWL 4RX4D 3WFEH 1UXWB 2PYEA 3H6JA 5D7LE 4XNMA 4QOKE 5AZ2H 4HZAA 3BI9X 3MACL 2JKXA 3SKNB 1IKNA 2FWOA 3OMZA 1BOGB 4C57C 2NW2B 1GGIH 5JDSA 2A1WH 3Q6GH 1I3GH 5INCB 5IIEA 3FT4A 1D5MB 1K9TA 1A7RL 5DURD 4TNVF 1CE1H 1Q9OB 5IVXB 4C59B 1HOCA 4D2NA 2NY1B 4YXLH 1IGTB 4OFPA 3LH2H 4RFOH 4PTTB 1EBPA 3T4YA 5MI0B 4IHOB 4LHUB 2B39A 3K8KA 5T1DH 2AABL 3ECBB 1TETL 3HB3D 5K9QI 4U6YB 3TFKC 4MS8C 3RZCD 4X6FB 1R3HA 3RDTA 2B5IB 5A2IH 1K2DA 1KTDA 3BGFC 1WC7B 4IS6B 1Y6NR 4P59L 3EGSA 4WW2F 4LLUA 5DQ9B 5HHNA 5MERB 1BJ1H 5IMMB 4RMSA 4U1JA 3EFFB 1P1ZA 1KN2L 1C8PA 5DD5H 2WUBL 3MRKB 1AXSA 1AXIB 1H15B 2C5DC 3GSWA 4Y4FA 2CXKA 1B4RA 4OCLC 3W81A 4F33A 4X7CC 4FFVC 3DSFL 4AEIL 1VGEL 4TNWF 3VRLF 5EOTA 3L3JA 5DUMH 5EOQH 4OGYH 4UDUB 3MOAH 1FCGA 5GS3A 3THMH 2DI7A 2FR4A 12E8H 3NIDE 1OP5H 4GKSA 4XXCC 4PRNB 5L7XH 1HK6A 3LVEA 3FB6B 5J1SC 3GSNB 2IBZX 5GRXG 1UKQA 4AT6B 3LKRB 4OIAA 2YBRA 4TSCH 5C0AD 1DN0A 3WD5H 3ALXA 4HLZH 3D25A 4X6BB 2VQ1A 5BV7B 4KDVA 3HS0B 2GITA 4D9RE 2JJWA 4K2UH 5HGAB 1MAKA 1ZANH 1OB1A 1YYLL 2EE2A 1BX2B 2BSSA 3DROB 3O4LD 4KK8D 4Z7VB 3WFHA 1EXUB 4U1KA 3JTTA 3HZYA 1SMOA 3V6FB 1NC4B 1WJ3A 2GK0A 2F8OA 5C07D 3STLB 3O2DL 1KC5H 2P5WE 4M8VA 1C5BH 3MRRA 4HUUA 3QDHA 3U6RB 4Q2ZA 4AG4L 1AR1D 3TN0C 4HPYH 4X4XA 4TSAH 5TE4L 1FAIL 1YC8A 1DBAH 1L0XA 1CL7I 5E8EB 2XQBH 3IJSA 3VFPB 3VG9B 3FQNA 1JNHA 3AY4C 2F53D 3T04D 1BBDL 1T7YA 4ZFZA 1F58L 2OSLA 3MLYH 5HI4D 3O3BA 4Y4KC 1OF2A 1RHFA 3EO9H 3RGVC 2R1WB 4MJIA 1IAOB 5A40E 2M1KA 2R4RH 3MRIA 3ET9F 4QRRA 2EYSA 3RBGA 1A21A 2XPGA 2EYRA 4OFIA 5GRJH 3FONA 3V5DB 3QZWB 3RTQC 4YAQB 5DD3H 2OP4L 4UQ2B 3LY6A 4LPWA 1UZ8B 3PWLA 3RWIA 1YA5A 1AQKH 3MRDB 2XN9B 3IGAA 2A74B 2CR6A 3OR6B 3UJTH 1NBQA 4S1DD 5GISL 1J1XL 1D3CA 4OZHF 2HLAB 3HRPA 2MQCA 4F80A 3QNYB 5IEKA 3D6GA 2ZUSA 5HYJA 4XCNB 1XF2B 43CAB 2MPAL 1NGYA 4UINL 4YDKL 1A7OH 5D71L 5F7YC 3TH4T 3KG5A 3U4AA 2DYPD 2VL4A 5JORB 2AXFB 1MPAH 2ZCLH 4IOIB 4HGMA 3FL7A 3K2UH 3LDBC 2D9QB 3HAEG 1F5WA 2APVA 3WNPA 3UTTA 3VFGH 2PNDA 1U8OA 2WIIA 5J06A 5TE7L 4NP4H 1OAXH 1BWMA 3ROLA 4H1LH 4O00A 2DM7A 2AJXL 3H8NA 3T0EE 1Q9LB 4UQ3A 3ARTA 5EBMA 4E9LA 2H2SD 4LIQE 2Q3ZA 3HMXL 3BPNB 3HPJB 3OF6A 1ZT4B 5FYLH 2NX5D 4PUBH 3KDMB 2MQ0A 3BZEA 4P99A 4MAUH 2DQEH 2GTWB 2JIXB 1QP1A 5DMYA 3HN3A 4ONFL 1OAYL 3QULB 2JE8A 1LE9A 1VKXB 4BZ1L 4ZFOL 4M6NL 3B3IB 3GHBL 3JBG7 4N0FA 4M1CD 4IIQC 3QXUA 4OZGA 2X4PB 3O6FA 4JZNB 1XR9B 5F70A 3PWNA 3SO3B 5CUSL 3PWPE 1HXYB 5JR1L 3F7YB 4GW5A 3IU4H 1M6OB 1G0DA 4ZXBA 5INDB 3W0WE 3C87A 4LU5H 2X89D 4UDTA 1QQDA 4HK0B 5BZWB 4H20H 2Q7NA 1S5HB 4JQXA 5I71B 2AS5M 1KF9B 3GGWA 4M8QA 1NANI 2WUCL 3N50A 4RMWA 1MVUA 3DETC 2GY7B 4KUCF 3ZKQD 4I8DA 3BVNA 4PRAB 3CSYB 4JZJC 1P4BH 1WBXA 4NWUL 1AJ7H 3RWFB 1HINL 5CD3A 2X70B 2FB4H 4UBDC 3S3PA 2PTUA 1K8DA 1N59A 4Y5XC 1CLCA 3OPZH 4JAMA 3VGAC 4LCYB 3UJIL 3OJMB 5H94B 5HTSA 5TDNA 1HWGB 1KNOB 4U1SA 5I9QB 3MV9B 1UM4L 2FH8A 1G9NL 3BKCL 1CVSC 3TWCH 4WI2A 4LKXA 1N2RA 4XMKH 3AREC 5FO9A 1R24B 5CD5C 5I15L 4NO2A 4JGJA 2Q7YB 3OQ3B 4O2FA 1CG9B 4D9LH 3DBXB 5I16B 4IDLA 4PJ8A 2BY1A 3GSQB 3QIBB 4P5TD 4UMGA 1X44A 1NFDA 4FFWC 1BD2D 5DT1L 4WTZG 4WUKL 3TT3H 2VABB 3G04A 4L5FH 1M7IB 1QSVA 5E00A 2F5AH 3DV6B 4L4TD 3VFOA 3P4NB 5IB2A 4KU1A 1P7KA 2K7PA 3RWDA 1P9MA 2FSEA 4BFEA 4Y1AA 3NFNA 4LASH 3EZ8A 5D8JL 5I18H 4XNUL 5D1ZA 4C56B 2KUTA 1BZ9A 3BOVA 4RFEB 2Y4SA 2DQGL 3F7PC 5JMOC 3IDJA 4PGDB 5GZOC 1EEQA 2Y5TB 3HC3H 3VI4F 2FATH 4NQSB 4XVUC 4ZOAA 3LQAH 2XTJD 2VR4A 1UXSB 3LHPL 3QPXL 4JPVH 4KPHL 1OOAA 1KELH 3QB7C 4P2QB 3O2WL 5C0AB 3MFFA 1QLRB 1NCBL 1PQZA 4PJFB 4TUJB 3TBVA 1J87A 4F7TB 1X5FA 1F4XL 1LEKB 2VDOL 4X9FA 1EVTC 3OGCA 3C8KA 1F4AA 4HHAA 5D7JC 5I76A 1OWWA 4Y4HD 4FXLA 5I17B 5DRZB 3O4LB 1HHJA 5C0NC 1F2QA 1INEL 4QRTB 3AXLA 3DMMD 4I1NB 4GMTL 3FOLB 3ZLQC 1ZXQA 4L8BB 5EU4A 4H1LA 4G9FB 3V5HA 1LK2B 3UPAA 4X4ME 4WCYH 2ZSVB 4V1DE 1FBIL 3VXUE 2NR6D 1ZMYA 2X40A 3P0YH 5JLZB 3TYGH 1KCUL 3I6GB 3ULVC 1T5WB 3PL6D 3K0WA 4F7CB 5KSUA 4XZUA 1WFOA 1JPFA 5HHVH 2FX7L 3SDYL 4HIHB 3CSPA 2F53B 3O9WA 2DQUH 2CKBB 4WI8A 3MJ6A 2CJUH 5I6XC 1MJJA 5DEGA 3GO1H 3T0AA 5CJXC 5DI8B 4J12A 4I9WD 3PGCB 2H45A 3F5WA 3QXDA 4JHWH 5C8JB 2RGSA 2HLFC 1MFBH 1YPZB 2RB8A 5IJVB 2R56H 5DYOB 5FK9B 1WCQA 4TVPE 4NZTL 2X1QA 4XP5L 3QT2A 4UILL 3VE0B 2GTZA 4NQCA 2OI9C 3MACH 3LS4L 4HUKB 3S35L 1MIML 3A6CL 4NUGH 3X11A 1D9KC 1J11A 1H3PL 1T89A 4HPOH 4GMSL 1XGRB 3F65A 3D0LB 3MNVA 1A7RH 2JF1A 2AV1B 1U8KA 3SJVA 5ESAB 4M7LT 3FO0L 4PJ7B 1T2JA 4HS3A 4DJMA 1JHTA 4XXDA 4GBXA 4S1SL 3QIWB 5F7WC 1TETH 1PD6A 4JM4L 5DS8B 3NZHL 4E41B 5CWSA 1ZLUK 4P2OC 3B9KD 3VDBA 3LB6C 3VG0L 2DQFA 3BDYL 5B8CB 3UTSD 3BZDA 4P59H 1UM5L 2RFXA 5SX4H 4Z77B 4QT5A 3ARBD 1ES0B 2OL3B 5FA4B 1HEZA 4JY4A 4MB5A 2R0ZL 3FQWA 1FVEA 1K8IB 2EDRA 5DUBA 1FZKB 4OGZA 4MZ2A 3NCEB 2W1NA 5BW7C 2AJUL 4HIJB 4JREC 3I6KA 1AP2A 4QHKJ 3HLAB 3MV01 4LVEA 1DFBL 1JGLL 1F3DH 3SDCC 2UZYB 2NX5B 4AEIH 1VGEH 3QDMD 1A7QL 4X98A 4Y19D 2PKDA 2GJ6E 2R23B 3C09C 3MC0A 2A6JA 3NZ8B 5EZOH 4WI4A 1T3FB 7FABL 2R0KL 2A73A 1Q9KA 1JZ2A 3CD4A 1FO0L 4DGYL 4ZAKD 5I8EB 1DQDL 1SQ2N 4AQ1B 4P23C 3GKWL 1NCUA 5H2BB 2GAZA 3ZTJG 2JJTC 3TZVA 3W2DL 5JHDD 2F54D 4CAGA 4ZYKA 4PRIB 3ZSSA 1YYLH 1JBJA 2I24N 4ODSL 2WBJC 3CH8A 4NBYB 4N9OB 4EI5C 2OJEA 3SKOB 1YEDA 2NZIA 4IMLA 4GRWH 3VXOB 5BVJA 1H5BB 4ZD3L 1YN6B 3O2DH 5JOFB 3MPCA 1KG0A 5FGBA 1YMME 3D2UA 4AG4H 2COQA 1OSZB 2Z4QA 1J1PL 3V52L 3AAZB 3EDFA 2P49B 3F58L 3DO7A 3QI9B 4WEUD 4L3EB 5IVZB 1R3JB 1GYAA 3MLSL 4PJHF 1BBDH 1N6UA 3VI4E 1LVEA 4OFVA 5HY9B 1F58H 3UROR 3J8F7 4KQ3L 5ALCL 3HI5L 1IGYB 1OP3H 4OF8A 3VWJB 2X09A 2P44B 3EOTL 5ICXB 1FV1A 2ZCKL 4MXQD 4NDMA 4BK5A 3MRBA 3F7VB 4K8RL 4HKBB 1NC2A 1HQ4A 1JRHL 4JFYA 3CVHB 5TH2B 5DJYA 5MENE 2X44D 1I7RA 5DJ0B 3EDEA 5D6CB 2OP4H 5IBUB 1NCWL 4WUUD 4X6EB 1WEJL 3MNZB 3QEUB 5EU5B 2BVOB 4H0GA 4DTGL 4XCYB 2UWEA 5GISH 3JV6B 3IETA 1J1XH 3VXNA 2UYLB 1DVFD 5EO1B 1AO7A 4H25A 5T1KD 3IFPB 1Z3GL 3S34L 1BREA 1U3HB 3LS5L 4ZNCD 3MRJA 4DZBB 2MPAH 4UINH 5EU7C 4YDKH 5D71H 2GT9B 2DD8H 2V7NB 4CKVX 4QF1A 4TVSa 5LGJA 1M05B 2YRZA 1GOGA 3ZT6A 2X4QB 3LQZB 4PJAA 4P49A 1PDKA 3MXWL 5IM7B 2IEPA 4MJ2A 5I1JL 4M93B 4G8EA 1AHWC 5TE7H 5C6TL 4MJ5B 5C0FB 4X7DC 2C3VA 5ID0A 4NNPL 3D9AL 5D7LB 1DQTA 2VLJB 2XTLA 2AJXH 4QOKB 1OQOA 2YPLB 3MGTA 1S8DB 4KRLB 4HWZB 3H3KA 2YD9A 4X4ZA 4DKAA 3GMQA 3LEYH 3SDDB 4YO0A 3VXRB 1TXKA 3IDYC 5IG7A 2XWTB 3MV7E 3VXME 2QKIA 2N1KA 5MEQB 4ONFH 1OAYH 2VDRL 2J6EL 5I73B 3IJYB 4P3DB 2E7LC 3DMMB 4BZ1H 1RUQL 2BVPA 2PXYB 4HK3J 3GHBH 1CICD 1AGBB 1TTGA 3HR5A 4WFFD 1IMHC 3AS1A 4PJDF 4J1UA 5E99L 4W4OA 3D3VB 5CUSH 4RISL 2VL5B 4XRCB 4OTXL 5JR1H 2HMIC 1JIBA 3DGGB 1P6FA 4WJ5B 4EJ1C 4GRLB 3WSQL 3UYOD 4OKVB 3VWKA 2HRLA 3FO9A 4M4PA 1P6AB 3I9GL 5EUOF 2YD6A 1JZ3A 3KWWA 3MUZ1 2WUCH 4FG6C 1DQJA 4HKZB 4LVHB 3LKPA 4BFBD 4NWUH 1I8LA 1HINH 2W9LA 4OSUL 3ARGD 4NT6B 3ARFB 3RNQB 2MJWA 5GSRA 4PRBA 1CLYL 1TJGL 5B38B 1SBSL 5J11C 5E2WL 4DW2L 2BNQD 1EAPA 4LGRB 4MNQA 3UJIH 3UPRA 5KS9A 2IPKA 1EZVX 3WFZA 1I3RB 1U2CA 3CLFL 1MCBA 3F12B 1UM4H 4H5SB 4ZTPL 4I77L 3BKCH 1G9NH 3I6LE 3O2DA 5L2KD 3TFKD 1QA9A 2DLIA 3FQRA 4MS8D 5I15H 4OM1H 4KJQC 1L7TL 3PP3H 3RVXC 1KIPA 4U6HB 3MLZL 3BP7B 4KC3B 5C0CA 5DT1H 4WUKH 1MF2L 3VXSA 3NGBC 4BELD 2OQJA 4AL8L 3NCBB 5C08D 3QFDA 4P4KB 3ARBB 5KG9B 4GW4B 1FYTA 4NQXA 2H3NA 1E4XL 2D7QA 2CH8A 4RX4A 2ZUQB 3BAEL 4CVWA 3D69B 3PXHA 2P5WB 3E1F1 4FFVD 5KVEL 5ESQB 4HWEL 3NA9L 5IMOA 1MCOL 2AQ2A 5D8JH 1B0GA 3L95B 4Y19B 4XNUH 2BVYA 3H2WA 5FYKU 1GGCL 1G7PB 3QEQD 5C2UB 2DQGH 4WV1A 4K07A 4PJHE 4HIEA 2VR9A 5DMKB 1YMHA 1CT8B 3B6SA 4A2MA 4XC3L 3LN5A 4J8RA 4X9GA 2CRYA 1RK1B 2XKNB 4P46B 5LJYH 3QPXH 1QFUH 3BN3B 4WHTA 4KPHH 4NN7C 4QXTB 3PHOA 3O2WH 4WDIA 1QFWI 1NCBH 1N8ZA 2IANE 4KZDL 4KKNA 3WN5B 2VDOH 1F4XH 2CIIA 4X8JA 4ZUTA 1SJEB 5GJSH 2GSGB 5GS2D 5HYIA 3GM0A 3MRHA 3TT1H 2XRAL 4QHUB 4R4FH 4WHCA 1F13A 4JFEA 2XNAB 1INEH 5F96L 2JJVA 4KI5F 2K1MA 4LPYA 4P5MA 4GMTH 2VQUA 1FFQA 1OT1A 2MNUA 1MJ8L 4M62L 1FBIH 1JUFB 2QEJA 2R2EB 1H0DB 3TN0D 1EAJA 4DVBB 4JHBA 1RZIA 4YPGB 3NPSC 4GAYB 5SWZB 5CJOL 3MLVH 3WIHL 5FHBL 5E6ZA 1MJ7H 2FX7H 3SDYH 3SPVA 1FG2B 4NIKB 4FP8H 2JK5B 4Y4KD 4TYUA 3RGVD 4DCQB 4ZFOA 3OKLA 4JG1L 4LBEB 1U8LA 4HLZG 3EJJX 5T33H 4X4YB 3CZFA 3T0EB 3IRZA 5L9DL 4U6TA 4XP5H 4UILH 1I85C 3VD9A 3ZDYF 2FGWL 1WUNT 1MHEB 1JHLL 3IDNA 3LS4H 3NN8A 3RTQD 3S35H 3A6CH 3C60C 4E5XA 1H3PH 3GMMB 4XPTL 2ID5A 2D7NA 3MA7A 1SEQL 3ZKNC 3QNXA 1A22B 3BKML 4ORGB 4G6JL 3H9HB 1TNMA 5GPRA 3QUZA 3FO0H 3K81A 4YDJA 1DVFB 3QUYA 5EU3B 1L7IL 2R29H 5A2JH 3UO1L 1KIRB 4PJDE 3TVMB 2BX5A 4S1SH 5ANME 5L88L 3KPRD 2IAMC 3PWPB 3SGJC 2XG4A 4J23A 3VH8B 3B9AA 4PRDA 1FSKB 3NZHH 3HE6B 3BHBA 5HGHA 3BDYH 3MRMA 4WW2B 1UM5H 1INQB 2NTSP 3F62A 5CZVL 3CFKA 4GXUN 4XNYL 1F6AB 4D0BA 5EUOE 2IH3A 2EE6A 1IM9B 4YHIB 2FJHB 2R0ZH 3O6LL 4FABL 4YHNB 5E9DE 3VMOA 4K9EC 2AJUH 2BC4B 5JO5A 4PPTA 2XA3A 5D2NB 3FRUA 2FZ3A 1DFBH 1JGLH 1UB5B 4LCWE 3JVGC 1J12A 4WU5A 1U8JA 5C09D 4DN4L 3IKCA 3WXWL 1A7QH 3DJ9A 5C2BH 2AXGA 1DQQA 2GJZA 2GFBA 4Z7UF 4S0SD 2XWBA 3BKJL 3LV3B 3I02A 1S9XB 3BH8A 3QUXA 1EO7A 1TQCC 7FABH 2FL5B 2R0KH 3KXFB 4I3SL 4FFZH 1H8NA 4ONHA 1KLGA 4NN6C 4DGYH 1FO0H 5HYSA 1TQBB 3LKOA 3VGHA 1UWEL 1H8OA 3NACH 4PLOB 3GKWH 1U8NB 3BIBX 4HWBL 3W2DH 2F9BT 4F3FA 1L9MA 3CDYA 2FLRT 5IMLB 3TJEL 4M9OA 4ODVL 1O0VA 3PWJB 1RJYB 1T4KA 3HNSL 3PXJA 5TE6L 2DI9A 2I07A 1FZJB 2ZNWA 4QWWC 1NBZB 4EVNA 4H1LG 4LFHG 4P4RB 2J5LC 2FCBA 1JV5B 1URLA 4ELME 3DETD 4WY7H 4HULB 4FA8A 2W65B 5FHAL 4ZD3H 2VB5A 1VFAB 3P11L 5K33A 3WHE1 4U4BA 1KB9K 5LGHL 1HDMB 4FQJL 4JN2A 1IGML 4UBDD 3TBYA 5GZNC 4PGEB 4QXUL 4UV7L 3HPLA 3V52H 3F58H 2AXHA 5CEZL 4U3HA 3HG1E 3HZVA 3MLSH 3O0RL 5IWLA 1QACA 2I25N 3PV7A 4PV9B 3H7LA 2VSCA 4G7YL 2BSTA 4KQ3H 4C83B 1LO2L 2G9HA 4KAQL 5DD6A 5ALCH 1OQXA 1WTGT 3HI5H 4N68A 3O81A 3HNTH 5F6HJ 4N0RA 4HF5L 1S7TA 2V2XB 5ICZB 3EOTH 1XAUA 2ZCKH 3STBA 3ARED 5CD5D 4FQCL 1FN4A 4K8RH 4HJGB 4NO0D 3GSNL 3OXRB 3VFNB 2XQYK 4WW1B 1XIWA 2VLRD 1JRHH 2FX9H 3BGFB 3EAKA 1QEWA 5IFAL 4FFWD 3JWNC 4GLRI 3O8XB 3FQXA 3X14B 2X7LA 2X89A 5FDWA 1WEJH 5BV7L 2XXMB 4MB3A 2PETA 4KI5E 4RFNB 4DTGH 1PX3A 1MNUL 4OZHB 3JWOC 1E4KC 2PR4L 3MROB 4YK4C 5EC1B 4XX1E 2VXUL 3VXUB 1R3LA 1RUKL 2BRQA 4HXAL 2VUOA 1Z3GH 4IRSC 4NQDB 3S34H 1KXTB 3MRCB 1FG9C 3LS5H 1PG7X 3M17A 5FXCH 4TOYL 5F3BB 5CJ8A 2AJVL 3P9MA 5GZOD 1KB9J 3TA3C 2IMMA 5EIQA 4YWGL 3TH2T 4XVUD 3MXWH 3UTOA 5I1JH 5FUZL 4EOWL 3G6JF 4WNQA 3QNZB 1RIVL 4JRWA 1CE6A 4NNPH 5AZEL 1XGTA 5F1NB 1HILB 1UJ3C 2ICCA 1T20A 2A77L 2AJYL 1KXVC 1PG7L 4R0LC 1KIQA 3ZDYE 4WI6A 1G7MB 5D7JD 1WQVT 3ARDB 4QXGL 5C0ND 1RAMA 1AKJA 3TCLA 3T2NL 1JWSA 1WBZB 4P5TA 1KPVB 2J6EH 2VDRH 3QEHB 3W9DB 5TFSL 4M6OL 1BD2A 4J7RA 1RUQH 2FLBT 5H8DA 1FFPB 5BCAA 3NAAL 4ZPTB 1P84K 1T80A 1PAMA 5E99H 4L4TA 3ULVD 4OB5H 2AV7B 4RISH 4OTXH 1IEBB 4NNYB 5GS1C 5EDXA 2NQCA 4CU7A 5KW9H 4WO4C 5FGCB 3WSQH 4Y4KB 3VFSA 2YN5A 3ARVA 1HXMB 5JW5A 1OAZH 3O45B 3K1KC 2HLFD 4WWKA 5F6HI 3I9GH 1AQDB 1S7WB 1UB6B 5FF6B 1TNNA 5E8NB 3X3GL 3GEWB 1FO0A 5T3ZD 5I8KL 4M7LL 2OM5A 5ICYA 2VNCA 2CIKA 4L8DB 4MHHI 4LCCA 3DVGB 4WFEE 1D9KD 2BY0A 3BFOA 1QFHA 5HDQH 2BJMH 3EYVA 4PJ5A 2GJ6B 1CLYH 4Y4HA 3BZ4B 3U4EB 4NKMA 1TJGH 4Y16C 4ZUSB 1FZOB 3AB0C 4X9BA 1EJ6A 5F89A 1Q94B 5D1XA 1YEEH 1GZPA 1JTOA 4ZTPH 1AC0A 4I77H 3OJVC 3T77B 1JTTA 1QR4A 4PREA 2PW2B 3C5ZC 4P2OD 1DQLL 4RCAA 3LB6D 3NFSL 4AEFA 3MXVL 2X5PA 3AVEA 4J3WA 1T1ZA 4DGVL 1P84J 3ULUC 1L7TH 1ORQB 3KYMA 4G6KL 3RUGA 5D6DC 1E6OL 4OZ4A 5HGBB 3MLZH 3GSUA 4HFUL 5LAXA 1XGUB 4JFQA 4Y89A 4ODWA 1LEGA 4JQIL 5BJTB 3SGKA 2BY2A 2LTQC 4R4NC 4AL8H 3BUTA 4ZUUB 1MELA 2A6DA 2ILLA 4RGNC 5BOPA 1E4XH 5F88B 4S0TD 2R2HA 3LPFA 1IKNC 1RHHA 1FIEA 3BAEH 4XNQB 1QR1B 4UUJB 5K9JL 1SVCP 4D0CA 5KVEH 2D31B 1BBJB 3AU1B 3SDCD 3QQ4B 4B0MM 3PIQA 3N1MC 5EU6B 4HWEH 3NA9H 4KKCD 5C09B 1YEHL 5JZ7C 4Y7MA 1NAKL 3BPOB 3QXAA 4EI6B 3MGOA 3HZMB 1O5DT 1GGCH 4JY6A 3TYFA 1F3JB 4MWFB 2I9TA 1CD1A 1FL5A 3TPUB 5KN5A 1AGCA 1K4CB 2EC9U 5IB4B 4XC3H 5E1AB 4ZOBA 5HYEA 5HHOE 2GSIA 2DM3A 4P23D 3Q1SL 5ERWA 3O41A 2ICWJ 3RDTC 2AGJL 4QKXB 1I3VA 5DWUL 4HUVB 3D18B 2R69L 1KJ2B 5E6IA 4P2RB 5MENB 1FL6B 2SEBB 2BCKB 1MCEA 3QH3A 2WBJD 2XRAH 3B9KA 4EI5D 3HHRB 3RWEA 3GIZL 2X9YA 2C3HA 1NBYA 3ZYIA 5J1AA 3HCVB 3CFBA 2ED8A 4UU9B 5E6YA 2NLJB 1T1WA 4YPJA 1MCNA 4GS7B 5DJZB 1MJ8H 1HHGA 2PCPA 4M62H 2XFXA 1C16A 3C6LB 4XBPB 4U1HB 1MH5B 1DZBA 2OX5A 3KHOA 3GI9L 5CJOH 3MV8E 5FHBH 3T09A 4HIIB 2W38A 5FKAB 1N6VA 3TBSB 1ORSB 2J6EA 1EFXB 3N1GC 3U0PB 3H9SD 1JNLL 1N64L 5IBTL 1RIUL 4C55A 2YUXA 1U42A 1WT5A 3AREB 5IR1A 1G9MC 5L9DH 4NO3B 1U3YA 4NO0B 1ETZB 2QQNL 2FGWH 4MCZB 4ZAKA 1JHLH 3OV6A 2F19L 1NBVL 4LARL 3IU3A 1U8MA 3RIAK 2D9CA 4BKLB 2HG5A 5I66A 3CIQA 3MV7B 4DKFL 5JHDA 3IXTB 3V0AC 2F54A 4CMMA 4XPTH 2FEDC 1SEQH 3ALPA 4H0HB 3BKMH 3CCHA 4V2CB 4G6JH 3D39E 1KT2A 1QBMH 1D5ZA 4O9HL 4X7SH 2FECI 4RA0C 1L7IH 3UO1H 1J10A 3QEGH 5L88H 1KPRB 3PGDB 1HH6A 3EYOB 5T1LB 5DDHB 5D5ME 4J4PA 4PY7A 4M7JL 3ZT7A 1M4KA 4LLVA 4UV4L 4KMTL 2PO6D 1N5AB 2O61B 1OM3L 5CIPH 2D0FA 5CILL 1NDGB 4JO2L 4Y5YB 2DL9A 5FGSA 5CZVH 4IOFC 3SHSA 4XNYH 1M7DA 3CDCA 4C4KT 2UZIL 4L3CB 4AIOA 4PJBF 1VEOA 3O6LH 5E5UB 4FABH 1TJIL 5A16A 2GUOB 3GJFH 2IBGA 3NCJL 5EIIB 4C58B 1EMTL 1U2HA 5GGRB 1E27B 2ZOKA 1MFNA 1ZWIA 3G5XB 5KAQF 1GPOL 5J89A 3WXWH 4UAOB 2A83B 3H7BB 2RCSL 2FIRT 1E28A 4HIXL 2LVEA 1EPFA 5JNYA 4FHBD 4WUUA 2GW5A 1G7QA 3BPCA 2AI0L 5EBLB 5T5FL 2GHWB 3QFJE 4QCIB 1LO5B 4DFIA 1WCBB 3QA3B 4WHYH 1VERA 4APQA 4OKDA 3GMNA 1UWEH 2HMID 5J6HB 2VITB 5EC2A 4O51A 1QYGH 4HWBH 1ZA6B 3A6OA 1QSFE 1U92B 4RIRB 1MWAB 5GGVL 5ESVA 5E70A 4ODVH 5I6XB 1AY1L 2YD5A 3HNSH 3LD8C 3WS3B 3ALWA 4Q58C 3KLHC 4FQQA 1QRND 4UT7H 2WWMC 1I9IL 3CX5K 1MCWM 5HPMA 32C2A 4Q9QL 4FG6D 2YS4A 4N90D 2OBGA 3TJHC 1P7QD 1BZ7A 5FHAH 4JRXA 1UWXH 1IZKA 5EO9B 3X13A 3P11H 2B2XL 5FUCE 5LGHH 3QIUA 5BS0E 2Y7QB 1T2QL 2ZUTA 1ZSDA 4FQJH 2Q6WB 1IGMH 2YR3A 2EDXA 5AD0A 4QXUH 3T2QA 1JF6A 2PYFA 2UZXB 5FO7A 3IDIB 5CEZH 1FGVL 4CJ1A 2N4IA 3EO1B 1DQML 4JVUA 2E6PA 5HHQA 3TO4A 4JRYE 3O0RH 5MHSE 2NY4B 3O6FC 4G7YH 1LO2H 4KAQH 5L0QB 3VGEA 5C0EB 1NMCC 1II4E 1MCIA 1NGZA 2AJSL 5C3LD 5F9DC 2VDKL 4HF5H 4OI8A 3A6BL 2I27N 4HKJA 4U2YA 1CICA 3TV3L 2FNBA 2LU4A 3MJ8B 4FQCH 1IQWL 4ZXBC 1ZLSL 3GSNH 4L3AA 4GRMB 4KJQD 3VFVB 5D72L 2ERJC 2Y07L 3KR3L 3QXVA 1FC2D 3RVXD 5C0BE 1IVLA 2DKUA 3IXAB 5IFAH 2W07A 4JQXC 4ZFFB 2XYCA 5DK0A 2ESVE 4Z0XB 2J8OA 4NQEA 1UACL 1QSEE 5BV7H 3P77A 4AY0A 5DJCB 2W9DL 2JB5H 2NY0B 1D5IL 4HUWA 5IESL 2PR4H 4JREB 5F1KC 2VXUH 4S1QL 2KPNA 1JMXA 4HXAH 1OT2A 4NO5A 3CX5J 4MQ7B 3OJDB 5D93C 5M95B 1S7UA 3IVKA 1AIFB 1NEZG 4AM0B 3UYRL 3HUJA 1OTTD 4L4VB 2RAMA 4TOYH 5EZLA 1OAUL 4N0UE 4GAGL 1X5KA 3EJYC 2OXHA 2AJVH 3ARGA 1I7TB 4FXKB 3L1OH 3QISA 1A1MB 4YWGH 3UTPD 2VZUA 1WTLA 1XF3B 5FUZH 3QWRD 1YNLL 1NSNH 3BEWB 4EOWH 1A6TA 4PR5A 3KVQA 2E7MA 1RIVH 3Q48A 3FHQA 5CEYA 5SWQB 3FQUB 1R6VA 1S7VA 3TO2B 4ERSL 2AJYH 1PG7H 4X6DA 1BFOB 2YZ8A 4PJ8C 3TBTB 3LZFL 3CZJA 2VAAA 3D85D 3H9YA 3LIZL 2MOVA 5HI5D 1ZVSB 4QXGH 1D7FA 4G8FA 5CIPA 5DD0H 2H9GA 1UEYA 3T2NH 3B2UC 1GVIA 3DWTA 3MV11 5TFSH 3SDXA 4M6OH 1CDYA 3CVHL 5EPMA 4YXKL 3NAAH 4LSTL 2CDFA 3U2SB 4P5KA 2IQ9L 4PJDB 1IEHA 3GJFA 4LQFL 4DKDC 2AKRB 2O5YL 5F7MC 4PBVC 3MRNB 4LF3B 2HP4A 5D1ZC 5A1AA 2HYMA 2P5EB 4QYOA 2PN5A 5C86A 1I1YA 3OR7A 4NQVA 5DMGC 3SKNA 1N26A 4OF3A 4UB0L 2NW2A 4OGAC 5EUOB 2VKWA 1KJ3L 2Z91B 4YHLL 2DJSA 5INCA 1QNZL 1V7ML 4X7TB 3FB5B 4EIZC 3X3GH 4PJBE 5I8KH 4M7LH 3X12A 5IVXA 1QLEL 4X0KA 3C60D 4QRPE 4HWBA 1G6VK 4LCWB 1IGTA 4PGBA 4PTTA 3EYUL 4LHUA 4S2SB 3LN9A 2MCG1 1XR8B 4U1IA 1ZHKB 1N3NB 4G6AC 1O7SA 3OXSB 4OF0A 1FIGL 4QY8B 4IS6A 4KI1A 5DQ9A 3U36A 5MERA 2ZCHL 2IAMD 1KTLB 4XPFL 1J88A 3EFFA 4RGMB 1T5XB 1PZ5B 2R8SH 4EN3B 3NFSH 2WAHA 3O9WC 3MRKA 3DIFB 4DGVH 3M8OH 4G6KH 1A8JH 3D0VB 1E6OH 1HHHA 3FRPA 4XCEA 4HFUH 3SDAB 3BPLB 4JQIH 2DLTA 4OM0H 1FLTX 2X1PA 1ZHLA 2JCCA 2M2DA 4JHZA 4OBSA 1J8HD 4J2XA 1OWRM 1HYRC 5JA9A 5K9JH 1I1AB 4MJ6A 3GSNA 1T89C 4LPVA 2XZCL 4AT6A 3PUCA 3BX7C 3LKRA 5I1EL 1YEHH 5CMAB 4K55A 1NAKH 4Y8DC 3V6OE 2HT4C 4HS6B 3BW9B 2NYYC 2Y06H 4X6BA 3HG1B 1FNGB 4OIIL 4GAJH 3L3DB 4R4BB 3TNNA 3MTRA 1DUZB 1I8MA 4ENEC 1RJZA 3S36H 5HGAA 2YRLA 3G6DL 2D7TL 4DAGL 4RQQA 3DROA 3E6FB 5SX4I 1D5XA 3Q1SH 3HZKA 2AGJH 3PWVA 1XGPB 5GGUB 2XWJA 5DWUH 3V6FA 1NC4A 1T1XB 1RPQA 3LN4A 4IRJD 3EW3B 4KDTA 4QWWD 3KPNB 2EO9A 1VACB 3QDGB 4UNVA 2OK0L 5HJ3B 4M1DL 1QRNB 3U6RA 4Q9RL 4XP1L 1GZQB 1XH3A 3UTQB 5EBGA 3HRZB 5GIRB 1CGTA 3VCLB 1TCRB 2UY7A 1REIA 2D4FA 3MLXL 4D8PA 1B0RB 1MFAL 2DL2A 5I1HL 5GZND 3NH7L 3RRQA 2R1WA 2GY5A 2YPKB 1TVBB 3BXNB 3RY4A 3GI9H 3ULVH 1IAOA 3KPLB 4YEFA 3JTSB 1JPTL 4FQHB 3QBTB 4ONOA 5B39B 2EDOA 1OGAA 3UBXB 1WGOA 3EYFB 1TZGL 1JNLH 2ICES 1N64H 3QZWA 1CXLA 5IBTH 1RIUH 3DX6B 4RDQG 1VADA 2AK4D 3MRDA 4JJ5B 4XAKD 3TZVC 2AEWA 5KVDL 5F71A 2A74A 4GG6A 2QQNH 5T3ZH 4LKCB 3WJLA 4MQXC 2KKQA 2EEBA 5KZCD 1NBVH 4LARH 5GQBA 3PGFL 1EIBA 2ADIB 2VLKB 4XCNA 4ZSOB 4DKFH 43CAA 1XF2A 3VXQB 3LQAC 1JVKA 3NGBB 3MR9B 4N9GB 1YDPB 3DURB 2MFNA 2C3WA 2C26A 1U95B 5JORA 3HTLX 3I50L 2AXFA 4PV8A 4O9HH 4IRSD 2G2RB 4HFWA 5ISZE 4L29B 5FGBC 5JUEL 3MRFB 3UAJC 1NGPL 3I3EA 4F7MB 4JZJA 1MHHA 1E6JH 4D9QE 3BMWA 5LCVL 1NQBA 4P9ML 1QOKA 4M7JH 4UV4H 4KMTH 3TA3D 4JM2F 3P0VL 1OM3H 1Y18B 4NPYA 4TUOB 4Z78B 5FA3B 4GW1B 5CILH 4JO2H 1N0LA 2Y6SC 1F42A 3HPJA 1ZT4A 1KEML