4FQQA

Crystal structure of germline antibody pgt121-gl fab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab light chain
total genus 47
structure length 211
sequence length 211
chains with identical sequence C, E, L
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqA01
4YHOH 2EDBA 3DGCR 4FOMA 4ZO7A 2X4TB 2VLJB 3AXLA 4YDJA 4N5ED 3KDMB 1XGRA 2IH3B 5AUMB 4ONHB 3GDBA 5D5MA 5C1MB 4JFFA 3BQUB 2DQFA 1DL7L 1A6PA 5CSBA 4EJ1C 1OWRM 2CLZA 3QDJA 5CP7A 1J1XH 1FZKB 1YYML 2D31B 4JFQB 3P4LA 4Z7UA 5FKPB 5CJOL 3HCVB 3HI6L 1LDPH 4Q97A 3LPFA 4HJJL 4G9DA 2FIKB 3ZMRA 2VH5L 3MV9A 3T1FB 4QHMB 5CJQH 1OP3K 1JZ8A 3MUY1 4KI5E 1M1SA 4M7KL 3B8SA 3ELAT 4MNHB 2YD4A 2WBKA 4NO5B 1KPVA 1QP1A 4X5LA 4AQ1B 4PGDA 2O5XL 3DETC 3RBGA 3U0WL 1TZIB 3UTTD 5D1QA 3CFBB 1SJHA 1P7KA 5FO9B 2H3NA 3F12B 3L3JA 4NKDB 1Z0MA 1GGBL 2FH8A 2GTZB 2Z4QB 1YJDH 1DR9A 5KS9F 3DX7B 2P47B 2UWEB 3MBEA 2ADGB 4HWBA 1JBJA 5JXEA 1JWSA 3T09A 3SE8H 1U6AL 1MAMH 1QFHA 3TYGH 3QWOB 1XF5A 2GY7B 4PD4J 1O7SA 2P43B 4CMMB 3GHBH 1AH1A 3ARFD 3B2VH 4Y16D 1V3LA 25C8L 2H2PC 3NA4A 1A0QH 2Q1EA 3B3IA 4X4MA 3V7MA 2DM3A 4QHKI 1NC2A 5F7LB 1AI1L 3CFKA 3MUHL 4FTVB 1EEZB 5IB2B 4NC0B 35C8H 4A6YA 4LASL 3CC5B 2VZUA 2R0ZH 3BEWA 1ZT4B 1D6EA 3KJ6H 4FTVE 4TSCH 5DUBB 3LHPH 2A9MH 1QUNA 3O6KL 2EDOA 2XZCL 3F58H 1OVZA 3GSNL 1V7MH 5E99H 5D2LF 3SDCA 1HI6A 4APQA 5KG9B 1RJLB 1YUHA 5E24E 4I0PD 1DN0A 2MCPL 1YEFH 3MBEB 4HG4K 3QIWC 1VFMA 2GFBB 3VH8A 4N68A 5E2WL 1ZANL 1W0WA 5IMMB 2X9YA 4KVNH 5F21B 3VRLE 4L9LA 4QWWC 3EO1B 3BPCB 2IJ0C 2R2CA 3E6HA 3LRSB 4M8QB 4Y2DA 3EOAB 2XTJE 1E4KC 4BSWA 1RD6A 1MRCL 3NA9H 1PKQA 3WD5H 1NFDA 1HCFX 5LWYH 1E4XL 1BWWA 2NZ9D 1HHJA 3DO7A 4CL7A 3H9HB 4N0UA 1IBGH 3FO1B 5DMJB 3IDYC 4MS8D 3CXHJ 3GGWA 3OKKA 1ZEAH 3IETB 4GW1A 3QUYA 3D2UA 4KJQC 4F7EA 3QA3B 1U8NA 1RURH 1A6AB 3SKJH 4O02L 3U9PL 1RUPH 3GMRB 1RU9H 4LDEB 4JGMA 3OV6A 3ARDB 4C56A 4WY7H 4YGVB 4KV5E 4M4PA 2CRYA 2APFA 4M7ZC 2BY3A 2EEAA 4OF6A 2KZWA 3IXAA 3TVMC 1U92A 4PJ8D 1A5FL 5HGHB 5E56A 4N0FB 3WUWA 4X7TB 3VDAA 3HRZA 1I8IA 5B39B 43C9A 1KJ2L 4U1GC 4ORGA 5E6ID 2I9LB 1MFCL 4U6VL 2ZUSA 4NWTL 1AIFA 1NFDF 3SKOB 2XXCB 5J11C 3IRPX 3CFJB 3MCKA 5SV4A 5M94B 4U0RC 3SKMA 2IC2A 3O8XC 2NQCA 5A16A 2FEDD 3CH1B 1QG3A 3MFFB 2GT9B 3VFUB 3QQ3B 2DYPA 4P9HH 4WY7L 4OI8A 2UZIH 3QUKB 4LP4A 2IG2L 3QHTC 1FL3B 1JVKA 3O3DA 1G7LA 5C86A 4KC3B 1RZ8A 3ARYA 1FE8L 1P1ZB 5GRJL 4U0RB 4JPKH 4OQ1A 4CVWA 4KHTH 3R4DA 2X4NA 2OJZH 3IGAB 5IFAL 1MRCH 1BZQK 2ARJA 4IRZL 5HHOE 2HKHH 4TNVF 2HRPL 3MRPB 4NQDD 5IW1A 4L8CA 3QJFB 2B20A 2D2OA 1YQ2A 5GGSA 1DQMH 3LKQA 3NFNB 3DX8A 4GG8B 3RDTA 3SDYH 2VIRB 2YR3A 2FJGA 2Y6SC 5HDBF 1LK3H 3WFCL 1JYWA 3BPLC 3KYNA 5EBLA 2Y5TB 2AAVA 1W72A 4KDVA 5F7EH 4MNHA 5DJYB 4M62H 3HZKB 4C59B 3EO9H 3FCTA 2DN7A 1Q0YH 3MRDA 3UYRL 3HUJF 4PGBB 1L7TH 4P5MA 3JWDH 2AJZA 5EORH 4LLWB 1OAQL 1KXVC 5F70A 3UTSE 2Z8SA 1CDHA 1HH9A 1IARB 1OSZB 1AI1H 4KV5F 3BQUA 5GGUB 2ZZUT 1S7SB 3IXTA 3EGSB 5EU5B 4AYFA 1CICD 3UTSB 1ZS8A 4PRHE 3PDDA 3RTQB 1YEDB 4QRSB 4I0PB 1QRNB 4BZYA 4R7NB 2Z93A 3OKLA 3TP4A 1T1XB 5EO0B 5F1IA 2HKFH 2QQKL 4O51A 1LGVA 1QSED 5DJ6A 4ZXBB 4R4BB 2FGWH 2NLJB 5FYKD 3AMLA 3RY6A 1IGTB 1QQDB 1B4RA 3QT2A 1EBAA 2E8YA 1YPZB 3LSOB 4M7JL 5J4MA 1RZIA 1Y18B 3HKFA 4P5MB 4DUWA 1CL7I 2VNCA 5GS2H 4DJMA 3DMMC 5EOCH 5ALBL 2PW2A 3ULUF 3MLVL 4M61B 5HDBE 5GGSY 1JWMB 3QHFH 3GSOB 5D7LE 3VDBA 1T03H 3MROB 4M7KH 3WXVH 3MRQB 3EZ8A 1IC1A 2MHAA 5DI8A 1U3HC 5D7LB 3RWEA 3CLEL 3NCYP 3OZ9L 1ES0B 3WNPA 3FRPG 3DOSA 4J6RL 3RWCB 4KPHL 4AEFA 3BN9D 2ZUXA 1I1FB 1U8IB 3F7YB 1PKQE 4LSRH 3G6JF 1A1NA 1H3GA 4TULL 4TVPE 1VEMA 2ESVB 3O3AA 5D7KE 4NUJB 3REVA 2BNQE 1FL6B 5F96H 2CRZA 4IRJC 4UTAH 5E2UH 1XGQB 3VJ6B 1BQLH 5E2VH 2XA8L 4E41E 3IVKA 4DVRL 4EUPG 1J5OH 3TCLA 1E4WH 4HIHA 3T77B 2H6PA 5C9JA 4JFZL 3RVWC 5K9QG 1AGFB 1OGAA 4GUPB 3FT3A 2F53E 2WBJC 1CLOH 3HRZB 1YECL 2MKWA 3O6FD 3D9AL 5DMIH 1DVFB 1QBMH 2VZTA 2PYED 3LH2H 4XP9L 3N0PB 2F53B 5HI3D 2E7MA 5DD5H 1LNUA 1U8PA 3E8UH 3MUGB 2FWOA 1NCCL 4K3EL 3SQBA 4YBLB 3BVNA 1M6OB 4K7PH 3FQWA 4F7MA 1RJYB 2BK8A 4YK4C 5C0FA 1A4JA 1IRAY 1NLBH 3LDBC 2AXGA 4GKZB 3VFTA 4F7EB 1QFPA 2EDKA 4L8DA 5F7HA 1UB5A 3IAQA 5EOTB 4M3JA 1K8IA 1LO2H 2L0DA 3VWJB 3ZZ1A 4MXWH 4KKAD 4AIXA 6CGTA 1BQSA 1G6RH 1JN6A 3IDUA 2A1WL 4U1HA 5I8KL 2FJGB 3LS4L 5C0JA 3ARVA 1FC1A 3H0TA 5IHLB 3QJFA 4PJDE 5GGSB 4WW1B 3DX8B 5FKPA 4UOW1 4HBQA 1OP5K 1BD2E 1T04A 4U6HA 4TOYL 1BVZA 3MGTB 4JVPA 4ZD3H 4D9QE 5EFIB 1PLGL 3LY6A 4KH2A 3EHBD 4RGOL 5JW5A 1BD2B 3MXVL 4H5SB 1HKFA 1FLTX 4YQXL 4UTAL 2AK1H 1JNNH 1U8LB 4ETYA 1MVUA 4HEPG 3P3YA 4F33A 2NY4D 4MXQC 4P9HC 2AW2A 1O7VA 3OR7B 2Z31D 4PJ7B 1DLFH 4HS3B 3SGKC 4KUCD 5L7XH 4GRLD 3TBVA 3MOQA 4KGJA 5D2NC 5FYJL 4CN6A 1PQZB 2MPAH 3FO2B 4CNIB 3G9AB 4TSBH 2WBJA 1F97A 3OPZH 5DHXB 3WIFB 4H25B 1DLHB 3K8MA 4RFNC 4Y4FD 4LIQE 4D9LL 5B8CA 3BH9A 1ZT7A 1AD0B 3X13B 5GS0H 2DJUA 4UOJA 3TPKA 2HG5B 2MCG1 4Q6IC 4HAGA 2BRQA 3RL1B 3FMGL 4OV5A 5A2JH 1NGWB 2IALB 1YMMD 3T3ME 2IMMA 5DVNA 3BRGC 2D4FA 1U58B 4WUUE 4FQIH 5EZJA 5EU4A 2ZWLT 5SWSB 4EDWH 4K9EH 5FGBA 3RJDA 1CN4A 3H3PL 4YHYB 4Q9CA 1C5DA 2FIKA 1JRHI 2JJUA 4UILL 4NZRH 4Y4KD 3CDGB 1EAPA 5FGCE 3WKML 5EZIL 1ZA3A 2FYYB 5DMKA 2P49B 3NOIA 4DEPC 5MENE 4BSVA 1T20A 3IXTB 2V6HA 1EGJL 4MCZB 4JFFB 4I77L 5TQ0L 2IANB 4H88H 1CXKA 1KBGL 3MLXL 3IFPA 1RSFA 4FG6C 5CINH 4WENB 5ERWB 3VFGL 1FYTB 3RKPA 4LHUD 3CUPB 3FRPA 1ZVYA 2DI9A 2LQRA 2AV1A 1KC5L 4F37F 3S9DB 5T3ZH 4NN5B 1VDGA 5TE4L 3QEHB 5EB9A 1G7PA 3GFUA 1OQXA 2ORBL 4HWNA 4ZUSB 5GGTL 4U7SA 3DMMD 1UVQB 3OWEA 1JHKL 4H8WH 4I4WA 4HS8H 1H0DA 3LIZL 5IESH 5JNYB 2HAZA 3AREA 1V3JA 1S7RB 5T3XL 4EXKA 3WFBL 4UUJA 5KVEH 1KYOJ 3MRLB 2CR3A 4LVNC 4LLMA 1U2HA 3UYRH 1LHZA 3T4YB 4XMLL 2FYYA 3P4MA 3FTGB 3CFDB 5T33L 5DMIL 4E9LA 2W0PA 2CIKB 4KRMB 4LQFH 4OF8A 4POZC 3DMMB 4OCYL 3TA3B 4HC1A 2N7AA 5DQJB 4PRID 2QHLA 3IDIA 3ZHKA 5AYQA 4JFPB 4JFZH 1OARH 1DBBL 1AQDB 3HNSL 5DD3H 4YXKL 4G8GE 2VC2L 4S0SD 3UEZA 3EJJX 3Q0HA 1KELL 1AHWB 4Y2DC 5B39G 3U7AA 4NKIH 1GIGL 2P44B 2I9LA 3GK8L 3GMNB 4PG2C 1OAXL 3ULUE 3EGSA 2PTUA 5EU5A 1J8HB 3OAUH 4S0TD 1VERA 3I6GA 1B9ZA 5IROA 1GPOL 4PJXE 2B1HL 2BNRE 1YY8A 4P49A 2PR4H 4UT7H 2PYEE 3Q6GL 5AZ2H 4YDVB 5T3XD 5GXBB 4OGXL 4PJGB 1RZKH 1T5WA 2OXHA 4JO1L 1KNOB 1OQOA 4K3JL 2EE6A 3P4OA 4PUBL 2BFVL 1JNHB 2PN5A 2X9WA 4RRPA 3IU4H 3PWPD 5LGJB 5GSVA 3G04A 1KIQB 3RDTC 1R5VB 3D69A 4CN1A 5CEXA 3C5SB 4U7MA 5H2BB 4JFDE 2H45A 2FD6H 5D1XC 1D9KA 5J7CC 3QHFL 5IM7B 3LQAH 4QXTB 1P6FA 4P4KC 5ALBH 1VESA 4HV8A 4WW1A 2ZP0T 4HZLB 3NIDF 1A5FH 4O2FA 4OZGA 4NN6C 4WTZA 4XBEH 2F58L 4IHOB 1M7DA 2NY2B 4YIQA 5JXEC 1EJOH 2DQDH 3L3OB 2C9AA 5DRZA 3UAJD 4DWHA 2DKUA 4ZFFA 1INDH 3ULSB 3RNQA 4XHJD 3V52H 4JRXE 5FYKU 4S2SB 1IM9D 3KPPB 3P11L 4GQPH 3BUTA 3O8XB 3RWIA 4ZO8A 1C16A 5C2BH 2YWYA 2UYLB 3BT2L 5GRWA 1G7JA 5AEAA 5LWYL 3VXRD 4XTRC 5FUZL 1CXFA 1EEZA 3LEVL 3TT3H 4OF3A 5F6HJ 1F00I 3CU1A 1VENA 1JGDA 4XAWH 2IFGA 3DRQA 2KZ1B 5DRWA 1MELA 1ZANH 4HIIA 1ZWIB 5HYJD 2P5ED 3DROA 4HUMB 4YIQB 4BQ8A 2KH2B 4GUPA 2V2XA 1QSEE 3NGBB 4FFZL 3GMPB 4MJ5A 2EXWC 5D70L 3OF6A 4X6DB 4M62L 3W0WA 1PW3A 2QKIA 3LKNA 3C5ZA 3EFFA 2OTWA 5E94B 4ELKA 1WBXA 1FGNH 4NKDA 4X6DE 2BY1A 1ZT1B 3EYUH 3SJVA 1GGIH 1RULH 5ID1B 1TTGA 4PJEB 35C8L 2GSIB 3BP6A 4XBPB 1JWSB 1AXTH 5GJTH 4CAGA 1OPGL 3NTCL 3KDMA 1WZMA 1LK2B 2XACC 1S5IH 5FUZH 2AQ1A 4ZODA 5DFVD 1CICB 3UTSD 2VLKA 1B3JA 3V4VL 3FB5A 2UZXB 4ZUVA 1CGYA 2BERA 1NUGA 1J7VR 1EK3A 1L4IA 2CK0H 3QP3A 5F97E 4ERSH 1KXTB 2F9BT 1MAKA 3ZTNH 2EC9T 1A7RH 4P9HL 4BFEA 2AJUH 3FQRA 4FQ2H 2NY1D 1OW0A 2HH0L 2FHFA 1U58A 4OM1H 4TRPL 4XBEL 1KIQA 2XWTB 3ARDC 4JDTL 1E6OL 3EOBB 4KXZI 1T66C 3VFWA 2COQA 2JIXD 4EEEA 2J1KA 1GXEA 4Y16C 4RQQA 4FQJL 4LPUA 3MCKB 3C6SB 3MLWH 4Y8AA 5HYSA 5HHNA 2PTVA 4PUBH 3QWOA 4FQQA 1T3FA 3FFCE 3WHE1 2IPKB 2DI8A 4NJ9L 4OGXH 5I15L 3LD8C 5AG9A 3OKDB 3WIFA 1UVQA 1ZHKB 1WVZA 5ICZB 5HHQB 1Q0XL 3PP3K 1QO3B 5IOPB 5J1TC 2R69L 9CGTA 4GW4A 5GS2D 4GW5B 1ZMYA 2B4CH 5CGMA 3OJDA 4KAQH 4WTXA 4KDWA 3RJQB 4NIKB 4WFGD 1LILA 5DD3L 3QWRA 1RIVL 1QR1B 3KYKH 3HNSH 2NW2B 4NKOB 5TGBA 1IAIL 4D9RD 4K8RC 1ORSB 1BP3B 4OZFG 4JN1L 4FABL 2BMKA 5CEXB 3KWWA 5KOVC 4DOHB 4J7RA 3G04B 2LTQB 4YDKL 4OIIH 4ONGH 4E42B 3PABA 4BSWB 5HGDA 3VD4A 1S9WA 1TLKA 3W9DA 2YBRB 4IDJL 3LRSA 2FGZA 5L8JB 3H0TB 5A2FA 4Z7WB 2XZCH 1T4KB 1N5YH 4RWYL 2PNDA 1FAIL 4P57B 4G9FD 3AC0A 3NPZB 4HIEA 2V2TB 5LVEA 4LASH 4NRYB 2KUTA 1S9XA 3VG0L 4K3DH 1ORQB 3FKUS 1G9MC 3VFOB 3QG7L 4M1GL 3SE3C 4WWKD 3C9NB 3T3PE 1EAJA 4JFEB 5IQ7H 1RK0A 1KCKA 1U8KB 4O2CA 3TYGL 2DOCA 3VGFA 4KWUA 4L29A 3RTQC 1CGSH 4YXHH 4P46D 4UNTA 4K23H 1QEWA 4HCRH 1NMBL 4HULB 1IGJA 4Z95L 1OOAA 1HNGA 4EN3B 4HJ0C 2DB8A 5DD0L 4OF0A 5CS7A 5GRZA 4QXTA 4AG4H 3DRQB 3BKML 3IDMA 3PWPB 4HG4J 5EZIH 5EUOA 1LP9A 3B9KC 3D39A 4P4RB 3L5WA 1HK6A 4J3XA 3MV8A 4KKBD 4EI5A 5ANMB 2YD1A 4XNUH 1VEOA 2OQJA 4U1HB 1A14L 2VXVH 3BP5B 2FDBP 3JTTA 1BQHG 4DUVA 5T5NF 4PRNA 2X41A 4JGUA 4PP2A 3R8BB 3ZE1E 2ZUWA 1NMAL 2RHEA 1ZHBB 2YD7A 1R3HB 4UIKL 3CFBA 4AK1A 4LPWA 1J0KA 2DDQH 4QT5B 1J8HD 2RR3A 4P5TC 5GS0L 1MNUH 1R3LB 3ILPA 4M1DH 3SBWC 4OTXL 2QHRL 3SOBL 3CGTA 1FLRL 4YFLI 3IAGC 3BSZL 1OTSD 1HDMB 2I5YH 4R0LB 5DC9B 5K33A 1DQQB 1YY9D 4MJ4A 1JPGB 2PYFA 1MHEA 2VLLB 5HSFA 5K9JL 2GAZB 1KV3A 4WV1C 3SGKA 2JJTC 5L7XL 3T2NH 4X4XA 5JW3H 3ULUL 1FNGA 3DUUA 5EUOB 1I9RH 4S1RL 4Y5YC 1NEZA 4OFVA 4YHOL 4GAYB 1PZ5A 4ONOA 3B2UD 4DW2L 4QNPE 2H9GA 4M9PA 2NY7L 3KPSB 4PV9B 3O81A 5D93C 3GMPA 4MJ5B 1INEH 3LSOA 5LCVL 2BNQB 1MCQA 3V5DA 4EIZC 3QUZB 1K4DB 1EO8H 3BH8A 3ZDXF 1XGTB 4YX2L 3AROA 2N56A 3NCEB 1S9VA 5B3JE 4HKJA 1TNMA 4XNMA 2KBGA 3WS6A 2XN9D 4IRSC 3LRHA 5DEFA 3C6SA 3CZJA 1KN2L 2DQHH 4K2UH 3DNKA 3S36H 5IMOB 3AM8C 1MRDH 1W8NA 4WI2A 3CFCL 1YDPA 4HUWB 5EO0A 2V2WB 1CICC 2DI7A 4JFFD 4OLZL 2H9GB 3CMOH 4X5XA 1D5BB 4NPYA 4HX1A 4X0KB 2YPLD 1AE6H 1QPPA 1PBYA 1R3KA 1NBZA 3HAEG 2XKSA 4RNRB 5A43C 1LEKA 5FXCH 3BN9C 4PRIE 5CKAA 3FO9B 4OIBA 3BSZH 3MV9D 3AU1B 2ZSVA 4KJPC 3N1FC 4XVSH 2NW3A 4OTXH 4XWOC 5FECB 5EBLB 1B4JH 4Y4HB 3LH2L 4L8SC 4NYLB 1T0MB 4UZGA 3UTZA 5C0JB 3QDMD 2H1PH 1A3RL 3NCCB 4MA8L 5MI0C 1IGIH 4YHKH 3DYPA 1LEGA 1K8DA 2RB8A 5LGJA 4OZFA 2A6JA 2O61A 4NQTA 1DBAH 1CK0H 3C09C 4J3WA 3MV7D 4DVRH 2XN9A 4P23B 1RJLA 3OBAA 5FFLA 4LSDA 3K2UL 2FR4A 3C08H 1S78D 3JWNC 4YAQA 4LPTA 3ALPA 1CDCA 2B7DT 4W4OC 4QRSA 5AAWA 3BN3B 4QO1A 4PRDA 5D6DC 5IMLB 1BBDL 5IHUL 4OZGF 1MCFA 3VI4E 4D0BB 4KMLB 2D9QB 4LIQH 3BKJH 4Y19E 4YFLF 3C60C 4ZSOB 5I74C 2Z91A 4CU8A 5DHVB 4Q7DA 1Q1JH 4LSRL 1ZLUK 4BFIA 4Y19A 3G6JA 2XPGA 2YUVA 4J8RB 1VGKA 3ULVC 3H42L 1ZSDB 2R1XB 5JHDD 3GSUA 4P3DA 2V17H 1Y18A 3NVQA 3CLEH 2AXFA 2ZCKL 1KJ2A 2GJ6E 3MLSL 1RUAL 4OLXH 5IVNA 2DQTH 1C7SA 4M48L 5KVDH 4JRYE 3SGEI 2X4OA 4PYGA 1K9TA 4KK5D 3ULUC 2HJFB 2ICWJ 2WBWB 1SJHB 5IHZB 4WWKC 3VFVB 2VDPL 4XWOD 4JFYA 3BESR 3HLAB 4XMKH 2YRLA 4YDKH 5D9SA 3VI3E 1IE5A 2KKQA 4DGIH 1LE5A 2D7QA 5H37G 2R1YA 1KLUB 5IK3B 1PX4A 4FZ8L 5T1KB 1U8IA 3PWNA 4NKMB 5EZLA 1BPVA 1OHQA 2Y36H 4HKBB 3BDYH 4KAQL 4QY8A 1KCRH 2P5WE 4OD1L 1EV2E 3ABZA 1ADQH 3QUYB 1KJMA 1N59B 4FXGB 3JV6B 3BXNA 3TBYB 3QUKA 5CSZB 1IC5H 5DLMH 4KQ4H 3E6FB 3N1PC 2P5WB 1Q0XH 1WZ1H 2VWEC 3EYSL 3D85D 3DUHA 4HWBL 3HPLA 3VWJA 4CRPA 2DJ4A 4XXDB 3X14B 1P2CB 3RL1A 4BK4A 4ZOAA 4XVJH 4L3ED 4Z7QF 1L7TL 1OCWH 5DJ0A 1NCBH 3P4NA 5GGVY 1Q0YL 2E5EA 4X7TA 5IEKB 3HG1E 2R8SL 1G1YA 4P3WA 1GGCH 4OLEA 4M9OA 3NH7L 4JJ5A 1BZ7B 4J3TA 5F7EL 4NRXA 4I5BA 1A3LH 1NGPH 4YHPB 3VD9A 5TE7H 1CFVL 3QXUA 1ADQL 4HUNB 4Y4HD 1CFQB 2VDOH 3B2UC 1KCRL 2BXYA 4X6CE 4U1NB 3PF2A 5IBLC 5H35A 5INDA 2IMNA 4F7MB 4CNIA 3LN4B 4JB9H 3RWDB 4PJCA 3I2CL 3B5HA 2ATKB 1B6UA 4KROC 3ULVL 4LSSH 3H9HA 3V4PH 3P40A 5ENWB 4FFVC 5CEYB 3VXRA 2IQAA 1NCWL 5D1ZB 4NN7C 5CBEA 4WTWA 1ZHNA 5AAMA 2EKJA 1FIGH 3JTSA 2NZ9C 2PXYA 2IG2H 2FX9L 5KVDL 1BFOA 4PLJC 5ETUB 1HQRB 2WQRA 1TMCB 1SEBB 2FATH 3IJSB 3MLSH 3QUZA 4NQEA 4UBDC 5CGYC 3WFHB 4AM0A 4NNPL 3MX0A 2F54B 2VDLH 3M8OH 2LAGB 4JVWA 3UO1H 5C0ND 3W0WD 3SGDH 5L0QC 4F80A 2HFGH 1TTFA 4L3EA 3C87A 4HF5L 4XPGL 2F54E 1NGPL 1QBLH 1DEEA 1TTUA 3MV8E 4XRCA 2HT4C 1PY4A 3FQUA 3VFMA 5D70H 2DM7A 1XCTA 2MQ3A 2OTUB 1QLEH 2CIIB 2R39A 3RTQD 4LLUB 3CDFA 1D5ZA 3V6FB 4XPTL 1OCWL 3MLRL 3VXPA 5FUCC 4PJ9C 4GXVL 3O3DB 3K2UH 1RUPL 4O02H 3U9PH 2YZ1A 4PRHB 3L3GA 3JSSA 1IGCH 5K9OA 5M7QA 1YEKL 4WFHD 4C83B 3PQYE 2BZDA 4LEXH 4MJIA 2EXWD 4QXUH 2EDTA 1KCVL 4WFEE 4X99B 5HPOA 1NCUA 3DIFB 1JZ2A 5HDQH 3JVGC 3H7LA 1MCDA 1IGIL 4OFPA 4EVNA 4ZMAT 3MRIB 2ICEA 4LEXL 1MHCB 4M00A 3TVMB 2H1PL 2MQCA 3QQ4A 2NY4B 4YC2B 3P77A 3T2OA 5ILTL 1YPZA 1FVEB 1BD2D 3O0RH 4MSWB 2VZOA 1NCNA 2D7PA 1EJOL 1W72B 2AJYH 1TXKA 5IEKA 1GH7A 1XGQA 3KLAB 1BOGA 4Q0XH 3VFRA 3QEQE 1N0XH 3F7YA 1JV5A 3QFJA 3WNLA 1V7ML 3LKOA 3VXME 1UKQA 2BSSA 1L7IL 2YXFA 3OKMB 2DJSA 1MI5A 3OKNB 5MEOB 3JUYA 2R0ZL 5BQ7A 1MRDL 4JDZB 3D3VA 1KB5B 1QD0A 5I74B 2V17L 1BX2A 3DJ9A 5TDPB 1I1FA 3C8KB 1ONQA 1A0QL 2OYPA 3S35X 4P57A 4ZYKA 1J8KA 2HN7A 4ODTH 4JY5H 4G9FE 1FC2D 1HHHB 5DGRA 4MD4A 1WZLA 4HAFA 4ZPTB 4UT7L 4HUXB 4E42A 5IVZB 5IEHB 3RDTD 4R26L 1N7ML 4MXVF 1U36A 2NLJA 3V4PL 2EDYA 5KG9A 3I2CH 5D7IE 3V4UL 2VC2H 3IDNB 3CZFA 1CK0L 1E27B 3QPXL 3TJEL 3W0WB 5C0BE 3DX6B 1RIHL 3VWKB 3HE6B 1GHFL 4NQCA 4PJ8A 2WLYA 3S88L 3GMLB 3PHOB 4AT6A 3EDFA 1A22B 4BM7A 4M1DL 1MNUL 3C5JB 1MREH 5IMKB 1ZLUH 5C6WH 4ISVB 4NHUA 3U6RB 4OF7A 3CSYA 4BZ1H 4GW1B 3BO8A 3GSRA 4MD5B 3S88H 4D2NA 2FBOJ 2QV2A 4NQUA 3C60D 3FFCD 2OL3A 5FB8B 5CD5C 1UM4H 4GRMB 4LGRB 4DN4L 2X4PA 3JWOL 2CGRH 5LGHH 2DTML 3I85A 2P8PA 3S5LA 4NO0D 3TCXA 4KQ4L 3HAEH 5F9JA 3ZE0E 3MODL 3H2WA 2YD9A 1NC4B 3VI4F 4ZPVB 1S78C 4O58H 2L7UA 5EWIL 1XIWD 5ESVB 3ZLQC 3GSXB 3GSVA 4OSUL 1KLGB 3LKQB 3NFNA 4XCNA 2NY3B 4R97C 5F9DC 3MJ7B 4OLUH 2DBLH 4JPWL 1HHKB 1T7XA 5A3ID 2WUBH 2QKIB 4Z95H 4O2EA 2JIXB 2Q7YB 2FEEL 4FZ8H 4QTIH 3FL7A 5CJXA 2YRZA 4X6DA 4YXHL 1WAAF 3NMEA 1Q9LA 2YOCA 4FFYH 3KWWB 3SDDA 1UQSA 2E9WA 3QCVL 4O2FB 4R0LC 1DE4B 5ID1A 1DSFL 4RMTA 5C08E 1T6VN 2PXYC 2HJKA 3FOLA 1XGUA 1G7LB 2IH1A 3FB8A 3RWFB 3H3PH 3LKOB 4WHDA 1CFSA 5C08B 3GJFK 4GSDH 5E00A 4Y88A 3QUZC 1DDHB 5HYJA 3ROLB 1T22A 1HIML 2ED8A 1G0DA 3QIWB 2YC1A 3FT2A 1PKOA 4YDLB 4Z7WE 4TTDD 1IKFH 2HTLC 3PHQA 2HTKD 4KKLC 5L88L 3EOAA 4GT7A 8FABA 4PP1D 4HHAB 1I9RL 4GSDL 4S1RH 2NYYD 3BZ4A 3C9NA 4J4PD 3FAXA 1WWWX 3WDHA 1CF8H 4PY7A 4XB8A 4OIIL 3HZYB 2FO4A 2B0SL 5GRVK 3TO4D 1EZVX 2I5YL 1BAFL 3D39E 1H5BA 2ICES 3CMGA 4PJAA 4JFEE 3WV0A 4FFYL 4PJBF 3SDXB 3JXAA 1J1PL 4OGZA 4PY8I 3V7AE 4U33A 4H26A 1JNLH 1CGTA 2R9HD 4GH7B 3SDXE 1NMAH 1ZT4A 2YUWA 2VAAA 2NY0C 3GRWH 2FLBT 5JLZA 3FT3B 1AGDB 5AD0A 1EXUB 3SDCC 4APQC 5FKAB 1R3IL 2XG4A 4TQEL 4PGZA 3SDAC 5LGHL 3I3EA 1NANH 4JN2A 2GITB 1FV1B 4HS6B 3PWJB 4GJTB 2FX7H 4UDUA 1G7PB 4YHKL 2ZKHH 2P8MA 4X6EA 3LS4H 3RA7L 5JPMB 3KLHC 1NFDE 3ZSSA 1I7RB 5F3BA 4M6ML 4CVZA 4ZUVB 5JNYA 4HCRL 1B4JL 4WO4A 3MRHB 3IB4A 3RVUD 5FO8A 1CLZH 3ARBA 4QRUB 1BAFH 3SE4C 3DGGB 5TF0A 3HZVA 1QFWI 5DHVH 3S5LG 3RZCC 5K9KA 1MCCA 4MD4B 2QQNL 1IAKB 4H1LB 1R5IB 3BP7A 2HN7B 4M1GH 4WUKH 4J4PA 5F9JB 4M5YH 1E6OH 4N0RA 1JYNA 5JQ6L 2VQUA 1IKFL 2JKXA 2X4NB 1AQDA 4XCFL 3WUZA 2HFEA 5EUOE 3E8UL 4JM4L 1G9NL 1NFIB 3NFPB 3BWUC 1CFBA 3OQ3B 3GMNA 3ARQA 3KPSE 3QEQA 3U46A 2L4OA 2R2HB 1VPOH 5SWQA 1AQKH 4X4ME 2CK0L 3EJYC 1AFVH 3TLRA 2DLHA 1YPZF 3JV5A 5BMFH 5L2KA 1FZOB 2X4UB 3WSQH 5JOFA 1CYGA 3BI9X 1P6AB 3DXAA 4N0CD 4X4YB 3VW3L 1PSKH 1NL0L 3Q6FA 1BZ7A 4S1QL 1ZLSL 2X1WL 3BP4B 1X4YA 2R56L 2AABL 1EX0A 3GMMB 4OLUL 5TH2A 1OP9A 2F19L 2WP3T 5IV2A 3QJHA 1GGIL 2LVEA 2R0KL 1NCTA 2K9UA 1FGNL 5K93A 1HHHA 1L7IH 2EZ0D 8FABB 3WIHA 1DLHA 4LSQL 3ULSA 2VXSH 2Q76A 5E0QA 3T0XA 3BQUC 1T2QL 3HAEA 3STZB 3KYOB 4G9FA 4G8GD 2D0HA 3KPQB 4TVSa 4NN6B 4X7SL 2ICWI 3T3PF 3JWOH 4MD0B 1TNNA 5K9JH 1UM4L 2WBJD 1AY1H 1LEIB 4HZLA 5EG6C 3QDGB 2ID5A 5I2IB 5ILTH 2AVGA 3MLWL 4PRIB 2EE3A 1BM3L 2GTWB 4CVXB 4LLAA 1KLUA 3SDDB 4IRJD 2OCFD 3GSWB 3VXMA 4O2EB 4AMKL 3K3QA 5J12B 4D8PA 4PRAA 2QTEA 3DXAD 3VWKC 5EZOH 4HKZB 1D5MA 2BCKA 4OGYH 3RBSA 3S34H 1OAKH 2Y36L 4KHXL 5CJBA 4ZNCD 4XNQA 4GAFB 4MQ7A 4Y4KA 1QNZH 2UWEE 4CGTA 3X11B 4F3FA 4UDTA 5IF0A 4EXPX 5HVFB 4JRXB 4ELKB 3JBG7 5DWUH 3FB7B 2VLJA 3AXLB 2P8PB 1M7XA 5E4IA 3OX8B 1MCJA 4Y16B 2A83A 4LKCA 5EO1B 1NMCC 3ARFB 4O00A 3ZE2E 2H2SC 1LVEA 4I18B 3MRGB 3QQNA 4IMKC 3NABH 1BFSA 2A9NL 5C0CE 1FSKB 3UJJH 3TZVD 1NGQH 3QG7H 4JFOB 2VDLL 3M8OL 1U3HB 3SDXA 4X6CA 3VXQA 5JTWA 3WL9B 2WSKA 2HFEB 1PYWB 5CMAB 2QLVB 1MHHB 1Q9WB 2FATL 3UJJL 5BZWB 3T0VA 4I9WE 4HH8A 2NR6C 4L4TE 2OZ4A 2C1OA 1HH6B 2PTTB 3VRJB 2NY3D 2PO6C 4LIQL 3UROR 5INCA 3LS5L 3HTLX 2OSLA 3F7QA 4JKPH 1WGOA 3BMWA 3SO3B 1GPOH 4ZS6D 3PGDB 1HEZA 1UXSA 4PJEE 3RZCA 2BVPA 1TETH 3N1GC 4PGEA 1GIGH 4I3GA 3FQXA 2HP4A 4JPVL 2XNAA 2NYYC 2JJTA 2NXZC 4RISL 3HPJB 4PP1C 1OAKL 3TM6A 3BRFA 1KYOK 2B4CL 2R2BA 1H3VA 1ACYL 4JCLA 1FNGB 2VDOL 4QRUA 1BIIA 1WCQA 3FQWB 1HXYB 2NX5B 5D2NA 3AY4A 4L8BB 2J4WH 5C2BL 1KTRL 4GO6B 3WFZA 5C0AD 3HI1A 1XF2A 5EPMA 2BJML 2NX5E 1IT9L 1NGXA 4JFDA 4NFCA 3WNMA 5FM8A 8CGTA 1H8OA 4U7KA 4F9PC 3RGVD 2Z8RA 3MUZ1 4UAOC 5BOZG 4POYA 3TESA 3LMJH 5KSBB 5DMGD 1HYSD 1QEWB 4HUVA 2V2XB 5AZEL 3DMMA 5BV7H 3MLPA 1XH3A 5DC4B 1OT2A 4HWBH 1FL5B 5KSBE 1T2QH 4YWGL 4MSWA 2ZG2A 4U6YB 3I6GB 4OLZH 3ZKND 4XPGH 3DX9B 2BNRA 3S8WA 4OD1H 2XZZA 2R0KH 4G8FB 4JFXB 1N26A 5H37H 3Q1SL 3R06A 4NNPH 3B6SB 3C60B 3FFCB 4MAYA 5I8EB 2JTDA 1A02N 3BX7C 1EGJH 1NL0H 4HQQH 5KZCD 1ZSDA 2X4QA 4KKBC 4QGYA 5BMFL 1OB1A 1N59A 3KGRA 3RPIB 1P4LB 2WUCH 4UILH 5TFSH 3VXSA 3FTGA 4NC1E 5IIEA 3C8KA 1NCWH 1CCZA 1I85C 5EU3A 4WJ5B 4ZTOH 2F53D 2WANA 2NCMA 4NWUH 4YUEH 3K1DA 4JHWL 1G9NH 1T89A 3RWJB 4JM2C 4XCFH 1I1AC 3NTCH 2Y5TA 5I2IA 4PJ7F 3MO1B 4HW6A 2ZCLL 4X8JA 3QDJD 4M5YL 3GSXA 1AP2B 1RULL 2R4SL 4Y5XC 1A6TA 1CD8A 3B43A 3ROOA 1SBSL 5E2WH 1Q1JL 3O6MH 1YEFL 3LV3B 5C0GA 4OGAD 1GGCL 3GI8L 4F8QA 4ACPA 5DHYA 2IQ9H 4M5ZL 4RMRA 1YNTB 5TPWH 5HDLA 5IIEB 3KJ6L 2ZPKH 4MZ2A 1RZ8B 4YDVA 2YHGA 4ODUA 2ARJB 4NCC1 2AK1L 2R29L 5DJ8A 3BD3A 5K59E 3U48A 1ADQA 3QO1A 3VMPA 1FZJA 1UZ6F 3KPRD 2O5ZH 4Z7QE 3BWAB 4ZD3L 4PPTA 3GSRB 5DJXB 2Y9RT 5GS0D 3MBED 2G2RA 2RGSA 2RQ8A 5GPRA 4C56D 4XH2B 4L3AA 1EEQA 3X12A 1W72L 4AG4L 1YEJH 3CSPA 4KRNA 3MRCA 5F7KC 2CDFA 4I5BB 3IDYB 1YPZE 1T0NA 4MXWL 2FHBA 3AREB 2A6IB 1MFEL 4I13B 1KF9B 2F54D 4NFDA 5KJRH 1HKLL 5C07D 5KVMC 4ZAKA 1FGVH 3P4MB 4QHNB 4XC1H 4MZ3A 3RVTD 2IBGA 2Y6SD 3NFSL 4N0YL 2W9EH 2MMXA 2Z8VC 5DK0A 5I76A 3KJ4C 4OV6F 3FB5B 3VG0H 1I8KA 3PWVB 4NQDB 5F6IB 3VXPB 4YH6A 3WN5B 3NZHL 1J05B 2DQHL 3BXNB 4K94C 1LDPL 1TCMA 2IFFH 2AEIT 4X9HA 4L8CB 1PKQB 5K9QI 1RZGA 1FVDA 4XP6H 4EIGB 4K3JH 1A9BA 2BDNH 2XNAB 3I9GH 4LCCB 2CDGA 3L9RB 3LN5B 2MPAL 5CZXC 2OXGA 3DSFH 1B0WA 4Z7VF 1UA6H 2BRRH 4KTEL 4FABH 4HFWB 4NDMA 4XNZB 1GZPA 1FQ9C 5EU3B 3WFHA 4WW2A 4AM0B 3GMOA 3DGGA 3S36X 5KZCB 5C71A 2HFTA 1BQLL 5E2VL 2HT4D 5FV2A 3U4AA 1F4HA 1MCWM 3RAJL 3SGEH 2DBLL 5HHXH 4E41B 4P2QB 1UYWH 3JUZA 2QR0A 4AJ0A 1UCTA 4OLYH 1MFNA 2MQ0A 4DW2H 4YHPA 4M02A 5FHAH 1BVLA 1M71A 5IMOA 3MODH 3UAJC 1PLGH 5DD6A 1J86A 1H8NA 3OF6D 1I9IH 1FL5A 3NIGF 3OGCA 3FQTA 3IKKA 3T8XA 1RZ7L 5E95B 1N5AB 1BGXL 1QYGL 3DSFL 5F89A 3O45A 4MB3A 2RBLA 4BQ9A 1S9YB 4OCYH 4ZOCA 3O3BB 1U8PB 3AY4C 3RWDA 3QXVA 5I1HL 2BSTB 2XT1B 4R7NA 1FLRH 3OXRA 5F9AC 1RUKL 5IQ9B 1CGWA 1Z3GH 3CDYA 4I0PA 3QFJD 4J6RH 3BIBX 2O93L 4XMLH 4P4KB 5CEYA 4PTTA 3ZSTA 2LABA 5I1EL 1N8ZB 1X3DA 3MJ8A 1GZPB 5F88A 2I9TA 1MFAL 1JPGA 2PYFB 3DECA 1CFTB 3DO7B 5HGAA 1F6AA 3ZKMD 1EHLL 3VRIA 4XMPL 3S3JA 1UB6B 4KUZH 3AVEA 2W9EL 5IBLD 2NY4C 4YC2C 4XC1L 2GK0A 3D6GA 3HG1A 3NIDE 1PZUB 1NAKL 4OCWH 4R2GC 3MROA 5DJDA 3N50A 1XH3B 2XV6B 1NMBH 4K8RD 4H88L 3D9AH 2VAJA 1K8DB 1CXIA 2NTFA 1QFWL 4LVHB 5F3BB 5D1XA 3BGFC 1W72H 4V2BA 3W9DB 4P2OA 4Q2ZB 2DAVA 2DS4A 4RX4D 4HK3J 3VH8B 1RIUL 2ZOLB 2JJVA 2GKIA 1DJSA 1E28B 1U8HA 4WEBL 4PJIB 5GJTL 3ZKNC 1X5IA 1J8HA 1A1NB 5LCVH 1AR2A 3CD4A 1P5UA 1I3RA 3AMKA 3U82B 4YDJB 2VL5B 3REWA 3EJZD 2R2BB 1UWXH 4LCIL 5JDJA 5TPWL 4ZSOE 1N5YL 3K2MC 5CP3A 4TUOB 4Y4FA 3TBWB 4JG0H 2OTPA 2MSPA 4N8CH 4XAKE 3I50L 2DTSA 5I30L 4N1HB 1JRHL 2WW8A 1K4CB 1SBSH 3I6KA 1C5CL 3TH2T 2VL4A 4K8RL 4JN1H 3WO4B 1A6ZB 2OQJB 2GJ6B 4YHIB 5GGVH 1I7UB 2YA1A 3OJ2C 3SGDI 1WIUA 4CU7A 4ENEC 3OZ9H 3QUML 4Z7UF 1I8IB 3W39B 2XFXA 3TT3L 3D39B 1JZ6A 4JRYB 1DEDA 1I1AA 2AEWA 5JXAH 4KQ3H 2AS5M 1FJ1A 3EYVA 1JNNL 3PHOA 4LGSB 4NWUL 4YUEL 2MFNA 5T5FL 1KCVH 3G6JE 3LQAC 4JPKL 5EOCL 5EU6D 1XGPB 5GRJH 3P11H 4IRJB 5TFSL 3SDDD 4LSVH 1NBYA 2VQ1B 1KPRB 3DUSB 3D39D 5EC1A 4U2ZA 3MV9E 3LCYA 1JPTH 4PRAB 3GIVB 1CE1H 2W9LA 5F7WC 3MLRH 3P73A 3STLB 3TO2A 4QLRA 2ADJB 4XWGL 2E9BA 4K23L 7FABH 1KJMB 3TBYA 4ELMB 2CR6A 4U6XA 1YNLH 1I75A 4BUHA 4IIQB 3MJ7A 1H3PL 4BQCA 1MJUL 3C6LD 1FNLA 5IQ7L 1K5NA 3G5YB 4I0KA 4GG8A 3RVXD 5IB3B 1TZIA 3MJGX 1QZ1A 4L3CA 3UO1L 2AV7A 2EH8L 2N1KA 4CW1B 3UTOA 1Q94A 4CDGC 1G7HB 5GRYA 4AL8L 5D7JB 1NGWA 3TA3D 5BV7L 3PDGA 4K7PL 5DJ6B 3H9SD 3RVTC 1DN0B 1I1AD 1BIHA 5L9DH 4NZUL 1G1CA 3ARWA 4IMLA 5HVWA 5ID0B 1A7RL 1FFNA 2J2ZA 2H8PB 1MH5A 1T7YA 4ZO6A 1XGTA 1GC1H 1J0JA 1RURL 3QZWB 2P45B 4Q6IA 1ZA3B 1SBBA 2LU7A 5EA0H 2DQGL 2FJFB 1I7TA 3QDHA 3P9LB 1ZEAL 5CMAA 3X17A 5ENWA 1VFAB 1UEMA 1IBGL 1CT8A 2NZIA 1CFNB 4PRBB 1FG2A 4Y5XA 5DVLA 1OSZA 2J8HA 4ONHA 3DO3A 3CK0H 4G80A 3SE4A 4IOIB 3VGGA 3F7PC 1DQML 2Z31A 1GGTA 1AXTL 4PJAE 5JW4N 3QG6B 3ULVE 4YXKH 5JW4Q 5IB4B 4QRPD 4PJXB 1TETL 3CH8A 4GRWE 3EYUL 4FQQB 4LLMB 1OY3B 2VLJD 2ZSWA 3AS1A 3O3EB 4PJAB 4K07A 4PJ9A 2R69H 4OZ4A 4MAYB 5SX4H 2XWJB 1P4IH 3ESVF 3NH7H 1YQVH 1KIRA 2W0FA 1OAUH 4FFZH 1QPXA 5EDXA 2PO6A 1SYSB 2H3NB 3FJTA 1JPFB 4TSCL 3MCLL 3UTZB 3WUWB 4XXCC 2Z0BA 1HILA 1XR8B 4BJLA 4KPHH 2VDRH 3PXJA 1D9KD 4JFDB 2QQQA 5BV7B 2EH8H 4RRPG 4P2CG 1WZ1L 4P2RD 1ITBB 1CE6B 5T3ZL 4MCZA 1CFSB 5C08A 1IC5L 4MQXD 5DLML 1Y0LB 4JM2A 4P4RA 2J6EA 2XQYG 4CADA 3VE0A 2ERJC 4V2CB 2NY2C 4F7TA 1YNLL 2N4IA 4P2OB 4JGJA 4XZUB 1ZLVH 4KK9C 4YO0A 5IK3A 1Z6JT 4QCIA 1V3MA 4M7JH 2VDNL 3M45A 5E7FA 4RAUB 5TDNA 4XPAH 1ZHKA 4JDVB 1JE6A 4F9PA 3TNNB 3PQYB 3BZFA 2X2YA 3HZYA 1GJIA 3AM8A 3W5NA 2AJVL 1AGEB 2PYEA 5E5MB 2K1MA 1KG0A 1U8QB 4KHXH 1FH5H 5DR5L 1YJDC 5HI5D 1X5YA 1G7IA 3TGXA 4PTUB 1EHAA 1MHCA 3EO0A 4NNXB 3V4VH 2DQTL 4OI9A 2FNBA 2P46B 1XMWA 1RUAH 2NY5C 2J8OA 3FFDB 4U1KB 5DJ0B 5L2JA 4R2GB 3IF1A 3K74B 1UACH 3EYOB 5BZWA 4WEUD 1MJJB 3VCLA 4D9LH 4K8RH 3QEQB 4M6OL 3QR2A 3M07A 4JO1H 2VZSA 4K7FA 1JRHH 4P46B 4ZQKB 2E7LA 4DK3A 3VMOA 2E27L 5GRXG 2C7UB 1BBDH 3UJIH 1P4IL 2NY6B 4L4TB 1E27A 3F58L 4W70A 2PW1A 4YJZL 4NRYA 3QDMB 1A6UH 1H3XA 4C4KT 4HMCA 2VDQL 2X10A 1T21A 3DSNA 3C8HA 5HGGS 4NKIL 3RP1A 2R56H 1BWMA 1VFUA 5J3HD 4LAQH 2A74A 4ZYKB 1CLCA 2FIRT 1WEJL 4G9FB 5GSVB 4AENA 3CK0L 1L9NA 1RK1B 2X1QA 1SMOA 5DSCB 4GBXA 1CD1B 3RWHA 3ZKXB 1G0XA 3LKPA 4MA8H 2VIRA 5JO5B 1W2KT 1VPOL 1HCVA 4HV8B 4IRSD 4HWZA 5T33H 2WIIB 1R3JA 5D7IB 2YPKA 1MLCA 5HJ3B 1S8DA 2C7UA 3HHRB 3ZE0F 2AEQH 2G5BB 3B9KA 3LKRB 2J88H 3T1FA 1J0ZA 1GGBH 5T3XH 5ANMA 4RMQA 3W9EA 2CLVB 4G43A 5E6IA 3LN4A 1N2RA 3OAYH 5EC1B 4MQSB 1N4XH 1N6QL 1MFCH 3LQAL 3CMOL 4F2MA 1WAAE 5SX4I 1JMZA 4RAHA 5IBUB 1MJUH 4MNGB 1QBBA 4RZCB 5CJQL 4QHNA 2DLTA 2W9DH 2A77H 1G9EA 1DUZB 2YK1H 1ODAA 3B6SA 3C60A 3FFCA 5DD5L 1IQDB 4WU7B 1P5VA 4XWGH 1XIWB 5E8EA 2UWEF 3WNNA 5KSUA 1YECH 4C83A 2QSVA 4UINL 4YHLL 3WKMH 1EERB 3OHXA 4PG9B 3TBSA 1MF2H 1G7QA 3T0BA 4RSVA 4PJ5D 5HYQB 1I9IL 1AGCA 1JGUH 2PR4L 2HA1A 5DHVA 2CLVA 5FHAL 3EDDA 5LG1A 3OAUL 4YE4L 3BZEA 4CJ0A 2NY7H 3T0EC 3D0VA 3NA9L 3HMXL 1I7TB 5FF6A 4LLWA 3UMTA 4YZFE 1KELH 1GYAA 1D6VH 4L3EB 3QUMH 5SWZA 4UNUA 1QHOA 5E70A 1AO7B 3RRQA 1ZTXH 1LO5A 2V7NA 2YD5A 2R0WH 3WFEL 2Q86A 2W0KA 1T20B 4WCYH 3P0YL 4L3EE 4U1JA 2VLKB 4ZFOB 3I9GL 3JVGA 3HNVH 2CKBL 1KTKE 5GGRY 1VADB 1EAPB 1HSAA 1XGYH 2VLKE 1LD9B 3D18A 5DTFA 3ESUF 3QQ3A 1MWAA 3RVVD 5L88H 2FLRT 1GOFA 1MJ8L 3QRGL 5CBEB 5JOPE 3PWJA 4HS6A 3MRIA 4MHHI 4GLRI 1CL7L 1G9ML 1KIRB 1IFHH 5FA4B 3TVMD 4XVTH 1WIOA 3QI9B 3OAYK 3QNZB 1HIMH 4YBQD 2Y5EA 4H0GA 1XZ0A 2ICWA 4K94L 4YQXH 3FB6B 3L5IA 1JK8A 4WW2F 3QAZB 3JWDC 4RA0C 3O8XA 1KULA 3T3MF 3P9WB 1P7QD 4M7LT 2P7TB 4WWKB 1B2WH 2IBBA 2GUOA 1ZA6B 1QSEA 5KJRL 4Z9KB 1D9KC 2XPGB 4F15B 1IM9A 3HB3C 1U8MA 2O5YH 2F74B 4HPOH 1TJGL 4NQED 1SJEA 3HC4L 4HK0A 1KEGL 4FQXA 4R96A 5IBTH 4LCWB 4FQCH 3MJ6A 1NUFA 1P9MC 3VXUA 5DZLA 4Q9RH 2O5YL 4NO2A 2FJFA 2ATPA 1F4WL 2BHZA 4FNLL 4XT1C 4OSUH 3ARPA 5ANME 3VCLB 2MWCA 4UT9H 1ZGLB 5JHDB 5KSVB 3U9UA 1A2YA 4NZRL 4F37K 1CG9A 3KXFA 2O5XH 2O5ZL 3DI3B 5K9KB 1EHLH 2JB6B 4FQIL 5J11B 4DN4H 4K3GA 2CMRH 4WV1A 4FQLH 5FIEA 5C0CD 5T5NG 5GGRA 3HPJA 5FGRA 2GHWB 4TTDC 1FBIL 2I24N 2WLZA 3I75B 1T1WB 2C3XA 2EIZB 2C26A 3VH8G 1LE9A 1EVTC 4BZ1L 4LCYA 2GK0B 4Y19D 4JLRA 1KENL 3ZHDA 5CJOH 4FN0A 1MREL 1T21B 2VDKL 5CZXD 4ODWA 4XHJC 2B2XL 2OR8A 1AGBA 2ZUQC 1RK1A 1PY9A 3OMZA 3O6ML 1J1XL 5I1HH 2VL5A 3BD4A 3W11C 1NDGB 3STLA 5FV1L 4LLQA 4XP1L 3O4LB 4MWFA 1F3RB 3WFEH 5B3JF 5DJ2B 2R0WL 1RIVH 3AGVA 1HHKA 3O4LE 4ODHH 1B0GA 3CX5K 2EYTB 2XQBH 4WI4A 5D1ZC 3MSPA 5E2UL 2C5DC 4M7LL 2JJWA 1KB9J 1UQSB 1R3HA 3RVXC 1GCFA 4BFGA 4KRLB 1AGDA 1H3UA 1K6QH 4YEEA 3MXVH 4FQXD 3DROB 5GGRB 5IG7B 2X4TA 4P2QE 2F53A 5AWNL 4C57C 1FE8H 4YHNA 3T65B 4JRYA 2AXJA 4WEMB 1H5BC 3IRZA 2OL3H 2J12B 1T66D 1HQ4A 1UKTA 1R5WB 2YPLB 3T2PA 2BDNL 4UINH 3RI5K 1ZT7B 5IR1A 3CLFL 2X7LB 2DM2A 2A1WH 3RL2B 3PHQB 1K4CA 3P30H 2YPLE 2WBJB 4GRMA 1T1ZA 2CO7B 3BGMA 4JAMA 2WMPA 4F3FB 2W9DL 3NZHH 1DVFC 1MI5D 1W0YT 3DHMA 3DV6A 3S37X 2V5TA 3PUCA 1T03L 4FQHA 4QRPE 5HD8D 4GAYA 2P4AB 4NQXA 2E3VA 1G6RB 2BC4A 2A73B 4WWKA 2UY7A 4WW2B 4LFHD 1DQJA 4NOFA 5EO9B 2BSRA 2G5BA 5E2JA 3MNZA 3GBNL 5BXFB 3MXWH 4U1LB 2FGWL 3DX7A 5HHPA 2WWKO 4CW1A 3HMXA 1BVLB 1M71B 2QQKH 3ETBF 3KHOA 5D1XB 1HHIB 5KSAB 3GBLA 5T1MA 3ARGB 5A3IC 2J4WL 4LAJH 4R90H 5IW6A 3HUJB 4R4FH 3WHXB 3GSQA 1ZHLB 3TZVB 1XIWC 1T5XA 4RGMB 2X4PB 4YHML 4HXBL 1YC7A 3EJZC 2EDHA 4RISH 1YEEL 4I1NB 2BVTA 2OSLB 3IFOA 5I1KH 4LHUB 3LN5A 3QJHB 2A73A 2Z93B 4KVNL 5D72L 2ZPKL 2VDQH 4PJIE 5C0DB 3QO0A 3GJEB 3W81A 4Y19B 1NGYA 4IOIA 1GC1C 5DDHA 4M5ZH 2IQ9L 4O51B 1OLLA 4FG6D 2IPTH 4Y5VC 2YD2A 2VXUL 1WITA 5C0CB 3RUGF 3QXTA 3SO3C 4Z7VB 3TA3A 5E8DL 1AC0A 3MRFA 4GG6F 5DRNB 1EFXA 2V9QA 1F11B 5I8CA 4M6OH 3MACH 3QUMA 3FAWA 4XI5D 3MGOB 1W8OA 4JG1L 4ZOBA 1NFKA 3SDYL 2ZCLH 2HRPH 5DQJA 2HKHL 4A2LA 4GKSB 1F4AA 2J5LC 3RIFF 2QSCL 2R0LH 3K1KC 3T8XB 1RJCA 5B4MC 4O5LL 3WXVL 2LVCA 4MQTB 1G84A 3DPBA 5C6TH 2WWKT 3BT2H 4ZDHA 3KLSA 4HUVB 3OKEB 2XA3A 4X4ZA 3Q5TA 3E2HB 2MTPA 3F5WA 4PS4L 4Y1AA 1SY6A 5EN2B 4HHAA 4D0CA 1PX3A 3LN9A 3ZDZF 4KTDL 4D0DB 1EZVY 3SE8L 5D1XD 2AJVH 3G6JB 1P7QB 1X4ZA 5DQDH 4RCAA 1Z0NA 1ZVSB 4F7PB 4NZTH 1YJDL 3MRHA 4EKXA 2DQDL 1KGCD 3FO9A 5BZDB 3MV9B 4LCCA 5E9DD 3ZL4H 2FBJL 5JUEL 4IIQA 3S34L 4OGYL 4K9EC 4LOUD 3VRIB 4CJ1A 3OJDB 1KJ2H 4WI5A 2Z92A 2Q6WA 3HA0A 1RUMH 3CSBA 4Z7NE 1JIBA 2ZJSL 2A6JB 1FO0H 2HLFD 4OV5B 4NN5C 3OL2A 5DUMH 2FJHB 4D0CB 5C08D 3HC3H 4J3VA 4D9RE 2EEDA 4NKQB 4OB5L 4LK4A 4WV1B 3EO9L 4E41D 4XBGB 5FK9B 3A6OA 3CVHH 1I4FA 2CLRA 5KSAD 3U79A 2VXSL 1YEGL 2IBZY 2BNQD 3EFDH 1HQ4B 4H8WC 3TBWA 5D7KD 2NY5H 5CSGA 5FA3A 4DUXA 2F19H 2HT3C 3VFTB 3W82A 1E0OB 3KYMA 2ZUQB 3HPLB 1F6AB 3QA3A 5DRXB 4IRZH 1JL8A 3SGJA 3SQOL 5CP3H 1TQCC 3UJTL 3SHSA 3LD8B 4JKWA 1QKZH 3S35L 2YD6A 4L8BA 3O4LA 1IVLA 3BGMB 4JAMB 3VD5A 3FT4A 4NBXB 1OGAE 4GRWB 1F6LL 5EA0L 1AIFB 2CUHA 3C8DA 4PGBA 1GOHA 3L3HB 4UU9A 2UZIL 4X7FC 2CQVA 3LKPB 4ZFZB 5DK3A 5KVEL 5E5UB 4XNYL 3KHQA 5C0BD 2Y06H 3LIZH 5IESL 2P1YA 5IG7A 3QIBC 4PRPD 4WHTB 1YA5A 3FOMA 4G6AC 5I16B 3VGHA 4WUKL 3KXFB 5TE4H 4XVUC 3MV8B 2VO5A 1IJ9A 1MEXL 3K8LA 3K4ZA 3GHBL 4PJGF 5BRZB 5HI4D 3KXFE 1A6AA 4PLJD 3DURA 2C3WA 3N1QC 1JYVA 5I1CL 4I3RH 1KBGH 4KI5C 1GZQA 2IAMD 1I3GH 3UXFA 1CE1L 2K7PA 4EI5D 3C08L 1JPTL 1QNZL 4XAKD 1JGDB 4WI7A 1AKJD 2AI0H 1A4KB 2DQFB 2IADA 3OSKA 4LLDB 1R3IH 4L1HA 3FZUC 1QSFA 1QR4A 3TWCH 2M1KA 1XZ0B 2ICWB 3V5KB 1TVBA 4WHCA 3TCLB 1BF8A 1MRFH 3FMGH 1X9QA 3MUJA 1P7KB 5FO9A 2MNUA 5F72S 3GI9L 3QUMB 5JIHA 1BZ9A 3QYCA 5GGVL 1U0QA 3ARED 2P5EE 3L3DA 1F90H 4WU7A 4YHNB 3V95A 4OCLC 3WHXA 3OPZL 5KSAC 1AY1L 2D0FA 3B9EA 3BPNB 3IDIB 1T2XA 3HC0A 3N06B 4PLOB 1HH9B 4FXKB 3MOBL 4NQDE 1DUYA 1QRND 3L9RA 1J88A 2CDGB 2ZUUA 4P2RA 3CUPA 4MXVE 3QO0B 3WDIA 3ECBA 2A9ML 1YEDA 3SPVB 2FR4B 5DA0B 4KUCF 3PJSB 4J3OC 3LEXA 2P24A 3VGDA 1MCKA 4PJIA 4P59L 4LVEA 4ZTPL 3PQYD 5IOPA 2DLIA 1WIPA 4G7VH 1CTOA 4S1QH 4YGAB 2NXYC 2G75A 1RIUH 1IILE 1D5BA 4NPYB 2D4DA 3EAKA 4C58B 1HILB 2VISB 5CILH 1KXQE 1FNEA 5CD3B 4JVUA 4PJ5A 2OP4H 5GJSH 2AGJH 4X7DC 4FRWA 4YHZL 1J0HA 3ARXA 4G8EB 1IEHA 3RGVC 3QULB 3U7WH 5TE6L 4ZFZA 3B5GA 4W68A 1KJ2B 1IAII 3PL6D 1HI6B 4RBPH 2YPVL 3W0WE 4P9ML 5BRZD 3U2SB 4YK4B 3MYJA 2GI7A 4EDXB 1EO5A 1QRNA 1BLNB 5C7XL 2GSGB 4NO2B 2G5RA 2X4QB 4RAVA 3MRRA 2X9XA 3U30C 3SEPA 3WS3B 4LMQI 5I1JL 4TNWF 3MFFA 4NT6B 1JMXA 2C3VB 2WM0A 1UCBH 5B3NA 4L8SA 4HJJH 1CXHA 2DDQL 2LV4A 1QBML 5D6DA 1OB1B 3DRTA 4M6MH 4PB9L 4UIKH 4X4XB 1R5WA 2JF1A 1X5HA 5CWSA 3G6AB 4JEGB 4RA3A 4XCYA 2FX7L 3WFDH 1KOAA 2NY3C 3FQNB 4R97B 4GBXB 1XR9A 5IFJA 2DMKA 1BGXH 1QYGH 3F7RA 1J5OL 1ZXQA 1SQ2N 4HZAA 4HUUB 4QYOB 4P2QA 3QWRD 1JF5A 4OCSH 3X14A 1NEZG 1BMGA 5FYJD 4LPVA 3TN0D 3I3DA 4JKKA 5MERA 3CVHA 5HTSA 1JNLL 3P0VH 5IW3A 3MZTA 1BX2B 2F5BL 3EYFB 1KB5A 4FTVD 3C09B 2FZ3A 4ODTL 2B0SH 1KEML 2OJEA 1UH2A 4TVPL 1JUFA 1DANT 2DIAA 3KPOA 4JKMA 3QIUD 2LTQC 1EMTL 3GGWB 3OKKB 2DIJA 3UTPE 5BZDA 1FFOA 3GBML 1CS6A 3BHBA 1MJ7L 4KVCL 1G0YR 5F3HA 3MC0A 2DLFL 3D85B 1CICA 4ZS7L 3U83A 4I3SL 1OWWA 4AENB 5TDOA 3OKDA 5HYSG 3D3VD 4RWYH 1Q9OA 2X7LA 5HI4C 3RI5F 3WKNA 2YSSB 3KPRE 4JO3L 1QSZA 5IJKC 4JRXD 4PJXA 1PG7X 3G5XA 3R1GL 5C09E 3FFDA 2H26B 1SEQL 4UV7H 3KPRB 5E08L 1TVBB 5HY9B 5C09B 5FM5O 2MJWA 1T0NB 3CXDH 4XNMB 5LKNA 1MFEH 2CSPA 1XCQB 5JMOC 1HXMB 4QTIL 4JFOA 2BVEA 2Q3ZA 2HTKC 2ZOKB 5JLZB 5CJXC 3H3BC 2NY2D 3MV8D 4PJ7A 4G6JL 3ALWA 1WISA 4P48A 4JRYD 4GOSA 5F7DA 1Q9WA 4ODVH 4HLZH 3L3OA 3OKOA 4ORZC 4U1JB 3SDAA 4YFEA 2VN7A 4WU5B 5F3HB 3BUYA 2C1PB 1NC2B 2WV3A 5FEBA 4Y5YA 5MEPB 1DQQA 5JHDE 1WZKA 5D7JC 4G8IB 4Z0XB 3TIDA 5DJCA 5CBAB 3MREB 2UYLA 1OAQH 5D1ZD 5EORL 5ICYB 3DUUB 4JQXC 2PCPA 4ELME 3JWDL 1M05B 1MWAL 4PJGA 4U31A 5D7IF 3S4SA 3U0TB 4I4WB 4FFWC 1TJIH 2ILLA 3GI8H 2WWMC 2G75B 2E7HA 3W11D 3VFPB 3TBSB 2GFBA 5CJ8A 4L3CB 1FFQA 3MNVA 1BHGA 1B88A 4HH9B 2B1AL 1RMFL 1UEYA 5SWZB 2GEEA 4OZIF 2OM5A 1JTTA 5FCSH 4PGDB 3S37H 5GS1A 3MYZA 5KW9L 5SWZE 4RFEA 3LKNB 4G80B 3L7EB 5IFAH 1H8SA 2Q86B 5D7SL 5I6XC 2Q7NA 2VE6A 4P2OD 5GISH 3LQMA 2V7NB 1VFBA 3RU8H 4KHTL 1N7MH 4R26H 2F5AH 1A2YB 3PWVA 4NQDA 1U41A 5DJZA 3WMSA 2EYRA 4HEME 4X5XB 2F8XC 4EDXA 2GK2A 2W38A 1JV5B 4UIMA 4F58L 3RVUC 1ZS8B 2AKRB 1S7UA 4QRQA 4A6YL 4PJ8B 3B9DA 4R3SA 3BFOA 2Y7QB 3KPMB 3MA9L 3S3SA 5KSUB 4BQ6A 2WQ8A 4ZDHB 1U8JA 5SWZD 5HYSB 1S7RA 3IDJA 4BH8A 4RAVB 5DF0A 5B38A 3FB6A 1H5BB 4U1SB 3VA6A 3QPQC 1FDLL 1SYVB 3QQ9D 1VB9A 4QKXB 3HB3D 5C0AE 2VERN 4XXCA 2YUXA 3ZKMC 3BKCL 2BNUB 3UBXG 4NWTH 4H1LA 1IL1A 5CD3A 2R1XA 2D0GA 4DQOH 4ZUTB 4WGVB 3O3UN 3B4NA 1JI1A 3K8KA 4J3UA 3ISWA 1CWVA 4OJFH 1L0XA 3TPUB 5D7JA 4NRZA 2GTZA 2ED7A 3NFPA 3QDGE 3L6FA 1XAUA 4L4VA 2GYSA 4CMHB 1Q8MA 3MLTA 5E03A 4G5ZH 3V79C 1EO7A 2HT2C 1NJ9A 2G60H 1S9WB 4XAWL 2Q8AL 4X9BA 1RU9L 1XF4B 3HE7C 1RJZB 2FSEA 1IT9H 2BJMH 3ARSA 3IKCB 3SDXF 3EYSH 4BYHA 1JZ3A 1XGPA 2A0LC 2H41A 4N5UA 3MV7A 4ZFGL 5BO1H 1NSNL 5I66A 4UB0H 1S3KH 3HZVB 5SWSD 3OTTA 3O9WB 3WD5L 2EXYD 5KS9E 4XNXH 1J12A 3BP7B 3HUJE 4ZUTA 3VFSB 4GMTH 5IJKA 1T1WA 2EIZA 2ZNWA 4JREC 4LLYB 4RGMC 1QO3A 2H2PD 3BYTA 5KS9B 3MLUH 1OAYL 3TIEA 5C0FB 4TNVK 1NAML 5FYLH 2VR9A 5KAQG 2EYSA 4GQ9H 2KPNA 2YXMA 4XPTH 1F4XL 1HQRA 4PTUA 1QLEL 4K3HA 1L6ZA 4OUUA 1R3KB 4NSKB 2NY6C 3PE9A 4M6AA 4ZQKA 5E99L 5JIKA 2CUMA 3PWPA 1B0RB 5SWQB 5E94A 3NPSB 5F7MC 3QEUA 2FD6L 4EQ2A 1MCPH 2VLRE 3MFGB 4Z7VE 5JDSA 1SJXA 4LRIC 1PVHA 2ZCKH 1FPTL 2EIBA 3UTPD 2KDGA 4H5SA 4E0RB 5EU7C 3V2AR 4QF1B 2ICCA 3UDWC 4Y89A 4U6HB 3TC9A 5F7DB 25C8H 4L5FH 1BJMA 5H35B 1NAMA 2D3VA 1C16B 1RZKL 3D2UD 3NABL 4YPGA 4F8TA 1FIGL 5IP4A 4TUKL 4G43B 6FABL 2BVQB 4MNQE 5HBBA 3Q6GH 1XF3B 3I6LD 1MFBH 3WJLA 5CEZE 1BEYH 5IWLC 4MNQB 2HT2D 4MVBD 4RAUA 4LCWD 5TDNB 1MVFA 1U92B 3QFDB 4LSSL 1KT2A 3ILPB 1PEWA 2D7MA 4JB9L 1KG0B 1U8QA 2YSSA 3L5XH 2DKSA 2PETA 4I48B 5C0RH 3U0WH 2XRAL 5C0IA 1CDUA 1CVSC 3GSWA 4PD4K 4PLKD 2LAAA 1A3LL 3LB6C 3QCTH 1AJ7L 2WINB 4WI3A 2VH5H 1DBMH 3LKSB 1QVOA 1BM3H 3CVHB 2F8VA 2R8SH 3V6OC 1MJJA 1NCBL 2I27N 3GRWA 4LP5A 3QEGH 3QFJB 4IRJA 3MPCA 1I9EA 5D7LA 4JM2D 4PGEB 1U9KA 4FQXB 4MAUL 5KN5B 5MI0B 3IFLH 3BUYB 4PJCB 4XP5H 1W0WB 5GGTH 1HEZB 3KPSD 2CLRB 4FQPA 4AEIH 1XFPA 4JFYB 4WFGE 4Y4HC 5DYOA 5DK2A 3CX2A 1IAIM 4P2OC 1X6NA 1SY6L 2IAMA 1U8OB 4NNYA 3QCUL 1EBPA 3BIKB 1CG9B 3OG6B 3EOYG 1FL6A 2BY2A 4M43L 5TF1L 2ENSA 1HE7A 2F8OA 5CINL 1RFDL 3ME0A 5FYLE 4X99A 3FT2B 3MRFB 5JMRA 1G7HA 2FO4B 4KRPD 3U1SL 2FB4L 1OTUC 4JANA 1OGTA 4IMKA 4JRWA 3WSQL 1DN2A 4KK8D 4L1DA 4PV9A 3H6JA 3MLYH 2X1XR 4U4BA 5T1DH 2R23A 4KKCC 5HGDB 3CIQA 1BFTA 2VDPH 5IBUG 4PLNC 1YEHL 1KPVB 4HPYL 2BX5A 2EH7L 3KPNB 5D1QC 1UKSA 5IROC 2X05A 3PDOB 5H94A 1MH5B 1KACB 2EC9U 3KR3H 1QSFD 5C6PB 4XX1E 1WT5A 4FS0A 1OGAB 4N8PA 4PFEA 1RV6X 1D5ZB 4P4KD 4YR6A 4M4RA 5L6YH 5BQ7B 1XCTB 1RI8A 3T0WA 1AO7E 1DEEB 5ELIA 3RY6C 4FZEH 5K59F 3OAZH 5I1IL 1F3JA 3HS0B 1NJ9B 4HXAH 5F1SA 4IM8A 4PJDF 2DWDA 3I02A 3RGVB 5DHYB 2NTFB 2QADD 2QQNH 2ZUYA 3UTTA 4GMSL 4OD2B 3O3AB 1UWEH 4C4KO 3O6FC 4F15C 5E6ZA 1R24B 1MY5A 1S7TB 3DV4B 3HNTL 1F2XK 4ZXBA 1CLZL 1FNHA 4HFUL 2V5YA 4QHUB 4RDQF 1V8HA 5GHWL 1FNEB 5JPMA 2CKNA 4UV4L 1LO0L 2I26N 3T0EA 2PO6B 1LQSR 1RZIB 2R4RL 3MJ9A 4W4OA 2B5IB 1VGKB 1JZ4A 3SCMC 1IKNC 3V8OA 2D7TH 3KNBA 4OI7A 1NBVL 3AUVA 3FT4B 3KLAA 4MCYA 3DX6A 3UYPA 1IGFH 1T1YB 2D7OA 5FUOH 3VXUD 3OAZK 2JCCA 3QEUB 4HIXL 4LCWE 3CZFB 4IOFC 4P2YA 1FNAA 1SVZA 3IF1B 5DD0H 1A3RH 3HE7B 2WZPD 5HHMD 3AAZA 5IHZA 5CEZD 1HINL 3B8YA 3A67L 5I8KH 1DBJL 3W9EB 4U0QB 3K0WA 2NNAA 1NFIA 2QQLH 1ND0B 3CX5J 3OKEA 2PO6D 3M1BB 3FN3A 5D8JL 1JTOA 3HZKA 5HY9A 3DV4A 3U36B 5DEFB 1OAYH 1KB9K 3SKOA 4XBGA 2EDEA 5FK9A 5EUKA 1D5XA 4WHYH 4LARL 4LSUL 4RZCA 3WUWG 3F62A 2Y7QA 4UAOB 1CF8L 5L2KB 3X13A 1HHIA 1G7MA 1Z9SA 1PG7L 2A6KA 1T0PB 1Z9LA 1U91B 3MLZL 4OFIA 4UQ3B 4C56E 4JREB 1NSNH 3CFCH 1EA9C 5HHMB 4JY6A 4ZPTA 5ICXA 4JO2H 3N85L 4OZHE 3VRLF 1JP5A 5GZND 3JV6A 5HJ3A 3NIGE 2VLME 4AIZB 1NLDH 3F6LA 4PJHE 4TPRL 3WLWD 5C0DA 1HSBA 2IPUK 4DN3H 1AXSB 1EIBA 1F3DH 3JV4B 3EYFA 2IAMC 4OT1L 4P5TD 3SBWA 4DVBB 3FOMB 5FOBB 4WO4C 1IAIH 1JGEB 3MGTA 3BGAA 4NBZB 1N3NB 5DFTA 3A0OA 1ZWIA 2O61B 3EYVB 4Y5VB 3RY4A 4DCQA 2E7LC 1BZ9B 1G7MB 3D48R 2PW2B 4M6NL 5C70A 1TCRA 3GUTA 2B8OT 4O58L 1XCQA 2DLEA 4NRXB 1WCBB 2OTWB 4MNQA 3QIBD 5JW3L 2DTMH 3BAEH 5EH1A 4EOWL 1RZFL 2YUZA 1IC4L 3EOTL 3PIQB 1OSPH 3BIKA 5LAXB 2VDMH 3B3IB 3BZ4B 4WU5A 1T1XA 1QFOA 2UVEA 5F1IB 3IDXL 1L9MA 1KIUA 2ZUVA 2CDEA 4XH2A 3RTQA 3X12B 4MQXC 5DJAB 2OLDA 1QSFB 1JWUB 2KQMA 2VXTL 5E9DB 4U05A 1RIHH 5EFIA 1HXYA 2NX5A 5KW9H 1WBYB 1S8DB 1UWXK 2CIKA 1WJ3A 4G3YL 4Q9QL 4WHYG 5ISZA 3RVWD 3QUXA 3G08B 1B0GB 5E9DE 3BEVB 2AEPH 1KPUA 5EIIB 1S9YA 3VXNB 4PJBE 3PP3H 3MNVB 2MHAB 2F54A 5C9JB 2NXYD 4JQIL 2CJUH 5GGTA 5C9KA 2XOTA 2OR9L 4H20L 2YC1B 1CXEA 1JWMA 3A6CL 5BRZA 4W6WB 3K46A 1MWAB 5J8OA 1OTUD 1MWAH 3RWGA 2ZCHL 3BJ91 4X7EC 5DVKA 4BKLB 3WXWH 1HHGB 5CIPB 4PYHA 1XF4A 4KXZH 1NH6A 3WHE0 3MRMB 1MCIA 3INUH 1FVDB 3ARTA 3AS2A 1EFQA 3D2UB 3VXRB 3GIZH 5BS0E 4KI5F 4L4TA 4QHMA 4ZUUA 3TBTB 2X09A 5HGBA 5CGTA 3ZDZE 3VXRE 3K4AA 5C92A 2Y72A 3KYOA 1AGCB 4NOBA 1RPQA 1DFBL 3NCYS 1JNHA 3UTQA 5DS8A 3KYMB 4WRLA 1ZLWK 1HZHL 3EDEA 1X5FA 3RPIA 2DF3A 3TO4A 5F6IC 3BZEB 2HJFA 2EECA 2J7LA 3ARUA 4JFPA 1UZ8A 1N0XL 1CDJA 1RVFH 4HC1H 4PGCA 3VI3F 4Q0XL 1AGFA 3GSNB 4NFBA 4P23D 4QTHB 3I3BA 1NEUA 3GSOA 1JGVL 4NNXA 2APBA 4OCMC 4DZBA 3O0RL 1ZVHA 5D93B 4JO2L 1LD9A 3D18B 3HE7A 3NAAH 3LEVH 1IM3B 1Z9MA 4WUUD 3PABB 3T65A 1R24A 1NBQA 2V5SA 3QHZL 3Q6FB 4R4NC 4ESKA 4KI5D 4JFDD 1MJ7H 3MLZH 2R2EB 2XKNA 4E0RA 1FRGL 4QHLB 3IT8D 1IGCL 5J1AB 5J6HA 2K7QA 4LSUH 5C07A 4KJWC 4TVPH 5JW4M 3L7FA 5CUSL 4NJ9H 3GKWL 4WVRA 4XVUD 4M03A 1M7IA 2YS4A 4U1IA 2NPLX 5DZOA 5J89A 4P5KA 3QDGD 5H2BA 2F5BH 1MHEB 1WSST 4BUGA 3WLWC 3QH3A 1TJHL 1NDGA 2HMID 3A67H 4IDLA 1F2QA 4HKXB 1G6RA 4OF5A 4FQJH 4JFQA 3DI2B 2HTLD 4KKLD 3KYNB 2HVKB 4M8QA 1CIDA 2HFGL 4F7CA 1QFUH 5E8NB 2W07A 1WC7B 2R1YB 3U7YH 4RWHA 4G3YH 4Q9QH 4LVNB 5BS0D 1TZHB 4XHQA 5FCUH 3EIFA 5CLTA 2BFVH 4OM1L 2YZ8A 1DZBA 1OW0C 4NP4H 5KSAA 4YPJA 5JZ7D 3QB7C 3W2DL 3ZTNL 3SY0A 5JIIA 1LO0H 4UV4H 4HLZG 2M2DA 5TH2B 1S5HA 2Y25A 3V7AG 1L0QA 5FO7B 3L5JA 4ERSL 3BP4A 1BFVL 3IGAA 3IDXH 3F65A 3G5ZB 4JCMA 5CKGA 3O6FA 3GMLA 4RGNC 5CHNB 4KKCD 3RUGE 4GMSH 3DETD 4QRPA 1T1ZB 5C7XH 1MLBA 3NN8A 3QZWG 2BHUA 2DMBA 3HAEB 3GB7A 4GBXD 3STZA 3GJEA 4R7DB 4YDLC 5ADOL 2D03H 2FEDC 4ODUB 4Y0GA 5E1AB 4JO4L 2XFXB 4GAJL 1WFTA 4XCCH 1X7QB 4RIRB 5HVHB 5DD1H 4G6FD 5C09A 2W65A 1T7ZA 3SKMB 5T1LA 4MMZC 4KDTA 3V5DB 5D2LA 1IAOB 4N8VB 1YYLH 1WTGT 4OIAA 2XN9E 4OT1H 3F12A 1Q72H 3HRPA 1A6VL 3PHSA 4Z76B 4DAGH 4WHTA 2ERJB 1P69B 5J1SC 3D25A 4IEFB 4QHKJ 4Y1AD 4ZUWA 5IFHL 2HVJB 2ADJA 4H0IA 1LO5B 3N9GH 1WK0A 1J11A 4WI9A 4G6ML 1YMME 2J8UA 4OLVL 3U9UB 3VMNA 4U2YA 1HDMA 4OAWA 4MLSA 5B4MD 4DKFH 3TIDB 1WT5C 3DYOA 5CIPA 5J6HB 5H8DA 3NZ8A 1FVCB 1SVCP 4MA3A 4LU5L 4LEOA 4HUWA 3FO1A 4XP5L 5DC0A 1HYRC 2ITDB 4RNRA 4I77H 5TQ0H 1JWUA 4OD3L 4NUGH 4BA8A 5CLWA 1BBJB 3ZE2F 4QXGL 4JHAL 3MRBA 3EDKA 4BK5A 2FL5B 1SEBA 3ZT7A 2D9CA 3IJYB 5C09D 4XMKL 2X40A 4XI5C 1YMHB 3VXNA 4I0PC 3T4AA 4EDWL 4U1KA 1HXMA 1ZT1A 2UVFA 1P4BH 3CU7A 5EBWA 5ITFB 3H9YA 3OJMB 4RQQB 4OZIE 7CGTA 5J0BA 3RQ3A 2ATKA 4Z7WA 4KMTH 2VLRB 3IU4L 1LNUB 1FSKC 4W4NA 4PJ8C 3H42H 3C5JA 1VADA 2ATPB 4POZD 3TNNA 2R4RH 2QSTA 2XTLA 3HR6A 3QIWA 5JORA 5KVGH 1QACA 3C2AH 3QDME 1BQHA 5ACMA 2XYCA 2XWBA 1DBKH 3S3PA 4ZUUB 2X4SA 5D2NB 2CPCA 1NGYB 1BLNA 2B1HH 4W81A 4PV8B 5FA4A 5GRVL 1X5GA 1UWEL 3WN5C 4ZUSA 1CLYL 3IVKB 1JUFB 1MEXH 4CMMA 4MYWB 2Y1VA 3PWUA 5D2NE 3RWIB 1R5IA 3SN6N 3B9AA 4GW5A 4NCDA 3WNKA 3HI1B 4PJ9D 3MRLA 1SYSA 5EO1A 3BPOB 1R5VA 5GS3A 4PJ5E 1NKOA 3MOAH 3PNWB 5ACZA 4LCCC 1DBBH 1DBAL 2EXYC 1CGXA 4NO0B 4XPFL 3ROOB 5L6YL 2W60A 3GHEH 5ESAB 4EI6B 1DVFD 1NCAL 3QDAA 3IFNL 2ARWA 2DWDB 3V9FA 5IGXL 3VD7A 3WJLC 1CU4L 2P42B 2PF6A 4ISVA 3MBEC 5E8OB 3WBDA 5TQ2L 1C12B 5ADPH 1MHHA 4GQ9L 5MEQA 1AD9B 4XVSL 3QIBB 5IJVB 4UQ2A 1OAZL 2OL3B 3UPCA 4NUGL 3C5ZD 2J3SA 4GXUM 2VWEE 4HS8L 4H8WL 4NJAL 2AKRA 4GMTL 1ZVSA 3U6RA 3ARZA 4UMGA 3P9LA 3SJVD 1AE6L 4MNGE 5DXWA 2QADB 1BQUA 1D5IL 4O9HL 1MCWW 2Y23A 2CLZB 3QDJB 5ESVA 3IU3A 1EEYB 3O4OB 4EN3A 5I9QC 3RNKA 4UB0L 1MCOH 5J06A 1NCCH 4K3EH 4X8XA 3N9GL 2DWEB 2QBWA 2QSQA 4AEIL 2JELL 3S36L 4FMFA 5IFHH 2VXQL 2H6PB 3G5VB 5D7IA 2DICA 1G7JB 1RHFA 3IS1X 4ODXA 1A9EB 2F15A 1OGAD 3GNMH 3QPQD 4LLDA 1UENA 4I18A 1CLOL 3QEGL 2VZ1A 1A6VH 1CGUA 1UZ6E 2BOBB 4KROD 5E1AA 1Q72L 4B7IA 1UM5L 2VABB 2H2SD 3FN9A 4F33B 1E4WL 4OJFL 1I7ZA 3U4BL 1HOCB 2XKUA 4K9EL 1FAKT 3L3JB 1T22B 4NGHH 1A6TB 4MHHG 5JW5B 4YXLH 4DQOL 4HS3A 5IUSA 3IKCA 1S7QB 3JV4A 3SJVB 1JHLL 3W5MA 3EOBA 3X3FH 3KS0J 1FORH 5DURB 3UPAA 4U3XA 1F3JB 3HS0A 3C5ZB 2VQ1A 1WFUA 3D87B 3RHWK 1GZQB 4GRWH 4TULH 3T2NL 1TQBB 4E5XA 2DQCH 4X80H 2UUDK 4R2GD 4ZUWB 4TSBL 3TFKD 2V9RA 4HCRA 3KLDA 1G7QB 3U4EA 4GKNB 4LSTH 4I48A 1MCSA 4OQTL 1G9NC 2QHRH 1YNKH 3SOBH 4D0DA 3ZT5A 2A6DB 1FCCA 1IMHC 1IC7H 3FQXB 1QOKA 4KJYA 1DLFL 4RGNE 3Q48A 2ZUTA 2DRUA 5EU4B 1C1EL 1T89C 3RDTB 3H8NA 1UB6A 4L5FL 4O5LH 1HOCA 3QNYB 5E2TH 1FG9C 5FECA 4NQEB 1IAOA 4N8VA 1NCDH 1DANU 4U1SA 5T1KD 3DIFA 5FCUL 4PJ9B 3S37L 2A6IA 4KZDL 5DMGC 1HYSC 4RGOH 3SDCB 4APQB 3ET9F 3QUXC 1BFOB 2XTJD 1S9VB 4MAYC 3AB0C 1KLFA 4BZ2L 2HFFA 3SDAB 3PDOA 3TJHD 3BH8B 2ZG3A 1FCGA 1T2JA 2R2HA 1MOEA 3BKMH 3V5HA 2BSTA 3WL9A 1DUYB 5DUPH 5BJTB 1YDPB 1Y6MR 3TBVB 4IRSA 3V6OE 2AJXL 3EDJA 4LLUA 1CZ8L 4MNGA 5JOFB 3MBXL 2PKDA 2ADFH 3C6LA 3OKOB 3QIBA 4MDIA 2X4RA 3LEYH 3LOWA 4XRCB 3KPTA 5F71A 4HWEL 1XF5B 4OM0H 5CIPH 4NM4H 3O11A 4OUOA 1IZKA 3IETA 2GW5A 2GCYB 4PJFB 5I1DA 3O41A 4HXBH 2Y07L 1A7PH 1S9XB 1BIIB 4AEHL 4K3DL 1OTTD 2OI9C 1FFPB 1VEPA 1J1OL 4GBXC 1AR1C 4ZFGH 1EDQA 4G6KL 5JA9A 1EFXD 5D1QB 3OXSA 4X5WB 4MA1C 5J57B 4WFHE 3S98A 1Z5LA 3O9WC 1JI2A 4XP9H 3SGJC 3G6DL 4NYLA 4OBRA 5D6CA 1F8TL 1HSBB 3GO1L 3O6LL 1MIEH 4IDJH 5F9WC 3T0ED 5D2LB 2G60L 4UT6L 5I1LB 4KZEH 1VACA 3BGFB 1TVDA 4ZNEA 1JGVH 5EPMB 4OFKA 5GZOD 3PNWA 4JQXA 4N9GA 2IANA 4PJHB 2Z92B 2IEPA 1LK3L 4OKVB 3WFCH 1NKRA 5JZ7C 4O4YL 2GJZB 1LP9B 5FYLD 1A6WH 3QNXB 1T04B 2X1OA 1F4YL 4M61A 4XNZC 4I3SH 3OXRB 2HWZL 3BDXA 2OJZL 5F96L 3ZTJH 3F5WB 1M6OA 4Y1AB 5F88B 1KJVB 4R9HA 3MJ8B 1W0VB 5I8EA 4EI5C 4Y1AE 1DQTA 4P4KA 3H9SB 3GIZL 4P0DA 5A2LH 4XPBH 5SX5H 4JFEA 3INUL 4DFHA 1A7BA 2YEZB 5FOJA 3BKYL 2A38A 3PG2A 1F5WA 4H26B 3BO8B 4MD5A 3Q5OA 4XPBL 3DRTB 5C0AB 2X89A 2FL5A 5ALCL 5IVZA 5IEHA 4Y2OA 4PJIF 2DWEA 3H7BA 2BNRD 4G7YL 4QRPB 1FO0B 1U3HA 4G6AD 4HK0B 4U6VH 4M7LH 1JZ5A 1IEBA 2ADIB 3MV01