4FQQA

Crystal structure of germline antibody pgt121-gl fab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 211
sequence length 211
chains with identical sequence C, E, L
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqqA01
1NMBL 3AU1B 2XIDA 4U1MB 1B9ZA 1VA9A 2X9WA 5HD8C 4LIQE 2IBGA 4HD9A 3V5KA 7FABH 4U3XA 2W9DH 2P8MA 2ZUXA 3BOVA 4WU5A 3QI9A 4FQJH 4CL7A 4JFFE 4Y4FC 4FS0A 5EBWB 1TITA 2EDYA 4TSBL 2AQ2A 3DVNB 1A6WL 2Z92B 1S5IL 1KACB 3F7VA 1S9KC 3FMGH 3C2SA 4UV4L 2CO6B 3T0DA 1TVBA 3SO5A 2BY1A 1FGVH 5E1AB 4IOIB 2Y7QA 2F53A 2OYPA 1X5IA 4LVHB 4QF1B 1V3KA 3HNVH 5ACMA 4PLKC 1IC4L 1YEHH 3N50A 1OSPL 3VWJD 4PJXA 4QOKE 2HTKC 3HS0A 5DD5H 2EKSB 5D7LA 3VDBA 2GSIB 1AY1H 2ICWJ 3C5JB 2X89D 1GZQB 1CT8B 3BIBX 3OPZL 1SY6L 1CXKA 2Y5TB 5J6GA 1UA6L 1MAML 4YAQA 1DBKL 3WV0A 1AQKH 4HBCH 3P77B 1P7QA 4PJ9A 4UBDD 2GITA 3DO3A 1IGMH 2YK1L 2E6QA 4TNWK 5HHOD 3VXPB 4S2SA 2VQ1B 3PXHA 5GJSH 1QLRB 4LSUH 5KTEH 4M9OA 3JTTB 2NNAA 5TDPB 5B3JF 5EZIL 5L2KE 5TDNB 3LPWA 5EUOE 4GBXC 4J3WA 4P4KA 2A0LD 3VXOB 4YFDB 4MAUL 3SKMA 2H6PA 1YJDH 4P23C 3WS3B 5J06A 3BP5A 3OTTA 4O4YL 1DFBL 2IPKA 2P5WD 2HFGL 4ONFL 2BSRA 5IKCA 1HH9A 1DN0B 3PDOB 1ZA3B 3ES6A 1UB5B 1M7DA 1A6VH 1G6RA 1MCDA 4BH8B 4F7MA 1AD0A 2QR0A 3VD5A 4WI8A 3WO4B 1GGCL 1N3NB 2IANE 1KCLA 4U0RB 1T1WB 4Z7UE 1Q72L 1KPRA 1JL8A 3A6BH 2JJTC 2BY2A 3MRFB 4EDWH 4XVJL 3LEVH 3MJ9L 3RTQC 4P2OD 1XGYH 1L7IL 1A6AB 4U33A 4FZEL 4FHBD 5GS1B 1J18A 1XCTB 4DEPB 1FZKA 4OCNC 2ZOKB 3D18A 1HHHA 4I18C 3KJ6H 3GBMH 4JDTH 4ZO8A 5F6HJ 1HWHB 3MV8A 5F71A 1BJMA 1CLOH 4R0LB 4BK5A 4XXDB 1VERA 3V5DB 3LEYH 4MJ2A 4Y5XC 1QLEH 5IFHL 2OQJA 3MUGB 4JO3L 4YDVB 1DLHA 3FQXB 4HT1L 4I1NB 4R26H 2LFGA 4GG6A 4FQ1H 3IKKA 3QNYB 3U0TA 4KK6C 4P5TA 5FF6B 4MWFB 5D1QC 3RIAF 4R7DA 4PGZA 1RK0A 3ESVF 1A6ZA 4ZPTB 2ICES 3KPSE 4HIJB 3P9LA 3PE9A 4K9EC 1D5IH 1U3HC 4CMHC 2EZ0D 3UJJH 3LSOA 4PJ5B 3QWQB 3EOTH 3CFKA 1JFQL 4MXWH 4OB5L 1XGTB 4P46C 1J7VR 1ZHKB 2ADGB 3OJDA 1R3KB 2N1KA 3OB0K 3QHZL 1J0ZA 3LQAC 1BPVA 4F57H 4JZJC 5CINL 2XWTA 3RWCB 5EBWA 3QEHB 2EYSA 5C0GB 5C0JB 2AQ1A 4Z9KB 2Z92A 1RIHH 3FB8B 3GMNB 4KAQH 5ACZA 2OZ4H 2R29H 4HV8B 4U3HA 4G6ML 4XPHL 3O45A 5E1AA 4IOIA 1IAMA 4QF1A 1KIRB 4QRRD 1I8MB 3OHXB 4D0DA 3G6JB 3J8F7 3VXUA 3AM8C 3GSXA 3DSNA 4KZDH 4U7MA 3EOBA 1OY3B 2EKSA 5GSVA 3NIFE 2JJWA 5LJYH 5F9JB 3IDIA 3C5JA 1BQHA 5TF1H 3FKUS 1E0OB 4YUEL 4YBQC 1AGCB 4XC1H 4YXHH 3MNWA 3BWUC 1MQKH 2Y5TA 5E56A 1R0AH 1G1CA 4WV1A 4H8WL 3PJSB 1LEIB 5HYQA 4FN0A 4MDJA 4F2MA 3ULUH 1CE6B 3P77A 2FJFB 1VFMA 4JQXC 1K3IA 3JTSB 4HLJA 2P24A 1HKLH 3U7WH 4ODHH 1JPFB 4K7PX 5GRYA 5F7DB 2EXYD 1RMFL 5TDPA 3TBWB 1A9BA 5TDNA 3CZJA 3QUZB 5SWZA 3NA9H 1VGEL 2B5IC 5KSVB 3S37L 4QNPE 4ZTPH 4NM8L 3WS3A 2FEDD 1CGSH 3BDBA 3NIDE 1XF5A 1KCVH 4KUCD 1NUNB 1CR9L 4K55A 5F3BB 2V7NB 1FNSH 2W1NA 3GB7B 5F6IC 3KWWB 4QRPD 1VADA 3AXLA 3QNXB 4HPOL 1UB5A 5IMLB 5DQDL 1JP5A 2JB5H 4ZXBB 4WY7H 4BSVB 3HMWL 3UBXG 1FIGH 4LPUA 4YZFE 4FRWA 4BFIB 3LQZA 5L8LB 4WUUB 4GAJH 5I66A 3C6LD 1N0XH 1N26A 4IRSA 4LP5A 4KDTA 4GUPA 4NNPH 5EUOF 4UB0L 2ZOKA 5CIPB 4PLOB 4LSRH 3FJTA 4Z6AT 1NCCH 1BF2A 1IEBB 4AIZB 5H35A 4XXDA 2BHUA 3V5DA 3VXSA 4E5XA 1I7TB 2J1KA 5DFTA 3MUGA 1QFUL 4LKCA 3O0RL 3A6CH 1PY4A 3V6OA 1RJCA 5HPMB 3K8MA 1BFVL 3CVHL 4OM1H 5C08B 1YPZB 1FYTD 3QNYA 4Z7UF 2J6EA 1W8OA 3CK0H 3GMOA 4MWFA 2IGFL 4CAGA 3S3SA 1CIDA 1WLHA 1CF8H 2Z93A 1REIA 4HIJA 3BZEB 1N2RB 2B4CH 4ZUUB 4YLQT 3NACL 5JA8B 3AB0B 4LSTL 2FZ3A 2OMNA 1GH7A 1P84K 4HT1H 1E6OH 2OCFD 1A22B 3F7QA 3GMQB 4GLRH 4LAQH 5FXCH 3QNZB 3HZYB 3QI9C 5MEOA 1UWEH 2CJUL 5JLZB 4JY5L 4TSAL 5EBLB 2HLFD 3O9WB 3IGAB 1ZVSA 3SN6N 1IJ9A 2D31B 2QADC 2WUBL 1F58H 3GO1L 3QEHA 3GJEB 4FNLH 1JI1A 5AYUL 1B0RA 5I1EL 5C0JA 4QHLB 1LVEA 4JR9H 1KLUA 3FB8A 4XWGL 2R4SH 3BPNB 5GGUB 3P3YA 4KRPB 3BZ4B 4TOYH 3AS0A 5F89B 1KIRA 1I8MA 2EKJA 3ZDZE 3WUWG 5K9JL 3OHXA 1OGAD 1UZ6E 5IBUG 1TJGL 5HI5C 4QTIL 2M26A 1SYVA 3T1FA 4XAKD 4R4FH 5E24E 4FFZL 4HDIA 5I1CH 1A1OB 2O5XL 4JB9H 4N8CL 1A0QL 3T0EB 3T2OA 1OLLA 3GI8H 1AGCA 3QB7C 4G8EB 4OBSA 5TFSL 2B1HL 1CDHA 3EYQD 5GSRB 3TWCL 4NJAH 4RMWA 3DYMA 1X5FA 5CKGA 3ZYJA 5E9DB 1DQTA 4NZUH 5J6HA 4HK3N 1SVCP 2J7LA 2G5BA 4PJ9C 2FH8A 4OLUH 4XPFH 5LGHH 5IFJA 3FTGB 2DQDL 4PJBA 3JTSA 1RY7B 5GGQH 4XI5C 4LEOB 2BHYA 5BXFB 4HSQA 5I1HH 1Y0LA 3FO2A 1F8TL 5C0AA 4J8RB 1FGNH 4R96B 5TE7H 8CGTA 4OCSH 1S7SA 4PLJC 1QR1B 3TBWA 4XMKL 1D6EA 4P4KC 4Y1AB 2XZCL 4PJGB 3CJJA 4Q9BA 1NANI 3ARBA 5L6YH 1MCQA 3Q6GH 4DKFH 4YR6B 4B0MM 3AREA 4DOHB 3MLWH 4OF8A 4P5MA 1S7XB 2DMCA 2V7NA 3GB7A 4MNGA 5GRVK 1T0NB 5E8NB 5D7SH 4Y8AA 3OR7A 2GFBA 4ZXBA 5IJKA 3MBXL 5DMKB 3HI5L 4YWGL 1MFCL 4BSVA 1MWAL 3IDXL 3DPBA 4M43L 5L7XL 3A0OA 1MHHA 4X7CC 3WKMH 4P9HC 3S3JA 3B9KB 3F5WB 1HQRB 5E5MA 3T0AA 2DN7A 2ZKHL 1IAOB 1U93B 2CLVB 3HLAB 3I9GH 3TH3T 4QNPF 3HUJA 5C71A 5KS9E 2OTWA 2WBKA 5E8EB 3NIDF 5EU3B 2A83A 5CBEB 4YQXH 3X14B 3QUYD 4TYUA 3MBED 5ALCH 4OI8A 1CG9A 4WGWB 2JIXD 2A6JB 3QXVA 4JJ5B 4JM2A 3VRIB 5LWYL 1S9VB 1IL1A 4P5TC 3FZUD 2HJLB 4IIQB 4WWKA 3LS5L 1S7TB 1MVFA 3U6RB 4YZFF 1CN4A 5F3HA 5K59E 3WCYA 3BZEA 2D9CA 1B4JL 2ZG2A 4HMDA 2CKBA 4TNVK 4KZEH 3MODL 5E99L 1J0HA 4R4BB 5C92A 3ORJA 4LRIA 1UGNA 5LCVL 2ZG1A 3TNMB 2ADIB 2V9RA 1A4KB 5I74C 1BFOA 3VMNA 15C8H 1HINL 4YIQB 1LK3L 4L9DA 5C09D 3FFCD 3W2DH 4C54A 1BVZA 6FABH 4WEBH 3QDME 4AEEA 5J11B 2FO4A 3SCMB 3QO0A 4KJYB 3LIZH 4PLNC 1HKFA 2X44D 1GXEA 1WQVT 5BZWA 3CIQA 1RIVL 2V9TA 3FQWB 1C12B 5DA4A 3MLZH 1HZHL 1OARH 5JOEA 5FKAA 1N5AA 2UZIH 3CFCH 4X4ZA 1EUUA 3VGBA 4BELD 1KOAA 4S1SL 3HNSH 2BNQA 2FHFA 3AS2A 3T0EA 3X3GH 2HFFB 1GOHA 1K3ZA 3RL2B 3DX9A 4NP4H 5B21A 2CUMA 1ACYL 4ODBD 5FUOH 4WV1C 3R1GL 5E9DA 5DJZB 3IS0X 1X5HA 1KTRL 1QR4A 3QHFL 4IRZL 5E2TL 2AXFB 1EGJA 3IFNL 5F88B 5I1GH 1UZ6F 1G9EA 5C9JA 5CGMA 4XCNB 4R96A 3O6KL 4EOWL 1M6OB 2YPLD 4W70A 1UADC 2CK2A 4LLMB 5EG6C 3HPLB 5ANMB 5EU6B 2BMKB 2X70A 3LS4H 3INUL 3HNTL 3P4LA 5FA4B 4ZO9A 3TCXA 3DRTB 1NFDB 3UBXI 4YHML 5DS8A 2CH8A 5TE4L 4YR6A 4E0RB 1PEWA 4UUJA 4LCWD 1NMCB 4DAGL 5FYLE 35C8H 3ZDXE 2EIZB 25C8H 2VABB 4L8CA 4Z7VA 3DX8B 1WFUA 4WU7B 4XH2A 5E8NA 1I9IL 2NY6D 3MRLB 1BLNA 4KKAD 4PB0L 4U0RC 1RV6X 3UTQB 1NUFA 3E6HB 4KDWA 2I9LB 4RISH 2IALB 4E9LA 2DD8H 4WI7A 1UXWB 2J5LC 5EPMA 3MRHB 4I48B 2VXUL 5A3ID 3B9KA 4DEPC 4KDTC 1XGPA 3P0YL 5I1KL 2IC2A 3MACL 1HQRA 4U1SA 4ZFGL 4MCYB 5C0DA 1QA9B 4WFGE 5ETUB 5B38A 3MQIA 3M17A 3T4YB 5E8EA 4YXLH 4XP6H 3QG6B 1JGUL 3L5WA 4G3YL 4PJAE 1J87A 4KMQA 5TGBB 3KVQA 3V6OC 1KUMA 5D72L 3TN0D 4ZNCD 1RUQH 4CDGC 5CHNB 5C3TA 4HHAA 1QFHA 1QFWI 3NCYS 4ZPVA 1H8OA 5A2FA 2WWMD 3TFKD 3I6LD 4PRHA 3U6RA 3V4PH 4M7ZB 3RZCB 5KBNC 3CSYB 3DVIA 4UINL 4EIGB 4UNTA 5EA0H 2IH3A 3M07A 1MY5A 1FL3B 3TT3H 4Z18A 4APQD 4XXCA 1AIFB 2R15A 3TBVB 3VFRB 4RX4D 3VU2A 3THML 4R4BA 5KS9F 2W0FB 3CCHB 5HHMB 4YBLB 2P7TA 4CJ0A 5IMMB 1DL7L 2O5ZH 3JWDH 4HUKB 1HXYB 1UM6H 2SEBB 4M1GH 1H3UA 4FFVC 2LTQC 4BQCA 1WICA 3GSNA 5ADPL 2A9NL 1UJ3A 3VFPA 4YIQA 4ZAKB 5GGVY 5D1ZB 3WHE0 4JQIH 2JTDA 2CRYA 2RBLA 1MJ8L 2F5AL 4GMTL 3SCMA 2FEEI 1QKZL 1M4KA 5DJDA 5EO9A 3T4AA 4Q9QH 3FQRA 1H15B 5K59F 5B3NA 1R3HB 2R0KH 3QH3B 4NO3B 3GM8A 1A2YB 4M93C 3BQUA 3NCMA 4KXZH 5C0ND 1PLGL 1MCOH 3UYRH 2VDOL 4XNMB 3KLHD 4Z78A 4RGMB 5DUML 5I15L 5KSAA 2HFFA 3REVA 3QUML 4MDIA 1A3RH 1XGRB 3Q1SH 4BK4A 5HHPA 4NRYA 5DJZA 5BJTB 1A21A 3FAWA 3DLQR 1KYOK 2ARWA 4YNYB 1EV2E 4N1CA 4HWEL 4X98A 5IHUH 3RNQB 4Y2DB 5D71L 5C0BA 1DUYB 2AXFA 2AV7A 1HIML 1BQLH 4W4OC 1I9RL 3GMLA 4AMKL 4NQDB 4V2CB 5JR1L 3WFCL 1CE1L 1N6QH 4G6KH 4MJIB 5LXGL 3VFGL 1EFXB 3ULUD 1ACYH 3O3EA 4MNQB 4L3ED 3ARBC 1RZ8B 4GFTB 3CGTA 5FA4A 5DD0L 1A7RL 1GJIA 4AEIH 3AREC 1RK1A 1CVRA 2EH7L 2X4PA 3IDUA 4MSWB 4N0UB 4ODVH 3H0TA 4EI6B 1JNHA 3CLFH 2N4IA 2DM2A 4TULH 4DW2H 4ZXBC 1UH3A 2PYEA 5IJKC 2EICA 5F7MC 1A14H 1CFQB 1B6UA 4KVNH 1I1AD 1JWMA 4JREB 3C6SA 4XMPH 4X5WB 3K80A 4DGVH 2I9LA 2IALA 2IQAA 2FATL 3CUPB 3I6KB 1DQJA 4HXBL 4OF6A 4GQ9H 2NXYB 4I48A 4IDJH 4TVPH 4P9ML 3QUKA 5DC9B 4G8GB 2YPKB 4MCYA 1BJ1H 3VI4F 3Q6FA 1E28B 3SDDB 3R0MA 3MMEB 3MV9B 4PP1C 4XBGA 4JLRA 2FECL 2YSSA 5I73B 2VXTH 2FX9L 1KNOB 4EN3B 2C1OB 4X7SL 5HGBA 5TGBA 1QRNA 4HAFA 3WFBH 3KPRD 3ZDXF 5IMOB 3MREB 3ARGD 5JO5B 3RWFB 1MEXL 4JM2C 5DMIL 4PJFE 1J10A 2AEQH 3B83A 4WWKC 3NZ8A 1TZGH 2A6DB 3ARXA 3VD4A 4I8DA 4L8DA 2ERJC 4HF5H 5HHQB 3RZCA 1BP3B 3GSRB 4JFDE 4F9LA 5B39A 4NQEE 4PBXA 1M05B 1FL3A 4PB9H 1PQZA 4M6AA 1OAUL 5DTFB 1AIFA 1JWSB 4WTZG 2VLRB 1U8MB 4N0CD 4DZBA 4X9GA 4LRIC 3CCHA 4U2YA 1AKJB 3ZZ1A 2VLJD 2CDEB 2NY1C 5KSBE 4GH7B 2H41A 4PJAF 3WNLA 1MPAL 1DP0A 5GIRA 4K9EH 2RHEA 1JRHL 2SEBA 3IF1A 2JB6A 3PG2A 4FTVB 3DUHA 3E2HB 1BWWA 1IC7H 3CLEH 1XR8A 1YEGH 2F54D 5C2BH 2CIIB 3O2VL 3LQAH 5IB2B 3KYNB 3SKOA 5DD6A 5IVXE 3B6SB 4H20L 3C2AH 3O41A 1EJOL 1ADQA 3D39E 4TPRL 2AJSL 3O3AB 3HZKB 5GRWA 4NO3A 1T1XA 1A2YA 5DMGC 4CN6A 1C5CH 4LPCA 2O5YL 1DANT 2CIKA 4FQQA 3T0EC 4OSUH 5DHVB 1E27A 1OB1B 1SYSA 1RHHA 4ODTH 5HGDB 2Q8AH 1DEEA 4LBEB 3R8QA 1GRWA 1I8IB 5IVZA 5IB5B 5GISH 4BFBD 4MD5A 2AEIT 1NCDH 1HYSC 3UTZA 1FZOB 3GIZH 3BGFB 5CGYC 3H42H 1AJ7H 2W0LA 2WIIB 5IT2L 3W9DA 3TA3D 3RNQA 3TIEA 4A2MA 4XNYL 3EFFA 1IILE 4U6XA 1PYWB 4UU9B 5DVOA 5I17A 2FR4B 2Y25A 4I2XA 2Y5EA 4NQDA 4KROB 43CAB 4Y16A 1EFXA 4LSQH 2ADFL 3L7FB 2MKWA 1MREH 4ETQB 5J7CC 1T20B 5CEZH 3D85A 1BD2E 3MRNB 5DQJB 1MCPL 4BZ1L 4OZFH 2EH8L 3RP1A 3VXNA 4BQBA 1GOGA 2VDLL 4UQ2B 2EEAA 3SO3B 3TVMB 1YEDB 3IU4H 3AGVA 4ESKA 2I5YL 4OD1H 5J57B 5IF0A 1RZFH 4J3OC 5LXGH 4GRLD 4FFWD 3E6FA 5T1KD 3CUPA 3I02B 3FT2B 2NMSA 3STLB 2ZSWA 3B9KC 5F7NC 4S0SD 3KPMB 2YPKA 3TJHC 1MVUB 3D3VD 3O4LE 1D6VL 3MUJA 2HFTA 4NC0B 3TZVB 1T5XB 4ZUSB 1NUDA 3Q3GB 3AAZA 3RKPA 2M8XA 2R8SL 3QCTH 3MMEA 1ITBB 5GRZA 1T7YA 5CD3A 2UUDK 4P59H 4TTDC 2V7HB 5ID0B 1RU9H 1EK3A 5GGTL 1U8QB 4NKOB 5D1XA 5EOTB 4HC1A 4DN3L 2EDOA 5IMOA 3MREA 1I7ZB 4LDLB 3V95A 5MEQB 4M03A 1KTLB 2VTFA 4OJFH 3ULSA 1AO7D 5ITBH 1MFNA 4P2QA 4G7VL 2A6DA 2QHRH 3KAAA 4G7YL 5CLWA 3BIAX 1NGQH 3GSRA 2AKRB 5E03A 5ESAA 2ESVE 4RAHA 2MMXA 3NCYP 2NYYD 3PHQB 4XXCC 4D8PA 1Y18A 1K4DA 1BEYH 1I1YB 3OB0H 5B4MD 1N4XH 1AKJA 4ZYKB 2IAMD 5B8CB 2BSED 2MCPH 1A5FL 4XVTH 5KZCD 1UJ3C 4AM0A 4JFFB 5DEGA 4N0FB 3GHEH 2IMNA 2XI9A 2GTWB 4FTVA 3UJTH 3S97C 5SV3A 4DTGH 3G6AA 4MGXA 4U6HB 2QQLH 2W0KA 1EHNA 1CFSB 4JFEE 3SCMC 3VH8B 4PJFF 3O6LH 5ICXB 2R56L 1FNEB 4QTHB 3RFZC 5F7WC 1EEUA 5CZKA 5E7FA 2VDPH 1FZJB 2VXSL 4RGOH 3MPCA 4EUPA 3VFTA 4U6VL 4PD4K 3BQUC 2G60H 4P2RB 2HJFA 4QOKB 4NPYA 4HS3A 4RIRB 3DRQB 5EOQL 2DF3A 5EU4A 2XT1B 5T3XH 3ARWA 4CBPA 5KSAC 3UJIH 3TBYB 4NC1E 1XGUA 1FBIL 5JW4R 1A9EB 4NQSB 1I8IA 1OSZA 1P1ZB 4LLQB 4FP8L 3TH4T 5IB5A 1F4XL 2NZ9D 3B2VH 3OKYA 1IFHH 2GW5A 4YPGB 3WDIA 4LDEB 2VR4A 3BKJL 2MQCA 1HHGA 5DJXB 3EW3B 3K4DA 4TSCL 4YHNA 4LASL 1PYWA 3RNKB 1CU4H 2FR4A 4M5YH 4X5LA 1YY9C 5I30H 4MB4A 4HH9B 4RZCB 3DX6B 1XIWB 2DYPB 3MLYL 4H0IA 3QUXD 4S1DD 4ETQA 5EUOB 2OJZH 4M6MH 3IFLH 1Q94A 2J8UE 4NQXB 5DQJA 2NX5E 4NQVB 1CK0H 1LO3L 1W72B 2R0LH 5FYJU 2VL5B 3FN0L 1MI5D 5CILL 3PGFH 1KJMA 5EOCJ 1DQDH 5DF0A 4LKXA 3IDGA 3GIVA 4JO1H 1LD9B 2YXFA 1LO4L 3H3PH 3U30C 2DQCH 3NGBB 2IANB 3F7YB 3LRGA 5DVLA 4Z7UB 1MCIA 2OJEA 4GAFB 1I3RB 2X6MA 1KELL 3QFDA 4G43B 4LLYB 1JN6B 3ROOB 5DUBB 2R4RL 3VGEA 2ZUQC 4PG2C 4NKQB 4JHAL 1G6RH 4UNVA 1R3LB 4GW5B 1TNNA 3QCVL 4IOFC 4YE4L 3L5JA 1MUJB 3TZVA 4O5LH 4ZUSA 3QIUD 5IW6B 1OAKH 1LGVA 5IW1B 5DRZB 3HC3H 1LMKA 3KXFA 4LSDA 2R2EB 4PJDA 1RURH 2Y6SD 5BV7C 3AS3A 1K2DB 3EDKA 4P9HH 5HVHB 1U8QA 4NKOA 5GJTH 1F02I 2HRPL 3L5XL 1ORQA 4JHWL 3LKSB 3QEQD 4HKXB 5MEQA 3K1KC 5T1LB 3C8DA 5EIQA 4JG0H 2Q86B 4M7ZC 3SDCB 1WGOA 5HHOE 3RZCC 5J13C 4F9LC 5IR1B 5I1AA 1QBLH 5MENE 2AKRA 3M8OL 5HHNA 3BH9B 5D7JB 3P4OB 2O61A 2YZ1A 2DQEL 1JYVA 4YBLC 2F19H 2IADB 5M7QA 4MLSA 3FO0L 4XRCB 3BW9B 5B8CA 32C2B 4HUWB 1WIUA 5BZDA 1JPSH 3VRLE 1NFIB 1JGLL 1KN4H 5BQ7B 2P5WE 4JM4H 4ZAKC 5KVMC 5GXBB 1NAMB 4J3VA 2GTWA 1E6JH 3H9SB 1AGBA 3UEZA 3RHWF 1YY8A 4D0CB 5J3HD 1SHMA 2DICA 1NGZA 1SJVA 4KH2A 1EHAA 4EQ3A 2V5YA 4YHLH 3ILQC 5DUPL 1TLKA 1XFPA 1F3DJ 3IVKA 3HI6H 3D2UB 1NEZB 4LLAA 5AUMB 4P2RA 3BD4A 2V2TB 1BOGB 3QFJB 3QJFB 4M7KH 4MXQC 2FWOA 3DRQA 3VXQB 4Y4FD 3NIGE 2HJKA 4KKNA 3VFUB 3TT1L 4A6YA 3OF6A 3NFPB 1MFAH 2X89A 3MLXH 3P4MB 4DZ8A 1J0IA 1RUPH 3B3IA 4U6VH 3V52H 2VE6B 3L3GA 1P7KA 3FB7A 3NPSB 4HZLA 4QXUH 3CVIL 4NCC2 4N90D 3RVUD 4PLKD 4Y2DC 1ODAA 2CKNA 1UM5L 5C0CE 3GFUA 4QGTA 4GLRI 1K4CA 1JGDA 2HTKD 3KHQA 2XNAA 3MSPA 1RZKL 4Y4HD 4Y16C 3SDYH 1K5NB 1KJ2B 2JELL 2XQBH 4X4ME 3WXVL 3WHXB 4F37F 5LBSH 4HQQL 1FNAA 4V1DE 1EDQA 2APBA 1KCSL 4OCWL 3K4ZA 4RMQA 4CW1B 5JDSB 5C6TH 1W72A 2VL5A 5CP7B 2OX5A 5GS0C 3NPZB 2YRZA 2CK0H 4ZSOE 1RUAH 1WBYA 3KYMA 1LD9A 5D2NE 2V5SA 1TETL 2VLKD 1J1PH 3EYOB 4EVNB 5CJ8A 3F7YA 1RVFL 2JK5B 3EOAB 4XNQB 2OI9B 5TDOB 3VG9B 5I9QB 4B7IA 1CD0A 1CDGA 1BGXL 4M4PA 4QKXB 1T0MB 4QRRE 1I3RA 3SDAD 5ITFB 3UTSE 2NXYC 4OD3H 3EGSB 3VXRD 4YX2H 2MPAL 4GBXD 1A3LH 1BWMA 3TYFB 2BRRL 1Y6MR 2YD6A 3C87A 1X5YA 4P23D 1MUJA 2J8UF 3G5ZB 3MRGB 3MRRB 3P2TA 3CNKA 5IW6A 5TE6L 3NVQA 3DNKA 4RAVA 2R2EA 3L95B 4P2OA 5HGAA 2R9HC 5D1XC 1K2DA 2PTTB 3JWNC 4CVXB 2IBBA 5KVEH 2ARJB 4HKXA 4P57A 1DQQA 3NH7L 1XT5A 4HWBL 1CCZA 4JVWA 1WFNA 3SDCA 1SJEB 2V17H 5IR1A 1C7SA 2R1XB 2L0DA 3DGGB 2MTPA 5D7JA 1NL0L 3DUUB 1F00I 2EYRA 2J6EH 1XF2A 1ES0A 3QA3B 2IQ9L 2FL5B 2IADA 1AQDB 3LAFA 1JZ7A 3BW9A 3W9EA 32C2A 2W60B 2X4RA 2WNGA 1AGFA 4OCXH 3V0AC 1A3QA 1ZHBA 5BQ7A 4DKEL 3E2HC 2F74B 3H9SA 5FM5O 4PRPD 2QSTA 4D0CA 3VFNB 4YHYC 4PS4L 5BS0A 4KK6D 5GZOC 5CJQL 1NLDH 4LARL 3S98A 4UT7H 4GKZA 5IB1A 3FQNB 1U3HD 3ARYA 4E42B 3UC0L 4LLVA 4P46D 1NCAL 2AK4D 3F6LA 1F90L 4NN5B 2VN4A 2X1XR 4OCRL 3B9VA 4OLVL 2V2TA 1P2CB 3QFJA 3QJFA 4Q0XL 4JAMA 3VJ6B 5ID1A 3BJ91 1IGTA 1KBGH 3VW3H 1Q9LB 1OD7A 4JRYD 3VRLF 2BOCB 4KC3B 4WCYH 1SQ2N 3S34H 3KYOB 3BWAB 4PGEB 5E4EB 4Y19E 2DQFB 1X5LA 3NFPA 1MF2L 3GHBL 3VD3A 4X6BB 5J9PB 3RVXC 1HE7A 1JGVH 4PR5B 4F7CB 2HKHH 1B88A 4C56E 3CFEB 2BHZA 4QWWC 4YJZL 4XMLL 5FUCE 4X6CA 5J1SC 1EIBA 2MWCA 1KJ2A 1FH5H 2JCCE 5KOVC 2EDXA 5EBMB 2YD4A 4F8TA 4R9HA 4HKBB 1BVKB 4OLZL 1J1OL 3IXAA 4M61B 1MFBL 2PNDA 4NQCA 5E2VH 5DRNB 1WFOA 3SO3C 4LGPB 1EAPB 5KVFL 1J8HD 3S7GA 1EHLL 4NFDA 1YC7A 2Z31D 4ZNEE 5CEZD 1JNLL 4EVNA 3BE1H 5L0QC 2BVQA 1U2HA 1CGYA 2JK5A 4XNQA 3QO1A 2IH1B 1WTGT 5ITFA 3VFWB 4XC3H 1F4WH 3ULVE 1OGAE 1PG7H 4QRPA 3BHBB 4Y89A 3F62A 2PW1B 2EIEA 1EEYB 4XAKE 5AWNH 3TZVC 2CLRA 5TQ2H 3MRKB 4UOW1 3G5ZA 3MRRA 5E70A 5KS9B 1OAYL 2E7MA 4PGCA 3B9EA 4KY1H 4H5SB 2J8OA 3WLBA 4FXLA 3L95A 3VXMB 4YH6A 5E94B 3C6LA 5JXAL 3OAYK 1RULH 2BNRE 4E41D 2PO6D 3MNZA 5CIPH 2ZUWA 3O6FB 5DHYA 1C7TA 4K94L 5IV2B 5I1LA 4PRAB 1J11A 1LO0H 1T03H 4MQXC 4ZD3L 3TNNA 1ONQB 3HC0B 3SKNA 1JK8B 3NCJH 4XPGL 2OR9L 1PSKH 4QCIA 2AV1B 3EYUH 1I8KB 1SEQL 4YGVB 1FYTA 4F33B 5FYJL 4DJMA 4XP9H 3LHPH 5I2IB 5CSGA 1CICB 1D5MB 2XN9E 3U1SL 5B8CC 2V2XA 3EUUA 1RUMH 2W60A 3F58L 5DQ9A 4OIIL 1KTDB 1NCWL 1U92B 2E8YA 3ALWA 4WO4B 2CKBH 4LQFH 3QULA 4U7SA 4LVNC 4TRPH 2OK0H 1MRFH 4OZFG 3QDMB 4LSSH 2MOVA 4TUKH 1IKFH 1NJ9B 4NRZA 3FO9A 3U0WL 4WNQB 3ZSSA 3RGVB 1NGYB 1JYWA 1JHLH 3FQNA 4WHYH 3TM6A 4BQ6A 3L7EB 4HJGA 5D7KD 1Z9OA 3UDWA 3FFDA 3WIFA 3OZ9L 1GAFH 3OKEA 1M7IA 5DA0B 5EBGA 5F1SA 3UCRA 1CDYA 5HY9A 1Q9LA 1YNTB 1UZ8B 5DI8B 3BEWB 2QADD 5BRZE 5IVNA 3P9MB 5DJ8B 4YEFA 3O3BB 2LAGB 2P5EE 4JFHE 4DKAA 2FB4H 2PW2A 3KYOA 3BWAA 4K3EL 5CCKH 4PIRF 1CLYH 1N6VA 4XT1C 3MRQB 1GC1C 5HBBA 4ZDHA 5IESL 3RA7L 3TBSA 5JUEH 2F53D 1U0QA 4B53A 5T3XD 4PR5A 1T22A 1YYMH 3LKNA 4Q0XH 5E95B 1UXSB 2FX8L 2E9BA 2FJGA 5HI5D 5DZLA 1VEMA 1D5XA 1RPQA 1S78C 1A47A 5GHWL 5EZJA 3GKZA 3T8XA 1A4JB 3LRHA 1SM3H 2CXGA 3GHBH 1EGJH 3S5LG 2Q76A 4M61A 1J0JA 1J0KA 3R4DA 4RRPA 1ZT1B 3GDBA 3U79A 2YEZA 3DROB 2IFGA 1EAPA 4YK4C 5C09E 3FFCE 1P7QD 4PJ9D 4GXVH 1UACH 3MLVL 4K3JL 4H26B 4XMLH 5EZOH 3WXWL 2OXHA 1T1ZB 1ZOXA 2CDGB 5AZ2L 1IAKB 3NGBC 4JFOA 5FHAL 3T0XA 4XI5D 5I1IH 1II4E 3CXHK 4PJ7F 5H2BB 1N64H 5FA3B 4KXZI 5CJ5A 3NFNB 4O51B 1G7MB 1M1SA 3CX5J 5HGGS 3WFEH 3MYZA 1QVOB 5IOPB 3FRPG 3LMJL 2JCCF 2HN7B 3EFDL 4LCYB 3G6DL 1RJZB 3MRKA 5F9OL 3WL9B 1YEIH 4HBQA 4X83A 1LDPL 3EJJX 2Z35A 4JDZB 3C60A 2XQYK 3VXMA 1RZGB 4PJAB 5HVHC 3KS0J 3DIFA 2OP4H 4IMLA 1HHKA 1LO2L 2VDQL 4MQSB 1INDH 1WT5A 3O6FA 4K8RL 5DD3H 3EYFA 5KAQG 3GNMH 3F7PC 4PRAA 4KJWC 4I0PB 3QDJD 3RVTD 5HDQL 3QUYA 3MBEA 3SDCC 3P4NA 4U1IB 3ULVF 3WFZA 1QLFA 3ZTJH 1YEJH 1WZKA 3T65B 1FAIL 4WI2A 4NCDA 4X7FC 2WUCL 4YGVA 5D7JC 3DMMD 4LK4A 4O9HH 3MV8D 1GGBH 1S9WA 4NGHL 1CICA 4K94H 1A1NB 3F6IA 2XFXB 1QSFE 4K7PL 4M62H 2BJML 1I1CA 4D9LL 5CBAB 1KTDA 2ITDA 1UVQB 1P4BL 4KHTH 3L3IA 3AUVA 3KPTA 3ECBA 1KG0B 4DUVA 1NC4A 3HAEB 4P5TD 1JHTA 4YDKL 3HG1D 3M1BA 5D7IA 1IGFH 3S35H 1FORL 2EDRA 4F58H 2BP3A 2GK2A 4X8XA 1MCRA 1NGYA 1YYLL 2BSTB 2WANA 3PGDB 4WFHE 3GSNH 3HZMA 1YEFH 2HT4C 1WVZA 3K46A 2UVEA 5L8JB 2CXKA 3NTCL 4TTGA 3QPXH 2AK1L 4PGBB 1G0XA 3HI1B 2Q7YB 3WSQL 2BK8A 4ORGA 4HMEA 1P7HL 1OW0A 2LE9A 2EO9A 2D0GA 5DLMH 4JG1H 4PY8I 3OKDB 1P6AB 1YNTA 1UZ8A 1WWCA 2PXYA 4WW2A 1RJYA 4ZUVA 5HDBE 3TGXA 1ZHNA 4LMQI 2WSKA 3CAFA 4Z77B 2P8LB 4NBYB 4HIEB 2C9AA 2VXVH 4MA7H 2QQKH 4ONHB 4C57C 2ZUUA 5FCUL 3CXDL 4GRWH 1A7OH 1X4YA 4FFYL 3GKWH 2Z8SA 3D1MC 4WDIA 2DAVA 1CLZL 3T0VA 4NM4H 1IQDB 2G75B 3U4EB 4MD4A 3QEGH 1VPOH 3LV3A 3RWEA 2CLZB 5JIHA 5JQ6H 4X6DA 4QLRA 1A4JA 4HS8H 3SOBL 4OFIA 1CTNA 3ZKMD 2EIDA 1GHFH 1HSAB 1QHPA 3KYKL 4N68A 1AR1D 3ZYOA 4BFEA 5F7EH 2YPLA 3DROA 2I9TA 2EDLA 3JBG7 2E8ZA 1Z3GL 1OM3L 2NW3B 3DARA 3PP3K 3QIWA 3LKQA 3VI3E 4U1HA 4LLUB 1XZ0B 3G08A 1GPOL 1I7RA 2HTLD 1T1ZA 4IDLA 5I0ZA 3HFMH 2IPTH 4RDQF 3VG9C 5J4MA 2V2WB 1ZLUK 4KK8D 5GQBA 4LCWA 5FA3A 5C07A 4JRXB 4KGJA 3OR6B 3P40A 3GJFA 4NO2B 4N0YL 2ZJSH 5I1JH 2EDJA 4CNIA 3TV3H 2H1PL 2B8OT 1B3JA 2Q8BH 4BQ8A 2HN7A 4LCYA 1LP9A 4YC2B 3PWJA 3IS1X 1RJZA 2Q3AA 2B1AL 3DVGB 2BDNH 1D5BA 2UUDH 3SY0B 1FVCA 1RZGA 3C6LC 4NCC1 1AFVL 4Z7QF 4LHUB 5B22A 5F7FA 4DQOH 3A6OA 1OAQH 4RGNC 3VFSB 1JYNA 1UH2A 4BKLB 4OZHA 4PJFB 2R69H 4BSWA 5BV7H 4NUGH 1BQHG 2ATKB 2R23B 1IM3B 5FUZH 4PREB 5LGHL 1EO7A 1QBAA 1SBSL 2X4NB 4NT6A 3FT3B 2LU3A 4HWZB 4HMCA 2DQGL 4X6EB 2R2CA 1AD9A 1FRGH 2CGRL 1NC2B 3ARQA 4AY0A 2O93L 5BW7A 1HILB 3MRMA 1DQLL 1UVQA 4APQA 4FQXB 4RX4A 3DUSB 4XNUH 5EU5A 5I18L 1T7VA 4OZGE 4PJEF 5SV4A 3JXAA 1G9NC 5CUSL 4JDVB 1VACB 2HLFC 3T77B 2BSTA 4NDMB 4PJ5D 3UDWC 4UIKH 3D39B 1CTOA 2ICWI 4ZS7H 4NN5C 4H25A 4MA8H 3HI1A 4G42B 3IDMB 2QKIB 3P11L 1VENA 1MHPL 4XPTL 3U46A 1ADQH 3MLUH 3OJ2C 4FFVD 4ZUWA 2YMXL 2A6KA 1MFDL 4NHCH 4XGZB 3WLWC 5IQ7H 4XP1L 4LPWA 5E4EC 5IBTL 3QCUL 4HCRL 4Z77A 1F6FB 3HN3A 2BCKA 4ONHA 2FECI 2AK1H 1J86A 2NY4B 1MCWM 2HWZL 5SX5K 4YBHA 1JUFB 3C8HA 2VSCA 3ZE1E 2BVUA 1RJLB 1RZ7H 2ZUVA 4OM0L 1KPUB 1YC8A 1QFWM 3EDEA 4IBLT 5I19H 4GRMA 4AT6A 4QXGL 3D48R 1JF1B 1BQSA 4OUUB 1BD2B 4XAWH 3TESA 5JHLH 5DK0A 5LAXA 2WLZA 4PJCE 5HDBF 4R90H 1VGKA 3CX2A 2ICCA 3VDAA 3DV6A 3U7YL 1BX2A 4L3EA 1YUHB 3B8SA 1CXHA 4LLUA 1A6PA 2PUQT 2X7LB 2EE3A 4WTZA 3O3DA 1P4LB 3TJEH 2BOBB 4P99A 4AEFA 5FYKH 5GGSY 1SY6A 3PGCA 4JRXA 2F5BH 3OR6A 1AH1A 4NO2A 1YNKL 3MXWH 3SKJH 1I3GH 5GS0H 2VXQL 1VFUA 3RVWC 4HGKC 5MI0B 4GW1B 3MLRL 3L3JA 3U9UB 1G0DA 3ARBD 2H2SC 1PZ5A 2VDKL 3O4LB 1ZANL 1I1AA 1QNZH 5E8OB 3GJFK 4O2FB 4OQTL 3C60C 4OGZA 1OAXH 5FK9B 1HXMA 3BAEH 1VESA 1U3ZA 4MMZC 3FB6B 4Y88A 4P4RA 4LHUA 4DVRH 1WT5C 3O6FC 4NN6B 4OGYL 4ZXBD 4I4WA 3NOIA 3TCLB 4JCMA 1PGRB 3S9DB 2W9LA 3LKOA 2NW2B 3GUTB 1FVDA 2VDNL 1G7QB 1CS6A 3QUYC 1GGTA 3MBEC 3KPRA 3FRUB 4HC1H 4OFPA 1URLA 4LIQL 2R23A 3MLTA 4UDTA 3KPNA 4LHJB 3ARGA 4M1DH 3MXVH 4GO6B 3I6GB 5MP6H 5JORA 1WCBB 2ESVB 3FT3A 1VFAA 3VFVA 5LVEA 4PP1D 5T3ZH 3FZUC 4XNXL 1RZJC 4XWOC 5D5MF 3D0VA 4HXAL 4L8BB 4NWTL 5TQ0L 3S36H 1CICC 4WI5A 4Z0XB 1R5WA 4ONGH 3QZWA 4PP2B 3BO8B 3IETB 2APWA 4GT7A 5HTSA 1NSNL 2RR3A 4ORZC 1ZGLB 1HH6B 5CEYA 1KCRL 2W65B 5EOCH 4Y4KB 1KFAH 3Q2CA 4NO5B 2VLJA 3BKCH 5F1IA 2XPGB 3QXTA 4MAYB 5FB8A 4G6AD 3HE6B 2A1WH 3KPLB 1Z6JT 2CGRH 2FGZA 1A6TB 1I3VA 1AI1H 2RCSL 1Q1JL 1CXFA 4M7LL 1N7MH 3HR5B 4XCFL 1OW0C 1HSBA 3CVHB 3OKKB 1ZT4B 2R39A 1UKTA 1JVKA 1JZ2A 1MIMH 5INCB 3WJJA 4OCYL 3WIIL 3MFGB 2PXYC 1SVZA 3HA0A 4WW2C 1LDSA 2NY3B 4QXTA 4S11A 3V4UH 2NXZB 3JV4B 2RFXB 3EOYG 5I75B 4OZIE 1VFOA 4R4ND 4JZOA 3ARZA 2YOCA 4ONOA 1H3PH 3MTRA 1AO7E 1CQYA 4NFCA 2ZG3A 3OWEA 1JUFA 3NCEB 5E8DH 2YMXH 1K6QH 4GAGL 3L9RB 4OKVA 4UILH 5F7KC 3RAJH 5DFWH 1V3LA 3T0ED 4M5ZH 5BCAA 5ESVB 3ARUA 3QWOB 3TO4B 5EZLB 4WI4A 2J8UB 2X4SB 3I3BA 5DEFA 5K9OA 4UTAL 2NX5B 1CDBA 5E9DD 4XZUA 1HDMB 1OAZL 3LD8C 4QHNB 4OLXL 1HNFA 3RU8L 2LABA 3QXWA 1HYSD 3QIWC 4KPHL 4UOW0 1MCJA 1Q9WA 5IVOA 1CXEA 3S4SB 1KB9J 4HIXL 3CZFA 2AI0L 4HGWB 1P4LA 2GJZB 2BVYA 2IG2L 5F9WB 4HULB 3ZE1F 3GK8L 3ZKNC 1CGVA 4JHZA 4ODUA 3W39B 3HZVA 4G9DA 3UPRB 4GSDL 3JWOC 4U6YB 4LL9A 1NH6A 2HH0H 1DBAL 2FIKA 4Y1AD 3MLSH 1ZLVK 3T3ME 2R2HA 5IB3B 3ALPA 3RJDA 4GW1A 3JUZA 2OLDA 4AEHL 4WHYG 3VWJB 3BI9X 4HFUH 1TZHA 1YQVH 5CEXB 3ZTNL 3U0PB 1QPXA 3ARDB 3BD5A 3CPLA 2XWBB 4N5EC 1G7IB 4PJCF 2VITA 2EEBA 1YMME 4CVUA 1V7NH 3D3VA 4BH7B 1S7QA 1F4YH 4LNRB 1QUNA 2X4OB 1C8PA 4Z7OE 3GMRB 1KIPA 1TVDA 3QRFM 3GUTA 3C9NB 4I0PC 4X8JA 4UI2A 2KBGA 3R06A 4I77H 3OX8B 1PW3A 5L9DH 3B9KD 4GKNB 4QT5B 2FD6H 3V4VL 4PBVC 2BFVL 4JFYB 1NBZA 2WQRA 4QRUA 3I6GA 4KUZH 5MENB 3BKYH 3PL6B 1WCBA 3H3BC 4WUKH 1OF2B 4S1RL 1X6NA 1T1YA 1TQCB 2WWMC 3V79C 5L2JA 4KV5E 3LKRB 4L8BA 1NAML 1TDQA 4R3SB 1FVEB 1PY9A 5BW7C 4AQOA 1R5IA 3BO8A 3QDHA 4NHUA 5DYOB 4APQC 1MI5E 2P5WB 3QRGL 4CVWA 5IHZA 3WFDH 1M71B 1OGTA 3JSSA 1V8HA 4NO5A 1TVHB 1WITA 2IAMA 2COQA 2X4TA 3HC4H 4J6RH 2AJZA 3X12B 4JANB 3V6FA 4QEGA 5HYJE 4HXAH 1KEML 1A6TA 1FE8H 4UIMA 4R2GB 4HPYL 3F65A 1ZLSH 4KU1A 3HE7A 3OKOA 2ZCHL 3G5YB 4RWHA 1F4AA 1CD8A 4K7PY 3CVHA 1ZT4A 1H5BB 3NZHH 3QHTC 4IM8A 1CXLA 2KZWA 2FBJH 5LQBH 1EO5A 1AGDA 1WZMA 5F72S 1ZTXH 2DDQH 1I7UA 2YWZA 3TIDB 2WWKT 5FECB 2KZ1B 5FYJE 3SCMD 3SE9L 4UMGA 2VH5H 3TO2B 4AYFA 3O2WL 3KLHC 5DJCB 2IBZX 1DBJL 3G04B 5JPNB 3BEVA 2IFFH 3LN5B 4AG4L 5DVKA 2QQQA 5T33H 4JVPA 3RWGA 5C0CB 4A6YH 1UYWL 4QY8A 4EDXA 3UZEA 3SJVE 3T2PA 1GC1H 5ISZE 5EORH 1U6AL 1UQSB 2EYTB 1EBAA 3AMLA 2VC2L 1CGTA 3ZTJG 1CFVL 1FNGB 2FJHA 5I16A 1BZ9B 1KGCD 3TO4A 4JFPA 3JUYA 5EN2B 2X4SA 4V1DB 5L8KB 4LLWA 4I3SH 4QRQA 2YBRB 3OAUL 4Z95H 5GRUL 3JV6B 4RFOL 4OZIF 3UTOA 3GM0A 4NSKB 3QUXA 5KVGH 3MRBB 3W11D 4ZSOB 4L9LA 3S4SA 4LCIH 5D2NB 5D70H 4D94A 1F5WA 3MA9L 1W72H 4K07A 4OLYL 5DWUH 3UPCA 3W39A 4QRTA 1YY9D 1JPST 1A6UL 3N85L 5EU6D 4K2UH 3UTSB 3KG5A 5IB3A 5T1DH 3SDXE 2QQNH 4U1NB 5LGKA 1QYGH 3VFOA 4JKPH 3U0PA 2PF6A 2AJ3B 1AXSB 1T2QL 3PWPB 1T04B 1IAIH 2YPVH 1VSCA 3OAYH 1YZZA 4BH7A 2H26B 2PYED 3MCKA 4G6JL 5DRWA 2J88H 4LNRA 5SWQA 2X4OA 4UTBH 5KJRL 5C7XL 3WD5L 1L4IA 3BSZH 3C9NA 3MGOB 3ZYZA 1KPVA 1ZA6B 4L1DA 1HQ4B 3IU3B 5I8OH 1PFCA 2HVKA 4JY6B 4Q97A 1CL7L 3RPKA 4OD2A 3ARGC 4X9HA 3T3MF 3BP4B 4OCMC 3RVVC 3QEQA 2ORBL 3RHWK 4XX1E 3B9AA 1OF2A 3ZL4H 3BIKB 5I71B 2ZZUT 1G7PB 2P8PA 1MWAA 1CFTB 2VYRE 4Z5RA 1MCSA 3CMOL 4CDHA 3BH8A 3O3UN 4JO4L 4Q6IA 4Z7OF 4AH2B 4X80L 2LVCA 1IT9H 3MCLH 3NN8A 1S7WB 3RZCD 4FOMA 1DBML 4JFQB 4RNRB 4XBEL 3K2UH 3UZQA 2NY0B 3MOAL 3TPUB 3HMXH 4CMMB 4L29B 1OCWH 1WWWX 4G8FA 2RAMA 4HUNB 5HHMD 5CKAA 3G5YA 4KV5F 1H5BA 2DQHL 3WUWB 1JNNL 2IPUK 2OMBA 3FL7A 5IBUB 4KTEH 5DJYB 1X44A 3ARPA 3OGCA 4ZAKD 4X5XA 5D1ZD 1DLFH 3O6ML 5E8PB 4G9FE 3HB3C 2UY7A 4TVPE 4NKMB 4F7EA 2YXMA 4D3CL 5D4QA 3VE0B 3G04A 5MHSE 5JPNA 4Y19B 3ILQD 2AJUH 5SWSA 3BGMB 1U91A 4LAJH 4F7PB 3CH1B 2BXZA 1T80A 3BKMH 5DGQA 4C56B 5FEBA 4PJ7B 1ZHLB 2AEPH 2DWDB 1HI6B 2X5PA 3PWNB 3L3OB 5KVDL 3TP4A 1IGYA 2EE9A 4XP5L 5DMJB 3NBNA 4XHQA 1NAKL 2BSSB 1UQSA 2EYTA 5IEKB 5D8JL 2JCCB 4X4MA 4PRIE 4CVZA 4LMQE 4UT9H 4HWUA 1FNGA 3STZB 3C5ZB 3O11A 1TCRB 3Q5OA 4OFYA 1JMZA 3KPPB 4Y4HA 1U8NA 5BMFH 1Q0YH 1KJ2H 1Z5LB 3RBSA 2QBWA 5IIEB 2JKXA 1W0WB 4KK9C 1YEKL 3LRSB 8FABA 1N6UA 4GMSL 4Y2DD 3WN5B 1W8NA 3OGOE 2AJYL 2L7JA 1GGIH 3MJ6A 2I07A 5HYEA 3QUMB 4NRXB 4NQDD 2E27H 4MJID 4F15B 1EFXD 3X3FL 4O58L 2ZCKH 5JHDE 5DD1H 2AK4E 3BPOB 5I0DA 1OGAB 3SGKA 2VLKA 3D85D 5EIIB 2I60H 4ZFOB 4OZ4B 5ENWA 3R0NA 3UTTE 1WBZB 2B20A 5CSZB 1HWGB 3SDAA 1A7QH 3MJ8B 3VXRA 1OTSC 5GS0D 2FO1A 3PWPA 3G5VB 2GK0A 1UM4L 3U9PH 1OP5K 2BNRB 1KB5B 1A7NH 1RUKH 4GG8A 1F3JA 1MY7A 4HKJB 5FM8A 2NXYD 3OG4B 3MJGX 4H1LB 3BP4A 3SDXF 4I0CC 3V6ZA 2X42A 3SDDD 2AXGA 5ILTH 3MV9D 3KPQB 2JJTA 5IMKA 5D9SB 5FM5M 4EN3D 4KRNA 1MJ7H 2R9HD 5D1XD 2FGWL 4XCEA 1G7PA 2D7MA 3WD5H 1NGPL 2XN9B 5J56B 1JE6A 4FXGA 1CFTA 3GSUB 4KQ3H 4LU5L 2HG5A 4JPIB 5FGSA 1O7VA 2MHAB 4JZNB 5B4MC 5T3ZD 1LNUA 3E8UH 2IAMC 3BZFB 4MAYC 5TH2B 2WBJB 1MNUL 3HE6C 1FSKB 4MD0A 5DJ6B 5TPWL 1IBGL 3ZKSD 2X1OA 5FGBA 4Z7WE 2AJVL 3TPUA 4PRPA 2ADJA 2VLRD 4N9GB 5EUKA 3HE7C 4OF3A 1G9NH 1AKJD 4R7NB 4PGJA 2OL3L 2D0FA 4IHOB 4FABL 1XCQA 1C16B 2C3VB 4M6NL 1SEBB 3KR3L 5IGXH 1DQML 1MJUH 4FTVD 2NY3C 4P46A 5E8PA 3ARFB 2QSCL 3C08L 5BRZB 1PEZA 4M7JH 2NXZC 2P5EB 1ZE3C 3QDGB 4IS6B 2WZPD 4O2EB 4JZJA 4E41E 4UV7L 2CMRH 2BNUB 2WINB 4LSVL 1MCEA 4U1JA 1XF3B 4FZ8H 4HG4J 4MS8D 3L1OL 3AY4A 3DXAE 1E4KA 4MZ3A 4PJ7A 2DQTL 4JCLA 3PWNA 5HHVH 2HMID 2NZ9C 3L3OA 3CFBB 1F6AA 3DHJA 3U82B 1MRCH 2BSSA 3VCLA 5IEKA 2VAAB 2OTUB 3TO4C 2V6HA 1KC5H 3STZA 3UO1H 3C5ZA 5DSCB 3PWVA 5FYLL 1R24A 3KPPA 1GGYA 2ICEB 1IGIH 4IRJB 1U58B 2YRLA 1Z5LA 2YC1B 3QUXC 3RVXD 1W0WA 1GCFA 1EMTL 3FFCB 3PP3H 2VIRA 2GSGB 5IUSA 3BFOA 4L9LC 4NKDA 4N8VA 2VDRL 4PUBH 4AJ0A 5F9WC 4WW1B 1LE9B 1ZLUH 2O26U 2DQJL 1FQ9C 1PAMA 1FFOB 4KROD 1J1XH 4NWUL 1J8HA 2DI9A 2XTLA 2HLAB 3KLAB 4RQQA 4L4VB 2Z31A 4MJ5B 3VWKB 4DGIL 1XF1A 1U8HA 5EIIA 4JPKL 4OZFA 4KHXH 4P3WA 1PX4A 2GJJA 1KN2L 1YQ2A 3O2DL 3ARDC 1WBZA 3WNPA 1WC7B 3D69B 2AABH 4NNXB 3TVMD 2AJYH 2XZAL 3I50L 1LWRA 2GQHA 3WIHL 4O02L 1VFBA 2I24N 3G5VA 1OD9A 4C83B 2AS5M 4MQTB 1KT2B 4QRSA 4Z7NE 3MR9B 1YN6A 2BVOA 4PJEB 12E8L 2R0WL 1I4FB 1JWUB 1HEZA 4R8WL 3SE4A 1UB6A 3QXAA 4HG4K 2CO7B 1Q9OA 3PXJA 4PJXE 2PO6A 2XRAL 3RZWA 4H1LA 5D7LE 5KN5B 2B0SL 3TZVD 4C58B 5CZVL 1IQWH 3I2CH 1BM3H 1Z9MA 4K3DL 3PL6C 4M8VA 1TQCC 1T4KB 2DTMH 2GUOA 3QEUA 4D2NA 3D87B 5FDWA 4ZS6D 4WHTB 5C1MB 3U48A 1ZEAH 1QSFB 3HHRB 4D9QE 4DWHA 3GSUA 1DSFH 5C8JB 3BXNA 3L6FB 4OGXL 4Q6IC 2XA8L 1MRDL 1LE5A 1RZJH 5F1KC 1ND0B 2ID5A 1S5HB 4MQXD 2DBLH 2NY6B 1MIEL 4YDIH 1NLBL 5FHBL 2VDMH 1KENH 2C4FT 3BUYA 3PWLA 2ITCA 4J3XA 3ZT5A 1S7RB 5J3HC 3MJ7A 4HW6A 1OOAA 3DV4A 1H5BC 2NPLX 1F45A 1INQB 2DQIH 1NDMB 2DQUH 4QHUB 5D2LA 4FQLL 5BVPH 5GGRA 4TNWF 1Q9KB 4JFFD 3GMMB 1A1MB 5C6PB 2N7BA 3ARFA 1KEGH 4YDJB 1IKNA 5L88L 3OKMA 5CS7A 3NCBB 5T5FH 3U2SB 3BP7B 1A8JH 3QDGA 3S88H 4O2EA 2F9BT 5JOFB 2L7UA 4JPVL 2BNUA 5H94A 1V7MH 3FRPA 2WINA 4KMTH 3S3PA 3GSOB 4L3CA 1XF3A 2FH6A 4P3CL 1S3KH 5SX5H 1K8DA 9CGTA 4RWYH 5DURB 4Z7WF 3L3KB 4P2RD 3LDBB 4LF3B 2RGSA 5K33A 1P4IL 4QOKD 2D03H 3FO1B 1OT1A 3N1MC 2OR7A 3K74B 3RVUC 2GAZA 3MV8E 1S9XA 3O8XA 5JOPE 2ZCLL 1A7PH 4WFED 1KJVA 5E6IB 5JW3L 5E0QA 3OF6D 3RWHB 3CC5B 5ESQA 5JZ7C 5FCSH 1E4WL 4Y4HC 3IDNA 2QTEA 1OTUD 2Y07L 4GG6E 1U58A 5GRJL 1RFDH 2YC1A 3DURB 5IB4B 2OS7A 3RWIB 2GSGA 3TYGL 4OBRA 1IC5H 5DT1H 3V0WL 3T2NL 5IFAL 4M1CD 1ZSDB 5ICYB 1S78D 1INEL 2DMBA 4F9PA 3D0LB 1QO3A 1S8DA 1XIWD 2DYPD 1R3IL 5IQ9A 4L4VA 3SGKC 3ZKXC 4MJ5A 5E08H 3CSPA 2NY7H 1OP3K 3X11B 4KI5F 3N06B 3IXTA 5F1NB 3V0VA 2DJSA 4AENA 5D5MB 3PQYB 3SDAC 3GJFH 1WEJL 3D69A 4NNXA 3JWOH 1FHGA 3VH8G 4UDUA 3DYOA 1LK2B 4M4RA 5E2UH 3EJZC 4C83A 4DGYH 4HUVB 4KVCH 1P6FA 3LB6C 1MCLA 1PKQA 2IAND 2APVA 2A73A 1G7HB 4HJJH 3IKCA 1QD0A 2GIYA 1F2XK 4PJEA 5EO1A 2P43B 1I4FA 3V2AR 4XVUD 3WO3B 5DRXB 5AZEH 4RFEA 2HT2C 3P0VL 3VXUE 5ALBL 4EBQL 2H32B 1TPXC 3LKPA 3ZSTA 1JV5B 4J23A 4YHOH 5FGCE 2PCPB 3NCFB 4H0HB 4JO2H 2FYYA 5DR5H 5TJWK 5HHXH 1F11B 2XZQH 3QDJA 4LQ1A 5JW5B 5I71C 4B41A 3PP4H 5MEPA 1HHIA 5HSFA 3FOMA 1FLRL 2FX7H 2KQNA 1HOCA 4IMKC 3DMMA 1NCBH 1KJ3H 3L6FA 4XVSH 4NYLA 5C0RH 1MSPA 4K23H 5EC2A 3JV0A 4Z7NF 1EO8H 4CRPA 4KKCC 4KJWD 3LN4A 1OPGH 1GZPB 1S5HA 3SDCD 2XICA 1MJJB 5FKPA 1T3FB 5BVJB 1XR9B 4LEXH 2E9IA 5FGBC 2NY0C 4ALAL 4YHPB 2AGJL 5GGVL 5D7JD 5GGTA 3FOLB 1XF4B 3E3QC 2YRPA 4WTXA 5F21B 5SWZE 1U8JA 3HG1A 1J5OL 3VRJA 2Y36L 2Q6WA 4PJIA 1YN7B 1INQA 4XP4H 4QHUA 5I76B 4W81A 1S7VB 4CU8A 3N9GL 4ZQKB 3AU1A 4U1MA 1Q9KA 1U8PB 2E7LA 1A1MA 3H9SD 4GXUN 1C5DB 4OTXL 5BS0D 3GSVB 4HUUB 1C5BL 4AL8H 4N5UA 5J12B 3BT2L 1L7TH 5IWLA 2HT4D 3AY4C 3DVNA 1E4KC 4I3RL 1JPTH 3ISWA 4NKIL 1NMBH 3QPQD 5EC1B 3QFJD 2YUZA 3DYPA 5FUCC 3K8KA 2CUHA 4Y5YB 1T21B 3AMKA 4WWID 2H3NB 2VAJA 2FCBA 5D93C 4J1UB 4NZDA 5JIIA 3VXSE 3C5ZC 5E5UB 2GI7A 2WMPA 3KGRA 3L3DB 3CC5A 3V6OE 2GSIA 4TSBH 1NBVL 1A6WH 4UT6L 4PJCB 1BBJB 1S5IH 4BSJA 2C7UB 3EJYC 1GZQA 5IB4A 1CT8A 4N9OB 4UV4H 2VWEE 3WN5C 3C5SB 2XA3A 2VOTA 2DRUA 4RMRA 1EHXA 4GKSB 4O2CB 1YECL 5I8KL 5A2IH 1KCUL 1IC4H 1OSPH 4F15C 1QQDB 2RQ8A 3CFJB 4H88L 4Q7DA 2Z31C 1ZLVH 2FHCA 1G0YR 1IGJB 3B8YA 3BZDA 3VXPA 3X11A 3QWRD 2VQ1A 4NQCD 1DANU 2J8HA 1QLRA 4UAOC 3VG0L 3JTTA 3OPZH 5D5MA 1SY6H 3PQYA 4GAYB 4ERSL 2KH2B 5I8CB 1UA6H 2X1PA 3VXOA 1MAMH 1DBKH 4GG6F 1LK2A 3HPJB 3DX7B 4R6UA 5CJOL 1LEKB 3RWJB 4AIXA 2ZPKL 3CDYA 3VGDA 1WZ1L 1FPTL 2CDFB 1MQ8A 3A67L 2YK1H 3SE4C 3PDOA 1DN0A 1ZA3A 5F9AC 1OT2A 4BH8A 5A2JH 2PO6C 2WW8A 4GXUM 2H32A 4MHHG 5D6CB 1IRAY 1N3NA 2EEDA 5EZIH 1T1WA 1JV5A 1Q0XL 2PCPA 3RQ3A 1DDHB 4MAUH 3MRFA 2VR5A 5JW5A 3QAZB 4O4YH 1DFBH 3MZTA 1A6AA 4AQ1B 5JW4N 5GS1A 1XCTA 2HFGH 4ONFH 5HXMA 2BVPB 2Z8VC 3ARTA 3SPVB 3KJ4B 1RIUL 1WFTA 4RGND 3UTPD 2AP2A 4R0LA 1GGCH 3D9AL 4DN4L 3B9DA 4PJBE 2Z8WC 3F12B 1Q72H 3PIQB 1GZPA 1TZIB 4YDVA 3FQXA 2OTPA 1XR9A 5HI3D 2DLFL 5C0AE 5I6XC 4XVJH 3MJ9H 4N0RA 3SGDH 1L7IH 2HKFL 4FZEH 3OXRB 1XF4A 2AEWA 4ZTOL 1VKXB 5FF6A 4KQ4L 1LHZA 5ADOL 4ZPTA 1YN7A 5A43C 4JN1L 5I76A 1EERB 1E4XL 4ZQKA 3EYSL 4PJ5A 3ESUF 4X99B 5IFHH 1XGTA 3ARFC 1A64A 1UCTA 1ZHKA 2ADGA 1IKNC 1R3KA 4JO3H 2A9ML 4JKLA 4MNGE 4ELKB 5GZND 1DVFB 1TFHA 4U1KB 5JNYB 2DWEB 4OZIB 1JPGB 1X5ZA 2JE8A 2XQYG 3RWCA 1R3JB 1VCAA 4NOFA 5C0GA 1AO7B 2YS4A 3GMNA 4HLZH 2K9UA 4Y5VB 3I75B 4OB5H 1JFQH 2DS4A 4HV8A 3HUJE 3QHZH 1T21A 4Y5YA 3O8XC 1QFPA 4NN7C 1PJ9A 5CINH 4D0BB 2GCYB 3G6JA 4X7DC 3U7AA 3WLWD 5CJBA 4XPBL 1J05B 5F9JA 2DLHA 4IRJC 1BBJA 3GMPB 3O81A 3VGGA 3U4BL 3BESR 4M8QB 4YHZL 3C5SA 4ZMAT 1I75A 4G6MH 4XPHH 4PGDB 1JJUA 4L5FL 4XPAL 1L9NA 2BC4B 4BJLA 1IMHC 1LEIA 3PJSA 4ELME 5JW4M 3GRWL 3K0WA 4F9PC 1CE6A 4M48L 3CFJA 2FJFA 3Q0HA 1NMAL 1JPFA 1VEPA 4RFNB 4YUEH 5F7DA 4W4OA 4PV8B 1B0GB 4GAYA 1G9ML 3NIFF 3QUZA 5I8CA 4X4YB 2P46B 4H8WH 1NGXB 4ENEC 5KSVA 1BREA 1YMMB 2P49B 2Y72A 4TNVF 5GGSB 3RWJA 2FDBP 4LLDB 4ODSL 4UNUA 4WFFD 5F3BA 1FL5B 3KWWA 5KW9L 3QNXA 2BZDA 3RVWD 1CQKA 5IMLA 3DOSA 1RMFH 4G5ZL 2H2SD 3GI9L 1VGEH 2BNQE 3S37H 4NM8H 3RVTC 3QG7L 2H8PB 1BZ7B 3C60D 2QLVB 4BFIA 3VXMD 1WF5A 4XCCL 4WUUA 4XNZB 1CR9H 4JPWL 4YXKL 1ZS8B 5CIPA 2BVPA 5E9DE 4M6OL 3EDJA 3O6FD 1FJ1B 3DMMC 4HPOH 1IEBA 2YN3A 5DQDH 4AIZA 2Q20A 2WIMA 1I7TA 1T7ZA 2ZOLB 1QSEB 3F12A 4JN2B 3PIQA 3HMWH 2EC9T 1X5XA 2EDKA 5HPMA 5HYJB 3WS6A 5ECJE 5C08A 1YPZA 3W0WB 4DK3A 4KTDL 5FO7B 1V3JA 4OT1L 4UB0H 4XWOD 4RRPG 4UQ3B 1CICD 1TJHL 1YDPB 1IAII 3HKFA 1N2RA 4ZUUA 3PV6B 2E7LC 1GSMA 2VN7A 3BUTA 4HWBA 4DOHE 1QFUH 3O0RH 5F9DC 4D9RE 3DO7B 1NC4D 4Z7VE 2GJ6B 3GMQA 3QDMD 1DVFA 3QNZA 1BFVH 3HZYA 3CVHH 1FNLA 1LO5B 5JLZA 2RJMA 4PJBF 2X4UB 4LOUD 5EBLA 4K3HA 3O9WA 3IGAA 5IWLC 2IGFH 2D31A 4P0DA 4B7LA 3GJEA 2VL4A 4CADB 2DKMA 4YDLB 4QHLA 2N56A 1BECA 5INDB 3LDBC 3MX0A 1UWGL 5I1DB 4HKZB 3NACH 4S1QL 3I75A 5GGUA 4LSTH 3BZ4A 4L4TB 1WIOA 3SJVB 4JQVA 4LVHC 5ISZB 5F89A 4ODWB 2VZTA 2PXYD 2YA0A 2CJUH 4JY5H 4TSAH 4D0BA 2GCYA 1CXIA 5ICZB 3P30L 1PVHA 4ISVB 2WUBH 3GO1H 5AYUH 2HT3C 2YD1A 5I1EH 4DVBB 4GS7B 1A1OA 1YMHB 4XWGH 3ZKMC 1BOYA 1EXUB 1QEWB 4G8EA 2CR3A 2W9EL 3SGJA 5GSRA 4NZJA 1AR1C 2MFNA 5DK2B 4PRHE 4G8IB 1EPFA 4PYGA 3LZFL 5K9JH 5DHXB 1TJGH 2XTJE 3GBNL 3DTXB 4QTIH 3FTGA 4ZFZB 1NBYB 3HUJF 2HTLC 1GIGL 4FFZH 1UCBL 4LEOA 5A16B 5BXFA 3ZDZF 3SDXB 3K2MC 2O5XH 1SMOA 1A0QH 4N8CH 3R8BB 4KK8C 4J8RA 4X7TB 5AD0B 5TFSH 2B1HH 4PV8A 5J1AB 3TWCH 1QR1A 5DVMA 2GY7B 4MHHI 4Y4FB 4Y1AA 3LPFA 3IYLW 4PJGA 4X4YA 3QIWD 4OF5A 2YD2A 1JZ3A 2ATPB 1OP5H 1UC6A 4JM2F 5DZNA 1FDLL 5E5RB 2DQDH 5GS3A 4FQCL 5C07D 3ZKND 3OKNB 1EVUA 3CFDB 3HCVB 4ELMF 1S7XA 5IBLD 2Y06L 3MLPA 3FONB 3PABB 1T0NA 1IGCL 1F8TH 3LPGA 3WO4C 3SE8L 4F8QA 4KTYA 4XMKH 1WBXB 4LVEA 5DMKA 4FQ2L 3T1WA 2XZCH 4WFGD 1FO0L 1KIQB 3TBTB 3KNBB 4GRWE 2VSDA 4N5ED 1QFWL 4M9PA 1ITCA 1FFNB 5KANG 5GS1C 1WWBX 3F5WA 3QXDB 3BPCB 2VNCA 1ZS8A 1IAOA 1U93A 2CLVA 3HLAA 1JHKL 3QBTB 5F93C 4W6YB 3EDDA 4R0LC 1D9KB 5EU3A 1MCKA 3H6JA 5F7YC 4I0PD 5DK3A 5CBEA 4PPTA 3MBXH 3X14A 1QSEA 3HI5H 5BO1L 4YWGH 5C0BE 4C55A 1MFCH 1MWAH 3IDXH 4M43H 5L7XH 1NFKA 2A6JA 3FT4B 2NLJB 3LH2L 3W0WA 4HX1B 4JJ5A 3VRIA 5CSBA 1S9VA 5FO7A 4FXKB 2ZKHH 2HJLA 4IIQA 3D25B 1S7TA 4MJ6B 4KGLA 1H3WM 1FNHA 4P23B 4Z0BL 4FA8A 3PV6A 3G5XB 3VXTB 3RIFK 5JW4Q 3MRJB 4RBPK 1OQOA 4G9FB 2GJ6A 2Y4SA 1I9JL 1MCHA 5LG1A 3TNMA 2PYEE 2ADIA 5E00B 1A4KA 2X4UA 5LWYH 3QT2A 2Z4QB 3LS5H 4OAWB 5AAWA 1QZ1A 1B4JH 2WM0A 2VLMD 3SEPA 4Z76B 2DB8A 4M00A 1K9TA 3RTQB 4TQEL 4KJYA 4YHIB 3MODH 4L4TA 5E99H 4OLEA 4Y5YC 3SJVA 4FQIL 3QIBB 5LCVH 1MHEB 3MOBL 5SX4H 4NQTA 5ICZA 3FQWA 1C12A 1QRNE 4ISVA 4PRIB 3TEUA 1HINH 4Y5XB 1XGQB 2HVJB 1LK3H 4KKBD 4Z7VF 5AG8A 4DVBA 1C1EL 1FL6B 1YMHA 3NABL 1G6VK 1I3UA 1JTTA 3QYCA 4JFZL 3ZT6A 3OXSB 3RL2A 5IK3B 2E5EA 1LQSR 2OXGA 1LILA 5D1QB 3ULVL 1GGUA 1LEGB 1JGEB 3RX7A 2B2XL 5F96L 3LEXB 2AJXL 1RIVH 5A1AA 4ZFOL 1HZHH 4CMHB 4BUHA 3DSFL 5E6YA 3EO9L 4ZFZA 1NBYA 4B50A 1BF8A 4HS6B 5JHDB 1WAAA 2AK4B 4Z8FL 2VZ3A 4S1SH 5F88A 3CSGA 4XCNA 4NJ9L 4Q9RL 4X7TA 3UZVB 3DETC 1M6OA 4NO0B 1AE6L 1BIIB 1TJIL 4LLMA 3P9WB 3UTTB 3HPLA 3QUZC 4OF0A 5ANMA 3OMZA 2KKQA 5EU6A 1KB5L 2BMKA 3R1GH 1KLGB 1RZKC 2A77L 3DRTA 2ATPA 3KHOA 2QJDA 1NFDA 3IJSB 2F58L 2LAAA 3QHFH 4IRZH 5E2TH 1S9YB 4E0RA 1U8KB 2G9HB 4JRXD 1BBDL 3IFNH 3OKNA 3CFDA 2EIZA 2VABA 3QDAA 1NGWB 3DX8A 3NAAL 4WU7A 5IM7B 4MZ2A 3O6KH 4EOWH 4WI6A 3MRLA 1FIEA 3UTQA 2DLGA 1WBXA 3ZT7A 5JA9A 3E6HA 3K1DA 1KIQA 3INUH 3KDMB 3HNTH 4U1LB 1B2WL 3TBTA 1UXWA 3MRHA 4YHMH 1MFEL 5IG7B 4PG2A 1FFNA 5TE4H 4KJQC 3QXDA 3BPCA 4LHUD 2ZNXA 4DAGH 1QA9A 1YEEL 5ETUA 2X41A 1RQ5A 4LRNL 1F4HA 3T4YA 1I9IH 1D9KA 1X7QB 3QG6A 4PB0H 3H2WA 3Q48A 1QSVA 2UZXB 2PR4L 1X5GA 5CHNA 3TF7C 4I2XE 3WS6C 2VXUH 1YNLL 5JTWA 4BZ2L 3RVVD 4Z7WB 2APTA 3P0YH 5I1KH 3MACH 1BAFL 4ZFGH 5JIPA 2R0ZL 4I13B 1DBBL 3D25A 4G6AC 4GRWF 1I8LA 1NC2D 5DJAB 1JGUH 2ZSVB 3CSYA 4G3YH 4LDOB 3VXTA 3AB0C 5FYKE 4FQXD 3TBVA 3VFRA 2NY5L 5D72H 3DECA 1FZMB 2W0FA 1DVFC 2H9GB 5F6IB 5IMMA 1HXYA 1DE4B 4HK0B 5EU7E 3NFSL 3O9WC 2D7TL 3DI2B 2ED7A 5EWIL 4OLWL 4ZAKA 5D1ZA 3D39D 2QEJA 5HGHB 3F8UB 1CGXA 3DXAB 4LVOB 4UINH 3NMEA 3BPNC 3C8KB 4R4NC 4KRPC 4JQVC 4P2CG 3THMH 1H15A 4POZD 2YKLL 1DL7H 3QQNA 4LHUG 4ODXB 1IM9B 1R3HA 4M7KL 3QH3A 1TCMA 5JQHC 2VISB 2R1YB 4ZOCA 3HB3D 1QG3A 2A9NH 5ADPH 2HVJA 4XNMA 7FABL 4S0TD 3UYPA 2W9DL 2YA1A 1MJ8H 2F5AH 1D7FA 4GMTH 3OXSA 5T3ZE 2NY4D 3SGJC 4FQJL 3ILPB 4UOJA 1QKZH 2DI7A 3L3HB 4P2QE 1RSFA 1IEAB 1XGRA 4HUXB 2FRGP 5BJTA 1N5YL 1PG7X 1X5JA 1FYHB 1ORSB 3FQUB 3FMGL 4YNYA 4ZG1A 3S6CA 1EH9A 3QZWG 3MYJB 1PLGH 2VDOH 4Y2DA 1OP3H 1FGVL 3V5KB 1DUYA 1BD2D 4YHKL 3HNVL 2P8MB 3F7RA 5DUMH 5I15H 3UMTA 2FLBT 3QI9B 1G1YA 1YEHL 2D4FA 1CD9B 3QUMH 3FN3A 4NO0A 4MJIA 4FTVE 3UTTA 5DD5L 3AROA 2AAVA 2QADB 4MNQA 4KK9D 1AY1L 1MOEA 1P53A 1KLGA 4DCQB 1RZ8A 1AXTL 1PG7W 3F7VB 2E7CA 1FV1B 4HWEH 5EFIB 5KANI 4KWUA 5D71H 2G9HA 2Y7QB 3FCTB 4LPTA 1Q38A 4MSWA 4N0UA 4P48A 4EI6A 4MA1B 1HIMH 1I9RH 4Q9CA 5IM7A 1AQKL 4AMKH 5JR1H 2UYLB 4HBCL 4QHKJ 3WFCH 1CE1H 4PJXB 3VFGH 1CFQA 1BJ1J 3O4LD 3HS0B 5D7LB 2EDWA 1IGML 4X5WA 4U1LA 3U83A 1KCKA 3I6KA 2V5MA 5DD0H 1A7RH 1V3MA 4HLZG 4EI5B 5GJSL 4LSUL 5KTEL 4XNZC 1OTSD 3QP3A 2EH7H 4G8GA 4URTB 4PY8J 4HUMB 4H1LH 5EULV 5J6GB 4YAQB 1E28A 3SDDA 3MV9A 1YJDL 3VA6A 5CD5C 1KNOA 4EN3A 2C1OA 1P7QB 2GITB 5BOZG 1Z0MA 2FATH 3HRZB 4HXBH 1A6VL 3RWFA 5JO5A 2DM7A 4P9MH 1IVLA 2ESVD 2NNAB 4IIQC 4P4KB 4K94C 4PRNB 3A6BL 1UKSA 2H6PB 5HHQA 4EDWL 3VDCA 2FX9H 4EEEA 3BP5B 3LEVL 4X7SH 4JGJA 2X4QB 3BMWA 1XGYL 4IEFB 4C59B 1M05A 2IPKB 5DVNA 5J8OA 2Y9RT 5DTFA 3RJQB 1JWSA 2VLRA 1U8MA 1HH9B 2WLYA 5IKCB 4Y4KD 2CDEA 3KJ6L 3ES6B 3GBML 4FMFA 1L0YA 1M7DB 1G6RB 4JDTL 4F7MB 4MAYD 1CLOL 1AD0B 1MEXH 2QR0B 5DMIH 4HK0A 3HE6D 3LEYL 4RAUB 1QLEL 1WV7T 2R0ZH 1KPRB 3ZHKA 4CN1A 1MLBB 4R26L 2CIIA 5J11C 5IB2A 3KYNA 4FQ1L 3HE7D 3B6SA 1OAUH 4EXKA 3D18B 1DR9A 3MV7E 3KXFE 3O3AA 2NY3D 1MPAH 3MV8B 3HZKA 1D5IL 4PJDE 1JRHH 2NXZD 3EOTL 2OQJB 4MXWL 2D9QB 1DUZB 1DLHB 1OVZA 3WKNA 5KSBF 5DGRA 3O2VH 4F57L 2NTSP 4GG6B 1CFBA 5DHVA 1OB1A 3MOQA 4H20H 5HGDA 4OI9A 3U0TB 2FBOJ 1EJOH 5E2JA 4LBEA 3DGCR 4TPRH 2AJSH 1RK0B 5I8EB 3P9LB 3FQUA 3BDXA 1MHCB 2NY2B 1RIHL 2WAHA 4KAQL 5IVXF 3LSOB 1FZOA 2O5YH 2WIIA 2GTZB 3CFKB 3W11C 5J1TC 4HCRA 2OZ4L 2R29L 3MYJA 3OJDB 4LPXA 3TO4D 4UU9A 1TTGA 2NX5D 5DJ2B 2V9QA 5DFVC 2MKLC 2XWTB 43CAA 5I74B 4KZDL 5L2KB 1JTPA 3L7FA 2EYSB 1T20A 1QBML 1N5YH 2IPUG 1H3VA 4DCQA 5TF1L 4F7TB 3E1F1 3MRNA 1ACZA 4XC1L 4YXHL 3SKUD 1FV1A 5ACZB 5IT2H 5EFIA 1MQKL 4UQ2A 1NMCC 4XNYH 3TVMA 3O45B 1R0AL 1YEDA 3FCTA 1HNGA 2XKSA 4YHKH 1FNFA 4D0DB 4CJ1A 2UYLA 4P2RE 3VXUB 3ULUL 3GSXB 2ADFH 3EOBB 5FGCB 5GSVB 2A38A 3IDIB 1HKLL 1BQHB 4ODHL 1AXTH 3U7WL 3WHE1 3ARDD 1MCPH 4BZ1H 4HGMA 3AVEA 3I02A 3FT2A 4EI5A 2EH8H 3STLA 3MNWB 3DHMA 4WFEE 2VDLH 3KPMA 1MVUA 3EIFA 4PBWD 3N0PB 3PDGA 1T5XA 3NA9L 4WV1B 1CDUA 3Q3GA 1KXTB 2I5YH 3S35X 4ZTPL 1D9KC 5HYQB 1CGSL 2ZNWA 4MDJB 4F2MB 2V7HA 1T6WA 5ID0A 1KCVL 3KYAA 5EOTA 2ILLA 4NBXB 3MV01 2P24B 1I7ZA 4LCUB 4OQTA 1FNSL 1AXIB 3HRZA 1ULVA 5MEND 3PL6D 1KTLA 2JJUA 2FSEB 2JB5L 4TUJB 1D6VH 1A9BB 3X13B 4K8RC 4ZOBA 5SWZB 4WY7L 1I8LC 2R8SH 4PRNA 1FIGL 4P5KB 3KPSB 2X4QA 3WE6B 1XF5B 2X1WL 4GAJL 3PHQA 1N0XL 5GGTH 1U41A 3S4SG 1MAKA 2BERA 4NNPL 4DN3H 2MJWA 1NKOA 1I1YA 4LSRL 1PDKA 1VADB 1NCCL 3VFMB 3AXLB 4ZYKA 4RAUA 4JFFA 4N0FA 4G7VH 5D1ZC 4XB7A 4RA3A 2C4XA 3A6CL 4G7YH 4U6HA 3CFIC 2VERN 4R2GD 1MLBA 2J5LB 1CFSA 4MJ4A 3LQZB 3VH8A 4OM1L 5ICXA 5I66B 4IRSB 1FNEA 4QTHA 4GUPB 3CK0L 4HK3J 1QFOA 3QIBC 1CF8L 1X4XA 1FZJA 2EDFA 2VR9A 2B4CL 5H35B 1A5FH 3VXSB 4E5XB 2HRLA 1U8LB 4LKCB 4QOKA 1DUZA 4TUOB 4OGAD 2DLEA 4RIRA 1E6OL 1ED3B 4LAQL 4RGMC 4LP4A 1U8OB 5SWSD 3SGDI 1UWEL 2R56H 3TBYA 1VHPA 4CKVX 4HAGA 1A9EA 3GMOB 2X2YA 1U9KA 1UT9A 4NQSA 5C0CD 4RMTA 1F58L 1P1ZA 4FNLL 4LLQA 2VXSH 2Z93B 5I8EA 4YPGA 4JR9L 1MHCA 2R4SL 2P42B 1PZUB 5DJXA 2J2ZA 2GTZA 2YR3A 5HDOA 2FZ3B 5H8DA 4TOYL 4M3JA 5EOQH 4OFYD 2CQVA 3RNKA 4PJDF 4V1DD 5DJ2A 5MEOB 5JZ7D 3H3KA 1FBIH 1ZVSB 4HH9A 4RZCA 3DX6A 4ZFFB 3N1GC 2LTQB 1XIWA 2DYPA 2XXCB 5L2KA 2C5DC 3H9SE 4R4FL 4MYWB 4FP8H 5EUOA 1B0RB 1F4XH 4NQXA 5BS0E 4F7TA 1VEOA 5I1CL 1KLUB 4JB9L 1EUTA 3BKJH 3GI8L 3EZJB 4NQVA 2R2BB 2P45B 4NJAL 4TSCH 2WBWB 4LASH 4NZUL 1NKRA 5MERB 3UTSD 3L5HA 2EO1A 3QFJE 4OLUL 2IANA 3KPOB 1SYVB 3AFLA 4JREC 4M93B 3B2UC 3MLYH 4XPFL 3T1FB 2LQRA 4Z7UA 1QBMH 5GGQL 4HDIB 4G43A 4LLYA 1JN6A 3QQ9D 5I1HL 3ROOA 5DUBA 5DZOA 4AK1A 1FGNL 3PWPD 5TE7L 1LO3H 2H32H 3FN0H 4OCSL 1R3LA 4GW5A 5CILH 3EJZD 3JV5A 3SDDC 3LB6D 4BA8A 5I73C 5DRZA 5IW1A 5J6HB 5L6YL 1LO4H 4EN3C 3RIAK 3RDTB 2G5BB 3Q6GL 4DKFL 1DJSA 5IFJB 2D2OA 4PJBB 2HT2D 2DJUA 2XKUA 3MLWL 4LCUA 1KELH 1H3GA 1WCQA 2X9XA 1Y0LB 4X6CE 2R4RH 3LKSA 3FO2B 3B4NA 5C0AB 4JHAH 5D7SL 1S7SB 3KLSA 4BM7A 3QCVH 1P84J 2FSEA 4TUJA 3X13A 1D6EB 4YE4H 2ZUYA 5T1LA 5M95B 5M94B 2Q86A 1XEDA 1SBBA 3ARBB 4P5KA 4NQCE 2EDNA 3KPSA 3RY6A 3WKML 2C3WA 3WE6A 3BH9A 3AREB 3L5XH 2HRPH 3P4OA 1P69B 3EHBC 3I9GL 4P5MB 4JHWH 4MNGB 4KKCD 3VFMA 4XRCA 1ZVYA 4WI3A 4HUWA 1NFIA 3OR7B 2GFBB 4YQXL 4J4PD 3ZLQC 1NAMA 2X9YA 5ALCL 2NY0D 3HMXA 5LKNA 4QRPE 1MHHB 4LVOC 3BDYL 3M8OH 5E5MB 2ZUSA 1KSRA 2DQEH 3EO0B 3HUJB 4MS8C 1ZMYA 2OTWB 3FO0H 4WTWA 3D2UA 4KI5C 1NEZA 2A83B 2GEEA 5AUMA 1JGLH 2YUWA 2HMIC 1U8LA 3BP6B 3Q5YA 1BOGA 1AHWB 4TUOA 4KZEL 1CG9B 1ED3A 4Y19D 5D6DC 1T0PB 5F1OB 3VXQA 5C2UB 1U8OA 1ZLWK 4RGNE 4W6WB 1TIUA 3UTPE 2YA2A 4ZODA 4JM2B 3VFUA 1IL1B 1QOKA 2NZIA 5DUPH 15C8L 4C56D 4WWKB 3W2DL 5F3HB 6FABL 4WEBL 2ERJB 3P4MA 4ELMB 4X9IA 4AIOA 3BGFC 1FYTE 2VE6A 3LIZL 2CKBB 3WNOA 1FFPB 3C5ZD 1MAJA 2NY1B 4KROC 1BFOB 3MLZL 1OARL 1K5NA 3TT1H 3ZHLA 4ZFFA 2UZIL 3CFCL 2Z91B 3EJYD 2ED9A 4JGUA 2EXWC 3WHXA 1OHQA 3NIGF 3HNSL 3QWRA 4N1HB 3X3GL 2FO4B 1E4XI 3BMVA 3QO0B 3CVIH 5JDSA 4CW1A 2HYMA 1JTOA 1KV3A 2R2BA 4LNVA 2XXMB 4NZTL 2DIAA 3TVMC 1UM5H 4NP4L 5CP7A 5FUOL 4MA1C 5FV2A 5BZWB 3MC0A 5MERA 3ULVD 1RZKH 3MRIB 5GRXG 3EYOA 3VD7A 2JELH 5FKAB 1N5AB 3KPOA 1TQBB 3EOAA 5TDOA 3S36X 3WXVH 5FFLA 1T83A 1T0MA 4HQQH 4X6FB 5I1GL 2BNQB 4EI5C 3ETBF 3EGSA 1KCSH 4OCWH 4KRMB 3TYFA 3IDJB 3DX9B 1BMGA 2BNRD 4CU6A 3MRGA 1CDJA 3LS4L 1PD6A 1TETH 3RDTA 3E0GA 4ZS6C 3WMSA 1RVFH 3FQTB 2PTTA 2LU4A 1BGXH 1HYRC 4CVXA 2UY6A 35C8L 25C8L 2IBZY 5C9JB 2LVEA 2HFEB 2ARJA 2MPAH 4U7KA 2BRRH 4YEEA 4JRWA 3ZE2E 2X70B 4RISL 1SJEA