1G6VK

Complex of the camelid heavy-chain antibody fragment cab-ca05 with bovine carbonic anhydrase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
QVQLVESGGGSVQAGGSLRLSCAASGYTVSTYCMGWFRQAPGKEREGVATILGGSTYYGDSVKGRFTISQDNAKNTVYLQMNSLKPEDTAIYYCAGSTVASTGWCSRLRPYDYHYRGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Antigen specificity and high affinity binding provided by one single loop of a camel single-domain antibody.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Lyase/immune system
molecule keywords CARBONIC ANHYDRASE
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g6vK00
1JUFB 3D69B 1CGSH 4NQVB 4TUOA 1Z5LB 3C8KB 4GUPA 5AUMA 5EU4B 1T1XA 1NCCH 2FWOA 1WBZB 2D7QA 4HWEL 1X5IA 2X4UB 4NQSA 2YWYA 1E27B 2VDLL 1O0VA 1WBXB 5DLMH 5F7WC 3EYVB 5D7JA 3WJJC 4OCWH 1P7KB 5AZ2H 4IRZH 3ROOB 4L9LB 5TFSL 1OD9A 2IMMA 3K3QA 1R5VB 4GAJH 1MWAB 3CZJA 4IJ3C 3ETBF 3VH8G 2D7TL 5I1AB 5IESL 1CGXA 3NACL 1EO8H 4BYHA 3RZCA 5IJVA 5C07D 5H35A 2XFXA 1CICC 2JB6A 5TDOA 2QKIA 1BOGA 1QBLH 3R4DA 4PJ8C 2A6IA 3MXWH 4GG6E 4FFYH 4X7TA 1ES0B 2JCCA 3NFPA 4YE4L 5F3HA 3QEQB 3P77B 3PGFL 4RRPG 3QH3B 3OL2A 3PGFH 4Y4HB 1TPXB 5J89A 3WDHA 1IEAB 4CL7A 5JIHA 4NC0B 3TWCL 1F2XK 4L8DA 1SMAA 2HTKD 3BPOB 3FCTA 1U8QB 3E0GA 2LABA 2XRAL 2ZSWA 3DI3B 4WI4A 4L4JA 1KIQB 3ESVF 4LLUB 4NBXB 3ROLA 5DJ0B 2ITCB 3OKOA 3PWLB 5B38G 3HNTL 4JY5H 3RVVD 3QFJD 3VD4A 2P5WD 2VC2H 2W91A 3QDJE 9CGTA 3PWVA 1U93B 5GGTL 4X9IA 1NGWA 3HLAA 4O5LL 3LQAH 3OXSB 4IRSB 5FGRA 4F9PA 1F8TH 4EOWH 4Y5XC 5AWNL 3VXME 2ZOKA 1CN4A 2Q76A 4EI5A 1PAMA 4HUKB 5DJ6B 5D1QA 3SKNB 2NX5B 4MHHI 4V1DE 5IF0B 5T1LA 4KKLD 2XOTA 5KJRL 5FYKD 1FRGH 1SM3L 4YR6B 5EWIL 2RIKA 3D39D 3STLB 4PJGB 2KL6A 2FIRT 2AV1A 3QUYD 3ZO0A 5JNYA 5KSVB 5E00A 3U9UB 3I02A 3K81A 4B7IA 5ICXB 3HZYA 4PJ9C 2KZWA 4M8VA 4RFEA 2VLKB 3T0AA 4JM2B 4ZXBC 2FO4B 3KLAB 1HHJB 4R2GC 4KRPD 3UJIH 3DX6A 4Z7UB 3UJIL 4EXPX 1RUPL 2VLRE 5DJCA 4GRMB 4AM0B 5I6XB 2CMRH 3C8KA 4GUPB 4TVPE 5SWZE 4DN3L 2GQHA 1NL0L 3WYRA 1LP9E 4OCYH 2IPKA 5HYJB 3AC0A 5IVXE 3BH9A 3VWJB 1WITA 4PBVC 1JK8A 4I77L 1UJ3B 1UM6H 4HDIA 3FN0L 4K3HA 4I77H 5DR5L 4DCQA 5CHNB 2HYMA 5CINH 3V5KA 3WBDA 1MOEA 4OFYA 1HE7A 3BP4B 3FB6B 2AVGA 5T1KD 3L6FB 4M6ML 2AEPL 3GSOB 3MJ7A 4GXVH 1OPGH 5I30H 2YA1A 2BNUA 2FSEB 1OB1B 3W0WB 1SVCP 3BH8B 4X5XB 5HYJE 5E6YA 1Q9WA 2F74B 5C07A 5C9JA 2Q86A 1RMFH 3G5XB 1I7UB 5SWZB 1K3ZA 4JO1L 3THMH 1ACYL 1D7FA 1YECL 3EDEA 2CIIB 3GIVA 1MNUH 2JJUA 3KDMA 5CMAA 4CN6A 3TPUB 1LEIB 3C60A 4HZLA 1ZK9A 3WMSA 2FECI 4FQXA 1X5JA 1MY5A 1PX3A 3O0RL 4H1LG 3TLRA 4DTGL 1X5ZA 4Y16A 4DTGH 2NY6D 2C3GA 4GMSL 4OZIB 2FX8L 2VQTA 3IKCA 4DW2L 2A73B 4GMSH 4QGTA 3T2QA 5DUMH 5L0QC 1Q8MA 3QDGD 1GZPA 2G75B 1OTSD 5DUML 5EORH 1LWRA 1U3YA 4XBEH 2A38A 3Q6GH 3LN5A 5EOTB 1P1ZB 3ILPA 2H8PB 1NGZA 2EH8L 3MRFB 1WEJH 1P7QA 4OIIH 1ZLVH 1E27A 3QISA 3NCCB 3PWVB 1HSBA 4KROB 3HE7C 2ORBH 5ITBH 3W11D 3QIBA 2XA8H 4LPVA 1KGCE 1S9WA 5FA3A 3LB6D 1KJVA 5JA9A 2IPUG 4R7NB 5DK3A 1N64H 4G9FD 5KW9H 2MSPA 2E7LA 1MFCL 35C8H 3JTTA 4L3AA 3M17B 2QHLA 4HIEB 2XG4A 1QR1B 1P84J 3U0WH 5KS9F 3U0WL 1D5XB 3S9DB 1DQJB 1XR8B 1W0WA 5CBAA 3A6OA 1HXYA 1T22A 5D2NC 2R0ZL 4MZ3A 5AYQA 1HKFA 3M17A 2VDKH 4G8IA 4R3SA 3STLA 1VESA 2IQ9H 4G43A 4LVHC 4Z7WE 3UYRH 3CSYB 1ZHNB 1VADB 4RGOH 2D03H 5CGYD 3LPFA 4NQVA 4MA1B 4TUOB 2UWEA 1YNTA 2IAMB 2FEEL 5T5NG 3RDTC 2NY5C 4OGXL 5E99H 2P42B 3RWCA 2CRIA 5I8CA 3TH2T 3CH1B 5IQ7L 3H9YA 4Z7VB 5F8RC 3MROB 2EYTA 4QRPE 5FHBH 5E6IB 1RZKC 2BSTB 1Z9LA 3O11A 3O81A 1IAOA 4P2YA 4OQTL 5FYJU 4JEGB 3EBAA 3O45A 4FFWD 2OM5A 5MEQB 4RIRA 4XNZB 3TNNB 3FQTA 2EYTB 4Z7OE 4YE4H 1JK8B 3KLHD 3TV3H 1A6TA 1DL7H 4UQ2B 1KTKE 2O5ZH 3LEXA 2MHAB 3MJ6A 1X4XA 2LE9A 1VKXB 4OLWH 5ANMB 4Q6YA 1TQCC 2WUCL 3OKLB 4XCEA 1EEZB 3NCEB 3P0VL 5FV1L 3T0EB 1CFTB 2Z8RA 1A22B 2P24B 4NSKB 2ESVD 1OGAE 5TE7H 2XTJB 1MRCL 1HKLL 1XMWA 3BO8B 5I8OH 4LMQE 1G9MC 5DTFB 5C07B 3S3PA 5C9JB 4LNRB 4ONFL 3HZYB 3CK0L 1KEMH 4YHNB 3BZ4A 1CXIA 4JY5L 2Y25A 5F21B 3FQWB 5HHPB 1OAZH 2UY7A 1W8OA 4OLUL 4F7CA 5F7NC 1MAML 4ZUVB 1FPTL 1F4YH 5FUCE 3LV3B 1Z0NA 3LQAL 2IADA 3EYFB 4PTTB 2Q8BL 3O3AB 2QHRH 4BZ2H 3BN9C 2QHRL 3TO4D 5CJOH 3ZKMD 2OTUB 4WO4B 3EIFA 3JWNC 2J7LA 3L1OH 1IGTA 4OGYL 2Q8AH 1FRGL 3LN5B 5EOTA 5H8DA 4QXUH 1T80A 3MBXH 2P48B 5FO8B 1NFDE 1HH9B 4NYLA 1GAFH 4LLWB 1EGJA 3KXFA 5HYSG 1LO2L 3IJHB 4Y4KC 3RTQB 1RK0A 2QSQA 5MEPB 1VFMA 2X70A 2V5YA 5F7MC 4PJCA 3OKDB 4IOIA 4WI6A 2C3HA 1NLBL 3UJTL 4FZEH 4WHTA 2IF7A 3IDYC 3FCTB 2NLJA 4H1LA 4GS7B 1TLKA 3LRGA 4HJGB 1KXTB 1PKQA 1I8MA 1NBQA 2XN9E 1AP2B 1HHHB 3ALXA 4NNPH 3VU2A 3DETD 4YGAB 3AXLB 3MRQA 1EFXA 1EEUA 1RZIA 1UKSA 2HA1A 4RZCB 1X44A 4GW5A 1I9RL 4JQXA 5JO5B 4DGYL 4ZFOL 4HJGA 1B0RA 1YYLH 1KBGH 1JF6A 1NGWB 4FFVC 5ICZA 3U4BH 2EDWA 3CFCL 1NMAH 2ARJA 2D31B 4Q0XH 4Z7QE 4MJIB 1C08A 2KBGA 5C2BL 4LEOA 5TFSH 1LHZA 3OBAA 5DHXB 1IAKB 2P1YA 3GBNL 4XVUD 3GFUA 4XWOD 3BQUA 5T5NF 3ARDB 1HHKB 5F96H 1NEZB 3PV6A 5TDNB 5FB8A 4XBPB 5IFAL 1L7IH 1DDHA 4PJHA 2DQEH 3VXQA 5DJDB 2DQEL 1CFQA 3KPLB 1CBVH 4P2RA 2BCKA 1SBSL 2EDFA 2FYYB 4ELKA 2R9HD 1FNEB 2IG2L 5IK3A 3VW3H 4O02L 3C5ZA 1MCWM 5IBTL 3UJJH 4OKVA 1CG9A 1DQQB 3G5YB 2FX8H 2BY3A 4WV1A 2EO1A 3MV8A 3RL1A 1MCOH 4CGTA 5I8KL 2D3VA 3TCXA 2YBRB 4ISVB 4MA3A 3IGAB 4G8GB 5BRZA 4AH2A 4ZAKB 5CZXD 1WAAA 4HWBL 3B2VL 1QFUH 1FL6B 2ZUYA 1TVBB 4MXVE 1KN2H 3IFLL 4GXUM 4P46C 1TENA 1EBPA 3MLSH 5DEFA 5L9DL 1EHXA 3CFDB 3ZTNL 3TVMB 2W0FA 1UH2A 5C09B 1ORSA 3MFFB 1DQTA 1ONQB 2ATPA 5M95B 1EXUB 5HHMB 4C58B 35C8L 2HLFD 2C7UB 1K2DB 3VWJC 5HI4D 1S5HB 1ZA3A 4RMVA 1CICD 3DUUA 5EZOL 3WO4C 4OIBA 2R2BB 3TO4C 4UINH 1IGCL 5FYKE 2ADIB 2N1KA 5H94A 3OAZH 1F58L 4DK3A 5BW7A 3MCKB 3C2AL 3DRTA 3EO1B 3TBYB 3HFML 1QFWM 4NT6A 4OT1H 5EWIH 1UWEL 4LDEB 1T1WB 3D2UB 1Y6KR 1U3HB 1WT5C 2D03L 2L0DA 4LLMB 1FIGL 3WL9B 4PPTA 4PJFB 4WWID 2VLMD 4XB8A 4HFUL 1J12A 5C0JA 3MV9E 1NUNB 1QBMH 4MAYA 4N0FB 5FKAB 5IQ7H 4GRLD 4IDJL 4XGZB 2AABH 2A73A 3NABH 2DQTL 3E2HB 4S1DC 4I2XE 1UM5H 3GGWB 5FF6B 3QIUB 1QSEB 4K7PL 3RIAK 2ED8A 1ZT1A 1WAAF 3FT3B 1YC8A 3HTLX 2W60A 3Q5OA 3TN0C 1KG0A 2X89A 5L8JB 4U31A 2VWEC 4U1KA 2MCG1 4EN3B 1DL7L 2X4PB 3RX7A 2AQ1A 4UQ3B 1SYVA 1FZMB 1YQ2A 5EBLB 3DURA 1FYTA 3MFFA 2JCCF 2WBJD 4PG2C 4GQ9L 4Z8FL 3PDOB 1NH6A 1M7IB 1EMTL 2BMKA 2K7PA 5CILL 3MXVH 5ADPH 5I17B 3L5XH 2VDQL 5GGRA 1MH5A 5A2LH 5DMYA 3L5XL 4X83A 3PHQB 1KIRB 3MNVB 4ODVL 2CO6B 3CK0H 1KEML 1CFBA 4JFDA 2GTZA 5CEYB 3CFJA 5GS1B 4U6HA 3PHSA 4TVPL 1JWMB 2G2RB 3DX7A 3LIZL 4P5KB 2GHWB 1XGRA 4WWKB 1FLTX 5GQBA 3O4LA 4K3EL 1F4YL 2HT3C 4NUGL 1I8IB 3TJHC 2FYYA 3QPXL 5EU6A 2YEZA 4Z7VA 1WUNT 3OG4B 3KPPA 4H88H 2J8UB 1MFDH 4PJEF 3UAJC 1UB5A 4WDIB 4K7FA 3BPCB 4U1JA 3C6LA 5IMMB 5EORL 2BRRH 5BS0B 5L6YH 4E41B 3HC0A 5DMKA 2I9TA 3MA9L 4XPHH 4GBXA 4PJDF 1LO2H 4HFWB 4GRWB 4MJIA 5DO2C 1BD2B 4JO2H 5T3XH 4M7KL 2H1PH 4EIGB 2PW1B 5B8CA 1GH7A 1KEGH 3HG1E 4LGPB 4J4PA 2BNQD 3O2DL 4QHLB 3D0VA 3IU4H 3UTQA 1BQHB 5HI4C 4I0KA 1KJ2A 3GUTB 4FABH 4U49A 1GGBL 5C86A 4RMWA 1MJUL 3VD7A 3LEVH 3CDYA 3QUMB 1H3XA 4HWZB 1KJMB 1CK0H 2BVEA 3U30C 4H0GA 5D70L 1CLYL 3TO2A 3MO1A 4KQ4H 5C0CB 3BUTA 1IJ9A 5JXED 1I7TB 5TF1L 3MNZA 3QIWC 1L9NA 4ZUSA 8FABA 4WO4D 1C12B 1HHGA 2W59A 1DLHB 1P4BL 4U1NB 4ZFGH 3RVUD 1RURL 4ZFGL 2ZCHL 4RAUB 4I0PC 1IC5H 2YPLD 2YRLA 5D8JH 4MQXD 3VXRB 5KZCD 2VNCA 4J3UA 4M1CD 2IFFH 3U4EB 5EOCL 4KTEL 3W2DH 1JHLL 5ISZE 4OQTH 4KXZH 2AK4B 5C71A 1NJ9B 3T09A 2IPKB 2VZ1A 4HW6A 5AYUL 4MNQD 3TC9A 4YHML 4YHMH 2FX7H 2VR4A 4PGCB 2C3WA 4OZGE 2UZYB 3PWUA 5IBTH 2YD2A 4G5ZL 5ADOH 1DR9A 1FV1A 4NKOB 2ZUQC 2G5BB 4B53A 3TBSB 5D71H 4NRYA 4MQTB 2BSED 3EO0A 4JPIB 1IGML 3DROB 3LH2H 1KCSL 4NN7C 1YDPA 4JZNB 2DBJA 2X10A 3F58H 5JR1H 1ROWA 1UWXK 2E6JA 5F1OB 4A6YB 4TTGA 1U8JA 5CGYC 2BP3A 4C57C 2V2WA 1GC1C 3O4LD 5B39G 2E6QA 1QG3A 4OLYL 5GRJH 1ZLVK 1CF8L 1XCTA 3RWEA 5I1HL 4P9HC 5BZDB 4XHJC 2CLRB 3HCVA 5CD5C 2QADC 1X9QA 1N6QH 4H5SA 3O41A 2I5YH 3FZUD 3C60C 3ZKND 3VFVB 5FFLA 4KRPB 2Q8BH 5EFIB 3I75A 2BK8A 4D0BB 2I9LB 2WWMD 4KI5E 2KQMA 1JI2A 2OR8A 3L95B 4LLDB 4OLXH 3UMTA 1U8LB 1A1NA 4WEBH 4HPOH 5KSAB 3X17A 5HHXL 2DQJL 4WEBL 3QULA 5BS0D 4J2XA 4P2RE 2BOCB 3AMLA 3FMGL 4X4YA 2F58H 3VXPA 3K80A 2VDPH 3IFNH 2R56H 2HRLA 3MNWB 3DVFA 5K9QI 1Y6MR 1QFWH 4NCDA 1A1NB 1LDPH 3E6HA 1OSZB 4KK5D 5DQJA 2NY0D 3WIHA 1BJ8A 3ARSA 4KQ3L 4ACPA 4X4ZA 2VXQL 3MLUL 1OVZA 1X4ZA 3G5XA 1AR1D 5DMJB 3GO1L 1SJVA 3BW9A 5T1MA 4I1NB 1QNZH 1FL6A 4ONGH 3MOQA 4I0CC 3UO1L 3NH7H 4U1SB 4UDUA 3W9EB 2CKBB 3V0AC 3CZFA 3P9LB 4NNPL 3Q3GA 1CVRA 1V3MA 4BFGA 4P4RB 3QXUA 1KFAL 3EDJA 2FEDC 5CZVH 1KFAH 1DEDA 3ZKMC 25C8L 4ZS7L 4EUPA 2OK0H 4ZOCA 3IVKB 2WUBH 1U95B 1NMAL 3CFCH 4I3SH 3PWNB 4LK4A 3BDYL 1I9EA 5F9WC 4ZOEA 5CGMA 5I1JH 4XT1C 3BDYH 1PZUB 4NKMB 2QQKL 4WTZG 5E4EB 1XT5A 3DO7A 4Z76B 3LKRB 4JFYB 1IC1A 5J0BA 3BEWB 4PLOB 2KH2B 1UWGH 2O5YL 4JO3H 1MWAL 3O6FB 4RMUA 1HQ4A 3JUYA 5F88B 1N6UA 5JW5B 5C8JA 4X6CF 4JDTH 1I85C 3U9UA 2QEJA 3U2SB 4UT6H 3IDMA 5CJ5A 4X8JA 3DGGB 4IRJD 5I76B 1MFDL 1YQVL 1SEQL 1PGRB 4JFFB 4KKBC 5ICYB 2FO1A 3FRPG 3O4OC 5A2IH 3B4NA 3TVMA 1MVFA 5F7KC 1AIFA 2FL5A 2P5WB 2XIDA 4J6RH 4TPRH 4J6RL 4HEME 4KK8D 4XPHL 3S35X 4Z76A 2GSGB 5C0FB 1A5FL 2EXYC 3EKCA 4RBPH 1KN2L 3IFLH 3EYSH 1T7YA 3REWB 1TTFA 3NN8A 4YHLH 3BE1L 1I9JH 2XZQL 1C8PA 4XPBL 2ZSVB 1SJEA 1FL5A 1QRNA 4YWGH 3V6OA 1RUKH 1WF5A 4ODWA 3RL2B 4APQD 1NBZA 3UBXG 2FH8A 1INQA 1IEBA 1X5LA 4FABL 4UB0H 3DVIA 4NNXA 1CWVA 1FFPB 4XRCB 5LGHH 3UZQA 3L7EA 1FFOB 5GJSH 5FECA 4HKZA 4L29A 1BFVL 5E2UH 3K8KA 2VLLA 4KV5F 4X5WB 5KVGL 4J8RA 4O2CB 3MFGB 4YGVB 2GI7A 5C09D 3TFKC 4H8WC 5DK2B 4MJIE 4N1HB 5T3ZH 3JV4B 3ZLQC 5T3ZL 4R90H 1WFUA 1FNSH 5HDBE 3WS3A 4M61A 4KI5F 4G6AD 2EE2A 4PJDA 1HI6A 4JANB 2A0LD 3IDMB 1RU9L 4TUKH 4XNUH 1TITA 3KPMB 2QKIB 4X80H 5LXGH 2AABL 2DLIA 2JJTA 3F8UB 5IROC 3HMXA 2GAZA 4PLKC 3W2DL 1B4JL 2A77H 3BZ4B 4YLQT 4PJDE 2WP3T 2X9WA 3SKMA 4DCQB 3VGGA 1C16B 3RZCC 2NTSP 4RBPK 3DX8B 3VCLA 2IH3A 4KMTL 1NAMB 5GRZA 3GK8H 4O2FB 4EIZC 4MB5A 3OMZA 3PWPE 5LAXB 3NZ8B 1AQKL 4KY1L 1S9YA 5I71C 1OTTC 3PE9A 4DQOH 4J3WA 4AEEA 2HKFH 5DI8A 2ITCA 3OKOB 1KCSH 3GMPB 5LG1A 5IQ9B 2F8OA 5EZIH 4ZXBD 4GKOA 1F6LL 4GRLB 4NP4L 3WFDL 5HVFB 2UZXB 3ES6B 1FE8L 2ZG3A 3HAEA 5C9KA 1A7PL 4JQVA 3W5MA 4ODVH 2E6PA 3MRNB 3UC0H 1AFVH 2VLKA 4C59B 5HYSB 4KZEL 4JR9L 2PCPA 1R3HA 3TO2B 1P7QD 3HMWL 3DGGA 4L4VA 2AEQL 2HH0L 1QO3B 1VSCA 2R1XA 1E4KA 5JW3L 4P2OA 3ARGC 1P2CB 1BLNB 2XTJE 3QFJE 3LRSB 5EC1A 4N0CC 4NQXB 1XF2A 1GIGH 2BNRD 3UCRA 3DUHA 1L6XA 4JG0L 5D93C 2EDKA 1I1FA 3FQNA 3KPSA 3MRKB 1U8IB 4FXGB 3NCJL 4A6YH 2EE3A 3DX9A 4ZUVA 4A6YL 3DYOA 3QA3A 1L6ZA 1U6AH 2VLLB 3RZCB 2VDOL 2DQJH 1OGAB 2VDOH 1D6EB 2F53B 1J8HB 1KSRA 4WU5B 3VRLE 2BRRL 1YPZF 4LSTL 2OTPA 1K9TA 3S98A 4LASH 1TZIB 4LSTH 1EHAA 2VDPL 2YKLH 1ZS8A 2DL2A 1INDL 1SY6H 3EOAA 3VDCA 3F62A 3QJHA 4JZJB 4B50A 3PHOA 2Y23A 3ZDXE 5HYJA 5FA4A 2CLVA 4YHKH 3BDBA 3IAQA 4APQC 4YHKL 2OTWB 3O2DH 2VXVL 1LO4L 1T0MA 2VXVH 3EW3B 2W9DL 5K93A 4N8VB 5CJQL 1TPXC 4FQ2H 3HC4H 1A6WL 1YMMA 1G1YA 4Z7UA 1KCRH 4HKBA 5EU5B 2XKNA 1GGYA 1I85A 5CSGA 4J8RB 2Z93A 1HILA 4L8SB 3QUZD 4WU5A 1CK0L 3NCMA 1RFDL 2R69L 4QXGH 4YK4B 2WP3O 5EOQH 3DV6B 1D5IH 5DHYB 4NFCA 4ORGA 4TRPL 5JXEA 1QLFB 4IIQC 4P4RA 4Z7WB 3AVEA 1RJLB 5IGXH 4AL8L 2WINA 2YBRA 3ARDD 1NDGB 1XH3B 4ISVA 4OTXH 1N7ML 5IGXL 5HXMA 1P4BH 3GB7B 2GSIA 4R4BB 3MRDA 3LKOB 3BZFB 4RDQF 2R15A 5D8JL 3T4AB 3SDAD 5F9AC 1CLCA 1IMHC 5B3JE 5HHVH 3RPIA 2IFFL 4Z95H 4L4VB 2CDGB 4KMLB 5E95B 2LVCA 3IF1B 4JDTL 2E27H 3QHZL 3BN3B 4EN3A 5FDWB 4LARH 3TGXA 4NNXB 3EDDA 2FO4A 3TYFB 3RWDA 4Y5VC 1INEH 3TM6A 3PQYA 4JQXC 1UEYA 4JREB 1JHTA 3U48A 4MQSB 5GGVL 3VXMA 4LAQL 3BIKB 3QP3A 4KKAC 5JOPE 4LAQH 5HDOA 3V4UL 4QRRA 5F3BA 1A6VH 4GRWF 4MCZA 5CZKA 2CIKA 4MNQB 5I73B 5HPMB 1MIEL 1XGUA 4PJFA 3S36X 5HI5D 4GAFB 1X5KA 5MERA 2AK4D 4K8RL 1T1YB 4HBCH 4LPYA 4K8RH 4OLYH 5D5MA 5GRJL 2Y5TA 3QIWB 5I1HH 2BNRA 4YUEH 1FQ9C 1MRFH 3EFDH 4KKNA 4JGMA 3WFCL 2ICWB 1OT1A 1XZ0B 4HS3A 2IALA 3ARXA 4UB0L 4UU9A 1T03H 3QZWB 4CDHA 4M6AA 3INUL 1QRNB 1H3UA 1KG0B 4XNQB 5I18H 3TIDB 2NY4D 1U8PB 2XI9A 3W0WE 7FABH 3PDDA 4W70A 3SJVD 4RWYL 2P49B 5F9JA 4YHZH 1FVDB 1NUFA 1TXKA 1CGWA 3UPRA 3RY6C 4NO2A 2AJ3B 2ESVA 4KHTL 4LLWA 1EX0A 3MOAH 3MUGA 4X6DF 3GHBH 2HTLC 2OMNA 3VI3F 4CW1A 3X3GL 1T6WA 3MJ7B 2XWTA 1BX2B 5H2BB 1EFQA 4LRNH 1CTNA 2X1WL 3ARFD 4HMEA 4JFFA 3D2UA 2R0WL 4KRLB 4NZDA 5FK9B 1I3UA 3FRUA 4K3JL 5SWQB 4K3JH 3DXAA 4E9LA 3TBWA 4JKWA 4LHUA 3HE6B 3I3DA 3UO1H 4ALAH 5DA0B 5MHSE 3LPGA 3C60D 5C08A 1YNLH 3GJFH 4LBEB 3QEUB 1REIA 3B8SA 4GRMA 5E6ID 2OR7A 4V1DB 1IGIH 5FUZH 3VFOA 4LLAA 1QOKA 1T1YA 1IGIL 2OL3H 5FUZL 3DX9B 4TVPD 3MO1B 2OL3L 1XCQB 2HKFL 3SDCD 4KROC 2YN5A 4PJGE 4GKNA 2AJVL 3SPVB 2C1PB 2AJVH 1HWHB 3SGDH 3WKMH 4MX7B 5E5MA 1UXWB 5IIEB 4X6CA 1FE8H 1NCCL 3QXVA 4HWEH 1Q9KB 3U2SA 3SDAC 3JTSB 4OCWL 1KN4L 3QG6A 4OZGB 1BWWA 4QNPF 3S88H 4JVPA 4KRMB 3TYFA 1E28B 4QCIA 3VG9C 2X2YA 4FQXC 4KU1A 3BP4A 5EUKA 1ZHLB 1EO8L 4HT1H 4LOUD 4AZ8A 1J11A 4NQDE 4UTBL 2MOVA 4AEIH 3F6LA 2NZIA 3QNXB 1PKQB 1QLRB 2GT9B 3X3FH 4FFVD 2DF3A 2EIZA 3QNYB 3B9EA 1EPFA 3CDFA 1OAUL 4MA7H 5HHQA 1TTGA 3UPRB 2X1PA 3SGKA 1UFUA 3DO3A 2D0HA 1BD2D 3V79C 1RULH 4P49A 3VFMB 3B9KD 2FJHA 2BHUA 1QLFA 1AGEA 2YKLL 4J3SA 4Z7WA 1U8JB 3DBXB 3CCHB 4D9QD 4YXKL 2IANB 3OZ9H 4LEOB 3RUGF 4KH2A 5T3ZD 4S1RH 4FQIH 3BYYA 4F8QA 1WIUA 4HHAB 2ICEB 1EXUA 5FOBA 1LE5A 3WIFB 3S3JA 4YDLC 4YWGL 1KJ3H 1KXVC 5ISZA 3WXVL 1G0DA 2IANA 1CYGA 3OB0H 4GRLA 4FQ2L 2L7JA 2CKBH 4GFTB 3HNSL 1JZ7A 1E6OH 1QRNE 3SGEI 3HG1B 5J9PB 2NY4C 2OTWA 2BVUA 5C08B 1MJ8H 2RJMA 3EGSA 4U2ZA 4XP1L 4WI7A 4Y4KB 4ZYKB 1J8HE 1J88A 2ZJSH 2NR6C 5AWNH 4P5TD 3MBEA 5EUOF 4F7CB 5LQBH 5CZXC 1MUJB 1U8OA 1JHTB 5DRNB 2I26N 5FK9A 1FNSL 1DQML 1DQMH 3GJFB 4LCYA 3G5ZB 3EHBC 4XNUL 3BFOA 2H9GA 3Q6FA 3BZDA 1VFBA 4XTRD 1KC5H 3BP7A 5H94B 1MCJA 1PD6A 3QG6B 1RJYA 4FRWA 3K4ZA 3VE0A 3IDJB 1Z3GH 2SEBB 2YD1A 4JGUA 2ZWLT 4WWKD 4FQHB 4HG4J 2YRZA 3BT2H 3HG1A 5E8EA 4PJFF 2I9TB 3PP3H 2C7UA 4F33A 1I4FA 4FZ8H 3RUGA 3DYPA 1RUQH 4HV8A 1JN6A 5E9DB 4JJ5B 4N68A 1NL0H 2VZOA 4U3CA 4G8GD 5T1DH 3X13A 5IB2B 2I07A 3O3EA 2ICEA 2A1WH 1TNNA 3MRNA 4P9MH 3O9WA 5I71B 5JPMA 3NGBB 1GGIH 5DT1H 5JIPA 2KUTA 3TBTB 1N59A 3G5ZA 1ZOXA 4YPGA 2PO6B 3QQ4A 1KTDB 3DI2B 4MAYD 1TQBB 4PBXA 4NOBA 5J6GA 4LQFL 1DN0A 2EDBA 4G6AC 1JWMA 1U9KA 1O5DT 3WLWC 3ZYZA 2P8MA 3SKOA 4NKQB 1KIPB 5I1DA 4M6NL 4WIQA 5DD1H 4KAQH 4WDIA 1LO5B 5J6GB 4AM0A 1JIBA 4PLKD 5GS3A 3VXOA 2EDDA 1WVZA 2AJSH 3WFBL 3KPPB 4LSVH 4ZXBB 5IB5A 5I8EB 4E41D 2VLRD 4NT6B 3REVA 2B4CC 2DYPB 3Q1SL 5IOPB 4HAGA 3LHPL 4PGDA 2M2DA 3P11L 5D7JD 2NXZB 1AGEB 3QHFL 1JFQL 5BRZB 4PJBA 1BD2A 4HIIA 5KANI 4P2QE 2G2RA 1TZGL 3MBEC 4U3XA 3OJMB 3TNMA 2JTDA 4JKKA 2D31A 1A1MB 1RUML 2ADJB 5KS9E 3O3AA 4DKDC 2H3NB 5EBMB 3DLQR 3LQAC 4I48B 3KYKL 1ORSB 2EH8H 4M7JL 1J8KA 5TPWH 4CW1B 1C5BH 5EC2A 1C5BL 2ORBL 3JVGC 4ZPVA 4JKPH 1ZLSH 3PV6B 1R3IL 1CFNB 3QG7H 1G7MB 3CVHB 4WUKH 2W9DH 2DM3A 2HVJA 1I8IA 1N4XH 2R4RL 4PV8B 1ZHLA 3CDCA 4OI8A 2PETA 1NGQL 4P5TC 3SDXA 2VQ1B 4BQ6A 2YUXA 5GSRA 3RY4A 3C5ZD 4IRJA 3CU1A 1KIRA 1G6RB 4NQCE 3T3PE 4BFIB 5DO2D 1QD0A 4KI5D 3I3BA 4NUJB 5GRWA 1RJYB 3ZL4H 1T21B 1PSKL 1N7MH 2ILLA 2P5WA 3IF1A 1Z0MA 4X6FB 5SWSE 5D6CB 1H8OA 1CQKA 5DEFB 1F6FB 2JELL 5LGJB 1GYAA 2F15A 4IEFB 3RFZC 3ARBA 1FZOB 4LSPH 3SBWA 3OKNB 2ZSVA 2EDHA 2OZ4A 1NC4D 3HE7B 3CFJB 5DUPH 5GS1A 3F5WA 1KJ2L 3EOYG 4XMKH 4JFEB 1CXKA 5C0GA 4AEIL 4KJWD 1JHKL 1SMOA 1FP5A 4X9GA 3KYMB 4XVJH 1JGVL 4NKOA 4XVJL 4NRXA 3SE8H 3K0WA 4AG4H 2DAVA 2HJLA 5E5UB 4G8IB 4R3SB 5BRZE 3V4VL 1IKFL 3IAGC 4ODSL 5CP3H 3JWDC 1IZJA 4I0PD 3V4UH 1JTOA 5L88L 1MIEH 5FUOL 4MQ7A 4NNYA 4S1RL 4YZFE 4C56B 4YDKH 1S7SA 5L2JB 1YEKH 4NKDA 5DS8B 3HNTH 3SGEH 1ZGLB 2YMXL 1KJ3L 5DEZA 4YUEL 5DUBA 4PGDB 3GGWA 5FF6A 1MRFL 1NFDF 3HS0A 3QIBB 3R06B 1U8LA 3FB7A 1Q72L 3QSKB 1JZ3A 1Q72H 4OBRA 1HXMB 1MAMH 3INUH 4QOKD 1F8TL 4XP1H 4EOWL 5A16A 3EYVA 5D7JB 4KKLC 4JFXA 1OL0A 1GRWA 4PG9B 3VFNB 2W0FB 5D93B 4JFDE 1TCRB 1WIPA 4JHWH 2LQRA 4Y1AD 3RUGE 1A21A 3RWEB 1IARB 1IRAY 3EGSB 4HEPG 3C9NA 3MNWA 1XF4B 2BMKB 1NC2D 4UIMB 2FJFB 4QXUL 2GY7B 3MBXL 3OB8A 4RGNB 3V95A 4PJXA 2P8LB 4PJAA 3V6ZA 1JE6A 3AREA 1Q94A 4YHNA 3RA7L 5BVJB 3MOBH 4LLDA 3WS3B 4PRAA 3ULVC 2N4IA 5IK3B 4A2MA 4RNRA 4ZDHA 4K94L 3WUWB 3DXAD 1HYSC 1JGDB 2HLAA 1MRDH 5DSCB 2CQVA 5I15H 3RPKA 4XXDB 3RJDA 1Y0LA 4XWGH 5F7HA 1RUQL 4DN3H 1YNLL 4QRSA 1NSNH 1JYWA 5F6IC 5DVKA 3ABZA 4PJAE 1AGCA 1U95A 4UQ2A 5GRXG 1NFDA 1A14H 3TA3C 1WWBX 2CD0A 2DMBA 4TSAL 2IPTL 4XMLH 1TMCB 4KJPD 3DX8A 4TSAH 4WNQA 2P7TB 4PFEA 3HNVL 5HGDB 4Q2ZB 3MODH 4XP4H 1K5NB 2CKBA 3O3DA 4XP4L 4WFED 1YY9D 5C2BH 1A9EA 3W9DB 2LTQC 5I1LA 3DSFH 4CBPA 3V5HB 5IQ9A 1SYSA 3T2NH 3QIBC 1RMFL 3O6FC 4LDOB 3RWIA 4UIKL 3WJLC 1G0XA 1ACYH 1S78C 2QL1A 3FO0L 1HI6B 3P77A 3BX7C 4JANA 4NRZA 1A8JH 1ZANH 1IQDB 4B7LA 1L7IL 2FECL 3EDFA 4N8VA 1AD0A 2VISA 1OW0C 1MNUL 5IMKA 2X4QA 3VXNB 3MXWL 2Y07L 4PV9A 1KENL 1QLEL 5GGQH 3NTCL 3V7MA 2BSSB 4XNZC 5B39A 1RVFL 3EOTL 1DFBH 4NPYA 2AKRB 3T4YA 1H8SA 1JYVA 1DFBL 1R5WB 5IOPA 3GRWL 1I1YA 1RUMH 1T7ZA 4Z5RB 1MCOL 4YDVB 2HFFA 3BP6B 3MGTA 3ZE0F 4XP6L 5DD5H 4YXKH 1T0NB 1LNUB 5E9DA 5M7QA 3KYKH 4V1DD 3BPNC 3L5HA 5TE6L 3GHEL 1L7TH 4AYFA 5TPWL 2FDBP 3B2VH 5ITBL 1W0VB 3HUJA 3DV4A 4R6UA 4XNXL 3FB7B 3BYTA 3QG7L 5HYQB 4XNXH 3OGCB 4IRJC 1QUNA 4LVNB 4OM1H 4JLRA 2DL9A 4JZOA 2R4RH 2W0PA 4L29B 4QHLA 3MV11 4GT7A 2KPNA 3CFBB 1S7RA 5GJTL 3BPLC 5F7UA 1R3HB 5JDSA 2C3XA 4KK8C 1IGCH 2AK1L 4QRUB 1WAAE 3TBSA 1L0YA 3DXAE 5E00B 3H7LA 1YEGL 1BQSA 4TYUA 1YEGH 1KPUB 1QR4A 2H6PB 5F1IB 5FKPA 4QO1A 4RSVA 4WHCA 2AEWA 1U8IA 4FXGA 1S7VB 5KSAD 2BOBA 4XAWL 3S96A 4KVCL 2BVYA 4NQUA 4R8WL 4UBDC 3QO1A 4OGXH 5E99L 4HFUH 4QGYA 1RJLA 5EU3B 2BOCA 3NPZB 4LQ1A 1Z3GL 3BPNB 3NVQA 5FHBL 1CD1B 4ZO7A 5CEZE 1DBAH 4ZPTB 4W81A 5IB4B 3TJEH 1KACB 3BT2L 1YMME 1KJ2H 4XMKL 4Y19D 1UM5L 4PJGF 1NBZB 2YD3A 5JXAL 1MI5A 3IJYA 1Y18B 3IAPA 4LCCC 4YHPA 2VJXA 2DQIL 3MQIA 4PV9B 4DZ8A 1BIHA 3MROA 3WHE1 5KVEL 5CS7A 1MCFA 4LGSB 2A1WL 5C0IB 1LO0L 4ZFFA 5A1AA 3C6SA 5E5RB 1P6AB 4X7CC 5DR5H 5TH2A 3KXFE 1WTGT 4U1HA 4JRYD 4GQ9H 2J3SA 4QRTB 5ERWB 1QSVA 4LGRB 4LDLB 3LRSA 4MXQD 2O26U 2IANE 5FYJD 3VCLB 5FUCC 4GXVL 4ZSOA 4HUUB 4RX4A 4PD4K 1A4JB 4LPXA 5FOJA 5SX4I 4M7ZC 4UAOC 5CBEA 1XR8A 5IBUG 1A7QL 1GGCL 2EIBA 5E94A 4LPWA 2CDEB 4Y2DC 4OLUH 3H8NA 5TDOB 4WWKC 4NKDB 1A6ZA 3EFFB 5GSVB 4K3EH 3WS6C 5DXWA 5JMOC 4Z0XA 5IEKA 5L2KA 2YN3A 3IRZA 5KSBE 4P59H 3BKMH 4P59L 1YNKH 2BXYA 1HQ4B 2VLKE 3RJQB 1MJ7H 2QQNL 1EJOL 1CD8A 2AW2A 3L1OL 1FSKC 5EH1A 4KVNL 3T65A 1BD2E 1IM9D 5CJBA 4JDVA 1CFSA 3UYOD 3HKFA 2HVKB 3HI1A 2XZCL 5L6YL 1OP9A 2EZ0D 2APBA 3O3DB 5C7XH 4QT5B 5C7XL 1OAKH 2WNGA 4UIMA 4F37F 2FH6A 5D2LA 4WFHE 2WIIA 5J1SC 2AV1B 3CFIC 3WD5L 4XCFL 5FAAA 1S9YB 4LSQH 4MAUH 2Q7YA 4NHCH 4MAUL 4X6DE 4FMKA 3SE4A 1UG9A 1NSNL 1LD9B 4RDQG 2X4UA 1MCNA 4NQSB 1A14L 3SCMB 3QI9A 3LEVL 2D0GA 3NFPB 5D1XC 3PGDB 1UCTA 4LBEA 1FYTB 4YBLC 1YYLL 2GSIB 1NUGA 4G8EB 4XWOC 4G6ML 2NMSA 4HXAL 1VFUA 5GSVA 5J1TC 1SY6A 1I7ZB 1JPST 3VXSE 1QSFA 2O61A 2DN7A 3LKQA 4DVBA 1FZKA 5CD3A 4ZS6C 5EA0L 4TSCH 1IAII 3TIEA 1UJ3C 2APTA 5CBEB 2CK2A 1IC5L 1NDMA 5E8EB 3W82A 5HHMD 1HZHL 3OHXA 1KB5A 4O58H 4BFEA 5JPNB 1I7UA 2FEEI 3NACH 4YHYB 4NN6B 4UDTA 3O6FA 1UM4H 3U6RB 4UMGA 2FHFA 3BH8A 3HI1B 3V6OE 1RZJC 2Y07H 2XN9A 5AAWA 4U1HB 1NKRA 4GSDL 1U8MB 4H26A 3PL6C 4MNQA 1P53A 3QIUD 3JSSA 5TE4H 3MYJA 3T1FA 2O5ZL 4XXCA 3ECBA 5I1EH 3UJJL 3HMXL 4ESKA 1J0JA 4G5ZH 1IKFH 1G7LB 3JV6B 5IB1A 5ADOL 1W72L 3VGFA 1MUJA 3PWLA 3T8XB 1U92B 5JLZA 4XP6H 5DD5L 1MFAH 4HIJA 3B5HA 5HDQL 4MNQE 5B4MD 1MRCH 4I2XA 4LSSL 3DIFB 2BNRB 3ZSTA 5J11C 1Q1JL 2GSGA 5C0FA 1WCBB 1KCKA 5DDHB 1XEDA 3M45A 3HE6C 4IS6B 4L8CB 2MQCA 3ZMRA 1OAZL 1YPZE 4NO3B 1MJJB 4EI5C 1OOAA 4DZBA 3STBA 4NQED 2FWOB 2DWDA 3AFLA 2CXGA 5F3HB 3VA6A 2I5YL 1V3KA 3TA3B 3LRHA 3FONA 12E8L 1WZKA 4XI5D 4NQEB 3GUTA 4HKJA 3IDGA 2P8LA 2LAAA 1H3PL 3VFGH 4BZ2L 5CCKH 3VXPB 1H3VA 1DLFL 1N8ZA 4FQLL 2R0KL 4ZO8A 1KOAA 2BVQA 4FQLH 4N0UA 4EI6B 4OLXL 5BZWB 1S7RB 3O9WB 5JPMB 4HPOL 2XTJD 3LEYL 2WLZA 5F97E 5CHNA 4J7RA 1XGUB 5DURB 1U8OB 3FOMB 1CT8B 1OGAA 3QWOA 1QFWL 4IDJH 4X6DA 1NLDH 3LKOA 3CIQA 5B21A 1MRDL 2OCFD 5I2IA 4JFPA 4H8WL 4CMMB 4KDWA 3CVHH 3EYFA 5B38A 2EEAA 1LNUA 1QZ1A 2NY3C 3QJHB 2CPCA 2ICCA 5E8NB 4C4KT 4OI7A 3BGFB 4JCLA 4ETQA 1QEWB 2DTMH 2IPTH 4XMLL 5C1MB 3FN0H 2VIRA 1H15B 3IDUA 1C5CL 4Y8DC 1S9VA 5KSUB 5CZVL 4Z8FH 3RBGA 2YUZA 1X5GA 2PYED 4HKBB 4QRPA 4ZS7H 4OCXL 1OSPL 1A3RH 2CO7B 4F37K 1OSPH 2VKWA 3EYQD 3RGVD 4U1MA 1OSZA 1AE6L 5M94B 5C3LD 2NY2B 2AEPH 1I3GL 3WE6A 2FR4A 1D5BA 4QTHB 4MCZB 5D1QB 4S1SL 1QPXA 1YY8B 1KTDA 3F7VB 4R4ND 2Y72A 3V9FA 3HE7A 4J4PC 3MRIB 2PYFA 1F4WH 1QLRA 4GRWH 5MEQA 1YECH 4NUGH 4XB7A 2CXKA 3V5DA 3QPXH 4OGAC 4YNYB 4TUJA 4CKVX 1FO0H 2GKIA 1BP3B 3ARBC 4O02H 1YUHA 4QRRE 2VDRL 1EEZA 2GEEA 2V2XB 4GG8B 3TPUA 1LEIA 4J3OC 1G6RA 2GJ6D 3KPRD 2VXUL 5F9JB 5CWSB 2QADB 1MHHA 2RQ8A 5IIEA 1MPAH 3QFJA 5K9OA 2XQYG 5T5FL 5BCAA 4CJ1A 5TE6H 1A4KB 3H42H 1B0WA 1PG7H 4F2MB 2H2SD 4DFHA 5BO1H 2DQGL 1AXSB 1N2RB 3MLSL 5L9DH 4GW4B 4O9HL 4EI5D 3FQWA 3MLZL 2XA8L 5HHPA 1QFPA 2I25N 4JY4A 3PWPB 4LSQL 1FN4B 1AC0A 5EOCJ 4D9RD 5EC2B 4M4PA 4D94A 2ZUQB 4JFEA 4K71C 4Q9CA 2AXJA 3BO8A 4OD2B 3RVWD 3WE6B 2FR4B 5GGRB 1T1ZB 4XBGB 5I1DB 4PJDB 3QCTH 3QCTL 1HDMB 3HI6H 5C0JB 1S9VB 4HK3N 1J0HA 3GI9H 5TQ0L 5C07E 1DZBA 1MAJA 3GI9L 3RKDC 4Y19A 4ODTH 2EDRA 3QUYA 2J8UF 4BFIA 5EU6B 5HVHB 1EAPA 1OLZA 3RNQB 1XF3B 2W60B 1CQYA 1R3JA 3ROLB 3QUKB 5CUSL 3BQUB 5GRVK 5IKCA 3JTSA 1E4XH 4DVBB 1JHLH 3ARPA 4U7MA 4Q7DA 1UJ3A 4K7PH 2NR6D 4EJ1C 4QYOB 4YBLB 2FIKA 2Q6WA 5BS0A 4P5TA 4X9FA 2ZZUT 4JN2A 2DQIH 3H0TA 4LPUA 4P2RB 5KVEH 3CVIL 2WMPA 4U1MB 5ITFB 2HRPL 2PO6A 1HQRA 4QRPB 2X4OA 2AJ3A 1E4WH 2ESVB 1MFEL 3SOBH 4OIAA 3TH4T 1LP9B 1K5NA 1G7IB 2ZUWA 1DE4B 3D85A 5JR1L 1A9BB 3RIAF 2XKNB 3VGDA 4R4NC 3IS0X 3U36A 2O5XL 2F9BT 1V05A 1XGPB 2AQ3A 2O5XH 2Y1VA 2AAVA 3VRLF 5BJTA 1QSEA 3QCUH 2DQHL 2DQHH 2XWBA 4WENB 1WBXA 1N6QL 1CFQB 3EAKA 3H9HA 2VB5A 3NZHH 5DJCB 2NY4B 4Y19B 3KLDA 1I8KB 4X99A 4G6FB 2OLDA 2BVOB 3ELAT 5EBWB 3HG1D 3CMOH 2FBOJ 5CCKL 2H8PA 4RAVA 3CMOL 1ADQA 1CDJA 4I18A 5E8DL 5EBLA 1KIPA 5E8DH 5CJOL 1OF2A 3QDJA 4KI1A 4EBQL 3O11B 3V6BR 1DBJH 3ARZA 1T0PB 4PY7B 3S4SA 5DZOA 3X11B 3U9PH 2IBZY 5HVHC 3MA9H 1OARH 4AIZB 1OARL 4R0LA 1J7VR 5KVDH 2EEBA 3IU3B 2X6MA 2DB8A 2Y7QB 4GLRH 3OJDB 2VXQH 1AP2A 2H32H 1KEGL 3GJEB 1A7RH 5BV7C 2X4TA 1AH1A 2E9BA 3OSKA 5ACLA 2YPLB 1T5XB 2F8VA 3BEVA 5A2JH 1D5XA 2CRYA 1DDHB 5DQJB 3ZKSD 3FRPA 1RZ8B 2OJEA 2B7DT 3LS4L 4P3WA 4GG6A 1CLOL 1EO5A 1UB5B 2WINB 3JWOH 5HYJD 1ZGLM 3F7PC 1R24A 3WXWL 1LILA 4XPGH 3RNQA 3KXFB 5EOQL 4TSBL 1KBGL 1MELA 1G7QA 3D25A 3U4BL 5JW4M 4I3SL 3AXLA 4YDLB 4D0CB 3G08B 4NDMA 4LFHD 3CU7A 4QLRA 2ZCKH 4PJ5D 3KPLA 4S1SH 3ZYOA 1XCQA 4PTUA 2C26A 3SQOH 1CD1A 2OTUA 2MFNA 1S8DB 2O5YH 2EZ0C 1AO7B 4WTXA 5AD0A 1HZHH 3IVKA 3TBYA 5F72S 3RWFB 4GAGL 1MH5B 4GJTB 4NJAH 5I1IH 1KJ2B 3C5ZC 1YN6B 5FO7A 5J13B 4J1UB 4NQXA 1D9KC 4KKBD 1G9NC 3QHZH 3V0VB 5HHOB 5KG9B 3KPNA 4P4KB 4WW2C 4N8PA 1II4E 4U6VH 2AJUH 2AV7A 2CIIA 4OF7A 5LGJA 1W0WB 2VDRH 2VAAA 4UT7H 1INEL 1LP9A 4JDZA 3MRRA 4HV8B 1IGMH 3KPNB 5C6PB 4M7LH 5E8NA 3AS3A 4M7LL 5HDQH 3F58L 1ZA6A 1FFQA 4NGHL 5DQDH 1BJ1H 4BH7A 1VCAA 4LSSH 4HWBH 4NGHH 1YNTB 1S5IH 2DBLH 2DDQL 2DBLL 1S5IL 2HTKC 3S96B 5JHDD 1U3HD 1CS6A 1FGNL 3RGHA 1LE9B 5C0EB 1FGNH 1EHLH 4O9HH 3PHOB 4QHKJ 3UX9B 2AK4A 1EHLL 2HWZH 4HBCL 5DA4A 2NX5E 5MI0B 2R1YB 2PXYD 3EO9H 4ZNEA 4OZFB 3I6KA 3SDDA 1FG2B 3P9MB 4BK4A 2VZTA 2NY1D 3RVXD 3VGAC 4Y4FD 3WSQL 1MREL 3RWDB 5MHSD 3HAEH 5MEOB 1F2QA 5HHOE 1MREH 1VGEL 2NNAB 4WTWA 2XQYK 1IM3A 1FFNB 4L8SC 5EZOH 3KAAA 1MEXL 3LKNB 3QIUC 3D87B 4OZGA 5ITFA 1OP3H 2A0LC 5CSBA 5TDNA 3C2AH 1ZLWK 1O7VA 3OKLA 4I48A 4Z77A 2OQJA 2G9HA 5J9PA 1H9VA 1YEEH 2PN5A 3MOAL 4MGXA 3BJ91 5E2WH 1CFTA 4YFLI 4HJ0D 4QHUA 5E2WL 4E42A 1U91A 1F90H 4XNMA 2EDTA 3GKZA 3GB7A 5J12B 4PJCB 1Z9MA 4ZODA 4XAKE 1CDIA 4NOFA 3RZCD 1D3CA 4WEUD 4LEXH 2HFGH 2HJKA 2A77L 5FYKU 1EAPB 3GO1H 4X9BA 1QNZL 2AP2A 3B2UC 4CN1A 4DOHB 5TJWK 1HHHA 1QBAA 2NZ9C 2I9LA 3EZ8A 3WNOA 2DMKA 2VDML 5DURD 1E4JA 2HP4A 5DJAA 1B0GA 1F3JB 4JFHD 5EUOB 4RAHA 1U58A 3CX5K 5K9JL 3NN8B 1C5CH 4DQOL 2JB5L 1E4WL 3MNVA 3O2WH 1YJDC 4C56D 2JB5H 1CD0A 1AQDA 1UKTA 2F53E 2X1QA 1D5MB 3ISWA 2MHAA 1UQSA 3MYZA 4R2GB 3ULVD 3D6GA 1UZ8B 3V5HA 2XTJC 1ZLUK 4L3CA 4WFGE 2VDQH 4OLVH 4GKZB 1JPSH 1FFPA 2UY6A 1NEZG 1NQBA 4TUJB 5GHWL 5K9KB 2HJKB 4KV5E 2JJTC 5EU7C 1XGQA 5GHWH 1WV7T 4Q6IB 1Q9OA 2AEQH 2HH0H 2P7TA 4JAMB 4K23L 2J6EL 3LPWA 1K4CB 2OSLB 1U8HA 4N9OB 4WUUA 4OFVA 2JCCB 1XZ0A 1U0QA 3QEHB 1GVIA 2YA2A 3KWWA 2XWJA 4DK6A 1C5DB 4ENEC 4ZUWB 1JF1A 5GGTA 4M93B 2ZKHH 3GI8H 1P4LA 1SEQH 3HRPA 1RZIB 1R0AL 1BLNA 4NO0B 5MI0C 4I5BB 4AQOA 4ONOA 4S2SA 5D9SA 1OAUH 3LDBB 2VXUH 5AG8A 3UTTB 4TPRL 4IOSD 5J3HD 4JN2B 3TT1H 1T7XA 3P3YA 3TT1L 3O4LE 2RHEA 4JGJA 3P0YH 2UVEA 4KGLA 3VFWB 5TGBA 1OTSC 3I6KB 4UOW0 5KVDL 8FABB 3ZHLA 5J13C 1YEHH 1JCKA 4P23A 1IE5A 4LKXB 2H1PL 1I9JL 5I75C 3OKKA 1NGXA 3KHQA 1QA9B 1FFRA 3DYMA 1AGFB 2EH7L 1PEZA 1NC4A 1RUKL 1ZA3B 3AY4A 5DQ9A 3T2PA 3P4OB 2VWEE 4F9LC 3P30L 5D7KE 4IJ3B 1N6VA 4ELME 3IDXH 5LGHL 5KVFH 4EDWL 1KPVB 5IB3A 3QDME 4LPCA 1KPRA 3E1F1 5KVGH 2BFVL 4QXGL 4P5KA 7CGTA 2BFVH 4AENB 2DIJA 2IAND 5D2LF 1LVEA 1OQXA 3QRGH 3QFDA 3VFSB 4BZ1L 5IB4A 4HJJL 2CDFB 4ZO6A 4OF0A 4JKLA 3FFCE 2DQUL 1FVEA 3GMRA 4OZHA 1C5DA 5DC0A 2X4QB 1EVTC 2V7NB 1CIDA 3R0MA 2H2SC 4PUBL 5HHVL 3TZVA 1YJDH 1D6VH 3GSVA 3QWRA 4POZD 3MRPA 1YA5A 2DQCH 1IC7H 3ULVE 1IC7L 2AJZB 2IGFH 4OB5L 1AHWC 4QXTB 3N1QC 4Z7WF 4XBPA 4K3GA 2PW2B 5CEZD 4BSVB 3CFBA 3T0BA 1GPOH 4KMTH 1FNLA 3CXHJ 1TFHA 4PS4L 1B6UA 1WC7A 1XR9B 3KS0H 5SWSB 5D2LB 2NY5H 2PF6A 4J1UA 4PJ7B 1NGXB 4KY1H 2EDXA 3AB0C 5ECJE 5C0ND 2VSCA 2Q20A 3C9NB 1KV3A 5D71L 1S3KH 5BOPA 4BSVA 5HI5C 3LH2L 1J05B 2CRMA 4HC1A 4ELMF 2ZOLA 2QSVA 1ZAGA 1A3LH 2QR0A 4E5XA 1A3LL 5BXFB 3DO7B 1T83C 3ULUF 5KANG 1Y6NR 2Z4QB 3KXFD 1T0NA 1EDQA 5FEBA 1MLCA 3ZE1E 2C4XA 2HWZL 5FM5O 1T2XA 1G7QB 3D25B 1MI5D 4HPYH 5DSCA 4YO0B 3DIFA 3KR3H 4BSJA 3NZHL 3KR3L 4JG1H 3DTXA 3WSQH 4JG1L 2BSSA 4FQXB 4G9FE 3X13B 1VGEH 3T0EE 1A6AA 3HPLB 1FL5B 3NCJH 1DP0A 3T04D 1UYWH 1EV2E 3VXRA 3LHPH 1G7PB 3P4NB 1U6AL 1JTPA 2FBJL 1WISA 4ETQB 1WSST 2ARJQ 3E8UH 4YDIH 5DJXB 5LBSH 3TT3H 3RWJA 2F19H 4JFQB 5J3HC 4YDIL 3E8UL 3MRGB 4WHYG 3TT3L 5JQ6H 3ARFC 3GHBL 1P9MA 3GJEA 2ZP0T 2P5EA 2VLJA 2AXFB 3QO0A 1F11A 4LSRL 2A9ML 2DIBA 5DQ9B 3GSOA 3JXAA 4PIRF 5EUOE 4PP1D 1SY6L 5IHBA 2VR9A 3CH8A 3TO4B 1WFTA 5C0RL 4LLMA 4I8DA 5D1ZA 2Q7YB 2HFGL 5IT2H 2DWEA 2B1HL 1JYXA 4FQQA 3GJFK 4OCRH 4OSUL 3FOMA 4CU7A 5IP4A 4JAMA 3MJ9A 4OD1H 4KJYB 2X9YA 3CLEH 2ITDA 4F7MB 1EERB 1CLOH 4WW1B 4C56A 3O3UN 1RUAL 1YYML 4DKAA 4ZUSB 1RUAH 5SX5H 2Y06H 3QUML 5J12C 2IH1B 5J4MA 2FD6L 1GCFA 5C0CA 5FCUL 5BZDA 3ZE1F 3DETC 3ROOA 1L4IA 4LLYA 2NXZC 3MLWL 3IXAA 1FZMA 3WKML 2QQLH 3MLWH 4AL8H 3QDAA 3S7GA 1NJ9A 5IR1B 4P3CL 2ADGB 1BZQK 5IVNA 1EIBA 2GTWA 5KG9A 1C7SA 1ZE3C 3M8OH 2H41A 5E7BA 2EKSA 5F6IB 3ULUH 4Z78B 5HYSA 1S7XB 4K07A 4K23H 1WC7B 1XR9A 3VXSD 2OL3B 3QUYC 2ATKB 1LO3H 1IGFH 5DUPL 1EUTA 4UT6L 1ZGLP 5DHVH 1X3DA 1XGRB 4N1CA 4WWKA 3KGRA 3KJ4C 2WWKT 2GJ6B 3KPRB 4Z7QF 4KWUA 1CICA 1ZT7B 3O9WC 4LVEA 3IB4A 4MCYB 1RJZB 4RFOH 5ERWA 3VJ6B 3T0DA 2VH5H 1LE9A 1M4KA 1J05A 1QRND 2Q3ZA 4TNWK 2VH5L 5GGVH 4MLIA 3K2UL 5DYOA 1I1FB 3KPSB 4JM2F 2MKLC 1FGVH 1FC1A 3SJVB 4Q74A 2QBWA 4DUVA 5D1XB 4DWHA 3ARRA 5JORB 4FQ1L 1DLHA 3AU1B 4ZTPL 1EEYB 1QSZA 5FUOH 1ZS8B 2Q7NA 3C09C 4ZTPH 1X6NA 1BGXH 5SX5K 1CDHA 3BE1H 1KT2A 1ZWIB 5FYJH 3S35L 4PJ9A 32C2B 5IW6B 5J57B 1CFNA 3LMJL 5EPMA 1NCWL 5EFIA 3LMJH 2CKBL 4D8PA 1UEMA 3NOIA 3K1KC 3STZA 5EU4A 1PYWA 3L3GA 4UNTA 2J4WL 3AY4C 4QTHA 3VMPA 1KGCD 4EDWH 1D9KD 4UV4L 3VWJD 1MVUA 5GJSL 3CLFH 2NW2B 3QAZC 2XA3A 5LQBL 2VLRA 1G7HB 4MXVF 2B8OT 4YHZL 2FLRT 2R1XB 3QRGL 4BZ1H 4R26L 4X6CE 1DUZA 3HAEG 2YXFA 3CFEA 4R90L 2X4SB 5HDLA 5CBAB 1BZ9A 1V3JA 4YBQC 3U83A 4I18C 1IFHH 4Y7MA 3R1GH 4NBYB 1IFHL 1XFPA 1JF5A 3FT2A 4UUJB 2UUDH 4Z7UE 2M1KA 4O2EA 1PKQE 2EDYA 1XGYH 1BEYH 1U42A 4QWWC 1IILE 3V7AE 2FLBT 1YMMD 5DYOB 3SQBA 4IMKC 4K94H 1CDYA 2IBGA 2BOBB 1ORQA 4P5MA 3TZVC 3IS1X 4L5FL 3L5WB 1J87A 3MCG1 1KYOK 3S37H 5C0CD 3BKYL 3EUUA 3S37L 1JGLL 4GRWE 5KSUA 4TNWF 1NCUA 1ITBB 1JGEA 1AQKH 3D0VB 2R23A 1WCBA 2WANA 1FN4A 4YXLH 1KNOB 3VFTB 4Z0BL 4M9OA 3HHRB 4LCWE 3P2TA 1IEBB 1BWMA 2JIXA 5IMLB 4ODUA 1YY8A 3EOBB 3X11A 1JPSL 4NZTL 4GKSB 2XTLA 4HJ0C 3DOSA 3HZMB 2WM0A 2R2EB 4HDIB 3MRLB 1AFVL 1KN4H 4HCRA 3N9GL 2DKUA 5D1ZB 2IFGA 3D18A 1CGYA 3JV4A 3BESR 4LF3B 4IOIB 2YK1L 2DD8H 4EN3D 2P5ED 1U8MA 3ZT5A 3MLTB 2OP4H 4PBWD 4HH9B 3FO0H 3JV0A 3RDTD 4RAUA 4HLZH 1BVKB 5JW4R 2XWBB 3QAZB 4ELMA 2UUDK 5I1GL 4UZGA 3ULSA 1JZ4A 4NBZB 3MRCB 3CD4A 2GK2A 4C4KO 3ULUE 5HVWA 4UOJA 3G6AB 3GIVB 4X6CB 1EFXD 2ARJB 2CLZA 1PKOA 3K2MC 3OZ9L 4RFNC 4YEEA 2XKUA 1F00I 3DVGB 1NBYA 3W39B 2BVTA 2XWTB 1FV1B 1AXIB 2Q86B 3PQYE 2Y5TB 1HYRC 1L7TL 2W9EL 4Y0GA 4G80B 1U8KB 3SDDC 2X09A 3D9AL 3FO9B 43CAB 5CLWA 4UAOB 1IC4L 4OCMC 4R0LB 3UTTD 4M1DH 1LK3L 4I2XB 1WBYA 4OZFH 4YH6A 3P30H 5BXFA 5F3BB 1NMCC 5IEHA 4LHUB 4LNRA 3S5LA 5A43C 1I1RA 1DBML 4PJ5E 1OM3H 5EU6E 1M05A 1FZJA 5IWLC 1FYTD 1QKZH 1T89A 4UILL 1OWRM 1MCEA 4PJ8D 5HD8C 3BXNA 4NN6C 3ZE2E 2C4FT 2QQQA 3N85H 3QUZB 5E8PB 3Q3GB 2AK1H 4HJJH 5CAYB 5SWZA 2QQLL 4GAYA 4M93C 2R29L 5CSZA 5FKAA 2AJZA 4O2EB 4ZTOH 3S4SG 4M02A 4P3DB 4ZTOL 1RZGB 5JXEC 1B2WH 3FB6A 4KVCH 2CK0L 3O45B 3KHOA 3ARGB 5D1QD 2DI9A 2CK0H 3DXAB 1G6RH 3G6AA 2R1YA 1OD7A 1LO3L 1QSFB 3RKPA 2O61B 2IGFL 5CJXA 1OT2A 3KJ6L 3GSXA 4OZFG 3RVVC 2P45B 2WK2A 2PYEB 2WLYA 4U3HA 1JHKH 3IDGB 1N59B 5GS0C 5I1AA 3SE8L 4HUXA 2YPKB 3CX2A 4RFOL 5IW3A 4Y89A 1HOCB 3B8YA 4ZSOB 2VDNL 4NQCA 1RZKH 4HCRH 4N90D 4XZUB 2VAAB 3QEQA 1MFBH 1RZJH 2CLZB 1CZ8L 3H9HB 2F8XC 1RZJL 3MRLA 3AREC 5CWSA 2PXYB 4M3JA 3ZDZF 5E24E 4XNYL 2NY1B 3V5KB 4Y4HC 3BWUC 3GMQB 1U92A 5DMIH 4ORGB 4ZFOA 5DMIL 5DD1L 4CMMA 3SDYH 1BF8A 4S11A 1TDQA 3SDYL 3JWDH 4JCMA 3L3JB 5F7YC 1MCHA 1EH9A 3E3QE 5A2FA 5F1NA 5FYLL 3LKRA 2IMNA 4JFYA 5C0AA 1JP5A 5AZEH 1GJIA 2ATPB 2R0LL 1W0YT 3CMGA 4P57A 1IGTB 2R0LH 3P11H 3QNZB 4RWYH 1DBKH 2XICA 3PWJB 4HMCA 1DN2A 4DEPB 5I8CB 3U79A 1MJ7L 4PLJC 3IU3A 2ATKA 4BQBA 2X4RA 4HUWA 1MVUB 4Y4KA 5D5ME 4CNIA 5BQ7B 1J1XL 2VN7A 1J1XH 4LSRH 5FKPB 4G43B 2B5IC 3R1GL 5I74B 4QYOA 4YXHH 3TNNA 5IMOA 3PWPA 4YXHL 3S8WA 1BEYL 1JRHL 1AO7D 2EDNA 3FL7A 4N8VG 2ICWA 1WBYB 1XF3A 5GGRY 2A6JA 2J12B 2PYFB 5I75B 5I15L 5EU5A 4L5FH 4PJAB 4HSQA 3QUXB 3WD5H 3CXHK 4RZCA 4XWGL 1AR1C 2RAMA 4MVBD 3TA3D 4WUUD 4HH9A 2NW3B 3DMMA 3HPJB 5AUMB 3QDJD 3MZTA 4JREC 3QPQC 1NGQH 1YYMH 1CI5A 3FQNB 4BM7A 1PQZA 4RQQA 5E9DD 2Y06L 1ZVSA 4XP5H 3QUZA 5E8PA 4ZQKA 3S6CA 3O8XA 3RL2A 2D4DA 5D2NB 2E9JA 2EC9T 5I16A 2VIRB 3ILPB 3HUJE 3MODL 4IBLT 5C70A 2APWA 3FHAA 4HF5H 3IJHA 1HN1A 4KUCF 3Q0HA 5T1LD 1NMCB 3BRFA 4GOSA 4NQEE 3T2NL 5DJDA 1KUMA 1UZ8A 5MENA 4MD0B 2HG5A 3D39A 3WNNA 4OFPA 4NZRH 5IJKA 4TSCL 4LSPL 5D5MF 3DPBA 3PHQA 4JB9L 3L3OB 5IESH 2DLEA 2Z91B 4E42B 1JVKA 1QHOA 1MCPH 3NA9L 1QBLL 4GRLC 1MCPL 3NA9H 2UV3A 3X3FL 1F6AA 1AY1H 4F80A 2BJML 5GGQL 3GSRA 5DVLA 1T22B 1CR9H 5ID1B 3VG0H 5IV2B 1DE4A 3IDNB 3K2UH 3IJSB 4ZUTB 3TN0D 3SO3C 3O2VH 4MWFA 4P0DA 5BW7C 4MDIB 4IRSC 1I7TA 4S10A 3DRQA 4QRRD 5HHNA 1SEBA 3WJJA 5MERB 3VRJA 4PY7A 1F3DJ 3OKMA 4G9DA 3QDMB 4OUUA 4WY7L 1VGKB 3G5YA 3ARBB 4W4OA 4CU6A 1YEJH 2G60H 4XPTL 3VWJA 4UTAH 4PB0L 4FQCL 4LLVA 3S35H 3D3VA 4OFYD 5I1KH 3ARGA 1IC4H 2H2PD 3GEWB 2W65B 3FQXA 3U4EA 2GT9A 2SEBA 1ZVHA 2F54B 3T08A 1E6OL 5ESQA 3VFUA 4JQVC 1RHHA 3PP3K 1GSMA 4OZHF 5FGSA 2C5DC 5K9KA 3OR7A 1OM3L 2F54D 4FFWC 2DRUA 2VQUA 1EHNA 3PJSB 3L9RB 5DJXA 1H3PH 5FO8A 1FJ1A 4FN0A 4X4XB 2RCSL 3EJZD 4G6FD 1PDKA 3O4LB 5ESVA 5DD0L 5DFVC 3SDXB 1U3HC 3BD5A 1A9BA 3MBEB 5KBNC 3QDGE 1IQDA 4XAWH 5D7IF 4OF3A 2V5SA 4OJFH 4R8WH 2P8PA 4K7FB 3TEUA 3CFDA 3DMMB 2NW3A 4MNGB 4W6XB 1FVEB 4QTIL 1G6RL 4MD0A 4FQPA 1P69B 3FN9A 2VE6A 4QTIH 4Y2DA 1NLDL 2YA0A 3DMMD 2H9GB 5FXCH 4MVBC 3WEXA 4F7MA 2H3NA 4JRYE 2BHZA 4AH2B 3L9RA 1XAUA 2CUHA 1KTRL 1F42A 5E6IA 5T1DL 5D2NA 3SDCB 3VWKB 3AS0A 3LZFL 1UM6L 4ZAKC 2VDNH 1RZKL 2LU7A 4PRDB 5ID0B 4OZIE 1G6VK 4PRIE 4CN4A 3D0LA 3VGEA 4Q9RH 1OTUC 2DM2A 4G9FA 1PG7W 4YBQD 4JRYA 4XNYH 5ENWB 3D1MC 5MEOA 1T66D 3MREB 3BI9X 5F8QC 3FJTA 4RMRA 5T1KA 3LD8B 4APQA 1U8NA 3O3BA 4M6NH 5KTEL 3T1WA 3B6SB 2DD8L 1FNGB 2H26A 1MCIA 3OX8A 3V52H 2BNQA 3QIWD 4QWWD 3PUCA 5KOVC 4LCCA 2AJSL 5D7IE 1SJXA 3MLXL 5L2JA 1EEQA 1B90A 1OCWL 3MLXH 4MQXC 2RFXB 1I8LC 1R5IA 3Q2CA 4FXLA 3TH3T 3LKSA 3QHFH 1JYNA 3GMOA 3FO2B 1AJ7H 1TZHA 3FTGB 1G0YR 1HSBB 3PDOA 2HT4D 2EC8A 2J5LC 3ZDZE 4BJLA 4M43H 1PBYA 1MIML 3QNZA 4JFXB 1U2HA 4M43L 4U1LA 4CUCA 1FBIL 5EBWA 3TBVB 1SQ2N 2E7MA 1DEEA 4XBEL 4D0CA 3W0WA 4X4ME 4KGJA 4UV7L 3D5OF 2DOCA 1FNAA 2YPKA 1LEKB 4OV6F 3KYAA 3GHEH 2XT1B 5GIRB 5ALBL 4G7VL 1TETL 4RISL 1PG7L 1BBJB 5BO1L 1W2KT 4Z78A 4LCCB 4BELD 4M1DL 1FZOA 1X5AA 2WIMA 2YRPA 4YNYA 1TVDA 1O7SA 1CXFA 4WGWB 1T5XA 1X7QA 4QRSB 3CSBA 5HBBA 3QXDA 5E8OA 4HKXA 1EVUA 2VUYA 1I7RA 5F9DC 5JA8B 3FZUC 3E6FA 3MRRB 3QUZC 3SE9L 4FHBD 5BV7L 1NCTA 2XY1A 4KPHL 4ZAKA 3ZL4L 3VXMD 4JFED 4OD3L 1AI1L 5KN5A 3EFFA 1U8PA 4WW2F 2OSLA 1LDSA 3QJFB 1OP3K 4OGZA 2BERA 2DLFH 4I0PB 1MHEB 3P73B 3WLBA 4NNYB 2PW2A 1VACB 4L4VD 5EA0H 4LCUA 3OAUH 3O2DA 2JELH 3FN3A 5FOBB 1LE5B 1SVZA 1T7VA 2D7PA 3MRHB 3QDJB 3TJEL 1T5WB 1U3JA 1QBBA 4FQJH 4M62H 3BPCA 3SDDD 1UM4L 4HIHA 5IJKC 1FAKT 3KPOB 3KJ6H 3T0XA 1HQRB 2OXHA 3VXRE 4KK5C 2H45A 3P0GB 1NFIB 2HVKA 43C9A 2HMIC 3PNWA 3QXDB 4CMHC 1JGVH 1R3LA 2HLFC 4Q9QL 1NEZA 2RFXA 4AG4L 2HKHL 4KTDH 3OHXB 2X89D 1HDMA 3QEHA 4HWZA 4JPVH 2XN9D 5H35B 3UEZA 2ZOLB 3TBWB 1UVQA 2CUMA 2D0FA 1KTLA 1W72H 3QFDB 3VFSA 1MF2L 4A6YA 2WIIB 1PZ5A 4WCYH 5FIEA 5DUBB 1CGSL 1UACH 4GO6B 4GKSA 5T1KB 5IHLB 2PTTA 4LAJH 1H5BC 1BFOB 2F5AH 2PR4H 5HPOA 4LVHB 4MWFB 4GG6B 5DRZA 2NYYD 4ZPTA 1FORL 2HT2D 1UH3A 3VXOB 4GW4A 3HA0A 3KPOA 1KPRB 4GXUN 3MRPB 3QCUL 1XIWA 1JZ8A 4N5UA 2X41A 3ESUF 3UXFA 5BMFH 4S1DD 2UWEF 2BHYA 5C0NC 3P4NA 2AJXL 3PL6A 5D7LD 3LKSB 5IMMA 2EIEA 4CAGA 4PJXB 2QQNH 2A74A 2YD7A 3VXUA 2DI7A 5GS0D 3RWIB 3LN4B 2IEPA 5JDSB 1KLUB 2IQAB 3EO0B 1I1YB 3TESA 4DUWA 1A6UL 1DVFC 1JWUA 2YEZB 5TQ2L 3RWFA 3BVNB 2MJWA 3N06B 3NFNB 1CDUA 3GSUA 3HZKA 2XZCH 2ZPKH 4U6YB 4CVWA 4F57H 4GG6F 5F89B 4OJFL 5HGDA 4K71B 4E0RA 1NC2B 3BKJH 3NCYS 3KPSE 2N56A 3KPQA 3SDAA 3HRZA 1UGNA 3CFEB 4S2SB 4U6HB 4HWUA 5HYQA 1AXTH 4NWUL 4AT6B 3PG2A 1T1WA 1WFOA 1CFVL 5EIVA 1UJTA 2CLRA 1JL8A 3HCVB 1OGAD 4OZ4B 4Y4HD 5DJ2B 4CVXB 3CVHL 1GXEA 1OGTB 3VRJB 3SEPA 5TF0A 4IRJB 3U82B 4R7DB 1JGDA 2HLAB 3LS4H 1BVKA 2VERN 2JKXA 2X5PA 4QXTA 3CUPB 3LZFH 3JWOL 5HYFA 2CGRL 1I9RH 3ARUA 4U0QB 1VACA 2J2ZA 3V6ZB 5F9WB 5FYLE 3HNVH 2GYSA 5J06A 4BQCA 5HY9B 3B9DA 3WFHA 2LVEA 1H3GA 1YN7B 5D1ZD 1SM3H 2VAJA 3W11C 2B0SH 3DSFL 3SKJH 3P4LA 4X7EC 4NZRL 4XXDA 5KTEH 3S34H 3B9VA 3UZVB 3WFHB 3DV4B 5D6DA 3S34L 3CGTA 1DSFH 3OPZH 4ZUTA 5C0BD 4BH8A 4N0YH 3OPZL 3WFZA 3DWTA 5F89A 3QWQB 2OI9C 1XGQB 5BV7B 3MR9B 1RUPH 1VHPA 4GSDH 2BJMH 3T8XA 1KENH 1JMXA 4WNQB 3H9SB 4KDVA 2AGJL 5DGQA 2LTQB 3HMXH 2AJUL 4IM8A 3K7UA 1KB5L 1VFAB 3QQ9D 3TP4A 3ZKXB 2XACC 1NCAL 4L4TB 5HI3D 1V3LA 1BHGA 2FCBA 1ZTXL 3BPLB 3X12A 1JZ2A 3H42L 5ALBH 2GJ6A 3KPRA 4CU8A 3HRZB 1N0LA 3GSNH 2ZNXA 3SKUD 1YEJL 2G60L 4UTAL 5FM4A 5TGBB 3FQRA 3KLSA 3MGTB 3QDHA 1YEFL 3RVUC 5HHME 4LCIH 3L3JA 2OL3A 4OM1L 3KLHC 4RMQA 2DJSA 4ZPVB 5C08D 2IQAA 2N7BA 1U8KA 2XFXB 1XF4A 4LP5A 2JK5A 1V7NL 4X8XA 1S9WB 1N0XH 2A9NH 4YO0A 1S7VA 2R39A 1G7LA 3JV6A 1FL3A 5J6HA 4M61B 4NO0D 3SCMA 3UDWC 3HI6L 4N0FA 1MFNA 2XZAL 1WTLA 1NGPL 1I75A 4KPHH 1OP5H 1HOCA 2XZAH 1PY4A 3LEYH 4N0RA 1AI1H 4DW2H 1NC2A 1UC6A 2Z8VC 5GGUA 3H2WA 1DQJA 4ODTL 1PLGL 3OKEB 4QRTA 5FECB 1PLGH 3FB8A 3SO5A 3SDXE 5B8CC 4OIIL 3F6IA 5LJYH 2AKRA 3T4YB 3NGBC 4PJ7E 1HSAB 2EKSB 3CZFB 4MJID 2DIAA 3WLBB 2X9XA 1YEDA 4FXKA 2DQFB 5IHZB 1A47A 2NTFA 5FGBC 3L5JA 4NFDA 4WTZA 2CR3A 3I85A 5J6HB 1ZVSB 3F7QA 4CDGC 1N5YH 1MFCH 2HKHH 4KTDL 3GSVB 4LIQH 1LO0H 5J1AB 1NFIA 1TQCB 2BNUB 2FSEA 3O6ML 4PRNB 4XXCC 4ORZC 4JM2C 1BQLH 2BX5A 32C2A 3ARQA 4Y4KD 1A0QH 2FZ3A 3CAFA 4Q9RL 3LKPB 4NJ9H 5CLTA 2Y36L 1FO0B 3MRJB 3BHBB 3BZEA 1AE6H 4JFFD 5I9QC 3HC3L 2I27N 4OV5A 1I3GH 4L1DA 1P4IL 4PP2A 4X6EB 4NZJA 3DSNA 1H5BA 3BISA 1ZT1B 3ARFB 3LKPA 3MRCA 1Z9OA 3ARDC 2V2TB 2NY0C 2CKNA 4G8EA 1F4WL 2ZG1A 1TNMA 2B20A 4L3EB 4BSWB 2XN9B 3DMMC 2AJXH 1Y0LB 4EVNA 1RJZA 4X7FC 5EO9B 3K1DA 1DEEB 4WGVB 1CFSB 1OAYL 3H9SA 1UADC 4P2OC 2YC1B 1P9MC 1EJ6A 5AAMA 1YNKL 4PGEB 2FJGA 3DVNA 4HS8H 4Y16D 4XX1E 4F3FA 3G04A 3GNMH 2ZKHL 2Z92B 3L7FB 4WHDA 3VD5A 4Z18A 5I19L 4X0KB 1X4YA 1W0VA 3O8XD 3TIDA 4HK0A 4WI8A 1FBIH 2D9QB 4JY6B 4OF8A 4RMSA 1BIIA 4NN5C 2E8ZA 4J3XA 2ZPKL 4F57L 1MPAL 4Z9KB 5BVPH 5T5FH 4X4YB 4RFNB 1EZVX 4IIQA 1J1PL 5SWZD 3P0YL 3MZGB 3VWKD 3FQUB 1OAKL 3DHMA 3ARVA 1A7RL 5E8OB 4G6JL 5HGAA 5I6XC 1MCKA 5IB3B 5JHDA 1KB5B 5HPMA 1HXYB 3FAWA 2B2XL 4RNRB 3L3IB 4ZDHB 1ND0B 5I76A 4WW2A 4P5MB 2K9UA 1GGBH 1G84A 4NIKB 3OKDA 4U1JB 4LSDA 3QJFA 2CLVB 2E7LC 4JRXA 4PJHE 3GMRB 2CGRH 2VYRE 5GXBB 4XPGL 1S7WB 4TSBH 3L7EB 4NZUH 5IHUH 3FT2B 4UUJA 5I9QB 4G6MH 5IB1B 4NZUL 5EDXA 2R23B 4P46D 3FB8B 3WKNA 1N5AB 3U0PB 3BD3A 3QI9B 5TF1H 1M71A 4KI5C 15C8H 1OY3B 4URTB 4KDTA 1A1OA 3B9KB 4LPTA 3I75B 3VFPB 4ODXB 1AKJB 3DVNB 4DKFL 5IBLD 4Y2DB 4P5TB 1K85A 3MJ8B 3PWNA 3ZHKA 3F7VA 3FKUS 3OAYH 4FQJL 3P4OA 4M62L 1T0MB 4O58L 2DQFA 4JQIL 5ANME 1NANI 1Q9LA 5EOCH 3MRGA 5JZ7D 4QKXB 4HAFA 4OD2A 3D69A 4OUOA 1JPGA 3MTRA 4JRXB 5AYUH 4BKLB 1VFOA 3CC5B 4YHIA 5KOMC 3V7AG 4CMHB 3LCYA 4KJWC 3VFTA 1H15A 2VZSA 5I1EL 4OV5B 3BP5A 4FTVB 4PRHD 3VXSB 1F4HA 4JM2D 2NY5L 1W8NA 1GL4B 4PJCE 3TJHD 3MJ9H 3A0OA 4WCYL 3L3DB 5DRXA 4AEHH 4LKCB 4IS6A 3OB0K 3QUYB 3C5SB 4AEHL 1MFAL 4LLQA 1XIWD 5LGKA 1LK2B 2PR4L 2A6DA 5CEZL 2OMBA 4AMKH 2UWEB 4AMKL 2IADB 2NY1C 1V8HA 3RVXC 4HIJB 4YQXH 4EEEA 2IBBA 4LCIL 3OKKB 2JIXB 5IMLA 4X6DB 3I2CH 3LB6C 4L3ED 4V2BA 1LP9F 4JVWA 4HPYL 1ZT4A 1NBVL 4W6YB 3K74B 4PJ9B 4P2RD 3UTSD 2I60H 4P2OD 1MI5B 1DBBL 3ECBB 4F3FB 4KJQD 2NPLX 2VZUA 3OJ2C 2HMID 2AJYL 4L4TD 1CXHA 2VLKD 4HS6B 1F4AA 4EDXA 1SBSH 2FHCA 3VFUB 2R0KH 1G7JB 5E1AA 3G6JB 2ED7A 2IG2H 4G7YH 2OZ4H 2MNUA 1T2QL 2PUQT 1HHJA 4HKJB 4RGND 1WIOA 1T2QH 3KS0J 3U9PL 2EDOA 3FMGH 4Z7OF 2BY1A 4W4OC 2A9MH 1WT5A 3T0WA 4HUNB 1SJHA 4FFZL 2HJFB 2HVJB 4YDVA 1BZ9B 4MJ4A 1EK3A 3MLUH 5IFJB 5F7LB 2CDEA 3QEUA 3ZTNH 3AS1A 1JRHI 5INDA 4WFFE 5J8OA 1JV5A 1EBAA 1S7QA 2HJFA 3CLEL 3V5DB 3UAJD 4F2MA 1NCDH 4JFPB 3Q5YA 3H0TB 4LU5L 3I84A 1ZLUH 3NCFB 4UINL 2Q6WB 4PGBA 3L7FA 3G6DH 3RGVA 4RCAA 3VI4E 1KYOJ 4X6FA 4YEFA 5LWYL 1A1OB 3B9KA 4BUGA 1MCDA 1A7OL 3HPJA 2ENSA 1P4IH 1UWEH 2OXGA 3EOAB 4Y1AB 4YJZL 1BF2A 4P3CH 2IAMC 3PIQB 4POUB 2Z8WC 2F5BL 2Q3AA 4KJYA 3O6LH 2J6EH 5IVXF 4NJAL 5I16B 4MD5A 3PABA 5C0BA 1F6AB 5IVXB 1ZSDB 2VABB 1RZ8A 3M07A 2M26A 1IEHA 3S5LB 4PV8A 4N9GB 2YUWA 1FO0L 1PQZB 4RQQB 1P7QB 3B3IA 1BX2A 4U6VL 1J8HD 4DEPC 3BN9D 4PRIB 3GMLA 5L2KB 3LV3A 2A6DB 4UT7L 3P40A 1XF2B 1EFXB 4WI5A 5E1AB 1DANT 1NFKA 1K4CA 3F65A 2OX5A 3RAJH 2VLME 2ICWJ 1UB6A 1ZTXH 2W9LA 1KELH 2WWMC 3ULUD 1MCWW 4ODWB 5DK0A 2PNDA 3GSRB 1WZ1L 3VXMB 3MXVL 3FONB 4AQ1B 3EYSL 3PQYD 2PTUA 3G6JE 5JW5A 4G6JH 2AI0L 2DWDB 4MS8D 5C6WH 4QT5A 4P46A 5L0QB 1Q9LB 4NQEA 4O2CA 4YGVA 5FDWA 3GM8A 2V17H 2V17L 2DTSA 4HS6A 4EDXB 4KHXH 3MUGB 2ID5A 2BY0A 4LCYB 4H20L 3CX5J 5HJ3A 3GMNB 2FB4H 3DX7B 4LHUG 3BUYB 4ONHB 4LCWD 5EBGA 2R2HA 5TQ0H 4KZDH 3S3SA 3DBXA 1NAMH 5E4EC 2E7CA 2IC2A 4AY0A 1NAML 5E1HB 4H1LH 1NUDA 3CNKA 4XVUC 4XCYB 4AENA 5CD5D 3QIWA 5LXGL 1L0XA 5IFJA 4PUBH 4FTVE 4LEXL 3L3HB 5T3XL 1BJMA 1E4XL 3TBVA 3HR5A 2DQCL 3VH8B 3QEGL 4EQ3A 3BDXA 1NDMB 3D85D 4M5ZL 5E2VL 1RIHL 1HXMA 3IU4L 2VDMH 3D0LB 1GPOL 3U6RA 5FB8B 3CVIH 5CKGA 1JGLH 1FVDA 1TVHB 1N8ZB 4F8TA 5HTSA 1DVFA 4P2QD 1G1CA 3M1BB 4XH2B 4Y88A 5DD3H 1MFEH 4CNIB 1BQLL 2YD8A 3BMVA 5KVMC 4V2CB 1F02I 4PLNC 5HHQB 4AJ0A 1FNGA 2FNBA 1TTUA 4U05A 1ED3B 1J1OH 1CU4L 2KQNA 1DQDL 3SJVE 1CU4H 4PTUB 2HTLD 5GS0H 1LO5A 1A7PH 3KPQB 5GS0L 4NWTL 2BVOA 4HH8A 4YQXL 5DWUH 1HINH 3LS5L 3I2CL 4PJHB 3VGHA 4K55A 1ED3A 3HMWH 3IKKA 1I1AA 3N9GH 4PRDA 3T2OA 5ID0A 3G9VA 3DUSA 2J8UE 3B43A 4HXBH 5CIPA 4DJMA 5EG6C 3STZB 2FEDD 2R8SH 5J7CC 2AV7B 2NY6C 3AROA 4HS8L 3KPTA 2R8SL 5FYJE 4LMQI 3HB3D 2OJEB 1G9MH 2FX7L 4APQB 2W0KA 4HS3B 1OQOA 5MEPA 1DBJL 4QOKE 3KPSD 3PJSA 4PR5A 4NQTA 4YPJA 5CGTA 2COQA 4HG4K 1A4KA 2LV4A 4GKZA 3G5VB 3SDCC 3JVGA 4KROD 1VEOA 3RUGB 4TOYH 2B4CH 1KJVB 3A6BH 3MJGX 2MPAH 3EJJX 4LF3A 1T04B 4O51B 1S9KC 3SGJC 3P4MB 1UH4A 3SDDB 1FZJB 1T4KB 2B2XH 4MD5B 1JWSB 1LEGA 3QNXA 4RRPA 3GMNA 4BFBD 5DJYB 1OF2B 4X4XA 1NCDL 4L3EE 1S7UB 4I5BA 4Y16B 1CL7I 5D5MB 4Y16C 3IDNA 1QKZL 5B39B 5T1MB 2R2CA 3GSNB 3WXWH 3G5VA 4P4KD 3WDJA 3MLPA 4NC1C 5EZJB 2IAMA 4C55A 1ODAA 4ZYKA 3O8XC 4N90E 3RPIB 1S5HA 3TCLB 1A7OH 5INCA 5EBMA 1U91B 1I3VA 3MV9B 2Y7QA 1IAIH 5F9OL 5DF0A 5GSRB 4P23B 4Y5YA 2C9AA 5F9OH 1VENA 4ZUUB 3B9KC 3IFNL 3OV6A 1D9KA 3VWKC 1HSAA 1P7HL 3HR6A 1BQHA 4NC1E 4GW1A 1IT9L 3MA7B 2MMXA 4GAGH 3RTQC 3Q6FB 4XPFL 1U8NB 3O3BB 5ALCL 2HN7B 4LIQE 2PTTB 3EYOA 6FABH 3RHWK 4D9QE 5I0ZA 4MSWB 4PS4H 1PEWA 2XWJB 5DMGD 2CIKB 1HYSD 2VISB 5IMKB 4F7PA 2QR0B 2YXMA 3PL6D 5D7LA 2NLJB 4H1LB 4JRWA 2Z91A 2E8YA 1S3KL 3C5JA 1AGBA 2BSRA 2XYCA 1FGVL 3MGOA 2GJJA 3GMQA 5HVGB 4JFFE 5DQDL 5KZCB 3H9ZA 3U0TA 1H0DA 4I4WB