1G6VK

Complex of the camelid heavy-chain antibody fragment cab-ca05 with bovine carbonic anhydrase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
b'QVQLVESGGGSVQAGGSLRLSCAASGYTVSTYCMGWFRQAPGKEREGVATILGGSTYYGDSVKGRFTISQDNAKNTVYLQMNSLKPEDTAIYYCAGSTVASTGWCSRLRPYDYHYRGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBONIC ANHYDRASE
publication title Antigen specificity and high affinity binding provided by one single loop of a camel single-domain antibody.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Lyase/immune system
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g6vK00
3HI5L 1FQ9C 3RPKA 1MIEL 2OS7A 5E5MB 1FAIH 4XNXL 3RL2B 5JUEL 4FTVB 3UTTE 2P5WB 5SX4I 25C8L 4KJYA 1NBZA 4H5SA 1WBYA 5DF0A 5BQ7A 1H0DA 1S7QB 4IMKC 5CINL 3DGGB 4M1CD 2FX8H 4GKNB 4HWZB 3ORJA 4YBHA 1DQQB 5AD0B 4HF5L 5B39A 3C60B 1KPRB 1K8DB 2ESVB 3HPJA 4YUEH 3LKNA 2F54A 3ALPA 2ID5A 4TVSa 2V2TA 4JLRA 2ZPKL 3J7HA 1IFHH 1I3UA 1R6VA 2NX5D 1AQDB 1D3CA 3AY4A 5LWYH 5INDB 1UH3A 1VPOH 4PRIA 2AXGA 5EUOA 4JHZA 2UYLA 1QRNB 2CIKA 4OCRL 3GSUB 2R1YB 2H45A 3ARDB 1OVZA 3RAJL 1ZT7B 3QDJE 4GJTB 4X0KA 1RPQA 3IXTA 4ERSL 2F54B 4YGVA 1D9KB 1UM5L 4ORZC 4M61B 1I1AB 1X5LA 1KELH 3MRNA 4OLVH 2OLDA 4JHAH 4QXUH 4ZUSA 3QQ3B 3MC0A 3SGEI 4IOFD 2AJZB 1FN4B 3LRSA 2WBJB 1MQKL 1LHZA 4M7LT 4NM4H 5IW3A 3V6FA 3U9UA 3LKOA 5L88L 4LSPL 1TNNA 1WVZA 4FQIH 4V1DA 5I71C 3K0WA 1YC7A 1MCKA 1MCPH 2OTWA 5C0AD 5B3JE 5IVXA 3BIKB 1AGFB 2A6DA 5T1LD 4BSJA 4PJ5E 4JO1H 1JV5B 1JPFB 4JHBA 3O81A 1NAMB 4YPJA 5DK2B 5E2VH 4PJEB 1I1FB 3HCVA 1CDCA 5T33H 5F1IA 1AE6H 3W9DB 2FSEB 3U46B 4HKBA 1QEWA 4KK6C 2VDOL 2NR6C 3GBML 4CMHB 3MV01 2VDKL 3FB8A 2JCCA 2A73A 4XP5L 3QNXB 5CJBA 3FQWA 3EKCA 1U8HB 1AXTL 4FMFA 4O00A 4Q6YA 4IM8A 2NZIA 4D0DB 4PJIB 1T4KA 3IFNH 2B5IC 4FQCL 5TGBB 5A2JH 4LLUB 4JN1H 3LV3B 1UCTA 3NCBB 2X1QA 1CICA 5C0EA 4JM4L 3U7YH 2VYRE 3QBTB 4OQ1A 1CFSB 5IV2A 4YHZH 5LCVH 4Q9QH 1ZE3C 1JVKA 3EOBA 1ONQA 3PWLA 4DW2L 4GS7C 1IC7L 1ND0A 3IU3A 5ABDE 5IP4A 4WUUB 1LDPH 4L9DA 3EYVB 4MJIA 4JM2B 5TDOA 2HTKC 2EYSB 3VDAA 2V17H 1KPVB 2YXFA 2Y5TB 3L7EB 1XT5A 1T4KB 3KJ4B 5ICYB 1MAMH 1OL0A 3C09B 4U1HA 4U33A 4YDJB 1A6UL 4P2YA 5KSAA 4JQVA 4P9HH 1VFAB 5D7JD 4CN6A 3SO3B 1R3IH 2OL3H 1TJGL 1VSCA 1TNMA 1FH5L 2WWKT 4GG6B 4JG0H 1J10A 1UACH 1ZHBB 2YUXA 3QDGA 5DJZB 3D25B 3BKCL 3DUUA 3G5ZB 1ED3A 3PGCB 2LABA 1IAOB 2W1NA 3OKEB 2YC1A 3FN9A 4KUZH 3UC0H 1FIGL 4A6YB 1OGAE 3DXAD 1ULVA 3H9HA 2IAMA 1UB6A 4Y5YA 1LP9B 1RHHA 2GI7A 4N5UA 3AROA 4GW1A 4X98B 1HHKA 4YWGL 3U30C 4Y4HC 5C08B 3BDYL 1U92A 3DX7A 4JQIH 2XI9A 3O2VH 3V4PL 4ETYA 4QGTA 4JPIA 2H26B 4FQJH 2CUIA 4QT5B 5EZLA 3ZT5A 3KPQA 1S9VA 4WO4B 2VLRE 4Y4KA 1KB5B 2A6KB 3L5IA 5K9QG 2VISB 1A3RH 1NGWB 1SYVA 3WLWC 4AG4L 1CGTA 2V2WA 3ZKQD 4ODXA 4N0YH 2NPLX 1JF1A 3BESR 1KT2A 3RDTD 4ODUB 4XRCB 4UQ3B 1CXHA 4WFHE 3QULA 2XKSA 5JXEC 3NCYS 1BM3H 5BS0A 4WWKD 3ULVC 1CXFA 3KPRE 1HWGB 1P1ZB 4X6BB 1K3IA 4GMTH 1R3LA 4RWYH 4KUCD 4IOIA 4OLWL 2P5EB 1RZ7H 1BQHB 3HNVL 1RIHH 1CZ8H 1KJ2H 2J4WL 4NQDE 1WBZB 4JZOB 4OUUB 3H3BC 5FCSH 2XZQH 5B22A 1Z5LA 2UWEF 4YO0B 4BH7A 3FT3B 3MOAH 1NCWH 2WLZA 1VENA 43C9B 5T3ZH 5L0QC 2MQ0A 4JFOA 1J9CT 4GLRI 2X70A 4P9HC 3UPAA 2J12B 5C0BE 3MYZA 1CD0A 3H9SB 4P9ML 5T3XH 1J0YA 4JFZH 3S36H 1MCWW 3CD4A 1V3JA 4K23H 5I73B 4XC3L 1BQLL 2R8SH 3WFCH 5IQ9A 2X5PA 4BH7B 2W0LA 5BZDB 3UPRA 5EBMA 1KJ3H 4X4YA 2PCPA 2EIZB 2VDNH 1FIEA 2CK2A 3FRPG 3X3GL 2HLAB 3QWRA 5HGDB 2MNUA 2VDLH 4EXKA 3MLVH 4X80L 3DTXA 2AEPH 3GNML 4OZGA 4YHKL 4NQXB 1INDL 1S8DB 1WIUA 3LQAC 5SWSD 1CDJA 1KCUH 3MJ7B 1T7YA 5CSBA 2ZG2A 5JW4R 1HKFA 5E9DA 2P1YA 3MLXH 3HMXA 1SVCP 3NA4A 5I1HH 1A5FL 5HI5D 2FEDD 4L1HA 3LN5B 5MEQA 3FQTA 1KG0A 1GGIL 2NW2B 1MRDH 2YRZA 4ZAKB 5HHMD 3D9AL 4JO4H 3SDDB 2FWOA 3HZYB 3E2HC 5IF0B 1FO0B 4NJAH 5DUBB 2GYSA 3G08B 2AK4E 2DJSA 2WAHA 2H9GA 4HXAL 4F57H 3CX5K 3QH3A 4JFPB 3U1SH 5LGKA 2IH1A 4HIIB 4PJDA 4RMRA 4C55A 2ZUQB 3QI9C 3WJLA 5J13C 4OLYL 1RZFL 5EA0L 2NNAA 5D72L 1CGUA 1KG0B 2R1WA 3SKUD 4Y1AE 3U4EA 4DFHA 3NA9L 1BLNB 2NZ9C 1YNLH 4KU1A 3I6KB 4L3EA 2W9EL 2UWEE 3D5OF 3GMLB 1S3KL 32C2B 4Z0BL 3OJVC 5GGSY 2IH1B 3NIDF 3QO0B 2GT9B 3T04D 3DO3A 1FNSL 2HLFC 1I9IL 3ZO0A 2NY1D 3I6LD 5F9OL 5I66A 2A0LD 1MREH 1EAPA 3BQUD 5EPMB 1EEQA 2VO5A 4ELMA 3ES6B 4P2QA 1NBVH 3SKJH 1JNHB 3V8OA 2IMMA 4P59L 3TCLA 4NBZB 4HBCH 5DZNA 2UUDK 2WIIA 3IU4H 5T1DH 2NXYD 1E4WH 2OTUA 4OLUH 5SWQA 5J6GB 1KPUA 4LSDA 1JWSB 5E2WH 3V6OC 3O6LH 5DJ6B 5KVMC 3AS3A 3C6LB 5GS1A 3HZKB 4X7TA 5JIHA 3QUML 1G7IA 4QRPD 5F97E 3K80A 4Z7VF 1CS6A 4M7LL 3RGHA 5I17A 4K94H 4KJWC 4ODWA 1KPUB 4YHLH 1A4KA 5D93C 3CIQA 2FX9L 3IDNB 2ZKHL 1XGPA 1EEZA 3I84A 1VFBA 1QFWL 3RTQA 3SDCA 4YR6A 3SY0A 1NBYA 4F9PA 5BRZB 4F33A 3LMJH 4YHML 1G0YR 3W2DL 4LLQA 4QYOA 4KTYA 2W0KA 1LE5B 3O2DA 5FKAA 4R9HA 5KN5B 3P4MA 4MD0A 2ADFL 1FL5A 1RZIA 1HHIB 2ZOLA 3MNVA 1TTGA 2HN7B 3NACH 4NZRH 1XGPB 4B50A 4EZMA 4GQ9H 3HZVB 3MODH 3HB3C 2NY6C 4ODTH 3FQUB 1RMFL 3B5TA 3EDEA 4LLWA 5HBBA 1EZVX 3QIWD 3QFDB 2OR9H 5F9WB 1NCBH 4U05A 4PGEB 5H37G 5F71A 1FVCA 3GDBA 4KI1A 2D4FA 1PJ9A 5E1AB 3P4MB 3R1GH 3WN5C 4Y2DA 3I2CL 4KK5C 1I4FA 4IMLB 4P2RD 4YZFF 12E8H 3RVXC 3QXWA 1N59B 5HYQB 4DKEH 3L3KB 1J8KA 1G6VK 4ZFGH 1CDYA 1MJ7L 1G9EA 4P46D 4U31A 2Z31C 1QPXA 3VGAC 4XCEA 2XXMB 1H8NA 5BMFH 2LTQC 4NO0D 1A1MB 4N0UA 1OAYH 4Z8FH 5CSGA 5FM5M 5KVFL 1DUYA 1WC7A 2F9BT 4OIAA 2VWEE 2BY0A 2CKBL 4L3CA 1MF2H 3L6FB 1VGKB 2CQVA 4FNLH 2B2XH 1RURL 1G7QB 2YN3A 4YHNA 2FRGP 2HFGL 1R5WB 4PJ8D 1N5AA 4NKDB 3BOVA 1GC1H 4KC3B 2H2SD 3T2NL 5JORA 2VLKA 3QUXC 3F12A 3IB4A 2Q3AA 3CSBA 4WW2C 4KKCD 1RHFA 2J8UB 3WIIH 3QCTH 1P6FA 3GHBL 4G9FE 2KZ1B 4K71B 4FQXB 4QHMB 3MRFB 5I15H 4Z7VE 3SGKC 4GAJH 4K94C 3VW3H 1SEBB 2UZXB 5I1LA 2D31A 2NX5B 4NZTH 1BEYH 1IGYB 3MYJA 1MLCB 5DRWB 1SJHA 4XNZB 3KPSA 1QSEA 4PJGA 5L2JA 3M8OH 5IB5B 4AIOA 4M1CC 3N06B 2AI0L 1OAZL 2CLRB 1X9QA 5EWIL 4EEEA 4N90D 4GRWF 1QNZH 4L4TD 5TPWL 3C08H 1IGMH 1OAXL 3D69A 4TUJB 2IEPA 5E2UH 5D1QC 5GRUL 3ROLA 1U36A 5CGYD 3UJIL 4Y2OA 4M6AA 4LVOB 5C9JB 2WIMA 1J05A 4BQBA 1QFOA 5I75C 1I7ZA 5IB2B 5I8EB 5DZLA 5DFWH 2Z91B 4BZ2H 4YNYA 4MD4B 3KGRA 1F3JB 4G3YL 2N1KA 4KZEL 1ZVHA 4LKXA 4YE4L 3QZWA 4YZFE 1B9ZA 4UDTA 3DVGA 4M5YH 2JB6B 4P5MB 4L8BA 2A9MH 3LDBB 3UTTB 5HYJB 4AM0B 4I3RH 1K5NB 2E9IA 4OD2A 4LVHB 1EGJL 4IOFC 1PSKH 4GG8A 2ED8A 1QSFD 3K81A 4EN3B 1Z9OA 4BSWB 5LQBL 3IS1X 4KI5F 9CGTA 3TBYB 3CXDL 3X12B 3TLRA 2ICEA 3QDJA 1IKFH 2YA1A 2B1HH 4DK3A 4X7FC 1UWXH 1W72L 3HR5A 1T1YB 4OQTA 2RCSL 3GKZA 3QEQE 2FATL 1JPGA 4UIKL 1AIFB 2D9QB 1GC1C 2GCYB 4I3SL 2F74A 3LY6A 5BVPL 3V6BR 2VXQL 1IZKA 1WZMA 5HGHB 5BXFB 4DKFL 2BRRL 1ZVYA 4PRID 3OX8B 1A0QL 2GTWA 4G9DB 5CUSL 5GRVK 1CE1H 2XWTB 4KDWA 5AWNL 3MO1A 3AS0A 3CPLB 5IFAL 2DLFL 3L5XL 1S7RB 1MNUL 4IRJA 1HQ4A 2XY1A 4OFIA 5EC1B 5CEYA 3X14B 2VRAA 2WBKA 2I9TB 2QSVA 1JIBA 3I3BA 1KLFA 4O51B 2VDQL 1RZJH 4U3XA 3O3EA 3QDHA 3GHEH 5C1MB 5DJDB 2PTUA 3PHOB 2GJ6D 1HYRC 3T1FB 1MIML 2Y36H 4Z95L 1YQVL 4PJ5A 5EU6D 4JKLA 2CLVB 3BPCB 3MRJA 3JWOL 4GRLB 2BHZA 3TO4D 1VACB 4XCFL 4GRWE 1KLGB 4XVSL 5FUCC 1S9WB 2DWEA 2IPTL 2WQ8A 3HAEH 4Z0XB 3RZCC 3VD3A 5CJ5A 1QLFB 3O4LA 2HRPL 3H7BA 1FORL 3A6OA 2FHBA 3LZFH 3NMEA 5CFHA 1RUML 1IJ9A 1J86A 1RD6A 1U0QA 1YN7B 3DYPA 4U1KB 5L8KB 3ECBA 3JTTB 4MNGB 1JYNA 3MFFA 4Z7OE 3QHZL 1FZJB 1VEOA 3PQYE 2O26U 5F3BB 4M7JL 3NIFF 1DVFB 2FJFA 2SEBA 1DQMH 2BP3A 1IQWH 1KN4L 2L7JA 4WEUD 5IMKB 4UUJB 1IEBB 2AKRB 5TE4H 5D7JC 4F7EA 5LXGH 2H1PL 4P99A 1SBSH 1N0XH 4JDZA 1DSFH 2DB8A 2I25N 1BREA 1DBML 1QKZH 4CDHA 2EYRA 3IF1A 2H8PA 3M45A 2R29L 4JCLA 5H94B 1TJIL 3W0WE 3GUTB 4U49A 1HZHH 5E2TL 1A64A 1YYLH 4P0DA 5E99L 3E8UH 5ESQB 5EBWB 5C09D 2CDEA 3RL1A 3RWCA 4N8PA 1K3ZA 2GITB 1JPSH 1YA5A 4LEXH 5HHQB 3F7YA 1GAFL 2R1XB 3RU8L 1YEIH 1I8IB 4DCQB 5F1NB 5F7WC 5KZCB 3D3VB 2A2QT 4XNYL 1F6AA 3RIAF 3UTSA 1MCOH 2ADGB 3TT3H 3VXRE 5SX4H 4NC1E 3VDCA 4HQQH 1C16B 1EJOH 1LMKA 1MHHB 1IEHA 1P4BL 4MJID 1FRGH 4KY1H 2EXWC 4LK4A 1S7SB 3NTCL 5TF1L 3UJJH 1TVDA 4MJ5B 3V4UH 3MBXL 5HHPA 5I16B 3F7YB 5J1AA 3KYKH 3KLSA 1RK1A 1RZJC 5KSAD 3NCJH 3RDTC 3HZMA 2F19H 3GM0A 1MUJB 1SJEB 4ZO7A 4LMQI 4WUKL 3QDGD 2VLLA 3EYOB 2VLRA 1QFHA 2YPVL 2HJLB 4OGXL 4R4ND 4WWKC 3SJVA 1JHLL 1OGAB 2VDRL 2OJZL 1J1PL 4R7DA 1UJ3A 3JTSB 3A6CL 5KJRH 5CEZE 5FIEA 1T03L 1BFOB 2A1WH 3S35L 4YDLB 5JW5B 5C0FA 5F7EH 3QXDB 1N6QL 2IAMD 4IDLA 3QIBA 3OZ9H 4R8WH 1FYHB 3WO4B 3WO3B 3WCYA 3TBVB 3NIFE 1C1EL 2EYTB 4HKZB 2BX5A 3WIHA 3LS5H 3G9AB 3MV9E 4G6ML 3BIAX 3KPRA 3SGEH 2FCBA 3AAZA 3D39E 5K59F 5A2FA 4Y4KD 5EO9B 3L7FA 4NQCE 3TP4A 3DX8A 5C0FB 3GSVB 3BP4A 1QSZA 3AMKA 1FC1A 5GRJH 1N4XH 4OM1H 5IQ7H 2Z92B 3U0PA 4GAFB 2XZCH 3VFOB 5ETUB 1S7UA 5FHBH 2CLZA 2Z35A 2KQNA 4ODHL 2R69L 4HZLB 3MLUH 3GSNH 5C2BH 4NCDA 3CU1A 1JWUA 3I75A 4YLQT 4M93B 3VFNB 5BS0D 3ZHLA 3MRIB 4UI2A 2EXYD 1NCAL 2VXTH 1DQTA 3LVEA 3LD8C 4PJ9A 3MRLA 2VTFA 3SCMD 1G7PA 1NPUA 4NQDB 4L4VA 3P0VH 1MJUH 3QQ4B 3DVNA 5IOPB 4MA8L 4Y19B 5H37H 4S1DC 4HIHA 4JFDB 5A43C 4LDLB 4CMMA 5HI5C 1K6QH 2FEDC 5FO9B 5C0BB 1X5JA 2GAZA 4OJFH 3PWJA 4KRLB 1A8JH 2ZCHH 1R3KB 3ESUF 4UINL 5ISZB 4PTTB 3MJ6A 1GZQA 4MQTB 1C08A 4FXLA 1TETL 2ZSVB 4Y5VC 3ARGD 2HG5B 1ZANH 2FX8L 5K9KB 2DQGL 4P48A 4CMMB 2IH3A 5D71L 4YUEL 5FDWB 1QD0A 5EC2B 3BQUB 1NEZA 1G7LB 4W4NA 3PWNA 2VLME 2P24A 4JFEA 2A74A 2EE6A 3X3FL 1L6XA 3QWRD 4J6RH 4WI4A 4LEOB 2AK4A 5LWYL 4NNYA 1N2RA 1N7ML 2NXYB 4C59B 3EW3B 1VPOL 2CJUL 3OPZH 1SY6H 1J5OH 3NABH 5FA4A 1ITCA 3V5HB 4PV9B 4WVRA 1K8IB 4UAOB 3BSZL 3KXFA 1LEIB 3MLZL 2HWZH 5K59E 4PJAE 4U1LA 4WV1C 1XF2B 2NY1C 2A0LC 4XBGA 5DA4A 2O5YH 3UTQA 4Q9CA 4X99B 1KELL 1HILB 4JHAL 4QXUL 4PB9L 5GSRB 2YUWA 4PJXF 3QQ9D 4HZAA 2UWEA 4UILH 4F7TB 3LPGA 2MHAA 3C2AL 1V8HA 5GPRA 4D9QD 3T0XA 4NSKA 1A7RH 4L9LC 3EYUL 4DGVL 1HHGA 4X8JA 2GUOB 2GQHA 4HWNA 1DN0B 4NM4L 4I0PA 4P3DB 1B88A 1ES0A 1TCMA 3GSXB 4FQIL 2RBLA 4KZDH 4Y1AB 3HNSH 1DLHB 3O41B 3OWEA 1II4E 4PTUA 5EO1A 3QISA 3GKWH 3Q1SH 4XCNA 3RVTD 5CGTA 4JO1L 5EZIH 1LO3L 4X5XB 3QWOB 3QAZB 4L3ED 5E2VL 3QA3B 4QTHA 2XKNA 3QIWB 1ZSDA 1YECH 1T3FA 1AE6L 1SMOA 35C8H 1Q0YH 4U1IA 3OR7A 3OTTA 4WFED 4GAGL 4HJGB 1SJXA 4KROB 5EU5B 1XGQB 5F7FA 2X4SB 3BGMB 5IBUB 1FLRL 3B9VA 1LE9A 4P2QD 2VNCA 4Y16D 4DOHB 2P8LB 3HC4L 3CFJA 3OJDA 5C0IA 2DDQH 3FB5A 2LVEA 2H6PA 4JN1L 4Q9RH 4KK9D 1DE4B 3FQXA 5ADOH 5FYKL 4F8TA 1P7QB 2N7BA 1M4KA 4B41A 1YY9D 4Q9QL 3UTZB 4PG2C 1TQCB 4Y5XB 4Z76A 4QEGA 4OKVB 3TYFB 8CGTA 1LDPL 5JZ7D 2XTJD 3BDXA 4FXKA 1B6DA 4MAYB 3I50H 4EUPA 1KULA 3MRHA 5IG7B 3X17A 2HT2D 1SYSB 1RJZB 4P46C 1N64H 2DI9A 5D70H 4PGJA 3MGOA 3PP3H 4PYHA 1R3IL 3GK8L 3OXRA 3RTQD 3SDCD 3PHSA 3T3MF 4JG0L 1WIOA 1D6EA 1UACL 1OTUC 1QO3A 4TULH 2E7CA 1FGNL 4GKSA 5F6IB 1ZEAH 2BOBB 3VMNA 1DBBH 4O5LL 4XVTH 3I9GH 1WCBA 3GSWA 2BNUA 4PJ8C 3G6JF 4S1SL 6FABH 3MRRA 1E4XI 3F62A 5T5NG 3UX9B 2H2SC 3P4LA 3RJDA 2PW2B 4OFVA 2NY3B 1JGVL 4PJBF 2Z8VC 2IQAA 4KKCC 4QHUA 4BQ6A 4QTIH 3O11B 1F11A 4I18C 1ZWIA 4JQIL 5CD5C 3O2VL 2BVQB 3LKPB 4CVXB 1YQ2A 1QBMH 4FQJL 3UZVB 2R0ZH 4JPVH 3ULSA 2FJGA 2Q1EA 3BRDA 2BHYA 5J6HB 4OCYH 4JFHE 5F6HI 1YMME 4Y2DD 5ACZA 1A3RL 3IFPA 3MLSH 1IT9H 4HLZG 3L3HB 3WFZA 4BQ9A 4OLXH 5ERWB 2UVEA 3STBA 4BM7A 2EDEA 3MROA 5E70A 2Z4QB 1EH9A 4PREA 4XBPA 1AQKH 4GW5A 4NZUH 3MCLL 3GB7A 1MVUA 4G9FA 1AC0A 5D1XB 2VZ1A 3GSRB 1O7SA 2DQEH 4JY5H 5AG9A 4ZSOB 5CGYC 2NXZB 4BFIB 2FGWL 3VU2A 1AGDB 4CRPA 1BBJB 2NY4B 4D3CL 4F7CB 1BM3L 4LVNC 4NQVB 3V9FA 5IJVA 4TSCH 5E8EA 3QXVA 4M6NL 3ROOA 1QSFB 4JZJC 2IPUK 4QOKA 2HA1A 1NDGA 3MZTA 4CVZA 1A6WH 4GMTL 5F7LB 1FNHA 4RWYL 5HYSB 4ZS7H 4PG9B 2A6JA 1KXVC 1P4LA 3P0YH 3WEXB 2E3VA 1RZ7L 4NDMA 1RIHL 2VLKD 3BISA 3V0AC 3HC3H 2XZQL 1CN4A 3PWPA 3JV4A 4K7FB 1PZ5B 4Z7VB 5IGXL 1A6AB 2DQJL 3MOAL 4RGOH 2PTTB 4PGBA 1Z3GL 3HNTL 1PD6A 3IDYC 3V52H 3E6FA 1NLBH 3PGDB 3JVGA 3IS0X 1CD1A 3HRZA 3GMMB 1OD7A 4JPKH 2XV6B 2B8OT 5T3XL 3S3PA 3S36L 1B0GB 1VADB 2FNBA 5HPMB 3T3ME 1M7DA 3FCTA 3KPSD 4L29B 3TBTB 4NN6C 2DJ4A 2X9WA 4MJ2A 2WV3A 2ADIA 3IGAA 5D1ZD 5JHDA 5EORL 4AEEA 3WFCL 5FCUH 2WLYA 3CSYA 2FR4A 4MMXC 5ALBH 5TE7H 1Y6NR 4CW1B 4PGBB 2Q86A 1AGCA 1G9ML 1KCVL 1CLOL 2Q76B 3F7PC 5EU6B 3JV6A 4HGWB 43CAA 1PKQE 3TO4B 2EH8L 1L7TH 4PJBE 1WBXA 3AY4C 2HVKA 1BOGA 2VDLL 2I5YH 2EKSA 3AREB 3OHXA 3TM6A 4XXDA 4PR5B 1IAIH 1ZT4A 2YWYA 1EO8H 3P9MB 4LCYA 4R7NB 5FXCH 3MSPA 3CSPA 1RU9L 4JGJA 4P2OA 1AGCB 2F53E 3MLXL 1KEML 3RWDB 4WHTA 5HD8C 2HJKB 4NQEE 5IFHL 2H32B 4G8FB 1CLYH 4LLDB 4ZXBA 1FL3B 4MNHB 3F7VB 3N1FC 1T83A 3V7AE 4NJAL 4Y4FA 1ZOXA 1I8KB 4F57L 2YMXL 1CIUA 1A9EB 5E8OA 3W5MA 3U1SL 3FFDA 5C7XL 2BNRB 4FFWC 3JZ7A 1HSAA 1XF4A 1WICA 4NNXA 4OLEA 3QEQB 3DIFB 5BO1L 4Q74A 3S88H 2VDPH 1CQKA 5F93C 5GGQL 5DXWA 1QPPA 5IB3B 4IRSB 5C09B 1PQZA 3O3DA 2ZNXA 4MJ6A 3QZWG 1BBDH 2OK0L 3MRDB 2W38A 2OZ4L 3D0VA 3ZYZA 2VZ3A 1KLUB 5JOEA 3KNBB 3O4OC 1IILE 3C5ZB 1KTRL 4IRJD 4MS8C 3LQZA 5DHVB 3VGBA 5DJYA 3OR6A 5FB8B 1MREL 3IFOA 3DV4A 3C2SA 4NKQB 1FV1B 1EA9C 5IR1A 5LG1A 4GXUN 2C3HA 3KLHD 3C8KB 1KOAA 1NBVL 3SKJL 3F7RA 1VFOA 3G5VB 3FKUS 2AQ3A 3QUMA 5IHZB 2HT3D 4HBCL 3IU4L 5I8CB 4M62L 5IMMA 1E4WL 4F3FB 4Q6IA 4NWTL 1CICC 5DTFA 4EDWH 4F9LA 1A6TA 3O4LD 5INCA 5E2WL 1ZA6B 2YSSA 3VGGA 3GMQB 2E27H 4M7ZC 3PQYB 2EKJA 3C9NB 4HG4K 5FYKE 3O8XA 2DQCH 4WJ5B 3W0WA 4WDIB 1OB1A 5DI8B 3B8YA 1IAKA 1YYML 3U83A 4K9EL 4ZQKA 2P7TB 1NANH 3MLTB 3QHFH 1KXQE 5HHNA 4OD1H 4DEPB 1KENH 5L7XL 1BZ7B 1YJDC 3TT1H 5KSAC 2R2EB 1HSBB 5D6CB 4G7YH 4JQVC 3WS3A 1Q1JH 5E94A 2NQCA 2Q7NA 4HEME 3P77A 4FABH 2YK1H 3P30H 1LO0H 4R3SA 2WUCH 1IGTA 4R4NC 4EI6A 4ZYKB 2YD3A 1CGSH 2BRQA 2HH0L 1J0IA 3A6BH 1XGRB 1X5IA 2XWBB 1FDLH 2IAMC 2GEEA 2X4RA 3O0RL 4Y5YC 1YDPB 4NZRL 1AXSB 1JN6A 4FQHA 4MWFA 5DMIH 3NAAL 4ISVB 4ODTL 4NHCH 4TNVK 3VXRB 1T5XA 3BAEL 1LK3H 1K4DA 3ZHDA 4R3SB 4HCRA 1VHPA 3ARRA 5HDQH 3UTSD 4XH2B 3ZTNH 3UO1H 1G7HB 3FT4B 1EUTA 2GSGA 4Y4KC 1TQBC 4HUWB 4S1RH 4BQCA 4LGRB 2HVJA 3G6AA 1UA6H 4U1NA 3HMXH 2ILLA 4JY6A 3SCMB 2X4QA 1CQYA 1YEDA 4DZBB 3CUPA 1U8OA 1ZLSH 1I8MB 1KTLB 4LQ1A 5IMOA 3WS6A 4FQHB 2AJVL 3CFCL 3UTOA 1MJJB 1HH6B 4Z8FL 2EDFA 5IHBA 3KJ6H 3RWGA 2ZSWB 3MV8E 1MCSA 3TPKA 5TQ2H 1EO5A 4YC2B 1MCJA 4FNLL 3U79A 2B2XL 2VLRD 3WFEL 4HWEH 4NQCA 3SJVD 3KPMB 4RGND 2ZG3A 4U1GC 2MCPH 2EDBA 1BVLB 3UJTH 3ET9F 3L5WA 5FM5O 2R9HD 1QRKA 3ARGB 4XHJD 3LB6D 4ZFOA 2XN9A 3UYRH 2DICA 2Y07H 5B3NA 3QIBD 3CXHJ 4BSVB 4KQ3H 5F3HA 3MV9B 3CLFH 4Z78B 1Q9KA 1TJHH 3D39B 1OAKH 5BVJA 1QR4A 3ARBA 5I15L 1R3JB 3DX6B 4IIQB 3TN0B 5JXAH 5HI4D 3MQIA 4FQQA 2BY1A 4GAJL 3MXVH 3PIQA 3VW3L 3KPRD 2J3SA 5KVGH 1A2YA 4C56E 4PRPD 4ZO9A 4NZTL 1AJ7H 1BEYL 3T0EE 1B0WA 1QUNA 3CMOL 5I9QB 1AO7A 5KANI 4ZFOB 3M8OL 4LRIC 3GJFB 2CKNA 1LD9A 3TCXA 3QPQD 2DIAA 3FOLA 1QNZL 3C08L 2ENYA 3TO2B 2ZCKL 5E5UB 3OAUH 2LU4A 5E2UL 3EBAA 3QDME 4I1NB 5KTEL 2VXSH 1MLBA 3ZDYF 2D9CA 1WT5A 1D6VH 5IESH 1T0MB 4Z7UF 3BPOB 5D2LB 1BPVA 1UZ8A 4XP4L 1V3KA 3O6KL 4PJ9D 4YBLC 4E41A 3F6LA 1XIWA 5ESVA 1LNUB 4L4VD 1EGJA 4BZ2L 1MFBH 4LSQL 5DMYA 1UB5A 1QACA 5DK0A 2BSTA 1S78D 3OQ3B 2WNGA 2A9NH 1NMBH 5DUML 3TBWB 4M43L 1AKJB 3LEXB 1IARB 1A6ZA 2Y06H 2A9ML 5C0GA 4LGPB 1M1SA 1KYOK 1NMCB 1YPZF 3MUGA 1W72A 4J1UA 4QHNB 4HLZH 5FYJH 1PSKL 5DJ0B 1EXUA 5JNYA 1MY5A 4ZUUB 3O2DH 3VXSD 1W8OA 3BP6B 1D5XB 1CD8A 2NLJB 1J0JA 1OY3B 5IK3B 5EU4A 1LGVA 5DS8B 3SDXF 1G7MB 3L3DA 2EH7H 2L7UA 3WJLC 3BEWA 4UQ2B 5FF6B 4XGZB 2JJTA 3VFSB 4Y16B 2F5BL 3WFHA 3D2UB 4JFED 3OKLA 1TFHA 5I1DA 2XACC 1EXUB 3MA7A 1T0NA 2YEZA 2P47B 5ENWA 4PJAB 4AIZA 5DSCB 1HXMA 3KXFD 2DYPB 2JB5H 1EHLL 3HPLB 4AL8L 1AP2A 3GHEL 3HS0A 1MHEB 3HA0A 4HIEB 2Y36L 5ID0A 1XF5A 4N5ED 3LPWA 5FGCB 1WFUA 5TH2B 4WU5B 2VE6B 2LU3A 5J12C 4KK9C 4WTZG 5FYKU 1UKQA 3BGAA 5KSBE 1YY9C 3FB7A 1QR1B 4I0PD 3QG7L 2E7HA 5HVHB 1XH3B 4Z7UE 5GS1C 4HK0B 5JZ7C 3DARA 2XTJC 3ME0A 1D5MB 5DMKB 4NQTA 5I8OL 2VUYA 3PHQB 1DQML 4YIQB 4JDVB 2BOCA 4DAGH 5HDLA 3AMLA 2EDQA 2HT2C 2AEIT 1I9JH 2BSSA 4XVUD 3DRQA 1EFXA 4X8XA 1NFDE 1WCQA 2Q8BH 2J8HA 5TE4L 5DQDH 4PP1D 3STLB 1TIUA 2XNAA 3RTQC 1N0XL 3SDCC 3CJJA 4F9PC 1ZXQA 3RKDC 4OBSA 5E08H 1UADC 4W68A 3THMH 2NTSP 3OL2A 4FXGA 5F7DA 3T1WA 2O61A 2QQNL 5E4EC 5DJAA 1HZHL 5JW4N 1YYLL 1WEJH 3BH9B 3RWFB 3LKQA 1JGLH 2YD1A 3MRGA 3VXUB 5FUZH 3SDXE 2PO6B 5D2NE 3MUHL 1JF5A 2G5BA 3T0DA 1YEIL 3BWAB 4WEBH 4O58H 3GI9L 4PJXA 4JRYE 4LPYA 5GRZA 4NYLB 1FPTH 4MCZA 3DETD 3VA2C 3RWJA 3IDGA 3FO9B 4HQQL 3UPCA 4PB0H 4UDUB 3NZ8B 4KY1L 4WNQA 4Y2DC 2E7LA 3QXAB 4F7PA 2FJHB 2ZUXA 3BEVA 4I2XB 3SPVB 2E9BA 4QRSA 1IKNA 3QEHA 3L1OL 3G04A 2G9HA 4OCXH 2W65A 3KYKL 1AC6A 15C8L 5JR1H 1XR8A 3NCJL 1PYWA 3ZL4L 4E5XA 4XCCL 2DWDA 3S5LB 3NFPB 1A1OA 4NKOB 4WFFD 4LLYA 1K2DB 4MXVF 3KS0H 3F65A 3L3IB 1PG7H 4P4RA 3R8BB 3TIEA 4OGZA 1FNEB 3WYRA 1OLLA 2IFGA 5C6PB 4TTGA 1MPAH 4OQTH 4PP2B 2Z8RA 5F7EL 2I60L 2EDNA 5D1ZB 2RAMA 5C0RL 5D9SA 3OZ9L 4D2NA 4ZFZA 4K7PL 4KWUA 4EUPG 3MX0A 1KJMB 3QIUA 5KG9A 5F7HA 2NY0D 2HKHH 4JG1H 4U0QB 1YMMB 3QG6A 1T2QH 3IAPA 5EN2A 4CN1A 3U0TB 4RZCB 5LGJA 3I3DA 4NCC2 4LCCA 4LSSL 1XFPA 1MFDL 1FCGA 5GIRB 1KIQA 3PXHA 2FBJH 5GRJL 3PJSA 5J89A 2I26N 2DAVA 4OM1L 4RAUA 1IGJB 1HH9A 3QIUB 5IQ7L 5F70A 1U91B 2XZCL 3V79C 3RNKB 3TC9A 2GFBA 5I19H 4MD5B 3UXFA 5IM7A 3MLUL 1ZT1B 5EN2B 3GSNL 3QXTA 4JRXE 3NOIA 3ARTA 5EU3A 2VXTL 3IJSA 4HH9B 5H35B 1QFUH 3VXNB 4RDQF 4QOKD 3IAGC 3HLAA 3FO2B 2APXA 1CE6A 4M48H 4UB0H 1Q72L 4NUJA 4LRNH 4YHIA 4I5BB 4M7KH 3EOTL 3PWPD 4GQPH 1LO2H 5EZJB 3G6JA 1K6QL 2J5LC 1S9KC 2PYEA 1XCQB 4Z7NE 4OJFL 4PJBA 2P43B 2CRIA 2V7HB 3ZE0F 2E6QA 4CAGA 2IWGA 4NT6A 1T5WA 4YFDB 3TYGH 2C1PA 5CBEA 2X4PA 5JPMB 3JWDH 5I18H 5DQ9A 3RWHB 1TDQA 5JW4M 3D18B 1CFQB 4YDIH 1JJUA 5JHDD 4U3CA 4LLAA 1INQA 1ADQA 3TPUA 2R23B 4I48B 4NHUB 1NC4A 3CVIH 2YHGA 1JNLH 1PKQB 4FQ1H 1JZ7A 5MEOA 3B9KA 5F7UA 1E4JA 1FFOB 2P44B 1BQSA 1B2WH 4J6RL 5LAXA 2NY2C 1G0DA 4R97B 4TOYH 1J1XH 4FMKA 1MCLA 2AJUH 4X9IA 3BPLB 1J5OL 2F53B 4LCWD 1DDHA 1JUFA 4IRJC 4NQEB 3QUZB 4PRDB 4M5ZH 4PJ7F 4P2OD 5FK9A 3MCG1 1DUZA 1YEGL 5D7KE 1FVEA 3QPXL 2O5YL 1RIVH 1UWEL 2VERN 1E4XH 1NH6A 3KLHC 3UP1A 4XCYA 4ZXBD 1X5HA 2HT3C 1QA9A 5GJTH 4UILL 1FL6B 1I85A 1JGEB 3K8KA 1MCIA 4RBPK 1EEYA 4L8SB 5HGGS 4MX7B 4APQB 4HT1H 1BVKB 4D9LH 4JFYB 3CSGA 1MCCA 1FLTX 1SVZA 4AJ0A 2ATKA 4JHWL 1MH5B 2X7LA 3ZYOA 1GVIA 3WLBB 2YZ1A 1PKOA 3L3JB 1ORQB 4MCYA 3AVEA 2IALB 3PWUA 3Q1SL 4R90H 1T6VN 2DM4A 3TNNB 4ACPA 3WIHH 1X6NA 3ILPB 1AGEB 4S2SB 1I9EA 3RWEA 4DVRL 5L6YH 4YK4C 2L4OA 4R2GB 5GSVB 1JZ5A 1F45A 2ICWB 4X6CF 5IEHA 35C8L 1JTTA 3HE6B 5J06A 4BFEA 3ZE0E 2X7LB 4J3SA 5FGSA 4ORGA 3PNWA 1XGTB 2JF1A 4P23D 5I1JH 3OXSB 1AD0A 3KPOB 3B9EA 2APFA 4RQQB 3JWDC 5IMLA 1Q9LB 1AFVL 5ID1B 1M7IB 1SM3L 1KV3A 4M1DL 3P2TA 1QYGH 1XF3B 5DJ8B 1IC5L 3DNKA 4S11A 2DDQL 4QXTB 4Q9RL 3IRPX 3W39B 5ADOL 1MIEH 3K2UL 3O9WA 1LO5A 3HG1B 4MMZC 2GSIB 2JIXB 5DURB 2GJZB 2C7UB 2X89A 1CBVH 2Y6SD 1XZ0B 3MFGB 4AT6B 4DUXA 3AS2A 5K9JH 4G7VH 4QXGH 3O8XD 3W0WD 3CDFA 3WNKA 4KI5D 5CINH 1YZZA 5FOJA 4U1SB 1A1NB 1U3HD 2CK0L 3SE8H 3U9PH 3UZQA 1AR1D 3EOAB 3KPLA 1QFPA 1RFDL 4PJ7E 4TUOB 3DURA 5CHNB 1KIPA 3N50A 1RUAH 4JGMA 4ZDHA 4NN5C 2C4FU 4F2MA 3OF6A 4ZUTA 3ARFB 1Q9OB 3DBXB 4MDJB 2ERJC 3LEYH 4UOW1 3BP7A 1A7NL 1ZEAL 4PRPB 4OCRH 4RGNC 5BV7B 3BGFC 1FGVH 4HAGA 3WE6B 3Q3GA 1OARL 1UJ3C 4XHQA 2BMKA 3I9GL 3HI6L 3Q5TA 2R9HC 4CKVX 5CEXA 5GS2H 4TSAL 4XHJC 4ERSH 4WI8A 1UM5H 2C5DC 3QIBC 1ROWA 1H5BA 4N0CC 1CXEA 4YPGA 3BW9A 3SKNA 4U7KA 2Z8SA 5C0JB 1LEGB 3TJEH 5JLZB 2Z8WC 1W0VB 3O6MH 3FT2A 3WNOA 4OF8A 5AG8A 4OCYL 2YWZA 3SKOB 1MQKH 3WL9A 1P4IL 3MLSL 5L88H 4LSPH 4WRLA 4XPTL 3BWUC 4OLXL 1DQDH 1T1WA 2B0SH 3QQNA 1R3HB 3HE7B 4OGYH 1NGZA 3QPQC 3MJGX 1AQKL 4NZUL 3MV8B 4B53A 4Z7WE 1F97A 4N1HB 2ARJB 1MHCB 2FHCA 2OQJB 1ZHKB 2DQEL 1N3NB 5GGSB 4NOBA 1NAML 5DJCB 4HMCA 4C57C 4NRYA 2XTLA 4HW6A 3T0EA 3VRIB 5LKNA 4OV6F 2YBRB 1QLRA 2CDGB 3MXWL 5K9OA 3IVKA 3QEUB 4PJ9C 2XT1B 3B2VL 2QQKH 1OLZA 4WU7A 3VXSB 1U93A 4ZS7L 4H26A 2APTA 4JY4A 4MA3A 5HHVL 5I1AA 1S78C 2XN9D 4QRTB 3HI1B 4XP5H 3QNYA 4ZUVB 3HC3L 3QDMA 4MXWH 1Z6JT 3IJYB 4C56B 2ZUVA 1FNLA 2XFXA 3ARBD 1NLBL 3KPNB 2VAAB 5I1GL 3IVKB 4A2LA 4W81A 3RIFF 2XZAH 4JREB 3OKMA 4P5TA 3V6OA 5C0ND 2PW1A 4DW2H 1IC7H 5HJ3A 1AO7D 2QSTA 5D7LE 4JJ5A 3ZDZE 2XRAL 4RMQA 5F9JA 1ACYL 5ALBL 5TE7L 3EO1B 1CFTB 5MENE 5DRNB 3SHSA 5I0DA 4JKPH 4PRAB 1L7TL 5D6DA 3LSOA 2CRMA 1UH2A 2I5YL 2J7LA 2KZWA 4BH8A 3C5SB 5EU7E 2ZWLT 4E41D 1XIWD 5B8CA 3BKCH 4EUPH 3TZVB 3BVNB 5IB1B 2I9LB 4A6YL 1AHWA 1FIGH 1DBJL 1YEJL 3MRPA 1CLYL 3EDDA 3QUYA 4N5EC 1B4JH 3LKSB 1WF5A 3SKMB 4YWGH 1YEKL 2G75B 1W0WB 4MAUH 3O45A 4X7SH 4XNMA 5JPNA 2HT4D 4OZFA 4ODSH 1KB5L 5DMGD 3MACH 2OZ4A 4I0PC 4PRBA 1CGYA 5FKPB 1O5DT 3MOQA 4EI5B 3QT2A 4P5KA 4Q7DA 2FIKA 4G8GA 2P8PA 1CCZA 1QLEH 3ULUF 1BFSA 5EIIB 4EIGB 2A6IA 1MRCH 4C58B 3BRFA 1FE8L 3CFEB 3FHQA 3V5KB 4QF1A 1WAAF 2ICWI 4PP1C 4QHKI 4IRZH 1YEHH 5GGRA 4Z7UA 3MJ9H 4IDJL 2X4OB 1ZLUH 5ESAB 1HHJA 4G43A 3F5WB 2IBBA 4V2CB 1TQCC 1OQXA 2H3NB 3RGVB 3WXWL 2IJ0C 2ZP0T 5IBTH 3V6ZA 2FEEI 4PRHD 4O2EA 1HQRA 1JGDA 1X4YA 5DHYB 1Y0LA 3T65B 2J4WH 3S4SA 1CFNA 5MHSD 1L0QA 3PWVB 5DJ2A 3OKNA 4GUPB 4MLSA 1Z9LA 2BCKB 5KSBB 3RHWF 3KS0J 3U82B 4JAMA 4D0BA 3Q48A 1YPZA 4BZ1H 4PPTA 2XWJA 4G80B 3TVMB 4G8IB 3DX9A 4PJEF 1KIRB 1VGEH 1I1YB 2AABL 3FB6A 1FYTA 2KKQA 1I3GL 4MA1B 3PV7A 4HV8B 3V2AR 3K74B 1TZIA 2DQCL 4FTVE 2P5WE 1HWHB 3EFDH 1WSST 5F9AC 4XC3H 4K55A 1QQDB 1NFDB 5ITBL 1KENL 1T66D 2YN5A 3SDXA 1CXLA 1GIGH 4KKNA 4Z6AT 4NZDA 2PETA 4QY8B 1EFXD 1MFNA 2DQTL 3PL6B 4PJIF 5TDNA 3V5DB 5KW9L 1WLHA 4M02A 4JRYA 3B8SA 1TXKA 2KH2B 3Q2CA 2ESVE 3VXPA 4XMKL 1JK8B 1FSKC 3MLRL 4FABL 2XQBL 1AGBA 1LO0L 2WUCL 3VE0A 3GNMH 3MRBB 1T22B 2BHUA 3N9GL 2DIJA 1HXYA 3VWKB 2P8MB 3IFLL 4JM2F 2Q8AL 1CGSL 3EDKA 4NOFA 5D2NB 4ZPVA 5HSFA 3A6BL 1QRNE 2JKXA 1EHNA 2FO4B 3KYNA 4L8CA 4ONFH 1FDLL 4MQSB 1NGPL 1A5FH 3VXMA 2AV7A 5DMIL 3ARPA 2NY0C 4RSVA 3ULUE 3R4DA 2VWEC 4JO3L 1XGYH 1X5AA 1FO0L 2ZUWA 3D9AH 4FG6D 5HDQL 3U2SA 1F6LL 5HGAA 5JOPD 3VE0B 3UO1L 3V4VH 4GG6F 5FYLE 1U8JA 5JW3H 2DKSA 4NRZA 1T1ZA 1WAAE 4HXAH 3P4NA 1K4CB 1UA6L 1NFKA 1UQSB 2IAND 5HVFB 3PDGA 1VB9A 2APWA 3PDDA 4N9GB 4RISH 4KKBC 1ZLSL 3U36B 1T7WA 4OLYH 1RZFH 1G6RB 5H2BB 5EA0H 4EBQL 1BD2B 3EIFA 1LP9F 2X4UA 3OB0H 5HY9B 4YEFA 3VCLA 4UZGA 2DI7A 3NPSC 1ZA3B 2OJEA 3GMRA 5DD1L 4H0IA 2E7MA 1XGUA 4YDVB 3FONB 1WWCA 3O6FB 5TQ2L 3N1QC 4LCUB 1S3KH 1DCLA 4HWEL 5CZXD 1CI5A 3K4DA 1JZ8A 1V5JA 3AU1B 3T8XB 4FHBD 3CFKB 5DHVH 3UJTL 4PJEE 3S5LG 4MGXA 2EO9A 1FNSH 3ARQA 4OCLC 4UU9B 1F00I 1S7XA 1A3LL 3HKFA 5F9OH 4M3JA 4GRWH 3UYRL 3I3EA 4KQ3L 3TIDB 1FAKT 1H15A 4P59H 2W0FA 3RRQA 1DBKH 1R0AH 4KVCL 4K3EH 3JVGC 4HKXA 4HAFA 2VOTA 3F58H 5HXMA 4PJIE 5C0CD 5JHLL 1BX2B 2GW5A 3GBLA 4MYWB 3NBNA 1GZPB 3CH1A 4KHXH 1CU4H 3G5YA 3OV6A 4LCWB 3BI9X 3RPIA 3QUMH 2FIRT 3KHOA 4WUUE 3BUYB 4HS6B 1FBIH 3H0TA 1P9MA 1EMTH 3MBEA 3OAUL 3FTGA 4JRXB 4M7LH 5B38B 3TNMA 2AW2A 5T1KB 5IESL 2FX9H 1NC2D 2ZKHH 1MI5E 4LHUD 5EB9A 1JPTL 2XPGB 5F6HJ 5KSVA 2ITCA 4OI8A 3VFRB 5ANMA 2R0KH 3GJEA 5F8RC 4YHMH 1OF2B 3LKRB 1WZ1L 3RPIB 4GG6E 2NY5L 2EICA 3BZEB 3BJ91 4HFUL 1JTPA 2ADFH 4P2OC 4TSBH 4HDIA 4JANA 3VXQB 4GAYB 4R4FL 3OKKB 1CDGA 2Y06L 4O02L 2C26A 3TNMB 3OKYA 2PYED 1NCTA 4ZXBC 1M71A 1U8PA 2YA2A 4TVPL 5F89B 2BNQA 5C71A 3M1BA 1I9RL 2PXYA 2WWKO 5FECA 1LP9E 1T83C 2VH5L 5FYJL 4H1LA 5AUMB 1RZGA 3PDOB 1KSRA 4Y4FC 3H6JA 4PLKC 3BPNB 2CRYA 3I2CH 2BSRB 5IB4B 4P23B 1F8TH 1NC4D 3ULVE 4LSRH 4ZOBA 1U8NA 4OF0A 4Y88A 5HYIA 5IIEB 3B9KD 4LNRA 5FEBA 1UZ6F 3L3GA 4M4RA 3S37X 1VKXB 4HCRH 1U8MB 1F02I 3QSKB 1R24B 2LAAA 4U1JB 3VFMA 3U7AA 4O2CB 4LPWA 3QFJE 1F4XL 1YC8A 5CEZH 5IEKA 1P7KA 4OB5H 1ETZA 1UH4A 1RURH 4KV5F 5GGUA 5A16A 3VWJA 3QNZA 4W6WB 4JR9H 2DN7A 3MMEB 3FQNA 5EFIA 1A4JA 4FFVD 3L3GB 3T2NH 1U3HB 1A9BB 1BIHA 1TVHB 1UVQA 4PBXA 5C86A 3RX7A 3GHBH 4Q6IC 1LWRA 4F9LC 2HFFA 2IPKB 2Q87A 5J11C 4PJFE 2VN7A 4M9OA 4WW1B 3V7AG 5HHOE 3CCHB 3LS4L 2QKIA 3O8XC 3GJFH 2MTPA 1G1YA 4KI5C 1TZHA 4G42A 3KLAB 3DPBA 5EWIH 3N85H 3NCCB 5L2KA 1AR1C 3Q6GL 5HHXL 1OAXH 4WCYL 1Y18A 2R4SL 2ZNWA 4DTGL 8FABA 2Q8BL 5DMJB 2VZUA 4YBQC 2DQDH 4LCIH 4NFDA 3VJ6A 4NC1C 4LFHD 3AXLB 5FYKD 3VRLF 1GL4B 4HS3B 4H0HB 3IDUA 5E08L 3BD5A 3THML 5KSUB 2LVCA 4HJJL 2CKBB 3KDMB 4G3YH 1MWAB 5SX5K 4LF3B 3KR3H 3VG9B 4X6DF 2APBA 4PJ7A 4YE4H 4EDXB 2DQFA 4JFFE 1C12B 3NCMA 5FUZL 4PY7A 4IJ3B 2ITDA 4P57A 2CH8A 3ELAT 3O9WD 4QHLB 3U6RA 1Z9SA 3MRMA 1UZ6E 3BO8B 1O0VA 2X89D 5E6IA 1FPTL 3FN0H 4PUBH 5I30L 2VQUA 5T5NF 4MB3A 4MZ2A 5LQBH 4YAQB 4HBQA 4S1QH 4PB0L 1VA9A 1V7ML 2OTPA 1YNKL 2PYFB 4HX1B 4X6FA 4DGYH 5D4QA 2X44D 4KV5E 4OCXL 2ITDB 1W72H 1YEFL 3WS6C 4F15B 4X9FA 5C07D 2AERT 2GTZB 4KHTH 3FQRB 5BVPH 4JFQA 3S98A 4PIRF 2OCFD 3OF6D 4R26L 3O3BB 5MEPA 2MJWA 5SWZB 4DKFH 5BZWB 2BRRH 2HKFH 1PG7L 5CUSH 4NPYA 4YXHL 2R2BB 2NW3B 3JV0A 2IFFL 4X6CA 4NBXB 5IFAH 3L5XH 3QRFM 2XOTA 2YXMA 1MNUH 1I3RB 1KC5L 1FJ1B 1MPAL 5CWSB 1CDHA 3HHRB 5I74B 3KYOA 4IHOA 5DUPH 1RZ8A 1MAKA 1DBAH 5GRYA 5DHXB 4NRXA 3RA7L 1MIMH 1NGXB 4ELKA 1B0RA 1YQVH 3PUCA 1UENA 2G2RB 3OKDB 2EDRA 1R5VB 2HKHL 3JWOH 4MSWA 1LK2A 2MKLC 4PD4J 1S5HA 1FZOA 3K8LA 4E42B 3ARBC 3FFCD 4XVSH 2XQYG 3DWTA 3CC5A 2IPTH 4O2FB 5DRXB 1X4ZA 5CMAB 4P4KB 1ORSA 3M07A 2HRPH 1FORH 3GSNA 5E95B 1U6AH 4X4XA 1XCTB 2FECI 4LOUC 4HKJA 4Z7WB 1FP5A 3REWA 3RP1A 2FBJL 5CBAA 1I7UB 5DEGA 5HGBA 4I8DA 4GBXA 4M7JH 3NFNA 1FNGA 4U0RC 2CD0A 5HI3C 3DSNA 2E5EA 3BYTA 5I19L 5BW7A 2J8UF 4X6DE 2K7PA 3C87A 1FZKA 1OCWH 1DL7L 3D85A 2V7NB 1WT5C 4LKCA 3T0ED 2PR4H 1PLGH 2RFXB 3SDAB 1UM4L 2H1PH 4WIQA 4GXVH 1U8IB 4DVBB 1QFUL 1XIWC 5D7LA 1A7BA 5CBAB 5EBLB 3KYMA 4N8VB 4UT6L 1GPOL 1XR9B 4JO2H 3R0MA 1WZKA 5T3XD 2R29H 4XB8A 3SEPA 5BRZE 4QRUB 4PRNB 4M48L 1UXWB 2CUMA 2FL5A 5E2TH 5E99H 3MCKA 5MENA 5IFJA 2Q6WB 1QG3A 2DTSA 3GSQB 3FOMA 3T3PF 5EIVA 3RU8H 3SGDI 4QRQA 4P5TD 3TYGL 4XNYH 2OI9B 2GIYA 2VIRA 4JCMA 4HPYH 3DGCR 4TVPE 1WFOA 4LL9A 2Z93A 5F88A 1P4BH 2QBWA 3BXNA 3CVIL 4PRHB 5DEFA 1JNLL 3BN3B 4FQ1L 4ZPTA 2JJTC 5CJOL 3VMPA 5CIPA 4OZIE 4MDIA 5C0DA 3PABB 3I02B 2VIRB 4TOYL 1J1XL 4PJHE 1B4RA 2XKUA 3W9EB 5GGTA 3JWOC 4OCNC 3FRUB 3BH8B 1CG9A 3DO7B 2R2HB 4AK1A 1XEDA 3ESVF 4OGXH 5ADPL 1EJ6A 3DV6B 3BXNB 3A6CH 4LMQE 2OSLA 2YR3A 1CDIA 3K8MA 5I2IA 1RIVL 5KOMC 3QUYD 4M6OL 5GJTL 4WGVB 1J0HA 2NY6D 3CDYA 5CP7B 4D0CB 1C1EH 1R5IB 2JK5A 3CFDA 5J56B 2ZOKB 4RFNB 1PX4A 2J8UE 3GIZL 4HGMA 1IM9A 2FH8A 2KUTA 3D0LB 1P7HL 1SBBA 4XXCA 3PGFL 2OSLB 3DMMA 1NGYB 2C3GA 3GMNB 3L9RB 4AENB 3LAFA 4Z5RB 2IBGA 3MLWH 2NX5E 1J8HB 3I85A 4G8GD 3K1KC 4X5WA 1T66C 2X4NA 3TA3B 1T89A 4DKAA 1B3JA 4OT1L 4G5ZL 4AEHL 3EYQC 3P0GB 3FJTA 5ITFA 3SBWA 1ERNA 5ICZB 2R69H 3MRQB 5D5ME 3VRJA 3IDIB 3CLEL 1WFTA 5E5MA 3IDMB 3RL2A 3UBXB 2AJSL 4FTVA 1T04B 2P5WA 5T1MB 2HP4A 4NO2B 3S3SA 5I1JL 2EIBA 1XF1A 3W81A 3QB7C 4OZFG 1S7QA 3CVHB 2IANB 2AQ1A 4DN3L 3QUXD 1QYGL 3DGGA 4NQSB 3S7GA 4GKNA 4HWZA 3T0AA 5GZOD 3UYPA 1DQQA 3BP5B 5AD0A 3C60A 1KPRA 1K8DA 2ESVA 1WISA 3EOYG 2K9UA 5F1SA 4FG6C 4UINH 1CBVL 5HYJE 2DQIH 5I8KL 3ALXA 1LVEA 3MRCB 4XP1L 2I07B 1FYTD 1AQDA 1QZ1A 2RIKA 5K9JL 4G7VL 5INDA 4QXGL 1KIUA 1TETH 5SV4A 3TWCL 1QRNA 4IS6B 2E7LC 3FAXA 2OMBA 3GSUA 2R1YA 3MJ8B 1JHTB 3ARDA 2DQGH 1IKNC 3SE8L 3U9PL 1JF6A 1ZT7A 4LQFL 5D71H 1ZK9A 4J3XA 5D1QD 1D9KA 3KG5A 1RUAL 4TYUA 4M61A 1I1AA 3G6DL 3X3FH 3S4SG 4GRMB 5D96C 3RNQB 3QQ3A 5L9DH 1N7MH 3LEYL 2CJUH 5CZXC 5IBLD 2AJZA 5C0CB 3RWIB 1FN4A 1ADQH 1FGVL 5FUCE 1JTOA 1T0PB 2WBJA 3BSZH 2OR8A 3MLZH 5JOFB 4XMPL 2DTMH 1NJ9B 3ILQC 3H42L 4KUCF 5D7SL 4WI5A 5I71B 2AJ3B 1KB9J 3S34H 3VXMD 1JYWA 1PFCA 1E27B 3QIUC 2IADB 1I7TB 4PB9H 3ARZA 3GMOB 3WHE0 3TF7C 3BIKA 3IDJB 1AGFA 2VL5B 4ZTOL 5EOQH 3C2AH 3E1F1 3TJEL 3QJFB 1JV5A 5MERB 1AD9B 1JPFA 1NC2B 3O6ML 3VI3F 3EYUH 1NAMA 4LHUB 5DK2A 4DGVH 4PJEA 4LCCC 1I1FA 1AH1A 3W9DA 2FSEA 3U46A 4ZFFB 5IWLA 1DQDL 2B0SL 5B4MC 1UM6L 2BXYA 4OGYL 3Q5OA 4MNGE 3QNXA 1C5DB 1U8HA 5GS0H 1ZVSB 3IXAB 1LO3H 3BE1H 4OI9A 4D0DA 2B5IB 4PJIA 2MCG1 1OWWA 1KTDB 3DXAE 3OKOB 1NCUA 5TGBA 4LLUA 3LV3A 1S7TB 2DQUL 2DLEA 1CFSA 2QQKL 4GS7B 4GAGH 5IKCB 4U6YB 4WUUA 3EYVA 1FLRH 4JM2A 2EYSA 4OCSL 1KPVA 2Y5TA 4MXWL 3L7EA 3P3YA 3HC4H 5ICYA 1G9NL 4YDJA 2D7QA 2R0WL 2XY2A 3RZCD 5FYKH 2XZAL 5FYJU 3DI3B 1VFAA 3ZE2F 4PGDB 4LIQE 4GG6A 3REVB 1ZHBA 4UNUA 5DJZA 3D3VE 3D25A 1WITA 4ESKA 2M8XA 1C8PA 2HFEA 3G5ZA 4MQ7B 2VZTA 3A67H 3PGCA 2YZ8A 1IAOA 3OKEA 1EIBA 4LP4A 2QSCH 4FZ8L 3MBED 1MI5B 3VI4F 4A6YA 1YEEH 3B9KC 2J8OA 1HDMB 3RY4A 3WNLA 1IGIL 1OSZB 3C8DA 1LP9A 4JKPL 4W6XB 2FYYB 3GSOB 3GK8H 4X98A 5FV1L 3U30B 4Y4HB 2FZ3A 5C08A 3T77B 2X9YA 2V2XB 5C6TL 3WUZA 1FGNH 2H26A 2HFEB 4QT5A 5B38G 2EDJA 1Y6KR 3VI3E 4O5LH 4WO4A 3SE9H 3GRWL 1KB5A 2A6KA 4JZNB 2VISA 3MV7B 1NGWA 4S1SH 1RJYB 4FFVC 3ZYJA 4HIXL 1JGVH 1B4JL 5E24E 2BNQD 4YFLF 4XAWL 2PXYD 4J8RB 2FZ3B 5CKAA 1I85C 4MAUL 4ODUA 4X7SL 5CD3B 4XRCA 4ODSL 3B6SB 4UQ3A 1XMWA 1ZS8B 3MACL 3QCVH 2EXWD 1EPFA 2QSQA 2RR3A 5ACMA 4GKZB 3I6GB 3SE4A 1P1ZA 5DLMH 1CXIA 4X6BA 3STZB 4DZ8B 4HEPG 2YD4A 1QLEL 3RUGB 3OGCB 4X6EB 1D5BB 1MRCL 3MCLH 2P5EA 1BQHA 5SWSE 3QFJB 1C5BL 1WBZA 4JZOA 4OUUA 1CLCA 3VXTB 2CXGA 2N56A 4YO0A 1IQDB 1JZ3A 1BHGA 3FT3A 2FGWH 2F58L 5L0QB 4D3CH 4IRZL 43C9A 1YEHL 5DJXB 1LEKB 5IUSA 3MJ9L 3UCRA 4MQXC 1J87A 4M6NH 2OL3B 1MJ8L 5LBSL 3VWJD 3NGBC 3ZE2E 2CIIA 5HHME 4H1LG 5MI0C 3H9SA 5IBTL 4AQOA 4QCIB 1FG2A 4JVUA 3U0WH 4J4PA 4OIIH 1CL7I 5A2LH 2AK1L 4HS8L 4QKXB 5IGXH 3NN8B 5BZDA 2DQJH 4Y19E 4PJFB 1Z3GH 3HNTH 2EIZA 4JFDE 5C07B 4BZ1L 5HHOB 3O9WC 3VI4E 2ZJSL 1P84J 1VGEL 2VLJD 4HSQA 2CIIB 2HLAA 5HGDA 1ZTXH 5ISZE 2EIDA 3H2WA 2RGSA 4M1GL 3EFDL 1FG2B 4NQXA 4LRIA 2EECA 1S8DA 5EORH 2W60B 4RFEB 5A1AA 2BFVL 3MJ7A 5L2KD 3WSQL 1GIGL 3B3IB 1OGTB 4RDQG 3L3OB 3VFPB 5DYOB 3FO1B 1G9MH 1KCVH 1CLOH 1I7RB 5DDHB 3I6LE 3LN5A 5DC0A 4XNQB 2EH8H 2NW2A 4ZAKA 3FFCB 3E2HB 3O3AB 3IJHB 3SDDA 3DRTA 3HZYA 2AEQL 5IF0A 1FO0A 5MP6L 2QQLH 5DUBA 1KNOB 3G08A 1L7IH 4JFFB 4NO5B 3SQOL 1CLZH 2BC4B 4JFPA 1RU9H 2RJMA 4S1DD 4UTBH 1KEMH 4ONFL 4HIIA 4YH6A 3QI9B 5IFHH 5J13B 3G9VA 1H5BC 2VAJA 5E8NB 1FFNB 1C7TA 4J23A 5LVEA 4X7EC 1XGYL 1KJ2B 1BLNA 3DRTB 5E6ID 3V4VL 3OGOE 1WWAX 4QRPE 5JW3L 3I6KA 1HEZB 5F9DC 3GIVB 3GMLA 2YMXH 32C2A 4YDKH 3MR9B 5C7XH 2D7NA 5JIPA 1UCBL 3QO0A 4RISL 2GT9A 5BO1H 5BJTB 5GGQH 1OM3H 5EPMA 1U9KA 4TTDD 3ES6A 1P5VA 1JNHA 4OZFH 4WENB 2OK0H 1OW0A 3T0EC 2EDYA 2OZ4H 2QADC 1TMCB 4ZODA 2BSED 3LRHA 3LPFA 5J6GA 1JWSA 1PAMA 3B5GA 3SOBH 5CZVL 5DJ6A 3C6LA 3HZKA 5CGMA 1ODAA 5EUKB 2V5TA 2Y7QB 4MHHI 4G6JH 1VEPA 3EUUA 5E6ZA 1DBKL 3MZGB 4M62H 1R0AL 3WUWB 4BZYA 4K3EL 2Q7YB 4YQXL 2WQRA 1G7JB 2VABB 3F58L 4FS0A 4NWTH 5D93B 1G9MC 4UIMB 4DOHE 1KYOJ 3V0VB 3VXOB 3HR6A 3ARUA 3IDNA 4P5TC 5JO5B 4L8DB 3ZTJG 2NYYD 4G6FB 4KHXL 1CU4L 1KN2H 1RY7B 2VITB 5L8LB 5BRZA 5I1EL 5ILTH 4CGTA 2VR5A 1YYMH 5ICXB 4K9EH 2EC9T 4X6DB 1LE5A 1HI6B 1MCDA 2FLRT 3WXVL 1FBIL 5KN5A 5L7XH 1IRAY 1EMTL 2DM7A 1RZKL 1HHIA 1WQVT 4L3AA 2HN7A 1S9YB 5HVGB 3D85D 2GY7B 4HUUB 2VSCA 2NY6B 4H8WL 2D4DA 3HZVA 5D6DC 4D9RD 2DMKA 3FQUA 1OT1A 3QFDA 4LBEB 2R0KL 3KWWB 5D7LD 4PGEA 5B8CC 3RJQB 3MNZB 1B90A 4X4ME 3WD5H 2FDBP 5E1AA 3WN5B 4TPRH 4WI3A 1AHWC 2HH0H 2YPLB 2DBLH 2NTFB 2V5RA 4IMLA 3MLYL 4K3HA 1DEEB 1H3GA 5F7NC 1N59A 4FN0A 5HYQA 3L3KA 4QRRB 3T4YB 3O0RH 1LQSR 1ZKAA 2VQTA 2BVOB 2Z31B 3VGAB 4DUVA 2W07A 3QUYC 2V5SA 4G6KH 2LTQB 3NAAH 3VGFA 1VFMA 4Z77B 3OAZH 1HCFX 1A1MA 3BAEH 4UNTA 5EO0B 4N0FB 4N90E 4L4TE 4KRMB 3L6FA 1ZMYA 1VGKA 4MNQD 1ZHNB 3WHE1 4CNIB 3C6SB 3AB0C 1F8TL 1G7QA 1Q9WB 4OZIB 4LSRL 1G6RH 2AJYL 1R5WA 4HGKC 2G60H 3FN3A 1NUFA 2AJVH 4NKDA 4PJHB 3CFCH 4I4WB 2BVPB 3QUXB 4HCRL 3Q0HA 1AI1H 1T20B 4WW2B 2J8UA 4EQ3A 3K3QA 2DKMA 5DK3A 4ZTPH 1OTUD 5CEZL 4KRPD 4FQXA 4OB5L 3MRFA 4QHMA 4S10A 3WFEH 4ZSOE 4BJLA 1SEBA 2NX5A 1UWXK 3P4OB 3UZEA 1NUNB 1A7PH 1IGYA 4MA1C 1MLCA 4JR9L 4RAHA 5DRWA 3TBSB 1YY8B 3QJHB 1QSFE 1NCNA 4OD3L 5IB5A 4K9EC 5GZOC 2CLRA 4NZJA 3UDWA 2M2DA 2DD8L 2BVUA 5D1QB 4TUJA 5CD5D 2IGFL 1IM9D 2EDTA 1VESA 5KAQG 1PY9A 4HUKB 5C9JA 3DMMD 3CMOH 5I75B 4ZFOL 2OYPA 2OP4L 1YMHB 5IB2A 5I8EA 4KQ4H 1JGUL 1GHFH 2Z91A 4AH2B 1OPGL 4MD4A 4PRIE 1VERA 1F3JA 3N85L 4YXKL 5D5MB 1TVBB 2WMPA 2ZCKH 3B83A 5D7IB 1ZGLB 4NKMB 5KTEH 3BHBB 2JB6A 4P5MA 2FLBT 4L5FL 3VGEA 3P9LB 2DQDL 1NCCL 4LCIL 4U6HB 3UTTA 5HYJA 3KPPB 4AM0A 2B20A 2GJ6E 3IKKA 3WHXB 1K5NA 1N8ZB 5EG6C 1E0OB 4Z7OF 4OSUH 1N6UA 5EU6E 3B5HA 4XP4H 3O6KH 2P5WD 5IBLC 4YX2L 2OXGA 4EN3A 4BSWA 4LSQH 3U48A 3TBYA 3KR3L 3X12A 5DUMH 1OP3H 4M43H 1KTKE 2HYMA 1GYAA 3X13B 4UNVA 1GOHA 5DA0B 1U8LB 1T1YA 2ESVD 5C0AB 4WWID 4ZUWB 2XYCA 5T1LB 3GMPB 2A83B 1AIFA 2GCYA 3LIZL 5CAYB 4I13B 1NKOA 1MRFL 5FDYA 4OZHB 2WINB 3FN0L 4OKDA 4ALAL 4PUBL 3AS1A 5HGHA 5BXFA 4S1QL 4UMGA 4LGSB 3OX8A 1DANT 4G9DA 2XWTA 3P73B 4DGYL 4JE4B 4PV8B 3CPLA 1S7RA 4HWBL 3ARDD 1OT2A 5ELIA 2FX7H 3KVQA 2AV1B 5EC1A 3X14A 4GW4B 2IF7A 1ZGLM 1JWMB 2I9TA 3QUKA 3L95B 2I27N 4O51A 1NLDL 2BNRE 3MREB 2F54D 1DP0A 1D9KD 5DJDA 4OFDA 3PHOA 1RUQH 3T1FA 3VFUB 3WKNA 4GT7A 4PGCB 4H1LH 4KHTL 2F5BH 1PDKA 4UTAL 1I1AD 1CYGA 1F4AA 2JCCE 5FO7B 3M17B 2AXHA 2CLVA 3BPCA 4GRLA 5C09E 1UGNA 1VACA 4AMKL 2HKFL 3U7WL 1KLGA 3LN4B 3RZCB 1Q0XH 5FA3B 1S9WA 3CZFB 4Z0XA 3MV11 1QLFA 5IVZB 4WI6A 4HHAB 4RA0C 3GGWB 2WBJD 5DZOA 1YN7A 3QUKB 4U1KA 1EHLH 5DUPL 1OP5H 4AL8H 3JTTA 4MNGA 1DBAL 1L0XA 5HD8D 5GXBB 3H9YA 4NP4H 3LEVH 1FZJA 4H88H 4IOSD 4NCC1 4OTXL 4ODVH 5F3BA 1DVFA 2HJFB 1EAJA 3DROB 3PV6B 4MJIE 4XZUB 4R96B 5JQHC 2N7AA 1EEUA 4WI9A 1F13A 5IMKA 4UUJA 1MCNA 3VGHA 4PJCB 4HIJB 5DVMA 1DZBA 5D7JB 1IEBA 2AKRA 4ZOEA 1S9XB 3LQMA 5TDPB 2UV3A 5CJQH 1U6AL 2PNDA 3QG7H 4FFWD 2UZIL 1F42A 5FOBB 1FFPB 5JA8B 2VZOA 4V1DD 2X4TB 5I8OH 5H94A 3GUTA 5ESQA 1P9MC 2GK0B 3DXAB 5EBWA 3MBEC 2YKLL 4F7MB 4H25B 5C8JB 1OCWL 2GITA 4KMTL 5HHQA 2PR4L 1PLGL 1W8NA 2R1XA 3JUYA 1M05B 4GXVL 1I8IA 3GZKA 4DCQA 5F1NA 3Q6FB 1NCDH 3D3VA 5J8OA 4MS8D 2ADGA 4JO2L 4NO3B 4OFPA 1U8QB 4RGMC 2QQNH 1C16A 1MHHA 4KKAD 4WUUD 4JM2D 4YHYC 1RJLB 1F3DH 1S7SA 4RRPA 4MJ5A 4KJQD 1HHHB 4C4KT 1MFEL 5I16A 1MEXL 4YHPB 1UWGH 4XPGH 2V6HA 2PXYC 3RDTB 1CICD 1TZGH 3D1MC 3GI9H 1OD9A 3QP3A 5D2LF 4HPYL 1MUJA 1SJEA 1MFCL 4CVWA 3DUSB 5TE6H 1QP1A 4U1MB 2E7BA 3EYOA 4WWKB 3HAEB 3DHJA 2HJLA 1MFAL 1I75A 1OGAA 4C83B 5BS0E 1KGCD 3JTSA 4JKWA 1KCSL 3L1OH 4XTRD 1BFOA 3R0NA 15C8H 4XPAL 5JW5A 3QXDA 1AXIB 3ZL4H 4XCCH 3LRGA 3TBVA 4XP9L 4XPHH 5DRZB 3GBNL 5C08D 1I3VA 4HC1L 2EYTA 3FMGH 4HKZA 1KFAH 2P49B 1X5KA 2VLJB 1FFQA 1FFRA 3VWJC 4WO4D 3VFVB 5EO9A 4QLRA 1L6ZA 4E9LA 3GSVA 2I60H 3G5XB 5C0RH 3ZTJH 3CXHK 4U7SA 4K7PH 1RK0B 5GJSH 5I76B 2D03H 3ZZ1A 1CGWA 2Z92A 5FGBA 3VFOA 5ETUA 4LSUH 2QHRL 4U3HA 3VH8B 4FQPA 4HZLA 1HCVA 4PJAF 4LSSH 3VFNA 3MRIA 3LD8B 5I6XC 1U3YA 1MFDH 2YPKB 3MLWL 3CDGB 2AXFB 5IVOA 4NJ9L 5SWSB 4NQDA 3H3PL 3QQ4A 5DFVD 1GXEA 3ARSA 1DQLL 5IOPA 2P5ED 3EYSH 4Y19A 3E3QE 5E6YA 1RIUH 2HMIC 3SE3A 1A21A 4JFDA 6CGTA 3PP4L 3HUJB 5FO9A 5C3LD 1P53A 4J3TA 5C0BA 1JRHI 1QVOA 3CFBB 5HHMB 3BFOA 1L9NA 1R3KA 5ISZA 1RUKL 4PTTA 1MHPH 4RFOH 2CDFB 3H9SD 5D2LE 4D9QE 1E28B 2ORBH 4Y5VB 3ZSSA 5KOVC 2X2YA 3CX2A 2ZSVA 5CJXA 1JYXA 1Q72H 2W9LA 2HG5A 4JRWA 4RMUA 3ZKXC 4J4PD 5K9KA 3EOTH 3FAWA 3VA6A 4DQOH 5KVDH 2UZYB 4HFWB 4HUXB 2CXKA 2GHWB 4LPCA 4PJDE 5FDWA 4LLMB 2ATPB 2K3TA 5EC2A 1QVOB 2C3VB 3BQUA 2VR4A 4MB5A 1G7LA 4F37K 1GCFA 1NL0L 1BQHG 2DQIL 5E6IC 4LLVB 1TPXC 4LEOA 1BIIB 2MQCA 4POYA 1MAJA 2OX5A 4URTB 1BZ9B 3VFWB 4BYHA 3V5HA 1YNTB 4PV9A 3RVUD 1K8IA 1LEIA 4WV1B 1I1CA 4WTZA 1S7WB 1U58B 2NY1B 2ZUUA 1XF2A 4WFEE 3LCYA 3WJJA 1UXSB 3DYOA 1X7QA 5IHLB 4X83A 4TTDC 4X99A 1YUHB 4OIBA 4XBEH 1DQJB 1HILA 2L0DA 5E8DL 5GSRA 4BKLB 4P2QE 4F7TA 5L9DL 4QXWA 3SDDD 4FA8A 4L9LB 1ADQL 4RAVB 2GUOA 1HE7A 1DN0A 2VKXA 1U2CA 1CVRA 1FZMB 4P3DA 4Q0XL 4EVNA 1NDMB 5E9DD 1ZLVH 3PP3K 5CIPH 2DTML 3GSXA 1YEGH 3QPXH 5TJWK 4Y1AA 3S34L 1X7QB 1UWEH 1DLHA 3O41A 1U95B 2XTJE 2DM2A 2EDXA 4QRPB 5GGTH 4Y7MA 5E00B 2DL2A 5EOQL 4X5XA 5FGCE 3QWOA 1NMAL 4RMVA 4CVUA 3QA3A 4EVNB 4OV5B 4DN4L 2NYYC 3QIWA 1FHGA 4JHWH 4HJGA 5CSZA 3EGSB 3MGTB 4LHJB 5EU5A 4GBXC 1HN1A 1XGQA 5IW1B 1TLKA 1IEAB 1IGFH 2X1OA 4LDEB 2X4SA 3BGMA 4GOSA 1T80A 5GS0L 5BW7C 1MCWM 1RI8A 4OAWB 4PBVC 1IMHC 3MRKB 3BE1L 2P8LA 2FD6L 2C1OB 4DVRH 1HOCB 4JDTL 1INEL 1DE4A 5JDSB 4M6MH 4BQ8A 4HUVB 1BFTA 2RHEA 1P7QA 1VEMA 4ZO6A 1P2CB 3UTZA 5CSZB 4RNRB 2FGZA 3C6LD 1BP3B 4MNQB 2UY7A 4Y5XA 3S96B 3T4AB 4OKVA 3TYFA 2FEEL 1AFVH 1KCKA 1NFIB 4IEFB 1BJ1H 4P2RB 1SM3H 4MAYA 2W0PA 4M1DH 4D8PB 1D5ZB 2VZVA 2QR0B 5IG7A 1FVDB 4B5EA 1MOEA 1NQBA 1W2KT 4P46B 1SYSA 4OZ4B 1RJZA 1IC5H 4OUOA 5LGHL 4GMSH 4NO0B 3VXUE 3CDCA 3K2UH 5DQJB 1CDUA 5EU7C 3QO1B 3HN3A 5HDBF 1S7VB 3P40A 4GLRH 1PEWA 1T1XB 3IKCB 2VXUL 4JN2B 5DVNA 2CR6A 4N0UE 4X4MA 4TUKL 5BRZD 3EDJA 2DIBA 4UV7H 3A67L 2BOBA 3IT8D 5IHUH 2CK0H 4K8RL 1IZJA 4PJ8B 2QSCL 1BWMA 3GRWA 1YN6B 1YEEL 1OP9A 1RFDH 4I2XE 2PW2A 2V5YA 3OAYH 1U42A 2IBZY 3J8F7 1C5CL 4GSDH 2EDHA 4RX4A 2YRPA 4G8EB 5JMRA 1A6VL 3O11A 4TVPD 4I18B 1JHKH 2O5XH 1HYSC 1D5IH 4HXBL 4KRPC 3RKDD 2WP3T 2BVQA 3LKPA 4CVXA 5FYJD 5BV7L 1A7NH 4PGZA 2J2ZA 1IL1B 1JNNH 1PGRB 3SE9L 5J6HA 1OARH 3INUL 3HI6H 2ZUYA 3C5JB 3X11B 3ULUH 1TCRB 4TSAH 2EEAA 3L3HA 4AYFA 5ERWA 3T0VA 4E0RB 3KPSE 5FO8B 2Z4QA 3ETBF 1M6OA 4L4TB 3EO0B 5KS9B 4M8VA 5D1XA 4ZNEE 2DMCA 1KF9B 3GSRA 4ZSOA 4BFIA 2A77L 3QCVL 1AGDA 1RVFH 1BBJA 4LVNB 4F7CA 4XXCC 4NQVA 3DMMC 1P4IH 1KCRH 3BZ4B 4JZJB 3MJ9A 3RZWA 1QSFA 4XPTH 5DLML 3R06B 1QHOA 5HYSA 4PG9A 1M6OB 1T21B 3WEXA 1T89C 2MSPA 5ALCH 1PG7W 4CU6A 1JMZA 4K7FA 1PZ5A 1J0ZA 3SBWC 4Z7VA 1A6AA 1NAMH 3IDYB 2BK8A 2PTTA 5DD6A 2C4XA 4WFGE 1EERB 4FQXD 2IG2L 3PGDA 3MXWH 3QRGH 4KJYB 1NBZB 3T0WA 3GMMA 4H5SB 1WBYB 3B2VH 5HDBE 1B0GA 5BQ7B 1H0DB 1VADA 2IC2A 4K3JL 5HPMA 4L29A 4NN6B 5HHVH 1UT9A 2LFGA 4PS4L 3TBTA 4N1EA 3B2UD 1E6OL 4I9WD 3U0WL 4OIIL 1RV6X 3EO9L 2WK2A 5B39B 4U6TA 4CW1A 3HPJB 3TV3L 2B39A 3C60C 3LKNB 4FFZL 5DD6B 2V2TB 4JLRB 2GJ6A 1B6UA 2Q76A 5I1GH 5EU6A 4ZOCA 4HGWA 3TO4A 1ZTXL 4PRIB 5EUOB 2AXGB 1KEGL 2UYLB 3AREA 1QSED 2CIKB 4PR5A 3QEGH 3P9MA 4R7NA 4PY8I 1ZLWH 2XRAH 3ARDC 1ACYH 4KRNA 4BELD 4X0KB 3IXTB 4YFLI 4YGVB 3RWDA 1ZAGA 1CF8H 2GJ6B 2HJKA 1D9KC 3ULUC 2HRLA 2H32A 4G8FA 3MRNB 4LLDA 3UTTD 1I1AC 5HYJD 3ZSTA 4FFYL 1FL3A 4ZUSB 2C3XA 4JFXA 4MNHA 1A7OL 2GJJA 3F7VA 3LH2H 2QQLL 1VFUA 4DWHA 2QQQA 3LRSB 1CVSC 1L7IL 3UEZA 1OQOA 4EN3D 2P42B 1CLZL 1I8KA 2WBJC 3V6FB 1A9EA 1CR9L 1HKLL 3U9UB 3LKOB 3O4LE 2RQ8A 4UTBL 4A6YH 1BAFH 5JA9A 2BNRA 4V1DB 3QEQA 1DBJH 3DIFA 1YEJH 2R0LL 3LHPL 1IBGH 2VQ1A 4KJPD 2OTWB 5IB3A 5IVXB 1A3QA 2A6DB 3TH2T 4IRSA 4JFXB 5C09A 1YEKH 4OFYA 1EO7A 3MRDA 1H8SA 4XVJL 2KQMA 3WNNA 4JQXA 1KB5H 3ULVH 3O4OB 1KLUA 3HCVB 4YDKL 3KNBA 5F1IB 1F3DJ 3QDJD 4NWUH 4HKBB 1QEWB 2HTLD 5IWLC 3C5ZA 5DVOA 4KDVA 4WY7H 5DHVA 2V9QA 2VQ1B 3FB8B 2JCCB 2A73B 3V8CA 4CMHC 5FB8A 3FQWB 1OM3L 1FV1A 2ED7A 1FE8H 3C8KA 4LAQL 3G5VA 2JELH 4GRLD 5IHZA 2NY2D 4I77L 1EFQA 4PYGA 5I8CA 1CICB 4F3FA 5C0EB 1F4HA 5IV2B 1NGQH 4IDJH 1ZA6A 3EOBB 3IAQA 1ONQB 3PWLB 4M7ZB 2BZDA 3SOBL 4DFIA 3S9DB 3GMQA 5EOCH 1ND0B 1RULH 3PQYA 3IU3B 3C9NA 3WXWH 1T6WA 4KKAC 4MJIB 5TDOB 4JB9H 4WJ5A 3UTSE 2PN5A 4WDIA 4YXLL 4JM2C 5DI8A 1REIA 2VL4A 4KJQC 1DVFD 2P7TA 3MLTA 4PJ5D 3KJ4C 4U1HB 4G6JL 1BZ7A 3C09C 5KSAB 2R2EA 1HSBA 5D6CA 3ISWA 4P49A 4JVWA 3LOWA 3SO3C 3ZMRA 1CTNA 4FP8L 2VR9A 2AABH 3QDGB 1KN2L 1I3GH 1I8LA 3HG1E 4EJ1C 5ILTL 3DUUB 3LQAH 3UTPE 2CMRH 2XXCB 1KJVA 1ED3B 2YC1B 4G6AD 5TFSH 4ZYKA 5ITBH 3SJVE 3FO0L 4XTRC 4RGNE 1ITBB 1XGRA 3EYFA 3H9HB 2IAMB 1UB6B 2XWBA 4XWGH 2DQTH 3DI2B 4P2CG 4Y5YB 4OBRA 1RHHB 5KW9H 1YDPA 3EJJX 1AXSA 4GW1B 1HHKB 1GGUA 3AUVA 2EC9U 4ISVA 4XMKH 3VXRA 3MLRH 1U92B 3DX7B 2XQBH 5KZCD 3D3VD 1J1OL 4FQLL 4JPIB 3TH4T 5EZLB 4XH2A 1KJVB 3KPQB 1S9VB 1DLFH 1G7HA 3FT4A 1IAIM 3N9GH 3WD5L 4Y4KB 1TQBB 4WO4C 3IFLH 4TPRL 2Q8AH 4HUWA 2DBLL 3NVQA 4J3OC 4PRPE 2X40A 3EYFB 1SYVB 3SCMA 3D6GA 4IBLT 3EZ8A 4DZBA 2V2WB 1NGPH 3KHQA 4ODXB 1RJCA 4U4BA 3QCUH 1I8MA 1KTLA 4G6KL 4EQ2A 3A0OA 3V0WL 1T2XA 1JF1B 1KT2B 1DFBL 1MSPA 4JO3H 2ZCLL 1MJJA 1HH6A 1FO0H 4KTDL 1X5ZA 2CO7B 1F2QA 2ZSWA 2H2PD 3QULB 3DUHA 5BS0B 1BJMA 4U1GB 1OGAD 3KPMA 1VDGA 2MFNA 1BVLA 3SE4C 1G6RL 1R3LB 3ZT6A 2PF6A 2G60L 5DFVC 4IOIB 3ARGA 4EBQH 2V9TA 4P3CL 4L4VE 1E6JH 1MCBA 1AI1L 3HAEG 4RRPG 1Z5LB 4BSVA 1FG9C 5DD1H 5IT2L 3MV9A 4Z78A 4POUB 4ZTPL 3D39A 1OTTD 1R3JA 3DX6A 4IIQA 3TN0A 4JFOB 2W9DL 2X70B 2PKDA 3S8WA 1LILA 3W11D 1A7PL 4UT7H 4UV4L 1A3LH 1N26A 1UG9A 4FRWA 5I73C 1S5IH 3GJFA 5IQ9B 4J4PC 3VXSE 4ONGL 2J6EL 2NCMA 4N0CD 3UPRB 3ZYIA 5EBMB 3O2WL 4X4YB 2PCPB 3TO2A 4WFHD 4Q9BA 1BMGA 4KVCH 1MCQA 1T0MA 3L5JA 5JHLH 3NFSH 5D2LA 4JFEE 4YBLB 2FECL 2A38A 3DTXB 4OZGB 4KQ4L 1GHFL 1LNUA 1U41A 4NQDD 3RX5A 1JFQH 3VH8G 4F8QA 3RVUC 2OMNA 5E9DB 4Y19D 3U4BH 5JTWA 3TBWA 4JFDD 1AKJA 1FNAA 3KXFE 5KSBF 3LEXA 4JKKA 5MEQB 3FQTB 5C0BD 4QHNA 4ZAKC 1JPTH 4GH7B 4OSUL 2FWOB 2AJXL 5ISZD 3SDDC 4O4YH 1JI1A 5DJ0A 3H8NA 2H9GB 4ZUUA 1A14H 1WZ1H 3QH3B 2NY5H 3HTLX 1GGTA 3BP6A 4HFUH 1D5XA 2NLJA 4M00A 4PJDB 1NFDF 5IK3A 3JWNC 4R4FH 5DS8A 1G7MA 2DF3A 2ZUQC 1A22B 2P46B 4HWBA 4WTXA 4O02H 2NNAB 4UQ2A 5FF6A 4XGZA 2R1WB 1GGCL 3U4EB 3DLQR 4TVPH 4LNVA 1I9RH 3VFSA 4Y16A 3D2UA 4RMSA 2VH5H 3QDAA 4L3EB 4NUGL 1BVZA 1BJ1J 5FUOL 5FV2A 4PJAA 2P48B 4KAQL 1J88A 1EBPA 4AEFA 4KTEH 5DSCA 2FX7L 2DYPA 1A7QL 5FHAH 1PG7X 3HPLA 5I66B 2AEWA 3RI5K 5GS2D 1CK0H 1EAPB 1MHEA 1RUQL 4HIEA 4ELMB 4P2QB 1DANU 3TCLB 5TH2A 4WU5A 2AK4D 2WIIB 5J12B 4J7RA 1OW0C 2VE6A 2OTUB 5SWQB 1F4XH 1EX0A 1V7NH 1Q0XL 5JW4Q 1DEDA 4LARH 1CFBA 3F7QA 5E5RB 4X5LA 1QR1A 5GS1B 3C6LC 1XH3A 1IAII 4X7TB 2XTJB 4HK0A 1D5MA 5DMKA 4NP4L 3LEVL 5J57B 1MCEA 4H88L 4Y1AD 4ODVL 3PHQA 4OCWL 4YIQA 1G7IB 4JDVA