1BWMA

A single-chain t cell receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
249
structure length
249
Chain Sequence
b'AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLGSDYKDDDDKRSGGGGSGGGGSGGSGAQQQVRQSPQSLTVWEGETTILNCSYEDSTFDYFPWYRQFPGKSPALLIAISLVSNKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAATGSFNKLTFGAGTRLAVSPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALPHA-BETA T CELL RECEPTOR (TCR) (D10))
publication title Structure, specificity and CDR mobility of a class II restricted single-chain T-cell receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bwmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bwmA02
5CCKH 2HLFD 3MPCA 4RGND 4JHAH 3F7VA 3GB7A 2IBZX 3NIFF 3EYVB 2LU7A 2DWEA 5EN2A 3T1FB 1QKZH 1G7PA 1HYRC 5CJ5A 3BQUC 1DN2A 2OYPA 3U6RA 3TO2B 2NXYD 4LCCA 3VFMA 1CU4H 4L9LA 3NA9H 4X7TB 5GRWA 2XTJE 2BNQB 4ZDHA 3OHXB 1SVCP 4I2XE 4HX1B 4KTDL 1T66C 2APBA 5L2KE 2JK5A 3QUZC 1OL0A 4BUGA 4O2EA 5DJYB 4NT6A 4AQ1B 2XPGB 4FQ1L 3CPLB 2CUIA 4G9DA 4BUHA 1HYSD 3MBEB 1JGVH 3QI9C 5IMOB 1EJOL 2XZAL 1T5XB 4YAQA 3WUZA 2GFBB 5T3ZH 1INDL 2J6EA 1JHLL 1DE4A 3GK8H 3X14B 3D3VD 4X9IA 5J4MA 5K9QI 5CIPB 5FO7A 1T03H 5LJYH 3NGBC 5FYJH 4OF0A 4H5SB 4JFDB 4OGXH 5KSAB 3WNKA 2UZIH 4C56B 5D1ZC 5ITFB 1C08B 3LVEA 1B6UA 4XMPL 4PGCA 2HP4A 4YC2B 3A6BL 3VXQB 3SE8L 2R1WA 4NO3A 3CVIL 1V5JA 2VXTL 2XNAB 4N8PA 4X0KB 5D72L 2Y1VA 4XZUB 1G84A 1IC7L 1R5WA 5C08A 4RGNB 1J0YA 3NTCL 2P8LA 3NABH 4ZYKA 5J6GB 3NCBB 3GJFB 2XWBA 3C60C 3D5OF 3WDJA 5DEFB 4IMLA 4P3CL 5F7HA 1MF2L 2YD2A 4N0FA 3O41B 5BW7A 5KS9B 5LWYL 4PY7B 2NX5E 2HT2C 1U8QB 4OCLC 3G6JE 3PWLB 3ARFA 4M4RA 2IPUK 4PGBB 4YBQD 3ZTNH 1U93A 3MLWL 1VGKA 3HFMH 3L3OA 3HZMB 3T0WA 4ODXB 3V7AG 4P2OC 4XB8A 3FRPA 4LNVA 4F7MB 4P4KA 4H1LG 3SE4A 5CEYA 4EI5C 3FT3A 3CDCA 3D3VB 3RKPA 1RZJL 4Y5VC 3VFPA 1T0PB 1Y6KR 2B2XH 5D5MB 2IALA 1S7QA 4ZUVB 1QEWB 2GI7A 3VXSE 3V4UH 5IQ9A 2YD9A 4LCWA 3E0GA 5IBTL 1QRNA 5I6XB 3NCJL 2JE8A 5K9JH 5IESH 3WIHL 1PZ5B 1G6RB 3UO1L 4W6XB 4M7LL 4QXUH 3V0VA 4ODUA 1P6AB 4JFQA 5HI5D 4PJDB 3UROR 5F1NA 2AEPH 3BP4B 4BH8B 3I2CH 1ORQA 2UZYB 5GZOC 4GW1B 12E8L 1QYGH 5IR1B 4YHOL 5DK0B 1K2DA 5D7IA 4PJIE 2EKSB 3PHQA 5HHOD 4CMMB 4X4YB 3MRBA 3MJ7B 4HDIB 2IH1A 4X6BA 4DUVA 5E5RB 4A6YA 3RIAF 2R2EB 1BX2A 5E1AB 3OJDA 1DLHB 3EGSB 4HUXB 1CN4A 2R0LH 4PRBA 4X6DE 3LQMA 5TDPB 4G8IA 3VDBA 1T7ZA 4UT9H 4CKVX 3TVMB 1FLRH 3FT4A 4L4TD 5E2WL 3IETB 2H2SC 4WRLA 3HAEG 2AV7A 4NBZB 2VDMH 5GZNC 4ODWB 4FQIL 3RNKA 5EO1B 1DBKH 1FDLL 5EORH 3SDAD 4HWBL 3BZDA 5CZVL 1DLFH 1WBZA 4XB7A 4DWHA 4NUGL 4HLJA 4LLDA 2FIKB 2VL5A 2XOTA 3D25B 1A5FL 1T0NA 2BY0A 4HUWB 3HHRB 3OAZK 4J4PA 3LMJL 3MMEB 1ED3B 4JM2D 5TE4H 2YPLA 4U49A 2EXWD 2EE6A 2DBLH 4UIMA 4F7EA 4R96A 1HWGB 4ORGA 4JVWA 4N9OB 1CGUA 5F9DC 1FL6A 3U2SA 3C9NA 1OGAB 5DD6A 4KRLB 5E99L 2YPKB 4ZS6D 5C70A 3BVNA 1WICA 4KTYA 4RAHA 1YMME 1UCBH 2AP2A 3BZEA 4R9HA 2IBZY 5HGGS 5FB8A 2X09A 5DEGA 5IF0B 5EIVA 1CWVA 3RBGA 2XA3A 3TESA 1IC1A 5CINH 4GKZA 4XAWL 1F2XK 1V3KA 5EUOE 1EVUA 3JWDH 3EJYC 3OMZA 1JHTA 3MLTB 2LV4A 3BD5A 1OTTD 1T21B 5ETUA 2H8PB 43CAB 2BNRD 4M7KL 4TVPH 4KI5E 4PJGE 4XCFL 5BZDB 3HNVH 4FQXC 4RGOH 4K9EL 1UJ3B 1F58L 1L6ZA 43C9B 4ZXBD 5E0QA 5F7NC 2CR6A 5FYLE 3U46A 1GGCH 3LKQB 4U6YB 3ZKQD 4PLOB 1JE6A 3PP4L 1P4BL 4KQ3L 4B41A 3SDAB 3FFDA 4E5XB 2P47B 1NBVL 1K8DB 5I1AB 2HKFH 5E5MA 3U4EA 2IAMB 2ZUUA 1KNOB 1P4LB 2WP3T 5HHQA 2ATPB 3VXOB 5MEOB 3CAFA 4JM2B 5SX5K 5C0CE 4DVBA 3KS0J 2R2BA 4ZODA 4BKLB 1R5VA 3OF6D 3CLEL 5B3NA 4M03A 1HHIB 1CFQA 1CZ8L 3UZEA 1DDHA 5GRXG 4N0RA 4P4KC 5D2LE 1ZLSL 3SE4C 3DWTA 3QIWD 5A3IC 4YFDB 2AXHA 4PREB 4WO4B 3WHE1 5B3JF 4X6FA 3MV11 3V0WH 3BPNB 4OTXH 1DBJH 2R9HD 4KVCL 4ZPTA 1AGEB 1KT2B 2E3VA 3K4DA 1A14H 1BLNB 2GTZB 1F4YH 4L4VE 5EC1A 3QDME 2B1HH 2NTFB 3UMTA 1XGPB 2Y5TA 5J6HA 5KOVC 3CFBA 5BO1L 1MCRA 4Z7QE 4U4BA 3LEYL 4JO4H 3QUYD 2AXFB 2EZ0D 4ZXBB 4LVNB 1ES0A 3E1F1 7FABH 5CKGA 3BSZL 3PE9A 5IHBA 5F7EH 2P48B 3P9LB 4XAKE 1OP5K 3WIIH 1FL3A 3N1QC 4JPKL 4HFWB 1OP3K 4F58H 1KIUA 2VQ1B 3GMOA 2J8UF 5FK9B 1IAOB 1ZT7B 4YXHH 5MEQA 3FMGH 3MUJA 3L6FA 5IHZA 1T22A 4KDWA 1UXSA 2R1XA 1IQWL 5ADOH 1JGEA 1MCWW 1EO8H 1A0QH 1JHKH 2VZUA 4I77H 2DLIA 3TP4A 4PJCA 4BZ1H 3ZHDA 4JE4B 1DP0A 2VC2L 3CSBA 3E3QE 3S36H 4I0CC 1KJ3H 3NCFB 3VFVB 1BFVH 4R90H 3CK0L 2ZJSH 1NC2B 3QIWB 5DSCA 2ARJB 1UKSA 3GMNA 2X1PA 1RIHH 5EZIH 5MEPB 5M95B 1IL1B 4N0CD 1JPFA 5FV1L 3WV0A 3OPZH 4C4KO 4MVBD 5A1AA 1FZMA 1IZKA 3PGCA 1L9NA 4PJBF 4YDIH 4XC3L 5T3XE 4O58L 1J86A 4URTB 4J4PC 5HD8D 2DQJH 1A7OH 3LKSA 1VFAA 5EOQH 1FYHB 1KULA 4ETQB 1FFQA 5I17A 2P5EA 1KGCD 1PW3A 2Z92A 1B0GA 2EECA 3BKCL 3HZKA 1J5OH 3OBAA 5TE7H 2D7OA 4MD5B 5JIHA 1TPXC 4MHHI 1V7NL 4V1DA 1P2CA 1IFHH 3QDJE 3VFOB 1IRAY 3GEWB 5E03A 4PJ8C 1L0YA 3PDOB 4NNXA 4CADA 5BOPA 4U6XA 5D1XD 4OZIB 4C55A 3RWJB 3VI4E 3QNYA 5DTFA 1GGYA 2V9TA 5KN5B 1IEBA 3I6LD 3KYOB 2UUDH 3RWCA 4JHBA 1GL4B 4WUKL 4Y4FA 3E3QC 1TQBB 4D8PA 4GKSA 4GW4A 4XCNA 3TO4A 3ALWA 5DK2B 3T0DA 2EYRB 4ZFOA 4KKAC 5L8JB 4QRTB 4WEBH 1SY6H 4YNYB 4TNVK 1KJ2B 3QZWG 2FDBP 4G6FD 4M1GH 2ICCA 5DQDL 4U1KA 1MRCH 3QQ3A 4KJWC 5FM8A 5F88B 5HPOA 1KIRA 2FEDC 2V9RA 3ZO0A 4WIQA 3TM6A 1MFAH 2DKSA 5FOJA 3F7YA 1VA9A 3SO3C 5EU3B 2HTLD 2ADJA 2NLJA 2MQCA 4M7LT 3UX9B 4OLYH 3HMWL 4Z0BL 1FIGL 1SEBB 1LD9A 3DROA 3H42L 4U1GB 1YNKH 2QV2A 4OCRH 1A3RL 1IGIH 5IFHL 2H1PL 1D6EB 1WAAF 5DJZB 5E8DH 3UJJH 2MTPA 1G7MA 1CGSH 4QRRD 5SWZD 1PLGH 3MJ6A 3EOBB 3KPSB 3MGAA 4YFEA 2Y36H 3FB6B 3L1OH 3S5LG 4Z7VA 4O51B 2FBJH 4AEEA 2V9QA 4J2XA 1ZHNA 5B22A 1OM3H 5D1XB 3S35X 1FE8H 1T7WA 4IRSB 2CK0L 2V17L 2WINA 1KCRH 4FFWD 5C1MB 1OPGL 3OGCB 5B4MD 4HHAA 3GJEB 3RWFA 5L88H 4QRPD 1YEDA 1NFKA 4X98A 2FECI 3F58H 4KRPC 3STLA 2P5WD 2WMPA 1JCKA 2ENYA 3R4DA 1MCJA 4H20H 3CXHK 3REWA 3CDGA 2XV6B 4HWZB 4TPRH 3D9AL 4U1LB 3DMMD 5A40E 4OLZH 4NZUH 2EDKA 5HYJE 3H9SA 4HPOH 1ZHKA 4YZFE 3FQXB 5IEKB 3ARDA 2V7NB 1FYTA 2DWDB 4F7TA 4S1QL 5DVKA 1TZGH 4EDXB 5TF1L 1PG7H 4M1DL 4FQQA 5LCVL 3GI8H 1S7VA 5EIQA 2XWTB 5D7LE 1JPSL 2EDJA 3O6ML 5E9DE 4QHNB 1XH3A 1QBAA 5JOFB 5C0BE 3LQAL 1GOHA 2H26A 4MS8D 5SWZB 4E42B 5BS0B 1MJUH 1N0XH 1QSVA 5LWYH 3VWKC 4X6CE 2VN7A 5HYSB 3CFKB 4KROD 2M8XA 5ERWA 4U1SA 4OZHA 4IRJA 3QDAA 2F58H 1LEKA 2F54E 2HTKD 4RBPK 2AEWA 4HS8H 5EC2B 2OP4L 2QQLL 4P0DA 4JANA 4BELD 1MAJA 4FQHA 2VXVH 4EJ1C 3WFEL 4JG0H 3ZKMD 3BPCB 1W0YT 4QRPB 1N59B 3FQNA 1HIML 5I0DA 2O5ZH 4MB3A 2P5WB 5BVPL 1FGVH 1WWWX 3T2PA 1C1EH 5E94B 4E41B 3HRZB 3RQ3A 5H94A 2ZSVB 5IB2A 1F6AA 4X8JA 2GY5A 2ZCHH 4WUUE 4WFFE 4AEHL 1NGXA 3UZQA 2A77L 2RCSL 3WUWG 1ZSDA 1DSFL 4Y8DC 3KPLB 3O6FD 5FKPB 1FBIL 2R56L 4ZFGH 1CT8B 1D5ZB 1I8MA 3QQ4A 3QULA 4NPYB 2OSLA 1DCLA 4IRZL 5FGSA 4PJ9B 3QIBA 4YWGH 4Z18A 3INUH 4Y4FC 2D2OA 3B2VL 1MFCH 5MENA 1WITA 3HMXL 2CIIB 1CIDA 3TO4C 3WD5L 4DKFH 4NFBA 4JFPB 2QSCL 4LNRB 3OXSA 1QFWL 3UTTA 1MI5B 2WIMA 2EDXA 5DUBB 1RUML 3JWOL 5KSUB 3FQRB 4XNMA 3T8XB 3U1SL 1E0OB 5DLML 5FUZH 1B90A 2VJXA 4HV8B 1K6QL 4KROB 4KHTL 4POZD 5HHXH 4JQVA 3L3JB 3WXVL 3RVUD 1HH9A 3Q0HA 4KMQA 2VLKA 3ZKSD 1LP9A 3PQYD 5EWIH 4A2LA 2VITB 3F62A 3OKMA 4NKMB 4NCDA 4R4BB 2IFFH 4DFIA 1K4DB 4YHKL 1MJ8H 1SBSH 2Q76A 1SM3H 4PJXE 4LSRH 1N7ML 1ZEAL 4Z7WF 4UOJA 1QLFA 4CN1A 3IRZA 2JCCE 4KV5E 4K7PX 2XFXB 1U8OA 3GSUA 5JDSA 5I71B 1NLBL 3RI5K 3NIGE 4GAGL 3C6SB 1OAZH 3EJZD 4Y4KA 4LBEB 2NY5C 3T77A 3LB6D 4NJAH 1RUPL 1M7IB 1HQ4B 1G6RL 1R3LA 5F7MC 4PJFA 2WIIB 4G8GA 2PW2B 1JGDA 2XWJB 5DDHB 1ODAA 3V0AC 3MLRL 5B39A 5DGRA 1J1PL 5C0DB 3LQZA 4J3XA 1AGBA 1UWGL 1XGYL 3VD7A 1BZ7B 6FABL 5D70H 2OZ4A 1HHKB 1YPZA 5I8OH 1H8SA 4LU5L 1IQDA 1QLRB 4NP4H 3A67L 2C3HA 3P2TA 2NY7L 1Q0YL 2PYFA 3AXLB 4Y16D 3S7GA 3W0WA 5JOEA 1KCVH 2Z91B 5ESAA 3FZUD 4XGZB 1A1NB 3M17A 5I1LA 2AJ3B 1KENL 3WL9A 5CMAB 3OKNB 4XWOC 4NHCH 5IB1B 3QDGB 2HFGL 4GAYB 3QWOB 1GZPB 3ARDC 4PS4H 4JHWH 5KVDL 2WWKO 5F9OH 5SX4I 5T5FH 1F3DH 2PW1A 1YEFL 1ZK9A 4GKNA 5JPMB 1LQSR 5F7WC 2O5YL 4O9HH 3GBMH 5ID1B 5AEAA 1JV5B 3DX8B 5CZXC 4K71C 2EH7L 1EH9A 4NQCB 4QXTB 4NOFA 1M1SA 1SBBA 5IVXA 4NKIL 4JN2A 3VXRD 4IRJC 1YYLL 5JOPE 1EBAA 5F21B 4PJEF 4NC1C 1ZXQA 3MFFB 1YEKH 5ID0B 1SQ2N 3MRIA 5GGTL 4GRMA 2W0FA 2DLHA 2HRPL 1YEHL 1OSZA 2KZ1B 1DQDH 3HC4H 4JDZA 3RU8L 4MXVF 2W9EL 4M00A 4NWTL 4R3SA 1Y18B 2PYEA 3X13B 4UQ2B 4MXWL 1HEZA 4DGYL 3MGTB 3SDDD 1AGDA 3O6KL 4RFOL 4Y16B 1X5KA 4TYUA 3BN3B 4KK8C 2X4RB 5HDOA 2CQVA 1A6AA 2MNUA 2ADFL 4LSQH 5AD0A 2X1OA 1A9EB 2OI9C 5C6TH 2Z8SA 1RFDH 5E8OB 3V5DA 4P3DB 5IWLA 3G5XA 2YD5A 1NMCB 4PJ7F 4HUVB 5BCAA 1FRGL 4XP4L 4TUKH 3MO1B 5I1CL 1X5AA 3MXVH 4PRIA 2W9DH 3SKJH 3QIBC 5INDB 1OCWH 2VLRA 3V79C 1G7QA 4MX7A 2XKSA 4RWYL 5JQ6L 1MCPL 4F33B 4K7PH 2EO9A 4PUBL 2AKRA 3D39D 5DHYA 1UXWA 3BZ4B 4H0GA 4OI8A 1IC5L 1I1CA 4RAUB 1CDYA 5KW9L 2SEBA 2C1OA 4ZFZA 2MKLC 3L3HA 4NN7B 5D7JA 2Y6SD 1CD0A 2BSSB 2BHZA 3RAJH 3CVHA 4JQXC 4JQVC 5I1JL 1SJEB 3IXAB 4B53A 3VXRB 2WLYA 3RX5A 2GSGA 4Z5RB 2OJEB 1CFSA 3EYSH 2LU4A 5C0AA 2Y07H 5FF6B 4ZAKD 3PIQB 2JIXA 3DI2B 1F42A 2AJSH 4HK3J 2QR0B 1IM3B 3GFUA 4OD1H 3WN5A 2WANA 2X6MA 3VRLE 1T1ZB 1T5WB 5F1KC 1L7TH 3P9MA 5EB9A 1BVLB 5KVEL 5IG7A 3FRUB 1YNTA 3O2WH 1I3GH 2BSRB 5ESVB 2VE6B 5DJ0A 3ZSSA 3IFPA 3HPJA 4PJHE 1I9IL 1GIGH 1T2QH 4JFEE 5D7SH 4Y4KC 3MV7B 4DVRH 3ARXA 1AFVL 3S34H 5F9WB 2QHRL 1XF2A 4Z9KB 3P0VL 3BGFB 4LLQB 4P4RA 3SKMA 3RUGF 4XBEH 4JJ5B 4MA3B 3VH8B 2O5XH 2WBJC 3CMGA 1A7BA 3VMNA 4BM7A 4WGWB 3VXUE 1A7QH 1CE6B 5D8JH 3H8NA 3QCTL 2AABH 1BFOB 2C1PB 3O3BA 3K2MC 4I4WB 2I5YL 2J3SA 4PRDB 3TYFA 1HI6A 1EEZB 3UPCA 5F89B 1IGML 1OB1B 1T2XA 5HHVH 4OZFH 3LH2L 4D9RE 2XTLA 1P7KA 1XF5A 2A6KB 3BJLA 3RVXC 3F12A 1NGZA 3EDKA 2YUVA 5E95B 2BOBB 4QOKE 2ICES 2FZ3A 4P5TB 1CIUA 5DO2C 3LS5L 5IFJB 3PHOB 1KEGL 4K7PY 4LLVB 5DJ6B 2VLME 3I3BA 4DOHB 3MLPA 4PP1D 1I9EA 1WAAA 3NIDF 3ZMRA 5FYKE 2GEEA 5CBEA 3RVWD 1AGCA 5J3HC 3U7WH 1EEYB 3U7YH 4JFOB 4MQSB 3MV9E 2PTUA 5D1QA 1HHHA 2M1KA 5E4EB 3BE1H 5C71A 1RQ5A 2IWGA 2ZSWA 4M7ZB 4N1EA 2Z31D 2GK2A 4QXGL 4ISVA 4UIKL 4OJFL 5FHBL 1MUJB 3VE0A 4KPHH 4WI5A 1HZHH 2VXQL 5FKAB 2R4SL 3L5WA 3MRNB 4WWKA 5FOBA 5F1IB 3KPPB 3VD3A 3B9KA 1RHHB 2APWA 3ARBC 4JO3L 5EU7E 1XAUA 2NY1B 2LU3A 2XRAH 2YEZA 1U8IA 3BQUD 4HZLA 2NW3A 2BDNL 2EYSA 3RDTA 4D3CH 4X83A 5LGHH 3NN8A 2X4UA 4ZTPL 5I2IB 4TUOA 2H32H 2R0ZH 4LCIL 5HYIA 4I5BA 1T66D 2YC1B 3QUZD 3W9DA 2NY0D 2Z35B 4RFNB 1P69B 1TITA 3KXFE 3C8DA 2Z93A 1RUQH 1U95B 5AYQA 4EQ3A 1A1MA 3HNSL 2EYTB 5EZOL 1YN6A 1OAQL 2V17H 2YPVL 4EN3C 2ESVE 3KPNA 3V2AR 5JA9A 2KBGA 1JGLH 4G8EA 1U8NB 5AYUL 4OZGF 2NNAA 1C5BL 5DT1H 1CDHA 2HVKB 4WI2A 4EUPA 5IWLC 5JUEH 1WWBX 2ZUSA 4R4FH 1KN2H 5SWSA 3UTQB 4W70A 4XHJC 4Q6YA 2J88L 1KJ2L 3GSVA 1UCTA 3TBVA 3PJSB 5HGBB 3KYKH 4RQQA 5E5UB 4YDJB 2VLJE 3EO9H 5CKAA 2OJZL 1DUYB 1CLYL 4RX4A 4X7DC 3WHE0 1VESA 1OAUL 4Z7OE 5T3XL 3GMRB 3WEXB 4Q2ZA 2CUMA 1PY4A 5D7JC 3DXAD 1QBLL 4LHUA 5JHLL 4JRYD 3UPAA 1JPGB 2PO6A 1HHJA 3AUVA 3IDIB 1CL7H 5ALBH 4YX2H 3HC0B 3GMLA 3C60D 4P5MA 5KS9F 2YA1A 4HH9A 2BC4B 3BQUB 4N8CH 2VDQH 3H7BA 2DDQL 2PR4L 5C0EA 3EDJA 4JG1L 2MCPL 1E6OL 1TTFA 1R5IB 4FQCH 1W8OA 3N85L 4NKDB 3SPVB 3TPKA 4JO2H 2ZOLB 3WN5C 4GRLA 1CR9H 4GFTB 5MERB 4WHYH 4U1NB 3EJJX 2QADB 3QUZB 1I7RB 2AEQL 4HKBB 2F53B 1FP5A 2COQA 2Z0BA 1T20A 1UT9A 1JF1A 5C6WH 4X5XB 4G43B 3VDCA 4ESKA 4EXKA 2P46B 3QI9B 4P2OD 4M6NH 1MQ8A 2EICA 5AWNH 4EI5D 2W91A 2A2QT 3EDFA 4NQXB 4ELME 1JNHA 5KANG 5D5MF 1KTLB 3S96B 5IMKB 4ZO6A 3REVB 4Y1AA 1YC7A 4Z8FL 2GT9B 4JLRB 4HULB 2CLZA 5D1ZB 3DHMA 1FO0B 1TETL 3VGBA 3UJTH 4NQSB 1B4JL 2ZOKB 1U8JB 3KPRA 4NYLA 1IT9H 1D5IL 4LSPL 2EE9A 5C09D 2VNCA 3HI1A 4MA1C 3IS0X 4YQXL 1LO4H 1KPRA 1MHCA 3AMKA 4PJDF 3KHOA 4RAVB 2BMKA 1WBXA 3V7AE 4RZCB 5C0RL 2EDEA 2X4QB 4G9FB 3DXAB 4JRYB 5CWSB 3IDUA 5GZOD 2ADGA 3OAYH 5TH2A 4L3CA 2HJLA 3TPUA 3C60B 3TJEL 2YD4A 3QEQE 2OR9H 3MNZA 3VXNB 2QQNL 4NRZA 5C0FA 4WI4A 5LG1A 1NJ9A 3NZHH 1RIUH 1W0VA 4QTHA 4P9HC 5GRVL 4WU5B 4XXDA 5F9JA 5E2UH 2D7TH 3JWOH 3PV7A 2VABA 5D1QC 3CIQA 3QEUA 3PWJB 1TNNA 3MLZH 1XFPA 3VXME 1IM9D 1G7HA 5ICXB 1N6QH 4PG9B 5C86A 3DRTA 3DO7A 4OLWL 4P2QE 4FXKA 1ZS8B 2H2SD 1XGQA 2HN7B 4QTIH 35C8H 4EI6B 4EI5B 5L2JB 2K3TA 3V8OA 4KZEH 4N5EC 3MJ9L 2DM4A 4JB9H 4WWKC 5GZND 1KG0B 1INQA 1X5IA 1PSKH 4O2FA 3B9KC 2GAZA 3OJ2C 3L7FB 4LPCA 4OD2B 5E2TL 3WNNA 2EDQA 5CGTA 4HKJB 4EBQL 1II4E 3LKOB 3RDTC 3QCUL 3OTTA 4P2RE 1EFQA 2DQHL 5F6IC 1C12B 1TFHA 1MEXH 4QGTA 3IVKB 1VACA 4AY0A 5C09B 1MWAA 1VB9A 3GGWB 3FB5B 4PGDB 3BKML 2DI7A 4GH7B 3BH9B 3RL2A 3LV3B 2A6JB 2FX7H 5ILTL 3WFZA 4C54A 1J10A 3TV3L 1WZMA 4NN5C 4Y19E 1U9KA 2DRUA 4IJ3B 4LHUG 3T4AB 5BJTA 4I3RL 4WTZA 4BZYA 4UU9B 3W2DH 3WS3B 4D2NA 4Y5XA 1GGIH 5DURB 5ICYB 3NFSL 4OFVA 1V3LA 3MUY1 5C7XH 3S35L 2EDWA 4ZSOA 3GUTA 1YEEL 3CH1A 1WIUA 4FA8A 1EHLL 2YBRA 1RJZB 2FX9H 3OKOA 3KPMB 1E6JL 4M4PA 5EBLA 3Q6GH 3V7MA 2HVJA 4JCLA 4PJEA 3E8UL 3ZDYF 3G9AB 2A9ML 2V6HA 3O11B 4QEGA 4Y4HD 5DFVC 3EJYD 3ARPA 1IM9B 4UUJA 4MB5A 1ZKAA 5MI0C 3IDJB 3R0MA 3U9UA 3P4MA 4FQXD 4R26L 4LDLB 1MREH 5IOPB 2PTTB 4WWID 3OXRA 3F7VB 3GB7B 5GS0H 2DWEB 1V05A 5EN2B 3MYJA 1G7PB 4OT1H 4Z7UE 1DBBL 2Q86A 1JK8A 3U6RB 4MJIA 4LCCB 3VFMB 1TCMA 3O4LA 4JM2F 4HBQA 4L9LB 1TZIA 3BKYH 3HG1A 4ZDHB 3STBA 4GRLC 4M5ZH 1EGJA 2JK5B 1MVUA 1W0WA 1CLOH 4G6JL 3BKJH 4Z7NF 4RMTA 4LVHC 5GJSH 3HLAA 4NT6B 3SEPA 5IUSA 5HPMA 3D85A 2IANA 2QSQA 2P4AB 4G9DB 1YN7A 4RIRA 1MCBA 4JRXE 1FNSL 3L95A 4L8BA 4LEXH 5CD3A 4YAQB 1YECH 4P4KD 5E6ZA 4JR9H 4TULL 2A9NL 4U6TA 1YMMD 1P84K 1DE4B 5A3ID 3QDHA 1LDPL 5FO7B 1CLCA 1JYWA 5BOZG 3IJHA 2P7TA 4K07A 4OCNC 4HGMA 2DM7A 3PGFH 1J0HA 2B8OT 2OL3A 2LE9A 2FEEI 4PGCB 1YY8A 5CP3A 1TDQA 2R1WB 4NGHH 4NO3B 4WFHE 5DJ2A 5B21A 3ECBA 5HDQH 4FQLL 3IT8D 4KHXL 2ICWA 1F3RB 1I7UA 5FYLD 4DGVL 2VKWA 5E2VH 4F37F 1R5WB 5C08B 1IEAA 5I1KL 2QSTA 5CJQL 3TYGH 4DEPB 2P8LB 3GNMH 4JKPL 1CGWA 2XWBB 2C4FU 2BHUA 4IMLB 4C59B 1S9VA 4HXAL 4N0FB 4KQ4L 4XNZB 4ZUWA 3GHBH 4MCYB 4YHLL 4H88L 3GMPA 2J5LC 2B4CC 3LKNA 4XVJH 2CDGA 5FM4A 1EJ6A 3ARFB 1RI8A 2DQEH 2A38A 3BP7A 3GSXA 2AXGA 4J6RL 1AIFA 1U93B 5I9QC 1VGKB 3L3OB 3LPWA 4UZGA 2H3NA 4HMEA 4PRAA 1JGUH 2FRGP 4P4KB 4G6AC 3HE7A 5CEYB 1KTDA 3NMEA 4WTZG 2QQKL 3SKNA 3RWDA 4CVWA 3W39A 1K85A 4O4YH 3MLXL 3QRGL 3VFPB 3W81A 2IALB 5FIEA 2DD8H 1DJSA 1UVQA 8FABA 4ENEC 1XGRA 5IQ9B 1CICA 4LCWB 1QRNB 1DN0A 4J4PD 1F2QA 3ULUE 1RIVH 3EO0A 2YPLD 1ZLVH 3T0EE 4I9WD 1NC4D 2CRIA 4XXCA 1A22B 3V6FA 1JTTA 2HFFA 3V0VB 4ODUB 1G1CA 4K3GA 4DK3A 5IVOA 4APQA 1IBGL 1KB5B 4OIIL 5F1NB 1ORQB 2X4SA 1HXMA 2A74A 3WKML 1OTSC 4XAKD 5FUOL 5CHNA 3WFCH 1S5IH 4Y5XC 5FYLH 1K2DB 5D7IB 3PHQB 1YY9C 4UAOC 4PJ8D 4OZIF 3MRBB 1IC4L 1QACA 3SE9L 3BP5A 3BDYL 2IH1B 2ZUWA 4X6BB 1UM5H 3CLFH 5CJXA 2WAHA 3MOQA 1BX2B 3OJDB 3O0RH 5CJBA 3QHFL 1P5UA 4PRBB 1FSKB 3TWCL 1S3KL 4G8IB 2F9BT 4KKBC 4L3AA 2YSSA 3MFGB 3FT4B 3MLYL 4U6VH 3GDBA 4PRHE 4KKAD 4MZ2A 1NGWA 1NGPL 3QWRA 1RVFL 2AV7B 1RZ8A 3TT3L 1KFAH 3RWEA 3RNKB 3BHBA 4JAMA 2NXZC 4FQPA 3DIFA 4KJWD 1FAKT 1D6VL 2FEDD 1WBZB 4IBLT 3O9WA 4LLDB 1PG7W 2VL5B 1UM4L 3WFDH 1T0NB 1NL0L 3ZKNC 4OCSL 1XEDA 2YPLB 4OZGA 4CVXA 4OM1L 1EX0A 5L0QC 4XPHL 4F3FA 3QQNA 1GSMA 1S9YA 4H25A 1F4WL 4UIMB 4DKEL 4R96B 2YOCA 4D0CB 4GG8A 4ORGB 5DF0A 3SO5A 3GMQA 3LPFA 1FL6B 3U2SB 2DQCL 3C9NB 5LQBH 4JPWL 4OLEA 5DD6B 5EO0A 3QNXA 1TPXB 3BVNB 5FA3A 3BFOA 1XIWC 5EIIA 4NHUA 3BZEB 4PRNA 5FB8B 1BD2E 1BIHA 4HXBH 1I1AD 1IAKA 1NBQA 1TMCB 5DEGB 4DFHA 4DKDC 4NKOA 4EDWH 2CMRL 1RZ7H 2VDKL 1G0YR 1VCAA 4GKZB 2X41A 1VFOA 4NJ9L 3LKPA 3X3GH 4UDTA 1JHTB 1AR1C 5DRWA 5FGBA 1G9ML 5GISL 2R0WL 4G42A 5ETUB 4LDEB 4LP4A 4KRPD 3VG9C 4LAJH 1MVFA 2BP3A 3TNNA 4U3HA 5CSGA 2Q8AH 3U46B 4QRQA 4NZRH 1IAII 3NH7H 2P42B 3BMVA 3FFDB 1QSFA 1Q38A 5GIRA 3AB0C 1KXQE 4NRYA 3U4EB 5E5MB 2I26N 4XMKH 1MHPL 4RMVA 3SO3B 3J7HA 1I7TA 1BQHA 1LK2B 5HHQB 1NKRA 2GJ6A 4Z6AT 4DVBB 5T3XH 3AMLA 2R2BB 4NQTA 4QRUA 2UWEA 1U0QA 1R5VB 4YHMH 1MPAH 3BO8A 1CFQB 1CK0H 3OAUH 2Q8BH 3CCHA 1WUNT 1VSCA 4X7FC 1DDHB 1HHGA 1PZ5A 4JGJA 5DGQA 2G60L 4F7PA 1H3WM 4DN4L 3UEZA 3VWKD 3SGKA 3ZHKA 4JDTL 3BP4A 1HILA 4ALAH 1NEZA 4F9LA 4HKXA 4X6FB 4RDQF 4ZPTB 3Q5YA 5DK0A 1CICC 4M7JH 3I02A 1KC5H 2B5IB 3EOYG 5EC1B 1MH5A 1T0MA 2Y5TB 3U30C 5J6HB 5TE6L 2P5ED 3CFBB 4M62L 1CDGA 4XXCC 4GG6E 2N56A 4LSUL 1YEGH 2QJDA 1FJ1A 3FN0L 1AH1A 4HS3A 4KRPB 1YDPA 1CXFA 3WYRA 2W07A 4APQC 1UZ6E 1CXEA 1J0KA 4WFGD 4WFEE 5FYKL 2N1KA 3UJIL 5TDPA 2QKIA 5LAXA 4V2CB 4V1DD 3ABZA 4WV1C 5HYJD 1FPTL 4N9GA 1CFVH 3O6LL 1FL3B 2CIKA 1INEL 5IIEA 3K8KA 4OI7A 4HEPG 3GMOB 5LXGH 1TJGL 5JA8B 3NIFE 2VOTA 5MEQB 5CJXC 2BVEA 3L6FB 5IHZB 1T22B 1CGTA 3MV8E 3Q1SH 1UXSB 2R1XB 1JGEB 3D25A 3MOAL 4Y4FD 1GJIA 4PJAE 5DFWH 2PTVA 3TO4D 4LCYA 4PJCB 3X12A 3NAAH 3D6GA 4HC1L 4M5YL 1BZ9A 1F11A 3QFJA 3N1PC 3ZKXB 1IKNC 1WSST 4ZG1A 5DSCB 4OLUL 3ZE0F 3GMNB 4WENB 5E08L 3DV4A 4XPGL 5ISZE 4HBCH 1WIPA 5I1IH 5JW3H 2M26A 4U1IA 1JPFB 3O9WC 4LIQL 3V4PL 1GXEA 5F7LB 1FZMB 3PGCB 5H35A 1F97A 4JZOA 2FX8H 4DZBA 5HHOA 3LKSB 1VFAB 5MHSD 4PD4K 4C58B 4PPTA 5AG9A 3U48A 5I17B 2P5EB 3UTSE 4U7SA 4H8WH 4B50A 5HHPA 4IEFB 2Z92B 4HUMB 1B0GB 5H8DA 4E9LA 3RKDD 3HZKB 4M8VA 4U33A 3VRIA 1FH5H 1FAIH 4DQOH 1AR2A 3C2AL 1QPXA 2EDHA 1FO0L 4L4TA 4V1DB 1XZ0A 1P2CB 3MX0A 5GGSY 5IBUB 2CKBH 4LRNL 5DXWA 5FUCC 1WEJH 4NNXB 2MQ3A 4CADB 5DQ9A 4L8DA 4U6XB 3TBYA 1JNLH 1Z0NA 1BQHG 1KIQA 3PWPE 3QNYB 5DTFB 1IEBB 3QCVH 1MJ7L 3MZTA 5TDNA 4ONFL 3WBDA 4Y4FB 3G04A 1A4KA 4D8PB 4GKSB 4GW4B 2ID5A 3HI5L 4XCNB 1KNOA 4LOUD 3TO4B 4O5LL 4X4XA 2AJYH 4GXVL 4JM2A 4OGYL 4IOSD 3GIZL 4LSSH 4BFBD 2X40A 4ZFOB 1E4WL 1EMTH 5C8JA 2WQRA 1UEMA 1K5NA 4OI9A 2CSPA 2E27L 3ILPA 2FECL 4JZJA 1N6VA 4WHTB 5JDJA 1MCHA 1F02I 5DRXA 2LQRA 2IGFL 4U1KB 1RUKL 3QQ3B 1KIRB 1QOKA 4BSWA 2A6IA 1HK6A 4XWOD 2WWMC 5GS2H 2K7PA 3F7YB 4L3EE 3GSWA 2OK0H 3DOSA 4HFUL 5F96L 1VENA 2ADJB 4MNGE 2NLJB 3ARDD 4YDKH 1R24A 4M02A 2R1YA 3O2DH 5L8LB 1IVLA 5E56A 1LD9B 3DROB 4NM8H 1K3IA 4YLQT 1WBYA 1Y0LA 1G7MB 2BNRA 4OQTL 2BFVH 1NDGA 5CJOL 5CZXD 3SGKC 4ODBD 5JHDD 5TPWH 3KLHD 4Z7VB 2FWOA 4F9LC 4CRPA 1MCNA 3PWVA 1L4IA 1ZHNB 4IRJD 4YBLC 4POYA 4ZTOH 1VFUA 4N1CA 2WINB 3FHQA 3D69A 4WCYH 1EUTA 3CXHJ 2NY5H 2OQJA 1A6UL 1R3IL 2VXUH 4HHAB 4P2CG 1BOYA 3RWFB 2DF3A 3BD3A 3BUYA 4MXQC 1YEDB 2XKNB 4X98B 5HYFA 3STLB 4FG6C 4MB4A 4HJJL 1H3VA 4JY6A 2FO1A 2ZUYA 4LHQB 3OF6A 1FC1A 5FGCE 3REWB 3CDGB 2WWKT 3LOWA 1ZGLM 5D93C 5FHAH 2AVGA 3ARGA 3QPQC 3FCTA 3DUUA 4YIQA 1HINL 4M93C 2VH5L 1OF2A 3WJLA 2E9WA 2OR8A 3U7AA 3CJJA 3H9SB 1ZHKB 4XNYL 1MFBH 4Q0XH 4M8QB 1V7MH 2CD0A 3ARDB 1FYTB 5DQJA 3U4BL 3MREA 1GOFA 5IHUL 2YS4A 4F7TB 1MNUL 5LBSL 1CDIA 2ZCKH 3QIBD 4LQFL 4BQCA 3MNVA 3L9RA 5MEND 4FQQB 4FP8L 1S7VB 3T2NL 1ZGLA 4NQEA 3CFDA 3KG5A 4CVZA 1XH3B 4Q9QL 4M6MH 4KJQC 3WNMA 3B9EA 3MODL 5CD5C 1J1OL 4S2SA 1A7NL 4K71B 3QUYA 4F57L 1EO5A 5CILL 2JLLA 5ERWB 4U1SB 1P5VA 4N0YH 4OZHB 4IRJB 1LEKB 2CGRL 2V7HA 5ALCL 2VLKD 2Z8RA 4XVSH 4JANB 1UA6H 3JWDC 4FQHB 4ONHA 1UM6L 3HNTH 4KTEL 4EIZC 3L5IA 3TLRA 1GVIA 3FQNB 2VDOH 5GRUH 1B2WH 4GUPA 5HVHC 3IDNA 1DBMH 5H94B 5BVJA 5IB2B 1F6AB 1TVBA 2NY2C 4X8JB 5DK2A 5DJAA 1PEWA 5F7FA 3W82A 4Y4KD 1NGXB 3E2HC 5IQ7H 4W81A 4XCCH 5BQ7A 5CS7A 1ZSDB 2OI9B 3FN3A 4JFFA 4YFLI 1DL7H 3GJFK 4ZOBA 4GAJL 1YZZA 1I8MB 2L0DA 4BH7B 1DFBL 5J7CC 3QQ4B 3QULB 4FQJH 1X9QA 2NCMA 1WWAX 2WBJD 2OSLB 4PBVC 3QIBB 1OGTA 2XY2A 4YHZL 4D9LL 1CE1H 5MENB 1OAKL 3LHPH 1N5YH 3SY0A 3QXAA 4DGIH 3P0GB 4JGMA 5DS8B 3OXSB 3RVXD 5D71H 5I76A 3FAWA 3UTTB 4ELKA 4KWUA 5I16A 4ZUTA 1SEBA 1LDSA 3HI6L 5D2NE 2EDFA 5DO2D 1OWWA 4XNMB 5D7KE 4DN3H 3MNWA 2XKUA 1SEQL 3DETC 4LFHD 4Z95H 4ZS6C 1PKQE 3H3BC 4L29A 2BHYA 1HH9B 5FYKU 2VLKB 2DLFH 1LP9B 1QA9A 5B3JE 3CH8A 4M43H 1D3CA 4MA8H 5J3HD 1AD9A 5BV7C 3OKMB 2XA8H 4OCMC 3P30H 2Q76B 1DANT 1JI1A 1QLFB 1BP3B 4LP5A 4R7NA 1IKFL 2J4WL 4XVTH 2DL9A 1U8OB 4JFED 3LRSA 3GSUB 5JDSB 5J13B 5HI4C 1H3GA 1T04A 4TN9A 4Y4KB 3T77B 2X89A 4KRMB 2HLAA 2ED8A 3V6OA 3NZ8B 3V95A 4HAFA 1E4XI 1R3LB 1WISA 3LS4L 5EPMA 4BZ2L 2EDNA 2UY7A 2ZCLH 4MDIA 2XN9E 1YYML 4PJFB 3ARBD 4G8GB 1JGDB 4UT6H 3L5JA 4M6OL 4ZNEE 1KB5L 3MA7A 1NFIA 1P4IH 4D9RD 4LSVL 5B39B 1BJ1J 5C0JA 3JBG7 3ORJA 1F3JA 2J8UE 3LQZB 1KBGL 3FKUS 4UBDC 2E7LA 3NACL 4NO0A 1AGBB 4QOKD 1YPZB 5DD5L 5BRZE 2B7DT 1IQDB 5EUKA 3CXDH 3W0WB 2PYFB 3EOTL 1QBBA 1ZVSA 5ESAB 1BREA 2BRQA 3ARGC 1JZ7A 3M17B 5I1LB 4IOFC 4XTRC 3WL9B 4QRRA 4EN3D 3GHEL 2WUBL 1YUHA 2HJFA 3C5ZA 1BQLH 3T1WA 2H6PA 1CVRA 3MQIA 1FORH 1VEMA 3BZFA 1J0IA 4AMKL 1LO2L 5GGQL 4XBGA 1KPVA 5HSFA 3OL2A 1CBVH 3FO0L 4XHJD 2VLRD 5HTSA 2PW1B 1KB9J 2NZIA 2F5AH 4PJBE 4UV4H 5TQ0L 4HG4K 4GKNB 4XH2A 4M1CC 1JYXA 4KGJA 4Q74A 4TSCL 1F8TL 1LNUA 5D7JD 3QO1A 4U3CA 1N4XL 5IVXB 4JN2B 3DJ9A 1OY3B 3WHXA 3DMMA 3MA9H 5J8OA 3ARBB 3MRIB 4GRWB 2X9WA 3WMSA 3SDCC 4BSVA 4GRMB 1JZ6A 2W0FB 4PLJC 5EOCJ 2CJUL 1OSZB 2JIXD 5DR5H 4JDZB 4NZDA 3QO0B 3SGJA 4R3SB 5MP6L 3B9AA 1J0JA 3KLAA 3T2OA 1T80A 3NCEB 1J8HE 2PYEB 5IROC 5C92A 4OCWH 1HEZB 2D7QA 2NY4C 1AQDA 1AGDB 3DPBA 1NPUA 2W60A 1XF1A 4UINL 1EZVX 4FNLH 4O02H 4OLVL 4XI5C 1JUFA 1A6AB 1IGFL 5ACMA 4JM4H 5L8KB 4HMCA 3MLSH 5AD0B 1FVDA 1EEUA 1C5CH 2O93L 4XP6H 1HKLL 3ARYA 1URLA 3V5DB 3G5XB 1A7RH 4EOWH 1T7XA 4QO1A 3JV6A 3MRLA 1X44A 5DFTA 3TBWA 4PRIB 3RL1A 4P9MH 2GITA 3FOMA 2VLRB 4X7SL 3C87A 5KSBF 1G7QB 4MX7B 4X80L 5FYKH 1T7YA 2VLJD 3WE6A 3EYUH 1JNNH 2AKRB 4NDMA 3HE6A 5IMLA 5DHYB 1UXWB 4KY1L 1CXKA 3T08A 1RULH 1VKXA 2SEBB 2C1OB 4ZFZB 1P7QA 2XZZA 3L3HB 5D7JB 3KJ6L 4K3DH 1N3NA 3CVHB 4V2BA 2AI0L 4XNUL 1WAAE 2DLGA 3SQBA 1TJIL 5GGVL 3QUXD 1MQKL 1H5BC 1CFSB 1MFNA 5C0AB 3O6FA 3S98A 4AG4H 2JIXB 1A6VL 3GSOA 4M61A 1GHFL 4K23L 2EO1A 4OCYH 1W72H 3WN5B 5I19L 2YWYA 1HSAA 3P9MB 1UEYA 4NCC2 5IG7B 5E08H 1YNTB 5D4QA 2ZUVA 3Q3GA 4ODVL 5DJ0B 4BK4A 2EC9T 3IFPB 3HPJB 1KLGA 4FZ8H 4UT7H 2DQIH 5DHVH 1VDGA 1SYSA 5C2UB 2FYYA 4BK5A 4LEOA 4F37K 4PB0H 1XF2B 4RISH 4N5ED 5F7YC 3CNKA 2FGWH 4P4RB 2ZPKH 3B9KD 3V4VL 4TQEH 2VR9A 3QXTA 4XGZA 3K1DA 3QJFA 1LO0L 5KVGL 2FJGA 1M6OA 1FZOA 2AGJL 1NCUA 2FB4L 3OG6B 3RDTD 2L4OA 2R69H 4KZDH 3TYFB 2HTLC 1HI6B 3EHBC 4AT6A 2A1WH 1DBAL 1WCBA 2EDTA 2MKWA 3BH8A 4L8SA 4RDQG 2E7LC 3ZT6A 3PQYA 1P7KB 4HD9A 1XF5B 4MSWA 5KJRL 3F12B 2J1KA 1NGZB 3K81A 2AK1L 4GMSL 4MA1B 4CN4A 3SJVE 1QRKA 1RZKH 4JKKA 4B5EA 1OARL 1S9KC 2FZ3B 1OSPH 3R1GH 4X8XA 1JWMA 3LEVL 1SJHA 4AEIL 2R0KH 4HQQL 5HGAA 2NW2A 4RFEA 1EFXA 3C5ZC 1QQDA 2KL6A 2FATL 2PCPA 5TQ2L 2YKLL 5SWSD 5F9AC 1NDMA 5CBEB 1VFBA 1S9XA 1AGCB 3SGDH 3N1FC 1KN4L 1REIA 4PTUA 3K8LA 2ZUQC 3MRCA 5E00A 3GSNH 2AJUH 1KEML 2UZXB 5D1QB 1HHHB 4JO1H 2MJWA 5DFVD 2ZSWB 1P9MC 1ORSA 1RU9L 5I30H 4ISVB 3PP3H 3VXTA 3TN0C 5KSVA 3VE0B 1CTNA 4J3VA 3ULVL 4N0UA 2FSEA 3L5WB 4WWKB 5CGYC 1NSNL 1XF4A 5FOBB 5K9QG 3RFZC 1UZ8A 3B9KB 5ACZB 4NWUH 3BW9A 1A9EA 2APFA 2YEZB 1U8IB 4HZLB 4P2RD 4ODSL 2NW3B 3M8OH 2EYSB 2FIRT 3RDTB 3LCYA 3NN8B 1ACYH 2AK4A 2X4UB 4TUOB 1YNLL 1MIEH 3QFDA 5F6IB 1FN4A 3WIFA 4I5BB 5C0NC 1GPOL 2XZQL 4LSTH 3DI3B 3RBSA 3W9DB 2GUOA 5I74C 3K3QA 5L6YH 4ODTL 4Y19D 3SOBL 4MD4A 3I6KA 1QBML 1YEIL 2Z93B 1CQKA 4LASH 4OCXH 4NN5B 1A1MB 1YN6B 2WBKA 1QPPA 3QIUA 3KPNB 5CEZD 4GQ9L 4G8EB 4H1LH 1JTOA 4EUPB 2NNAB 1SMOA 5SWSB 4ZFOL 4JN1L 3HZVA 4J23A 1UWEH 3Q5TA 4QCIA 2ADIA 3GSVB 3TBVB 1OP3H 2CRYA 1Z3GH 3V9FA 4RQQB 2NY6C 3HE6C 2AW2A 4MJ2A 1UJTA 1AXSA 4HJGA 1NCDL 3KHQA 1J1XH 4EVNA 1WTLA 5DWUH 1BECA 4Q2ZB 4LHUB 3FRUA 4TNVF 2C5DC 3SDDA 1KCKA 2BSRA 2XG5A 4Z7WE 3IFOA 2PO6B 1HHJB 1QSEE 2ITDA 1EZVY 4LK4A 1DQLH 2KQMA 3GMLB 2D03L 4P5MB 3QHZL 4HH9B 1Q1JL 4WVRA 4MA7H 3H7BB 2DL2A 4NM4L 5C0EB 1AXTH 3I84A 4OZFA 3ZYZA 4YHYC 1G7IA 4GRLB 3WFHB 1BVZA 5ENWA 2DLTA 2OMNA 1I85A 3MODH 4FQ2L 4PRDA 3VU2A 4LVHB 1T20B 2BVOA 3PV6A 1JF1B 4MNHA 1HWHB 3D39A 2B0SH 4LLMA 1H8NA 3F6IA 2Y23A 5EU6E 4G6AD 1JNHB 5HI3C 4QT5A 1WT5A 3HAEH 3IJYA 3VFGL 2HJKA 4Y1AB 1AO7E 3PHOA 4POZC 4S1RL 3SCMA 5IJVA 4DW2L 5J56B 5I66A 2J6EH 1JPTH 3BPLC 4NZTL 1AQKH 3RGHA 3IFLH 4ENED 5K9OA 2CLZB 3RVUC 5DZOA 2JB5L 1OAXL 4JY5H 4L8SC 5AZ2H 4ZAKA 2XQBH 3JTSA 3H3KA 3KPRB 4NYLB 1X7QA 3HI1B 3L5HA 1NFDA 1KPRB 1FC2D 1MHCB 1ZANH 4U31A 4DAGL 4Y2OA 5HY9A 2BMKB 1WBXB 5HGHA 3TEUA 4Q9RL 1IARB 1Z0MA 4CJ0A 1XCTA 2ZNXA 5GRVK 2YXMA 4U2ZA 1PYWA 1S7WA 5ITBL 2ADGB 5D7IF 4L3CB 2HJLB 3TPUB 4KUZL 2VDNL 3EJZC 3NBNA 3MNZB 1TXKA 3QAZC 3QP3A 1YY9D 1L7IH 2MSPA 3FT2A 4NRZB 4ZUUA 4OSUL 5C0FB 1WZ1L 1NJ9B 5GRZA 4LARH 1W0VB 4QTHB 2H32A 1JMZA 4XXDB 5F9JB 2J5LB 3UYRL 1RURL 4QKXB 1U6AH 2WUCL 3P11L 2VABB 1RK0A 1SJXA 1CFTA 3QEUB 5TFSH 1AD0A 1IGTA 5IP4A 1OVZA 1JZ4A 3RZCA 3IS1X 3JWNC 1G7HB 2DS4A 4NC0B 3QNZA 4NQDE 4KKBD 3DRTB 2B4CH 3D48R 4MXVE 4FXKB 5J12C 5DUPL 3PXHA 5IK3A 1FNHA 1XGQB 4XMLH 5C07E 4DUXA 5TDOA 2VAAA 1INQB 4AIXA 4O2FB 2GAZB 2NXZD 3ETBF 3W9EA 1DQML 1XF3A 4MJID 3DO3A 5F93C 3L3KA 3KR3L 3ULUD 3GO1L 4CGTA 3CC5A 1JMXA 3QUMH 3KPOA 1VACB 4RRPA 2K7QA 1MWAB 3OZ9L 4PJ7E 1MRDL 4JQIH 4PRPA 5B38A 1GGBL 4TUJA 3RL2B 2KZWA 3D85D 2IAND 3WCYA 5IFAH 3HUJA 2Z31A 5BJTB 2R2CA 3QIUC 4PB9L 3BGMA 3CMOL 3IAQA 4NUJB 3IJSA 4XPTH 4Y5XB 4JFZH 1XIWD 4UAOB 2N4IA 2ZG1A 5FCUL 1AY1L 2MPAL 4ZSOB 3GUTB 3CH1B 2YBRB 5ANME 1JTPA 2XZCH 4OZFG 4YE4H 3VH8G 2OX5A 3OKOB 5EBLB 3BQUA 4KDTA 4X99A 2BY3A 2HVJB 4GT7A 4PJEB 5IT2L 1E27A 2ZG2A 3ZT7A 2DKUA 1AR1D 4NKDA 4A6YH 4UUJB 3U9PL 1D5BA 2Y5EA 5DZNA 3U9UB 1U36A 4I13B 2FEEL 2LAGB 3P4MB 3QUZA 1RPQA 3ZDXF 1FVEA 1GC1H 3LIZL 5GRJL 15C8L 4R4NC 5DMGC 3JZ7A 3ALPA 3OXRB 3DUSA 3MACH 2R29H 1IGYA 3BP6A 4Q6IA 2NXZB 4LAQL 3FFCA 3IFNH 4G6ML 4KK9C 2YHGA 1JK8B 2Q7YA 2Q86B 4MJIB 1I8IA 3O4LB 2KKQA 1TZIB 1UKQA 2QTEA 4OFPA 3HG1B 3RUGE 3SGEI 1I85C 1P84J 1MVUB 2BY2A 1W0WB 2J12B 4FTVE 4P59L 3HLAB 1Z6JT 2F8OA 3TFKD 4NQSA 2NPLX 3ULUH 4PJ5A 5HPMB 3D85B 1MFEL 2IANB 4MMZC 4OB5L 1QFUH 5KSBA 1YN7B 4RIRB 2DQUL 3WXWL 2RR3A 5HDLA 3L95B 4L8BB 3GI9L 5CD3B 3RI5F 2F5BL 4G6KL 4K55A 1FFOA 3FJTA 3FTGA 3SCMC 3VGFA 3IJHB 5AZEL 4UTAL 2P7TB 2OZ4L 3KYAA 2X10A 4MJ6A 1KCUH 3LDBC 1J05A 1CICD 1HH6A 5A2LH 2OL3B 4CBPA 5GXBB 3NIDE 1C16A 3C09C 4KK6C 4I2XA 5I1HL 1U42A 4HUNB 2R8SH 5L2KA 1M05A 2IMNA 4AQOA 5DJ2B 3ECBB 2IG2L 2ICWB 4S0TD 1I7UB 3PWJA 3RRQA 2ORBH 4M48H 3Q48A 1IEAB 4Y89A 2HWZL 1N64H 3G5YA 3CFCH 4P2OA 1A6WH 3AB0B 1S9VB 1JVKA 1OAYH 1BPVA 4ZUWB 1LK3L 1NGQL 3S37X 1MIMH 1QNZL 2AV1A 3GMPB 4Y5VA 3LKNB 2CDGB 5KVFH 3FQWA 4D9QD 1ULVA 3ARTA 5DRZA 3BP7B 1CD8A 4MYWB 3RZCC 3S88H 4PJCF 3GSXB 5HVWA 1IE5A 2AXGB 1AIFB 2BNQE 1MFDL 2E9JA 5B38G 1QFPA 1WFNA 2H3NB 4M3JA 5C09A 1HOCA 1J18A 4PRAB 1BGXH 5T3ZD 3ES6A 4GMTL 5C2BH 3HE7B 3QWRD 1KTDB 5EBGA 1FIEA 1N5AA 4NNPL 3SKNB 4PGJA 3RY6C 3W39B 4W4OA 2NY3B 3IU4L 4P23A 1JNJA 5FYJD 4AZ8A 1NBYA 4OD3L 3I6GA 5J06A 3O9WD 4P5KA 1UVQB 1H3PH 4ZPVA 2D7NA 3DX6A 8FABB 4KVNL 5I18L 1LVEA 1XGRB 3KDMA 4YXKL 5I1GH 3ULVF 1CICB 1P1ZB 2X44D 5IVZA 3THMH 2NX5A 4WHYG 2BX5A 2I9LA 1DN0B 4FABH 3IXTA 4K3JH 4OZGE 4JFDE 2VWEE 3EO0B 3K4ZA 4I3GA 4PY8J 4C56E 1CD1A 3QA3A 4N90D 1F4XH 5T33L 3V6FB 2HFFB 3BT2L 1DEDA 2C3VA 4IDJH 1TTGA 5HHMB 4APQB 1UH3A 4FZEL 4X5WA 5FDWA 3ROLB 2X4SB 2A74B 1A7PH 2D3VA 3IDJA 1BAFH 5CHNB 4WV1B 4HF5H 4RGNE 1DBAH 4RNRA 1VGEL 2X2YA 3EFFA 3LSOA 3VJ6A 1CF8L 3HS0B 2BZDA 3BP5B 4ZS7L 1BJ1H 3VGGA 3EUUA 3W5MA 3MV8D 2Y4SA 4XP1L 3VXSA 1MELA 4KDTC 5KS9E 1QR4A 1CG9A 3CVHL 3LEVH 3OJVC 4K7FA 4Y5YA 1I1YA 5F44A 1YQVH 2YSSB 4O00A 4MJ4A 4UB0L 4IDLA 2NY0C 1NGWB 1RZ8B 3RWEB 1KLUA 5EG6C 3BHBB 5GS3A 3ZTJG 4Q6IC 3L5XL 4JAMB 1FG9C 3DIFB 3U0WH 1QSFD 4YGVA 2FJHA 1D5MA 3WLBA 3O9WB 2A6DA 2WWMD 4PJIA 3D3VE 3EBAA 2F15A 1HQRA 2VWEC 1IAIL 3F5WA 3AM8A 5D5ME 4XPFL 4HPYH 2GJ6D 4CAGA 1U58A 3AREA 4OZGB 4CVXB 1AJ7L 4LPWA 4KMTH 3TJHC 1MOEA 4F3FB 2R4RL 5DJXA 1S9YB 4H25B 4XP5L 3GBNL 2A83A 4I3SH 1R6VA 4YK4B 4X6DA 5F6HI 4G7VH 4GG8B 4Y4HA 4XPAH 1XR8A 3GMQB 1T3FA 3VFTA 4ZO9A 3BRDA 5EO0B 4Z7VF 1JRHH 5IB4A 3QNXB 1YMHB 4FQXA 2JTDA 4PJDE 2DQFA 1MCOH 5FA3B 5DUMH 1G9NH 1NAKH 3S37H 5EIIB 1IGCL 2F19L 3QH3A 4NHUB 4PRNB 5EOCH 5I1EL 1IAKB 2Y06H 5KTEH 3RA7L 3BDXA 3JWOC 4NKOB 2IPTH 4HWEH 2XTJC 4IM8A 2NXYB 3LKPB 4UDTB 4MCYA 4POUB 5I8KH 5DRWB 3BAEL 4G80A 4MXQD 4G42B 5DVMA 4J3SA 4FG6D 2Y72A 2D31A 5JXAL 3TNNB 4PBWD 4P9HL 4QRQB 1ROWA 4HCRH 5CUSH 3H0TB 2V2TA 3QPQD 4KU1A 1MLBA 1QSFB 4L3ED 4BFIA 5JW4R 5GIRB 3I50L 4NRYB 3DSFH 3W5NA 3JUYA 1YMMA 2VR4A 1TVDA 3L3DA 4YDLC 3F65A 1I7TB 1BQHB 4XP9L 4Y88A 3U83A 2GJ6B 3TC9A 4BFEA 3IF1A 5I6XC 3A6CH 4YHNA 4QRUB 2UWEB 3VRJA 4XC1H 5EUOA 3BO8B 2DTML 4HIXH 3CCHB 1HHGB 4KUCF 4WI7A 1UH2A 4PJGA 3LZFL 3QFJD 4F7PB 5FECA 4JCMA 2ZWLT 3ZT5A 4KJQD 3WFBH 4LMQI 4Z78A 5CD5D 1A3LH 1NBZA 1WWCA 3X3FH 4W4OC 4P23C 3CSYA 1KB5A 1HILB 4OZHF 1NEZB 4NFDA 2HT3C 5IB5A 4XPBH 2BRRH 4RMQA 4HKXB 1OGAE 3D0VA 4ERSL 1M71A 4ZFFA 3N06B 3MGOB 2VISA 3I02B 1BJ8A 3NCMA 4UV7L 4ODHL 1L6XA 1MH5B 4ZD3L 1T0MB 1BF8A 4W6WB 4Q58C 5DD3H 1G9EA 5C0CA 1LO3H 4G7YH 4RMWA 4OM0L 4TVPD 5J1SC 1FJ1B 2E6JA 2DMKA 2D4DA 4HS3B 1YDPB 5JZ7C 4TNWK 3TVMC 3BN9C 1AI1H 5EA0L 3ZDYE 4R7DA 2X70B 5GS0C 2QKIB 5LAXB 1NCCL 2NY2D 1NCWH 5D93B 2C9AA 5AUMA 2B1AL 3WSQH 3MLUL 4N9GB 4M93B 4YUEH 5C6PB 2CIKB 4OF7A 3VFRA 5B8CA 5IIEB 1QVOA 3P0YH 3C08H 5CLWA 1UADC 5GJTL 5SV3A 3PDDA 1QFOA 3NCCB 3T2QA 1UACH 5I8CA 4L4VA 3QDMA 4ZOCA 3MLVH 3RX8A 5JORA 5FA4A 4LCYB 3C2SA 4K2UH 4Y5YC 3X12B 1IAMA 1BF2A 1NCAL 1BZ9B 3G08A 1F11B 4PGZA 5J9PA 1NC4A 1NMAL 3SN6N 1BM3L 3MBXH 2BVPA 3QFJB 2DYPD 3DGCR 5EZJA 4Z7NE 1CD9B 4PD4J 4GSDL 3VWJD 4D0CA 5DMIL 3DV4B 3S36X 4U1IB 5ABDE 1ONQA 2RQ8A 3DETD 4P46D 2HH0L 5H35B 4MAUH 4FFZL 4JZOB 1LP9F 4LHJB 3AM8C 3N50A 4DZBB 5HHOB 3QG7L 1FNFA 4PJ8A 4K3EH 3AREC 5ADPL 1OT2A 5HHPB 5CEZL 3GKWH 4P48A 1NMBL 1UB6A 3SBWA 1R3HA 4R0LA 1EHNA 2AJVH 3MOBH 4ONGH 4Y4HC 3VRIB 2GK0A 5F7DA 2AJXL 1UJ3C 5HVHB 2W59A 5CSBA 3VD4A 2VQUA 1XGUA 2NY2B 5HI4D 2QLVB 1NAMH 4L4TB 4NQVA 1XZ0B 2I60H 3FRPG 3BIAX 3E2HB 5FO9A 3AY4A 4GLRH 3BUTA 2ICWJ 4JPIA 4PJFF 4XWGH 5DQ9B 3C8HA 4L8DB 3TBYB 4MQ7A 3RY5A 1KIQB 2VIRA 5BMFH 1ADQH 2DQGL 3EFDH 2C3WA 3FB7A 4FFYL 3TT1H 5TDNB 3UBXA 3QEGL 1S5HA 3G04B 1A4KB 1LK2A 1QLEH 3NCYS 3KYMA 1JFQH 4UBDD 1MRFL 1YPZF 3C8KA 4X4XB 3WO4C 1CVSC 4W68A 2V2WA 2OBGA 5IKCA 5D7KD 2NQCA 5C8JB 2FD6H 2X1QA 5T1DH 1K5NB 2EH8L 1B6DA 1G7JA 4LVOB 3ILPB 4JZJB 3OGOE 1I9JH 2DQDL 4LGPB 4JY4A 1KIPA 2IQ9L 2Z4QA 3ARGD 3MCLH 5DRXB 3TCLA 5GHWH 4KKLD 4IOFD 4XTRD 1NLDH 3QDJA 4BSWB 4WY7H 3ZE2F 2A6IB 1F45A 1M7DA 1Z2KA 4WO4C 3UCRA 3GSWB 3RNQA 4L5FL 4DZ8A 1KCSL 1I4FA 1R24B 1W2KT 2R1YB 5E7BA 8CGTA 1NCBL 5IVNA 1I1AA 3VFWA 1RUAH 5GGSA 1S7TA 2WZPD 3UC0L 4GS7B 5DVNA 2FHCA 4NQED 4XNXL 4RA0C 4M1CD 4KI5C 4LAQH 1WBYB 1ZT1A 4UTBL 3BEVA 1Y0LB 5DD1L 2K9UA 3BXNA 5BV7H 2BNRB 4LVNC 2D7PA 2JELH 4LKXA 1NDGB 5IVXF 3GRWH 1F5WA 2FWOB 3FOLB 3VG0H 2YRPA 4MDJA 1MWAL 3PWVB 4QWWC 5J0BA 3MCKA 3G6AA 4GRWF 1A9BB 3G9VA 5D6DC 5AAWA 4PG2A 3SDCD 3D69B 1UYWL 2ZZUT 2OQJB 4PLJD 2VDRH 2EIDA 2BJML 3X11A 4OZIE 2RIKA 4L9DA 3BUYB 1R3JA 5JR1H 5BRZD 1S78C 1UQSA 4JY6B 4QLRA 1JF5A 1CXIA 2NY4D 2Z8WC 1R0AL 4MMXC 3JUZA 1MCCA 4JPVL 1RMFH 1U2HA 4XI5D 3ARGB 3B8YA 3FCTB 3DUUB 3SDYH 4WTXA 4YIQB 2M2DA 1OF2B 3K2UH 1F90H 3PF2A 4JFFD 3S4SA 5B8CC 4YHPA 3VWKA 4UNTA 3MXWH 1LILA 3NA4A 4IIQA 4OKDA 5DQJB 1ZHBA 3MREB 1FGNL 1N2RA 3ELAT 1Z5LA 3S6CA 3OKDA 4G3YL 4TOYH 3MNVB 3L9RB 1KELL 4PR5A 2Q87A 3G6DH 1ZGLB 4NQEB 4JFYA 3CFDB 5I15L 4NN6C 1AE6L 4CVZB 3KPQA 1RJLA 1PG7X 2CKBA 4S2SB 4PFEA 3QUYB 4HGKC 1YJDH 4K8RL 5DI8A 1EGJL 1QNZH 1FNEA 1Q0XH 2Z8VC 1CL7I 4R8WH 3KPSE 2VERN 1U8KA 4DCQA 4CW1A 5K33A 4FXLA 2CH8A 4OLXL 4UILH 5HYJA 2V7HB 4HT1L 4OBRA 3PWUA 3P77A 4ONHB 3RGVA 2VDLH 2ZKHL 3H3PL 2MHAA 2HRLA 3I6LE 2E7MA 4R0LC 3SBWC 4GUPB 1PY9A 4G5ZH 2X9XA 3H9ZA 1KJVA 5IGXL 1J7VR 4TSAL 5D7LA 2NY4B 3IDNB 5E9DA 3IDXL 1FL5A 3VFSA 4LKCA 4Y7MA 5BVJB 1X4YA 1TVBB 5C0BA 5DJAB 2Y7QA 2OL3L 25C8L 4X6CA 3AY4C 5BQ7B 3V6OE 1JN6A 1PX3A 2X89D 4JFFB 2V5MA 2YMXH 3T0BA 1ZTXL 4WHTA 3I9GH 3SQOL 3DV6A 2F54A 3O2DA 2DIBA 2CDFA 3CZFA 3E6FA 3I3EA 1E4XL 4JVUA 2F8XC 1OGTB 2DQTL 3EHBD 3O2VL 3ZZ1A 4MD0A 3SY0B 3QXAB 3SGEH 4K94H 1EAPA 4MJ5A 1GGTA 4NO0D 5I76B 4U1GC 3MUHL 4ELKB 5I16B 4ZUTB 4AL8L 3V52L 4HLZG 1NH6A 4QY8A 3JTTA 2E8YA 4ZS7H 3VMOA 4HGWA 5F3BA 2VDPL 3MNWB 4WUUA 1GAFL 4XP1H 3ZL4L 4NO2A 5SWZE 5BS0E 1S8DA 4WDIA 3C5ZD 3CX2A 4L29B 3QR2A 1ZLVK 4NBYB 1S7UA 1QA9B 1I1AC 4KTDH 1CGXA 2O26U 1AD9B 1UENA 1QFWI 4FQ1H 2EXYC 1O7SA 5L7XL 2QL1A 1EJOH 4R7NB 4QRPE 2XZAH 3LRSB 2XKNA 2YD1A 1INDH 2D9CA 2P5WE 1JHLH 2YK1L 1T04B 5L9DL 3TN0D 3VW3L 1FFRA 2AQ1A 4E41E 3T0XA 1A2YA 2HLAB 3B43A 4G6FB 5CGYD 4Y2DA 5EPMB 4F8QA 4NFCA 2MOVA 4MDIB 1NCNA 2FCBA 1A6WL 2HFEA 4PG2C 4TRPL 4XMPH 4BQ8A 5CCKL 4JHAL 3MA7B 1NFIB 3MSPA 3A6BH 3SE8H 4M8QA 5C3TA 1OLLA 5C0JB 3CFEA 1F3JB 1QKZL 3CVIH 1H3UA 2VXTH 4NO0B 3LD8C 5D72H 3MUZ1 5C0ND 1NUFA 1NGYA 1OQXA 1IC7H 4PJXA 1CU4L 3NA9L 3MJGX 5EUKB 5F7UA 3DARA 2JCCA 3NTCH 1VPOL 1HSBA 1JJUA 1ZVSB 4X9FA 3KPTA 1MI5E 4HUUA 3WDHA 4N8VA 4QRRB 1JZ8A 4P3CH 1Q8MA 4CVUA 1MF2H 1JI2A 1YUHB 4HG4J 2HJFB 1V3MA 2XQYG 3C5ZB 5JHDA 1JGVL 2H6PB 4LPYA 5IBUG 4IIQC 3ZE0E 2CLRA 3BZFB 4WTWA 3TIEA 1FFPA 1BVKA 4H8WC 4XBGB 5T3ZL 1KPVB 4W4NA 5E6YA 3GK8L 5E8EA 1DQQA 2ZUQB 3MLWH 5C9JA 2JB6A 3DVFA 1X5HA 1T03L 3DLQR 2I9TA 5FYJL 4XH2B 4OGXL 2NY6D 3HE6D 2UZIL 1Q9KA 2CPCA 2V5SA 1X5FA 2PN5A 1ZLUH 1LNUB 3K74B 1P7QD 1FLTX 1RZJH 3QO1B 5FV2A 3VI3F 1A6TA 3WHXB 3DMMB 3TH2T 2B39A 2CRZA 4LRIA 3KLSA 5IBTH 4BSVB 3NCJH 3NABL 3DX9A 3RGVC 3WIHH 5F1SA 4BH7A 2X7LA 4PJ9C 3UO1H 1Z9SA 4M7LH 3KLAB 2RFXA 5I74B 1JL8A 4WI6A 3IGAA 1AQDB 2W60B 5DS8A 3JXAA 1JUFB 12E8H 4YHOH 4I18A 3ZTNL 3EIFA 1FVDB 5IV2A 3HFML 4MNQD 3FO9B 4C57C 5HI3D 4QHUB 4JQXA 3JV6B 3MRLB 4BQ9A 1BQUA 3TBWB 3RL1B 2GITB 2VXSL 3QDGE 3FOMB 4OFIA 3ESVF 1VEPA 2B2XL 5TJWK 3WE6B 4OKVA 1X5ZA 1JWUA 2X4NA 3HE6B 4NDMB 5E2WH 5HYQA 5IMLB 1I8KB 2CRMA 3V4UL 1DZBA 3MRQA 3N1MC 1RK1A 5E7FA 4J1UA 5K9JL 3RKDC 4FQIH 5I71C 1VKXB 5IESL 1P7QB 1QSED 1FDLH 4HWBH 1N3NB 5CZVH 3HB3C 3MRHA 4HJ0C 5M94B 4QXUL 4L4JA 1LEIA 4NUGH 1EFXD 1ZA6A 3DNKA 4NQCE 4S1SL 1Q9WA 1A5FH 2AEPL 4P3WA 3I2CL 3DSNA 3NZ8A 3O6FB 2WV3A 3LMJH 3GSOB 4IOIA 4M61B 5JO5A 1QYGL 1NMAH 2WBJA 4YHYB 4F8TA 1HSAB 5A2KH 1FFNA 4LOUC 3Q3GB 1ND0A 2J7LA 5GSRA 1KLGB 5EU6D 5E99H 4L8CA 1SYSB 2FYYB 4LEOB 2R0LL 5ICZA 4N8VG 4Y2DC 2JJVA 3O3UN 1FLRL 3OR7A 3QJFB 4ZO8A 1NKOA 2FJGB 1M6OB 1FZOB 1TVHA 2VDML 4XAWH 3MUGA 2IFGA 1SHMA 3VGDA 1DBKL 1ITBB 2AK4D 4AT6B 5EBMA 5EORL 4L8SB 1WCBB 3BH8B 1DLFL 3PQYB 4M7KH 4XCFH 2WSKA 4N1HB 4MSWB 4K9EH 3ARUA 4J3UA 1F58H 7CGTA 4JREC 4W6YB 5TE4L 4PJHA 3PP4H 3R8QA 1JWMB 1P4BH 5CEXA 4KQ3H 1SJHB 4JFEA 4CMHB 5HGAB 2DBLL 1NBVH 3EZ8A 3QIUD 2NW2B 4RFEB 1EFXB 3VD9A 1QQDB 3KLHC 3TF7C 1KB9K 2PCPB 2EDRA 4QF1A 3VXRE 4IS6A 1NDMB 1VFBB 1S9XB 3VXUA 2E8ZA 4WW2A 4PTUB 3MRCB 3ARBA 5E00B 3CLEH 1UCBL 1CZ8H 1VADA 4FN0A 5DJDA 1KLFA 1H15A 1ORSB 2B20A 3QO0A 4P49A 4YFLF 1ZLSH 5D96C 3VXTB 5CINL 5KSVB 4QOKA 4OQ1A 2GYSA 4QHKI 4R4ND 3JWDL 1EVTC 5DMGD 4N0UB 2FSEB 1MCLA 2XQYK 1C7SA 1MHHA 1XF4B 4YH6A 4YBHA 1UZ8B 3HNVL 3MV7E 4KVCH 4RGOL 4LRIC 4E0RA 3BW9B 4KK9D 4EN3A 1GGCL 4UI2A 3UXFA 2FO4A 2AK4B 3KVQA 3QFDB 1FN4B 5BO1H 3WIFB 3LEYH 2HKFL 3MV9A 2GUOB 1AHWA 1QSZA 5FDYA 4MD4B 3I6KB 3BSZH 3BOVA 4YHIA 2W1NA 5HBBA 2HA1A 4I18C 2V5TA 2HKHL 4YO0A 3QIUB 4YXLL 4JPKH 1MCWM 1FZJA 2P8PA 3L7EA 2LFGA 3ILQD 3K46A 3SCMD 1IAIM 1LHZA 4DOHE 3OKLA 4HZAA 3MTRA 1W72A 2G9HA 3HZVB 1AGFA 1IQWH 4QCIB 2ADIB 3MRFA 3TBTA 2VC2H 1CFNA 3V0WL 1WFUA 4KK6D 4OTXL 4MLIA 1DBJL 5B39G 1AXSB 4HJGB 1A14L 5DHVA 3CK0H 5F7KC 1F4YL 4LPVA 4PBXA 4EVNB 2B1HL 4OFDA 3KXFA 4NRXA 3QUKA 1ZT4A 4KXZH 3SDDB 3IFOB 5EBWA 2ITDB 5F9WC 3V6ZA 3RX7A 4KFZC 2ESVA 4XC3H 4JO4L 3UTZA 4O58H 1BBJA 2GQHA 1QFHA 1T1XA 7FABL 3UTPE 2JKXA 5ESQB 2LTQC 4OZFB 5F7EL 5KAQF 3WIIL 1G7IB 5ENWB 5LGJA 3VGEA 3WO3B 4KJYA 1XCQA 3BKCH 4F58L 3RZCD 3B2UC 2L7JA 2BVOB 2OS7A 3UBXI 3LEXA 3PV6B 3ZE1F 5JTWA 2VLJA 4YXHL 4MNHB 3PL6A 2YD7A 3D39B 1V7NH 4LLMB 5ADOL 4OFYA 1EO8L 1A0QL 2YUZA 1JHKL 4I77L 4BZ1L 1D7FA 1OQOA 4QT5B 3WNPA 3S36L 3IJYB 1CDCA 2HJKB 3RTQA 1KJ3L 5IJVB 3SCMB 1BFVL 5I66B 4R90L 3FONA 5EH1A 2ZJSL 3FB8A 3LDBB 4I8DA 5K9OB 2FL5A 3QUXA 3GSNA 1LEGA 1S7RA 1SJVA 3IU3A 4WUKH 1X4ZA 3C5SA 1RIHL 5EZIL 4ZAKB 3JTSB 4PGEA 3C09B 1X7QB 3AAZA 3OPZL 4HKZA 1JWSA 1NFDB 4YDIL 5GS1A 3IYLW 4OGZA 4PRPD 4M7ZC 1Q9OA 5HY9B 5HGHB 2DQJL 1A7OL 5EOQL 4MCZA 1XCTB 5DQDH 3CSPA 5J89A 1C7TA 3K7UA 1L0XA 3F6LA 3IDGA 1PYWB 1U91A 1S7WB 2NR6C 4QRSA 3OKKA 1TTUA 4ELMA 4WEMB 3MRDA 5J1TC 1I1FA 1J5OL 4P57A 5TE7L 1SYVB 2EEDA 3FT2B 4ZUUB 2NY1C 2H32B 2ITCA 5ACZA 4UNVA 4U0RC 5E70A 2N7BA 4WW2C 5DMYA 1PVHA 3HMWH 2NYYD 1FIGH 4Z0BH 3O3DA 3H42H 3KS0H 1RK0B 1CFTB 3RZCB 1AD0B 1IGTB 1A3RH 2IADA 5IFHH 2H1PH 4J8RB 1GAFH 3QNZB 3MRMA 1GZQA 1Z9MA 4LIQE 2WNGA 3D1MC 5IK3B 2X5PA 4D0BA 4YEEA 2F53E 1IJ9A 4H1LA 5TDOB 2VAAB 3AS0A 3TA3A 2NZ9C 3H9HB 3CX5J 3FFCD 2CK0H 5CSZA 4WEBL 3W9EB 3QEQA 1XF3B 1OPGH 3IKCA 3L3KB 4M1GL 3IDYB 1T83A 5BXFA 1MRCL 3CC5B 3KPOB 1MFAL 3TJHD 3VMPA 3KJ4C 4PRPB 1AHWC 1MHEB 2BOCA 5B38B 4TUJB 4PJ5D 3VXMA 4NZJA 5KSBE 3D9AH 3HUJB 3RZWA 5DK3A 5F6HJ 4P2QA 2R39A 2Z31B 4OLYL 3BI9X 4CU8A 2OR7A 3BGMB 2C3GA 2X4TA 4RA3A 1YNKL 3IJSB 4G9FE 3DXAE 4OCRL 2R23B 1IGIL 4JRYE 3LRGA 3QISA 2VZOA 4F9PA 4HK0A 5E8DL 3UJJL 4S1QH 1CGSL 1RHFA 5EU7C 1BHGA 1PLGL 2WW8A 5TF1H 1KOAA 3U0TA 4PJAF 3BESR 4M1DH 4YPGA 4Y8AA 2Y36L 4JHZA 2C3XA 3L1OL 5LCVH 4P2RA 2FBJL 4X99B 1VPOH 2XTJD 3LN4A 1E27B 1JPSH 3O6MH 2QADC 2VL4A 1U8LA 1OM3L 5L2KD 1FE8L 4BFGA 3WFHA 3LQAH 1D5BB 2IMMA 1RJYA 4C83A 3TH3T 1KCRL 1ZLWK 1FVEB 2NY0B 1X5JA 1D9KA 5DZLA 5L88L 4CN6A 4Y19A 2DM2A 3HAEA 4X4ME 3DUSB 3BEWA 1IGYB 1UG9A 2DM3A 3BP6B 3F58L 4Q6IB 1J8KA 5EO9A 3FFCB 3V5KA 4H20L 2OP4H 2QQLH 3AS3A 1FV1A 2Q7YB 4NQUA 1I8IB 4TPRL 4XNQA 3WFEH 5JXEC 3EYOA 4OLZL 3NGBB 4NZUL 1HIMH 2UWEF 5CIPH 4CUCA 1RZKC 4HPOL 5BVPH 5GGRY 4JFHE 4PJ5B 1VFMA 1F3DJ 4S1DC 2X1XR 1TZGL 5C09E 3PL6C 5KSBB 1ZVHA 1PG7L 4AEHH 1MCIA 2A77H 2RCSH 3KNBA 1DSFH 2ZUXA 3PNWA 1FBIH 2R56H 3GI8L 1FFOB 4P23D 3RTQC 4NO5A 2HT3D 3FTGB 3NPZB 4AENA 1RV6X 4IRZH 3AS2A 4MJ6B 3QPXL 1MJUL 1N0XL 4Z7UA 3B3IA 1J05B 3QUXC 1HH6B 3B2VH 2NX5D 3HMXH 3WD5H 3GJFH 2XTJB 3DVIA 1C16B 2QSCH 4I2XB 2F58L 5I73C 1QFWH 5GS1C 1M05B 5L2KB 4HS8L 1RUMH 2UYLA 3DX7A 1HXYA 1WGOA 4UOW1 2VXVL 5FFLA 3U1SH 5DLMH 1WVZA 5JZ7D 3QG6A 3G5ZA 3TVMD 1WFTA 3BN9D 4JG0L 1K6QH 4KHTH 3G5YB 4JRXA 5GS0D 3WXVH 4P2OB 2O5ZL 2VXSH 1FGVL 1C1EL 4DK6A 2BCKA 4YR6A 4PIRF 1S7XA 5JNYA 4YDLB 2IC2A 1XGTA 2ZCHL 2AV1B 3QUMA 4Y5VB 4EUPG 3VXSD 1AKJD 3RHWK 3FQWB 3RWIA 4TTGA 4YHKH 5DRZB 2EEBA 4ZFGL 4FFVC 2LVEA 2BVUA 1N7MH 1ZEAH 2J8HA 5D9SA 3MR9A 4AM0A 3EYFA 1NLBH 3D18A 1BFSA 1HOCB 4I0PA 4GAGH 1E28A 1N0LA 1OLZA 3PHSA 4YWGL 3ES6B 3INUL 4S1SH 2DI9A 1MFCL 4IJ3C 1RUPH 1N5AB 1G6RH 4HIIA 4DKFL 3TA3C 4H0IA 1EERB 1OGAD 4P23B 3HZYA 1NBYB 3CZJA 3I6GB 3V5HA 4P5KB 4ZPVB 3VGHA 3DX6B 4NUJA 2MFNA 3KDMB 2ATKA 2HT4C 5FUZL 3MLRH 5IVZB 2NX5B 3VD5A 1T83C 2I9LB 1J1PH 5HHXL 3IXTB 3N1GC 3UAJD 3ARED 3G6JB 1UWGH 1XGYH 1CD1B 3QA3B 6FABH 2HMIC 4LU5H 3A67H 4LF3B 1I3RB 2NY7H 1Q0YH 2LVCA 3MC0A 2C3VB 1X4XA 4X5WB 5FDWB 5DHXB 5EWIL 1KTRL 1KENH 3MRPA 2IFFL 1NUNB 4U7KA 1KUMA 1MJ8L 1SBSL 1SM3L 5C08E 1O5DT 2DIJA 4LSRL 3TIDA 3EOAA 5GSVB 2HFGH 4F9PC 4RNRB 5H37H 3EFFB 3VJ6B 3LSOB 1GOGA 5KVDH 4LCCC 1OAZL 3VXSB 1WFOA 4KAQL 4L9LC 1AKJB 2IAMD 4ZOAA 1YEFH 2CXKA 2EKJA 4NJAL 3CFJA 1CS6A 1CG9B 4U1MA 3JSSA 5IMMA 3T0EA 4K7FB 4Y5YB 1I1YB 3FQUA 2O5YH 2W65A 2EH7H 1D9KC 1QO3A 1EEQA 3UPRA 1KLUB 4NKIH 1WZLA 1YYLH 3IKKA 5D70L 4YGVB 2FJHB 1D5MB 3WLBB 5I8OL 5GGTH 4NP4L 2A6DB 4WO4D 4PTTA 4PJIB 1J9CT 1KCVL 2HRPH 1YEHH 4HAGA 1HQRB 3F5WB 3R06A 4KGLA 1XIWA 3RU8H 1BZQK 3WNOA 2W9EH 4NWTH 1U58B 3AREB 4NHCL 5K59F 1F00I 4LCWE 5DJXB 4MXWH 4DGYH 1QRNE 2A83B 3O6KH 1UWXK 4RFOH 3FHAA 4PS4L 4X6DB 1MJJA 4JHWL 4Y4HB 3T4YA 1XR8B 2CLVA 5F9OL 4KI5D 1PX4A 1T3FB 2ADFH 3VFTB 5T5FL 2IH3A 4PRHA 2EDLA 5IB4B 2E7CA 4FQXB 4DEPC 1HKFA 4Q7DA 2DQFB 4U2YA 1OD7A 3ZYJA 3CU1A 2GSIA 3CUPA 3QH3B 4QWWD 4O2CA 1FRGH 4XP4H 5I1CH 4O9HL 3GBML 5BW7C 2W9LA 4XNZC 5D7IE 1FVCA 3MROA 4RWYH 2BVYA 1N8ZA 1MCPH 1U3JA 5JQ6H 4LCUA 4PUBH 3PP3K 3ARFC 4NBXB 5C0CD 2ARWA 4WHDA 2BY1A 4G80B 4AEFA 1IC5H 1NANI 1YEKL 2HKHH 3WO4B 4AH2A 1S78D 1IGJA 3S3SA 4YXLH 1DEEA 5KW9H 2D31B 1DQDL 1FNAA 3HC4L 5BZWA 1JBJA 1BEYL 5I1JH 1P7HL 3QZWA 1XR9A 1NC2D 2V2TB 4WW1A 1MLBB 4HIJA 4BFIB 1YMMB 3B5GA 3L3DB 4RWHA 1BD2A 5JIKA 3TNMA 1T2JA 2BXYA 4LSQL 1Z9OA 3IF1B 3B9VA 4L4VD 5C6TL 4HIHA 1I9RL 3QDMD 4YHNB 1P1ZA 5KVEH 5FAAA 1RFDL 3VRJB 5EUOB 2YPLE 1I9IH 4I9WE 4TUKL 4I0PC 3MXVL 1Q94A 2W9DL 4PJGB 3SKJL 1OCWL 3WLWC 3WS6A 1AFVH 5FECB 2QHRH 2ZG3A 3NPSC 3MRRA 4Z78B 3P0VH 3GZKA 1T6VN 1NBZB 4K7PL 3CSYB 3ROLA 5IB5B 1EHAA 3S5LA 1EPFA 3D0VB 1M71B 4ZFFB 3P4OA 3FO2A 4WV1A 3QCTH 2VISB 5A43C 2I5YH 2FGZA 3B9DA 9CGTA 4LGRB 1IGMH 3RAJL 3LH2H 2YD6A 3F7QA 3HS0A 1QR1A 4F80A 1T89A 5C0CB 4AIZA 3EYSL 1FSKC 1GC1C 2PXYA 2Y07L 5D6CB 1CDBA 2FLBT 3LS5H 2AJSL 2VKXA 2ILLA 1KEGH 4R7DB 4OD1L 2Q20A 2W0KA 1KPUB 5D2LB 3TZVA 1EAJA 1A8JH 5AUMB 1L7TL 1IKNA 1A64A 3ZDXE 3O2WL 3DECA 1I3GL 3RPKA 3VFRB 5B8CB 1QVOB 1X6LA 4PLKD 1GIGL 1T2QL 3NFPA 5D7SL 2VUOA 4DVRL 3S34L 2CUHA 5T3XD 4B0MM 4UDUA 5I8CB 2CO7B 4L4VB 3QDMB 3ULUC 3K8MA 5JORB 4XBEL 3RWGA 2R15A 4P2YA 5FA4B 2O5XL 3T0EC 3RWHB 5GRYA 4QXGH 4U6HA 4UIKH 4GG6A 4MQTB 4OJFH 5FHBH 3DGGA 3G08B 2MCG1 4NN6B 5J9PB 1A7QL 1NC4B 5D8JL 2BVPB 2AABL 2VXQH 2R4SH 5EZJB 5HHVL 3OB0K 4LGSB 3KPSD 4IHOA 2NMSA 4JKMA 2APXA 3QDJD 4JO3H 1ONQB 1YMHA 3C6LA 3P73A 2BDNH 2P24A 5GGUA 2GCYA 4LLUA 4ZTPH 1EK3A 4PJ8B 3DTXA 4IRSD 4LCIH 2QBWA 3LAFA 3MV8A 1G1YA 1HCVA 1UB6B 1R3HB 4R0LB 4PJAA 2H41A 2EXYD 5EFIA 5T1KA