1BWMA

A single-chain t cell receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
249
structure length
249
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLGSDYKDDDDKRSGGGGSGGGGSGGSGAQQQVRQSPQSLTVWEGETTILNCSYEDSTFDYFPWYRQFPGKSPALLIAISLVSNKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAATGSFNKLTFGAGTRLAVSPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALPHA-BETA T CELL RECEPTOR (TCR) (D10))
publication title Structure, specificity and CDR mobility of a class II restricted single-chain T-cell receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bwmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bwmA02
3O11A 5T1MB 4L9LA 3C08L 1HEZB 3MODH 4IEFB 3S35L 4ZXBC 1WSST 1U8PB 1P5UA 4FMFA 1AGFB 4H5SA 1D5IL 1C12A 1E28B 1B0WA 1OARL 2X44D 1A14L 5EBWA 3CVIL 3UYPA 4YDKH 5EFIB 3UTPD 3BIKA 5EG6C 5DYOA 5DHVH 5BS0E 2P45B 1HXMA 3BJLA 2DM2A 3QEUB 1HI6A 4OCYL 2D9CA 4LSPL 4GUPA 4LASL 4P2QA 3EIFA 4D9RE 1HSAB 3VI3E 1EEQA 1MCEA 1QLRA 1EEYA 2W0FA 3BWAA 4WGVB 3SGKC 3HC3L 3C2AH 3TV3H 1PKOA 3HE6A 3O4LB 1XCQB 4CMMA 2Q20A 3HN3A 4OQTA 3CCHA 1CGVA 5TH2B 2CUHA 4KVNH 1HQ4B 1RJLA 3MJ8B 4JY4A 4PRIA 1A22B 2AQ2A 3ZT5A 2PN5A 5DJYB 1RUQL 8CGTA 1QBMH 4XGZB 1NBZB 2NX5A 2FGWH 4PRDB 3BKYL 3FOMB 2R2HA 3BPNC 4I1NB 3U30B 3T0WA 1NUFA 2FYYA 3PGDA 4NQEB 1KULA 4EN3D 2V7HB 2MHAB 3RWGA 4XPGH 1IJ9A 1EZVX 2ZCHL 2X89A 1A6WH 2VLLA 2MJWA 3NVQA 3ET9F 4DGIL 3F7VA 2QADB 3SDXF 5IJVA 3RWFA 3HMWL 2PXYD 2YC1A 1L0XA 4XZUB 5IFJA 4L8SB 1GJIA 1CDJA 2V5RA 4L3CB 4WENB 1MJUH 3CVHL 3W2DL 3HTLX 4FN0A 1BWMA 1CD1B 5DLMH 2Q8AL 4MNHB 3GJFK 1DBAH 2X4OA 4M03A 1CE1H 1DUZA 4KJYA 4MX7B 5IVZB 2EYSB 5EIQA 4OI8A 1KCVH 2EIZA 1F8TH 1ZVYA 4KAQL 2VXTL 1KBGH 3D87B 3O3EB 3CXDL 4DGVL 1W8NA 5K9OA 5HYSG 5GGQL 1FCGA 3N1PC 3BAEL 3H7BA 5HVWA 3GBMH 3TCLA 1F4WL 3ULVE 1Z0MA 1FZKB 4R7DB 4KROC 3ROOA 4DCQA 1NCAL 2GTZB 2J8UE 4P99A 3T0DA 3MV7A 3WNLA 3QAZB 5D1ZC 2HKFH 4LPXA 3DRTA 3U4BL 2X4TB 4P5KB 2Y72A 5J57B 1IFHH 2N4IA 3EHBD 1G6RB 1BF2A 3E1F1 3TA3B 1H3UA 5CEYB 4UNTA 1FGNH 1I3RA 1NCTA 4HC1L 3OB0H 2N56A 4RNRA 3VFWB 5ACZB 3CDGB 3DVNB 4JDVB 1FRGH 4H1LG 1R24B 3FN0H 1IAOB 2DICA 3X12A 5KSBA 1SMAA 4HUWB 3E8UH 1Q94B 4M61B 4JFFB 5LGJA 1CFSB 4XPBL 4I3RH 1JP5A 1NGWB 3K4AA 5HI5D 2IGFL 3GRWL 4K9EL 4LRNH 2CRIA 3ECBA 3CFJA 5C0DA 3LKOA 3UTPE 3MRRB 5K33A 4I18C 2NNAB 3X14A 5F1SA 4JREB 4XCEB 4GKZB 5FDWA 3MNZA 1S9YA 2E9BA 1LE5B 1EEZB 3O41B 4ZSOE 2BVPA 4JKPL 1FIEA 3B9AA 4X5WA 3QHFH 2IANE 5FKAB 5D1XA 1EH9A 1DQJB 4NUJA 4ONFH 4IIQC 3ZSTA 3LB6D 1ZVHA 4MD4B 2QV2A 5HYJD 5IB4A 3BZ4B 1T4KB 3S4SB 4TUKH 5EO1B 3NIGE 2YMXL 1YYML 3EAKA 3SE8H 2ATPB 3MACH 2AXFA 4TRPH 3S34H 1RZKC 1NGYB 3RKDD 5JORB 1INQA 3BMWA 4PLKC 4R0LA 3I6KB 2GITB 4K7PY 4YHIA 2XOTA 2XTJB 5JOPD 2FDBP 1JZ8A 2P5WD 1OY3B 3F6LA 4P2OB 1S8DB 2H26A 4M93C 1L0YA 3KPQA 4OLXH 5LG1A 3VXRD 1RIHL 2BJMH 3RWCA 1HKLH 4JZNB 3CUPB 1KGCE 1LEGA 2YHGA 5TDOB 3ARRA 4P59H 4ZNEA 2XA8L 5DDHB 2ED8A 2IADA 4NM4L 5A1AA 1U58A 3MUY1 4LSQH 2R23B 4ONHB 1YEIH 3NACL 3B8SA 3O6FD 3CXHK 2E7LA 4JAMA 2R4RL 2BNRE 4WY7H 4GJTB 1G6RH 3LVEA 5FA3B 5T3XH 4NRZA 5C09D 4HPOH 5DD0H 3ZTJH 2BSRA 1JF6A 5JHDD 3BRFA 5CJ5A 3ULSA 2XACC 5FOBA 1YNTA 1NCDH 4CU6A 4HWEL 2BXZA 1FORL 2KQMA 3KXFB 1G7IB 2X4PA 4HDIA 5JR1H 6FABH 5T5NG 1NGZB 3BP7B 1NJ9B 3NFSL 4NWTL 1BQHG 1MCOL 3ZE1F 4JQIL 1MFAL 5CZXC 1OF2B 4QOKA 4TSCL 3O81A 3S96B 1DANU 2NCMA 5E5MB 1D9KA 5EUOA 4IDLA 3RTQC 5B4MD 3HR5B 2O5XL 4R26L 1TQBB 5FK9A 4UIKL 3T8XA 3HI6H 2AV7B 2HT3D 3WNMA 2DLEA 3PQYB 4Y1AE 2W60A 5FM5O 2JB6A 3V5KA 4F8TA 3BN9D 2VDQL 3BGFB 2DQDH 4GLRI 1T2JA 3FN3A 1NAMA 5BVJB 3JV5A 4ODTL 2A74A 3I3EA 1JPSH 4B7LA 1DN2A 4RGNB 3KNBA 3QYCA 2Y5TA 3P4OB 4PR5A 3CPLA 4S1DC 3SDXA 1QHOA 5GS1A 1NQBA 2ADFH 4JN2A 5SX5K 3IFOB 3LS4L 2UYLA 4F57H 1S7XA 1RULL 2F19L 4EI5C 4LPTA 3WL9A 4LVHC 4YXHH 2PR4H 4FXKB 4F9LC 1I1AB 2P4AB 2XN9E 4N90D 4FFVC 4M00A 2NY5L 4TVPE 3I75B 5AWNH 4FZ8H 1JHKL 1YPZB 2PW1B 1IGTA 4K3EH 5I8OL 4P23C 3O2DA 4G8GB 3MR9B 3T0EB 2AVGA 4ZDHA 1B2WH 3VD3A 1MIEH 3C5ZB 4HULB 2P42B 2R4SH 1CFNA 1ONQA 1QQDA 3T65B 1MCNA 3VRJB 4HG4J 2OJZL 3B4NA 2XWBA 4NBXB 3KPLB 3QUYC 4R3SA 3UJIL 5ID0A 4LHUG 3IETB 1BFSA 1I1FB 2E6JA 1DDHA 1I3VA 1U8QA 3ARBC 2EE6A 4DKAA 5B22A 3C60C 1T6WA 2D0HA 2IQ9L 2GK0A 5FECA 5GRJH 4OZFA 3SE9H 1K9TA 5FKPB 1A9EB 2VIRA 5CZVL 4HPYH 2D7TH 1UA6L 1MHHB 4AEIL 1H5BB 1Q0YL 4F58H 3DSFH 3T1FB 1PSKH 4L4TE 2SEBB 4TQEH 3TM6A 3NAAH 1YQVL 1A6TA 3TT1L 4HMEA 5GS0H 4S2SB 1CL7H 4RAHA 2DQTL 3QIUC 1AHWB 4XMKL 3CJJA 3FO1A 4BFBD 2WQRA 2DM3A 2QKIA 3GJFB 4OZ4A 3BQUB 3G04A 2WZPD 1QNZL 3SOBH 4HIXL 4E41A 5JW3L 2EKSA 3EO0A 2HFGL 4OIBA 4XI5C 2HJLA 1XIWD 5LWYL 5C07A 1MRFL 5IGXH 1EO5A 3ZKXB 4DN3H 5EO0B 4PY8J 5TQ0H 3EFDL 2IMMA 1AXSA 4KTEL 2VLKA 4YJZL 4MNQA 4QXWA 1FLRL 1A3RL 3ARTA 5KBNC 4WFED 2W0PA 3C9NA 3OGCA 4YGVB 1JGVH 1WV7T 2FX8H 3QDGD 4ZUVA 4OLUL 2ZOLB 5T3ZH 2B20A 4OFDA 1ZS8A 4HV8A 1OAZH 2DYPD 5DMYA 1PZ5B 3HMWH 4J3OC 1A7QL 1IRAY 2JE8A 1RI8A 3RWIA 1CFVH 4Y16A 5BW7C 2ITDB 2A6IA 4NCDA 5E9DE 3SBWA 2F53B 5GGVH 1EERB 2GAZB 1ZLUK 4NQSA 5I74B 2C3XA 2CJUL 3HB3D 1NGQL 1MREH 4AQOA 4KK9C 5DUPL 3SKUD 5ALCH 3VXRA 4GAYB 5F6IB 3VXOA 3QIWA 4YR6B 5INCB 3DV4B 4JFDA 3OKDA 1BAFH 4HT1H 1KT2A 3HG1E 2F54B 5DT1L 2VQUA 5LAXB 4NKMB 5C0JA 3P77A 4KK5D 1EHLL 3RWDA 3N1FC 3FTGA 5CEXB 5MEQB 2HWZH 3KDMA 4NQCB 2WBKA 5D7LE 4DOHE 1E6JL 1CF8H 1AKJB 1G7MA 5CBAA 3KR3H 5E1AB 4YHKL 3KYKH 5HGDB 4JFED 3DX6A 1OWRM 2ICEA 3HPJA 1IKFH 3KPRD 4C56E 4U0RB 3MJ6A 1XCTA 1QHPA 3WKNA 1H8OA 3TYGL 1WWCA 4F2MA 4OM0L 5I73C 1DVFC 2PTVA 4PJ8D 4RQQA 3NBNA 1TZHA 5CKGA 4Z77B 3DUUA 3RWHB 2DBLH 4PG9B 3ARZA 7CGTA 5GGRY 3MLRL 2DMKA 2J88L 2Q86B 1I8MB 4ZOBA 3PHQB 5FO7A 1I7ZB 3UMTA 3VD7A 3TBTA 1FH5H 2H1PH 3U6RA 1QSVA 3I2CH 5T5NF 1G7HA 4IS6B 5FYLH 4Z5RA 3GJFH 4AH2A 3BKML 4Y5XB 2YD5A 3BDYL 5HDBE 3TBVA 3MNWA 2WLZA 2Z31A 3MBEB 1JNJA 1M6OA 3DYPA 5E99L 3QUZD 4JPWL 4X4YA 3HNSH 4OZGF 4L8DA 5I1EL 3AS1A 4YBHA 1UWGH 4TTDC 4HWBA 2GHWB 3RVUC 4XP5L 3UROR 1TCMA 2A6DB 4OI7A 5HY9A 2OL3A 2BY2A 3IDJB 1N0XL 3QXDB 5EB9A 5DK0B 4JKPH 4R4NC 1OLZA 3ELAT 4P9HH 3DIFB 1F13A 1MJ8H 3CZFA 4AL8L 4M43L 3KLDA 1XZ0A 5CCKH 2W65B 1A7PL 4OD2A 2H2PD 2IH1B 4POZD 2XT1B 3RDTC 1RZ8B 3ARDC 1UCBH 2EC8A 1IQDB 1YYMH 5CWSB 1ZKAA 5HHQB 4NO2A 3ES6A 4QHKJ 3FT3A 1YEKL 2X2YA 5HHOA 1OAXL 4LSSH 5CBEB 4UZGA 4MDIA 1OGAB 3PHOB 1JF1B 2VXUL 3BDXA 2IFGA 4HJ0D 4KZDH 3O3BA 4XBGB 3D39D 5HDOA 5D7IE 1YMMD 1P7QB 4P3WA 2AK4E 4TSBL 4DGYL 1ZHKA 3PP4H 1A1MB 4HIIB 1AFVH 2YK1L 1XGYL 2R8SH 3HLAB 4ZUWA 3OB8A 2PTTB 5D2LB 1TQCB 2DLHA 4YEFA 2QSCH 4LCYB 4CN4A 1QSEE 5L6YL 4R2GC 4HKJB 3CSPA 4EDXA 4LHUD 3TPKA 4PJIE 3QIBB 3QCUH 2G5BA 2EH7L 3NCMA 3O0RH 1RUML 3WFHA 4YAQA 4ODUA 3K8LA 3FL7A 2ICCA 1IEBA 4XC1L 1CG9B 2Y23A 4X7FC 4RFOL 3VJ6B 1WCBB 4JY5L 4MCYB 2HVKA 1TZGH 4YDVB 2VISB 3NFSH 4TSAL 1QD0A 4JHWH 4D9LL 4NQVA 3NN8A 2FSEA 5EH1A 4M5ZL 3IGAB 4U6VH 4LPYA 4Y4HA 3BN3B 5C0BB 4JRXB 4QT5B 4LLWB 3D69A 4LNRA 1W72B 3VWJC 2O5XH 3B43A 4UIKH 3ZKMD 3U79A 1XIWA 4CNIA 3OKNA 1T0NA 2PYFB 3JV4B 4CADB 4OZIB 2NLJA 1X4YA 4JFYB 4YX2H 5DSCA 2KL6A 2Y07H 2CMRH 3HZKB 3PWLB 1DLFL 4XNUL 3G5YA 4BH8A 3UTZB 5T1DH 5CMAA 4JVWA 5K9KA 1G9MC 3CX5K 2H6PB 3LZFH 2L4OA 4WUUD 2NW2B 1ADQL 3GMNB 4LAJH 3PL6D 4JCLA 4NIKB 4I2XB 1VSCA 1X9QA 3QDGA 4QXGL 1BX2B 3B5GA 4NDMB 4M7ZB 5BMFH 1E4JA 4GS7C 2VL4A 2DYPA 3SY0A 1RZJC 3TNNB 3WIHH 5F72S 4QXUH 4QHLB 1UM5L 3GGWA 1L0QA 2GKIA 6CGTA 3L3JA 4P4KA 3QDMD 3RI5K 5KS9F 5GSRA 2IBGA 4K7FA 3QRGL 1HEZA 2XTLA 2FBJL 4PP1C 4MD5A 4QRTA 3DX9A 4Q0XH 2NY5H 5EU4B 1JHKH 4P5TC 1C7TA 3RIAF 2BVYA 5L0QC 4G5ZL 2P24A 4F3FB 4X80L 1MAKA 4OCRH 4L8CB 4HG4K 1KB5B 1UACH 3R0MA 1EZVY 1LP9E 1YEFL 4HIJA 4OIAA 3AUVA 5TDNB 2OJZH 3UJIH 4TNWF 4YBLB 1HIMH 4XP9H 4L8BB 4UTAL 3IKCB 2I07A 4UINL 8FABB 4Z7VB 4PJCF 3MJ9A 2IQ9H 3R1GH 5F1KC 4JFEA 2GY5A 3KPRA 5GRVK 4LIQH 4UI2A 1M71B 3BKJL 1HQ4A 2P8PB 1EVUA 5BVPH 1RJZB 5DJYA 5C08E 4OKVA 4QCIA 3W5NA 2OP4H 4X6CE 5D5ME 4O58H 1II4E 2KUTA 2WW8A 4KI5F 3FOMA 4IMKC 4NN6B 4NM8L 3SQOH 4KI5D 2DQUH 4LCWD 4F7CA 2ZJSL 2VTFA 5SX5H 1NLBL 4YFEA 4NQEA 1HCVA 1T0MB 3NABL 3BXNB 3G5VA 4QHMB 5E2JA 1MFCL 2J8HA 4M1GH 1YEJH 3WIIL 5I8CB 4XMKH 3M17A 2X9XA 5JQHC 1W72H 1MFEL 4EBQH 1TETH 1F4YH 3REVB 4GKNB 3RNKA 3X17A 4PTUA 3D6GA 3QUZA 4XVSL 1A7RH 2JCCB 1FYTE 4L8SA 1R5IA 3TVMD 1D5XA 4Y4KD 5IESH 3DOSA 4I4WA 3P0YL 3M1BB 5HHMB 3AY4C 3ME0A 3KJ4B 1TFHA 2CO6B 3U46A 1MJJA 1GOFA 2OM5A 4FTVE 5E08H 2DQIL 4N0CC 4RX4D 3ARUA 2AXJA 3MLYH 5T1LB 3QG7H 4JGJA 5I6XB 3LMJH 1H15A 5IEKB 1OWWA 4Y5YB 3GK8L 3QXWA 1A7QH 1YJDH 2OSLB 1FZKA 1XGQB 3D0VA 4NQDA 5J4MA 3U2SA 2JKXA 1CXKA 3H2WA 2GTZA 1KCKA 3T0AA 1I1RA 3H3KA 3L5XL 5I8KL 2H45A 5BZDB 1ZA6B 2CLRB 2WMPA 5LVEA 3WO4C 2ZPKH 4M8VA 4BSWB 2CJUH 2VLJB 4FFYL 3BESR 3TA3A 5KSAA 3QJHA 2HKHH 1BBDL 3UTQA 1KB5H 2GJ6E 3UPCA 1IM3B 1N6UA 4P3DB 4RWYL 5DXWA 5SV3A 3EGSB 2IQAB 3BP6A 3L3IA 3DURA 3NZHL 5DT1H 1FGVH 1KF9B 2VKWA 3V4VH 2I9LB 1B9ZA 4PV8A 2LQRA 1QBAA 3K4ZA 1NGWA 4R7NA 3MO1A 1DE4B 1KB9J 2VABB 2EE2A 4K3DL 1CD8A 4MQSB 4XHJD 5ADPL 3QA3B 1G7QB 2IAMD 4QWWD 5L88L 5INDB 5AEAA 1KC5H 4LLMB 5I16B 3IDNA 4XPFL 4Y2DC 4OUUA 4X4XB 1S7RB 3U82B 1G0DA 1K4CA 1ZT7A 4MDJA 4G6FB 4LVOC 2EDBA 5CJ8A 1F6AA 2W9DL 2OI9B 4U7KA 5D2NA 3WS3A 1MCBA 4D0BA 3Q0HA 4Z76B 3OKYA 4LVEA 5FHBL 3LQMA 2Z9TA 4LQFL 3MREB 1T4KA 2VDNL 1ZLUH 2UZXB 5JPNA 4OI9A 2B4CL 3GSXB 4HKZA 2NTFA 5I0DA 3OXRA 3ALXA 5HPOA 1NGYA 1IMHC 1OPGL 1FDLH 1EIBA 5K59E 5EOTA 4G8FA 4DQOL 4HBCL 3V8OA 3STZA 4J3UA 5I1KL 4WUUA 4JRYD 5JZ7D 5F21B 3NZ8A 5DVMA 3PL6A 1C5DA 1CDHA 1WWAX 4ODXA 4MLIA 4AL8H 4ZFFB 1UXSB 1HHJA 3HAEB 3ULVL 3MGAA 5EN2A 4R8WL 1VENA 1MAML 1J1XH 4OJFL 1TJHL 3UPAA 4GG6B 1I7TB 3V0AC 1HHIB 1QUNA 2FWOB 4LGPB 5TDOA 2P1YA 3HNVL 4BELD 4QHUB 3V5HB 2MKWA 4NYLB 5HTSA 4JDTH 4MAUH 1P4IL 4XNYL 5KS9A 3P9LB 3LS5L 4DAGL 5EU7C 3WJLA 1CK0L 2FO4A 3MLZL 2AKRA 3CMOL 4UU9B 1T66D 2B39A 4XNQB 5E2WL 5HYEA 5E2VL 1HN1A 2FR4A 4WI3A 4L9LC 4OZFG 2XZCL 2NZ9C 2W0LA 3OSKA 2VR4A 1NEZA 2OMBA 2R0ZL 1KCSH 1JVKA 3KXFA 3MCLL 1U91A 4Y5VA 4WW2F 1WFOA 1DZBA 4PREB 3ARQA 1NAKH 1Q9LA 4MQXC 3FMGH 4UQ3A 5I19H 3L5JA 2Q7YA 3EO9L 4PB0H 3EYQD 2PTUA 4GSDL 4PJCA 5IMMB 5JW4N 2DIBA 3HR5A 2VL5B 1ZOXA 2AV7A 2FEDD 3MV8E 1PKQB 2DQEL 3ALWA 2C26A 4PS4L 3HE6C 4XPTH 4GRWF 2HTLD 4KVCH 3HC0B 3CNKA 1VGEL 1V7NL 4PJHF 5IW6A 5MENB 5DUBB 4ALAH 4U1LA 4IRSD 1UM6H 3UBXI 3VFRB 2NXZD 3EOTH 5L9DH 3N50A 2ZCKL 4N1EA 5EBMB 2H3NA 2ZNWA 4FHBD 4Z7OE 4OSUL 4XRCB 2CXGA 4OCWH 3Q3GA 4CW1B 3FZUC 2NY3B 4DVRL 3B6SB 3WFEL 5JDSA 1OTSC 3BIBX 3IFOA 5C0IB 5EA0L 1G0XA 5CJOH 3MRKB 4FFWC 2X41A 3DGGB 5DJ2A 2Z91B 5FA4B 3TVMA 4Z7WE 3UZQA 1FBIH 1KTKE 3CSYB 4MB4A 4PJ7B 2AEIT 5DHXB 5J12B 1SEQH 4U0QB 2EDTA 3U9UB 5K93A 4ONGH 3ZE0E 4RMRA 1BFOB 3MOBL 2AEQH 3BFOA 4RMUA 1XF3B 4NO5A 5DA0B 3SE3A 3HAEH 3EZ8A 1N7MH 3IF1A 2EXWD 4ZAKD 3G6JB 1MFDH 4U1HA 1BBJB 1RZKL 1NFDB 4S1RH 4J4PD 2VC2L 3X11A 5EZLB 1A1NA 3GSUA 3K81A 2QSQA 1NGXB 1LO3L 3ILPA 2V5MA 1YN6B 2QL1A 4NC2B 4ORGA 3MLUH 4KDVA 4FQXD 2BNQB 1UB6B 3EBAA 4OCXH 4AG4L 1U8IB 1A9EA 5EORL 1I3GH 4OLZH 4KRMB 1MQKH 3T1FA 4APQB 1MNUL 1IQWL 3N1GC 5BS0B 4L29B 2DIJA 2GYSA 1YEEH 2DWEA 5IBTH 3T4AA 3MLPA 4MXVF 2IC2A 5J7CC 2Y06L 2EC9T 4I0KA 1YY8A 1JI2A 4UTAH 5DMGD 3CC5A 1XF5B 3BZDA 4UINH 3L95A 2AABL 1W0WB 1G9NC 3GJFA 4M6NL 5DA4A 4LLYB 1YDPA 3IXAB 3SGJA 3U0TB 1UXWB 5DJXA 4M7JL 1R5WA 2AS5M 4Z95H 3WHE1 4WNQB 4FQ1L 2Z4QB 3HPLA 4Y8AA 3QCVL 3U1SL 4M62L 3PWUA 1QP1A 2B8OT 4YIQB 3QT2A 1XH3B 5F7WC 2A73B 3IYLW 2AJYH 4MCZB 1H3GA 4TOYL 3A6OA 5DS8B 4UT9H 5JMRA 1NEUA 3EO1A 5C70A 5BZWA 1ACYH 4I48B 4CRPA 2ZOLA 2X4RB 2FLRT 3QZWA 4KPHL 5C9JA 4ZUTB 2MCG1 5D1XC 1ZEAL 3GI9H 2OYPA 5D8JH 5C0GA 4JY6B 1A0QH 4JPVH 2UZIH 3BPNB 1NANI 4TVPL 2F53A 1A6AA 5KG9B 2UUDK 1EO8L 2H41A 3QUXD 5JOFA 2B1HH 1VFUA 1UYWH 2F5AH 4HWNA 4RDQG 2XQBH 5DEGA 4B0MM 4E9LA 3D48R 4R0LC 5DK2B 3BKCL 4E42A 4LEOB 5INCA 4YR6A 1EX0A 5EBGA 3VGGA 3KLSA 1QO3B 3HUJE 3TBYB 3V95A 2DTMH 1HK6A 1Y18B 4XVJH 2XKNB 3D85A 1A02N 5J3HD 1FNFA 1G7LB 3QO1B 4OF8A 3RVVD 3LEVH 2QEJA 3FB5A 3QNZB 4WTZA 1KCRH 1NMCC 4OF5A 3ILQD 5JUEL 2E7LC 5C1MB 2X70A 4OF6A 4KWUA 4U1NB 2W07A 3NFNA 1BBDH 4EVNA 4DKEH 1H3TA 2DQCH 1T21B 3ALPA 4NPYA 3GKWH 4I0PD 3LN4B 4IJ3C 5TE6H 5D1ZB 4PBVC 1I7ZA 5FHAL 1U3HD 5CGYD 3Q6FA 4UT6L 35C8H 1QFWH 1RMFL 4ZNEE 5F6HI 4PYHA 4PJFA 4LARH 4HUXB 1JFQL 5JW4Q 3QHZL 2R0LH 3AAZB 4EUPH 3OJDB 3HI5H 3KPNB 1IC4L 1D9KC 1VDGA 2BRRH 1CZ8L 1BQLL 2QHRH 3EYOA 5D1QD 1ZE3C 3GEWB 3V52L 3HMXH 4OD3L 1VEOA 4PJHA 1HDMB 3PDGA 3QXDA 2JK5B 5DK0A 5LCVL 3KPSE 5IVNA 4XNZB 4GMTH 4O2FB 3DIFA 5J11C 5I1HH 4U3CA 1NUNB 1F00I 5EZJA 1UH2A 4PJXF 3VGBA 5E56A 4XVUC 1K5NA 1IL1A 1GSMA 2QR0B 3TJHD 3BO8A 5C0EA 1UFUA 1T0PB 3BH9A 3MLSL 4I18B 3WD5H 1S9WB 3FB7B 5IT2H 5HHQA 2YBRA 5EUOE 1PYWB 3PF2A 1OVZA 1DQMH 4JFXA 3O6KH 4R6UA 2ARJB 5GS1C 1PEWA 1UADC 5J6HB 4O2CB 5F89B 2EICA 2W9EH 1QEWA 1S9VA 5F7YC 5TPWH 4K3JL 4GRLD 4BUGA 15C8H 4X8JB 4IIQB 5MP6L 4XCNA 2Y7QB 4YXKH 4ZUUA 2EECA 3EYVA 1T5XB 3VFNB 3MXWL 1TJHH 2DL9A 3FN9A 1T20B 2VH5H 4WIQA 4OCMC 1JHLH 2CK2A 5B38A 4X7TB 4MZ3A 2C5DC 4X0KB 5F9WC 1O5DT 1BOYA 1JRHL 2VUOA 5JO5B 5D2LA 4KRNA 5IEHB 5C0AD 4DUWA 5HBBA 3FO2B 4LCYA 1YEHH 4TULH 4G3YH 4M93B 4HHAA 5I9QC 1UZ6E 4FQXA 2LABA 3EYUH 5CSBA 3SEPA 1CG9A 3EHBC 3NA9H 4ODSH 3D3VD 4NO0D 5L7XL 4LCUA 2XQYG 4YUEH 3JV0A 3WMSA 3IJSB 2MTPA 1OSPH 4RAVB 1M4KA 4E0RB 7FABL 4G8IB 5FXCH 4LP5A 5SWQB 5JXAH 4JRXA 3KVQA 3DJ9A 2NY0D 1XT5A 2X10A 5LBSH 5E6ID 4ELME 4HS3B 5HI5C 4QYOA 1INDL 1LK3H 2HG5A 1KFAL 1H3WM 3MLVL 3RX8A 4CADA 2F8XC 1J1OL 4JPIA 3L9RA 2GJZB 5F7MC 1ZLSH 2PCPB 3PWLA 2BDNH 4MJ2A 3E6HA 5I1IH 3BWUC 4HUMB 4IHOA 4U3HA 2R1WB 4P4RB 1KSRA 2ZCKH 4N0UB 3RTQB 4GFTB 2BFVH 4BKLB 3K0WA 4OGAC 1QRNB 5JPMA 3O9WA 3S8WA 4HXAL 1KEGH 4U6XA 3LB6C 5FGBA 1J86A 1I7RB 5EUKB 2EIDA 1CT8B 5C6TH 1LK2A 3S37H 4RRPG 5ANME 5CGMA 5LJYH 2BSSA 4HGKC 2OTWB 3VH8B 4E41E 3MX0A 4OCSL 5GRXG 3MOAL 4Y16C 1CR9L 5E94B 5CEZH 2DKMA 3QUXA 4NT6B 3MLXL 2J4WH 5CINL 5C07E 3UC0H 4JPKL 5L8LB 4MA7L 3MOBH 3SBWC 5EU4A 4NN7C 3T04D 3LPGA 3PP3K 5B8CA 1AI1L 1SBSL 1KOAA 2CD0A 1IEAA 1Y6MR 3SN6N 2HH0L 1JK8B 2VLKE 2JB5H 3ZT7A 3ZTJG 2R2BB 4MNQE 3MA7B 1KB5A 3WEXB 2VE6B 3N1QC 1V3JA 3MGOB 3TZVA 4EI5B 4LVHB 4PJ5D 1D5ZB 4OIIL 4XX1G 1S5HB 3QIWC 3WLBA 5CP3A 1RUPL 4NKOA 4WU5A 1GCFA 3RAJL 4N8CH 4PJ9A 4QRPE 4XMPH 5B21A 3T09A 4P23B 2A83A 3K2MC 1RJYA 5E6YA 2NYYD 5I15H 1FIGL 1JZ7A 1K4DA 1NC4D 1ZHLB 2P8PA 1SJHB 2CK0L 3IU4L 3ARED 4Y4FA 4G8EA 1SEBA 5I30H 4I0PA 5TFSH 1J0HA 5EPMB 3BSZL 1T0MA 4JFDE 2Q6WA 3ARBB 1NCCL 4HD9A 3BXNA 4Y0GA 5BXFB 4FQQB 5F71A 4KKBD 3C60B 4QHMA 3FFCB 1KJ3L 5DJ6A 2YPLD 2YSSB 3CDFA 3MMEB 2M8XA 1JUFB 1QBLL 4PJDF 1UVQB 3RWEB 12E8L 5F9OH 4WFFD 1I7UA 4NFCA 3P4NA 4M7JH 3P9MA 1GXEA 1RZFL 2AV1A 3S4SG 5HHVH 1B0GB 1WAAA 2Z31C 5B4MC 4LLQA 4LDEB 1FPTH 3MJ7A 1MIML 2HT3C 5LXGH 4KV5E 3QG6B 3OV6A 5CGTA 4WEBL 3QIUB 5DRZB 3I3BA 2FL5A 4K07A 2ARWA 5D9SB 2EC9U 3WLWD 1MCKA 3I6LE 3MCG1 4XNXH 1LNUB 5K9QG 4GKSB 4URTB 1EFXD 5GGVY 2Y9RT 2AJUL 3EUUA 1CS6A 1BFTA 1OTUD 4J3WA 3QQNA 4LBEB 1FNEB 3C5JB 1CTOA 4TVPH 3LQZB 1FG9C 3GUTB 1MRDH 1I4FA 3FQTA 3U7YL 4GRLA 2Q3AA 2CLRA 5KOVC 3WO3B 3VXUD 4OM1H 1DLHA 3SDYL 5E7FA 1TVBA 3CFKB 5IHZB 2FHBA 4JO2H 3DX7B 3LEXA 3OXSA 4P3DA 1U8JB 1N4XH 2IH3A 2ZCLH 1F3JA 5JW5B 4K7PL 2XPGB 1JF5A 4M1DL 1W0VB 5FYKH 1RIVH 2AJXH 1EK3A 2DRUA 2A77H 4X6DF 1R3JB 5BCAA 5IMOB 3VFVB 3FO9B 1Q72L 1JRHI 4MJIB 5HHOE 1PEZA 2QQLL 3FRPA 1H8SA 3QFJD 1RHHB 2X9WA 1JZ5A 1DSFL 1L7TL 4ZO7A 1G7QA 2BVUA 1F2XK 4Y19D 1JPGB 1BIHA 2YD7A 3GM0A 4K3GA 1KV3A 1TENA 1KJ2L 5I66A 4NO0A 2UWEF 3HZMB 1MJ7L 1BM3L 2LU3A 3FQRB 4OBRA 1OLLA 2GCYB 2IG2L 5F1IA 4K2UH 1JZ6A 3ULUH 3ZT6A 4NZTH 3MGTA 2VWEC 3W9EA 1LEKB 3CFCH 4Z76A 1IGFH 1MWAL 4HJJL 3THMH 3T3ME 4KUCF 3ZSSA 4LF3B 2UUDH 4KUCD 3MREA 3REWA 1I9RH 2QJDA 4Y4HC 1DVFB 5I73B 3RX7A 1GYAA 5DVNA 2FLBT 2ITCB 3SCMD 1ZHBB 1S7TB 4HBQA 4MMXC 4LKXA 4PLNC 5DI8B 4P5MA 2J12B 2ESVA 3OAUL 3QNXB 1XIWC 5CLTA 1X5XA 4ODVH 2VSDA 1YECL 1EBAA 2VWEE 3NCJL 4ZTOH 3DROB 1CGSL 3X3FH 3T3PF 5ETUB 3O2VH 3DBXA 1K2DA 2K7PA 3DXAA 4S11A 3VXSB 4BFIB 3BEVA 5DFVD 3IU3B 4UIMA 3V5HA 2EYTA 3RFZC 5F97E 1BD2E 2QQKL 1G7PA 1I8KA 1C08B 5MEOB 4P4KC 3QEQD 4FS0A 1CLZL 5MP6H 5IQ7L 1GAFH 1X5LA 4NRYA 3DYOA 1CLOH 3BZFA 1TJIH 5DMJB 3RDTB 2YA0A 5F1NB 1A9BA 3V6BR 4CU8A 1Z6JT 2VYRE 5HVHC 5K9JH 1NCUA 5IVXF 3WHXA 1YN7B 1DTUA 4OBSA 4ONOA 4YWGH 1CE6B 5EU6B 3ZDXF 1HXYA 3RBSA 1P2CA 4M8QA 3RQ3A 2EH8L 4KK5C 1OSZB 4YHNA 5IF0B 3BRGC 4K71C 5HYQB 1A64A 1QLFB 2APBA 1OP3K 4ETYA 5EO9B 1N2RB 2VL5A 3EDKA 2GUOA 3GSNB 5DD1L 5BJTA 1FO0A 2VQTA 1NC4A 3VFUB 2WBJD 1XR8B 1KNOA 3AREA 5L7XH 3S3PA 2OK0L 1GZQA 1TJGH 3TBSB 1NC2B 5DUBA 2B2XH 5JIPA 2LVCA 4HIEB 5CSZA 2CLVA 2VDKL 3DI3B 4R2GB 4X6EB 3I6GA 2XNAB 4LLUA 3JSSA 1DQDH 2YPLA 3U30C 2AQ3A 5DO2D 4YPGB 4L3AA 3B6SA 1LDPL 1T7WA 1C5BL 2AGJH 4UUJB 1HNFA 4B53A 3DRQA 4NFDA 2V2WA 4AIOA 3B9KB 3O6LL 2NY7L 4OFPA 3F5WB 3O4LE 5FA4A 2GSIA 3VWKA 2O61A 3QUZC 2XZQL 5I1CH 5BRZB 1XF2B 4L8SC 3MRBA 3E3QC 4AEFA 2UZYB 4FP8H 3FB6A 1BHGA 1HOCB 3RNQB 5D70L 5HHPA 4NQEE 3VWJB 3KPPB 1J1PH 1KN2H 3G6JA 4J8RA 2QQNL 3OMZA 1KXVC 5KVDL 3RHWK 2BZDA 5ERWA 1BVZA 1S7SA 2H2PC 4X5XB 1FE8L 2E27H 3SHSA 3T0XA 4M7KH 3H3BC 4TPRL 3VXQB 4BYHA 1C16A 5ADOL 1UH3A 3HFML 1CR9H 5KN5A 3MYJB 4U1KB 4EDWH 4LSRH 2V2XA 3CH1B 2ZG3A 3MZTA 1XGUA 3QAZC 1SBSH 1GPOL 1Z9OA 4M1CC 1IAIH 2HT4D 2VN4A 2C1OA 4GS7B 4HJ0C 1OAQH 3CFDA 3GI8L 4NZUH 1LP9B 1FC1A 4P57B 4AIXA 4GRMA 1WZ1L 4APQA 1RV6X 4GXVL 1EHAA 1MCPH 3SGDH 3TA3C 5KSAC 1T3FB 3CFBA 4CJ1A 4JFPA 2HTKD 2VLRA 3S37X 1V05A 1UZ8A 4X6DA 4NQDE 5A3ID 3RAJH 4PGDB 5GZND 4P5TB 2BK8A 4KHXH 5L0QB 3OX8A 3GSNH 1CDYA 3M07A 4LSTH 1H3PL 2ZUVA 4UT7H 1EV2E 2E8ZA 4Y19A 3T77A 3D25A 5FUZH 2GY7B 2HMID 4ACPA 3AGVA 5BV7C 5T3XE 4X6CB 1M7DA 2DI7A 1OTTC 1CBVH 1U8KA 2UWEA 3L1OL 4YIQA 1VGKB 1XH3A 3FT2B 3F58L 4G9DB 1QSFD 1T22B 3EYFA 4DW2H 4MCZA 2D3VA 4JB9L 4RA3A 5DUMH 4JREC 4L4VD 4A6YL 4WUKH 3SKJL 4RIRB 4XX1E 3PQYD 2XWTA 1J8KA 5CKAA 3B9VA 3QDAA 1S7WA 3WS6A 3FRUA 5D2NC 4JFFE 1G84A 2E9WA 1Y6NR 1NDMA 1FYTB 4AIZA 5C86A 4N5ED 2JLLA 1CQYA 3H42L 4JKMA 3SCMA 3BP4A 3OPZH 2Y25A 3FKUS 5HGGS 4LSVH 3CLFL 5EU5B 3GSRA 2VAAA 1QACA 4YDJB 2FX7H 2VDML 1RUKH 1EJOH 4PJAF 1A6PA 5BO1L 4ZPVA 2CKBB 4M7LT 5DQJA 4RGOH 1DEEA 2A9NL 4GAGH 5DK2A 4J3TA 3EOBB 5JIIA 4Z7UF 3SDAD 4UDUB 4U2YA 1RY7B 2VDRL 3PL6C 4UNVA 1UWEH 2VZVA 3ETBF 1MVUA 3QXAB 3IKKA 1YPZF 2X1XR 4U1IB 4JDZB 5CD3B 1LO2H 1GOGA 2M1KA 3P3YA 1G9MH 4PB9H 2CR6A 3FHQA 4G8GD 5DURD 1OP9A 3T0ED 1F02I 1AGEB 4DVBA 3B8YA 5IOPB 4FNLH 2F74B 3TWCH 5FO8A 3C5ZD 5F3BB 5KZCD 2V17L 2M26A 3NIDE 3O8XD 2LTQC 3VRLE 3L3OB 5GJTL 4H0HB 1MRCL 2YKLH 3WJLC 4JZJA 2X1WL 1RZJH 4WI4A 4Z78B 4UV4H 2XTJE 1KPVA 3S98A 3DV6A 4PP2A 2IALB 5T1KB 3U0PB 1K8DA 4GAJH 1JWMA 4ZODA 3HCVB 4BZ2H 3FO0L 4RGMC 2C4XA 3B2UD 5D6CB 4HZLA 3H6JA 2B0SL 5IVXA 1K6QH 2WUBH 4QRQA 1JGDB 4MWFA 4QRRB 1UB5A 3GHEL 3MRMA 4M48L 4MVBD 1KELH 1K3ZA 5FUOL 2IJ0C 4J1UA 3L3KB 4Y5VC 3GIZH 2R0KL 4NGHH 3WO4B 3QJFB 3MFFB 1Q72H 3JWDL 1KTDB 3PDOB 1GC1L 5J8OA 5J56B 2JF1A 3PWJA 3DO7B 1JZ2A 2JJSA 3AAZA 1L7TH 1MFBL 3BP5B 2VDOL 5KAQG 3HZVA 5FYLD 3UTSA 4C83B 1R3HA 1N5YH 3BQUD 2F58H 5B39A 3MUGB 5KOMC 1HDMA 1JWSA 1N59A 3L3DA 2P8MB 4I5BB 1TZIA 1P4LB 3KXFE 1U93B 1FL6B 1N64L 1BVLB 3Q6GH 4N8VA 3SQBA 5KW9H 3LEYH 3L5WB 1RZGB 4FQ2H 2DAVA 3SJVD 4MA3A 4BSVB 4M6MH 2BVOB 3LKNB 3RU8L 1J8HD 1N8ZA 4NO3A 5DFWH 1S9WA 1WZMA 3U7AA 3GB7B 4Y2DB 3OF6A 4U2ZA 2W59A 2QHLA 5IMLB 1AR2A 3PDDA 5DGRA 3VI4F 2CKBH 4JLRB 3PQYE 1U41A 1ED3B 3TVMC 1B6UA 3O3UN 1DQLH 4JZOA 5KSUB 3WYRA 3C5SA 4DN4H 1JL8A 1JHTB 2P5EB 5IB3B 5ACLA 1AD9A 2Y7QA 4PRAB 5DMIH 5GGUA 5KVGH 3OZ9H 4GXUM 4RGNE 4YLQT 3SE3C 1QFUH 1MI5A 3S97C 2CIIA 3QUMA 5EWIL 4G80A 2HFFB 2FO1A 5E95B 5DD3H 5HDQL 1WEJL 2AAVA 4CVXB 3W9DB 5T3ZE 3AU1A 3I9GL 3LKQA 4BH7B 4H26B 2PO6D 4N9OB 3FO2A 1RK1B 3ZHDA 4Q97A 2ENSA 3W39A 2F54D 4F15B 4H8WC 3FOLB 2XZAH 5IBLD 1CLZH 1T5WB 4L3EA 4XPAL 1A6ZB 5HPMB 4YBQD 4G6JL 3QFDA 2R56H 4NQCD 2G2RB 5FV1L 5C3LD 4WJ5A 1AKJD 1TVHA 3T0EE 1V8HA 3RZCB 1QR4A 1QA9A 3H9SD 5FUCC 4Z7QE 4EI6B 1KEML 4E0RA 2MWCA 3MBXH 1U8LB 1S78D 1F4XH 4YFDB 1S7UB 2YOCA 3RRQA 3O11B 5C6WH 4L9LB 1F42A 4XVTL 5E8DH 5E00B 1S3KL 4Y88A 4XPHL 3VW3L 5DD1H 5D72L 2OX5A 1C12B 4JM2F 4R96A 4JM2D 3SKNA 1WF5A 5IFAL 2DB8A 4XHJC 3SGJC 5EBWB 1RZ7H 4HK0A 3MBED 5JNYA 3BIKB 4LPUA 4HGWA 4L4VA 1WQVT 5DYOB 1HXMB 3ZKXC 1HI6B 4GUPB 25C8H 1WBXA 2VZUA 1WICA 5C71A 4HUKB 2XG5A 4P2QB 1HINH 1AE6L 5I71C 2FNBA 4HKXA 2BP3A 2BSED 1QRNA 4J12A 5LQBL 1LE9B 4MZ2A 1EEYB 3BWAB 3QISA 1CD9B 3T0BA 3HE6B 4P9ML 1I7RA 3UJTH 4TUJA 3CSGA 4XBEH 4YO0B 5EUKA 4CMMB 3O6LH 3W0WD 3CCHB 3QCTL 4CDGC 1GHFH 4PRIB 1FZOA 5F9DC 4NT6A 1TTFA 5SWZB 1NAML 2NX5B 3GO1H 3OKLA 1OT1A 5ECJE 1AH1A 2R2HB 4UOW1 3GMQA 3MV9A 2V5TA 2FYYB 3PGDB 3CVHA 4F7MA 1ZWIA 1JK8A 2B1AL 3RWGB 3ZE2F 3RPIA 2VLLB 2A6JA 4Z7UA 3V4PH 2MQ0A 1DQTA 3TT3L 3C2SA 2AJSL 4EXKA 5IJVB 5KVDH 1CXHA 1HYRC 3RWFB 2YC1B 1S7QA 3H0TA 2XY2A 1OP3H 1P7QD 5IFJB 3GMLA 3PE9A 3ZL4H 3FB8A 3KLHD 2YA1A 3D18A 2X4OB 1DUZB 3I02A 4KJYB 3O8XA 3WUWA 1P1ZA 1UEMA 4MD0A 5F93C 5IIEA 1XMWA 3CLEL 1NCBL 2F53E 1JPFB 1ES0B 1F2QA 1NSNH 3VG0H 2EIZB 2GFBA 1T66C 3T2OA 3SPVB 1E4XH 1SJHA 1KTLB 1KENH 3JBG7 1XF4A 4Q9QH 3GFUA 5K9OB 4RMQA 4D0DA 3WKML 4DZ8A 3B5HA 5L2KA 1Z3GL 3H7BB 1U42A 4OB5H 3QIBD 4L5FL 3TCLB 4J2XA 1PG7H 2OZ4H 4DCQB 5BXFA 2F54E 1DBMH 3FFCA 5SV4A 3ARFA 3MV7B 3RY5A 4KHTL 1FFOA 3DRTB 1BVKA 3WFZA 5FB8A 1UVQA 4ZD3L 3V4UL 5C2UB 5IP4A 1EGJL 5H2BA 2BHZA 4Q6IA 2X40A 3N9GL 4J3VA 5EDXA 5DZOA 2CO7B 2ZSVA 1I3RB 4ZOAA 1T03L 5C0BD 1NCWH 5TQ2L 4MS8D 2CDFA 2FEDC 4Z7NF 3QG6A 3GRWA 5DQDL 1Q1JH 2MPAL 3IVKA 2CGRH 1Z2KA 2HTLC 1U6AH 3PV6A 4I3SL 4LMQE 4KMTH 1WBZA 1MF2L 2VXVL 1CQKA 1WUNT 5KSBB 3O6MH 4WHYG 4LAQH 1CDCA 5LGJB 1BFVH 1LNUA 1KLUA 1AO7D 5DC9B 5C0RH 2NXZC 3A6BL 3GSVA 1Q9WB 3HAEG 4NKIL 3GHBL 4PJFE 1J8HA 4OQTH 5C0DB 4PGCA 1L7IL 4NQXB 5ALBH 4S1SH 3U4AA 4S1QH 1FCCA 3LQZA 5E8EA 5E0QA 3X14B 5FDWB 1S9YB 4M3JA 5BO1H 1FQ9C 3KPMA 3FONB 4JO4H 4KJPC 2BVPB 5TE7H 3CFKA 3O4OC 4X5WB 3X3GL 3EJYD 1HKFA 5D1XB 3S88L 1ORSA 4NUJB 1IGMH 1PX3A 5IB4B 1BJ1J 3KJ6L 2D7OA 2EXWC 3LKSA 2XPGA 3HZYA 4NCC1 5GXBB 5I75B 2XRAL 3OGOE 5I1LA 2AXFB 2XKUA 1FNAA 9CGTA 2PO6A 2DI8A 4DKFH 1NMBH 3VFVA 3WSQL 3FO9A 1CTNA 4LCIH 4R0LB 1VCAA 2KBGA 1OGAE 4YXLH 2BNUA 2GT9A 2NR6C 4MXQD 2H26B 1EUUA 1JPGA 3KPQB 4XCCL 3VGHA 4FQXC 4PJBB 3LIZH 1Z9LA 4LQ1A 3FO0H 3QP3A 3LKRB 1T7XA 4O02L 1D5BB 3RWCB 4F7PA 1LEGB 3H9SA 4AM0A 1WK0A 5D7SH 2XI9A 2GCYA 2D03H 3K46A 3P40A 5JW4M 2IADB 1U58B 5D71H 3VRIA 1ZLWK 1NMCB 2N7BA 3MCKA 1LEKA 1LO4H 4POYA 3LRHA 5FF6B 1A6VL 4JAMB 3VXMD 5D2LE 4ZFOA 5C7XL 1D3CA 2R69L 4NWUL 5DMGC 4NRZB 2FJGB 4K94L 4LOUC 2BSRB 2I5YH 3PWPA 4H0IA 1ITCA 3ULSB 4JM2A 1S7TA 5FOBB 1MFBH 3P4LA 1YNTB 2WUCL 4IJ3B 4P2RD 1INEL 4GG8A 4JRWA 5E7BA 5KSVA 1E4WH 4LIQE 3LD8C 4ZNCD 4QNPE 2X4PB 3O3DA 5F3HA 5HI4D 4XMLH 1G9NH 4LLVA 3V5DA 3DROA 3LPFA 2ED7A 4QOKB 3UTTD 1VPOH 5SWSD 1VADA 1JGUH 2ADGA 5FCSH 5HHMD 1D9KB 2FB4H 4JRXE 4OT1H 4PRHD 4QY8A 3T8XB 3MA9L 4OFVA 1QBBA 3W0WA 4HWBL 3O9WC 3MV11 4HK3N 1JGEA 4PG2A 5FGBC 5E03A 3V5KB 4OZIE 2OL3L 5J11B 5MEOA 3RVTD 4P46D 3BOVA 3VE0A 1I1YB 4XHQA 2A74B 1P9MA 2Z0BA 1IT9L 3QDJA 3QUXC 1FN4A 1NFIA 1RVFL 3RDTA 5B8CC 1C5CH 2RCSH 2Y5TB 5DTFA 5J89A 1CGYA 4I2XE 4PR5B 3CPLB 3SDXB 5GS1B 1NDGA 2VLMD 1WEJH 3ABZA 2UYLB 3GSWB 3TZVC 2J6EL 4NN5C 5ICXA 4HFUL 5KVFL 2Y6SD 5J3HC 5F7KC 4YBLC 1OSZA 3RVXD 5IF0A 3MODL 4N0YH 3G5ZA 4JFQA 4PJ9C 1EAPA 1JI1A 4XPAH 2ADIB 1IGTB 3DGCR 2KZWA 4JO3H 1CICD 1MHPH 3C8DA 2WINA 4MJ4A 4ZDHB 4DJMA 1TLKA 4NNYB 5FM8A 2AK1L 5ICZA 4FQCH 1QSZA 1FYHB 1CFNB 1XGRA 2AJZA 4Y4FC 1QQDB 4R3SB 4K23H 3ESUF 4I0PC 5ID0B 1PGRB 1WZLA 5I9QB 4B5EA 1DDHB 1U8QB 4NHUA 1LO0H 5F7UA 2CDEA 3TV3L 2GK0B 1IAMA 3C2AL 3M8OH 5FECB 3RUGA 2AEPH 4Z7VE 3UEZA 4X83A 4OLWH 4I77H 2W0KA 3F8UB 1QYGH 2VIRB 3B9KA 4KVNL 1C8PA 4YDIH 1XF2A 4QTHA 4FRWA 1QBML 1U3YA 2FGWL 5EULV 1RAMA 1UM4H 4M7LH 1KJMB 5D96C 5A2LH 1J5OH 1A6TB 4IOFD 1AIFA 3RNQA 3BGAA 4KTDH 4XPGL 2DQHH 1YEGH 5IW3A 4CUCA 1A6WL 4C55A 5LQBH 1MY7A 3FO1B 1BZ9A 3KYNA 4AMKH 5EC2A 2FIKA 2QKIB 3MJGX 3G04B 5SX4H 2HP4A 3S6CA 5GRUH 5I6XC 2EKSB 3EO0B 4OCNC 2HJLB 2PYEA 1MJUL 1P6FA 1MH5B 2JCCE 5C07B 1ETZA 5DLML 4GH7B 1DBAL 3IXTA 4U1KA 1WAAE 1AY1H 1CE1L 1ZGLP 4MHHG 3W82A 3MNVA 1AXSB 2XIDA 2N1KA 1HILA 3MRLA 4HW6A 1HE7A 4MNQB 5HHME 1KCVL 1W2KT 1DFBH 1F8TL 4GRLC 4QXTB 1XFPA 3C9NB 3OGCB 4YHLH 1AXTH 1JNHA 1KBGL 4P57A 4ZUVB 3MRHB 1EBPA 5HYJB 4HV8B 3P9WB 4CMHC 1P4BH 2QTEA 3GBML 3D2UD 3P11H 4OTXH 3RWIB 4Y16B 2A6IB 5IB5A 4U7SA 4NN7B 3ZYIA 2HKFL 4NNXB 1SYVA 4PGZA 1IFHL 4NKDA 4NQSB 3QBTB 1YA5A 2P5WB 4KRLB 2R0WH 3TFKD 5ID1A 4PV9B 5IB1A 1MSPA 3O2DH 1CDUA 4OZHF 2VLJE 1FGNL 1N0LA 2DJSA 5GSVB 4WGWB 3V6FA 3VXRB 3VXOB 1F97A 1Z3GH 3QIWB 4JFDB 1FRGL 1RFDH 1KT2B 4G9DA 2APWA 3FN0L 4JE4B 3MFGB 5C0JB 3P77B 3RWDB 3E8UL 3FTGB 2ZOKA 1HYSD 1BIIB 4JN1H 3RY6A 3KDMB 1A4JB 4MJ5A 2ID5A 4I3RL 1ORQA 5H94A 3ROLB 2WBWB 3LH2H 1G7MB 3V4UH 5CBAB 4LRNL 5BQ7A 3IFLH 5JHDB 4XAKE 2VJXA 4KQ3H 4ZYKA 2ICEB 3HPJB 2R39A 1XCTB 1L6ZA 4P2RA 4F2MB 1T03H 5CILL 4RQQB 1J05A 1TZHB 2NY3D 4NP4H 5GGSA 3QEHB 3V6ZA 5DQDH 3DUUB 2P44B 4NFBA 1CCZA 2CKBA 4IRJA 1PG7X 1MHCA 4I3SH 5IHBA 1R0AH 5FO7B 2JTDA 4N0FA 3KWWA 3B3IA 3QHFL 3TBTB 4PJ7F 3QULA 2A0LC 3U6RB 3UTTA 1G7HB 5SWSA 4ONFL 5L2JB 4UDUA 4D0CA 3TBVB 2YRLA 3HC4H 3MNWB 5DWUH 4TUKL 5MHSE 5DJ0A 4PRHA 1M6OB 4PRPA 1HZHH 5CD3A 5CP7A 2WIIA 4L8DB 3MACL 4UV7H 2D31A 4TRPL 3S34L 3BPCA 3DHJA 2D7MA 1M05A 4JHAL 4XCYA 5HY9B 1EJ6A 4Q9BA 3IJYB 2ATKB 2ESVE 3BW9A 1JJUA 4X4MA 5CHNB 1UKQA 3S88H 1RU9H 5I1DA 3CZFB 2OS7A 1XZ0B 4OLXL 4KK6D 4OD2B 2BJML 5I1AA 5IROA 5CSGA 1HKLL 2BNQD 2VKXA 3HRZA 4QRRA 5HHXL 3RL2B 4GG6E 3KLAA 4P59L 4U1SB 2DD8H 2YXFA 4NO2B 3FT3B 4LSQL 4DWHA 3PIQB 3WSQH 1YEIL 3MOQA 5BS0D 4MDIB 4NHCH 3WFBH 4WY7L 4W68A 5I76A 1G6RL 4F8QA 3ZDZE 4WW1A 5T3XL 4HPOL 4Z8FH 5DD0L 3VI3F 4YHMH 3CXHJ 2BMKA 4D9RD 2G9HA 2DJUA 4ZXBD 1CICA 4V1DA 1NCDL 3MRPB 1J0KA 2NYYC 2DQJH 4PYGA 1KIRA 1ZHKB 1MHEB 5GJSH 3ZKNC 1ACZA 4XNMA 3AREC 5JR1L 2VXQH 6FABL 4I5BA 2D0FA 1T1WA 4JKLA 5IVOA 3GNMH 4AENA 3GM8A 4HF5H 1FL6A 4NUGL 2BVQA 2R1YA 4X6FA 1Z5LA 2I9TB 2R69H 1CYGA 4KKBC 4NWUH 3JTSA 3LKNA 2A1WH 3ARPA 4EDXB 4NKQB 3W81A 5I17A 2XY1A 2G5BB 5H8DA 3WFHB 4YAQB 1FVCA 4ODUB 1DBKH 3HI6L 4G6KH 4OFYD 2MNUA 1IEBB 1CFBA 5IMLA 3GZKA 1INEH 1FNGA 3DSNA 4PLJD 3BISA 4XCFH 3VH8G 5F7EH 5D7KE 2DQDL 3VWKC 3RIAK 5KSUA 4U6HA 4QF1A 5MENE 3V6OE 3DUSA 1JPSL 1TPXB 3NN8B 4NQVB 2FSEB 3TN0D 2VRAA 4Y4HB 5FGCB 3ZO0A 5AG9A 4RISL 1ZVSA 3WLWC 2FZ3A 3D69B 1N3NA 2F15A 5DZNA 2HFFA 4FQLH 4TNWK 2ADFL 1Q9OA 4FQJH 1ADQA 2EKJA 4F57L 1XIWB 1T0NB 3ULVF 3ULVD 3MRJA 5DSCB 4YXHL 4HIHA 2PR4L 1RK1A 4YQXH 2Q1EA 2J8UF 3G5YB 3VFTA 5CMAB 1A7BA 5K9KB 1CXLA 2GTWA 5AWNL 2MQCA 1R3IH 2VDLL 4FZ8L 5HPMA 3B2VH 1JV5A 3K1KC 4K3EL 1ZLWH 5E8OB 3QDGB 2G2RA 2DLFH 3LRSA 4JFHE 4HAGA 2MKLC 4BM7A 1B2WL 2DYPB 3SY0B 1MIEL 3PHSA 3RZCA 3G6JE 2A38A 2HYMA 2R4SL 4APQC 1KTRL 1LWRA 1NFDE 3GGWB 3L3JB 4P4KB 1EAJA 4WI2A 5GSRB 4KROD 4K7FB 5CLWA 5LGKA 5E00A 1LO5B 4MD5B 5D1ZD 4QRTB 3DX9B 3NGBC 2VDPH 4LGSB 3DMMA 3TO2B 3GSOA 5GRJL 2YWYA 3SE9L 4TNVF 1A6UH 4U05A 2P24B 3GBNH 5HVHB 4DK3A 4OZHA 2BNQE 4HPYL 2D7TL 4F58L 3DSFL 1PSKL 4TQEL 2AK1H 2I27N 4HIJB 1PQZA 3NAAL 3DTXA 5CJXA 3UDWA 4K71B 5GS0L 1CL7L 3UBXA 2I07B 3BUYA 3P0VH 5ESQA 5FCUL 3PABA 4OQ1A 2JJUA 1LE9A 2FJHA 3AS0A 3TBWB 3QPQD 2IAND 3V0WH 4ZUSA 4KRPC 4JFEB 3WS6C 3SOBL 5TE4H 4MJ6A 1T1ZA 3KPRB 1RZIA 4YO0A 3UO1H 3LHPH 3NIGF 4KKCC 3MRGA 3SCMC 4X9BA 5IGXL 1AJ7H 4DN3L 4OKVB 4QCIB 5SWZA 3GMRA 4RFNC 2BOBB 5TQ0L 4F7CB 3VA6A 3G5VB 1SYSB 4HX1A 4JANA 4X4ZA 1JGVL 4X7EC 2FX8L 3M17B 5EC1A 1UC6A 5ISZA 5T3ZL 1OAZL 3RNKB 4PTUB 3FQNA 5DRXA 3QUZB 3STBA 3C6LA 1CFVL 1R5IB 3WNOA 3AMKA 3JWOC 4G9FA 4HWZB 5F1OB 2Q76A 1KGCD 4AEEA 5DFVC 3WDIA 1D5XB 1AQDA 4I4WB 5JIKA 5GGVL 1MUJA 2BVTA 3UAJC 1JPFA 5C0CA 1S7VA 1ES0A 4GOSA 2X7LA 2BNRD 3U46B 1MJJB 3IT8D 3UJJH 3SPVA 1PX4A 1KTLA 1MREL 2LAGB 3HNTH 4PJGA 5ALCL 4JZJC 5JMOC 1H15B 4JFOB 4WHCA 1BAFL 4HT1L 4PJEA 4CL7A 3D0VB 5IJKA 4NQDB 2FECL 5EOCH 3U2SB 3Q5OA 2HWZL 5TDPB 1FNLA 3IFPA 3NPSC 3O2WH 4DFIA 1CF8L 5DJDA 4RZCB 3D39B 3KR3L 3KYKL 3B9DA 3MLTA 5IG7A 1KIQA 5KSAB 1IKFL 3QJHB 3UTQB 1NLDH 2JJSC 3NTCH 3TNMB 1WBYA 4F33B 2H9GA 3TEUA 2DBLL 3BP6B 3L3IB 2YN5A 4Y1AD 5B3JE 3DURB 1OW0A 3DETD 4NQUA 4NJAH 1QLEH 4MB3A 1MCQA 4PV8B 1FH5L 2H1PL 3I2CL 5CS7A 5FYLL 3MJ9H 4R7NB 4XNZC 4EIZC 3MO1B 1Q9WA 2AP2A 5BV7B 2HLAA 1BJ8A 1WFTA 2ERJB 1JPTH 3VFPA 5DD5H 3HNSL 4NQXA 3RTQD 1UWGL 4UBDC 5CILH 3H8NA 2EZ0D 4JO1H 3IDNB 1L6XA 4OUUB 3T2QA 1K4CB 1ZT7B 4GMSH 3FONA 4MDJB 4WCYH 5KTEH 3UTSE 3LCYA 1F6AB 4NQTA 3I85A 5D2NB 3WS3B 2XN9D 32C2A 4P9HL 3RIFF 3TN0A 4D0BB 1MJ8L 3PWVA 3U7WH 2Z8VC 4A2LA 4TVPD 1OCWL 5CCKL 1YYLH 2LFGA 1GGCH 1UCBL 3U36A 3UYRL 5JPNB 3PXJA 5MERA 1U2HA 3U9PH 3GBLA 4HKZB 2NTFB 3O45B 3OXRB 4S1DD 1YMHB 3P4MA 4K8RC 4O2EA 2C7UA 4JHAH 4LSSL 4EI5D 5EOTB 4FABH 4G8FB 2J8UA 5IBUB 3STZB 3BZEB 4KZDL 3WIFA 4QGTA 3EDDA 4WUUB 3QHTC 5EIIA 3NZ8B 5DEFA 5CEZE 3PL6B 1C5DB 4ODXB 3CIQA 2DQGL 3VFMA 4PJBA 1HHJB 5EN2B 5E5RB 4XP4H 2HT4C 3LKRA 1D5BA 3PP4L 1AFVL 2X1PA 3FT4A 1BOGA 5HHXH 4ZO6A 5IHLB 4L4TD 1MI5E 3ARSA 2R8SL 3BYYA 3ZMRA 2LTQB 4MA1C 2HTKC 5KS9B 5FF6A 5J0BA 4M5YH 2QSCL 3QUYD 5JHLH 2FO4B 5GGTH 2AKRB 5DR5H 1PG7W 2YD4A 1OQXA 2FJGA 5HXMA 2EDXA 1E27A 2FR4B 1CD0A 3QCUL 1Q38A 3C60D 3O0RL 4MQ7B 4Q9CA 1IZJA 4RGMB 4JVUA 4N9GA 1JBJA 2I60H 5GISL 5A2KH 3QNYA 4OLEA 5J6GA 1NEZB 1V3LA 3WFDH 5FV2A 1FFPA 4LDOB 2HMIC 2NW3A 1TZGL 1FVEA 4X98A 1U91B 4Y5VB 4TVSa 5D6DA 4KK8C 1LGVA 3TO4D 2D9QB 4LCCA 1Z9SA 2NY6D 4JHWL 1J7VR 2P49B 1Q9LB 1FZJA 4NUGH 1R5VB 2ZSWA 4UQ3B 4MXWH 4U6VL 1U3JA 4ZSOA 3SDCD 1JWUA 3T2PA 2Q7YB 1SJEA 3PXHA 1X3DA 3A0OA 4UILH 5BV7H 4ODHH 4PJCB 1J87A 4YHPA 1CL7I 1B4RA 2ZG2A 3QQ3A 1BJ1H 1VFAB 1ZANH 3E2HC 5DHYA 4YX2L 4XI5D 2Y07L 2IBZY 3C87A 2CMRL 3F7RA 5IW6B 1JN6A 5E2UH 4U1LB 5T1DL 5E9DD 3LZFL 1I1YA 4H20H 4R4FH 5ENWA 4EN3A 5E8PA 2H3NB 3CX5J 4RISH 3Q3GB 2CXKA 4N0UE 1U8OA 4MA8H 5I18L 5BMFL 2I24N 2PXYA 5JDSB 3WIHL 1QRNE 2HRLA 3QI9D 3GMMA 4GQ9L 4QXUL 3GSWA 1SJXA 4MGXA 5DJ2B 3HG1D 1J0YA 3TVMB 4Y4KB 2BHYA 5DVLA 4E5XA 3S3SA 4Q0XL 5FO9A 2VDLH 3ARGD 2BNRA 5D7LD 4B7IA 2ADIA 3R4DA 5JLZA 4NO5B 3WBDA 3O8XC 3BH8B 3MV9E 3IF1B 4OCRL 4BZ1H 1ITBB 5GRWA 1UACL 4U1HB 4C56D 3U0WH 4NNYA 4WI6A 4KK9D 1KLGA 5IK3A 1MEXH 1QFOA 3IJHA 4OCLC 2DJ4A 3X11B 1A1NB 3GSUB 4Z6AT 4PGJA 4KC3B 1QVOB 1HQRB 1HIML 4XP9L 5TF1H 3ILPB 2FECI 5FYKE 2EDWA 5DK3A 1H0DB 4GW1A 1V3KA 3ARFC 1KN4H 4FFZH 3ULUC 4ORGB 3R1GL 3BT2H 1IKNA 1U3ZA 2OLDA 4ZFGH 5HDBF 3BDBA 4LIQL 3E6FB 3LRGA 2YZ1A 2EDJA 5BVPL 3KS0J 4HMDA 4Q6IC 3OKMB 4YHYC 4YGAB 2OP4L 4O58L 1VKXA 4Y1AA 2DWEB 3SQOL 3MUHL 3T4AB 2DQUL 2LAAA 1KJMA 4DEPC 5L2KE 4K9EC 1YY8B 2Z35A 5ITBH 1WISA 3CC5B 1MCFA 2X4QB 5FCUH 4M1GL 1YEJL 2IPKA 1ZLVK 1P7KA 3L95B 3FFCE 3RA7H 1W72L 4EBQL 4DTGH 3ULUE 3VG9B 1TETL 1F4YL 2GI7A 1MLCA 1YDPB 1DBJH 3OKKA 4A2MA 5DJXB 1R5WB 2IAMB 1A7RL 4MLSA 3K2UH 2AJVH 4NOFA 1MH5A 3DVIA 3HPLB 4D2NA 2Y4SA 3NIFE 5IESL 3PWUB 3V79C 4J3SA 4HZAA 4TTDD 3VXSD 3RVUD 2L7UA 1ODAA 5M7QA 2YD8A 4I9WE 3LSOA 5I71B 2XN9A 3KPOA 3EO1B 1S5IH 4QXTA 5BZWB 4R4ND 5E08L 3ARXA 4YFLF 5D7IF 5C2BH 3MRHA 3MLYL 3QG7L 5HYJA 2AXGA 3QZWB 3LMJL 5C9JB 4OLVH 1YJDL 2AK4D 3AS3A 4IOIA 5C0GB 1XGPB 4ISVA 2FHFA 3ARDD 2G60H 2FATH 3MRCA 4M6OH 4OGXH 3OAYK 4P3CH 5DZLA 3D1MC 1A6AB 4RMVA 5JOFB 4JKKA 2NXYC 4NNXA 5DJAA 2PO6C 5CJBA 2ZPKL 2P5WA 1QSED 5DEGB 4PV9A 2HKHL 4YZFE 1D5MA 3VFGH 1KB5L 1X5GA 4PJIF 4YC2C 5GSVA 4E42B 1DL7H 3SO3C 1KYOJ 4YEEA 5TJWK 4L4TA 4HKBB 5IB2B 4H8WH 3I50H 3D85B 1FGVL 2KQNA 1FP5A 3V4VL 1BIIA 3O6FA 3WHE0 3F65A 3DX8A 1A4JA 4YHOH 3FB5B 4WHDA 1NC2D 3AXLA 3ROLA 4X9HA 5FM4A 3T2NL 5C09A 5DRNA 4KQ4H 5JHDA 3QO0A 3DARA 4MJIE 2X70B 4R2GD 3U4EA 3NFNB 4EVNB 3OTTA 1DN0A 1VB9A 1I9IL 1KC5L 4LGRB 3QEHA 3DHMA 4JM2C 3HS0A 4NPYB 4X9IA 2ICES 2FGZA 3TO4A 4WW2B 3Q6FB 1TXKA 5BRZD 2ZZUT 3SDCA 2CIKA 4PJFB 5L2JA 4HCRA 5C0NC 4KJWD 5F7HA 1QOKA 4JHBA 3DPBA 2X09A 1I3UA 4HEPG 4U1GC 3PWPE 4PRBB 3EYOB 4O4YH 3F7YA 4LU5H 4GRWB 5GHWH 1FDLL 4PGBA 2DS4A 4PJHB 4N68A 1NBYA 3IJYA 2ATKA 5E9DA 3SDDD 4PG2C 2ZUSA 1EUTA 2YD2A 2NXZB 1OD7A 4O51A 5CHNA 1MCJA 3TIEB 1OCWH 3IS1X 5EZJB 1HHKA 4O9HH 3R8QA 1P9MC 1GL4B 5CD5D 1K5NB 1IL1B 1J1XL 3BO8B 4LL9A 4PUBH 4WWKD 5C0EB 3BH9B 4BQ8A 1AC0A 4YE4H 3UYRH 3QI9A 4Q6YA 3RL2A 4ELKA 3OWEA 4U1SA 2ZUQC 1LP9F 2YBRB 1TNMA 4JFXB 2QSTA 3VA2C 3VXSE 3HG1A 4NNPL 4JDTL 3PIQA 2YUZA 4MAUL 2NTSP 5C0FA 1LHZA 1QEWB 1S9VB 2EEBA 2DWDA 3O4OB 4LPWA 1WT5A 4HXBH 1A3LH 1UWXK 2YUVA 5IFHH 2ZUUA 3ARGA 1MCHA 5JOEA 5ELIA 4KZEH 2DN7A 3L3HA 4XCNB 4ERSH 4P48A 2DQGH 4ZUUB 3EYVB 3MRPA 3TC9A 5AZEH 3V8CA 4C56A 3KAAA 1MHEA 1KCSL 2HT2D 3AM8A 5B38B 5C9KA 1CGWA 1MLBA 5HYSA 5C08D 5D5MF 3OJ2C 1NAKL 2UY7A 3EOYG 3NCCB 3FMGL 5EU6E 4AYFA 1TMCB 4RBPK 1BQUA 4O00A 5I19L 2I9TA 3ARWA 2E7HA 4PB0L 3UBXG 1A2YA 4HHAB 4FQXB 1IBGH 4JG1H 2R1XB 4Q2ZB 3HE7D 3IAQA 4GO6B 3BD5A 5GISH 1QR1A 2F5BH 1EO7A 5A16A 1RUAH 4XPTL 1FYTD 4KVCL 4LCUB 3B9KC 4YDLC 1Q0XH 1G7JB 1WZKA 4ALAL 3F62A 1UM6L 2DQFA 1J18A 4ZMAT 2XYCA 2JELL 3EOTL 4F7EA 5A2FA 3NOIA 5L9DL 4ETQA 2CKNA 4DZBA 3LN5A 1ZA3A 4OLYH 2MCPH 3D5OF 4KGLA 4OCWL 1RQ5A 1PLGH 4EQ3A 4NJ9H 4I13B 5ICYA 5IQ9A 4FTVD 3VCLA 4AEHH 4QYOB 3G6DH 5CJOL 3BD3A 2HG5B 3LD8B 3RUGE 4JPIB 3L9RB 2EXYD 1FBIL 2NY4D 1HH9A 1Y6KR 1SEQL 2EIEA 3MRNA 3D9AH 4KGJA 5D7JD 5BRZE 3E6HB 2FCBA 4ONGL 5C6PB 5JQ6H 3BVNA 2AEQL 4IHOB 1A5FH 1OAKH 5MI0B 5E8OA 1KJVA 1JCKA 1N7ML 5HVFB 5D7IA 1TTUA 5I18H 1MFDL 1XGTB 5JPMB 5E70A 4S1RL 2GJ6D 3O9WB 4GQ9H 4U6XB 2AK4A 1GGYA 3RBGA 1LK2B 3SE4A 2BSSB 4OKDA 4GXUN 4JGMA 4ZS6D 1L4IA 5A40E 1EMTH 1JNNH 1H8NA 2PYEE 4BUHA 3TYFA 3QUXB 1LO5A 2BC4B 3KYOA 5CJQH 5B8CB 3TO2A 1GIGH 3MLUL 1QRKA 2BERA 2P47B 1QSEA 4OCXL 1IEAB 4GBXD 5FYJH 1I3GL 4OLZL 3JTTA 1MQKL 4PJIA 2CRYA 2DBJA 3CK0L 2W92A 5AUMB 3TZVB 2J5LC 1YEEL 4KH2A 4XXDA 4NN5B 5IBTL 4JHZA 3QEGH 3MRQA 4Q9RH 3WLBB 4LEXH 1IM9D 1CFTA 4NKOB 4HFWA 4WU5B 4PJ9B 5IHUL 5GS2D 3TBWA 4HH9A 4AZ8A 4X8XA 1R6VA 2D0GA 1T89A 3V7AG 2A83B 3RY6C 1UCTA 1RJYB 1YEDA 5H37H 2IPUK 5JTWA 1IEHA 3RY4A 1K4DB 3TH3T 4Z95L 1SY6H 4PJ8A 4X7SH 1O7SA 4Y4FB 4G8EB 1SEBB 4I0PB 2BOBA 4CN1A 1URLA 2AJYL 2J8OA 2JJVA 2Q6WB 4Z0BH 5K59F 1I8IA 2JJTA 4UT9L 2ILLA 1SYSA 2CUIA 1ACYL 4IRJC 1WGOA 5DJ6B 1UKTA 1BQHA 3VDCA 4KMLB 5E6ZA 3W11C 2P5ED 1I7UB 3GI9L 3P4NB 3P9MB 2RBLA 5D8JL 5HI3D 2AV1B 4OZGA 3GSQA 2YPVH 4HWZA 1A0QL 1BEYH 5CUSH 2NY1D 4K55A 2XWJA 4LLQB 1BF8A 4JPVL 2UZIL 1T7ZA 3MJ7B 3S36H 5D96B 4ZOEA 2IWGA 2B1HL 3SDDA 4IMLA 4F9PA 1UYWL 3FQUA 2A6KB 2F5AL 2FL5B 2XQBL 4HQQH 1E6OH 3G6AA 4TUOA 1FFQA 4XP6H 3ZHLA 4M9PA 3VMOA 4PJXB 2OTUA 4LP4A 4JFOA 4WWKA 4ZPTA 4NRXA 5J13C 2DTML 4AT6A 4PTTA 4XVJL 3R06A 1CGXA 5EU3A 3RGVD 5IROC 5GRVL 2YD1A 4PRPE 4OGYL 5TDPA 1H3VA 4H0GA 1I4FB 3LEVL 3FQTB 5AZ2H 1AD0B 5EZOH 4GRLB 4QEGA 3BE1H 3D0LA 1KCRL 4RZCA 2NZIA 2NY2C 3D39A 5GGTA 4FA8A 2Y6SC 1YMMA 3RVXC 1U92A 4R90H 1DLHB 5HJ3A 2P46B 3IAPA 1KYOK 1TVBB 5F9AC 3ZYZA 1FAIH 4CMHB 3K7UA 4DKEL 3AMLA 5IM7B 3RVWC 3LEXB 2HLFD 3OXSB 3V0VA 3TNMA 4G6AD 1ZLVH 1EVTC 2DQCL 4F33A 3MV8D 2IH3B 4AJ0A 1CICC 1F3JB 2FEEL 2K3TA 3GKWL 5TE6L 3MXVH 3FCTB 1EXUA 5CP3H 2Z93A 5DVKA 5C08A 2IMNA 3QQ9C 5EZIH 3BHBA 4QRRE 1KPUA 5C0AB 1KJ2A 1YY9C 35C8L 1QFWL 2ICWB 4G7VH 4LARL 4MQXD 3T2NH 1WWWX 4J6RH 2R0LL 4LHUA 4U6TA 4Z7OF 1BREA 3Q1SH 1IARB 2IBBA 4UB0H 3HI5L 4GQPH 1NGPH 2VAJA 4GW5A 2BRRL 1I9IH 2QHRL 5I66B 1MWAA 3D3VB 4NO0B 1EEUA 3HMXL 1OAYH 1J0ZA 3HE6D 4Z7WF 5GIRA 1KG0A 2VR9A 2UY6A 5F1IB 5CIPA 4Y89A 4Y8DC 4GMTL 2VN7A 2E3VA 3MGTB 4PRID 3W9EB 3ZE0F 3OAYH 5F7DA 5I1HL 3MRIB 3REWB 4FTVA 5E6IB 3FZUD 1SM3H 3WD5L 5IT2L 1CXEA 3O45A 2PW2A 1F90H 2X89D 1OTSD 1DQML 1YMHA 3ARYA 3O6KL 3WDJA 4LKXB 2CLZB 1QFPA 4P5MB 1R3LA 2ESVB 2W9EL 1QKZL 5FFLA 5TPWL 1S9KC 5D7JA 2H8PA 3BZEA 3MYZA 15C8L 2G5RA 1KPRA 1Y0LA 4KFZC 4F15C 3K3QA 2XV6B 1C1EH 4FQHA 2P5EE 2XICA 4MNGB 4YXKL 1TCRA 4QTIH 3DBXB 1K2DB 2DL2A 2VH5L 3WFCH 3DXAB 3T4YA 3BEVB 1JHLL 1FSKC 2BY0A 1KCUH 4UIMB 3EJZC 2EYTB 2I25N 2YS4A 4NNPH 3QDMA 4UTBH 1ZV5A 4HS8L 4Z0XA 3RZCC 1AGBA 4G43B 1YEHL 3PGFH 2BRQA 4TULL 1DQQA 1G7PB 1I8KB 3WNKA 4G3YL 3JWNC 2WWMD 1LD9A 4NSKA 4MQ7A 4NRYB 1DANT 4GBXA 1OM3H 3EYUL 3BZFB 1GGTA 4H88H 4EOWH 3DMMC 1A9BB 3NA9L 4ODSL 4RMWA 3SGEH 3TFKC 2V6HA 4NZRL 1FFNA 3WHXB 2OCFD 4YUEL 1GGUA 2Q7NA 1OSPL 1R5VA 1HXYB 3HRPA 1P2CB 4M8QB 5EU7E 3VFSA 2C3WA 3OKEB 4WEMB 5JXAL 3BGMA 3CGTA 3ZTNH 4YHNB 5CJXC 3UDWC 5LBSL 3PJSA 5AD0A 2WNGA 1AP2A 2RHEA 2GUOB 5BJTB 2VXSH 4MAYD 2EDDA 1FO0B 1FVDB 1LK3L 3PNWA 1NC4B 1IGJA 1VFAA 1KNOB 3AREB 3MV01 1ZLSL 1HHHA 3CAFA 4Z18A 1ZGLA 3BEWA 1GZQB 2BDNL 4JFZH 4LCWA 5I1IL 5CSZB 5EOQH 5T5FH 2CLVB 2JELH 2VB5A 3I6GB 4LLUB 4DK6A 2YPLB 2BFVL 4PBXA 4P2QE 1FNSH 4PRNA 2HJKA 1CLCA 5J1SC 1KEGL 1UWXH 1MFNA 2YRPA 3DRQB 2V2WB 4UDTB 5D1XD 3S37L 2YD9A 5C6TL 3HUJF 2GSIB 3VWKB 4Y4KA 2O61B 2HRPH 3INUH 3C6LC 3NCYP 3WV0A 3MRBB 5CEZL 4WHYH 2J4WL 2R29H 4PRIE 3UC0L 3ZYOA 4Q7DA 2RFXA 4RA0C 3FB6B 5SWZE 2NX5E 5HHPB 4WWID 3UYOD 3BH8A 2BHUA 4XP1L 2JB5L 4RX4A 5I1GH 1DBBH 2YN3A 4RBPH 4J8RB 1I9JH 2C1PB 4HUUA 3CFEB 2EDQA 4KTYA 1MCWM 1Q9KA 5ERWB 4KK6C 1S7SB 3RGVA 5HGBA 1QVOA 1HQRA 1C16B 5IJKC 5T33H 4N8CL 5KN5B 1H0DA 4XMPL 2V2XB 1NBVH 1T1YA 3ZKQD 3VXUB 1NL0H 1XGUB 1JYNA 4BK4A 2EIBA 5I15L 1GZPA 2C1OB 1AQKH 2VMFA 4D9QE 1T04A 3CFDB 3E6FA 5C0CE 4LNVA 5E5UB 4GRMB 3CK0H 5I30L 3OKMA 3CFBB 3MV8A 4XWOD 5TFSL 4ENED 4PJGE 1X7QA 4JFPB 2VLRB 1UZ8B 1XF1A 2GSGB 4PJEE 4X6DB 2FEEI 1P53A 3NGBB 2X4QA 5IHUH 1OW0C 2GQHA 3KPSD 3EOAA 5F9JA 4HS6A 5F7LB 1MVFA 4PY8I 3MV7E 3OX8B 5F9OL 1QFWI 3QFJB 1YNLH 1FO0H 2EEAA 3CX2A 4A6YA 2IAMA 1ZT4A 4QOKD 4Y19B 3D25B 3T77B 2YR3A 1B4JH 5HHVL 1M7DB 1CN4A 4JM4H 1FPTL 3MROA 1D9KD 5EUOF 1U8KB 2UWEB 5LXGL 4LPVA 4Z7WA 5GGRA 3EYFB 4PLJC 1IC7H 3KGRA 2VERN 2XWTB 2Z92A 4FG6D 4KRPB 5KSBE 4XNXL 2B4CC 2QQQA 1S7WB 4LHJB 2X1OA 3FRUB 1NDMB 2W1NA 4AIZB 3TN0C 1WTGT 4WRLA 3V7AE 5BOZG 3EFFB 3SCMB 3T0VA 4XVUD 3BP4B 2CDGA 1XGPA 5DRWA 4RFNB 2XXCB 3MLWH 3GSRB 2VAAB 1A7OH 1RIUH 2Q87A 5I75C 1YNKH 1MRDL 2H32A 5DD6A 2V2TA 4ZPVB 4W6YB 5DQJB 3ULVC 2FX9H 1HHGA 4OM1L 1DEEB 5DJCA 4JRYA 4UMGA 1KUMA 4WTWA 1UZ6F 1ZHNA 1OT2A 2HJFA 4JO2L 4IDJL 4WO4D 2ADJA 4BFGA 2CRZA 1OQOA 1OP5K 1N4XL 3FAWA 3Q5TA 1MVUB 5E24E 2ZCLL 1FL5B 1MCDA 4HKBA 5TGBA 3KS0H 5FYKL 5IB2A 1RIVL 2AJXL 1U8MA 3IDYC 2A77L 5HGHA 3S36X 4OGYH 3VMNA 2AI0H 4DVBB 2H2SD 5FO8B 5KANG 3QEQB 4MHHI 5M95B 1J88A 1WVZA 1XR9A 4JZJB 2B5IC 3M45A 1KPVB 3DV6B 4ELMF 4PP2B 3A6CH 1K8DB 1JWMB 4R97C 2BX5A 4ZG1A 4HZLB 4PJBE 4JG0H 3PWNA 5E2TH 5IVXB 1ZK9A 2MSPA 4QRQB 4MWFB 1UB5B 3MRMB 4WW2A 5JW4R 3NPSB 4K2UL 4J1UB 3ULUL 3WN5A 3N85H 1WIUA 4F37F 4NZTL 5D6DC 2YEZA 3CFCL 3X13A 2X4SA 4LCCC 1IGFL 1W8OA 2FD6H 3THML 3PWJB 2EDFA 1I9RL 4MAYA 3QPQC 4YK4B 4EZMA 5DQ9A 2VQ1A 2WBJB 4PRBA 3HZVB 2HVJA 2A9MH 3RL1A 3UTSB 1R3HB 3UTOA 5B39B 4ODVL 4IRSA 1JWSB 2BOCA 4E41D 1N59B 3L3DB 5ESVB 1TZIB 2RIKA 1F58H 4N8VB 1VFMA 4QHKI 5C07D 4ZTOL 3OR7A 3TIEA 2QBWA 3X3FL 1D6VH 4MA3B 4X99A 4EN3C 1VFBA 3O2VL 1V7MH 4QOKE 2VLKD 1N8ZB 4NO3B 4PLOB 1A4KA 4MNQD 4OGAD 4PD4J 3L7FA 5IMKB 5ILTH 1IC1A 2PXYC 1NMAH 3HUJA 1CLYH 1A7NH 3VGFA 4CVWA 3PGCA 1ZGLM 1QKZH 1CVRA 3LAFA 3MC0A 1JGLH 4H25A 4PPTA 1WWBX 1BGXH 4JZOB 3C5SB 1F6LL 4Y16D 4XC3H 2X4UA 1GAFL 4QRPD 1MOEA 3GMPA 1AD9B 1ROWA 4KY1H 1CLOL 1TJIL 5GGUB 1N26A 4ZAKA 2CUMA 3JWOH 1G1YA 1MI5B 5K9JL 2CIIB 3QUMB 4J4PA 4U4BA 3SKMA 4G80B 1FZMA 3WXWH 1M7XA 3L7EA 1A47A 3CDCA 2IPTL 4YWGL 2ORBH 3SDXE 4XWGH 3AU1B 2Q8BH 4HS8H 3TIDA 2D2OA 3LKQB 3QIWD 4JFDD 2ZUYA 1K8IB 2VUYA 3L5HA 3O3AA 3PUCA 2X05A 3W39B 4IRZH 3VD9A 4FQPA 2O5ZH 3EKCA 4L3EB 2R1XA 2JIXD 2PKDA 4Q2ZA 4WHTA 1VACA 2X5PA 2ZUWA 4LLDA 3QFDB 3RKPA 4D3CH 2EDRA 1IKNC 4WJ5B 1SY6A 3MRDA 1TVHB 4G7YH 2O5YH 1W0YT 4NZRH 2ZNXA 1TJGL 1G7JA 2DIAA 1QA9B 2B2XL 5AYQA 4MA1B 5AAMA 4KV5F 3LV3A 4YNYA 5DVOA 2BCKA 1DQDL 3KPSA 4ZFOL 2YPKA 3DETC 2HFEB 1I9EA 2KPNA 1U8NA 3I6LD 2AGJL 4EQ2A 3UPRB 4R96B 3SKNB 3MPCA 4JR9H 4ODBD 3T1WA 1DP0A 2J1KA 2L7JA 4KI1A 5FDYA 5I1CL 4HK0B 2Z31D 5JNYB 1QSFB 3ISWA 4HLZH 4FP8L 4HGWB 2EZ0C 2J2ZA 4L4VB 5FYKU 1KXQE 5H35A 1WBXB 3A67H 4O5LL 1J1PL 1V5JA 1KN2L 4HKXB 1FL3A 1XGTA 3EDFA 5HHNA 3KYMA 3E2HB 4LSUH 4TUJB 5FAAA 3ORJA 2E27L 1N6QH 4M7KL 1IGIH 1FZOB 1YUHB 4PJAB 4LSRL 4EDWL 2BC4A 3RKDC 3OKLB 4WV1A 1DUYA 3H3PH 4Q58C 3GMQB 3MV9B 1GVIA 1ZTXH 3CVHB 1IAIL 2E7MA 1ZWIB 4F7MB 4XP1H 5HHOD 1OAQL 5KVEH 4NZUL 3RPIB 4WO4A 1U8HA 4Z7UB 2A6JB 3SDAB 3QUMH 4RDQF 3L3GA 1MCPL 5AUMA 4K8RH 1S7QB 1NUGA 3H0TB 5HYJE 3GMLB 2P8LA 5DURB 2ZKHH 3FB8B 3D18B 3OR6A 2OR9L 3I02B 5KZCB 4KHXL 4X7CC 4D8PA 3O8XB 3WUWB 1P1ZB 4MD0B 5IIEB 3O6FC 3NFPB 3GSNL 3VU2A 4LSTL 4UT7L 3T3MF 4R9HA 3DVGB 3C8KA 2GFBB 2Y36H 5AYUH 5JOPE 5FUZL 2P5WE 4ELMA 3C08H 1F4AA 1XF4B 2XXMB 3S35H 2V5SA 4GW4A 1CBVL 4D0DB 1BZ7A 4DZ8B 1J10A 5L2KB 1D5IH 3VXRE 1EGJA 1OB1A 4DW2L 1RSFA 1OARH 5DUML 4WUKL 3G5XA 1A14H 1U3HA 3VGAC 3ARFB 3CVIH 4G6ML 1RK0B 3TO4C 5HSFA 3WDHA 2NY6C 1FFOB 3G08A 1BVKB 4XBPA 5FB8B 4OCYH 3SDCC 4LSPH 4RAUB 5H2BB 4UOW0 4LASH 4Q6IB 3OPZL 5C09E 4ZQKA 4YHYB 3VXTA 1UQSA 5JHDE 3GIVA 2ZSVB 4LSVL 1AGDA 4Y4HD 1MCRA 5D1QA 4U1MA 2O26U 2RGSA 5HGAB 2FX7L 5I0ZA 4DEPB 1RUKL 2CDFB 1EJOL 3HC3H 3IVKB 5ANMA 1FG2B 3QWOA 1BD2D 4RGOL 2J3SA 3PV6B