1BWMA

A single-chain t cell receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
249
structure length
249
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLGSDYKDDDDKRSGGGGSGGGGSGGSGAQQQVRQSPQSLTVWEGETTILNCSYEDSTFDYFPWYRQFPGKSPALLIAISLVSNKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAATGSFNKLTFGAGTRLAVSPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, specificity and CDR mobility of a class II restricted single-chain T-cell receptor.
pubmed doi rcsb
molecule keywords PROTEIN (ALPHA-BETA T CELL RECEPTOR (TCR) (D10))
molecule tags Immune system
source organism Mus musculus
total genus 21
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bwmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bwmA02
1UWGL 5D7SH 4U6HB 1MRFL 5BS0A 4BFGA 1YN7B 3MRIB 5EFIA 1P6FA 1S9XA 4XNUH 4HSQA 2WBJB 4TNWK 3B5GA 2KZWA 4XCCH 3ZE2E 1DDHB 3I84A 4N9GB 2GTZA 3HA0A 4MNHB 4ORZC 1WCBA 4DZBA 2DQDL 1JNNH 4XP5L 4IBLT 5EZJB 2DMKA 4J6RH 2QADD 3L3OA 3HAEG 1PZ5B 2NR6C 1WZKA 1C1EH 5CEZL 4YNYB 5C07B 4HWBA 3KLSA 1MQKL 2DF3A 4UMGA 4YPGA 4EBQH 5HD8C 4KQ3L 4HIHB 1PD6A 3MRJA 2P5WD 3U2SB 1K3ZA 3OWEA 4JQVA 4KV5F 4TTDC 3D3VD 3FT3A 3E3QC 5E0QA 2NTFB 1IJ9A 2NTSP 3QIWB 5F7HA 5HYJE 1FCCA 2HFEB 3HPJB 4XCFH 5CBAA 4TULL 1JZ8A 4WEBH 2DLGA 5F71A 5L8JB 1SY6L 5EBLA 4QGTA 4PJAF 3GSRB 4RGOL 4XH2A 4K7FA 5TQ2H 5IVOA 3NCJL 4G5ZH 2XZAL 5JIKA 2VLKB 4ZPTB 1A2YA 5B8CB 4P59H 3SQBA 3VXMA 5I66A 1SYSA 5ALBL 3TZVB 3TBWA 2XN9D 2AJ3A 1HINL 1FO0L 4ZS6C 1X5GA 3MRCB 1S78D 4TNVF 4I0PD 4JDZA 1DVFC 5CJXA 1A0QH 2BVEA 2HLFC 3QUXD 5B3NA 4NIKB 5DHYB 2AJXH 4JM2B 5HPMA 3TH3T 2YKLL 5CBEA 4YZFE 5I1HL 1AGFA 3OKKA 4LDEB 2J88L 1BFTA 2GJ6A 1VADB 4GRLA 4XCEB 5HHOD 1CDJA 2SEBB 3QUMH 5L2KA 3OR6B 4ONGH 3Q48A 2L7JA 4X7TB 2YRPA 2VXUL 1NBVH 1PEWA 1HYSD 5GGTA 3S36X 4QTHA 4BZ1L 3UTSA 2IAMA 3S3JA 4LSSH 2QSCH 3TN0D 1UVQA 4WI6A 5SWZA 1C08B 4UDTB 1YEJH 4J1UA 1QSFB 1KNOA 3S96A 4JZJA 4RGNE 1P9MA 1JV5A 4P57A 3U30B 2P8PA 1N0LA 2WZPD 1NEZB 1I7RA 3IDGA 1U6AL 2CRMA 3V0WH 3GMPA 3G6JB 1E4XH 4RGMC 2P5EB 4F2MA 2VLLA 4UV7H 4Y4FA 4OCWH 4QXGH 4Q2ZB 2HTLD 3RI5F 3ZDZF 1CD1A 5CHNB 4PV8B 5BO1H 3I6KB 4OQTL 4LCIH 1U93A 5TDPB 1FO0B 4R26H 4OSUL 3LS4L 4Y1AA 2YD9A 2OR8A 1RIVL 1HHJB 1EEQA 1LP9B 1ND0A 3X13B 3BSZL 1E28A 2PYFB 5E99H 2Z0BA 3FCTA 3WIHL 1JGLH 1J0YA 1LDPH 1NH6A 4FRWA 4N5ED 3TPUA 3KNBB 4PTTA 1ACYL 4L8SB 5FXCH 1AXTL 5I17B 4CVXB 2Y25A 2Z31A 3VA6A 2F5AH 3VG0H 3DRQB 4LGRB 1YEKH 4UTBL 3SKUD 4MB3A 3MV9B 3C2AL 1U3HB 2RCSH 1IAIM 3QT2A 2DLTA 5DD3L 2CLZA 1KJMB 3EO9H 5A2LH 2ADIA 3L6FB 3HZVA 4P2QA 5C0BE 2Z4QB 3WHE1 2DJ4A 1G7IB 3FOMB 3GKWL 4DGIH 1T0NA 5E9DA 3F7YA 3INUH 3C60B 3MACH 1RJLA 4X7CC 4WDIA 4CNIA 4U1GB 4PJXF 4R96B 2CDFA 4X4YB 4TUKL 3E8UL 5JHDA 4JFQA 4HKJA 2H6PB 3T0EC 1IEHA 5CSBA 5I73C 5LGJA 4ZOCA 4HX1B 3BP5A 4K3EH 4NUJA 5T5FH 2VLRB 2UWEF 4OD3L 3STZB 1INDL 4PJHB 1G6RL 3IDJB 3TEUA 1BMGA 5EOCH 4XPFH 3KXFB 4P4KC 3TWCL 4KRPC 4KUCD 5H94B 1BBDH 2LFGA 3SDCB 2FDBP 1KJVA 4WI3A 4MAYA 2R1WB 5C7XH 3UJJL 3UPAA 1SEBA 2AP2A 3VGAC 4OLUH 4POYA 5I2IA 3WDJA 3D2UD 2IGFL 5D5MB 3WUWA 4OAWA 1AJ7L 1OD7A 4NUGH 3HNTL 5BVPH 3GI8L 4F7CB 5TF0A 3M8OL 3H3PH 3PWNA 3LY6A 4IRJB 3QXAB 4FFZL 2R2HB 5GGVL 2B20A 2AK1L 1HHGB 3O4LB 4U1SA 3KPLB 4WU5A 4Y5YB 4JRXD 1IM3A 3D0VA 1N2RB 4PGBA 2N7BA 3G5YA 3K3QA 4J3XA 1KTRL 1L7TH 4F7EB 3MRBA 5I8CB 2XG5A 1T4KB 3RZWA 5GHWL 2D4DA 2BVUA 4LQ1A 5FIEA 3U7YH 5B4MC 5D8JL 1CDBA 1EVTC 3WO4C 3FKUS 4XVJH 1H8SA 1X3DA 3KPNA 3H9SE 1MHCB 4LOUC 4NCC1 3HC0B 1JF5A 5SV4A 1D3CA 1HHKA 2IWGA 2P24B 4YHKL 4NNYA 2BHUA 3W39B 3Q6GL 4XC3L 1KCKA 3BKMH 1WZMA 4KJYB 3HI5L 4G6FB 3KPOA 5DRZB 3S3PA 1G6RB 1RFDL 4XCNA 3WYRA 4NM4L 4QRSA 3QFDB 3C09B 5BZDA 1OT2A 5CIPA 2DMBA 3QRGL 3ULUE 2BX5A 2YS4A 3NFPA 5ESQA 4ODSL 5C0AE 4Q7DA 2ESVD 3B43A 3S3SA 1N5YH 3T0AA 4RFOH 4WWID 4O4YH 1AXSB 1FFPA 1YPZF 4Q0XL 4Z18A 1NAKL 5CSZA 5JDSA 5HYIA 5KJRL 3VWKD 3A6BH 4MQ7A 4TUOA 3FQXA 1UB6A 1U8IA 4N8CH 4FP8H 2EZ0C 3QHFL 3WFBL 5DO2D 1PSKH 3EOAB 3IF1B 5L8LB 2OXHA 4HIJB 5E2WH 1MPAL 4R9HA 4QOKD 5IVZA 3B9KC 1LHZA 5I74C 2CDEA 1WGOA 4S2SA 43C9B 3MGTA 4AYFA 3ARBC 1IILE 1HCVA 4Z78B 4ELKB 4MA7H 2F74B 3BRDA 4M48H 5D7JB 1I7UA 1KG0A 1ZANH 1RVFL 4U6XA 5T3XD 5CGTA 2NY1C 4IHOB 4X6FB 3L1OL 4OZHB 4WV1B 5EUKB 1EEZA 1DFBH 3GHEH 4HLZH 5C8JA 4MDIB 1MLCB 2VDPL 5F1NA 4I0KA 4OM1L 4KGLA 4HHAA 5DC4B 1IAKB 3BI9X 1YZZA 3DSFL 4KAQL 3VFNB 3MOAH 1YEGL 5MENE 1HSBB 4FZEL 5D7LA 2Z8VC 2YRZA 1SBSL 3GSQA 1MAML 2NX5D 4U7SA 5ACLA 3QPQD 2JB6B 3SKJH 1DBJH 3X12A 3PDDA 4LP4A 1F11B 1I8MB 2PO6B 4Z7OE 2WUCH 5BV7L 4PREA 1R24A 5DUPL 3TBYB 3TNNA 4EI5A 2HKHL 1QBML 1C5BH 1EMTL 2OM5A 4Z5RA 4K7PY 2NY7L 4M1CC 1ZLWK 1EBAA 3RVUC 1JN6A 1R6VA 3S98A 3PJSA 5FGBC 2HH0L 4LASL 5F7FA 2RJMA 2FBJH 4PJFB 4HUNB 4PJ9B 4AG4H 4C56E 1SM3L 5EOTA 1NFKA 3B2VH 3KYKH 4LCCC 2Z92B 3VFUB 3BO8B 2C3VA 1CE6A 1T1WB 4CMHB 2FR4B 4Y19E 1FFNB 2X7LB 3RFZC 4Y4HC 1VFBA 3ARBA 4F37K 3E6HA 2CSPA 2R1XA 4LVHC 2BY1A 3EO0A 3K8MA 1I1FB 4O58H 2VQUA 3C8KB 5LXGH 4I8DA 1EZVY 4LVOB 2XWJB 5E1AB 4AM0B 1FZOB 2QR0A 2WBJC 3N0PB 4Z0XA 4P2OB 5K9QI 3VXQB 4KUCF 4LIQH 3FN0L 4H0GA 1AC0A 3MV7A 5EO0B 5LCVH 3P9LA 5HHMD 1H8NA 4J4PD 5MEPA 3G9VA 1BD2B 2H2SC 2NYYD 1QA9A 4HEPG 1AIFB 4FZ8H 3WDIA 4CGTA 4MA8H 3MROB 1A02N 5GSVA 3VD3A 3OXSB 4R4BA 4CDGC 1RUKL 3D85D 1EEYB 4OT1L 4G6KH 1X4ZA 3L3GB 4UB0L 4G8GA 1ULVA 5DA0B 2I5YH 3QIWC 1KN2H 4N90E 4PJDA 4G3YL 3TJHD 4NQSB 5DGQA 3SJVD 1KB9K 4PJ8D 1YQVL 4NKMA 4H0IA 2HT3C 3QNZA 3QCTL 3VWJD 3AC0A 3L5WB 4PJ7E 2HFTA 1ONQA 5B8CC 1KEGH 3OPZL 1Y18A 2ADFL 3CFCL 2JKXA 3TZVC 2DQHL 3BIKA 2WMPA 5H37H 5IB4B 3SGKA 3W9EA 4HQQL 1CTOA 4YUEH 4YE4L 3EW3B 1NUDA 1EFQA 1U95A 5CLTA 4HS3A 5BCAA 2FHCA 2JJTA 4K23L 2D4FA 4WUUD 1NMCB 3S97C 3PGDA 1QO3B 4JM2C 4Y4HA 5CJOL 4GRMB 3BJ91 4OFPA 2D7MA 3ARDB 4L1HA 5IKCB 1ODAA 3NIFF 5IUSA 1AKJA 3V5DA 3IFPB 4V1DB 2XT1B 1INQB 2FJHB 4YHIB 1XF5B 4ZUSB 3L3JB 2FLRT 5CMAA 5CILH 3KJ6L 2G75A 1A14L 3UAJC 2XZQL 1B6DA 4J12A 4MNHA 2YBRB 4WO4A 3TJEL 4XHJC 4XBPA 4OFVA 4U1IB 3WKML 1A6UH 4B7LA 4M4PA 3DV6B 4PRPA 1IQWL 2XRAH 5JR1L 3GB7B 4HXAL 4Q97A 1DLHA 2Q8AL 4ZSOA 2X05A 1W0WB 3VW3H 1ZA3B 3TBVB 3U30C 3NAAH 1L6XA 1GGTA 4HIHA 5TH2B 5T3ZE 4X6CA 4XP9H 5SV3A 2ARJA 3S36H 5DVNA 1I9RH 2IH1A 4BFEA 3QIWA 5EWIH 5CZVL 5GJSL 3O2WH 1CGSL 1I8IB 4S1DD 1ES0A 2ENYA 3O2DH 4KPHL 1CTNA 1R3LB 4S11A 3MO1A 4WFED 3GSRA 5FFLA 3T0BA 2VLKA 1LEGA 4MS8C 5B8CA 1B90A 2J8UB 3L3HA 5E8EA 3IDNA 4NJ9L 5D71H 4ODUB 5DJYB 4OTXH 5EU6D 1EAPA 4JN2B 1N3NA 5D1ZB 3LN5A 5ICXB 4L8SC 4UOJA 1JK8B 1AC6A 4KZDL 4PUBH 3P30H 1DQQA 1PFCA 1KCSH 1RZFL 3ARGD 4X7SH 1AO7B 3B8YA 3PABB 3ORJA 1U3HC 2R4SH 4ZD3H 4GBXD 1BX2A 3SKMA 4M6MH 2W9EL 3KPMB 4D9LL 5JPNA 5EZLA 3QUYB 5FB8A 1XR8B 4P46B 3HG1B 4JQIH 3OR6A 1CFQB 3QB7C 3C60C 3QI9D 4X7TA 1G1CA 3KWWB 3G5XA 1IEBB 3RL1B 2DQGH 5F1OB 1MCPL 1TFHA 4U1GC 1IKNC 1T21B 2VDRH 4NZRL 3SDXF 4HUUB 3ZKMC 1ZT7A 2J7LA 5EO9B 3RUGA 4M8VA 1KYOJ 1DBKH 5J3HD 3OR7B 1QSFA 2FWOA 1J0ZA 1NEUA 4RAVB 5EU3B 5LQBH 4ZTOH 1JHTB 2PYEB 4N8VA 5BW7C 2V5TA 3B6SA 3EDFA 4U6VH 2A83B 4H8WL 1Z2KA 1B4RA 2HWZL 1BFVL 4L5FL 3SDCC 4ODTL 3R1GL 3IKCB 2HJFB 5EZIH 1N0XH 4DGVL 4JY5L 1H5BB 5CHNA 2BHZA 1J9CT 4R90H 3RVWD 2VLMD 4IRJC 2AEPL 3VI4E 2PYFA 3FN3A 2NY4D 3E6FB 1GJIA 3H9YA 4LU5H 1F4YL 4L8SA 4JO3H 4ONHB 5I17A 4MSWB 1WC7A 3MUGB 2A73A 5BS0E 2OZ4A 1EH9A 4HAFA 4G9FA 3L5JA 3VFMB 4PS4H 4OKDA 3PWLA 2MCPL 1LE9B 3L6FA 2Z4QA 3JTTB 1K8IB 2WINA 3QO1B 4QRRD 4JO1H 3MA7A 4J8RA 3REWA 3C60A 3KJ4B 4XNXH 5A16A 1NKOA 2ZNWA 1C5DA 1QR1B 3F12B 4HV8B 2RAMA 2IQ9L 4LRNH 1D5BA 1YMHB 3GSNB 4X4YA 1BOYA 1F02I 3FO0H 4ELMA 1R0AH 5I1EL 3BPLB 5EOQL 2VDOH 3L3KB 4FQQA 3C09C 4I77H 4NN7B 2VLRA 2J3SA 4ZQKB 2GY5A 3STZA 4ETQB 1KB5B 2IG2H 3FQNB 3MV8D 5F7KC 5I76B 5A2KH 1DN2A 3KYAA 2A1WL 1ZLSL 2YC1B 1NDGB 1XGQA 1JPFA 3VXME 3VXPA 3WD5H 3CVHA 1FZMA 1T89C 3WNOA 1HQRA 1B2WL 4L9DA 3X3FH 2X9XA 1B4JL 4HH9A 4LPYA 4M6OH 4RBPK 3C5ZD 4FXGB 2UVEA 3V52H 4APQD 4J3OC 2EEBA 3REVB 1TPXB 4PFEA 1UWGH 1MRFH 3UDWC 3HLAA 2CXKA 3TCLB 5M7QA 3CJJA 1YY9C 2FEDD 4JY4B 4ZUTA 3L3DB 2AKRA 2B4CL 2R2HA 5DK2B 3GMRA 2NCMA 1YC7A 2GJ6E 3T1WA 1NDMA 2DQDH 5IFJB 4XP5H 5ALCL 5F9WB 5L2KE 3FOLB 3QQ9D 1C16B 2H32A 5CEZH 4NCC2 5ID0B 1MQKH 3ZKNC 3UTSE 4KQ3H 1G7PA 5D7JC 3FB6A 4GAGL 5EUOE 4Y0GA 4LF3A 5SWZE 3NN8B 3SKNB 1GSMA 4WV1C 4NSKB 2X4NB 4MJ6A 4QHMB 2N56A 3W39A 1JWSA 1GGYA 4TULH 2HT2D 3VRIA 4PRAB 4ZXBB 1G9NC 1SY6H 4PJ5B 4GRWB 4RGOH 3NCJH 4KI1A 2XZAH 3E3QE 4JFDA 1FNGB 5D2NB 5ALBH 2BERA 3RWEB 1HINH 1FO0H 4E0RA 2APTA 4RBPH 1FL3A 5B21A 3BZEB 5DYOB 3S37L 5DUBB 3QEUA 4Y1AE 2P48B 3ZTNL 2R56L 3LN9A 3NIDE 4HBCL 5D7KD 5FOJA 2PO6C 4RFNB 4HUXB 4RDQG 1JGDB 2BVQB 2YKLH 1WZLA 5C0CB 5I1HH 4GKZB 2J88H 2D03L 1A1OB 4JCMA 3BMWA 1U2CA 3VXSA 4L3AA 2XTJB 4MQXC 3OG4B 4PJAB 3EOAA 3BIAX 3OF6D 2VXUH 5F9JA 4BZ1H 3EZ8A 4PJ9C 4WHTA 3WIIL 2EO1A 4P2QE 3ALXA 3SDDD 2FYYA 2VYRE 3EFDL 1OCWL 4CMHC 4NQUA 5E9DE 3G5ZA 1KIUA 1OWWA 1ZKAA 4LGSB 4YXKL 3JV4B 1TVBB 4R4FL 1KIRA 3DSNA 1EO7A 5SX4H 3V8OA 3AS3A 2W1NA 5JHDE 4X6EA 1FJ1A 2DM2A 1U6AH 2QKIA 1WBZB 4HS8H 4LP5A 4LVOC 5C2UB 4S0TD 5C0DB 5F7DA 4U1LB 2NY0B 5IMMB 5EUKA 4P2OC 1I85A 1OAYL 5A3IC 3K2MC 3O2VL 2LVEA 1FCGA 4MDIA 3RRQA 4ORGA 4OQTH 5C0JA 2IPUK 3KG5A 4NQCD 4OSUH 2DQFB 3LS4H 4XRCB 1RIVH 2X4RB 1JYNA 1P4LA 5KANI 2YOCA 3BSZH 3DUSA 3MRRA 3WIHH 3I3EA 1QFUL 3DURA 1HSBA 2BC4B 3S34L 1MFDL 3ULUD 4DK3A 4HIIB 1ACYH 1M4KA 1NFDA 1UXWB 4WTXA 1AXTH 1JZ4A 4TSBH 2DQUL 3D25B 1QFHA 1Z9SA 4UTBH 1I8MA 3KYOB 3C2AH 2PO6A 3JTSB 4NZUL 1T3FB 4J3UA 1U58B 3GRWA 5DD3H 3T0WA 3RVVD 5JXEC 4YFDB 1JBJA 1TVHA 1PEZA 3ILQC 4BUHA 3OL2A 3FN9A 1OARL 1TENA 3BJLA 3GKWH 3IDMB 4PYHA 2R9HC 3IKKA 3MJ9A 2GJZA 4POZC 4GO6B 3QH3A 5IW1B 1QRNA 4PJFA 3OG6B 3GSOA 2OR9L 4DVBB 3PGFL 3NCMA 4TUKH 4K8RC 3E8UH 2Z92A 3ES6A 4JRYA 1KBGL 2BHYA 1YNLL 1NCTA 1T5XB 3F6LA 5DR5H 3V7AG 2NXZB 3QXDB 4FTVB 4OD3H 3ARDC 1G6RH 3SCMD 3P9MA 3C9NB 1A4JB 1QD0A 2Q1EA 3TWCH 4PD4J 5ACZB 4Y4KB 2OL3A 4H88L 4AM0A 2FHBA 2ZUXA 1FZOA 3UJJH 4JGUA 3CD4A 2Y6SC 4JANA 4DCQA 3DV4B 4OKVB 4ZAKD 4OCYL 3HNTH 1TNNA 2CKBA 3C6LD 5DEFB 3GI8H 1ITCA 2FZ3A 3EOYG 1AIFA 3M8OH 4HIEA 4FFZH 5GGVH 3C5SB 3P9WB 4LNVA 1F13A 3QZWA 3V2AR 2AK1H 5EC1B 3QWQB 4N1CA 1S9YB 5DMYA 3UTTB 1U8HB 2AAVA 4PJEB 4FQXD 3MUHL 3EJZC 1CIUA 5GHWH 4HMDA 4TUJA 3S7GA 2UZYB 5D8JH 1LK2B 3NFNB 5JXEA 5D93B 3HZMB 4CU8A 3ZHLA 2Z93B 4HCRA 3PWUB 4NQDA 1KIQB 4KI5E 3VXOB 2ATPA 4YHKH 3QXUA 1OTSC 3Q6GH 1A21A 4XC3H 4DOHE 4GMTL 3VDBA 2AXJA 5D1ZC 5FV2A 1J0JA 5IB4A 4DAGL 4P3DA 3HI5H 4DTGL 1U8LB 4JZOA 1S7WA 4NDMB 1RFDH 3P4MA 3RAJL 4NM4H 1QO3A 1EO8L 4GRMA 3QRGH 3NPZB 3SO3B 4OI9A 4RMUA 4ODSH 4L4VA 3QUYC 5E1HB 2VISA 4P46C 5GJTL 2V9QA 4DKDC 3O3EA 3M1BA 4OV5B 1I9JL 3QFJB 2FJHA 3O0RL 4Q0XH 4GXUN 1TLKA 3VXRB 4AIZB 4PP1D 3ECBA 1NAKH 3KHOA 4MCYB 5D7LE 2R2BB 3EJYD 3KPPB 1QKZL 4XGZA 5KJRH 2E6PA 3SEPA 3QHFH 3OHXB 2MQCA 4PBWD 1IGFL 1DEEB 4OZGF 3WFBH 1K2DA 3FB7A 3FQUA 3ILPA 5A2FA 2X4TA 4WJ5A 1UZ8B 4GQPH 2OYPA 2NW2B 1IM9B 3HB3D 1MPAH 3TBVA 3LKQB 1IGJB 3GMNB 1CLZH 3QDGA 2WQRA 4N90D 1DE4A 4HLZG 1KOAA 3IETB 4R0LA 4XMPL 1EK3A 2IBGA 1YPZB 1OM3L 1H5BC 3P4NA 1R3LA 3IAQA 5KVDL 1HYRC 1YMMB 3OKYA 1HILA 3BD4A 3L1OH 4JKPL 3S37X 2J8UA 4O51A 5HYSG 4NNXB 1WICA 2VDPH 5ICXA 1AH1A 5IR1A 4L8CB 4OM1H 1WLHA 2J8OA 4HWZA 2R0KL 3DSFH 1AO7A 4NBZB 4KAQH 2HJKB 1Q9KA 1YEGH 2V7HB 3MCG1 4M43L 1SVZA 4FZEH 5E6ZA 4MJIB 3MV7E 3KPMA 1AXIB 4OF7A 3S4SA 1SBSH 1MCLA 1XCTB 1MAMH 3QQ4A 1XR8A 4P46A 2F53A 1VB9A 3QXTA 1ZOXA 4HK0B 5IHZB 2VDLH 3I2CL 5BV7H 1QFPA 1CFQA 2YSSB 1T80A 4X6DF 1H3GA 3KJ4C 5DUPH 5DRNB 3O3DA 2HKHH 1QBMH 4X5XB 5FO8B 3RL1A 2BNRA 2NY7H 1S5HA 1XF3B 4G8GE 2A74B 2YHGA 2YD3A 2HH0H 3BPLC 3RWGB 5IMOA 4ODHL 4WGWB 3V8CA 4NN7C 4PJDE 1TCRB 4C55A 2BNQD 4XP6L 1KLUB 4M5YL 4L3ED 3LPWA 4ZOEA 1SM3H 2PYEA 5FKPA 3ET9F 2A83A 2ZSVB 3MBED 3VFVB 4R7DA 1I9IL 2IANB 2IH3B 2OJEA 3G6DL 5FEBA 4QRUB 2KZ1B 4JFOA 1Z9MA 2DM4A 2Q7YA 5I1LA 4K8RH 4EN3A 3GIVB 3K74B 2AW2A 5IVXF 2FL5A 3QIBD 1BVLA 4JG1L 1TPXC 3LKOB 4ZOBA 4JJHA 1ZGLP 4HKXB 3QPXL 4G9DB 4YDVA 4YWGL 1BZ7A 4O2CA 3MLSL 4JN1L 3FZUD 4HKZB 2LU3A 4GW4B 3FN0H 4FFWD 4MA3B 5F9WC 4DGYL 2WWMD 4Z7WA 2P1YA 3P4OB 1EFXA 15C8L 3AS1A 4DZ8A 2EDDA 2MWCA 3DO7B 2VABA 3LKSB 3SKOA 1RUKH 3SBWC 1M7IB 1UEMA 2DJUA 2YPLB 4JFZL 4OT1H 3Q5TA 4X8XA 4XVUD 2JCCB 1T1ZA 1K8IA 4UB0H 4RMSA 1NJ9A 3W0WD 3MZGB 4PRPE 4MHHI 3VH8B 4LHUG 1K5NA 4G3YH 2DQJL 4XPAL 4ZSOE 1T83A 1TJGL 1YQVH 4G6AC 4EI6A 3CDYA 2NZIA 4LAQL 4N0YL 4Y5XB 1QR1A 3QCTH 4ZXBC 1YMHA 3GSNA 7CGTA 4X6CE 2WUBH 1BJ1J 1NMAL 3N06B 3RNKA 2UZXB 5D2NC 3OPZH 3CFCH 2ADFH 5K9KA 2YPKB 2DQHH 3SOBL 4UT6L 4TPRL 4ZQKA 1AGBA 2F5BL 5CJQL 1KB5A 2GW5A 4BH8A 5KS9F 2X4PB 4KWUA 4HQQH 1HWGB 2ZG1A 3V6ZA 4YE4H 3SDAB 1L0XA 2EKJA 2VLKE 4K23H 4U1HB 5F88B 1SJXA 4RFNC 1MF2L 2GITA 5HI4C 3WNLA 1FYTB 3RZCB 5CJOH 3WE6A 3WHXB 3JV6B 2VAAB 3QEHA 1IAOB 4FXGA 4MXQD 4BUGA 4BYHA 3T1FB 4GKNB 3LN4A 1F6LL 3RDTB 1R3HA 1XMWA 1OAZL 2XTJC 5T1MB 5DA4A 5BOZG 5D6DC 4IS6A 3U6RA 1A14H 2XZQH 2AV1B 5GRJL 3TJEH 1WUNT 3QA3B 1ZGLA 3WUZA 5BS0D 1H3PL 2QV2A 3WKMH 1TTFA 3U9UB 4FXKA 2VXVL 5DI8A 4ODXB 1A6ZB 1IQWH 5JR1H 1FHGA 1UH3A 4HXAH 2Q8AH 4HF5L 3O11B 1FVCB 4MZ2A 5EU7C 3SBWA 4FFVC 4M1GL 3MNVA 3QRFM 2QQNL 4TTGA 1X5IA 2NW3B 2IQAA 3GMQB 3SKNA 4IIQB 3VRLF 4QCIB 3RUGE 1K3IA 2NY0C 3PWPB 3MNZB 2FSEB 2H26B 4NSKA 1SVCP 4YXHL 3THML 1QSFE 5CZVH 5GJSH 4E41A 2VIRB 1YNTB 1CGSH 1MAKA 3O8XB 4NKQB 4I3RL 5IEKB 4C58B 5FECB 4X98A 6CGTA 2CO6B 4JFPA 5FHAL 3GI9L 5IBLD 3BT2L 3I9GL 4NN6B 4NJ9H 1K85A 4PTUB 3WLBA 4QYOB 2YEZA 1XIWB 5DYOA 4KZDH 3ME0A 1RZFH 4XNMB 5DUBA 4FQHA 1DUZB 3VXMD 3Q6FA 4YHML 5LAXB 1UXSB 1JGVL 5IESL 1CU4L 2NY6B 2W9EH 4IOIB 4AQ1B 4D9LH 4CBPA 3PHOB 1RJYB 6FABH 2FGWL 4GUPB 1J8HD 1CN4A 1G9ML 3S9DB 4PJAA 3DETD 4G9FE 3TESA 2V6HA 3H3KA 5CP7B 5D6DA 1MCPH 2ZSWB 4ZO8A 1Q9LA 2QLVB 2DLHA 1Y6MR 2NXYD 2R15A 4NZRH 4O2EB 2DYPB 1FG2B 3ULVL 3CMGA 3DVNB 2NXZC 2V5RA 3EOBB 1QSEB 2GUOB 5I9QB 3BW9B 3UTSD 1PYWA 3IFNL 1JRHH 1P4IL 4H8WH 3FONB 1IGCL 2HWZH 1NC4B 1BFVH 1PKQB 4L5FH 5SWZD 3VGEA 4ELME 4ODTH 1WBZA 3C6SA 3R1GH 1KB5H 1UKTA 2NR6D 4EXKA 1Z3GL 1CFSA 5IMMA 2VLRE 2VLJD 4JFED 3TYGL 4DGVH 5HD8D 4JY5H 4YQXL 4NQED 4X7FC 3UP1A 3I6GB 3IFOB 1GAFL 3K46A 3B9VA 1P1ZA 4TOYL 3QJHB 2DQFA 1CF8L 1RHHA 3DXAD 4Z7QF 2X4RA 1JVKA 3GSVB 3RY5A 2AEPH 2R2CA 1U8OA 1BEYL 1FL5A 1NGXB 4GW1B 3CLEL 1VFAA 1F4YH 1YDPA 1UXWA 5AUMB 5ESAA 3LKNB 3D25A 2XPGA 2FO1A 1DN0B 4NYLA 3JTSA 1T3FA 1EERB 3CNKA 1T1XA 2ZUVA 4FABL 2HFFB 4ZS6D 2HJLB 2MCPH 5IQ7L 5D1XB 4W4OC 5D93C 4X4MA 1CG9B 5F7NC 1DVFD 1LO4L 3CDFA 5GS1A 2HLFD 3IDMA 4Q9QL 1FNSL 4CMMA 4NQVB 3MJ8B 5DQJB 1R5IA 3WL9A 4AK1A 1HH6A 4NFCA 4TNVK 2IFGA 3QEQA 1MI5B 2IQ9H 3HAEB 4I18C 2X4OA 2I26N 1NAMA 5A40E 2PW2B 2EIBA 2XZCL 5I1EH 5IQ9B 5MEOB 1CT8B 1T5XA 5EOQH 1BLNB 5D9SA 4GRWH 2BY2A 4RDQF 3TFKC 2CMRL 3IFLL 3CVIL 1UH2A 2A1WH 5IM7B 1ZLSH 4JFDE 2H45A 2DIJA 4RAHA 1N5AB 4X9IA 1B2WH 3Q3GB 3IS1X 5JPMB 2DWEB 1B4JH 1T7XA 4PRID 1E0OB 2IPTL 4OKVA 5KZCD 1VGKB 4H25A 1I3RB 1WVZA 1P5VA 2G5BA 4PJXA 1F3RB 4L4TB 1MCJA 1FBIL 1QNZL 2B4CH 4N0FA 1I4FB 3LRSA 2EDRA 5EC1A 1A6WL 1UM4L 1ZGLM 2UWEA 4LLQB 2JK5B 5ALCH 5IIEB 5LJYH 1F4WL 3AAZA 3VXSE 3UTTA 1U8HA 4QHLA 1EVUA 4YK4B 3ARFB 4MJ4A 3RI5K 2A6IB 1RJZB 5DRWA 2XNAB 1P7KB 4GAGH 2KPNA 3I50L 4W4OA 3HZMA 4A2LA 4I0PC 5DC9B 4FNLL 2VSCA 4MXVE 4PLKC 4U1JB 1U8QB 3U46A 1C12A 2Z93A 1XGTA 3QNYA 4P3WA 3RGHA 2AJUL 1ROWA 1KIQA 3VXOA 1T04B 1JGUH 4LMQE 3RX5A 4M1DL 4DJMA 1FYHB 1HKFA 2W0FB 1JPTL 1UZ6E 4I18A 2EIZA 4EUPA 2WM0A 4GG8B 3MRDB 4UNUA 4DN3L 1WZ1L 2E7HA 5B38A 3F7VB 1FAKT 4XVSL 3CPLA 4ZNEA 3QDJD 2VKXA 1ZT4B 2Y07L 4AIOA 4K7PX 3S37H 3KPRD 4M9PA 3T0ED 4X9GA 2HTKC 1LO2L 3ZTNH 2R56H 3QULB 4HBCH 5D70L 3W5MA 3TIEB 3DX8B 1VACA 5FGCE 2GFBB 1J8KA 3AB0B 2R2BA 4BQ9A 4ZOAA 1NFDE 2YXFA 3QG7L 4KRPD 4P4KD 1MCNA 5K9QG 4OLVL 2D03H 2P5WA 4PV9A 2F54B 5AYQA 1HNFA 2BOBA 5DD6B 4G8FB 3LPFA 2W65A 4PR5B 1A7PH 5CAYB 3T4AB 3HI1B 3WIIH 4OBRA 1F4HA 5DQ9A 3BZFB 1XAUA 3AREB 4NKOA 2C1OA 3O6FB 1OCWH 2D0GA 2DMCA 5CWSB 3N1QC 1EZVX 4YXKH 3WMSA 4XX1E 1QRNE 2NNAA 2XN9A 4R4FH 4OZ4B 4WW1B 2BCKA 4LRIC 2X4QB 1YPZA 1Y0LB 2QSTA 4I0PA 4JRYE 3IJSA 1YMMA 5J9PA 3QUXA 3EYFB 3TBTA 1OAYH 2EIDA 3BN9D 3TH4T 5B4MD 5FM5M 4IOSD 3MRNB 4YIQB 3KYNB 2XA8L 4LOUD 4WNQB 4YGAB 5HHOA 3EFFB 4P2RD 2XYCA 1QFUH 3S34H 1MFDH 2RB8A 35C8L 1XCTA 1P4BL 5F3HB 1KFAL 1MREH 2HP4A 1OGAB 3BVNB 1WV7T 3JUYA 3TN0A 4FXLA 5HY9B 1CXIA 5FO9B 1NLDL 1CVRA 3L5IA 3T04D 3PP3K 3B9EA 3CSBA 4NZUH 1F3JB 2YSSA 2RGSA 2BRRL 5ISZB 5DRNA 4X5XA 4OUOA 2JTDA 4Y5XC 1K4DA 3UBXG 4UQ3B 5ICYB 1HDMA 1HQ4B 4ZDHA 5EO1B 1CGTA 1KYOK 3M45A 1OARH 4PJIF 2A74A 5IJVA 3HMXL 5I1JL 3RWGA 3L95B 3I75A 5SWQA 2R8SL 3O41A 3CGTA 4EVNA 1KLUA 1ZVSB 4NO3B 3MX0A 3DUHA 4MQTB 5DD5L 2OR9H 1G7QA 2DD8L 4PY8J 3SDAC 1JPGA 2FJGA 3TNMB 1KBGH 1KCUL 2EZ0D 2OMBA 1YNLH 4LPVA 4Q6IB 5C0GB 4NQDE 3ARQA 4FG6C 1HSAA 3RZCC 3PIQB 4JFHD 1J87A 2AEIT 3B9KD 4ZUUA 1UQSB 3FFDB 3RDTC 1J1OL 1NKRA 3L9RB 1N59A 1CFNA 4LCWB 3GNML 4H88H 4HKXA 4PLOB 4ZO6A 1A47A 3VG9C 2CRYA 2MFNA 3ARBD 5DHVB 4LEOB 3K4DA 1MUJB 4HKZA 5ECJE 1BECA 1JTTA 3OKNA 1U0QA 3MRLA 4L4VE 5T1LD 2EDBA 4OCYH 3G08A 4PYGA 2NY1D 3RVTC 3P4OA 5KN5B 3CAFA 3PP3H 2WP3T 3DO7A 4M8QB 4JFXA 1X7QA 3FT4B 3RIFF 1VEPA 1XF4A 3EYOB 1I1RA 1IBGL 1ORQB 2Z35A 2AJZB 1MRCL 4IIQC 5IB3B 1EEUA 5IFHL 1P7QD 4QRPD 5JO5A 4RWYL 4Z0BL 3W5NA 3O8XC 4WVRA 5DJCA 4D0DA 4CADB 2DI8A 3TO4B 3C5JB 1KTDA 3QDGE 3K0WA 3AROA 1T7ZA 2YPKA 5DJXB 4NN6C 4RCAA 3MR9B 4DUXA 1RK1B 4GMTH 4M1CD 3VU2A 2PTVA 4DAGH 3OB8A 4DTGH 3RVUD 1XIWC 4MNQB 5L2JB 3RAJH 4Z8FL 2J8UE 4NHUB 2EDJA 3VXUD 1FYTA 4IM8A 1EO8H 3RZCA 5FV1L 5KSBF 3G6AA 2R29L 3WHXA 2NY6C 4X8JA 3FT2B 1V3MA 5DJ2A 5E56A 1WT5C 3CSYB 4JZNB 4P5KB 5GJTH 3T1FA 4ONFL 4JRXA 1I3GL 1I9JH 3WHE0 1AO7E 2AV7B 4ACPA 4JDVB 3O0RH 4R97B 5HSFA 1J5OL 2Q86B 2DN7A 5I0ZA 2JJSA 1QLEL 4AENA 1AKJD 1QKZH 1ZTXL 4NO2B 2F53E 3MLRL 4U2ZA 3QA3A 5TQ0L 5IB5B 3OGCA 1IGFH 5MERA 1OW0C 4BK4A 4O00A 1FNHA 2WBJD 5IHUL 5E8DL 4TVPL 1S7XB 1WCQA 5I9QC 2BNRE 3ZE1F 2YK1L 1CDHA 2ZZUT 4RFEB 1UJ3A 4HKBA 5HGAA 3FRUB 1TITA 2NY5L 3T3ME 3FFCB 4X4XB 2H2SD 2EKSB 3PWPA 1VCAA 5C07D 1AY1L 5CCKL 4YFLI 4LPCA 1I9EA 4XMPH 5FA3A 2PYEE 1OM3H 5TF1L 3DGCR 5KVDH 2F8XC 2ESVA 2F15A 3DVGB 2W38A 5E8NA 5IROC 2FHFA 3QIWD 4JKPH 3C87A 4D94A 2XICA 3NBNA 3PWJB 3ARRA 3BDXA 1JFQL 1IGYB 1QFWL 1Z9LA 2ITCB 2HT3D 2GCYB 5C86A 4JPKL 5AEAA 3VWKA 1BPVA 4N0UA 2VLKD 2R0KH 1DUZA 1FDLL 3TZVD 4BKLB 2I9TA 4M43H 3SPVA 1ED3B 2HVKB 2BSTB 5D1XC 3V5HB 4LVNB 3PHOA 1AGEA 4JM4L 4QOKA 4WWKB 4AQOA 1BBJB 4Z7WE 3PDGA 1EXUA 5FHBL 2V2XA 5IB1B 2D31A 3VCLA 3I2CH 5I6XB 3JV0A 4JM2D 4QNPE 2GAZA 4PRNA 5CP7A 2B0SL 3JWDL 3ULVC 4I48A 4GG6B 3BP4B 1MCBA 1YA5A 2QQKL 1MIML 5J7CC 3OBAA 4FN0A 4L8BB 4YXLL 4ODHH 3RVXC 1FG2A 1OW0A 2GY7B 4PJBB 4XP6H 3SY0A 3RNQB 4M5YH 1QSEA 3EJJX 2BMKB 3UAJD 5CEZD 1SJHA 1CGYA 4XHJD 2DOCA 4PG9B 4NOBA 1I9IH 1PKQA 3G6DH 1UWXK 2NYYC 4PJCF 1W8OA 2V7NB 1FIGL 2WK2A 5LGHL 1JPSL 4X6DB 3U0WL 4XNQB 3I6GA 2NX5A 4JG1H 5EOCJ 1OTUC 4GKSB 3QPXH 5IROA 5CD3A 2P5ED 1YEDA 4ZFOA 3V6FB 1H15A 2YD1A 4I4WB 4WFFE 4YWGH 3MLSH 3SDXA 4JN1H 4IMLA 3DGGA 3GSUB 2XTLA 3U0TB 3AM8C 4DGYH 3JVGA 3R06B 4MS8D 1D9KB 15C8H 5DUML 4YK4C 4HUVA 1A9EA 3ARFC 4KK8C 4UU9B 5F7UA 5DXWA 4IRSB 2EH7L 1EUUA 4JFZH 5KG9A 2V17L 3DLQR 4LLWB 3RJQB 3UXFA 5E8OB 3MV9D 1BZ9B 4JY6B 4PRHB 1B6UA 3OB0K 1U3HD 1S9WB 2DQJH 3MJ8A 3PQYB 5IOPB 2EC8A 3DTXB 1BQLL 1JZ5A 4CN1A 4N0YH 4LAQH 2KQMA 5HDLA 3HAEA 2ATKA 5DK3A 4PG2C 2PW2A 1NMAH 5MEOA 2HG5A 5GZOD 3C60D 4E41E 3SOBH 4UT6H 3UZVB 3NCFB 3OXRA 4TPRH 4WENB 2F5BH 4PD4K 5CJQH 1LEKA 4X7DC 4EEEA 3W9DB 4YO0A 1MCDA 4U3CA 4J4PA 4KXZI 4C4KO 5IM7A 3WV0A 2O26U 3PDOA 1IAMA 3ZKMD 1NQBA 1MF2H 2FX9L 1N5AA 2VLRD 1WFUA 3Q3GA 3AB0C 1S7TB 4KVNL 3KXFD 3CFEA 3D85A 3UJIL 3UTQA 2C7UB 2WV3A 2VUOA 2Y5TA 3SDCD 3FRPG 2O61A 1OAZH 4KV5E 2YN5A 5DK0A 1I1CA 3CDGB 4UT9L 1XR9B 1I4FA 3SJVA 4PJ8A 5KANG 3AREC 4NQXB 5GRJH 1DQTA 3O6FC 2JK5A 1NSNH 3VWJA 4NHCL 4F7TB 3AM8A 1I7TB 1H3PH 2ZKHL 5MEQA 2VXVH 4PJAE 4IRJD 3WKNA 4RIRA 3HKFA 4HF5H 4P5MA 5I75B 4OIAA 3HR5B 4M5ZL 3O4LD 5DQDL 3MRFB 4E5XA 2RBLA 4M1GH 5DFWH 1P7KA 3EO1B 2QQNH 3RX7A 2OQJB 3PGCA 2X40A 1CQKA 1U3YA 3DYPA 4KKLC 3RY6A 4P0DA 3MNWB 2YZ8A 4HFWB 1NCWL 1QSZA 4WUUA 4HJGB 4YXHH 3THMH 2YUWA 5I1IL 1KJ3L 5EU7E 1A4KB 1ETZA 4I3RH 1S7VA 3HRZA 2HMIC 2DQEL 4PG2A 1UEYA 2BVPB 2I60L 3EDEA 4XMKL 5INDA 3GI9H 1U8NB 3WNMA 3BT2H 3I9GH 3T8XB 1JWMA 4HMCA 4LPWA 1W2KT 3JWNC 3RPKA 1WBXA 3ROOA 4G6FD 1I75A 3F5WB 1NBYA 4AEFA 4LK4A 4RAUB 5IK3B 1JL8A 4KDTA 4H26A 4YHMH 3IJHA 1JGVH 5IESH 2YD7A 1L4IA 3DX8A 3GMLA 1CU4H 4MCZA 3QAZB 3I6LE 2P43B 4XPBL 4ETYA 4HUKB 1N8ZB 2F54A 5C9KA 3STLB 2FGWH 1AE6L 2UZIL 1E4WL 4G8FA 1X5AA 1G9MH 3QIUB 1RZGA 5GIRB 2VL4A 2X70A 4LLYA 2KKQA 5GGRA 5IW6B 4X4ME 4MNGB 3BZFA 5JQHC 4M6AA 3VMOA 2F9BT 1NPUA 3O6FA 2HLAB 3UYRL 5CKAA 4Q6IC 4JM2F 4UUJB 3ZDZE 3Q0HA 3BP6A 5E24E 3ULVH 3TCXA 1YY9D 1IC4L 2J1KA 5ESVA 2ZUUA 2NY4C 3QEQE 2P8LB 1GZPB 3BIBX 3CLFL 1S9KC 2X4QA 1Y0LA 3IFNH 3NCBB 1P4IH 1IGCH 4P49A 1RZIB 2YUXA 3ARGA 1Z3GH 4Z7UB 2YD8A 4CN4A 3TYGH 4B5EA 5TJWK 4A6YL 3ZKND 1REIA 1JTOA 4ISVA 1N6UA 4YQXH 5D7JD 3D1MC 5BVJB 3BD5A 1OVZA 1M7DB 3KYNA 4UQ2B 1GAFH 3OX8A 2QSVA 4TOYH 1CF8H 2ZWLT 1HHIB 4GAJL 3QI9A 1BEYH 4UIMA 3CLEH 2ICWI 3CFJA 1D5ZB 4HC1L 2BXYA 3G6JF 5C92A 2R69L 5FO9A 4PJXE 1MIEL 3MLVL 4OLYL 3MREB 4FABH 1AGDA 5HJ3B 1U8PB 5IQ7H 3RWIB 2UWEE 2B5IB 1RY7B 1QLRA 3TO4C 4MD4A 1LP9F 1LO4H 5C9JB 3SQOL 5FYJU 2QHRL 3UTTE 4Q9QH 1FNSH 1QFWI 3IYLW 2PO6D 5CGYC 1QLFB 4UZGA 2MMXA 2EXYC 2ZUQB 1ZVSA 4JREB 5INCB 2CLRB 3BKYL 3PV6B 4S10A 2PW1A 4XBGB 4LCYB 3WNPA 5C0GA 2XZCH 1IC1A 3C2SA 1BFSA 3AY4A 4MD0A 4MQXD 3WXVH 4HXBL 4PJ9D 4ZS7L 2CMRH 3IFLH 3PIQA 1MY5A 1D5IL 4QRQB 4A6YB 3CVIH 4F9PC 2A9NL 4R97C 1MCFA 3D0LB 5DT1L 5HYFA 3CFDA 2K7PA 5ITFB 2VXQL 4ZNEE 1A6VL 1DQML 5C0EA 1MH5A 2IPTH 2EICA 4QRRA 3O4OB 4PJHF 1QR4A 4P2OD 1FBIH 1QNZH 3O45B 5A3ID 4OV6F 4KRLB 1H0DB 4PJGF 3VFTA 4I0CC 5C08B 2HT2C 1A6WH 2LU7A 2YD6A 1UM4H 3EYOA 3L5XL 1ORQA 3D69A 2P5WE 1BD2D 1F4WH 2AJZA 3N50A 5F6HJ 5D5MF 2Z8WC 5E7FA 4I13B 2V5MA 3T4YA 2A6KB 3GZKA 1FVEB 4JKLA 3DX9A 3I50H 3MV8A 2JIXB 1QP1A 1HEZA 4FNLH 3TO4A 3NTCL 3ALPA 4D0BB 3C5JA 2J12B 2AJUH 2BK8A 2IALB 1NGYA 3P4LA 2XN9E 5EBMB 3T77A 1A1MB 1RK1A 1GGCL 1YPZE 2DWDB 5JXED 4D8PA 3UTZB 2I07A 4H5SB 1JPTH 3ILQD 4C83B 1YMME 3HPLB 1AHWA 2R9HD 3CFBA 5FYKU 4POZD 4DN3H 1WZ1H 5EH1A 5BRZB 4LVNC 1FZJA 2Y07H 5FA4A 3CSYA 1DBBL 4K8RD 4JZNA 2G9HB 4WWKC 5JOEA 1LO2H 4G43B 4R2GB 5HHOE 4KHXL 2CJUL 5D70H 5FOBA 1IRAY 1HZHH 3GSXB 2H3NA 3ARDD 2OSLA 3QG7H 2DTSA 3HE6B 5FYJL 3U36A 4V1DD 4OLVH 4NO2A 1U36A 2XKNA 4EOWL 4KRNA 4P4RA 1A64A 5I16B 3D18B 3MRMA 3O9WB 4LCUB 5EBWB 5F1IB 2NY5C 1KT2A 3GJFB 3QWRD 3OZ9L 5E5MB 2ZUSA 3QXWA 3B3IB 2Y6SD 4NC1C 4DKAA 1WK0A 4X4XA 1UB5B 5HBBA 1AQKL 4UNVA 1BJ8A 2GK0A 1N26A 4OJFL 3FO1B 3FO9B 1V7NL 2M26A 3MGOB 2ADJA 4MHHG 4E42B 1BGXL 5CP3H 3IDIA 1MOEA 1YEEL 4U7KA 2ZCLL 4OIIL 3DVGA 1MCHA 2VO5A 3EJZD 2VH5L 1CDYA 2OTPA 3BXNA 4HMEA 4XNYH 4LKCB 4OZGA 3BEWA 1IGYA 3EZJB 1I3UA 1BHGA 1Q0XL 2GCYA 2XA8H 3ZHDA 5DHVH 3RWHB 4URTB 4PY8I 1D9KC 1EO5A 3D39B 5FYLL 2X4SA 1KPVA 1OTSD 3OF6A 1E27A 5DJ8B 5D1ZD 1LO5A 4IRSC 35C8H 3X11B 2Q87A 1P4BH 1Q0YL 1PW3A 1KFAH 4OZHF 4WWKA 3DUUB 1IQDA 1UM5L 4U1MA 3DO3A 1AO7D 4Y2DB 1KULA 1V3KA 4XB8A 3WJJA 2BRRH 3PE9A 1PG7L 4HPOL 4KXZH 3SDYL 3QUYD 5JW3L 5T3XL 2ZUWA 4P46D 4WEUD 3HMXH 3HG1D 5I1JH 5EPMA 3Q1SL 2CIKB 3QXVA 2R8SH 2FB4L 1QQDB 4G42B 3MV01 4JFEB 5JORA 5DD5H 3AMKA 3H3BC 2DD8H 4ODWA 3VFSA 5FYKL 2OX5A 4PG9A 1KCUH 4YR6B 4NQCA 3RIAF 3RY4A 1JYWA 1FPTL 3HZKA 5KSUA 3KLHD 5DVMA 4HS6A 1RIUL 1TZHA 3PNWA 4R7NB 4X6DA 2EYSA 1IE5A 2MNUA 3MXWL 3GDBA 4KMTL 2ZUYA 5GSRB 3GNMH 1FYTE 2MHAB 4FQXC 1JGEA 1Q72H 2VDKL 4PJIB 5GGUB 2C3WA 4MD5B 4JRXE 1PZUB 5BMFL 3BUYB 2WQ8A 4XZUB 1KN4L 1WAAF 1YJDL 4AZ8A 2DKMA 3VJ6B 1MFEL 3MRHB 4JVWA 4DEPB 1J86A 1Z6JT 3R0MA 5I75C 3BOVA 5I30L 4MX7B 3BGFB 1W0VB 3P3YA 4MZ3A 3ARUA 1PDKA 1J7VR 1IBGH 3VGGA 4FQ2H 4AMKL 1CDUA 1T7WA 1MRCH 5EU5A 5IVXA 4HUMB 1OSPL 2VR5A 5IFHH 3QR2A 4RWYH 4Z0BH 4NRXB 3H7BB 1D5XA 1EGJL 1HIML 1UGNA 5HYQB 2BVTA 3SCMA 43CAA 3GBLA 1AD9B 1YN6B 4YDJB 4F33A 3BYTA 4NPYB 3NIFE 4O9HL 4NT6A 1VDGA 3PWPE 4KTDL 1UCBL 3MYJA 4UTAL 2R0WL 1JMZA 2M2DA 4JDTL 1NCAL 3QG6B 4NC2B 4BELD 2ESVE 4ZAKA 1GOFA 1XF2B 5DZNA 1N4XL 2ENSA 3C6LA 1MEXL 5C09B 5D7IB 4Z8FH 2MCG1 1LD9A 5DEGB 5CZXC 4MLIA 3OKMB 3QISA 4OF5A 2R29H 1S7TA 2EC9T 3QAZC 4J7RA 1D6EA 2FO4A 3VDAA 3LVEA 4ONFH 1I3GH 1SYVA 4N0UE 5HYSB 1QPPA 2DLEA 1J5OH 1IKFL 1EAJA 3QIUC 4FQXA 4OLZL 1OSZA 4PRDB 1DANT 2XI9A 3CDGA 1QLEH 1ZTXH 1U91A 4IEFB 2DLFL 4QOKE 3F7PC 3C8DA 2G5RA 3MLRH 5TQ0H 4U1NA 5KS9A 5CJBA 5JXAL 3BHBA 3MOBL 5IHUH 5E8DH 4N8PA 2YPVL 4TVPH 3VFOB 5EBGA 2YK1H 1MLBB 3HR5A 5AG8A 3O3BA 1FVDA 4P9HC 4AT6B 1CFBA 5L7XH 1PX4A 2NY5H 2OQJA 3VFRB 2KH2B 2CGRL 3TBSB 4HFWA 3ZYZA 2X1OA 4X99A 4HJGA 1P69B 3MFFA 1OAXL 1AY1H 1QSEE 3I02A 5CCKH 3RPIB 3MLTA 4H1LA 2CUIA 5TF1H 3NH7L 2VR9A 4XWOC 3HUJF 1PKQE 4OZIB 5BZWB 3LEXB 3FQTA 3PL6D 2K7QA 2BVPA 4ZUVB 1YY8A 2HVJA 1I1AB 3WBDA 2PTTA 3T8XA 2MJWA 1JFQH 1QFWH 4G6AD 4JGMA 4ZXBD 5H35A 2NX5E 5F7YC 4PJ5D 1P7HL 1JF1B 4JPKH 2ZPKL 3CCHB 2WP3O 3G5VB 2EEAA 4NCDA 4XB7A 3WS6C 4RAUA 2J6EL 1FDLH 3CC5B 3MRPB 4QHKJ 3SDXE 3IRZA 3T09A 1NMBL 4MWFB 2FLBT 1JYVA 2EDFA 3VH8G 2B5IC 4U0RB 4JM4H 1EHNA 5DFTA 5FM8A 5FHBH 3K1KC 1IL1B 4JPIB 4RX4A 5HI4D 5SWSB 2GSGA 3OKOB 5I8KL 2ZUQC 4JREC 1PY9A 2B0SH 1VFUA 4GT7A 5C0CD 4PY7B 4M02A 1WF5A 1JP5A 4MNGA 3UZEA 3FO2A 4HAGA 4CN6A 2QQKH 5E4IA 1MIMH 2J4WL 4CVZB 4Y5VA 1TZIB 1KELL 4YXLH 3RGVB 4G80A 5JW4R 4X9FA 2XTJD 3U82B 2WSKA 2NLJA 4XCYA 4H20L 1R5WB 1GZPA 4P5TB 1G7LB 4LHUB 2XY2A 1E4JA 4OFDA 1U9KA 2EDQA 2CIIA 1Q9WB 5JLZB 3AMLA 1FIGH 4BM7A 5IG7A 4WU7B 1RI8A 4G8IB 3KDMA 5C0IA 1RZJL 5DJZB 5LGHH 1PQZA 4FFVD 1JPSH 5BVJA 3U0WH 4OZFH 5DJ0B 1CGWA 2IJ0C 1QFWM 4UQ2A 5HHME 3IU3B 4LBEB 3O4OC 3ARTA 1MJJA 2GI7A 2NY0D 3ZDXF 5GRVL 2Y06L 4Y8DC 1HHIA 4RZCB 3TP4A 3BH8A 1MCOL 3FB8B 3V4VL 3FMGH 3FAXA 4XXDB 3GIZL 1PG7X 2DL2A 1TDQA 4W81A 1CIDA 2VWEC 5DUMH 3BKJH 2BNQA 1BZQK 2AJYL 1B0RB 1U8JB 5ENWA 3SJVE 4FMKA 4L3EA 2J5LB 2EH7H 3RWIA 5BQ7A 2V17H 5DMIL 1KF9B 3MBEA 1JZ6A 2RIKA 5L9DL 5EZOL 2K9UA 4YDKL 5TDNA 3VRJA 3EYVA 1M05A 2QJDA 5INCA 3ELAT 3W81A 5F3BB 3QIBA 4LCYA 2CR3A 1CICB 1WBYA 5F7EL 3P77A 4WUUE 5DRXB 1I8LC 2IADB 4MJ5B 3OTTA 1ERNA 1MCWW 2AJSL 4NNPL 4Y89A 4NKDB 5IB2A 5EUOF 3GO1L 3H0TB 2A6DA 3WEXA 1KSRA 4QRQA 1NBZA 1W72L 4R2GC 1SJEB 3OV6A 5HHPB 5GXBB 2FX9H 4R8WL 4RMWA 5IF0B 2CQVA 2C4FT 2NXZD 4RMQA 2H8PA 4FTVD 5I8OL 5E5RB 4KVNH 5M94B 3HE6C 5DURB 3UJIH 3KGRA 4Y4KD 4ODBD 1HOCA 1RZKL 1HHHA 4UIKL 5E2TL 3O9WC 5FCUL 1YC8A 3O3AA 3W0WA 4YX2H 1KJ2L 4YC2B 4UT9H 1MHEB 3KPSB 3QUMA 2V2TB 2P7TB 4M61B 4GW5B 2F54E 4NHCH 5EC2B 3MMEA 1A7OL 4XXCA 4F15B 2ZKHH 5J06A 5K9OA 3DMMB 4Y16B 2FIRT 3U4BL 2OJZL 4M5ZH 5HYJB 5DQDH 3ZYJA 5GPRA 2APFA 1ZA6B 1MFBL 4BSWB 5F72S 4A2MA 4WFEE 4J2XA 1UKQA 3UTTD 3FL7A 1NCWH 2B1HL 4G8EA 5D1QB 2IALA 5EBMA 5I1IH 1KJ3H 1WITA 2MKLC 3RJDA 1LGVA 2XWTB 4OGZA 2V2WA 4NO0B 2DQEH 2P8MA 1O7VA 5I18L 5AWNL 2I60H 2LV4A 4XMKH 1I8LA 1Q9OB 5E03A 5ICZA 3MOQA 1W72B 3HZYB 3WFEL 2CLVB 2XFXA 2A9ML 3CFKB 5BRZA 4ODVL 3GFUA 4KJQD 4CW1A 4Y2DC 1MVUA 4XMLL 4F80A 4KK6C 4R6UA 5K59F 4I5BB 1FL6A 4M7JL 3TFKD 1JHLL 4GRWF 5CEXB 5KTEL 5TE4L 3HE6A 1KJ2B 4XPBH 3DYMA 3WIFB 1KPRA 1I1YB 3QFJD 1AE6H 3EAKA 2UZIH 1E4WH 1DL7L 3UZQA 4UI2A 3VXRD 3VXNB 1P2CA 4O2FB 5C2BL 3B3IA 3DROB 5JIIA 2VTFA 4KKAD 1UH4A 5E00A 1Z9OA 4RGNB 2OK0L 3UYRH 1KPUA 1UB5A 4K55A 1VPOL 4JAMB 2E7LC 1BQUA 2ID5A 3P11L 5I15L 1IC4H 2VB5A 1T0MA 1RK0B 5FKAB 1IM9D 1FE8L 3CLFH 2MQ3A 2CDGB 5GGSA 1T20B 4I9WD 1ZSDA 3ZT7A 1ZMYA 1OT1A 3Q2CA 2VLME 1YYLL 5GS0L 4A6YH 2W0KA 4JLRA 3UMTA 1OAQL 4Z76B 3PXJA 4LKCA 2HKFL 1EV2E 4HJJL 5AYUL 1LILA 1CXFA 3F6IA 5IMLB 1YMMD 4PLKD 1S8DA 2M8XA 3RWHA 2EYRA 1EHLL 4DEPC 1DUYB 1J8HA 1XGUB 3H42L 4GAJH 2E8ZA 5JZ7C 4DWHA 5DJ8A 3BGFC 4LLMB 5CEYA 4HC1H 1K8DB 2BJML 5I1DA 2R69H 4JR9L 4QRRE 3MGAA 1Q94B 5C0BB 4KMLB 5J1TC 2X4UB 4L3CA 1CFTB 2ICEB 1MIEH 1E6OL 3MLVH 2GSIA 4MJID 3GJFK 2W91A 2HTKD 3SQOH 3B8SA 4FFYL 2QHRH 4PB0L 2CIKA 1F6AB 2BSSB 1ZLVK 4OD2A 2VLJA 4JFEA 4ZFFA 3BKYH 3T0VA 5FUCC 5FM5O 3MV8E 4NQEA 4QGYA 4YFEA 4OFKA 3ARZA 1WWBX 4U1KB 2Z91A 1YEIH 3DXAA 4DFHA 3RWJA 1A3RL 2E7LA 5D96C 5BJTA 1PY4A 2VC2L 4HXBH 4X5WA 3ULUL 3FQWB 4ZS7H 4ZPVB 5F6HI 3SE9L 4RA3A 5I1AA 1D5IH 2ZOKB 5IMKB 4ESKA 3HC3L 2IAND 2MKWA 5FDWB 2VQ1B 2A9NH 1H3VA 3WXWL 5DT1H 2VXQH 8FABB 1YJDC 4PJIA 1S9VB 1A6VH 2H1PL 5GGUA 1DQMH 1WJ3A 1AQDB 1FORL 5JUEL 1XH3A 3DX6A 3LMJL 5FO7B 5DFVC 1AP2A 3ARYA 3BZ4B 4PBVC 4PGEB 1DVFA 1HXMA 5DZLA 4O02L 4QXTA 1XGPB 3V0VA 1W0VA 3IGAB 5L0QB 4Q6YA 3QWOB 3L5XH 2VQTA 3GJFH 2EDXA 4N0RA 3TIDA 3OKEB 1WIUA 3H9SB 3PHSA 3WFHB 4WI7A 3JSSA 4WHCA 1ZLVH 1AR2A 2Q20A 3GJEB 4NRXA 2YPLD 1TJHH 1AD9A 4FQ1L 4YDJA 3NTCH 1OY3B 4LLDB 4QF1B 1R5VA 1I1AC 3ZKSD 1A6TB 1PAMA 4YHOL 1GGCH 5DSCA 3QP3A 2E9BA 2XACC 4PRIA 1FZKB 4PJEF 4PJGB 5L88L 5C0AB 2R23A 5C09A 1CFVL 2G2RB 1PKOA 5D7KE 3WDHA 3VFGL 3KPQA 1NUNB 2GT9B 3OKMA 3PXHA 4OZGE 5J6HA 1ZHKA 4RISH 2A0LC 5HHVL 4U0RC 1DBBH 4EDWL 3DX7A 3SDAD 2YR3A 4U6YA 5HYSA 4KHXH 2CJUH 4PGDB 2H9GB 4FG6D 1FYTD 5IWLC 3RZCD 5IFAL 3AU1A 1N6QL 5TE6L 3K81A 5F9AC 1XFPA 4LSDA 4S0SD 5FYJH 3RDTD 4EOWH 3RGVC 1A9BA 1R3JA 3IU4L 3OKDB 3OZ9H 3EGSA 1XCQA 2XIDA 4YAQB 2I9LB 3BN9C 1ADQL 1G7HB 1MLBA 2R2EA 4P5TC 5JA8B 1FAIL 3T65A 5KSBA 3RKPA 3RVTD 1KIPB 3UBXB 2PCPB 4GH7B 1AQKH 4ZNCD 4NRYB 4OJFH 1Z5LB 1V7NH 1ZHNB 2ERJB 1BGXH 3QDJA 4OUUB 1YEEH 2ZCLH 4OIIH 3LEYL 3KPRA 4ZFZB 1PJ9A 3ETBF 4NQCE 5HHXL 3T0EA 2YWZA 3A6OA 3PWPD 3NGBB 5J57B 3P40A 4KH2A 1UT9A 2VH5H 3VFPB 3O8XD 5KSVB 3S35L 3RIFK 1KLGB 4X6DE 1XZ0B 3T2QA 4WHYH 5MENB 4P4KA 3MLUL 4AH2A 5HGGS 4L29A 3ARPA 1I8KA 4JVPA 5FYLH 1X5KA 5F9OL 5MI0B 3WN5B 3BFOA 2J5LC 2KBGA 1OLZA 3CZFB 1Q0YH 1XIWD 3MRGB 4F7PB 4F9LC 1X6NA 2ITDB 1JWUA 5GQBA 1UM5H 1B88A 2JELL 4JFYB 4JPIA 1MWAL 1PG7H 1EA9C 4HPOH 2NY6D 5IV2B 3SDYH 5C6PB 2GHWB 2AEQL 5JW3H 4JJ5A 5T3XH 5J6GB 3BQUB 3GUTB 4C56B 1NANI 1B0GB 1CICC 5D2LF 5IVXE 3PHQB 5T1KB 1TTGA 4C59B 4RQQB 2LTQB 3Q1SH 2GTWB 2FB4H 3VE0B 4Y19B 3DNKA 1ZT1B 1IGIL 1SEQH 2VZVA 2X10A 3LKPA 4BZ2L 3K4AA 5FYKH 4W6XB 1BQHG 1RZJC 1NFIB 5DD1L 5HDBF 3GMMB 2DYPD 1TQCB 4NBYB 1HH9A 1Q9WA 4D0CB 3FTGB 1FPTH 1QSED 4WU7A 1JPST 4G8IA 5E2UL 1RIUH 4P2RA 3P2TA 5HHQB 5DJ0A 1NC4D 2VUYA 3MXWH 5J4MA 5AAWA 3WS3A 4KMTH 3HS0B 3CXHJ 3RWFB 5ADPL 2W9DL 2QQQA 2VDKH 1MJUL 2LU4A 4YC2C 4RZCA 3O3UN 4EDXA 2KQNA 3FB5A 4QO1A 2BVOB 1GCFA 5BMFH 3ZT6A 4WIQA 4NC0B 3DOSA 1KN4H 1YJDH 5ID1A 4F15C 1DBAL 1MFEH 2DB8A 2RFXA 3DMMC 4Y16C 4QWWC 5JNYB 5EN2B 4PJCA 3VFWB 2A6JA 5I30H 1TTUA 3KYMB 1A1NB 5T3ZL 1MWAB 3LV3B 2O5YH 4AMKH 5KS9E 3B9DA 2DM3A 5IEHA 3UPRA 4PJ7B 1OSPH 3TVMB 5D1QC 1PVHA 1CGXA 1EGJH 1HIMH 3U4EA 5D1XD 1LWRA 1IARB 3B9KA 3BGMB 4BA8A 3IS0X 1HXYA 4YHPA 1CICA 1CWVA 4O9HH 5F89A 5TQ2L 3O2DA 1RZ7L 1A3QA 2IADA 1NLBL 4KTDH 3AXLA 1UCBH 3BEVB 3IXAA 1QUNA 4B53A 2DDQL 1FFOA 2R0WH 4RNRA 4UTAH 3BH9B 4JDTH 2JCCF 3ULVD 1MI5D 4NKDA 3HE7B 3N1GC 4QHUB 5T1LA 3NMEA 25C8L 1N4XH 1IEAB 1MEXH 3FQRA 1LEIA 1IC7L 5JIHA 3RVXD 4UDUA 2HN7A 5IF0A 3DWTA 1DTUA 2FH6A 9CGTA 1M1SA 1RZKC 3LKRB 4NRZB 1YEFL 3V5KB 5GRZA 3S5LB 2ZNXA 1GGIL 2Q76B 1P84J 5AZEL 1R3KA 1NGWB 3RP1A 1IKFH 4OLZH 1P7QA 4QRPA 5JMOC 1IAIL 5J1AA 1IGTA 3VRLE 4BFIA 4GS7B 3SE3C 3KPSA 3LRHA 2V2TA 5BV7B 2DLFH 3MCLL 4KY1L 4RGNC 5GGVY 1OTUD 3CZJA 4GW5A 4LSRL 1GZQB 5JXAH 5AD0B 4DW2L 4L4TD 2AQ2A 2Y7QB 2WWKO 3MOBH 4WI8A 4YDLB 2YPVH 1ZHLB 5HGHB 1TCMA 1CE1L 5JOFB 3OJDA 4QHKI 1MHHB 4MNGE 5DJAB 1TMCB 5DTFB 3RTQB 1ZA6A 4BH7A 5DMKB 3L7EA 5ADOL 3QJFA 4KKCC 2CGRH 5FGBA 4W4NA 3B5TA 4PGCB 3TT1L 5JW5B 5DJDA 1JUFB 5H2BB 1OAXH 3VXUA 4HUWB 1QVOA 3ARFD 4KK8D 4QT5B 1UADC 3ESVF 3NH7H 3DBXB 4LCCA 5IJKC 4QEGA 3S6CA 4YGVA 4R26L 3BYYA 1Q9OA 3HMWL 5GGQL 1XGRA 4KTEL 4IMKC 5HVGB 4HK3N 3M17A 3VGFA 1F90L 4O5LL 2ZPKH 5GS3A 1UYWH 3SE8L 4U6HA 5ETUB 5GRVK 1I7ZB 2J6EH 4WY7L 1YN7A 2VKWA 3MRIA 4L8DB 1CL7L 3UBXI 2WBJA 2XKSA 1DDHA 1NMBH 4N9GA 4FQPA 1R3IL 3OKLB 3RHWF 3QEGL 1I1YA 5EZJA 1J88A 4HWBL 4AEEA 4TQEL 1PZ5A 3HUJB 1OP3H 2BNQE 4BQCA 5I8KH 4YNYA 5C07A 4L3EE 1DBML 4Z7NF 1A8JH 3DROA 3H6JA 3ZSSA 5KSAB 5IHLB 1A6AB 2GEEA 3U7WL 2F54D 2J4WH 3U2SA 4J23A 4LAJH 2NTFA 4LVEA 2PNDA 2OXGA 4Z7QE 2HFEA 3HPJA 1S3KL 4OZFG 3ARED 5GS0C 1AD0B 2J8HA 1DR9A 3O6FD 4ZODA 2XZZA 2R0LL 3S35X 4Z77B 1NCCL 5KBNC 2WIIB 4ZPTA 1RHFA 1MHPL 1ZHBB 2BDNL 5E8PB 3KLAB 3TZVA 1RZJH 3G04B 5JQ6L 2VITB 2C1PB 1KC5L 1RV6X 3MRCA 1CCZA 5I0DA 2FNBA 4FQLL 4KKLD 5GZNC 2EDYA 1KLFA 2Y06H 4CKVX 3U0PB 5DHYA 5EFIB 2PXYD 4JM2A 3V4VH 1MCOH 1VFMA 2CRIA 4LLMA 5L0QC 3GIZH 2HMID 1YNKL 2GTZB 4HWEH 5GRUL 3ZKQD 1T66C 1VADA 1WCBB 4DZBB 1HWHB 4XCEA 2SEBA 3W0WE 2X2YA 3L3OB 2NY3B 1VHPA 5GGTL 5GZOC 4QY8B 3VD9A 2AJYH 2E6JA 1GXEA 1L7TL 4WCYL 1RURL 2A38A 1RUPL 2X6MA 1AR1D 3U7YL 1OGAD 5DMIH 2X09A 4WTZA 3MRJB 2O5XL 5L9DH 5EZOH 1C08A 2R39A 4UDTA 4YDKH 3FT3B 4I3SL 1Q1JL 3MQIA 5KVEL 5ISZD 4R3SB 4JPWL 4UAOB 5CBAB 2NPLX 4Z7VF 1NEZA 2Z9TA 3BPNB 5EBLB 4XH2B 5F7EH 2CK2A 3G6JA 3HC4L 2P5EA 1SY6A 2CPCA 1A2YB 1EDQA 5I66B 3I3BA 1SYSB 3FQWA 2AJSH 4NNPH 3TBWB 3MLWL 2AJ3B 1L7IL 3GO1H 4Q2ZA 4P2CG 4PV8A 2ZOKA 3I6KA 5IMKA 1W72H 5TDPA 1B3JA 1FO0A 5FDWA 4JDZB 4WFGD 4R8WH 5F7WC 1HHJA 3ULVF 1LP9A 4RFOL 3X13A 5I8OH 1S9VA 3QDAA 5BRZE 5HPMB 3KNBA 4Y5YC 4HGKC 5CBEB 1AGFB 3OKKB 4CVXA 3UC0L 4D9QD 1RZKH 4LCWD 2GJ6B 4UIKH 3DRQA 4GRLB 5E2TH 5FCUH 3LB6C 1QTYT 2W07A 1FFRA 3MV9A 5L2KB 4IOFC 4X80L 1KJ2H 2LE9A 3PUCA 1U3HA 2JB5L 2DQCL 1KJMA 4LLVB 3IGAA 1RUAL 4ONOA 2IAMB 1CK0L 3J7HA 1PBYA 1G7IA 5EUOB 1A7OH 1J0KA 3FOMA 4N68A 3U4BH 1F58L 2OJZH 3CUPB 3GJEA 4J1UB 2ERJC 4XVTH 2EE2A 1KNOB 3S96B 4JZJB 4MGXA 4KVCL 1MFBH 4R96A 1IKNA 1EIBA 4P57B 2FATL 2P8PB 3TM6A 2H6PA 1I7RB 3NGBC 4MB5A 2B1HH 2XA3A 2APBA 1BP3B 4HX1A 5TDOB 4PBXA 4DKFH 4F2MB 2VLLB 4NQTA 3OQ3B 4PJHA 3IDJA 4Y4FB 5C70A 3KXFA 4ENEC 5BW7A 3TO4D 5H94A 4PJGA 1CD1B 1F4XL 3SDCA 1U93B 5I18H 5CGYD 2R1WA 1FLRL 2JLLA 4AIXA 4OQTA 2EXYD 4Y1AB 5MI0C 3BAEL 2GT9A 3WFEH 1ND0B 1N7ML 2A9MH 1E28B 3NOIA 4ODVH 3FCTB 5JA9A 5D5MA 4LDLB 3V7AE 3TPUB 4MNQD 1YEHL 3RQ3A 3WIHA 4PGJA 2Z31B 4XMLH 4F7CA 4PGDA 1J8HE 2FECL 4IRJA 1FNAA 2UVFA 3QXAA 4M7JH 1U8KB 1JHLH 5FGSA 5KTEH 1HHGA 3O4LA 5TE4H 3KPLA 4Y5YA 3BQUC 2ADIB 3HZVB 4P2QB 1QACA 1N2RA 3MUZ1 1DL7H 2DS4A 2LTQC 3OKDA 5E9DB 3F7YB 4F7EA 5I8CA 1T4KA 3VI3F 4WDIB 2A77L 3R8BB 3AGVA 2OK0H 1MHCA 4YFLF 3HC0A 2CDFB 1QHPA 1TQCC 1VPOH 4JFQB 4HKJB 5JHDB 3MUJA 3PL6B 2PCPA 2W60B 3P11H 5I15H 5LGJB 2P24A 2VLJE 4JFEE 4NRYA 4NUJB 1FE8H 5IBTL 5EIVA 4NQEE 4KJYA 3FFCD 5DRZA 1IAII 2XQYG 1G6RA 3MRKB 3DXAE 2XY1A 1YYLH 3QFDA 4MAYB 5GS0H 3GKZA 5KSVA 2FBOJ 1SEBB 1OAQH 3LPGA 1ZAGA 2IBZY 4HJJH 1OTTC 5KAQG 5AYUH 4CJ1A 1MCWM 4OAWB 5I1KL 1EHLH 3NPSB 3S88L 3H42H 5A1AA 1AXSA 1T89A 4Y88A 3NA9L 2OTWB 4U1SB 5F8RC 4WU5B 2BJMH 2MPAL 1HCFX 3TVMC 3UDWA 4QTIL 1IM3B 4DQOL 3D0VB 4PGBB 5CJ5A 3IF1A 1E6OH 2I5YL 3UO1L 3IB4A 3MRBB 4KK9C 1T22B 4HIJA 2UY7A 3NA4A 4WWKD 3GUTA 3S8WA 4FFYH 1UA6L 4PB0H 43C9A 5I71B 4FMFA 4POUB 3RBGA 1CLYL 4RQQA 1F3DJ 5F97E 2PUQT 4U33A 1KEGL 1MJ8L 4KKBC 3ARVA 1HHKB 4Z78A 4ELKA 2X9YA 1KTLB 3D9AL 4NNYB 2F74A 5D7JA 4TVPD 1ZLUH 4BQ6A 3F7RA 1CL7I 3KPOB 1RPQA 2BVYA 4IHOA 4X6FA 4K3HA 4Y2OA 1A3RH 4OZHA 4WV1A 4XCNB 2VC2H 3MPCA 4QRSB 3ULUH 5BZDB 5CIPB 1MLCA 5JW4Q 3SE9H 4PRIE 3NFPB 2AVGA 5ESQB 4P2YA 3HC3H 1IAKA 5C09E 1J18A 2D2OA 2XG4A 3B83A 5JW4N 3WXWH 2VSDA 3VFNA 4GS7C 1FFPB 2H1PH 1FORH 5JUEH 5BV7C 4XI5C 5CSZB 1FNFA 3LMJH 3I3DA 5JDSB 4Z6AT 4MQ7B 4TUOB 3FQXB 5SX5K 2JB6A 3ZE0F 1U8IB 2E9WA 1F11A 4YDLC 4WUKL 1A6UL 2D0FA 4O02H 3TBYA 3RTQC 1A1NA 2R1YB 3BDYL 5IVZB 1C5CL 4K94L 2CDEB 1D9KD 2VZOA 3MGTB 3VXTB 3OJVC 1G0XA 5EWIL 1C7TA 4IRSD 4PJ9A 4DOHB 1JNJA 5KSBE 3VFUA 4FQ1H 3BO8A 1YQ2A 1KG0B 1T1WA 5MHSD 3MXVL 2FR4A 4PRHD 1NMCC 1FFNA 2X7LA 5CKGA 3PQYD 2VZUA 1BQSA 1WAAA 1C8PA 4YHOH 1INDH 1EEZB 1RUML 3QDJE 4NP4L 5C8JB 4QHUA 5DC0A 5F1NB 2UUDK 3KPRE 4G7YL 3T0EE 1I1FA 5L88H 3VD7A 1IEAA 3C8KA 1CFVH 4HHAB 5HHNB 5E1AA 2XWJA 4JHZA 5E6IB 5GS2H 3VFGH 4NRZA 3LKRA 4P2OA 1RIHL 3VXQA 4EZMA 3EDJA 2IGFH 5HHVH 5EO0A 1AJ7H 4EDWH 5D7LB 4KHTL 3ZE1E 3GSQB 1N6VA 4LIQE 1BD2A 4KK5C 5SX5H 2ICCA 3MROA 2DBLL 1DCLA 5IFAH 5MP6L 1N6QH 4PREB 4EI5B 3TNNB 3OXSA 1EEYA 2X5PA 5KSAC 4XP4L 4Z5RB 4RSVA 2BSED 4AEHL 2MOVA 3B9AA 2VDRL 1JN6B 3L3GA 1GZQA 2IC2A 3RIAK 2YRLA 3IU4H 3ZO0A 2Y7QA 2BZDA 7FABL 4NQSA 1KCVL 4HWNA 2DRUA 1FAIH 2YUVA 5DTFA 2ZCKL 5EOTB 3L5WA 2YN3A 1BVZA 3RKDC 3HNSL 1D6VL 1CE6B 2C3VB 4PGCA 3UX9B 3ZT5A 1VFBB 2XXCB 3E6HB 3V6OC 4WHYG 3DBXA 2R1XB 3LEYH 2UUDH 3EO0B 5HHXH 3CSGA 1ITBB 3ZDYF 2DICA 3UCRA 4P2RE 3S35H 5HPOA 4Z0XB 3ARDA 5IKCA 1TVDA 5B22A 3LSOB 3IFPA 4M03A 3MLUH 4V1DA 5MEPB 1X4XA 1INQA 5ITBL 1N64L 4YHIA 2NY3C 4L8DA 1XF5A 4ZUSA 1QA9B 3L3JA 3QWRA 5F9OH 4XAKE 1BWWA 4R4BB 2YBRA 1F97A 2GIYA 5B3JF 4F8TA 4JQVC 3E0GA 3SGEI 2JELH 4U1IA 4G8GB 2B7DT 3DV6A 3HUJA 1MWAH 5CZXD 3RWCB 4PJCE 3GB7A 4OIBA 3KLHC 1QRKA 2E5EA 4UAOC 1EPFA 4XPHL 4AEIL 1W0WA 1ZA3A 2VR4A 1WIPA 2AEQH 5KSAA 3F58L 1KXQE 1Q38A 5TH2A 4NKMB 1J1PL 2B8OT 2FIKB 3QNZB 3BPNC 4RX4D 1ZWIB 3QIUD 1OD9A 3BZDA 3LCYA 5J12B 1Y18B 1IGIH 3BIKB 3N1MC 5JIPA 1I8IA 4BZ2H 5HVFB 4JFHE 1KEML 2DJSA 2FECI 5E95B 1RVFH 3W9EB 1JNLL 5DD1H 2DM7A 1VGEL 4KJPC 1U95B 3MV11 1INEL 4HS3B 3CDCA 4GG6F 5E2UH 4Y4HB 4ODUA 2VDQL 4OLEA 3LIZL 4YH6A 5DJYA 4TSAL 4OCMC 4JN2A 5D1ZA 3V6OA 2VXSL 2X42A 1JK8A 4PJBF 2ZCHL 1FC2D 3V5DB 4P23B 5ADPH 4FQJL 1GYAA 1Q8MA 1J11A 2W9DH 3PABA 3PWVB 3U0PA 5D2LB 1MJUH 2Q7NA 4YBHA 4NN5B 5CMAB 5E6YA 4MDJB 1QBLL 3IVKB 2DKSA 2G75B 2IAMC 3QUYA 4XWOD 1S7RB 4WO4B 4XBPB 1DBAH 3K8KA 2EC9U 3HG1A 4QRPE 5FDYA 4QY8A 4PRPB 3KWWA 1EMTH 3KPSE 1IEBA 3FRPA 1ACZA 1DLHB 4JZJC 4ZSOB 5T3ZH 5FUZL 1P9MC 1T21A 2OBGA 3EDKA 3MJGX 1DANU 1NCUA 1Y6NR 4HUUA 4X6CB 1CXHA 4H8WC 3EYSL 4LASH 5EO9A 1EJ6A 2ARJB 2IH1B 2D7OA 4R3SA 3OR7A 1F45A 4RAVA 5EU3A 4P3CL 4Y4FC 1JHTA 1ES0B 3V6BR 1X5FA 4PLJC 1GGUA 3MO1B 3VGDA 1RZ7H 4DUWA 5DD0L 1NLBH 3IKCA 3VXUE 1LEGB 2HJFA 2CKNA 2DDQH 4JHAL 1X5HA 3L3HB 5E8EB 2Z8RA 3IDNB 1FIEA 3NACL 1H5BA 5IT2L 1EAPB 1N3NB 3LN5B 25C8H 1IC7H 2C3XA 1FRGL 2Z31C 3HR6A 1DQQB 2FX7L 2Q8BL 3HNVL 3STBA 2VDNL 4OCSL 1YEFH 2IPKB 3E6FA 2Y1VA 1BX2B 1HKLL 3SKMB 1GGIH 4RRPG 5E4EB 1CYGA 5JPNB 4ONHA 5EZLB 2OZ4L 3D87B 4MSWA 5AZEH 3MUGA 5FB8B 1A7QL 3VDCA 1IAIH 3X17A 3VFMA 3G5XB 4LLVA 1LE9A 3MCLH 4KY1H 2YD2A 1WTGT 4LSRH 2FX8L 3JTTA 3QO1A 5EUOA 4ZTPL 4DW2H 3PL6C 5C07E 1ZT7B 1RU9L 3RUGB 3CUPA 5C08D 5HXMA 1CE1H 4Y7MA 2FWOB 1OQOA 3F12A 4HV8A 2OR7A 1A7RL 4N8VB 2AK4B 5ADOH 4X7EC 3B6SB 2QEJA 3TT1H 3L3KA 1WIOA 2X1PA 1MCKA 3ARSA 4HS8L 4MAYC 5ANMB 5TDOA 3WJLC 3CU7A 4ETQA 3FQNA 2JIXD 5L8KB 1JNHB 5I76A 1LVEA 3CVHL 2YC1A 3CK0L 1NDGA 3NPSC 3V4PL 3HMWH 5GGQH 4KTEH 4OCXL 1ZVHA 3QUZB 1F90H 4O5LH 2B4CC 3REVA 4GSDL 4TSBL 3SE8H 5KOVC 1WC7B 4WY7H 5FK9B 2A73B 1GL4B 3TCLA 1CL7H 4JY4A 4K7PL 3L3DA 1U8KA 3KJ6H 5BRZD 5DK2A 4G9FB 1R3IH 3TH2T 1RMFL 3PWLB 1DJSA 5IFJA 3QEGH 3MFGB 4R2GD 1NCDL 5I71C 3FOLA 4HWBH 1OQXA 2WINB 1A5FL 4TQEH 1C16A 3MA7B 4D9RD 5ID0A 4J8RB 4BJLA 1DBMH 3REWB 4QXWA 1VFOA 1TZGL 3E2HB 3HE6D 4S1QL 5CEZE 5A16B 1C5DB 5FAAA 3U7WH 1U42A 1D5BB 4GLRI 2ARJQ 3NN8A 3O9WD 3O6KL 3PL6A 4ELMB 5I1CL 2W60A 4FQQB 2X4NA 5DR5L 4BFBD 2AQ1A 4KROB 4QHMA 1S3KH 4KPHH 3VGHA 4PRAA 3GMOB 4ZXBA 2R0LH 4PJ5A 4PRBB 4JHWL 1NCCH 3G6JE 3MRKA 1FNGA 2P5EE 1MHPH 5D2NA 2BDNH 1XGQB 1G7MB 1JPFB 3VXPB 3RWEA 3A0OA 3CVHB 1FZMB 4BZYA 3WJLA 1HQRB 5JQ6H 4HH9B 1KC5H 3BZEA 5E70A 1OAKL 4I3GA 4FQLH 1F5WA 2L7UA 3P73B 1LP9E 5HI3C 3HLAB 1VEOA 1ZS8B 4HUXA 1JGDA 5JOPD 2BVQA 4ZUTB 3U83A 3NZ8B 2AKRB 3ZYIA 2OTWA 5C0CA 4GKZA 1YNKH 3GMRB 2C4FU 4Z7UF 5GRUH 1GH7A 1A1OA 3NCEB 1NDMB 2D7TL 3MV9E 3LS5L 5M95B 1URLA 3B2UD 3D39D 5GGTH 1T1YB 2H32B 4KI5C 1DQJB 4WCYH 1RURH 1RUPH 1T22A 2PN5A 3T3PF 2FJFB 3VMNA 1G7PB 1AGCB 3FB6B 2O5XH 4MVBC 4LF3B 1H3UA 4Y2DD 5FYJD 1BM3L 4KK6D 4I3SH 1KENL 1Q1JH 5KVEH 2Y72A 1Z0NA 4JPWH 3JV4A 2EYTB 1TVBA 1KTLA 4MJ6B 4JO4L 2AEWA 1JWSB 3GHBL 3NIGF 3VRIB 4Y4KC 1G0DA 4GFTB 4KU1A 5E6IC 5C0DA 4U1LA 3HC4H 4JFDB 4OGXL 2KUTA 5IW3A 2NY2B 2YMXL 4PJHE 3MLWH 1ZK9A 3IAPA 1G9NL 1L7IH 3KXFE 4E0RB 1F2XK 3CXHK 4PJGE 1FL3B 3F65A 2OI9B 4OM0L 4XRCA 3QEUB 3GEWB 3EBAA 5EORL 2YWYA 2CUHA 4EI5C 2BC4A 5D5ME 1MJ7L 4HIIA 1KUMA 1II4E 1ZEAL 2N4IA 2DI9A 1MELA 3UC0H 3GSWB 4RMVA 1KCLA 4Z7VB 3GRWL 3KYOA 4X80H 3VXSB 1U58A 2AQ3A 2JB5H 4K94C 2BNUB 2DQCH 1T03L 5F9JB 2VN4A 3O4LE 5FYLD 1DSFL 1RUAH 4WHTB 4UOW1 3MTRA 1CK0H 3C08L 2R1YA 3UTPD 2FYYB 3MJ9L 1CLZL 3DVFA 2X1WL 2ICES 3G5ZB 3VXTA 4HBQA 1F58H 5JZ7D 2WANA 5IW1A 3BPCB 2Y36L 1NL0L 4GAYB 4DVBA 4KVCH 3KVQA 1KIRB 1JE6A 2FATH 4B50A 5KAQF 4KJQC 4X6EB 1FJ1B 4CVUA 2QKIB 2BY0A 3R8QA 2ICWJ 5F7DB 3QXDA 4F7MB 4FTVA 3SO3C 3SGEH 4GXVL 4MQSB 3C9NA 5JW4M 1A4JA 2OL3L 4ORGB 5ACZA 3V95A 2DBJA 1F4XH 3QO0B 4Y4KA 5C0JB 4RWHA 5HHNA 1FLRH 5E6IA 5FYKD 4HGWB 4YHZL 4Z95L 1P4LB 3BAEH 1N7MH 1P84K 3DUSB 3MRRB 5EDXA 2CKBL 5FGCB 3DURB 2F58L 1IT9L 3DV4A 4WFHE 4KKAC 1YEHH 5L6YL 1NFDB 5DEFA 5C09D 4U2YA 4XHQA 2B39A 2VDLL 3EUUA 2V5SA 3C5SA 1BFOB 1MCIA 2C3HA 3WLWC 4K3DL 1TVHB 1S9YA 4FQCL 3QQNA 4PJEA 2V9TA 2AXGB 3O6ML 2GJZB 4N0CC 5J12C 1DQLL 2D3VA 3QH3B 2VRAA 1LK2A 1QRNB 3NFNA 2A77H 3GSOB 5DFVD 3SGKC 5J13B 4HCRL 3RWDB 3ES6B 5J89A 1VKXB 4JRYB 2JJTC 3PWUA 3W11D 1NUGA 4D2NA 5IBTH 4HPYL 4K8RL 3P9MB 1U8LA