5CR8A

Structure of the membrane-binding domain of pneumolysin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
RNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Pneumolysin at 2.0 angstrom Resolution Reveals the Molecular Packing of the Pre-pore Complex.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Toxin
molecule keywords Pneumolysin
total genus 22
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 5cr8A00
1M3JA 1S3RA 1M3IA 5CR8A 3HVNA 3CQFA 4HSCX 4BIKA 1PFOA
chains in the Genus database with same CATH superfamily
4XMWA 3D25A 3AT9A 5F7EL 3T5WA 4U31A 2ZJSH 3F7PC 4N3TA 1J12A 2AXGB 2FYYB 4X4KA 3IU3B 1YJDL 4XB7A 2X2YA 3VFUB 4QF1A 1TZHA 4I89A 1E2VA 2FSDA 4H5SB 4PGCB 3RPIA 3N40F 3FUHA 1TJIH 4LLUA 3GSUA 3MRIA 5TGBA 5D70L 3CDZA 2ZX7A 5C0FB 5EOCJ 2GITB 1NAML 4RMQA 4G6MH 3MACH 4AUUA 1P5UB 2EICA 4P2RA 4YBLB 5HTSA 3HJ0A 1EERB 2PTTB 1AMYA 4PUBL 4ISVB 5FHAL 2WWOA 2NY2C 3SCMB 3L95A 5CR8A 4K5MA 4BA0A 1KTKE 3FCSB 2RMNA 1A0QH 1N12A 1TYEB 4WSKA 5F0LB 4R97B 1L9PA 2XFXB 5L2JA 2CM6A 4QGYA 1D5ZA 5F7FA 1FGVL 3BD3A 3IVKB 4F24A 5GSVA 3CH8A 1T6BX 3DHPA 3MLWL 3HS0A 4X6DB 1CG9A 3GUTA 5MP6H 4FQCH 3LB6C 1CDBA 2Q76A 3UBXI 1CXKA 1XGRB 2HG0A 3IJYA 3LKRB 3QUYD 4CVWA 4O9HL 2F54E 5DCCA 5I17A 3S9DB 3CFMA 5M94B 4PVBA 2A77H 3EFFA 4IGBC 1L6PA 1X9UA 3L5WB 4GSUA 4YFLF 4JPKL 1QTSA 3CK0H 3BDXA 3GSNA 1Q94B 5IVXB 2B2XL 3AAZA 3EYQC 4BSVB 1MG3C 3BZ5A 1WC7B 1E6JH 2BCMA 1PDKB 2OQJB 1Z5YD 2BOCB 5ADOH 1CGXA 2JKRM 3KXFB 2AAAA 4XMZA 2VDML 3SDXF 2ZG3A 5IBLC 3C6LB 4X0KB 3DK0A 5C0DA 4LCWD 4HLZH 2COQA 3IU4H 4DQOH 1RJZB 2HFGH 1G87A 4HGWA 4NPYA 5EOCL 4XVJH 5B8CB 1X4XA 2ADIB 5B39G 4GKNA 1G5AA 4HIIA 3VXSE 5DWPA 5DFWH 5BO1H 1RERA 1GGTA 4JRWA 2YUXA 3FO0H 3FSZA 4OAWB 4X8GA 1NCCH 5MI0C 5JHBA 4TQHA 1UOWA 5IMOB 3LQAL 5IR1A 3VI4E 2I32A 4AQ1C 4AQEB 1HXYA 1NC4D 3MV9A 5E99L 1SJHB 4PS7A 2VSDA 3JVGA 5K9KB 1T5XB 4XCEB 4UQIM 3CSBA 5IG7B 2R29A 5TFSL 1FNHA 4RWYH 4DVRH 5JW4R 3KLAB 3T0EE 1BFSA 5AOLA 4BCYA 3MYJB 4POZD 4ALAC 5B39B 4XMPH 5K1JA 1E3ZA 3CPUA 1KFAL 1HKFA 1TYJA 3QJUB 5DS2A 1KEMH 3STLA 3QORC 3DRTA 4BK5A 1X5IA 5DZ9A 4HULB 1ZKAA 2JKNA 1DEEA 1MCJA 5IB3A 4XOCA 1VGEL 1NGYB 4MVBC 4U3SB 2P5EB 4NYLB 1AC0A 1AD0A 3GM0A 3PL6A 1AIFB 5DUBA 2IH3B 1WAAF 3ZYZA 3HHSB 1T4WA 3WFDL 1LDPL 1CD0A 3GSWA 4N0FA 1ORQB 1PTZA 1AGFB 4LOFA 4UZGA 5E6IA 2XXCB 4DP1X 5D1XB 4F8QA 4M62H 4DP4X 1B90A 4PCSA 4MDRA 4RFOH 1MXDA 2E6PA 2N0KA 5DZVA 2XQYA 5F3FA 2HX9A 3DX0A 4O02L 1KELH 1JPGB 1R17A 4N2BA 1U42A 4WV1B 5F7WC 2E7LA 4IW4C 1GIGL 2QADD 5ISZA 3Q8BA 3KJ4B 3FF8A 2D8KA 2XA8L 2Y1VA 4JDTH 5HYQB 1IVTA 4JRYD 4MA8H 1IEAB 3JT0A 1I4FA 3LS4H 4S1DD 4N2IA 1JWUB 2AXWA 3BSZH 3MBEB 4U4BA 3NSDA 5T5NG 2K6YA 1KLUB 5IUCA 4Y4KB 3LZPA 2F74A 3TZVB 1VFUA 2NX5A 4JPQA 4NQXA 4TSCH 2X4SB 5JOPD 3LAFA 3K6IA 3IFOB 3AXIA 4QXUH 5L4FA 4ODHL 2OS7A 4HOMA 4G43B 2XZAL 3FQTB 1UA6H 2AQ2A 4PYGA 3H3KA 5SWSD 4FXKC 2F18A 5ICXB 5HYIA 2ZXDA 1NOAA 4Y4FB 3MMEB 3T4YA 1J0KA 5DK3A 2VR6A 1XCQA 4ZMNA 3W5MA 3S5LG 3ULVH 4GB9A 3DHMA 4HV8B 1U58B 3KJ6L 4MCYA 3FO2A 4LESA 3O6FA 3UOAB 4KMLB 3MLVH 5T5FA 4LHUB 1IGCH 4FMFA 4PJGF 1IQWL 2IQ9L 5F97E 5MERB 4K2UH 4EZKA 4KVPA 3WMQA 4NQSA 3GSWB 2PPAA 3ZKXB 4E9XA 2WXQA 3ZKQD 3BEVA 4Z7NB 1KMGA 3F7QA 2EIMB 3I75A 2HRHA 1AD0B 1DN2A 5TH2A 4XB8A 4LKCB 4J3SA 1JHLL 4HOXA 2WTPA 2APXA 2A1WL 4D0CA 3KCPB 4EI0A 1UM6H 2XZZA 1VENA 1QR1B 2Z35A 1A6WL 3IMWA 1CS6A 1MLBA 2VMCA 2ZPKL 4I4WA 1BFVL 1MY5A 5TE7H 4KQ3H 3GHEH 4YE0A 2YAQA 2DJMA 3WMPA 4DGVH 5HVWA 5E1AB 2OV0A 4U6XB 1U3HD 1OGSA 5IG7A 3GSNH 1EO5A 1O9ZA 4ALAH 1IFHH 2VH5L 3KLDA 4HP5A 1SJHA 5IROA 1GGIH 1UWXH 2OCJA 2B3RA 3WFZA 1MJ7H 1V3KA 2FJHA 4CSTA 4AQEA 4NQUA 4IMLA 4GIPD 1WQVT 4DEPB 2VC2L 2EDDA 4NO0D 4LSDA 3SGJC 4N90E 4PB9H 4KTEH 4XWGL 1CK0H 2VLRE 3QUML 1FGNL 3FB7B 4XBEH 4GH7B 4BKSC 5GS0L 5CLTA 5FO7A 4PI0A 3ZTNL 5GIRB 2JTDA 4HGWB 4NPYB 3TO4C 2AV1B 5CHNB 1OT2A 3RBSA 1D6VH 2JV6A 2LLGA 1A4JA 2PP8A 5LNDA 3KBHE 1T04B 3OSKA 1CDCA 2W59A 1EHXA 1A14H 1FH5H 4HFWB 2DLFH 4MBRA 1FORL 2J20A 4Z3HA 3MRFB 2E59A 3HW7A 3JWNG 1USQA 5IVXA 5IBUB 4XMLH 3WY3A 1L9OA 4F8PA 2DOCA 3BOVA 4LU5L 5GS1C 4KDVA 3V4PH 3V4VL 2VXUL 4YO0A 3RHWK 2WK2A 3RG1C 4O4YH 3J27A 4HEME 4NLHA 4ADJA 4F2EA 1HCVA 4FTVB 1Z9NA 5B1BB 1PJ9A 3QDGE 3KPRE 3PV7A 3L3OB 4G6JL 3CX5K 1NANI 1DJGA 2E8YA 3P77A 4N28A 1D5XB 4JPWH 3RGVC 2AK4D 3SYAA 3TWCL 4Y9BA 3L5IA 1D5ZB 4KQ4L 1L9SA 4M5TA 5F1OB 2XIIA 4QHNA 4XZUA 1JNNL 1ZLWK 1KCVH 2XY1A 4NN5C 1EXUB 1G0DA 3NJXA 2NYZA 3PG2A 1OSPH 3QZOA 5B1CA 2DV6A 5A2JH 4NPJA 5LCVL 4WEEA 3SCMA 1VCBC 2BNRD 3B34A 4RETB 1HCZA 1IM3B 4IBYA 3TCLB 4DO5A 5D1QC 5HHOD 4JRXA 5KVEH 4LSRL 1OCWH 3AQYA 5FIEA 4Z77B 5CSZB 1XB8A 4QRQA 1INEH 3MLYH 2RGSA 4N2GA 3KM1A 3D52A 1N4XL 4OIIL 4JCWA 5JHDD 2WINA 1XF5A 4OKDA 1S3KH 3RPIB 4HUWB 1CI3M 2VITA 3STZB 1EZUA 5HGBA 2NYKA 5EBWA 1MHCA 1EX0A 3KPOA 4ZSOA 4EIUA 2OR8A 1BQKA 3SE9L 4PJHA 4UV4H 3TVMB 3G9VA 1YY9C 1EO7A 2R1XA 1KV7A 4U1GB 4TSBL 4XNYH 3V5KA 3K91A 1REIA 2VW6A 5C07A 4XN7A 1IE5A 1F1DA 3MJ9L 4HAGA 5LNEA 1R3KA 2AW2A 1FL3A 3HRZB 5CAYB 3T1FA 3N41B 1I8MB 2OJZL 2DYPD 5GRVL 4PJFA 5KVFH 1PBYA 4YXKL 1KIRA 1CTMA 1BJMA 5I8OH 1KZQA 4QY8B 4RAVA 3P4MA 3S37X 1CLOL 2HVJA 5H37H 3NIGE 4FQ1L 2M1KA 3H7LA 5HDBF 2XUWA 2VIRB 1IJ9A 3C6SB 3WXWH 5IQ7L 3RAJH 1MFVA 1HHIB 2DTML 3HLKA 4PBXA 3OKNB 1PZBA 1MIML 1XGZA 2BC4A 1O9VA 5TE6L 1GSMA 4HKZB 3DHUA 5DYOA 1MHEB 3HG5A 1G6RA 1EMTL 1JRHI 1P53A 3QZWG 1MH5B 4G8IA 2R23A 4XXDA 4B9FA 3PFUA 5GGTA 5K1VA 5F70A 4QJ4B 1KB9K 2G0LA 3MLSL 1ORSA 2QEJA 4DZ8A 3HLAB 4CSPA 1FAIL 2DMCA 5HHVL 2ERJC 2BIQA 1CLYL 1GJWA 3UBHA 1YQVL 5JNYB 2TAAA 3WOVA 4JHWH 1DBBH 1IBHA 5A43C 5I6XB 3WTTA 3X1FA 1XMWA 4PMFA 4YDIL 2D7TH 2NY5C 3ML9A 2BSRB 3V9CA 4QWWD 1COBA 3EGXA 4XAKD 3WS3A 1FZKA 2X3CA 5CEYA 1R3IL 1JAEA 3F62A 4FXTA 1TZAA 5D93B 3B5TA 3FQXB 2IGFL 3T08A 2I9LA 2RQ8A 4PJAB 4NBZB 1C1EH 4FMVA 3EH1A 3LH2L 3RJQB 4P4KD 5TDPA 3CUPA 4QEGA 5ITBL 3HHMA 3DOSB 2XWBA 2WN2A 1Y0LA 2YPLE 3UJJL 2MCPL 3ET9F 2AABL 3UJTL 1L5GA 2NYYD 2OKMA 4X6CF 2A3TA 2I26N 4JO4L 5IHHA 5ESVA 1QLEL 4BCZA 2DWEA 3AS0A 1KELL 3NTCH 4WUKL 2W8CA 4FOMA 3S6CA 1CBVH 2NY5L 1KG0A 1B0WA 3WNOA 1ACZA 4LPVA 3T0EB 1PIGA 2C7UA 1WWWX 2YAMA 2FIKB 3PUUA 3AITA 4KX7A 1TZOA 5J9PB 3A6OA 1FZMA 1PNCA 1SDDA 3ROLA 3U25A 4UT7H 3SDYL 2ADYA 2B20A 3MUZ1 5AB1A 3TN0A 5DC9B 3SDXA 5EN2B 1OGAD 3BT2L 3QHFH 3U46B 2Q9OA 2XWRA 2K8MA 4E2OA 2QKIB 1ZLDA 1BYOA 5CF3A 5C08B 4L4JA 4HS3B 2H1PH 5FPIA 4HCRH 3ZY7A 2VH5H 2YQ2A 1EK3A 1KJ2H 3T3PF 1P84K 3QR2A 4HKBA 4PRPB 1BQLL 1DQJB 4D8PB 4TL5A 2BW5A 2HH0L 1D9KA 1YNLL 2AJVH 2VC2H 1LEIA 1YC7A 5D7EA 5DRZB 2OBGA 4UM9B 1RK1B 3G3LA 3K2MC 4OCNC 1G1CA 4W9EC 5IHZB 3UC0L 2ZX6A 3JV5A 4FI6A 1ET5A 4HX1A 2R69H 3QS2A 4MJID 3JZ7A 4GMTL 5JIDA 4XCYB 5DLLA 4WK4B 3NZ8B 5ID0A 1DJHA 1V3MA 4LSVL 5F1IA 5HI3C 1C12A 5DVMA 4NQEB 2X4UA 5GS0D 4IIQB 5DQJB 3ZHDA 1MVFA 3VH8B 5E8OA 4OZFB 1RK0A 2WANA 1JHLH 2UYLB 3K1KC 3NGBB 2BFVL 2ZF9A 4LSQL 1WO2A 3RY4A 1OAZL 3CV5A 3REWB 3PABB 3TL5A 3PP3H 4GSDL 3HG4A 5FM5O 1AI1L 2VXTL 3REVA 3VD2A 1D5MA 1P4UA 2F53D 3MV9E 2P46B 3U4EB 4F9PA 3QUZA 5DFVD 2YRBA 1K6QL 3CFJA 4LIQL 2YZ8A 2GAZB 1QFPA 4Z0BL 4BFFA 5GSRA 1B2WL 1WWCA 1RJCA 2RIKA 5DMGC 5DJCA 4W6XB 1E5BA 1D7CA 3FT0A 2VDMH 3A67L 1NUDA 3ARYA 4XCFL 5HGHA 3VDCA 3K81A 2IBGA 3DUHA 3HC3H 1JYWA 2P3YA 2YKLL 1F11A 1ZLUH 3G5XB 1T5WB 1ZAGA 4MKTA 2VLKE 3TBSA 4GSRA 3TFKC 2MSPA 1XBRA 3CTTA 2OSXA 1U8QA 1Z9OA 2PMZA 3PWPD 4DNLA 32C2B 1OSPL 3MRNA 2JJWA 3MX0A 1U8LB 1ZT4B 3I50L 4IRSB 1XIWD 1JGUH 2O5XH 4ZK8A 4Y2OB 4LSRH 2YGPA 1HOCB 5I1CL 4M8UA 5SX4I 4P59L 1NC4B 5FF6A 3ARGB 1SJMA 4ONGL 3ARFC 3VXQB 3GC3A 5F6HJ 5DD3L 5IB5B 1WFTA 2NY3C 4I0PC 3T0VA 2DLFL 1LWJA 5D4HA 1LO4L 3OQ3B 4JN2B 3D39D 4D0BB 3VXSD 3J7HA 2FR4B 1DL7L 2FJFB 5HDLA 3K4ZA 2JLPA 5L0QB 1IX2A 1KTDA 3MJ6A 1NPUA 1VGEH 3D3VE 5G4MA 1HSAB 4WHDA 4X9IA 3GK8L 1CQKA 2ADJA 5DWUH 4WI0A 4AIZA 4IS6B 4WHTB 4XBGA 4X7TB 1FE8L 2ZOUA 4OF8A 4PP1D 5LN8A 5ICUA 2FEDD 5TF0A 1KCKA 1XZWA 1PW3A 3QG7L 3DVIA 4PV9B 2BOBA 4L4VE 1O9WA 3K8MA 3SOBH 1HZHL 3N91A 3PIQA 3VGDA 5KBPA 35C8H 2GC7C 5FHBL 5LCVH 4JO5A 1WRFA 3BKJL 2Z31C 1IV8A 5INDB 1R5WB 4P3CL 4FKKA 1KUMA 5EEUA 2CALA 3C9NA 3BPCB 5CP3H 2YAFA 3MZGB 2Y1YA 5T3XE 1T7YA 2WNXA 4ZQKA 5C8JA 3INOA 1TFHA 4F2ME 4NT6B 4R84A 2F7IA 4MXQD 3CSGA 1KPUA 4WFHD 3T0WA 1KWKA 4MJ2A 4OZIE 3H9SA 4JKPH 1UZ8A 4C57C 1FP5A 1TVHB 4NN7C 1R47A 5EZLA 2DQIL 3KPSB 3QYMA 3U6RA 3JWOL 1JI1A 2XG4B 4M43H 3SKJH 1WBXB 2VN6A 1WA2X 3LSOB 2EC8A 2PKDA 4FZEL 5J6GA 1I9JL 1KBBA 3BISA 5F7HA 4X4XB 4OLUL 4F7MA 2OTWB 3DA0A 2IBZY 1HOEA 4NPKA 4RGNB 3RVXC 5C6TH 4PRPE 4JB9H 5JXAH 1MHHA 3IFPA 1HQRB 2FQGA 3KPRA 4GRWE 3L2MA 4JHUA 2QVTA 3LJ3A 2JQZA 1CFQB 3O6FC 4XPHH 4Y2LA 5JHDB 2EYTA 2H0EA 2XV2A 3QQ9D 5JR1L 5DD1H 3MRLA 2JJTC 2VYRE 3UIZA 4X4YB 1U3NA 4JO4H 3ULVC 1XH2A 3RFZB 4EN3B 5EULV 3NFPB 3NPZB 4I18B 5ITFB 1DTUA 3AU1B 4QOKE 4YHKH 2FGWL 1WCQA 3GMOB 1CUOA 1N7MH 2FHBA 5BW7A 3K1DA 4JHZA 4O5LH 5KAQG 2FJUB 2NZ9C 2Z8WC 3V6ZB 4P5KB 2WUBL 4AM0Q 3D18B 5C6WH 4BE5A 1A8JH 3SDCC 4XC1H 3ARBA 5DRNA 3S2AA 1BZOA 3BP7B 5F9WC 3UAAA 4EO5A 4D9LH 4PJ8A 4PLOB 1VLXA 1WV7T 3UTSD 3QBTB 2Y2YA 2P8LB 4I1RA 3PDOA 5AUMA 4CUCA 4ENZA 4DK3A 3ECBA 4IRSC 1KGCD 4NNYA 4PAZA 4YLBA 4HAFA 4MWFA 1UB5B 3PQYE 3VFTB 1NDGA 1BAWA 4K5OA 1MNUL 1PZ5B 2E75C 2WZAA 2CR0A 5LAXA 5JYMA 5CGYC 2IWKA 4MS8D 1EJOL 4GXFA 1CK0L 3QUMH 4HDIB 4JG1H 3PHOA 2FQFA 3PGDA 1WFNA 3GIZH 8PAZA 4UBDC 5HD8C 2XA3A 1WBYB 2Q86A 1E7UA 2Z7ZA 3FUKA 4PG2C 3VE0B 4EF3A 1OTUD 2WWMC 5HDOA 2XN2A 1EANA 3H2WA 1S9XA 3NSYA 2ROYA 3IGKA 2UXGA 5A40E 4TVPE 2Z7WA 4Y1AE 2QBWA 5E2VH 3ZXAC 3NCCB 4PRNB 4GUPA 5HI4D 2YO3A 1WFMA 5JW5B 1NC2D 2X1XR 1Q9LB 3MRMA 2HVBA 4R0LB 3WLWC 3IFNH 5I1GH 5IM7A 3VGHA 1NBVH 1UQSA 2VJ8A 5K39B 2ZOLA 4I87A 4S1SL 4RWYL 1S7SB 2L8AA 4LK4A 3MBXH 4WHCA 2YAHA 2AI0L 1IE4A 1TT6A 1KT2A 2OMZB 3DX3A 3S2CA 1HQ4A 1A1OA 1C16B 3MLXH 1OM3L 4N1CA 4YDLB 5ICYA 5LJYH 1VACB 5I30L 4MWFB 1U93B 2PP9A 1KXQA 2Z31D 3QQNA 4IKNA 4H25B 5EA0H 5CNHA 3QFJE 4TM9A 1J11A 2VLRB 3SBRA 4ZFGH 2MPVA 2UWEE 5AOMA 3QCUL 1DVTA 4JMNA 1U8KA 4JRFA 4ZSOE 4H20H 4HIXH 1URZA 1S7UB 2XZCH 1FDLH 1L7TH 4Z7OE 1WF5A 2ESVB 1JNNH 2FBRA 3D18A 4LAQH 1W72L 1C9SA 5F72S 4P2RD 3TONA 3OHMB 2HVKB 4KK8C 4W9CC 5MEOA 4YWGH 1MWOA 1ZLUK 5KYNA 2QQKH 1KN2H 4G8AC 4BZ2H 2WLLA 5JOFB 4O02H 5A3IC 3G5ZB 4G11A 2BSBA 1JK9B 2C3GA 4CC0A 4YDLC 5T3ZH 2F54A 5JHLA 2ZP9A 4ABQA 3PYCA 4JDTL 4XVOA 5FOBB 4WI3A 3O6LH 3VXRA 5IW1B 2EYTB 2LVEA 2NY1D 2WC7A 4NRZB 3KWWA 2G9HA 5D4JA 5IGXH 1LP9E 1A4AA 3RWDB 4JANB 3BVVA 1MHHB 3IFPB 1UM5H 2NTFB 1INDH 1OAUL 1G5GA 2Q5BA 2QVFB 3CH1A 4FP8H 1BMGA 1EJ6A 2R0WL 4XMKH 3VD3A 3TO4B 3LSOA 4F57L 3NK3A 4U7SA 4HZLA 2ZD0A 3DMMB 3QI9B 1BW8A 3BKYH 4GPVA 3HG1E 3T2NL 3U6RB 2DL9A 2DQDH 2R39A 3K4DA 2QT6A 3PXHA 5DUPL 3NRFA 1XIWC 1UZ8B 4XNAA 3VFOB 2OZ4L 2BFGA 2IBZX 4FADA 1KPUB 5L2KE 5EUOA 4J1UB 5T1JA 4JFSA 4AYDC 3VQ1C 4HOZA 3VG9C 2WBJC 5I23A 5T5FL 1H8LA 4W9IC 3WN5C 2FAUA 2AKRA 4JFXA 2OSLA 2WQUA 2EDNA 1WSST 4RAHA 3T8XA 4PJDA 3FQRB 4NQCB 1NIEA 4AIEA 4KX8A 2CUHA 1JGUL 2O5XL 1BFOB 3VCLB 4UTAH 3TA3A 1PL3A 4G1EB 4Z3GA 1JMXA 1SBSL 1YN7A 2P5EE 1QPKA 2L7UA 3BT0A 5E1QA 1KPVA 5DA0B 1CXHA 1ZS8A 4M61A 4PV9A 1TETL 4QAWA 1TQCC 4MAYC 3V5DA 2UWEA 1UKQA 2IAMD 3U7YL 2UVEA 5I5MA 2YD9A 3O3EB 4PVMA 2BHUA 2D31A 4KRNA 2DIAA 4I48A 5E95B 2ZKYA 2XZQL 2QTVA 1OE2A 2P8PB 3BX7C 4PCYA 1E4HA 4WI0B 2ADJB 4WFED 2IH1A 3ARSA 1F90H 5GZNA 1TLMA 3PGCB 4J12A 6TAAA 1GY1A 4DKFH 2BO0A 3TIEB 5MEPA 1FHNA 5IROC 1D9KD 3M86A 2VN5A 3CFKA 5JDSA 5I9QB 4HK0A 4YC2C 5EBLB 3ULUF 4G7QB 2X4NA 2EZ0D 3MRKA 1RP8A 2IBBA 4LIQH 1GHFL 4NQCD 4X5WB 2WZPA 4NUQA 5KBNC 3X11A 4P5TD 4B6ZA 4KNUA 2CBQA 1SF5A 2DWSA 3I02B 5FF6B 1NC4A 1OSZA 2B77A 1YEKL 1C7SA 3O45B 3OX8A 5F6IC 1BLIA 1DDHB 3N1FC 4Z7IA 2VDOB 4MVBD 3KPRD 2BVOB 3DETD 1J5HA 3P69A 5D55A 5E1HB 1F8TH 3AB0B 3BKMH 3DUSA 3KPTA 1VCAA 4JY6A 4LB8A 2JNZA 3UAJA 2YPLA 2H26A 1XIWA 4JZNA 4P99A 2YPVA 4PBWD 5GRUH 5LGYA 4B41A 3DVNB 5FYJL 1KTLA 2FWOB 4O9HH 3KYMA 4L48A 2OW6A 4OV6F 1QWHA 1WHOA 5K1NA 4PJXF 3C6LD 1XO8A 2G2NA 2E86A 4HWZB 4WK0B 1BF2A 1F11B 3TN0C 5KYYA 1HYRC 1NIDA 2FHFA 3EO9L 4I0PB 3IXTA 3JTSB 2P1YA 2XG5A 4J4PC 4N8VA 3GDCA 1QEXA 3S3JA 3KPPB 1AQDA 3DX7A 4W9JC 5A6LA 3EZJB 4R4BA 4DAGH 1FHGA 4NCC1 3W5NA 4AUJA 3WFDH 4X42A 4G9FA 5JHDE 1TU2A 4J4PD 3MCLL 5AB0A 1DQVA 2Q3XA 2VN3A 4JDVB 3REVB 3UAJD 1JNHA 1YEEH 2O6DA 5KYXA 1K4DA 4CA4A 3D12B 5KVGL 1IKNC 2F53B 2ITDA 1P4LA 3K74B 3L3IB 2OSWA 3VQMA 3K2KA 5TK2A 4JDEA 3U48A 1E8XA 5DQJA 3II3A 4PHXA 1NQBA 4JKWA 3RJOA 1C12B 2TSBA 5F1IB 2C3HA 2VTFA 3LHPH 3DURA 2VW7A 4P57B 4XNXL 2ZKWA 3K8LA 1NCWL 4YSCA 4U2ZA 3QNZB 1NGQL 1HL5A 5I73C 1UM4L 4WLCA 4UQ3A 5IQ9A 5FO9B 2ZCZA 3PWJA 5DS8A 5A2FA 2HT2D 3OWEA 3VFNA 4K3DH 1TQTA 1X7TA 1YECL 2OM5A 1J87A 3QIWB 3V4UH 1J18A 3ULSB 1CT8A 4DP9X 1Q0XL 1T7WA 3CZUB 1JZ5A 1J9QA 3QUZC 1CR9H 2NQ3A 1WUNT 1Z5HA 2AK1L 3QXVA 1J0ZA 3CZNA 5GZOC 4A7GA 1J8HE 2X05A 1G7PB 1HHGA 4LAJH 4UIMB 1KEGH 1DVQA 1N3NA 3OJDB 1WWBX 3TTYA 2BSCA 5FM4A 1PFCA 3HNSL 3O3AA 3IE9A 4U1HB 2B1AH 4FULA 4Q0XH 4AMKL 5AOZA 1FPTH 3FTVA 1AD9A 1FZMB 3BN9D 3BUTA 2VR4A 1OPOA 3GUFA 3IDXL 5I0DA 1XZ0A 2YEQA 2BERA 2X09A 4R7VA 4ZO8A 2LV4A 2VR7A 1IEBA 1QATA 1FLTX 3VU2A 3W0WD 4WGKA 3VRLE 4CVXA 5GZND 3GXUB 3OR7B 5F1KC 3MLTB 3CFEA 5HYFA 3RKDC 5F6IB 3FDWA 4AYID 2VSCA 4JKKA 5KWYC 2A1WH 2V4LA 2EE9A 4M5YL 1BLNA 3NIFE 3NABL 3ARFA 4N6RB 3QZBA 4WU5B 3EBIA 3L5XH 3NFSH 1LO4H 2DN7A 1DBML 3DECA 4AYFA 3J8F7 2XIDA 4JFHD 3AREA 3DX4A 3IJ7A 2A74C 1OL0A 3PWPE 3TIDA 2GY7B 3II1A 4APXB 3CLEL 3AQZA 1MDAA 1MRCL 5JMOC 3WJLA 2XTLA 4X98A 5D1ZI 2FWLB 1MCQA 2ZAIA 1QQDA 5E56A 4BXSV 4Z7OF 1Q9KB 1VFMA 2LHAA 4QYOA 3NJIA 3F12A 3MC0A 4KMTH 3IFLL 4BCXA 3RTQC 3S37L 1M7UA 4Q9RL 4R2GB 5I9QC 2DH2A 1ORSB 1PMYA 2LU4A 3FO9A 4G8IB 1BXXA 5E5UB 3FO9B 4PTUA 4KJPD 1UUSA 2HSIA 5LBSA 2IPTL 1QFOA 5GJSH 4UNVA 3FZUD 3RZCA 2K3TA 1QRNA 3FOLB 2XRAL 3EYFA 2ZOTA 3MLZL 4XPTL 2YGNA 1KCBA 4LRNH 4K9EL 1KC5L 1RURL 4XE5B 3SDCB 3ZMNA 5C08E 4QY8A 4RAVB 3VXSA 2EYSB 4KTDL 4KK8D 5DJ2B 1SHXA 3TIDB 3EYSH 2HJLA 4OLZL 4B9IA 3ARWA 4HUVA 1MFAL 1U95A 4H4NA 5HHMD 4ZYKB 2DTSA 4I2XA 5ILTH 3IMVA 3QQXA 4Z7QF 2EDRA 2EIZB 1IGYA 1PLAA 4RMBA 4AGOA 4U6VL 4WU5A 4ESKA 1DSYA 3PRZA 4H26B 4F2MA 2R1XB 2WXMA 3ML8A 2HT4C 3IDGA 2J7LA 2YXWA 2D73A 1MCPL 1GYUA 3TBBA 2VCOA 2NY0D 2UXTA 3MAWA 4JPWL 5C6TL 3FU6A 4F91B 3BSHA 3T2NH 1PZSA 5TE4H 3TLRA 3B7SA 3J07A 4CVXB 4JKMA 3K71B 5EBWB 2Z0BA 5JIPA 1ETA1 1F4YH 5AVUB 2BXZA 3A6CH 3LN9A 3UMTA 2R15A 3RDTA 5EDXA 4PJ7E 1IBYA 4FJYA 3VXOA 2ITCA 3IAGC 2CHZA 2XN9A 4PGEA 4NSKB 4UF7C 1UD5A 2K1MA 2FQEA 3ETSA 1X4YA 1RU9H 4GLRI 4MCMA 1B6DA 3BRGC 4GG6E 4ADIA 3V4LA 3MLYL 4DKTA 2OMBA 2DM7A 3MN8A 1HHGB 2UX6A 4HIHA 4KZDL 3SY0B 5GS3A 4PLKC 4PMEA 5KVEL 1XX9C 4A7SA 1EXUA 4M7ZB 5T33L 5D7HA 1CXLA 3MXWH 5EOTA 2BHFA 3GXMA 4RCAA 3VGFA 4XCCH 1UH3A 3UL4A 5HD8D 5I71B 2EUZA 4P5TC 5DJYA 2BHZA 5FYLE 1QNIA 1I7RB 4KI1A 5DFTA 1FYTE 3ZR6A 4G7RB 2CGYA 1KCSH 2V3FA 1B3IA 2DQGH 4UIKH 4U1KA 2VQ1A 2FLMA 4N0RA 2LU3A 3HNTH 4NX0A 1LK3H 4JQXA 1JI2A 3BGAA 4LLVA 1TPXC 3LKNA 4LDEB 4R8WL 1PKQB 5EZIL 1BF8A 3SYOA 1QSFB 2NX5E 1FL5B 5EF0A 3BAIA 4IOFC 1JZFA 2Z91B 2NY5H 4K3EH 4GRMB 4L29B 3SGEI 3O6MH 4IBSA 5DUMH 1K4DB 3TZVD 5L2KA 3ARVA 1YA5A 1PAZA 2WQSA 1HI6A 4ZX4A 4PY7B 3Q8AA 4QRRE 4Z0XB 3D3VD 2WSPA 2G4GA 1W8OA 1HKLL 1O7DC 2YOAA 1NGZB 3BHBB 1RULH 3E6FB 1DCLA 2OJEA 3ULVD 3P3RA 4RIRA 2MJWA 1NGQH 2MKWA 4HA1A 1IQDB 1F56A 2XICA 4X7SH 4N20A 2ZXWB 5DVKA 4I0PA 2OZ4A 1PZ2A 2J4WL 3O9WB 1CL7I 5FV2A 4HWZA 1A6UH 2MCMA 1NKOA 1TQBC 4MDJB 1EMTH 1Y18B 2X70B 2FGZA 2XOTA 3DX6A 5HYJE 5MEND 5CILH 1HCYA 5D5ME 2WCGA 2DKSA 2H47C 3QIWC 3QJZA 3DVNA 2FJHB 3I6GA 5BZXA 3LV3A 4B27A 3QDHA 5DURD 1NMCB 2YPLB 3DIFA 2L4OA 1EGJA 4QXVA 4KXDA 3P3UA 3SDAB 1JIBA 5D7IB 1KNOA 2MNJB 5E1AA 3CSTA 5E1GA 4NP9A 1IKFL 5T3XD 4EIGB 4JVWA 1EZSA 4KUZH 4GKLA 1I9RH 1QBML 4GMSH 1OSZB 4WWKB 5IK3A 1GZQB 2ZKMX 2CDEB 2FX9H 4XMXA 2COVD 2Z35B 4LEXL 2CSPA 1SDAB 3ZE0B 3HCVB 1A7PL 1SUHA 3PWNA 1QYGH 4X5WA 3AMKA 2CO6A 4OSUH 4J3WA 5F9OH 1TEFA 3QXUA 1JXJA 4X5PA 2EIKB 5LQBL 2X40A 3IPFA 2QGEA 4OFVA 1JYNA 2DTMH 1CYXA 2ILLA 4APQB 1NLBH 1RZJC 2E4FA 1ZWIA 4CBPA 4QAMB 3PGCA 3ARTA 1ZLSL 3ILPB 5CJOL 4PJCE 4R3SA 2DQCL 4DESA 4PTTB 2CR3A 2W5PA 3HE6A 2WW8A 1GA2A 4OD2A 2JFCA 3HKZA 4JQVC 4P2RE 5D71L 1UKTA 5EWIL 2O5YL 4CU6A 4ZOCA 4BFIA 1ZS8B 2H1PL 3FQWA 3ZL4H 4NUJB 4OR1A 5I28A 5HP5A 1YN7B 3DGDA 4MDIB 4QOKD 1N6QL 3BT2H 4YDVA 4TKWA 3B7UX 4W9LC 2A9NH 1YNLH 1T2QH 2AJVL 1GAFL 2P80A 4PN6A 2XBDA 3IFOA 1WZ1H 3OMNB 2JIXA 1F3DH 1AXTH 5LGJB 1A6ZA 4U7MA 3FQRA 3BFWA 4ZW3A 1BOGA 1NCHA 1YUHB 3DYOA 1I7TB 3O0RL 5DJZB 4ZX3A 2BVEA 1HL4A 3E1F1 4L9LC 3US0A 3SGJA 2EDOA 4HHAA 2O26U 2PO6B 4S2SA 2IFFL 1KGCE 4NNPH 4XPAL 5EB9A 1MIEL 1D7DA 1KJ3L 3PQYD 4LSUH 5I8CB 3QNFA 25C8L 2JKLA 1K8DA 4QR7A 4HZLB 1V8HA 4XWOD 2L0DA 3WYRA 1BPVA 4RDQF 1FVDA 1AGFA 1K72A 2Z3FA 4OUUA 5L2KD 4N5ED 5DWUL 3MRCA 4X80H 3G6DH 2IH3A 2ZOOA 2CKBA 3MI6A 4UBDD 2PXYB 2P5EA 5DR5H 3VXRB 2ED8A 2VZVA 4UAOC 3DI3B 4LVEA 3WUWA 1W91A 4W9HC 2A4ZA 2PPDA 1ZDSA 3UGEA 4MJIE 4KZEH 2QPDB 1ZEAL 1P7BA 2SEBA 3M6DA 1JP5A 2KZ1B 3AXLA 1NEZG 3X13B 1WTGT 1NDMA 4GFTB 4DFIA 3WS6C 3L4VA 2ZUSA 2D7MA 5B39A 4PB0L 3HNVH 4GIOA 4QXGL 3MGTA 1OARL 3WKML 4LASH 2HVKA 3KLAA 2A83B 4PJ7F 2HB0A 2VR9A 5EEVA 3DJTA 4NWTL 4LLWA 3RGVA 1S7UA 4GBXB 1IC7L 4BJLA 2YC1B 1IAIL 1ILUA 4QRBA 5SV4A 4YSDA 4KXZH 2ENYA 3C5ZC 4NO3B 4LSTL 3QFJD 4F92B 2Z93A 3TS8A 1AAJA 2FQDA 4NQTA 2BJMH 1FZJA 2FIRT 2YK1L 3FT9A 4ODUA 4QTFA 4RAUA 4XMPL 2DM3A 2C8NA 4JZJB 3OKOB 5FUOL 3QZMA 2BW4A 2CCLA 3BH8B 3VACA 5ICYB 1JYXA 1XFPA 3SGEH 3LKQB 3THMH 1HQ4B 2PN5A 3EADA 5M7QA 1R34A 2BSTA 1GOGA 2E74C 2ARWA 3CX2A 3E1ZA 1S7SA 3O8XC 5CJ8A 1D6EA 1UQSB 4AV4A 2AJ3A 2CBMA 3HI1B 5CEZL 1ITBB 8CGTA 5IHUH 3GK8H 1TJIL 1AS8A 4PJXE 3QRBA 4BSVA 4Y2DA 3A67H 2HX7A 1R5VB 1YYLL 3LZFL 4GUPB 4PRNA 3AY2A 2ZXQA 5B3SB 1FJ1A 4IRJA 3MV8A 4LSSH 3QCUH 2V7HA 1DR9A 3BMVA 3RUGE 5C97A 2P7TA 5J7CC 2JB5L 1MPAL 4IKJA 4LGSB 2FGWH 3D2UA 2IMNA 1IGTA 5I0XA 1R3HB 4I88A 3VD0A 1VFOA 3O11B 3R19A 3HAEG 1I3RA 5E6ID 2W9EL 4EI5A 5HYSB 1NPJA 1PZ5A 3CGTA 4OFPA 2DJUA 3CSFA 3NZHL 3U9WA 3T2QA 1HKLH 1QHQA 3MJWA 1OD7A 3OKDA 3OXRA 4N8UA 1UEMA 1MHPH 4P5SA 3GINA 2K45A 5B21A 1ZGLB 1CVRA 2HT4D 3LPOA 3MV7A 2N3JA 2GK0A 3PDOB 1KB3A 5AUMB 2Q10A 4LCWB 3WNPA 1XF2B 4DOHB 1LHZA 1YMME 4N87A 1ZVHA 4R26L 4HS8L 2WM0A 1VPOH 4FC3E 3DPBA 2B59B 3DX2A 4MGXA 2GK2A 3ARBB 5DRNB 2PW1B 3Q06A 3ZTJG 3IN0A 5EZOH 4CSSA 3RDJA 5I1DA 2Y69B 4CMMB 4FFZA 1F4WL 4P2RB 4P5KA 4F58L 4ODWB 3ULVL 2HPOA 4FNQA 1MWAB 3QHFL 4OGAC 2WHVA 5F96H 1IBBA 3CDZB 2ICCA 3ARUA 3NT0A 5C0FA 1U21A 2NY4D 3I3BA 1KEGL 4Z8FL 1F4XH 4X6BA 1BCIA 3NFPA 4MMXA 4QF1B 3KDMA 5EEYA 4XGZB 2JIXD 2QMKA 3BAEH 2I69A 1JK8B 4GSXA 4L1HA 5I1JH 4OQTL 4W68A 4EKXA 4L8BB 3TH4T 1RXLA 5B8CC 2YBRA 1WIUA 2YD5A 3QH3B 3QG7H 4OTXH 3I9GL 2E7DA 5AYQA 4DVBA 1DO6A 5DVOA 1DLHA 2DRUA 3MRBA 1J0JA 4PSPA 3KPRB 3BIBX 5F9JA 4ADGA 3NJJA 1SYVB 5BS0A 5ABDE 1VADA 2XT1B 4IGBA 1UWYA 3U2IA 1TTGA 5BZWA 1ZANL 2R0KL 4GKOA 3TASA 3ELQA 1U92B 4QDGA 2ZSWA 5EU4A 1J9CT 1RIHH 3QDGA 2CPUA 1HZLA 4H1LH 5CMAB 5I71C 4Y16B 1M9WA 1NFDA 1N9PA 1IUZA 4JZJC 2APSA 1VEOA 3SZKC 3ZDXF 5CGMA 4NZ8A 3H9SB 2OL3B 3HR5B 4ZMTA 1UG9A 4QXTA 3QEUA 3VXME 3L4UA 4HF5L 2BK8A 1SOQA 1MSPA 5I2IA 1T66D 3AWFA 1TQSA 4R83A 1ZRUA 2WQRA 4H8UA 4Y4FD 5I19H 3BPCA 1B2YA 1PD6A 1EBAA 3VO0A 3VVVA 3DC0A 5JPNC 1HSBB 5KSAD 2CJTA 5AAMC 5I1LB 4RMVA 4NC0B 5I74B 3CXHK 4HJIA 3HG0A 3FRPG 1G1KA 4IRZH 2D7OA 5TQ2L 2V5SA 43C9A 2WO3B 2AK4B 3V6OE 3MLPA 4BH8A 3CXFA 3C5JB 2DQFA 3Q2LA 3U30B 3MOAL 4MX7B 2IPTH 1MCCA 1UOLA 4FGMA 5TFSH 1CE1H 5C07D 1NCOA 1XH3A 3BN9C 4JW3A 2W0LA 2IFFH 4WHTA 4XBGB 5CLWA 1WCBA 4TN9A 3EJZD 2XRAH 1YNTF 2E0PA 4FFTA 2QLVB 3U9UA 3P9LA 2VDQH 4KXAA 2DWTA 4NFBA 4IOFD 3JUYA 3OKMB 4LBEA 2BZDA 1M1XB 1NBQA 4B9KC 5JPNB 3P3YA 4X9YA 2BSSB 3FONB 4L3CA 4QLWA 1DVFC 1TTCA 4HD5A 1TNNA 1E5UI 5B7EA 4FN0A 1IKOP 3HN3A 2NW3A 4ZMOA 3AS1A 4HBCH 4EI5D 2C9SA 4HAKA 2K78A 1UYWH 4MZIA 4NM8L 5F9AC 5BW7C 4BUHA 5CJ5A 2J56A 3WNMA 4EBQL 4M6OH 4K23H 5F7UA 2QQLL 3MV8E 3OM3B 1A7NL 2PWFA 3NYKA 2R0LH 5L7XL 3CIQA 4KJWD 4ODHH 5CR1A 1G9NH 4XN4A 5IMLA 4MKMA 1I1FA 4OJCA 2GJ6D 1AXSB 4PJGE 4FABH 3MNZB 4N9GA 3FOMB 4PFEA 4Y2OA 1R33A 3FUIA 4EKJA 1ZHNB 1G1YA 1FYTA 4IRSA 5CIPB 4X50A 5EU6B 1I82A 1UXLA 3ELAT 3RRQA 1GCFA 4P2QE 3QGVA 5FDWB 4P5MB 4MA8L 1NFDE 1W8EA 1S78C 4OCMC 4YHYB 3L2NA 4NWTH 1ED3A 3L7EA 3BGMB 4P2OD 1QBMH 5MHSE 3ARDB 4OM0H 1A7OH 3Q6FA 4IDLA 3QYNA 3AQXA 1XDTT 5GSRB 2WTRA 4IU2B 4JRLA 3E80A 1OF2A 5IY5B 4FHBD 2LABA 1MCOL 5GGQL 5TDNA 1D5MB 4YDNA 5ESQB 2NYYC 2H8PB 1SM3L 4N2DA 3V4VH 3V4PL 5I6OA 4FFVC 3UPCA 1AOHA 1BQ5A 1TZIB 4OFDA 4WNQA 4WV1C 5D6CA 1S5IH 1TTFA 4MNQD 4OZFA 2F8OA 4XN1A 4NZUL 4RGOH 3DDFA 1GOFA 3RHWF 4NIKB 2PYFA 3N6YA 3BWAB 5DUPH 3P0GB 2GI0A 1XF3A 1WS7A 1ZA6B 3FF7A 5DK0A 2D0HA 2YPVL 5EHFA 2ZUYA 1MFMA 1WITA 3GHBL 4YK4B 5D5MA 3W2DH 4APQC 3FH7A 3GI8L 1B4TA 5KEZA 1ZVYA 3CMOL 4JFOA 4WEMB 1GJUA 4Q56A 2D3LA 5C0EB 2R2BA 1CD1A 4ZO6A 3OAZH 4JZOB 3VFGL 1RK1A 4ZMAT 1KN2L 4FKHA 1LEIB 3KR3H 3PNWB 2R83A 2BRRH 4Y5XC 3K6SB 4UTBL 4N25A 3H54A 1OCWL 3MRRA 4POZC 3A22A 1G7LA 1MRFH 3EO9H 3DV6A 4OZGB 5CN1A 3OLDA 3VGEA 4G82A 3O6LL 1U8CA 3B83A 3B2UD 5CEZD 1Z7JA 1W0WA 2BWIA 4LDLB 3QDJE 5E4IA 2CO2A 2D7QA 2QL1A 3HN8A 4FLQA 4ZTOH 1CTNA 4JM2B 4J39A 2GVYA 3MCLH 4GO6B 3HI5L 3WEBA 2RFXB 2ZXGA 1ZV9A 2X6CA 3ZE1E 3FJTA 4JFFE 3VNYA 2EUVA 5DT1H 5AYUH 1LDSA 2F7RA 4ZAKD 3T0EA 4CNIA 4R96A 4AI7A 3DX8A 2MWCA 5E2TH 2F7OA 2LLLA 2YMXL 1TITA 3ZKND 3ARDC 4URKA 5C09A 1A1MB 1KB5L 5EOQL 3O2VH 2NW2A 4B7IA 4RISL 3M7OA 4DFHA 1BVLA 4PJ9A 1NUGA 5A16B 1JN6B 5HHME 5E2UL 3RKDD 3FQNB 1QLEH 3U2JA 3VVWA 4HCFA 5IB2A 1NCDL 2OULB 3LN5A 1GS6X 3ZMRA 5I5IA 2JXMA 2X41A 1LE5A 3K2UH 3CUPB 5HYJD 5MENE 3APMA 2HWZH 3EYQD 4AJVA 2C34A 3UTSB 4NGHH 2CNZA 3L3GA 3NJHA 3O0LA 2QR0A 1NOLA 1WAEA 3RVVD 1W9XA 4WW1B 5MHSD 2V9RA 1OP3H 2H1LM 3EO0B 2EDWA 1XF1A 4MA1C 3B7RL 4YHIA 2W0PA 1IM3D 4G7SB 4AL8H 1LP9F 5AQ0A 1RZGA 4NQED 4XP9H 1VAHA 4NC1E 1RSYA 5D1QD 4TTDD 5BRZA 3RIFF 1IAIH 1IGML 1S2EA 4L37B 4MS8C 3U7YH 2OX5A 3NG5A 4XNQA 3BVTA 2Q2EB 1LO2L 2BJML 4Z9KB 1G7JB 4OV5B 2Z4QA 2J1WA 3GJFB 2KT6A 1G6RB 1AVAA 3CSPA 5DJAA 3FUEA 2FHCA 4HJJL 4CILA 1T2XA 1VZHA 5CU5A 1HEZA 2J55A 1GYVA 2Y7MA 3AZUA 4JO3L 3V4VA 1UOVA 1YNKH 3FN3A 1QLRA 3AGWA 4QRAA 1CWVA 4LL1A 4F7CA 3WAJA 4M00A 2UZYA 1E6OL 2CA3A 3ZRFC 2DWXA 1XGTA 4IRZL 3ETBF 1KGIA 5TQ2H 2XQBH 1MF2L 4FERA 4EZJA 1TQCB 4NENA 3P4MB 1ASPA 1INEL 1M7IB 4HIQA 4W9FC 1IAMA 3S8WA 1A9VA 5D2NB 5I15H 4TUJA 2FYVA 1OP5K 1G9EA 2ZX5A 2VT0A 1SJVA 2VAAA 2ZNXA 3E38A 2D03L 5GRVK 5LGKA 1FL3B 2PO6D 4TVUA 3TBWA 1AZBA 2DL2A 4LLYB 1MEXH 3E8UL 2VN4A 2B14A 3NCJL 3TH3T 1YMMB 1X6NA 1AI1H 4LQFH 5K33A 3B5GA 1QBLL 3VXMB 2GUOA 1WFIA 4HCGA 5T8IA 3W82A 4CU8A 4FA7B 1OCCB 3N55A 4X5LA 1JGDB 1DVFB 2ATKB 2EH7H 3CZFA 1OWWA 3BLPX 2FNBA 5E1IA 2NR6A 4RMUA 2OI9C 5AW3B 2BNUB 5FAAA 3VFVB 4HWEH 2ADFH 1CMOA 4YVNA 2AVFA 2QQLH 5KZCD 2MMXA 3FRUB 3QA3B 3KAAA 3CVBA 2GJ6B 3VQ2C 2CLZA 2QDVA 5DYFA 2C1OB 2EABA 4KFZC 1R24A 4JRXB 5JW4M 3QP3A 5EZIH 1UWGH 2EACA 1S7VB 3SKMA 3HAEB 1DJSA 1D5IH 3ECQA 5GQBA 3DV4A 3QRLA 1LLAA 4KKAC 4NLAA 5B4MD 3WJMB 4POYA 3ALXA 4XPBL 1UXWA 4TNWF 4PJ8D 1ETB1 1XB6A 2I60L 1E90A 2IGTA 4KKCC 3OAZK 4PGDB 3I6SA 2R1WA 5HBBA 3M7FB 1NAMB 2VMEA 2ZZUT 4AENA 3EZ8A 1CGUA 4GXUN 2R4SL 4OZIA 4PBDA 1UASA 1MQ8A 4ZT1A 2Z6FA 2ITEA 3DYMA 3L3OA 3QXDA 3UACA 1ES0B 4NO0A 4Z7OB 1HL9A 3B43A 4FTVA 5FCSH 1CD8A 3VX1A 4L4TB 5AAWC 2R1YB 2Y5TA 3QO0B 1CLZL 1URLA 1YEJL 1Z9SA 2EDKA 3C5SA 1P4IH 3L13A 4JFFA 3OKLA 5IROD 2X4QA 4HJ0D 3VFSB 4B9CA 4E9WA 5BVJA 6PCYA 4NBYB 3OKKB 3SYPA 4YHNB 3G08B 1JGVH 2VDOL 4YPGB 1QNZL 4LHQB 3E3QE 1RY7B 3SDYH 3VDBA 3ILEA 1KJ2B 1ZLVK 3MRFA 1GS8A 1SOSA 4PRDA 1ZSHA 1BAFL 3KHOA 2AJUH 3JWNC 4RGOL 3FU7B 4G1MA 3LKPA 1JZ8A 4KMQA 1QWUA 5EV7A 4HD9A 4WDIA 2VL5A 4D9RD 5LNGA 4MAYD 2JKIS 4M3JA 1XAUA 4Y2DC 1QO3A 1E28B 3UC2A 1BM3L 1Z3GL 3SHSA 2OMVB 4XVUC 1FN4B 1AR1B 2AV1A 5CHNA 2QKSA 3BVNA 2NY3D 1X4ZA 4JGNA 4YUEH 1WPCA 4I1PA 2P45B 2EDXA 2JKJA 5MP6L 1LYQA 2AZUA 3FB7A 4CGUB 5BUPA 5GJSL 1CL7L 3I50H 3OMZA 4Z7QB 3UROR 3FFOA 1UURA 4C4UA 4J3OD 4YBQC 5FXCH 5KG9A 4TXVB 3MRJB 3DO7B 3A4EA 4O2FA 4B7LA 2BNRB 3E2HC 1HYSC 1NEZB 2NMSA 5K69A 5SX4H 3WN5A 3QFDA 5JPMB 4F8NA 1Z0MA 3SKOA 3MLRL 4QRTA 1N59A 1DFBH 4KKNA 3VXUE 3X17A 3WBDA 5ID1B 1DQDH 4QRSA 5EC1B 2ZUQB 3MPCA 1U8IA 1I1AD 1NCIA 1PG7X 2MOVA 4FFZH 3BVWA 5FM8A 1QAWA 2HCZX 5J11C 3QUXA 2YLHA 2EJ1A 2GIYA 4AGPA 1KLFA 1L3NA 2V7NA 3DX9A 1XTLA 4OGQC 5IV2A 5GHWH 3CQPA 2H32A 5EIIB 5JLZB 4CAGA 3GSQB 3TO2B 5DUML 1C5BH 2A9NL 2DD8H 4GKZB 4NN6C 1JXFA 2NZ1A 3BGFC 1CZ8L 1W72A 2WXJA 3DUUB 2YKLH 1ZSDA 3R7RA 2BY3A 5DHXB 2A6JA 3OJVC 1YMMD 3R06A 4F8LA 5KVGH 2LFGA 4LHUA 3O41B 5C08D 2DJSA 5JORA 1QO3B 4LCCA 3MCG1 5EZJA 3VWKC 3VI3A 4I18C 1FG2A 2A4EA 1ZV2A 2IDFA 3PAYA 5CP7A 5E5MB 5E7BA 1T1ZB 1WJ3A 3A3YB 3Q43A 1KIPA 2DWYA 4O58H 5F44A 3T4YB 2EDLA 2EDJA 2VRKA 1KJ2A 1KDIA 1LILA 3PP3K 1F02I 1UZ6F 3T4AB 4F9PC 4YHNA 4BM7A 2BVTA 3FHQA 3GS7A 2R8SL 1JZEA 3HFMH 5BVJB 2X4RB 2WNWA 4HETA 4UB0H 2FSEA 2K0RA 3FK3A 5EU3A 1AE6L 3N43F 4K94H 5GGUA 2R1YA 1FO0L 3QO0A 4OIAA 3BRFA 3RTLA 5E08H 4HH8A 3SDAD 2NXYB 1ES0A 1GPOL 5B3NA 5INCA 1F6LL 4XCCL 3O2DL 5D5MF 1KYFA 3FCGA 5FCUH 3D85B 4TQ8A 1I4FB 3IMUA 1OCOB 4XE0A 3Q3GB 4OZIB 3ZO9A 4PSRA 3V0GA 1RZKC 4MMZA 2YGOA 3Q0HA 3QQ3B 4HC1L 4JDZB 1KXTA 1JPGA 2WIIB 3WLWD 4LPYA 2RALA 3U2SA 4A37A 3QIUA 2YGQA 5IT2L 4A7UA 3UEQA 4DN4H 2AANA 3SBQA 3C09B 5ABZA 2AQRA 5E6IB 4RFNB 1QUPA 4IGBD 5D1XE 4X8JB 2ZOKA 4ZUWA 3NIGF 3N1PC 5DUBB 3IYLW 3BUYA 3TBYA 1P5VB 1YEFH 1MCWM 1EAPB 2BVPB 4YL9A 1A6VH 2IWEA 5HGDB 4PRHD 3F8UB 1DVFA 2PWGA 5IB1A 1U2CA 3C08H 3G04A 5A7BA 1G6RH 4S1RH 4XVUD 4EAEA 3HS0C 2DQJH 2GUOB 1TTBA 5CXPA 4TVPD 2GUYA 3W39B 2YR3A 2Y2WA 3IBOA 1AS7A 3TWYA 2X6VA 4FYRA 4LLYA 3TZVC 43CAB 1ZTXH 3OPZL 1RHHB 1EEQA 2X6UA 3LQMA 2B1OA 3NIDF 3GBLA 5C7XH 1S7XA 1V7MH 1IEHA 1H15B 4BRJA 1SMAA 2N4IA 3F7KA 2F19H 5T5NF 5IMOA 3ESPA 3QW9A 5IF0B 2PR9A 3HI5H 4M9OA 4NENB 2NXYC 3EF7A 1MY7A 5JW4Q 4WKXA 1H8OA 4GKNB 2F58H 4JFED 2Z4TA 4J8RB 1RJZA 2O5ZH 3D48R 3L5HA 1I1RA 3NA4A 1GGBH 4HK3N 1AR2A 2YXMA 4AG4L 3VXRE 1EZVY 3C6LA 1A66A 1DJZA 1OV8A 2D4FA 2FO1A 2QHRL 1IZJA 3GIVA 1EH9A 5JMRA 3GGWB 2V2XB 3EH2A 3D2UD 3LZLA 3KPQA 2AQSA 3GEFA 1WC7A 3NCWA 3PJNA 1OAUH 3Q2VA 1P4IL 1QSVA 4JY5L 3ZTDC 4HT1H 4L5FE 4ODVH 2PABA 3VM7A 1CLVA 5CZXD 4KDWA 1QPPA 2Z34A 2AI0H 3EFFB 3UPRA 3QWQB 4P9HL 1IMHC 2V3EA 4U0RC 5D7JA 3IRZA 2P28B 2YD1A 4FQXD 3RWEB 1ACYH 2DPKA 4WW1A 3L3HB 4KNSA 4N8CL 1OWRM 1MVYA 2QR0B 5D71H 2CRIA 4HUXA 3OR6A 4BZ1A 3NP3A 4PJBF 1NMAL 3RILA 1GS7A 2X87A 5J6SA 1WHPA 2XYCA 1MRDH 3CFBA 3Q48A 4ZS6C 1NJ9B 4W4OC 4QUOA 5KVDE 2H3XC 1W16A 4ZO7A 1UD3A 3S3CB 4Z7WB 1ND0A 1W72H 1WD8A 2VLJD 2YKKA 3GEWB 2Y7QB 3PL6C 4DH2A 1SN5A 4LBAA 1BBJA 3DX8B 3LZOA 2EDQA 4G71B 4CNIB 5EO1B 4AYBA 3FCUB 4J7RA 3SQBA 3TJEL 4OCXL 2BSEA 4I7ZC 1P5UA 2E9BA 1A21A 2B1HL 4PJBB 4I5BA 4J3OG 5IFJB 1F97A 3VB8A 2XVLA 4ONGH 4JM2A 6CGTA 4QCIA 5BOZG 3GSUB 1M3IA 2NSMA 3B3BA 1O6SB 2FD6L 2J8UB 3CN1A 4WKZA 1X7SA 2XJLA 5T33H 3EDDA 3MSPA 5I6NA 1AC6A 2O6PA 1U8CB 5A2IH 3OF6D 4OZGA 3DV6B 3U7AA 1KIQB 4JJHA 1N0LA 2LAAA 1G7LB 3SE8L 2ATPB 3IJEA 1NAKH 2YFOA 1LEKB 3JWDL 1OHZA 1U3HB 2VZOA 3PNWA 1GYWA 5H4ZA 1A9BA 1XCWA 3B1TA 5IEKB 3ULUC 5HHPB 2G3XA 4UM8B 5DR5L 5DVNA 3T3PB 2R2CA 3FUJA 1NCGA 1PZCA 4GW4B 4JZOA 2OZ4H 5ISZD 2QGBA 3RUGF 4F20A 4KTYA 3LHAA 3FAWA 5CEZE 2X10A 1AQ8A 4A6YH 5DSCB 3V0HA 4BKLA 4LCYB 4PB9L 3T6XA 1ZA6A 5C0AD 3ZKXC 1TSRA 3D0VB 5DXWA 5C0GB 3OWRA 4G3YH 3PHQA 5DEJA 3VDAA 2DQTH 4JFEB 4XBPA 5FYJU 4OZ4B 1DQMH 5GRUL 4B9JA 1JF6A 1KJ3H 2ICEC 1ROWA 1ANUA 3QQ4A 3FFCD 3KWVA 4BFBD 5FECA 1EHLL 1ZHBB 4OCYH 3V0EA 4LP8A 1S5HB 1UZ6E 3U30C 4JUTA 4MAYB 4NUMA 3KYNA 3DSFL 1HXMA 3IDJB 2H8PA 5ESQA 3U0TA 2DLIA 3UIYA 2GTZB 2VDPH 1OB0A 5HHNB 1JGEB 5AEAA 4K94L 4BHUA 3PGFL 3V52H 8FABA 1YPZE 4N90D 4TNWK 4KKPA 3UADA 2GJPA 4UT6L 3WO4B 1Z32X 3GM8A 5DMKA 3IMBA 5LXGH 2Q87A 3VRJA 5IQNA 4BSJA 5FO8B 4ONFL 1HU8A 2EADA 4N86A 5BNXD 2NXZC 4FQ1H 1XGUA 1XF4B 1J10A 1MPAH 1GGUA 1IZKA 1LGVA 5IJDC 4MQSB 3K7UA 5DUJA 5GS0C 3O4LD 1OAXL 3G6JE 3L1OL 3SODB 2Q8AL 3D0AA 2IALB 3CXHJ 1PJWA 3BAYA 1K5WA 1NC2A 3UYPA 2NY7L 1S9WB 1X5JA 4RDBA 4LLQA 2CDGB 3B3IB 2F5BL 5IQOA 3QUZD 5I1IH 1SN2A 1KGWA 1HHJA 3AWEA 3D0LA 5CLXA 4FG4A 3NIGB 3CVHB 2GIXA 4DPRA 2ICWJ 4XZ4A 5F3HA 4HIJB 4B5EA 5HHOB 1JCKA 2EIJB 1BD2E 5HHOA 1NCBH 1ZLVH 4OU3A 4Y1AA 2ED7A 4YE4L 3QZNA 5F3HB 3CVHA 3M46A 3E6HA 3JYBA 4XX1G 5E6UB 2ZTBA 1RQ5A 1QTYT 3RWJA 3S88L 2D7TL 3CN4A 4QNPF 2CD0A 4R90L 2EDHA 1MCBA 2CDGA 3B3IA 2HFTA 3I2CL 4S11A 4OF0A 4L3CB 1VZGA 4FTDA 5KYUB 1SEBA 2DY2A 3DOHA 4A55A 1G7QB 1I31A 3PP4H 5E24E 4MSWB 3VMOA 1AYRA 3CFCL 4PV8B 3MXVL 4X99A 4B53A 3OKMA 4LBEB 2K4WA 3JWDC 1CGSL 3HE7A 1R3JA 2EE2A 2IH8A 3CC1A 4OCLC 2L3BA 2XI9A 3B9AA 3OB8A 4ELMA 1VFAA 5IFAH 2BIMA 3D85D 3IPEA 5AKVA 1PCXA 5FFLA 4MA1B 4BZYA 1UB6A 4RZCB 3UO8B 3V6FB 4DGYL 4BDVA 2BP8B 3MA9L 1ZMYA 5IREA 4UTAL 4PJAE 4U1SB 4YHMH 4AW7A 2X12A 1EVTC 1KXHA 4NXSA 4R7DB 1CFNB 2X4TA 2ZG1A 5D7LB 5DO2C 2GTZA 1KXVC 4XC3H 4HUMB 3Q9QA 3WELA 1JV5A 5EEWA 4TPRH 1HXMB 2CU9A 3T09A 4K7PY 1DQIA 1GVIA 1U3JA 4MAYA 4MCZB 4PR5B 3MA7B 2L7JA 4MD5A 4DCQA 2XVBA 3RIFK 1C8PA 1ZHBA 1A9EB 1CYGA 3GB7B 1FC1A 4KPHH 4PJDE 3WD5L 2ICWI 3CBJB 1QSZA 1YDPA 4G70B 2YD8A 5I2IB 1FCGA 3CN0A 4K23L 4NQDD 5CGTA 5GGVY 4E0RA 4J5VA 1CLZH 1F90L 1L9QA 3BO8B 3TGXA 1YAZA 3QEUB 4JFVA 3CIAA 1RZKH 3HB3D 1NBYA 2DIBA 4B96A 2R2HA 5KANG 2ZPKH 1FH2A 1G6RL 1F2XK 4E9VA 4GSQA 4ZTOL 2F0CA 4BFJA 4DETA 4F58H 2CHXA 4LP4A 1ZGLP 4FNPA 3KH4A 2VXSL 4V11A 4GW4A 1ONQA 3LRKA 3GMLA 5L88L 4GQQA 5IP4A 2WXGA 2YARA 5DHVA 2B3IA 2FT8A 3LXAA 2OMWA 5E9DD 4ZFGL 4LFHD 4MQXD 5GPRA 3MRBB 3POHA 1U3HA 4WK2B 2H7WA 4OCRH 3RY6C 3EOAA 1S3RA 1CU4L 2O72A 5GS1B 5AZEH 1MUJA 2BNQE 3TPUA 1QASA 4EE2A 3KBPA 4FXKA 5KSAA 4P2OB 3V6BR 1F8TL 3BKML 5KBLA 3RL2A 1EBPA 3GMMB 4F7KA 1LD9A 2QQQA 2WYIA 5KJ7E 2XX0A 3RUGA 4JRYB 1ZPLA 5KN5A 3EH5B 2QLYA 3WKYA 2ORBH 3N0AA 4LQ1A 4M3HA 4OD3L 1HAUA 2WMPA 4Y4KD 5D7IF 1UATA 3CVDA 3NSXA 1U91A 1IM9B 2B59A 3DPBB 3ZKMD 3WHXB 2HRGA 1KENH 4XAKE 1DZBA 2OMUA 2WQWA 2WZ5A 3CU7A 5IB4A 1G9MC 3VRIA 5FUZH 1ZGLA 4XNUH 3TBTB 1NL0L 5IIEA 4BZ1H 1H0DB 4EN3C 1SHSA 3OKDB 3OXRB 3MBWB 3LKOB 3EGDB 4H1LA 3CFBB 3V0WH 4PREA 5L9DH 2VW4A 1D7BA 5DQDL 3UZVA 3A6CL 2MHAA 3QJVB 5E8EA 1JPFB 5TDOB 3O11A 1JZJA 1KYAA 1UWFA 2N59A 5C07E 2DQUL 3FBKA 1H6UA 2PTUA 5G2NA 1RCYA 2WLIB 1D7FA 2WBKA 3OLIA 2Z65C 5C0AB 4WSGA 2GSIB 2WIMA 2ZAHA 1ZHKA 1FV1B 4HGMA 1RJLB 1UXSA 3FTXA 4WI5A 1R5VA 1CFTA 2VDMB 2BSED 4OM0L 4B97A 3ECVA 1JVLA 2VRAA 4DWHA 3W9DA 4U1NB 4BWWA 1RAMA 3ULUD 3SE4A 2K9UA 4AVKA 1RIUL 1RUKH 4E68A 3W0WB 1X44A 4UOQA 3EO1B 2XWDA 5DD0H 1DFXA 2JQMA 3ASWA 1AO7E 5JUEH 1BX2A 4LGPB 2FD6H 1MCWW 3IJ8A 5HI5D 4KJPC 3OGOE 3BH8A 4KVNH 2CK2A 2CBTA 3OKOA 4J3BA 2GSGA 5TF1H 5A3ID 1BZEA 4L1LA 5JHLL 1N6VA 4HEPA 1QBBA 2IANA 3EFDL 5CD5D 2VXTH 4A7VA 1WBZA 2R0ZL 2WLJA 3PFQA 4Y16D 2D7PA 1H15A 3C8KB 1E9OB 3HG3A 4M93B 5E2WH 3FPXA 4ODVL 4K3EL 4NAQA 1RHHA 2P47B 1XD0A 1OAKH 3MO1B 1M2VA 3WDHA 2NQCA 3FO0L 5J5EA 1AGDB 1WT5A 1ACYL 3MRHA 1X5KA 2AJXH 5F7DA 3JT2A 4EEEA 2P5WB 5L8LB 4PJ5B 4RRPM 5FGBA 3CHRA 3MBEC 1BVNT 4KXBA 1OAJA 4CL7A 4UOW1 3SBWC 4G6AD 3LOWA 4M6NH 4YFDB 5I16A 4U6HB 4IRJC 3R0MA 2HFEB 3QJFA 1IGMH 3IAQA 3ORJA 4Y8AA 4KBPA 1WUZA 1J0YA 3NCFB 1AGCA 3PWLB 4OT1L 4AMXA 3WUWB 3VW3L 4M3KB 4FDWA 1J1OL 1GZPA 3UYRH 2W65B 5GGRB 4A2EA 2J2ZB 4L8CA 1FCCA 2JJUA 2QZQA 1UTDA 3KXFE 4FQJH 1DVUA 1UC6A 3ZKNC 2JCCA 3RKPA 4EVNB 1UWEL 3QUYA 5I8KH 3L45A 1YPZF 4I3SL 2PPFA 4DPBX 3ZQWA 5BJTA 5L0QC 3BMWA 4W93A 2F1AA 3HJEA 2AQNA 5I6XC 5PCYA 4XI5C 3I3EA 2XIBA 2ZT9C 3HI6L 3NSCA 1Z0NA 1LNUA 2DBLH 2FZ3A 2LVCA 5D96B 1UCBH 3EOTL 1GGCH 3QQ3A 4JDZA 1B9ZA 4DAGL 2FLBT 5T1LB 3BYYA 1J1XL 4X8XA 4UDTA 4JHAH 4OLWH 4I3RH 3ZSSA 3LB6D 5GRJL 4TUOB 3RJDA 3VYNA 1X5GA 4KI5C 3COOA 4WNJA 5MI0B 4HWBL 4Z7AA 2A9MH 3O9WC 4WFFE 3LMJL 3HA0A 1FNSH 2EUWA 5GGUB 1CE6B 1FE8H 1IM9D 4PJGA 2YA0A 4P2CG 3OB0H 2AGJL 4YH6A 1QFWL 2AABH 3WLBB 5TD4A 3MZTA 3LD8B 4YDVB 5JXEA 3KR3L 4EZMA 3OPUA 1MI5A 4GAJL 2UY7A 3S3PA 4P04A 2YQGA 2DI9A 3U0WL 3EG9B 3V7MA 1TKWA 1N26A 1T1ZA 4BFIB 4MNHA 3SQOL 4AVIA 3UCRA 1OGPA 1FG2B 3NGBC 4JFFD 2EC9U 1RPQA 1WT5C 2R56L 5AFAA 5C2UB 2CK0H 4R7NB 1A1NA 3FTZA 3OZ9L 1AR1D 4P06A 4OZHA 1QSED 4YGVA 3CHOA 2V8MA 3OV6A 3JXAA 4HXBH 3ILPA 3SBWA 1CDGA 4ERSH 3BUBA 5TPWH 1ZWIB 1WEJL 1ZSDB 2F5AL 1JHTB 3T0DA 3RVWC 3GSXA 3VGGA 2B4CC 2IAMA 4OF7A 3CK0L 3GXPA 3H9SD 1EFXD 4U1MA 5LKNA 5KSBB 5DZLA 2AJYL 4F7PB 2KH2B 4ELKB 3DRQB 1OTTD 5JO5A 5AW9B 1T4KB 4W6WB 4S1DC 5GRZA 4OZGE 1KLFB 5C0RL 3QDMB 3LKSB 3QFJB 4JO3H 4HSAC 1A4KB 4PRHA 2J8OA 4TRPL 5KOMC 4ZUUA 5E4EC 5EC1A 5T3XL 4KK5D 1MAJA 2VWEC 2BVUA 2PETA 4FA8A 1IB5A 2KLRA 1P1ZB 1RSFA 3UG3A 1Q8MA 5L4IA 1N59B 1K4CA 3CLFL 5C0BD 1KCRH 4EUPA 1J9RA 5SWZA 4ZXBA 4WFHE 5F8QC 2B1HH 3P02A 3QUMB 3MRPA 1JGVL 2VDOH 3V8CA 4NRXB 1ZS2A 1LP9B 2OXGB 2V9TA 4HQQL 2R7EA 3WNKA 2J1YA 3QXAB 2VISB 5DDHA 3HUJB 4LPWA 2JCWA 5F7YC 3U6XS 1LK3L 2F7PA 4OD1L 2IDSA 3U7WL 2R29L 4YX2H 3BQUB 1I1CA 1F13A 5D1XD 3FCTA 5L6YH 2ZYHA 2A6IB 4Y4HD 1FN4A 4FQHA 2OMVA 4QTIL 4KFMA 3WE1A 2A6DB 3GLAA 3R8QA 2WBXA 4QXWA 3KL0A 5E7FA 2VL5B 3F58H 5B1AB 3P3TA 2GC4C 3APNA 5CJQL 5I1HL 3WV0A 4N0UA 2QQKL 1TJGH 3JVFC 4KNTA 2EEDA 4PRDB 1RMFL 3CHXA 4OFKA 1E9PA 1G9ML 2CKNA 2WXKA 2Z91A 4GFXA 5IMKA 1I75A 2XY2A 1U8OB 2Y6SD 4N85A 4N3UA 4ABVA 1FL5A 1YUKB 3WY2A 3ULUH 2X4QB 3VFSA 1CQYA 1X9RA 3N1MC 1GJIA 3GJFK 4FNLH 3T6QC 1P6FA 4YFLI 1DFBL 1JPST 4QO1B 3AGVA 4WWNA 2J4WH 1IC4L 2VR5A 2WYZA 4Z7UE 4U1KB 1J86A 3BDYL 1FIGL 2BRRL 3QEQB 3LYRA 3QEHA 4U05A 5CP3A 3RWGA 4J3UA 3FL7A 3S35X 1SXAA 5DJYB 1CDYA 3L4WA 3WFCL 3VUAA 1I8KB 3Q9PA 1L6XA 2EEBA 1R5IB 2DB8A 1DBAL 3CZGA 4RZKA 1BFVH 5BO0D 1WA1X 3DGGA 1NBVL 1TR7A 2KLSA 2DM4A 5D2NE 4YIQB 2K8QA 2RACA 3PE9A 5IBTL 3SD2A 4XVSH 2DKUA 1TXKA 1QNZH 1AGBA 1BIIB 1H3TA 2XN9B 4PGEB 1F3JA 2CO7A 1G4RA 3QA3A 1QACA 2VLKB 3DXAD 1RZIA 5FA3A 4KDTC 2V8LA 5L8KB 4YUEL 3B9KB 2R2EB 3MUGA 3NSFA 4LXFA 4A2FA 3GMNA 1CB4A 2V2WA 3OHXB 1NA8A 5EU5B 2CJSA 2EXWC 4O2EA 2Q2LA 3P73B 4BSWB 5B7FA 3F6JA 4L9LB 5D1ZC 3BXNB 4HIEB 3R7QA 5CFHA 3K71A 4PWJA 1ZLSH 5IOPB 4C54A 5E8DL 5DMIH 2B7DT 2VDKL 2NXZD 4N0CC 3TV8A 3LEYL 3X1BA 5GS0H 1NGXA 4ZNCD 4PG2A 4UZUA 2FX8L 3NOIA 5FOJA 1DQTA 3SB3A 3F6IA 4HS8H 4WI6A 1MREL 3FT3A 3Q2NA 2XTJB 4ZFZA 2N7AA 4PQXA 1GPOH 1PYWB 1O7VA 5LLIC 1J9TA 2YD3A 5AW4B 4BQ9A 4LKXA 2KPWA 1FH5L 2ZXEB 3KDPB 2HJLB 2AXFA 2VKWA 3AUWB 4O00A 1L9NA 4PJIA 1A6TA 3BFQG 3UTOA 2Y1AA 5DJ2A 1WZLA 5FYKE 2EYSA 1VJSA 2FCBA 2L04A 2RQEA 3LEVL 4PJCA 4Z8FH 1YJDC 4AM0A 5CEXB 5HGAA 3HI6H 3SJVD 1E67A 2ZAGA 3GHEL 1QI5A 4XHJC 3L4XA 4ODTL 5E9DA 3UP6A 1QLRB 1DJXA 5DJ6B 4N8CH 1M7DA 3DNKA 5I8EA 4G7VH 5EF1A 3BVXA 4I77H 3GZKA 5EBMA 3VU1A 1JFQH 1EZVX 4LSSL 3AU0A 5FGRA 3GJFA 3P2BA 2Z4QB 5DHEA 2ZWSA 5I76A 1M05B 3MU3A 5D1QB 1DEDA 4H8WL 1QTPA 3QULB 1CFSA 2ARJA 5EU7C 3RVXD 3SEPA 3UFIA 3ZE1B 4CC1A 1U8JA 3CHSA 3DIDA 4Z6AT 2QFPA 5BRZB 4KWUA 1QQDB 1U9KA 4M6NL 1Y6MR 2BY2A 5EU6E 5F1NB 4OY9A 3CHQA 2RBLA 3QORB 4YHIB 2NLJA 3SJVA 2GYSA 3GDBA 5FYKU 1I3GH 4Y19A 5ECJE 5CD3A 4KRPD 1KIUB 2YMTA 1TOXA 5ISZE 3FTGB 2JB6B 3D1MC 1G7HA 3X3FH 5DD5H 2ICWB 2BS8A 1PGRB 1WFOA 4GI8A 3Q5OA 4HC1A 2FECL 2OTUA 1N8ZB 2LU5A 2VDNL 3GO1H 4HALA 4KO9A 2HZHA 3AJ7A 4ZOBA 4ZMPA 1KFAH 1HK6A 1BQHA 4R4ND 1ADQH 1YCSA 2VLLB 2O6CA 1K3ZA 4FEMA 4IM8A 4UM9D 1KTRL 2CZNA 3RGBA 5DVPA 2BM3A 1RZQA 5C09B 4M4RB 4HWBA 4L4TD 1WFUA 3OR7A 5EORL 5KSBF 4J3VA 3N42F 2ETWA 1IEBB 1X5FA 4YGAB 3OSVA 1IKFH 3S3SA 1VGKB 5D7LE 5FB8A 2XLLA 1NM4A 3MLUH 4EPSA 1CICC 1MWAH 2V0AA 4C55A 2X3AA 4TRPH 5H35B 1A6AA 2I85A 4XHQA 3VXMD 1P7QA 1YN6A 4G80A 4P23C 2GBVA 5AWNL 3ZHLA 2CIIB 5KJ4A 4DZBA 5K9OB 1G43A 1I9EA 2GY5A 2RH0A 3BP5B 2XBTA 4E41B 1N3NB 3OJDA 3AB0C 5BVPH 1RVFL 2DAVA 3P0YL 2DQTL 3HC0A 2VKXA 3D9AH 1MFBL 1JPSH 2XA8H 2BNQA 1SY6A 3CVHH 1BHGA 2XYBA 5FFOA 4OVUA 5E9DE 4F2FA 5ABAA 4MD0B 4LOUD 4Y5VB 1CT8B 2OMYA 1BQHB 3LDBB 3V0JA 5IQ7H 1MCEA 3VFNB 5A1AA 1IAII 4ENED 1KBGL 4XVTL 1NMBH 2D2CC 2OA9A 2R0LL 3HBQA 3OAYK 4HISA 2ICWA 3B9KC 5HGGS 3O4LA 3FTGA 2G75A 3AC0A 5C0EA 1KYUA 1EUUA 3QNZA 4L1TA 3F85A 4YBHA 4RFEA 2OTPA 3JWNE 4TULL 3VQLA 1R19A 2HKAA 6FABH 1ACXA 1J5CA 1N68A 1T83A 3IN2A 2WWNA 2EXYC 3UTZA 1G0YR 5DMYA 5A2LH 1T0NA 4Z78A 5F1NA 4L3EB 3I6LD 3L6FA 3ZYJA 4U3XA 1FAIH 3VGAB 5F96L 4Z23A 5AVQB 2E6JA 3FN9A 4XXCC 4H8HA 3RNQB 1BGXH 1IFHL 2FB4L 1I8IA 4RQQA 5KBMA 1KCUL 1ML0A 2H0FA 1TZIA 4WNQB 2EDYA 2YSTA 5D1QA 2DS4A 1MLCB 4L8DB 4DKDC 5I76B 1JNHB 5I1KL 4EN3D 1Q9WB 1ADWA 1TU2B 1JPTL 4I85A 4G9FB 3SCMD 1CBJA 5DK2A 2CO1A 4NM4L 2ISDA 3C09C 3RIAK 2IPKA 1WD9A 2Q7AA 1UFGA 3ZTNH 4JREC 4XAWL 1J48A 2Z8SA 3NTCL 5FLVA 2VXQL 2FX7H 4G8GB 2VERN 4JFWA 5HGAB 4IBLT 4M1CD 4WTXA 1C5CH 2F8XC 4C56D 1IARB 3WXVH 2V37A 3IRPX 3IDIA 4PY8I 3EYUH 2CRZA 1BG9A 3L7EB 2WBJB 1ED3B 4NO5A 2VXVL 1F18A 3FU3A 2DM2A 3ZZQA 3KYMB 2QPFA 3QDMD 2Y6SC 4N2FA 4OF3A 3SYCA 3MJ9H 1AZZC 2D4DA 4NUGL 5SWQB 3NCYP 3HVDA 2Y22A 3O2WH 4EDWL 2MH4A 1RD6A 5F88B 1WWAX 2YOCA 3QAQA 4PRBB 3UBFA 1MNNA 4FRWA 1F45A 1L9TA 2BVOA 3GHBH 3MNZA 1E8ZA 4OFQA 4KRLB 1SXZA 5L7XH 2D9QB 2WUCL 1A8ZA 3QUKB 2GB2A 3DJSA 3OX8B 3ULUE 5IOPA 1E27B 1J5OL 4TQIA 1NSNL 1H3UA 3ILDA 3B4NA 2CM5A 4RMWA 3S96A 3WENA 4L9LA 4J4PA 5FYKL 3KLQA 3P73A 4BSWA 4Q9CA 3IDYB 4CU7A 2EVIA 1RI8A 2X4OA 1UD4A 3SPGA 1RMFH 3MRKB 1KB5B 4WVRA 4H2CA 3SN6N 3SSGA 4MJIA 3IJHB 5JDSB 5JXED 4M7KH 5HDBE 3VRLF 4GT7A 4BINA 3HB3C 4HUVB 4P59H 1CURA 1MAKA 2PYED 3RP1A 2ARJQ 4KKRA 1BIIA 4AG4H 4KHTH 1T83C 4FQCL 4H0IA 4PS8A 3TIEA 4UILH 2AQ3A 5L8JB 2IH1B 1IC4H 2A6KB 2CLRB 4N2EA 2B9BA 4J27A 3BSZA 2P8PA 3MUHL 3ES6B 3DGGB 3OAYH 1WGOA 1XH3B 3NDYE 4QHUA 3S36X 1MCOH 4KK5C 5GGQH 2W9LA 2UWEB 4I13B 4PI2A 3BWSA 3C60C 5IMMB 2LTQC 3KGUA 3HPLB 4NAMA 5E6ZA 4KROC 1Q9OA 2Z31B 4P4KA 1GW6A 2W1NA 3P40A 43C9B 4D0DA 3MJ7B 1DBMH 2V5MA 4O2CA 5AOJA 3QEQA 4YBQD 2D9CA 1N0XL 2ZP8A 1LE9B 3HRZC 5DRXA 1G84A 1TLKA 2DYRB 5ECGA 2DLHA 4U1GC 4EOWL 1JE6A 3W0WE 4UCFA 2JKTM 3T3MB 2FNWA 4KQ4H 3GPEA 4P46D 4L0PB 4J1UA 4U1JB 4PM1A 4Y4HC 4MLIA 4PBVC 3WL9A 3BZEA 4PJXA 3QJSB 4N2NA 5C2BL 1X5YA 1SFDA 1F86A 4LNRA 2AITA 2JI3A 3UYOD 1OSYA 3CPLB 5EU7E 2Y3AA 1ZJAA 2EIDA 3ATAA 3QDGB 4XP9L 3S4SG 1NANH 1VEPA 2J1XA 1MZZA 2OAAA 4AV5A 2JQAA 3R1GL 4JFHE 5ERWB 3H0TA 4JL2A 4AQZA 3HZYB 2VLMD 3FZUC 4QJ3B 3VFWB 2UY6B 4GKSB 3BQUA 2W92A 3ASOB 1UD6A 1KGXA 1IIKA 1NCAH 4PJ6A 1UENA 4HCRL 3N85L 4RBPK 4FLOA 2G9HB 3JWOH 4LDOB 4WIQA 4ZNEA 3HZKA 3TA3C 5FS5A 3FO1A 4CW1A 5LHDA 3FUMA 3X1GA 3ARED 4LFHG 5EZOL 2OXGA 4NRXA 2O61A 4HGKC 3VD5A 4UOJA 4KROB 4N9OB 4DN3H 2XVGA 2HFGL 4FXGA 1GC1L 1JK9A 4FQLL 4DUWA 4ZXBB 4X6BB 4DEWA 4ODTH 1E7VA 5KTEL 1MFCL 5I73B 1U33A 4HLZG 3JTTA 3RA7H 1D5RA 1LK2B 3WIFB 2JKXA 1AO7D 1YLBB 2QPUA 1OKEA 4GIAA 3U0PA 2B5IB 4FCAA 2VDRH 1AG0A 3EUDA 4JQIA 3LKSA 2IFGA 4QRUB 3HEIB 5FHAH 1DVZA 5JO5B 2HXAA 1XF2A 5DHYA 4HHGA 2A73B 3SDDA 3DRQA 3MV7B 4M5SA 4ZUTA 4HSCX 3VFGH 1R46A 1YEHL 5KSBA 4C83A 2OYMA 4A7GF 5EF2A 3EBAA 3CVHL 2IAMB 1S8DB 3BIKB 3JVGC 1MW0A 1C16A 1HZHH 1ZHLB 3OZKA 2BSDA 4XNXH 5A2CA 1I3RB 2UXVA 4YGVB 1UJTA 1J0HA 1J7VR 1XR8A 3FB6B 4FQXA 4IIQC 4JCMA 4OD1H 4TUKH 3L1FA 4Z7VA 3G5VA 3P11H 1QW9A 2XPZA 4HCIA 3H4HA 4AQAB 2G2PA 5B38A 4ZOEA 1UA6L 3N2JA 3FRPA 4N2CA 4R0LA 3B6SA 4F7EB 2W0KA 4HKXA 4MAUH 5HYJB 4IRJB 1MFDL 3TEZA 3WEAA 4WQOA 5JW5A 4PJ5E 4WCYL 3H4FA 2UZXB 3WFBL 3B9KD 4LEXH 2PXYD 2WPGA 1H3VA 2OR7A 2I07A 4KV5F 4QHMA 4XNMA 5C9JB 2MPAL 3VX0A 4MA7L 3APDA 3OGCA 1KLGB 1ZDQA 1IGCL 4GUCA 1U8NA 3HI1A 4P8QA 1WYJA 2AJ3B 4KKCD 2XBZA 4M43L 4XRCA 4OJFH 2NY1C 4E42A 1RFDH 3PGDB 3EHBD 5HI5C 3PHOB 3L3DA 1FFTB 4NWUH 1JS4A 4TPRL 5DVLA 5DI8B 3CCHB 5AWNH 1JZDC 1AKJA 5DD1L 5HDBB 5T1LA 2QV2A 3DJRA 5KSVA 1UB5A 1JZIA 4FZ8H 3KWTA 1V3LA 1T20B 1LO0L 3UO1H 4ODUB 1FZJB 4OT1H 3BESR 1LNUB 1ZIAA 4OCXH 3BVDB 1NFIA 1U36A 3NMEA 3RTQB 4ACTA 2PXYC 2BMKB 1TG8A 1BFTA 1BBDH 2NT1A 2IGLA 1SMOA 2IIJA 3ARRA 3OF6A 5BJTB 2XX1A 3HMXL 4HFUH 5E9AA 4H88L 4NKDB 1PX4A 4JJOA 2JSFA 4X4MA 2EVFA 2WKOA 1TQUA 3W57A 1PPIA 1ZIBA 2WWKT 3MGTB 5JIIA 4JKPL 2ENPA 4L4VB 3QIBA 4K0OA 1BAGA 3HR6A 3D69A 4XN5A 2NY0B 1KEML 4CC4A 4PP2A 1IQWH 2IQ9H 3D34A 2DBJA 4X9BA 5TK4A 2HFEA 3QJFB 1WAAE 1P2CA 3MRLB 2W81C 3D69B 4GEJA 3KYKH 3QJXA 4TVPH 3TU6A 2HJFB 2BIPA 5HSFA 1KZYA 1UACL 2E27H 3GMRA 4FI8A 2CKBB 4KJQD 4FQXC 3ABKB 1K9TA 3RDTD 1FNSL 3OKYA 3MRCB 4R5VA 4L0YA 4HPYL 4N4YB 4ZUVA 3ZKMC 5IOKA 4XPGL 5E2JA 2ICES 1BXUA 4Z7VE 1USZA 2H2PC 3NDZE 3MLRH 3QIUD 3EJCA 3W11C 1WBZB 4B3VA 4HUCA 3BLBA 3WIIH 1MJJA 2QHLA 1NFIB 2P44B 5MENA 1MREH 2WO4A 5I74C 4IEFA 3FMGL 2M83A 4DKEH 1AP2B 2PO6A 5ETUA 4QYAA 3DPDA 4K71B 3HUJF 1AQHA 4X5QA 1S46A 1BM7A 4Y5YB 1AHMA 4FEIA 5DFAA 4AEIL 4LEBA 1ZEAH 4DP6X 3QFGA 1DBJH 3L3DB 4OGYH 4DW2L 2EH7L 4JM2C 4TLUA 2X9WA 3HMXA 1IGIL 1J1PH 4R4FL 5C0BE 4AK1A 3HNVL 4QXGH 3SQRA 1WZAA 1M42A 1J0IA 2I07B 4HMDA 4MS6A 5CKGA 5J13B 5EZPA 1EAQA 1OQXA 5HY9B 2GJJA 3MACL 3FFDA 2JJTA 4NUJA 2ZUWA 3FQWB 4XP5H 5JOEA 3UTQB 2PW2B 4RGMC 4TNFA 1DQLL 3QDAA 3ESMA 3KLHD 3NCXA 4Y5XB 5B38B 1ZT7A 5J1TC 2ZUQC 3KLKA 2K7PA 3L08A 3SPCA 4NN6B 2XXMB 1A14L