5CR8A

Structure of the membrane-binding domain of pneumolysin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
RNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Pneumolysin at 2.0 angstrom Resolution Reveals the Molecular Packing of the Pre-pore Complex.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Toxin
molecule keywords Pneumolysin
total genus 22
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 5cr8A00
5CR8A 3HVNA 1M3JA 1S3RA 3CQFA 1M3IA 1PFOA 4HSCX 4BIKA
chains in the Genus database with same CATH superfamily
4PJ9D 1U8NB 1DANT 2QVMA 3T6WA 4LCWB 5FOBB 2J8HA 4K5LA 4K2UH 3BGMB 1HESA 4YZFE 2NCMA 2C9UA 1IT9H 2X7LA 3GMPB 3T71A 3MUGA 4MNGB 1WJ3A 4K9EL 2C3WA 2FWOB 2V5MA 4H0IA 1ODAA 3KPLB 4HEME 3A67H 1JVLA 4LPYA 1DZ0A 1I9EA 3C5XA 3K74B 5AG8A 2IPKA 2XNAB 4N2LA 4EDWL 5HI5C 3G5VA 1D5ZB 4LCYB 1RU9L 5I1IH 1OM3H 5I6OA 1MUJB 2G4GA 2SEBA 2BM3A 4MS8C 4WWOA 3H55A 5B1KA 3L81A 4NPYB 3NDZE 1WGVA 1ZT4B 4Y89A 5GGSB 3F7RA 4LPTA 4EMZA 2FUTA 1CICA 2SODB 2H7WA 4KAQL 3TV8A 1LNUA 2EE6A 1H6EA 1OV8A 4I9WE 4Y9EA 4DVRL 3LZRA 2OMNA 3CDYA 3IE9A 3NG5A 4A7GA 3F6LA 2XY1A 2PKDA 2D9QB 1E43A 2PW1B 3FQWB 3P3UA 4R3SA 3VWKA 4MNQA 2K0RA 3NJHA 2Q87A 4Y4KB 1A6AA 4KHXH 4XNYH 5EBWB 3U1SL 5I1LB 1RUML 5ID1B 2D3NA 5I15L 4WU5B 3N42F 4QHMB 1E2WA 3WEAA 2XWBA 3E6HA 1VCAA 3ARBB 4L9LB 2NY6B 2GJ6B 2EQDA 4RX4D 4DERA 5J8OA 2WD0A 1ZA3A 2NYYC 4WIQA 3WIAA 3D1MC 1A7QL 2FH8A 1FFNA 2VO8A 4NBZB 1MLBA 4XX1E 2Z93A 1OCOB 4MCYB 4LLVA 2M1KA 4OD2A 3SO3C 2A6DB 3W0WB 4G9DB 2Q2LA 3S4SB 2OP4L 3T77A 2I07A 5EU3B 1VGEL 3OHXA 3FT0A 2PXYA 4GBXA 2FT7A 1FNSL 1QLRB 4UT6H 3RAJL 3O8XC 5HHNB 1AMXA 2Q10A 3EO1B 4ELMB 2X0UA 4GSUA 1SEBB 2WLLB 4PGCA 4WI7A 5E1IA 1F11A 2OQJA 4NLHA 2LTQC 5HJ3A 3BP6A 4PM1A 4O02H 4S1SH 4XBEH 3MUJA 4V1DA 3VWJB 3EW3B 2J4WH 2DQCL 3SPIA 2CIKA 5J11B 2V17L 6FABL 4KK8D 3B9AA 1GCYA 5C09E 1DVZA 3NTCH 5SWZD 4PGBA 1J5OL 1UKQA 4P23D 5E00A 3UJJL 1MCRA 1YNTB 3EBAA 3BZ5A 3CSGA 3HHRB 3Q44A 4NDMA 5T1KA 4W70A 3P0GB 3WIFA 2VN7A 3V0WL 4G11A 2VGLM 1BYOA 4MA3B 2VXQH 2DLIA 4EIBA 1DUZB 5H37G 4G8GD 5GGUB 5FDYA 3UCQA 4WFGD 4Q9QH 4L9DA 3JSSA 3BSGA 3ERXA 2C1PB 3LPGA 4OIAA 4R0LB 1YNLL 3FO1A 3AJ7A 43C9A 4HKXB 1A9EA 2I5YL 4ZMZA 3BC9A 5C0BE 4UU9A 1ZK5A 3WEXA 1U8OA 1RUAH 3H9HB 2N1TE 3WN5A 1T21A 4HGWA 1IEAB 4YDZA 1CJYA 3VXNA 3ECBB 4L29A 4MSWA 4CADA 2C8NA 4FG0A 2XICA 2QVTA 3QG7L 2WCSA 2VLRE 4AZUA 1QZNA 1ZT1A 2OFQA 3EGXB 5I5IA 5IOPA 4JE4B 2WTRA 4JFYA 5L8KB 4PGEB 2YMOA 4WTXA 3KJ4B 5E8OA 3NACH 2A77H 3Q01A 5DQ9B 4ZO7A 3C6LB 5EIIB 4S1RH 3DJZA 4CN4A 2J73A 4CMHC 1KCSH 4IGBB 5CJOH 5AW6B 3RTQB 4DEPC 4V33A 2ZKMX 5H35B 3WEBA 5JYLA 4JKPL 4TKWA 5I5RA 4I3GA 1HOCA 3DUHA 3C5SA 3FYEB 1G7IA 3OR7B 4HYTB 1NAML 1CXLA 4I3SL 4NNYB 1DJXA 4P49A 5KTEL 1UJTA 5D7LA 4LPXA 4UUJB 4WV1C 5ILTH 1UOVA 2IFFL 5E8NA 5FKAB 3T08A 1CO1A 2AEQH 1NAKH 2ZWYA 4FAAB 2DQ6A 1FNEA 3MBXL 3F83A 3QDJA 4NWUL 4ZNCD 1RJLB 3BAIA 1HH6A 4TSAH 2PO6D 5AW8B 1FNFA 1N8OE 3LNHA 4GKLA 4XH2A 2Q2EB 4GQZA 5F8RC 2O4EA 4QNPF 2NTFB 1ZTXH 2WSKA 2JI3A 5IESH 3QORB 3BN3B 4YEEA 3DO7B 1DQTA 2VZSA 3NJXA 2CBQA 4G71B 5HJDA 4ZG1A 4YK4C 1OTSC 2H3KA 4HUXB 5FUCC 2XI9A 2JXMB 2WLIA 4XVUD 3FTWA 1QHPA 4GUPB 4Y8AA 1RZ8A 3EFFB 3BVVA 1HL9A 2K70A 4DZBB 1U8LA 5L9DL 3TS8A 4BEIA 4P9ML 2NY2B 4J1UB 1SDDB 5LXGH 4BQCA 2HMIC 4B97A 4RNRA 2E4TA 1J1OL 2GSGA 5C0DA 3PHOB 1RZ7H 2R1XB 2X6AA 3L9BA 3X13B 4YHPA 4XNUL 5I18L 2ZKWA 4PJFF 3ZE0E 1SLXA 4JW3A 3TA3B 4M4RB 4D0CA 4CVWA 3FB6A 5IW6A 5JLZB 1HFUA 3UAJA 4ZMNA 3G6AA 3EXJA 2G3XA 4A63A 3CVHB 4JB9L 3TBSA 3NSFA 3PWUB 5F6IB 1HYSC 1A14H 1O6SA 1HXYB 3MA7A 2Z31B 1EZUA 1WUNT 1NCWL 3S8FB 1RU9H 2KBGA 5I1IL 3MR9A 5TE7H 5JXAH 5EOCJ 1L7TH 2E6PA 2VKWA 2V7HB 1QPXA 4FJZA 4R4NC 2DQEH 5D4JA 5IB4B 4W9KC 3FU7B 1J1XH 3SPJA 3IRCA 3U46A 2EE9A 4C56D 4BHUA 1DJIA 5DURB 1YO4A 1U8JB 3CMGA 2H1PH 1V7NL 2AC0A 3QIWD 1CDYA 5IK3B 1GL4B 3BKCL 4YHIA 5C2UB 25C8H 2PWGA 4G1EB 4LSPL 1IFRA 4KQ3L 2D7TH 5B38G 1WIPA 2OMXA 3LKSA 3SCMB 5B8CC 5BZWA 3GJFB 3G6DH 1XGRA 1JHTB 5DGQA 3SKMA 1AD9B 2H9GB 4RFEA 4UM9D 5IBUG 2NYKA 5CILL 3R4RA 4MMZC 3V9EA 1MCEA 4K5PA 5D7JA 4PG9B 3BHBA 3DV4B 3UG3A 4OJYA 4WRLA 3EBGA 2E8YA 5DRNB 2PP8A 3RFZC 4P57A 3MRCB 4KFZC 4Q6IA 3QXAA 2G5BA 2FL5B 5AAPA 3D0VB 3LQAL 1F42A 2EXYD 5FYJE 1Y18A 5HGGS 4G6JL 3GXIA 5KAQG 1LMKA 4LSVL 1SEBA 5LWYH 1TTFA 3K6NA 1FYHB 4HKJB 4UV4H 1AZRA 2ARWA 4XAKD 1VA9A 5JIKA 1SLWA 4KUCD 2Q7NA 5IZ7A 4F8OA 3W3BA 1A7RL 1CICC 2XETA 3MBED 1KPRA 4QTFA 1FH2A 1NCUA 1EXGA 4L37B 1C08A 3IETA 2J3SA 4PS7A 4TVSa 3ZKNC 5CD5C 2JKNA 2R2HB 1NCAL 3SPVA 1KEGH 5HHVL 4OCSL 3A6CL 4XBMA 3AG3B 2A9ML 1IZKA 1JNNL 5IVZA 5HVGB 4HUVB 2JJTA 1BVKB 3WS3B 4UQIM 1MVUB 1OM9A 2MSPA 3LD8C 1AQMA 4Z7UB 1S5IL 1Z9MA 1IQDA 4FA8A 1CTMA 3BP5B 4HMDA 1ZS2A 4N3TA 4NZTL 4BCXA 5D9SA 4N2NA 4BCYA 4M6NH 2QQLH 3C8DA 3FFCE 4WO4C 4JVWA 5M94B 4N5UA 1OAYL 3ILQD 4LVNB 1U8OB 5KSBE 1VZGA 1JSYA 3ZMEA 1GGUA 3HA0A 3IAGC 1MF2L 2GBAA 3UAJC 1EXUB 3WXVL 2DMCA 3ESVF 4V11A 1UH2A 3KPSD 3CGTA 3MNDA 3OQRA 4AGOA 2BSED 2HX7A 2YSTA 2Q8AL 4MFHA 4WEBH 5ACZA 1IM9D 1X7QA 5DMIL 3OXRA 4N5ED 1E4KC 4GXVH 4FNTA 4TS6A 3IFLH 4RCAA 2Z7YA 4TNVK 8PAZA 1I8IA 5AKSA 3C6SA 4FFYA 2WIIA 2YSSB 4LSTH 3LRGA 3QE5A 3GB7A 1UXSB 1R19A 3BPOB 4NAMA 3DTXA 4KJQC 3S96B 5I0DA 3VGHA 4PV9A 2DTML 2FYYA 1SOKA 5B1BB 4PTTA 4GB9A 3BWAB 1DBAH 2NX5B 4ISVB 4LPWA 5HI5D 3AABA 3VXUE 3OF6D 4KNQA 2X41A 3DHUA 3EJQA 3NIFF 3NACL 4GAYA 3M7FB 5AQ0A 4F2EA 4U3SA 2TSBA 1YEFH 2UZXB 1EQWA 1XGYH 2JNZA 5T1LB 5JMOC 3HMWL 4PJ7E 5IUCA 3BAWA 1TO5A 5AAMA 3MRRB 2NYZA 1ICTA 4ZUVB 1GRWA 1QI5A 2ZAHA 1LO4H 1NAMH 3WSQH 3OGCA 1ZRUA 1OZUA 3X1NA 5KJRL 5ILTL 1F6AB 2VQUA 5E4IA 5HI3D 3ELQA 4PRPB 3GS4A 1HH9B 1ZJAA 3ZKSD 3F7QA 3QH3A 2QTEA 4ZUTA 2AEPH 3KBPA 1JFQL 3AWFA 2WCPA 1BZQK 2YEVB 4IKJA 2XJLA 2DYSB 5E9DE 5KVEE 2AK1L 4F7CB 4DN4L 1OD9A 2H6UA 3J07A 2ZCLH 3PQYA 4WO4A 3L7EA 2HWZL 5AVSB 4CC1A 4FNUA 3SO3B 1EXHA 4NZUH 5I6KA 1EEUA 2J2ZA 5H37A 3SDCD 1U8HA 3FQNB 3I9AA 3KCPB 1IV8A 2Y36L 2D9CA 3QI9C 3V55A 3ZMRA 2ZP0T 3V4PB 4LP4A 1G84A 2BOCB 1MAML 3L3GB 2R29A 2UZPA 4PLNC 5DUML 4PJHA 5EF0A 3B7TA 3GHPA 4NRZB 4CDHA 3PHQA 3R7QA 3STZB 4YSRA 1JWUB 3L3DA 4A7SA 3C08L 4EQ2A 3WMSA 1JYXA 3LAFA 1J0YA 2XRAH 5E4EC 1NDMB 4FFVD 2EIZB 2ZG1A 1X5MA 4CU7A 4WTQA 4MQSB 4V1DD 4PJXA 2H0PA 5JW3H 3VWKC 1NANH 1ZK9A 1K2DB 2FQGA 1D2PA 5CLXA 5DD3L 4X6BB 3WGVB 4ANVA 4KI5D 5C0EB 1NPNA 4AIOA 4MJ6A 4YHKL 5CEXA 4HMEA 4AOFA 3TCLA 2IPTL 3DWTA 3B37A 4Q0XH 3RP1A 1T0MB 4YDMA 3L95B 4ZFGH 4POZC 2CM6A 4Z7OB 5CWSA 2NY0D 1S46A 1G9MH 3QQ3B 2PO6A 3UGUA 5DD0L 2MPVA 4PBXA 1KY6A 5CSBA 5D93B 5DUJA 4K5OA 5JHBA 1EHLL 2DKSA 1WT5A 3QXDA 2O61A 3T0BA 5ISZE 3LEVH 3MV7D 1BZOA 1Q4NX 1S7SB 3VCLB 1ZGLP 4EXPX 2ZOKA 2G5BB 3QQ9C 3U6XS 4DNLA 1YNTF 1N3NA 2BVYA 3NCFB 2D7MA 1CL7I 3M1OA 5J6HB 4JHWH 3IU3B 3OAUL 5LHDA 2W38A 5D7SL 4PJEA 1TSRA 2PXYC 3VTAA 2OR7A 2RD0A 7CGTA 1BLNA 2D73A 7TAAA 3TURA 3QEQE 4OLXH 1TQBC 2FX9H 4H8WL 4Z3IA 1SNRA 4KZEH 2BH0A 2OMTB 4OLEA 3ARRA 2KHAA 3GZKA 4Y5YA 3HRZB 1TKWA 3O2DH 3QUYB 4MNHB 1MJUL 3OKKA 3OWEA 3WY1A 1WAEA 5GSRB 4WHTA 3SBWC 5BOZG 3RPIB 1CR9L 5EO9B 4NP4L 3K1DA 1MH5A 3VG0L 4JFVA 4XB8A 4F8NA 1F3JB 2IG2H 2XKNA 3CXDL 3B8SA 4CNIB 5DJAA 3WHE1 4AIEA 1OAXH 4FEIA 1LO3H 4QTHB 3QIBA 2X28A 5KS9E 2CKNA 1OL0A 5CJBA 4JFFD 3LEYH 3NEOA 3PXHA 3V6OC 5B39A 4HU8A 3QWRA 4TSCL 3EO0A 1MWOA 5E99H 1MFAL 5EN2B 5IROC 4WI0B 2RIKA 4WGKA 1ZXKA 1S7XA 1MCPL 3A6CH 3SIKA 3V4PL 1NDGA 3GLEA 3BRDA 1OAQL 1G6RL 1NCDL 2OR9H 4R7DB 1XR8B 3JTSB 5EULV 4XX5A 4HBQA 1Z5YD 4MAUH 1CBVL 4F7MA 3W0WE 1S78D 2XWTB 3BGFC 1A4KB 4RWYH 4XXWC 2CDGB 1UWGL 2NX5D 3WGUB 3T77B 2P49B 3FCGA 3KDMB 4RAUA 4A7GF 3C5JA 2MOGA 2F1AA 2Z92B 2QGBA 2F1BA 2FGWL 1TEFA 2WNXA 5IQ9B 1ID5I 2G5RA 3X3GH 3KPSE 1I8IB 3LKQA 2V9RA 3VA6A 2FLBT 2BP3A 3U6RB 3ZLQC 4UDUA 3RWDA 5HVFB 1M7UA 2V9TA 1S9WB 3FN0H 3ZQXA 1LP9B 1EFXA 3UMNA 1WRFA 3QXUA 4L2YA 3MUY1 3EXLA 4NNXB 2OMBA 5GRXG 5E8EB 5GSVA 1SJHA 5EZPA 4JY4B 3RIAK 4AM0A 1KJ2B 4UTAH 1XHHA 4IRJB 1ZTXE 2NXZB 2BX5A 3ARBD 1S9YB 3IFLL 2XUWA 3D2UA 4OFDA 4OZGE 3V4VH 1JZ3A 1JGLH 5GRWA 5JNYA 1PG7H 3HZMA 4PWHA 4EZJA 2W80C 2P48B 2HX9A 3S6CA 1PY9A 2X70B 3S3SA 1TQWA 3CBRA 5DK2B 1L6PA 3VI3F 4RWHA 1DUZA 3WNOA 1MAKA 1N2RA 1T7ZA 3GRWL 3ZKXB 4AKOA 1NCJA 2GT9B 2VXVL 2HLEB 5I8KL 2AJSL 2DQDH 3VG9C 1NC4A 4Q9RL 3B8YA 1FC1A 1JXJA 3DX3A 3H0TA 4N0UE 2UWEB 2WZPA 1AO7B 1YY8B 1QSFB 3HR6A 5CKAA 2BNQA 4Q14A 3ES6A 5IB3B 1UHVA 3TASA 3PQYE 2P5PA 2CLRA 1MJ7H 4W9HC 1LLAA 5D8JL 1TXKA 1OP5K 4PJGB 3MGTA 1G7PA 1IGFH 3VXNB 1FGNH 2J6WA 1KYDA 4G8EA 1C12B 4JM4H 4F9LC 2VITB 3RGHA 5JZ7D 2JFCA 2VDMB 4WJ5A 1ZT1B 3EGXA 4XBGB 4WSKA 1YN6B 3QS3A 5CMAB 1EVTC 2A6JA 2P26A 3V4UL 1U9KA 2C3HA 2VC2B 4DWHA 4P23C 1MW2A 4U6XB 5GS0D 2XTJC 3QPQC 3AUVA 3JUZA 1UENA 3CCHA 2MTPA 4HQQL 5I82A 3VXQA 3KVPA 4KMTL 3NABH 1BQHB 1Q1JH 3QFJA 5BUAA 2H47C 2PW2B 4N0UA 1FFTB 4HIXL 1QBLL 4KVCH 4NUJA 5EC2A 4EIZC 3NK4A 4PTUA 5DR5H 1AKPA 1SRDA 4A55A 1D7BA 4HCGA 1MAMH 1S7VB 1C7TA 1DQLL 1I85C 4DKEH 1DSYA 1WF5A 3SZKC 1JZ8A 1OF2A 5SX4H 4Z7NB 5JQHC 4GKOA 3U83A 4FLRA 2FECI 2ESVA 1HH6B 3OAZH 3LH2L 1AGCB 1WK0A 1DN0A 5JA9A 43CAA 3KWWB 3D39B 4NQDE 2XA3A 3EG9A 2FSDA 3BWZA 3U0PA 1OAJA 2JI2A 2I27N 2OW7A 3CQQA 4JFFE 1RERA 4UAOB 4TUOB 5BW7A 4R97C 1UUNA 2ROYA 5KSVB 3L5IA 1AP2A 4R7LA 2VDMH 4YS4A 3JQOB 4OCLC 1MHCA 5GRUL 1JNHB 1YPZF 2DLFL 3RKDC 4GP5B 1UEYA 4DP5X 2JV6A 4HXBH 1H6UA 2O5XL 1L7IH 3NBNA 4YO0B 2YXVA 4A6YL 3TNNA 1UXWB 1KIQA 3VGDA 1CUOA 5GRVL 3V9CA 3JBG7 1QVOB 5CIPA 4S1QL 1SBSL 5I17B 3C09C 1OGAB 2ODHA 5A3ID 3QDGD 3MBWA 2IFGA 2CXGA 2UXFA 1CD8A 1LJMA 5FYJH 4RMBA 2D7OA 2CIIA 3V4VA 1QFUH 3MU3A 5C6TH 3VNZA 3O3UN 3QO1B 4OZFA 3MTRA 4AMWA 5CBAB 3MO1B 2R7EB 1VIWA 3W11D 2CK0L 5INDB 2VLRD 1NJ9B 3PWVB 1OT1A 5FM5M 3L08A 4DETA 2X10A 4ERSL 1MNNA 3GK8L 3QIUA 4M5ZL 2MMXA 3ZTNL 1JPSL 4WK4B 4AV5A 2WVVA 3K6FA 1P7QB 4R9HA 4JFOB 5ADOH 3UO8B 4AYDC 2EE0A 1OWWA 3U46B 4QHLA 3CDGB 2P5WE 1A6WH 2Z7UA 2Y7MA 3LZLA 3MV9B 2DJSA 3TFKC 2XC8A 1S7XB 3G5YB 4W6WB 2WNKA 4R4BB 4P48A 2GK0B 3LRHA 1H3XA 2EC8A 1ZE3H 4BJLA 2Z35A 5HYSB 1RIVL 4EZKA 5AZEH 3K71B 4MA7H 5C0CE 4JPKH 1KUMA 1MKFA 5G2NA 4DVBA 2X0WA 5KSBF 1LK2A 3M17A 4TSCH 2C9SA 4PB0L 1P4UA 2OK0L 3NP4A 4W6XB 3PWNB 2R69L 2R2EB 1FFPA 1UG9A 2ZIDA 3V4PH 5I6MA 4OI8A 3RQ3A 4Y1AB 1QSEB 3MROA 4JRXA 1OEZW 1PBYA 1SYVB 4L8CB 1KIPB 2ESVD 4DHLA 4C56A 1AO7E 5DFTA 3MRHB 4OCXL 5LAXA 3V10A 4K8RD 1CU4H 2J8UA 3IDYB 2AQTA 2BVOB 5DJ8A 4EUPH 5E6YA 3ZBMA 4YGAB 3NA9H 3DRQB 1IX2A 2CAKA 1YMMD 3FDWA 1C8QA 4W4NA 4PRAB 2UY7B 2HRGA 3CFCL 3GDCA 4KRMB 2JCCF 3K2UL 1G7LB 3T1FA 3OR6A 1GZPA 1D6EB 5BS0B 2F2HA 2E4FA 2NNXA 1C7SA 3WEMA 4J3UA 4NI6A 1GYWA 1IGML 3KD4A 1U93B 3RVTD 2G2NA 1BVKA 1MWAL 2GABA 5F9OH 3CMOL 4L4VD 5JW4R 4JPSA 2Y24A 4MMXB 4KVPA 5JDJA 2E75C 1BF2A 1QBBA 4LLMB 1SDYA 3RDTD 4JDVB 3ILPA 1F13A 2EIBA 3V95A 1X5ZA 4L3EA 4WNJA 5JIPA 1SGKA 2R56L 4XGZB 3VSQA 9PCYA 2WZAA 4X5RA 4ABVA 3FL7A 2XWXA 1F00I 3ZE2E 3QUMA 3KPSB 1AR2A 2XQYG 1R3LA 1M3IA 4NQEB 1I9IL 2R0KL 5IVOA 4E9XA 4WJG3 3Q05A 2HP4A 1ZMYA 5FC9A 1QFOA 3ZYOA 4HJSA 4WJ5B 4HS3B 1JWMB 2CO3A 4FQCL 4Z0BL 4IU3A 1DBBH 1HIMH 4JGJA 1JL8A 2JJVA 3WJLA 4BCZA 1TVDA 2K4WA 1WFIA 2ZKYA 5E6SB 3UYPA 3V0DA 3MJ7B 1U2YA 3RKPA 3TL5A 1XGPA 4HWBA 4JEGB 4KXDA 2DI7A 2A74A 2H32B 3DK0A 1UD3A 2AXGB 3GJEA 3H4FA 4POZD 4F2MB 3AG4B 4JO2L 2VR3A 4MRBA 4Z7QB 1A4JA 1YPZE 3MUGB 4HEMA 5E95B 4P8QA 4P99A 3GWJA 3MNZB 4FYTA 1AQHA 4L1BA 1G5GA 3FOMB 3IF1B 5BMFH 1IJ9A 2CRZA 5D1QD 3QEHB 4PVNA 4UTAA 2BSSA 4M8RA 4ZMLA 2FX8H 4CVXB 3FC8A 4X7TB 5GHWL 3CFMA 4I1PA 3GJFK 4F58H 2YEQA 3VXSD 4B7IA 3QCTH 5ID0A 1GOFA 2YAQA 4G42A 4MMXC 3QCVH 3TM6A 2GITB 4YSUA 1U95B 1VF5C 3VXRA 2IDUA 5GZND 3T2OA 1VFMA 4ESKA 1IGCH 5DUBA 3ZDYE 3F5WA 1TCMA 4YEFA 3JV4B 3L5WA 3GLDA 4JG1L 3HI1B 1OTSD 2HT4C 2A9AA 1TYRA 4Z0XA 1FLRL 3LS5H 1WBZB 5AKRA 2H1XA 4GRMA 4OF3A 4GS7C 3CU7A 2GI0A 3DUUB 4DP4X 3S37H 1WH0A 3M07A 1M4KA 5KUMA 2G60L 4Y9GA 4N0FA 4U05A 5BV7L 1CIDA 2J2ZB 3EH5B 2YGOA 4TLTA 1P1VA 1AJ7L 3SE8L 3FQ1A 5L8JB 1GIGH 3MLRH 1DQMH 1WHPA 4XCEA 5AL0A 4GXUN 4ZNEE 4M02A 1AQKL 1XF2A 3L1OL 1HHJB 4AMKL 3OC5A 4P4RA 3MLTA 1Q72H 3MLXH 4U31A 1KB3A 3D48R 4N8VG 3IYLW 3G6JE 3CU1A 4P5TD 4Z7WF 1JGDA 1IAOB 4ZMXA 4JGMA 1XXFC 4M5TA 3FOLA 3I50H 3O2WH 1HCZA 5HYIA 5C6TL 3EYSH 1XGZA 4MNGE 1LGVA 1BFVH 1Z9SB 1BXVA 3ARDB 4O00A 1HJBC 2OPCA 2XN9B 5F7EL 1IIKA 5C0GB 3IXAB 4OFPA 2OX5B 1TLKA 1JYWA 2B0SH 2IH3B 3BAKA 3KR3L 3KYAA 2N56A 4ONHA 3VFNA 5F0MB 2ZUSA 1E4XI 1TZHA 3BLPX 3IDMA 3ZZSA 1FL6A 4NZ8A 3KDPB 1JYVA 5KANI 4FQIL 1KCBA 5LCVA 2J1YA 3MZTA 4ZX4A 1G7MA 3KPOA 4X7SH 1A21A 1X5JA 2OZ4A 4M7LH 1PDKA 3FB8A 3L9EA 3DVGB 4YSSA 4PCKA 1BREA 2JCCA 3E7JA 4P2OB 5DWUH 1L9TA 2CLVA 1BLIA 3L3KA 1CG9A 1K8DA 5K1JA 3T0XA 3HC0B 1BBJB 4HK3N 3RPBA 3L3HA 1QZ1A 1A6TA 4DP2X 2P24A 1OW0C 1OQOA 3JWOL 4DP8X 1I7TB 1L9RA 2VL5A 5HP5A 1HQRA 2DRUA 2DL2A 2K1MA 2FHFA 5EBMB 2Q9OA 1MRDL 3QEUB 4X7EC 1M6UA 4XVSL 1KJVA 1ETZA 5C0NC 2FEJA 1TKWB 3QUYA 3LMJH 4EZMA 2VWEC 3U2SA 3LQAC 3BVXA 3S4SA 2F1EA 3MTXA 1GGIH 3SQRA 4Z7OE 2BP8B 4GXUM 5ALCL 1WUZA 1IBYA 4YLBA 4K3DH 3EHBD 3UGXA 1NM9A 4G3YH 2LE9A 4PB9L 5TGBA 3WOVA 3CZNA 1BAFL 2H6PA 2DDQL 1KB5B 1SQMA 5E2VL 1XTLA 4NJAH 2WXMA 3F7VB 4OB5H 4KZCA 3HE6C 2W8CA 2VERN 4EI5C 4FLSA 2KERA 1FHNA 1NIDA 5C9JA 3V7AE 3GHBL 4JM2B 5DMKA 2Q8BH 1AHWA 1INEL 2JKRM 1MCDA 4JZNA 4KZDL 1R3LB 1XH3A 3GIVA 3QDAA 5BRZD 4PVBA 3HBPA 4KNUA 5E4AA 4S2SB 4M1DL 3SGKA 1E5BA 1M7IA 3PP4H 4Y19A 3C60C 5LCVL 1S4IA 4GEJA 1CXIA 4QR7A 5D1XD 5DK0B 4JFQA 1A6VH 5J13C 3KYNA 1E9OA 2YAOA 1UJ3A 1V54B 2R83A 5DEGB 3ZO9A 3QYNA 3O0RH 3T3MF 3DOSA 3G5XA 2F53B 5F1NA 4ZTPH 1CDHA 3UBXB 3UTZA 3LKQB 3WNJA 3KLAB 2J12B 3Q1SL 4G72B 2VN6A 1GHFH 4G8GB 4NO3B 1LP9A 5D4HA 5AAMC 2C34A 4G6KL 1FFOB 2AAAA 2OSXA 4AKQA 3OB8A 3UBGA 1U3HB 2H2SC 4PP2B 3BKJH 4BKLB 2VLKE 1MRCL 1QQDA 1MFBH 5EUKA 2J44A 2VUKA 3J2PA 4H0HB 4YVUA 4H20L 4HCFA 3KLLA 4JRYB 4Y19E 3VG9B 3VSVA 5CJQH 3BEWA 4BK5C 3AS3A 1YUHA 4NFCA 4WU7B 2CK2A 2ATPA 4JPIA 4FKKA 3I74A 3W2DH 1HVXA 3MDJA 2VUOA 3VXMD 1QD0A 3NA4A 5HYFA 4Z6AT 1HEZA 5KSAB 4G5ZH 2XTJE 4YDVA 5F7MC 4YWGL 5ES4B 1S7UA 1CZ8H 3O3BB 3PFUA 2JI1A 5HGDB 4N0YH 3WKQA 2A0LC 1VZHA 1NZRA 4FQLL 5GGTA 3V8OA 4B3VA 1CD9B 4GI6A 4P5KA 4XRCB 2YA0A 3ULSB 5KBLA 4APQD 1Y7VA 1FO0H 3N91A 3RX5A 3NH7H 3WO4B 2VDPL 3PWJB 4JQIH 3STBA 2CRIA 3PABA 4U0QB 1MJ8L 1CDJA 4CC4A 3OWRA 5KG9A 2QL1A 3QP3A 5JTWA 1H6FA 2BC4A 5AFAA 4LFHD 1RZKH 4GO6B 2NT1A 3W37A 2OJEA 3GM8A 2IV9A 1RY7B 5I0XA 3WIIH 3QQNA 5KVGH 1J7VR 1CE1L 4F15C 4LGRB 3DTUB 2AQ1A 1OSPH 4PAZA 4ZO8A 3L3JB 5DHYB 3NZHH 2KDYA 2DQTH 3V6OA 1H0DA 2WXOA 5F21B 3HPLA 3QIBC 5TQ2L 1TG8A 4NUJB 5JYMA 3IGAA 2WPGA 1EFXD 1T89C 2K6ZA 1RHHB 4NP9A 1X4YA 5KEZA 1GPOH 1F4HA 3VWKD 1LO2H 3GS0A 5MERB 2X4OA 5FA4A 3ESNA 2CO7A 1M1XB 3HIZA 1UA6L 1EO8H 2EAEA 4GRLC 3LRSB 4YDIH 2Y6SC 5I73C 3AU1B 4KK9C 1KXQA 1OP4A 2FWSA 4N87A 4QKXB 4U6VL 3I3DA 5ITFA 1TITA 1USQA 5FGRA 4YSQA 3FB7B 3ZL4H 4HS6A 4KTDH 4RAHA 3MA9L 2D8KA 4MDRA 1KGXA 1H3PL 1X7SA 2B8OT 5TDPA 2YPKB 5FYLD 1SVCP 4AQEA 2CJSA 1AP2B 4PREB 5JXED 1T0NA 2YUVA 3ATBA 4NUQA 3QZOA 4I9WD 4BQ8A 4F37F 5FHBL 2B1HL 1LEIB 1L9SA 2QKIC 4G82A 1NWPA 2HG5B 1F58L 2WWKT 3HAEA 4K94C 3KPNB 1KB9J 4NQVB 4O2EB 5IMKA 5IK3A 3VFRA 2ITCA 4LO9A 3FJTA 1OB1B 4QXGL 1ZGLM 5C08E 4HKBA 1JNJA 3T4AC 2CKBH 2Y4SA 4BE5A 3GKWL 3CN0A 1QFWL 3MNMA 3Q6FB 5ESAB 1K4DB 3DXAE 3SQOH 5GGRY 1E3FA 3N40F 3APCA 4LLQA 2IWEA 4I8DA 1BFOA 4I3RH 1ET8A 5ABAA 2WXLA 4DKDC 1P5UA 1J5IA 2WXJA 4XP5H 5KWYC 4KRPC 3NP3A 1DJWA 3SKOA 2ZWSA 5JW4N 4QOKD 3CQPA 4HVBA 3B3IA 3P3RA 1MDAA 5JHDD 1H8OA 5EMYA 5IGXH 3FH7A 5TJWK 3NJGA 2VSMB 2JK5B 2CA3A 1KSRA 3REVB 5CR8A 2N7SA 3IJEB 1GGIL 2DZEA 5BOJA 5C0FA 3G5YA 1I8AA 3HB3B 4PUBL 2H2SD 1WFJA 4GSRA 1CFVH 2DICA 3BDYL 1ZA3B 3OMZA 3CHPA 3HCVB 1ZDQA 4NQSA 2E7MA 4XPFL 1R3KB 2ZWLT 3RZCC 1IC7L 1U3NA 3TN0B 5I8EA 4WWKC 4YZWA 1QFWI 2EYRB 3S48A 4F8PA 4WSGA 1D5XA 4AYMC 5I1DA 4ETQA 2ZOOA 5BZDB 4JR9H 1OTUC 3M17B 1WE5A 5FUOL 5DQDL 1I8KA 4FMFA 1JGVH 2DS4A 1MEXH 5JR1H 1A4BA 5ETUA 4X99A 2WQUA 3DX6A 1ACYL 2DMBA 5CN1A 5DJ2A 2R9HC 4G9FA 2AI0H 3NFNA 2AQSA 4UANA 5A16A 5AD0B 4PJ7F 2AJVH 4KROC 1I1AC 3VRJA 1DSWA 4FJYA 3PYCA 4LSSH 2NY3D 4RBPH 2AQ2A 4K7FA 3UJIL 5FGCB 4N0CD 3AS2A 3MRBA 3VI4B 5CGBA 3LIZA 4FQXA 1UH4A 2V33A 1KF9B 3FMGH 3TFKD 3VXMB 1IUZA 4OLVH 1OPGL 4XP1H 2QTVA 3BEWB 3M8OH 4OLWH 3U0TB 5E2JA 1TVHB 4M9OA 3VSTA 3OZ9H 5DJZB 3BWUC 4HPYH 4JO5A 3WFBL 2VLKD 3LH8A 4WI3A 5HY9A 3A67L 1BWMA 1QAWA 2BNRB 2VDQH 8FABB 2WIIB 2YSSA 3ZXAC 5GGRB 5SX5K 1J10A 1UD8A 2NZ1A 4YQXL 1FV1A 2VAAB 1MFBL 1WITA 3UBXI 4H8WC 2NW3B 3VGBA 4A6YA 1ONQB 4WLCA 2D0FA 2R0WH 4TN9A 4I0CC 5TF1H 1DJHA 2B1OA 4HUWA 15C8H 3SPHA 3JUYA 2N0MA 4Z7NF 5F9DC 2ENSA 4ODXB 3UP6A 1P7QD 3FT4B 4RFOH 3QUML 4BRVA 2QV2A 4O2CA 5C0RH 2F08A 3UMTA 1XX9C 3KPPB 1YEDB 3S88L 3FQXA 4G6ML 4IRSA 5FO8A 1J05A 4YN3A 2QQNH 3U4EB 1PZAA 1PW3A 4LVHC 5DZOA 3FU9A 5MI0B 4KRNA 5CP3A 5GZNA 4PW9A 1XB6A 3FCUB 5FW6A 2V2TB 4NERA 3VE0A 4F8QA 1G0YR 1IBHA 3CJJA 1X9RA 1JCVA 4Y16A 1RHHA 5IHUL 5I1GH 1OP5H 3NZ8B 3B2VH 2NSQA 3GSQA 1OCWH 4Y2NA 3TPUB 4AVJA 1HDMB 4LIQL 4NAJA 2CJTA 4ZPVA 1CDGA 5DJDB 4ZS7L 4IMLB 2JLPA 4XI5C 1YDPB 3O4LA 4OKVA 2P52A 2EZ0D 1IFGA 3IVKB 2DQJH 3W1ZA 1HYSD 1MLCA 4F2FA 4S0SD 5IG7A 4NKIL 1RK1A 1WD9A 4U7KA 1QTYT 3PXLA 2FEDC 4BZ1L 4MD4A 4AM0Q 3WUZA 1D9KD 4PREA 1YJDL 3DX9B 3V6ZA 4JN2B 4UAOC 4LDCA 4HD9A 4GRWB 4O02L 5ICXA 3VXTA 3JTTA 4P5TB 4YDIL 4B5EA 1JK9A 1KXVA 4Z78A 1QTSA 3H53A 4IIQB 4ODUA 3RL2B 3ULUF 5K1NA 1FZOA 4LAQH 4ADJA 3KS0J 5T3XE 4G8IB 2MQ3A 3KXFA 1KLGB 2YAMA 3TCLB 2FJHA 3A3YB 4GYBA 4JFED 2DYRB 2OSLA 5F7KC 5FR3A 2DLHA 5CUSH 1VCBC 3AB0B 4L05A 3QIUC 4OCRL 3N1FC 4XE0A 3MMEA 5TF0A 3U1SH 5DZNA 1DUYB 1JZFA 2WBKA 4HG4J 3DSNB 3GQFA 4JM2F 1TYJA 1QI4A 1XAKA 5LGHL 3NQIA 1S8DA 3EOTL 4MMZB 5ERWA 4YDNA 3RDTC 2DQHH 1KBBA 2JSFA 3I9PA 3AW5A 3WTYA 3TFBA 3O3DA 1THAA 3PJNA 2QGEA 3DRTB 4YAQB 1EO7A 5IV2B 1PLGL 4G6AC 4ZX5A 4B9FA 3G9AB 4Y2OA 4DCQA 2GTWB 3GC3A 4Z5RA 2VDPB 3EAKA 4ES9A 1KIRA 1IAIM 5CHNB 1AD0B 5GRZA 6CGTA 4RZKA 3B43A 3CZUB 4I3RL 3VGAC 3EYUL 1AR1D 2HFTA 2CNYA 3EFOB 1CGXA 3ARGD 4QRPB 5HPMA 1QSFD 3VFPB 3QUXD 3UZEA 3WELA 4FABL 5DLLA 4BZ2A 4Z7AA 5DDHA 2J5LB 4BHUI 1YAIA 4FQ2H 4WFED 4S1SL 4XBEL 4R4FH 3FT2B 1FDLL 3KH4A 5K93A 3MJGX 1VDGA 4BFBD 2X4RB 1U8NA 1Q94A 2FECL 4XMLH 4AQ1B 3RYMA 3SKJH 5IHLB 1MCNA 4Z7VB 3OPUA 5CP3H 2P28B 5KTEH 2X1OA 5C0AB 1NMBH 1BV8A 3BVUA 4PEEA 3SKNB 2JB5L 3FU0A 1SHWA 3HG1E 5CKGA 3O9WD 1IIIA 3MPCA 5E1QA 2APTA 3E8UH 3ALWA 2XWJB 1CLZH 1LD9A 1DJGA 1RIUH 4R5VA 2FO1A 2NXZD 4AEFA 2G3MA 2MKLC 3CNKA 3FB5B 2ZX8A 2B59B 3JZYA 3QYCA 4P46B 4FX5A 1LILA 4HOXA 2BFVL 3ATAA 3X3FL 3MQIA 2Z8WC 4UTBH 4NXSA 5DMJB 4B9GA 3PDOA 1DQDL 3CSBA 4O4YH 1AGEA 4LSRL 3K6SA 4YHLL 3FF7A 4E41E 1ACYH 4KI5C 3RFRA 5AZUA 2KH2B 2VMEA 4MAYD 5HHOB 5IWLC 2EC9T 2CGZA 3UBFA 4YK4B 4C57C 5DMGC 3FRPA 2MCAA 5CJXA 1JAEA 5LO7A 2AITA 3QDMA 5C0JB 4HUVA 4F5CE 3T4YB 5L9DH 4FLHA 2Q7AA 4BSVA 1ORSA 1DQVA 1I75A 3S36L 4BUQA 5K9KB 4XNXH 4FXGB 4K5MA 4ZYKB 4HFWB 1XF4B 3FSVA 4HC1A 4K71B 4WKZB 5F3BB 5KVMC 4JFUA 1FSKB 1PJWA 2R29H 2XPGA 4WFHE 4PGZA 1BD2E 3HG0A 2X6UA 1QNIA 1P5VA 1U3YA 5DZJA 5I18H 3A6BH 2HX8A 4HHWA 5ADPL 4MQ7B 4XMVA 1PNDA 1OQXA 2NLJA 1XH3B 3A4AA 1U42A 4LHJB 1B2YA 5KOVC 4AC4A 3K8MA 5IKCA 1IBDA 4TL4A 3FTZA 4ODSH 1PD6A 2WXHA 5EZJB 5FO9A 1FYTA 3D0LB 2WXRA 4JG0L 2CO4A 1A14L 1X4XA 2X89D 4Q8BA 1TTUA 5DUPL 1SEQL 3F12A 3UAFA 4RSVA 1HEHC 1RJZA 3FBKA 4P4KB 5CCJA 2AXFB 4PI0A 4NT6B 3LY6A 3LIZL 2WGXA 3TIEB 5DYOB 2BSBA 3U4AA 2OMZA 4JGNA 1UVQB 5F9WB 3BH4A 3VYOA 4ADIA 2O6FA 4IHOB 2WXNA 1NLDH 1ZLUH 1B4JL 1ODUA 1GGCL 3ZZLA 2V2TA 1M71A 4LSPH 2YOCA 1J0JA 1FORL 2QV4A 2CJUL 4UQAA 1EVUA 4WWID 4LOFA 1AXTH 2NX5A 1E8YA 3DMMD 4Q97A 4QF1A 2IANB 2NY5H 3A23A 2NSXA 3T4AB 3U9PL 4QYAA 1MHEA 3ZDZE 3WFHB 6PAZA 4J3OF 4N1CA 1RZPA 4N26A 5T1LA 3FUNA 3G3LA 5MEPA 4HH9B 1JGUL 1V3JA 4Y16D 2WKOA 4H8VA 1BW8A 4Z7VE 1BIHA 2APSA 5I1JH 5I1AB 3MLYH 1M42A 5I6PA 3EJUA 2GJPA 1QNZL 1SJEA 4EKXA 2Z8RA 3T65B 2ZG2A 3TH3T 3HZKA 4I5BB 5E8PA 5LQBH 1D5BA 2XHNA 3UTTD 5EU7C 2X1WL 4NYLB 4LIQH 4U1IA 1PD0A 3LCYA 5IHZA 3O8XD 4OLUL 2C9QA 5K9OB 3O8XA 2DQUL 3K6IA 2VXTL 2EIDA 3K46A 1X3DA 3MAWA 4YBLB 1ED3A 5A43C 4Y4KA 1MCQA 1IB5A 2DQJL 1J12A 1MZYA 4TSBH 2LAAA 4BKSC 4FQHA 4JCLA 3R06B 2CA4A 3DNKA 4GRLA 4GQRA 4J23A 4L1HA 5IMMA 3ABKB 2V6HA 4K8RL 2VDOL 2IBZX 3D85A 4B27A 3UTSA 4ABWA 1BWWA 1E50A 2J88L 5HYSA 4GUOA 2QSQA 3EJSA 5I76A 5IEHA 3HB3D 3IDXL 2IALB 3BKCH 2QVKA 5DVLA 5EFIB 1FVCA 3UPAA 1REIA 2WLKA 4CKVX 2Y0SA 4LL1A 3MLPA 4GBXC 4DQOH 1XCQB 3HUJA 3MXWH 3DV6B 4QGTA 5JXEA 3O6KH 1RPKA 4L9LC 4HIHA 4KKRA 4MB4A 3ULUE 1G0DA 1VPOH 3HHSB 1WO2A 3OJDA 2EVHA 4WUUD 4D8PB 3H85A 2H1LM 2VDLL 2DM3A 4HPOL 1ZE3C 4NM8H 3T0VA 1FNEB 2BVTA 4UIKL 4ELMF 4N8VB 1KTLB 3RWIB 3MCKB 2BHYA 3MFGB 2Y5QA 2J6EL 3CFIC 4HZLA 2XVKA 4P3DA 5HGHB 4GKSB 1GGBL 2CMRL 3SEPA 4GXVL 5CFHA 2OL3H 4XVJH 1I53A 1EHXA 4AW4A 4UILL 4PV8A 2VISB 5EF3A 4PJBE 2DQFA 1WA1X 3UG5A 2DTMH 2CRYA 2VW7A 3K2MC 3GBMH 3QQ4B 5LBVA 2ZOLB 1NCAH 1KEGL 4F7TA 2DWSA 1LDSA 2ADIB 4BH8A 2IH8A 1PEWA 4FLQA 1CFSB 5FK9B 2DMHA 3NCWA 4PBVC 4NEHB 2ZSVB 5LJYH 4LZKA 1H15A 4FQ2L 5EC1A 1DCLA 1JMZA 4JFZH 4Z7QE 2I26N 5IJDC 2OLDA 5JPMA 1O5PA 1WYJA 2R1XA 4HJGA 3IJHA 2PYFB 5D1ZI 4Z95L 4NZTH 4ZMPA 9CGTA 5I19H 2GJJA 2B77A 2QQKH 3MODL 4M6NL 2VAJA 3DROA 5GSRA 3I6GB 2DBJA 4HA1A 1QRND 1BQSA 3ZMNA 4TTGA 1C16B 1E8WA 3IKKA 4OV5A 4IU3B 3JWOC 2D7QA 1W0VA 3KWUA 1VFBA 3C6LA 1L0YA 3TBWB 3X3FH 3HG4A 5FXCH 1BM3H 4DKAA 1GKOA 5DSCA 3V2AR 2C3VB 5B4MD 2CU9A 5BV7C 1FH5H 1P5VB 2R0ZH 1KULA 3DOHA 4RZCA 2B4CL 3L7FB 4WEBL 1XF3B 3FCTA 3WYRA 5SWQA 2WMPB 3BEVB 1ITCA 4YX2H 1XZWA 3COOA 4HALA 5BXFB 3QC5X 3WKMH 4ODHH 5DC0A 4LSTL 5KYXB 4PJAA 5IB1B 2WP3T 3KHQA 4U33A 2WQVA 4UF7C 3R8BB 3SCMA 1OAKH 3RTLA 1CLOL 1BZEA 1YLBB 2R29L 3Q3GA 3QFDA 4D3CH 1MWAB 5CCKH 2DEYX 1CVRA 4DOHB 4QNPE 2R0LL 2NTSP 1N5AB 3PDGA 2W0FB 2AQPA 3AXLA 2BVPA 2G9HB 4WDIB 5C08A 4LVOB 5I9QC 3EDFA 1YC8A 2FBRA 2JKSA 4EUPA 1F2XK 2ARJQ 1CL7H 4ODSL 2NXYC 3FQTB 3O6FC 2WOBA 4NENA 5T5FL 5JIIA 2BSTB 1WGOA 1SEQH 3QXVA 2JJUA 3IDIB 4FFZH 4NNXA 4PJFA 4W9CC 4BM7A 3S9DB 3P40A 1EJOH 4YXLH 4JFDB 3AQDA 4LNRB 4Y4HD 3ZDYF 5TE4H 2YXWA 3DC0A 3ZO0A 3OX8B 4KKLC 3L3IB 3TO2A 1S9YA 2F74B 1PSKL 2V9UA 1A6ZB 2VW6A 4PRNB 1Z32X 2BNRE 3E1F1 7PCYA 1UZGA 1QOKA 1PZ3A 4NQEE 2UY6B 2Y6SD 2O6EA 1XB3A 2P8PB 4PRID 3NIGE 3T65A 3ORJA 4GSDL 3V0VB 1Z9LA 1I3GH 4EQ3A 2ZUTA 1TQSA 2AEQL 1I1FA 3GSNH 3DJRA 4IBWA 3E80A 3B9EA 4U1IB 5IHZB 3UGEA 5LNEA 4PWFA 5SWSB 4KJWC 2OZ4L 3NCEB 4OLXL 4Z7WE 4HU2A 3VXOA 4H2AA 4M7JH 2OSYA 2TSAA 3FOLB 4RMSA 3KM1A 5H35A 2MRYA 4Z9KB 3WG7B 1KC5L 5E7BA 3PWLB 1PZ2A 3L6FA 4PJDB 5DEFA 2J1WA 1R75A 1Q9WB 3SDCC 5E8DL 1R5IB 2NY1C 2BIHA 2NSMA 4JHUA 4YDJB 1MCFA 1IZJA 3OKEB 4LSDA 3VD1A 1NCOA 4QXWA 2IQAA 2IWKA 3FU5A 5I1HH 1IC0A 5I8CB 5EEVA 3WNKA 3UL4A 3Q2VA 4JFEE 4QT5A 5F6HJ 3C5ZC 2COVD 2IBGA 5CJ8A 2V7NB 5JORA 3MV8A 5DJ0B 5AOZA 3EJZC 3RKDD 2C3GA 3P4NB 5HYJD 3I9IA 4J1UA 3P2DA 2KQMA 3TJPA 5D5MA 3QORA 1DVSA 1DP0A 3FZUD 4ZAKD 3TVMC 3RU8L 1EH9A 7PAZA 2DIAA 4XVOA 1LE5A 3TO4C 4GFXA 1NCDH 2OR9L 3QRGH 3TA3C 3V0JA 4AQAA 1J18A 1UKTA 2FT6A 1AY1H 2YJQA 2B08A 2IADB 4Z7VF 4JB9H 2W92A 3SDAC 5FYKE 2UYLB 3IDXH 4HWZA 3LX9A 3W5MA 1KPRB 3LKRB 4CVUA 2XV3A 4PVLA 5ICZA 3C8KA 1AVAA 3HJ0A 2ZPKH 1A1MB 4PJ6A 4YHYC 5JXAL 2FJGA 1F4AA 4GXFA 4FTVA 3JVFC 1LXMA 5F89B 4PJAF 1QABA 2WNGA 5FM5O 1J1XL 4LGPB 2I60H 3RI5K 5C7XH 4J3BA 3VRLE 2FX9L 4H8WH 2YPVH 1V7NH 4FZ8H 3HZYA 1MJUH 3EYOA 4I0PC 1OWRM 3BZ4A 1KG0B 35C8L 25C8L 3FSZA 5KBNC 3F04A 3H9YA 3SDDB 2QSCL 1AQDB 3VXRD 1TSHA 4XR8C 3F7VA 2X4NA 2VDQB 3WS6A 2HFFB 4P2QA 1D6VL 3F8UB 3VFGH 3BW9B 1HHHA 4N24A 3BAEL 3UAJD 3V4LA 1LMIA 5D2NB 3AAZB 4Y8DC 1YEEH 4LCCB 4DK5A 4DGIH 1N8ZB 3BUQA 1AXSA 1MHPL 4QYOB 4RFNC 2ZNXA 4Y1TA 1M2OA 3LQAH 3QC6X 3TLRA 3RJDA 3RA7H 4TQEL 2CCVA 4ORGA 3GSVA 3P3YA 4PJ9C 2KZBA 5T3ZH 2AJYL 2YN5A 3CDFA 3VU2A 3PL6B 3OKNA 2HYMA 3D6GA 2PCPA 3WFDL 3K72A 5EDXA 3MV9D 3NCMA 3NIDF 4XC1H 3S97C 1J0ZA 4IGBD 1KFGA 4QHPA 3BQVA 1F02I 4HCRH 4CSTA 1NBYA 3QNYB 1XGUB 1EZSA 4WGVB 4OF5A 5FV2A 1MJ7L 3MODH 4BV1A 4U6YB 3D39D 3QZPA 4QHMA 5IFAH 4Z3TA 2WN3A 4AENB 2EKSB 2FR4A 2EDQA 3NIDE 4PCYA 3FQUB 2BP8A 2OXGA 4YSPA 3CFJA 2ERJC 4YPGB 5CN2A 3ENEA 3P9LA 4G8AC 2NY7H 3N43B 2CALA 1UD6A 5A6MA 4UYPA 1RZFH 3MRRA 2FIKB 2OMWB 3II1A 4WHYG 5JMRA 4YIQA 5AYTA 3V7MA 2A73A 4WY7H 1J48A 3I9GH 1DLHA 2FO8A 1IGIL 1RZGA 2C7UB 2MNJB 1HE7A 1JGLL 2FQDA 4HLEA 1PG7L 1FC2D 2BIOA 2CDEA 3LZPA 2ZCHH 3OC8A 4IKLA 3KYKH 4L8DA 4QKTA 5CEZL 1ZSHA 1IM9B 4QRSB 3WS3A 3EJYD 4M3KB 2ZXCA 4D94A 4QOKA 1TQVA 3QWQB 3WE6B 3WI9A 1LQSR 2IH1A 1YEGH 3EYFB 4FNPA 2G3ZA 4JRFA 3BQUB 4GP4B 3S3DB 4PRHB 4OIFA 3S3JA 5I66A 3VFMB 2LTQB 3R8QA 4R26L 1X4ZA 1PZBA 3QIWC 2ICEA 4AIZA 3EJCA 4BA8A 3M7OA 3S35L 4A7TA 5AVRB 4F80A 1U91A 3RHWF 5C0AD 4A6YH 4XWOD 3GKZA 1MCWM 3WL9B 2R27A 4JQVA 4PD4K 4UQCA 3GLZA 4XXCA 3SGEH 5EU5B 1TFHA 5HBBA 4UNUA 5JHDE 1U3HA 2I7SA 4U7SA 1THCA 2VXSL 1T6BX 1KPUA 3CZEA 1A9BA 2GJ6D 3MACL 4H4NA 2EUWA 4NBXB 1BBDH 3MRJB 3MOAL 1YEWA 1P9MC 5DHVH 4E9YA 5KVDH 3ARFC 1KLUB 1Q1JL 5CD3B 5KJRH 4N28A 1NFIA 1Q9WA 3PGFH 4TPRH 5E03A 4OCNC 2VXUL 3GSNL 2QDVA 3U30B 1JS4A 3D2TA 2R2CA 3J27A 3GMLA 3CH1A 3MYJB 4JLRA 3ZX1A 2EH7H 3IXTA 4R83A 1S3RA 2CDFA 2ZCLL 3UYPB 3MLSH 2VM4A 3H3BC 2MH4A 3BUIA 3LQZB 4LCUB 4FA6A 3LKNA 4PCTA 1GH7A 5TDPB 3L4UA 5AVVB 5I16A 3W9DB 1G5AA 4TLKA 3SBWA 5D71L 4GRWF 3CFUA 4E5XB 4Y5XC 1D7FA 5ANMA 4NGHH 4L4VB 3TBYB 3L4YA 5F7WC 5CNHA 4P07A 4KX9A 4QHKJ 5I30H 4K15A 1VADA 3SBRA 2FTAA 4MA7L 5IIEB 4LMQE 1QUPA 4P05A 1AIFA 1HI6A 5CFAA 1RZIB 3T0AA 4JANA 3Q8FA 3AC0A 3G6JA 4HX1B 4NKDA 3B56A 1N6QH 4I18A 2O5XH 1DVFA 2VJ8A 3EJPA 4KXZI 4J6RH 1Q9KB 5DXWA 1HCVA 4S1QH 4HZAA 3UTOA 1C5CH 3QIWB 2WB7A 3GI8L 5JW3L 4QXUH 4R8WL 5BVJA 3G6JF 5IB5B 4EIGB 1N6VA 3PPSA 3I75B 4JFFB 3ZE2B 4PG2A 4CKQA 3DX8A 5HJBA 1FVEB 3VD2A 4XMTA 4PQXA 4PJHF 5DWPA 1CU4L 1AYRA 4BGLA 4NRYA 1UZ8B 4KROB 5C0EA 3FXIC 4ZFGL 2Q3XA 2CUIA 3OMIB 4GKZB 4TVPD 2XIDA 1DEEB 1EMTH 4X5XB 3QRBA 4U1JB 4ENEC 5IB3A 3SDXB 5B22A 3ZTNH 1CLCA 4AC2A 1P7KA 2PYED 1T4KA 3VB8A 1ACZA 2P8MB 2NR6A 3MGTB 2V2WB 3JYCA 1OO2A 3NFSH 1H5BA 1KPVA 4QIRA 5F7NC 4I0PA 5T1KB 2UV3A 3W9EA 5F9OL 4ZUSA 1S7SA 2V9QA 5CZXD 4DEUA 4HDIA 4WWKB 1DDHB 1JPFA 1GCFA 5CZXC 1FVCB 1P53A 4GQ9H 5GS1B 1QEWA 1CGVA 2BS71 1J5DA 2Y06L 3HB3C 1K3IA 3JV6B 3O4OB 3NN8A 2I24N 2X4QA 1Y6NR 3BIAX 3L4XA 1DJZA 3IN0A 2ITDB 1TETL 3N41B 4C8XA 5E7FA 4HIHB 4KKCC 5CP7B 3WY2A 1QKZH 2JB6A 3CLFH 3UFIA 4HUUB 4PV1C 4J8RA 4QRQA 3RA7L 3PGDB 4F5CA 2UZIL 4H1LA 5JIQA 4BWUA 1IO4C 1YC7A 1ET7A 2YMTA 4MMYA 3P4MB 4PJ5A 2N7BA 4KMLB 4AYFB 3VD7A 4PS4L 1OAXL 5J6GB 1I82A 3ZRFC 3MOBH 1NCIA 4HZLB 1HNYA 3O6LH 4GFTB 2E46A 1MIEH 1KELH 2X6BA 3LNFA 3PJSA 4OZIB 1I4FB 1NOFA 5MEOB 1ORQA 2UUDK 3D2UB 3V6FA 5D1ZA 3S3PA 4TVUA 1KIUA 3RTQA 1Q90A 3VI4E 5E1HB 3FCBA 3GTNA 4M3JA 5IFAL 3TX4A 1L0PA 4N5EC 2QJDA 3GIZH 3O0LA 5HHQA 2FLRT 2BY0A 3KYOB 1MH5B 4EDXB 2FX8L 3BX7C 1CBVH 3IPEA 1WSST 3C6LD 3SE9L 4F92B 4U1SB 3U6XA 3T2NH 1XCWA 1BJ8A 3VFOA 1S7RB 2PPDA 4D9RE 3DMMB 1TEYA 1YEHL 3BVNA 2EVIA 3ULUL 2P5ED 3MUUA 5JOFA 5GJSL 4QY8B 1A1OB 1KGCD 1SPDA 3GXMA 5BRZE 4G8EB 3KBFA 2HT3C 4OZFB 1EGJL 5F0LB 5CBAA 2DI9A 2ZCHL 4U49A 2CUHA 4YHYB 3PLYA 1Z3GL 3QUZD 1OTTD 2E9WA 2J21A 5D2LE 1Y1DA 2EXSA 4NLAA 3SDAB 1SFDA 3JTBA 1UA3A 4AZ8B 1GY1A 5GRJL 2OI9B 3ECQA 3HHMA 4W9GC 4XXDB 3QWNA 1XTMA 1U92B 1IBZA 2VLRA 4D9QE 3SJVA 2B2XL 3D9AL 5DT1L 3IBOA 5DJXB 5T1MB 4ZSOA 4UDTA 2MPAH 2ZUQB 5ENWB 3P54A 4FQJL 2TRYA 3QEQD 5FDWB 3CK0L 1DBML 4ZFZA 3K91A 3MI6A 1TZ8A 4GY4A 4HIEB 2OTWA 1R24B 1SXBA 2EXTA 3GSQB 4JZOB 5EG6C 4ZFOB 4ATTA 2I9TB 4IBYA 1ZGLB 3MFFA 3F7PC 3V0FA 4P2CG 2BJML 4L4JA 1AGCA 1JD7A 2X4PB 3PXJA 5GSVB 3HE7A 4YFLI 1HXYA 3MA7B 1KJ3L 1W15A 4F58L 2BVQB 3SDCB 1K5NA 1DBJL 4WI6A 3WLBA 1BBDL 2BP0A 3AY4C 2XT1B 3PUUA 4FI7A 2F8IA 4YZFF 4XAWH 1YY8A 3BUTA 5J9PB 2A6IB 3PGFL 2Y5TB 5SWSD 1FGNL 5ECGA 4KROD 5LGKA 3UO1H 1G9NC 3UPRA 2BCMA 1G7PB 5MP6H 1P84J 2VQ1A 3FTVA 4PMEA 5LAXB 1ESOA 2Y7QB 1KTCA 4GRWH 4RMWA 4MDIA 1GJWA 1ZDSA 5FKPA 1GS6X 1HHKA 5GGQL 2V5YA 4NPJA 1B90A 5BZZA 2EADA 5A2CA 5AWNL 3CLEL 1MY7A 3KPRE 3IGUA 3A47A 4RETB 3NABL 1DQQB 1I3RB 4NPYA 4MCZA 5E00B 1FGVH 3LB6C 2AK4D 3DGGA 1Q9KA 4UTCA 4AE0A 1F3RB 2XX1A 5EU6A 1OE2A 4I77L 3E38A 3GGWA 5HI4C 2WLNA 1U3JA 3DYMA 5BV7H 1U33A 1F4WH 1NINA 4Y4KD 1T04B 4B6ZA 4PTUB 4LCIL 4B41A 2YHGA 4M8QA 1IKOP 1ZLUK 3PWPB 4I0PD 1XZ0A 1N6QL 4NKQB 1NGXA 4BFEA 2J5WA 1QRNB 1U8KA 4F33A 4AH2B 4AMKH 1T3FB 4LLYA 4JY6B 4J12A 1KJMA 1UWEH 3LN5B 4YSDA 5F7YC 2WCGA 3PCYA 4QXUL 3NEEA 4R8WH 1H3GA 5ALCH 1NKOA 4Y4FC 1BCIA 4WFEE 1T1XA 3EFOA 4XZUB 3TONA 1YY9D 1CVSC 1OP9A 3NGBC 3OSKA 5J13B 2WWOA 1LWRA 2D03L 4YXHL 2YOAA 3MLVH 3H9SA 1F2QA 1MLBB 4DKFL 3TPKA 4ZUSB 4NUPA 1WZKA 2ZOWA 4DP7X 1ZTMA 3F2LA 5I1KL 4XVTH 2WYHA 5C6PB 2VH5L 2V37A 4LEEA 2B0SL 4EVNA 3HVDA 2A74B 1F4YH 2H32A 4WW1B 1YSOA 2AXJA 5DJYA 2O6PA 2XVLA 3G5VB 1PKQE 4MXQC 5G5DB 5T5NG 3SDXE 5GZOA 5BV7B 2O30A 2W65A 5I5MA 3INUH 3Q2NA 4RGOL 2ZYHA 2ICWI 32C2A 4DO4A 4H1LB 3WTTA 2IDFA 2X09A 1XAUA 3GSWB 1RZJC 2J8UB 1XIWA 2PETA 3W82A 5E5UB 5IQ7H 5FA3B 2F7QA 4H5SB 3WLWC 4M5ZH 4APQB 4BZ2H 3L95A 1P6AB 1LDPH 2OYMA 4WUUA 4PY7B 4CMMB 1YYLH 4ZDHA 3DI2B 3ZKND 1AS7A 2AGJH 5CD5D 2W95A 3FTUA 3IJ8A 4ZTPL 5L4IA 3B7UX 3TH4T 1SHMA 4F8LA 4OY9A 4TUKL 5TK2A 3V0IA 5KS9F 2JELL 3F5WB 4CGUB 3V0EA 2OXHB 3R1GL 3VXSE 3MHZA 1JI1A 5FCUL 3EF4A 4U1GB 4MGXA 4HOMA 1WBXB 1LNUB 4BKTC 1EEYB 4R5XA 3X17A 3BKJL 3H7LA 1ADQL 5D70L 3S98A 3AG1B 4G3YL 4JFDE 4PB9H 1FAKT 3AFLA 5HJGA 2F53E 5H2BA 4LQFH 5DEZA 5IJVA 4NKOB 5D7KD 2DDQH 5IVNA 3FU6A 1V27A 5TH2B 1DQJA 5D6DC 1AAJA 3Q13A 1CYXA 4WI5A 2GTZB 2G75B 2YPLE 4CADB 4AIXA 1QLRA 1G4RA 5BS0D 4HK0B 5L88L 4L3FA 5F3HB 4JFYB 3MRPA 4JRXB 4TVPL 4Z3GA 2GUOA 4MJ5A 5SX4I 3SODB 4TNGA 4Y9BA 5EIIA 4LHUG 4JVPA 4ZXBC 4AZ8A 4X7DC 4AVKA 3OXSA 4F2MA 1TDQA 2KS0A 3ZYZA 4EBQL 4LK4A 2GEQA 2VDPH 4WKXA 1URIA 5MEQB 1K6QL 4N2DA 5DI8A 2A4EA 1H8LA 4NO0B 3QG6B 1WPCA 3LS4H 4WV1A 1CGSH 3FN9A 4HIEA 1FZKA 4JFXA 1NEPA 2FBOJ 3MV7B 4HIIA 1PG7X 4NQED 3WIIL 5KVGL 2XQ0A 2ALAA 1ETA1 5F88A 1OSPL 2CPCA 4FRWA 5DF0A 1BPLB 3BGAA 4U1HA 4Y1AD 4WW2B 4WK2B 4LMQI 3LD8B 5D7IB 1HE8A 3POCA 1ZLVK 3CSTA 4U6HA 1JF1A 5EU7E 1MRFL 2CHDA 4PJ8C 2MPAL 2H0JA 3A21A 1XBDA 3NZUA 4PG9A 5DMGD 3WLBB 1ZWIB 5K5YA 3I84A 1WS8A 3GXNA 1A5FH 3B2UC 4X80H 3WBDA 4E9RA 2FZ3B 3EDJA 1E27B 4N68A 1XMWA 5F93C 1IU1A 1IM9A 2BJMH 3T8XA 3T1WA 1XF1A 2A38A 1P6WA 3N04A 4LIQE 3DUSB 2OBGA 2WLHA 4XXWA 3S5LA 1TZGH 3UTTB 2ADFL 1CQKA 4R0LA 2CO1A 4KBPA 3FUDA 3WKPA 4EXKA 5CZVL 1ZHNA 2D31A 4OUOA 4XAWL 4XNMA 1PQZA 4HLZG 1B6DA 3KH3A 4AJWA 4XNYL 3D85B 4PWGA 4Q58C 3DGDA 3TEWA 3FK3A 2EUVA 5EEWA 3NH7L 2VR9A 3ZSTA 3OHXC 5I15H 4PVMA 4X98B 2RCSL 1EEZA 1NKGA 4R2GC 3V52H 5IEHB 1QP1A 3HC2A 2QGDA 5D7LD 4EE2A 4FC3E 3HN8A 4Q56A 2RHEA 4BUGA 4F3FB 4V2CB 5H4YA 5HGBB 1A7QH 4BFJA 1S7WA 3PWPA 1CLYL 5BUPA 1DFBH 1HKLL 3O3AB 5AWNH 4PJEB 3MRDA 2ZUWA 5F72S 1Y6MR 1Z9OA 1ND0A 5EBGA 5K39B 5IB4A 3DV6A 4XNQB 5F1KC 2WO4A 3NZHL 1G7JA 2VRKA 3RWCA 4S1DC 1IGCL 2GITA 3ESOA 3EO9H 4MS8D 2AZAA 3T0EA 2BRRH 1DLFH 2X42A 3I02B 4K3EH 1TJXA 4P4KC 2EDYA 2B9BA 2IGFH 3V0AC 5FYKL 4P4KD 1M7IB 4ZOBA 4E36A 1FFQA 3IFOA 1GPOL 4NO5A 3G9VA 5M95B 4NN7B 1A22B 2NPLX 3FNKA 2OMUB 2VNCA 3B9KA 3IMSA 5ESQB 4J5VA 4ZFQA 2Z31C 3V5HB 3W56A 2EYSB 1OK0A 2PCXA 4XN4A 4X4XB 4I85A 1UWEL 5DEGA 5HYSG 1AH1A 5JO5A 3QULA 1SYSB 2VLME 3O6MH 3UDWC 2HT2C 1O9ZA 4OGZA 3GB7B 4Z76B 5JPNC 5H4ZA 1TNNA 2ZSWA 3ABLB 5TE6L 2XG4B 1AQKH 4N2CA 2QZ5A 3WTWA 3UTSB 3H7BA 3QPXL 2GC4C 1S2EA 3ULVE 1Q72L 3MLXL 4Q9QL 1MFDL 1OANA 1T7WA 3QUXA 4X6FA 1C08B 5E6ID 4JBSA 1F4YL 4PW4A 3ARGA 1TQCB 3WE1A 4HSQA 5JR1L 1MCIA 5L6YH 1RL1A 2CKBL 2ZF8A 1E6JL 1HQ4A 2BNUB 2YUZA 4FQQA 3RIAF 4KOCA 3NJJA 3WKNA 4ZW3A 2IJ0C 4HV8A 1J8RA 1S9XB 4BSWA 1Z9SA 3TBWA 4M9PA 4BFRA 1FZOB 1MAJA 3QG7H 2LU5A 3CZFA 4U3CA 5CZKA 5E6IB 2K78A 3JZ7A 4LHUA 4XP5L 3SZ6A 4UZSA 1NPUA 3O9WB 1OAUL 3LZOA 1IEHA 1ZHKB 3ZQWA 4RQQB 4XX1G 1JGDB 5A6LA 4KKBC 3L48A 1HL4A 4UT7L 3DGCR 4IBUA 1CD1B 4AQ1C 1QEXA 1FLTX 4G7YL 3T3PF 1XCTB 1NMCB 3RWFA 5KG9B 1CK0L 3F01A 1PDKB 4TV3A 4YC2B 5DZLA 3PS6A 3B6SA 3GEFA 4JGUA 3W81A 1R17A 3HI6L 4QJ4B 4Q6IB 4LLWB 3BGMA 2Y5EA 4BELD 1I7RB 4HHAA 1CFVL 3BDYH 3QT2A 3ZE0B 2DWYA 4PRIA 4CDGC 3TO4D 5E2WH 1GZHC 4ILDA 1N26A 1TZHB 2H26A 1VGKA 3VVWA 4UB0L 2Q86A 4APXA 1JTTA 4QRPD 2GKIA 3VXUA 2IQ9L 4XVSH 2XV6B 1ROWA 4BUHA 2B3IA 1SXNA 1NMAL 2P7TA 4M6OL 1T5KA 1YCSA 2LABA 1MCJA 2A9NH 4PHXA 1KENH 4M7LT 5FB8B 1FUNA 2ZXBA 3PNWB 2FL5A 3X12B 3LXCA 4W81A 3B2MA 3S7GA 1ZPUA 4YR6A 4O51A 1TZIB 4WEMB 2YKKA 1KBKA 3IM1A 2MQGA 4OIIL 1MREL 3MV8E 4F57L 4PGJA 1VACB 2X2HA 1WCBB 3KJ6H 1YRKA 4I18C 5IROD 1A3QA 3BN9C 1O6VA 3VYNA 1RSYA 2ICWA 3LHAA 3DVNA 5C6WH 5FW8A 3UJIH 1FL5A 3DIFB 4E9TA 2R4RL 4FNRA 1EAPB 4N8CH 5HDBE 3U7YH 1R6VA 2FCBA 4UM9B 1J5HA 4KZDH 1TCRA 4MB5A 3GT6A 4PJ5E 1CGSL 4Y5XA 3SCMD 3KYOA 1QBAA 4LU5L 2JIXD 3NOIA 3D33A 1KJ2L 3PAUA 2AK4B 3KPQA 4NJ9H 3VACA 3MLWL 1CLVA 4JDTH 1VAHA 4Y0GA 3QIBD 4Z7WA 2O5ZL 5EZLB 1SOXA 4NQDD 4WNQB 5GJTH 4PJGE 2VTFA 3WNIA 3AWGA 1T89A 1UQSA 5EO1B 1X5XA 4P23A 5H94B 3REWB 3RURA 1Q9OB 4P5KB 1KOAA 4B95C 1WWWX 3LZFH 3IAQA 3NFPB 1CF8H 2HFEB 3NIGF 1EHNA 5TE7L 5LKNA 4KH2A 4HIQA 1ITBB 2CHWA 4ZD3H 1G7LA 3KHOA 4FERA 4H1LH 4LF3B 4K2UL 1OK8A 4EF3A 3K8KA 4XCNA 1SOSA 3WJLC 2ZYSA 4WW2C 5TF1L 3FFCA 4I87A 3BVWA 5I8CA 1DDTA 1JUFB 1OCCB 4MNGA 4FJ6A 4DF9A 3EADA 4PJBB 3QDGE 4ALAH 5D6DA 1NL0H 1P4BH 4EN2A 5K9JL 1AKJB 1UXMA 4OUUB 2ZJSL 1RZJH 1G7QA 1UXWA 2XU9A 5CBEB 1T1WA 1DZBA 2E7CA 4LFHG 4JFDA 4LNRA 3OHMB 5FV1L 3SE4A 1KLFA 4DO5A 3UTZB 3KG5A 3RY6C 2XA8L 3QZLA 4YPJA 4ONFL 3WFEH 5J3HC 4ZJ9A 3EOTH 3N55A 4OM1L 4YE4L 2H0FA 1FI8C 1SBBA 5E5MA 1HKLH 2DOCA 2J6EA 1U3ZA 3R7RA 3VQLA 3L45A 2EDLA 3QHZH 1J1PL 5IEKB 3QJHB 4HS8L 4K3HA 3TEZA 4IU2B 3RGVB 3RL1B 2AXGA 3LHPH 5E9AA 3VQ1C 1KCKA 1HTYA 1MW0A 1NGWB 2XN2A 5HYQB 5FYJU 4GBXD 4K3EL 4ONOA 1AZCA 4G7RB 4TNEA 2CO6B 3JWNC 3P4OA 2PWDA 3JWNH 1YMHB 2X3BA 3MXVL 2M83A 4WNSA 1BX2A 1S9VA 3LZNA 4JNXA 4MHHI 4M61A 1JWSB 1BJMA 3ARSA 1E0OB 3GM0A 1AACA 3L4ZA 1E4WL 4K9EC 1U6AL 2K6YA 3BE1H 5FGSA 1BQHG 4NBYB 3GSOB 5L2KE 4GI8A 4F7PB 1FDLH 5B8CA 3QFJE 2H32H 4JKNA 1G1OA 5JQIB 2OP4H 2ED6A 1XGTB 4X0KA 4OTXL 1BSIA 4HXAH 4FADA 4KH9A 4O58H 4UT6L 1Z0NA 1UACH 1X5GA 1HNFA 3KLDA 3U25A 2WLJA 5BCAA 3UYOD 2X88A 2FH6A 3GXFA 4BK4A 2IAMC 5JHAA 4HGKC 4ZO9A 2PR4L 4ICWA 3HPLB 3QR1A 4RAVA 2VO5A 2PCPB 2KC0A 2XKNB 2APWA 1LEGB 3L3GA 1E30A 1EHAA 2PPAA 4IM8A 1WQVT 2C5DC 2C1OB 3N1MC 1I8LA 4W1TA 1OARH 3ARFD 2QKSA 3OLDA 5C07A 3MGAA 2BFVH 2CO7B 2FNWA 1V8HA 1U8KB 4HHGA 4KTDL 4DVRH 4ZBJA 1J5OH 3C8KB 1QUNB 2X4TA 1O7SA 4GBXB 2OTUA 4Y9CA 5L2KA 3D8MA 1VENA 1EBAA 1PLGH 2EO9A 2GCYB 5DGRA 3OJVC 3MRNA 2MJWA 2HA1A 2KLTA 4NHUB 4PU2A 2XFGB 4AQ8C 1UYWL 5EZOH 3QDGB 5ANHA 4Z8FL 4GMTH 1BQKA 2XXMB 3TN0C 3AU1A 3HS9A 3OF6A 5T33H 4W4OC 1JHTA 3SKMB 3ZRSA 1PL3A 4TUUA 1WD8A 3FQXB 5EU6D 2DH3A 4Z77A 5CSZA 2YFOA 2C1PA 2WZ0A 2XFXB 2HPOA 4X5QA 2C7UA 5E94A 4G7YH 1NFAA 4ZTEA 1YPZB 1AXIB 3AWEA 1R33A 4L3CA 1J11A 4XMLL 2DMKA 3D18B 5I71B 3BH9A 3MV9E 1L9OA 1FNSH 1NBVL 4NM4H 4TULH 4PLJC 2OMYA 1XIWB 1IQWH 5D1XA 3X14B 5HYJA 1T22A 1MFVA 4KDTC 3CPLB 2GVYA 3I2CH 1UGNA 4UMSA 1PZ5A 2AW2A 3VFMA 1DBKL 3PWUA 3BFQG 1DQIA 3S8GB 1IL1B 4G43B 5KVEL 43CAB 2DBLL 2KDGA 3CH8A 2G2RB 4PLKD 3RZCD 2B14A 1XGQA 3CFBB 5JXEC 4YVNA 3ARDD 3U7AA 4Q2ZA 2ENPA 2OS7A 4L0YA 3VI3E 5HY9B 3EOBA 5DJCA 1CDUA 3N1GC 3V0HA 2ZT9C 2I9LA 5FO7A 3D09A 1NAKL 1QO3B 3N41F 5EWIL 5I1CL 3TYFB 4PGCB 4X6EB 4E9WA 2OXGB 4LPVA 2NW3A 1KCVH 1KIQB 4A6YB 4UCFA 4L8SA 3B3IB 5L7XH 4LCWD 1GC1C 2VOTA 1RZKC 3S36H 1LTXA 3SBQA 1D5ZA 5L8LB 3EYQD 3PHAA 1J0KA 1S3KL 4IOFD 4FFYL 1V5JA 3BFOA 1JGVL 1T1ZA 4I1NB 4AW7A 5E9NA 5J3HD 4JHZA 4PJEF 4N2KA 4B3EA 1MFEL 4YIQB 3EZ8A 1MFUA 3DVIA 4IW4C 4JRXE 2E0PA 3A6BL 5LQBL 2X89A 4OCWL 3VMNA 3NPSB 3AT9A 5ITBH 2FO4A 4JDTL 3JV4A 3L5WB 5INDA 5I8EB 1NOLA 2HJFA 5F7BA 4FNLL 1YEKH 4B0MM 4DFIA 1BPVA 1KXTB 4RMQA 3V5DB 3FBQA 1EFXB 1Z5HA 5KSAD 2DM7A 5BZDA 4IOSA 3SY6A 4K7FB 3VWKB 3OXRB 1E28A 3H1ZA 5C8JB 2CLZB 4ZXBD 4XNUH 4FGMA 4WVRA 3MRMB 4Y2OB 4JZJC 5DTFB 3TEXA 4KKZA 2R1YA 4KNTA 4S1RL 2Z92A 3GYRA 4RRPA 4URKA 2VDOH 4L4VA 2YBRB 2EE3A 3VYPA 1M05A 1NAMA 1URZA 1Q8MA 3PAVA 3QNXA 4LLDB 5IMLA 1XB8A 1G1YA 4M62H 5DRXB 3P3SA 3LEVL 5F1SA 4HAGA 4GG6F 3FO0H 1V7ML 5DJZA 3VXSB 1UB6A 4C59B 1KXHA 2Y3NA 3KEHA 1CMOA 3DBXB 3MRFB 5DK2A 3VGFA 5C97A 3GZQA 4K7PL 1CFTB 2EUZA 1AXTL 2VRQA 5D7SH 1BFSA 3BZFA 3RI5F 2XCMC 1YMMA 3DHJA 1KBGH 4Z7UA 3QIWA 2UZYA 4TOYH 3NSDA 1XL6A 2H41A 3MR9B 3N2JA 4QO1A 3ZT7A 1HILB 1ZOXA 2B39A 2YAHA 1IM3A 3S5LG 3WU1A 5F7AA 5IJKC 2QVIA 1NCGA 2FWOA 3B5HA 3BDXA 3H42H 3MRJA 2XXCB 4ONGL 2OMVA 3EJJX 1OZTG 1A7NH 2QPSA 4YE4H 4G2AA 4M4PA 5GGRA 1HHGB 4AEHL 4H8PA 4BRJA 4C54A 1S7TA 3CN1A 4YHIB 1QSFE 1CFBA 2F5AH 4ANWA 2MQ0A 4ONHB 3VFNB 4ELME 1E5AA 4L1LA 1ZPLA 1EIBA 2OL3L 2UVEA 2EXWC 3MYJA 3UZEC 1XT5A 4UILH 1D7DA 1NEUA 1G9MC 2O5YL 2JCCE 3MC0A 5CF3A 5IW1B 1ZEAL 4LCUA 1H8NA 3GMRB 1OGTB 2DJMA 1IC5L 1QPKA 3GEWB 4M48L 3KYMA 3JT0A 4HAKA 4P57B 1D3CA 3RJQB 4MLSA 4DPCX 1NGYB 4G1EA 3VFSA 4TQIA 5EHFA 2E9BA 2XN1A 5CLYA 4BSVB 3IDGB 1E5ZA 1E4WH 4YDLC 5JHLL 1BBJA 5ICYA 4POUB 5BO1L 2GJZA 4AL8L 2J20A 1GW6A 1II4E 5KN5A 4E42A 4FE9A 1ND0B 4GAYB 4Z7QF 1EK3A 3OZLA 4HXAL 4OFVA 5FHAL 4LE8A 3EUDA 2ZUVA 2K8MA 5EPMA 5IMOB 3CBKB 3J7HA 4HJUA 5IHHA 3TJHD 5DK3A 1LEKA 2ZONA 3IJ7A 5D4IA 3LH9A 5AG9A 3GSRB 5BVJB 2P80A 2WXPA 2NUTA 4GQQA 1AR1C 3WDJA 3IFOB 3TEUA 2XOTA 4PJXE 2RA1A 4MCYA 1VEOA 4RRPM 2VDLH 1FRGL 2P8LB 2VR8A 3L3OB 2D7TL 2QQLL 2YD2A 5I6XB 4UIKH 1YECL 3HZ3A 1DVFC 4M1CD 1GOGA 2RAMA 1CFNB 3FHQA 2CMRH 1GGBH 1SMAA 1W0YT 2ADJA 2Y3AA 5EV7A 5CILH 3Q48A 5SV3A 2QFPA 4Q6IC 1BQRA 4LXFA 3MX0A 4A38A 4KWUA 4FL4B 4WWPA 4YC2C 3ZUCA 4YBQD 4K9JA 3ZT5A 3V4VB 2V2WA 4J3XA 2FGZA 4P5TA 1OGAD 4HP5A 3W57A 2CR3A 4X8JB 2BSSB 1IE5A 3NCYP 5CCKL 1BXXA 3WJMA 3ZUNC 4G6JH 5DC9B 3PAZA 2Q8AH 5CIPB 4Y2LA 4ZMOA 3MJWA 3EOYG 1ZJBA 3O4LD 4FG2A 4M29A 2ZXWB 4MHHG 1I8MB 3CE1A 5DZPA 3D3VE 2NZIA 3OLIA 3RGVD 3VXRB 3JV6A 1IVTA 2Q1EA 3KL0A 1A3RL 3NN8B 5IQLA 1BZ9B 5A2IH 4WTWA 1I31A 1NC2B 2NDGA 4NM4L 4TULL 4QHLB 2ILLA 4CJ1A 2XDHA 3SDAA 3UZQA 2HG5A 3HAEB 3QXWA 4N2GA 2D2OA 4NQVA 3RDTA 4QRPA 1UT1A 1OSZB 4TMPA 3P9MA 4GT7A 4FHBD 4W9ZA 2HN7B 1RV6X 1TTBA 3C12A 3X11B 1HSBB 3EO0B 5D1QC 1S5IH 5MENB 1NUNB 3MNVA 3R06A 4HKXA 5ACMA 1BM3L 3X1GA 5CSGA 4KMTH 3FUIA 1TU2A 2YUXA 3VRIB 2R0ZL 1ZHLA 3AXIA 3CZGA 4MZ3A 1A0QH 1I3GL 1QBLH 4QJ3B 2HFGH 4LCWE 5CR1A 3Q06A 4OAWA 4K23H 3SPVB 2RGSA 5C0AA 1CXFA 5CU5A 3PL6A 4AUUA 3KPRB 3RWGA 2RB8A 1D5MA 4N25A 1RIUL 3SKOB 1TVBB 2DYPA 4KOBA 8CGTA 4ODHL 4P9HC 4ZAKB 4F1ZA 5DQ9A 2PYEA 4MAYB 1HXKA 3AXHA 5AALA 4ENZA 5C71A 3EYVA 1S3KH 1N64L 1MZZA 3MRKB 4X5WB 4FOMA 4TNVF 2A6DA 1LL1A 1U8IB 3W0WA 4QJ5B 1KV7A 2RFXA 1XCQA 4KNSA 4NN7C 1KB9K 2Z8VC 4N8PA 1FNGB 4M5YL 4CC4C 1KCWA 1TJMA 2QR0A 2Z91B 4XBPB 4MD5B 5ITBL 1GTNA 4TRPL 4L1TA 3U82B 4O51B 1XR9B 3EGDB 4ZT1A 1BZ7B 1TJIH 2XKUA 3MRIB 4PFEA 2IANA 1RUQH 3IXAA 6PCYA 5AKTA 1YEKL 2ZKHL 3VXSA 2R15A 1NCHA 4MA3A 4XPFH 3VFTA 1QLEB 2CE6A 4IEFB 4D0BA 5DJ8B 1AD9A 2H9GA 1DQQA 4RFEB 1B0GB 2YJLA 3OKOB 5C0IA 5I75C 1WZ1H 4HIJA 5FUZH 1Q38A 3RU8H 4M43L 1SBSH 5TDOB 5ADPH 3TZVB 4XPHH 3SJVB 3OR6B 4QO1B 2ADGB 1IMHC 3DVGA 4LEXH 5E8PB 1JV2B 1TJHH 5F8QC 4XMXA 3FO0L 4F7TB 3B2UD 1LO4L 2HVJA 1R5VB 5F96H 4JG0H 4RIRB 4ODTH 1CTNA 4AUYA 4GSDH 3F7LA 5H37H 4GW4B 4NQXA 3ABMB 4PIRF 5JOPD 2DIJA 1RLWA 1ZA6B 4TNFA 1CICD 3MBEC 5AZ2H 1KJVB 2BINA 1E9QB 2NDFA 3JT2A 2M2DA 4P2RB 3FUHA 1XO8A 1KZQA 2WUBL 1ZLVH 2EO1A 4Z7OF 5BUGA 2JMRA 4MWFB 4J2XA 4UYQA 35C8H 3ULVD 1IFHH 4UNVA 1M7DA 2P46B 2QSCH 2X44D 2F5AL 3NK3A 2EACA 5HHOE 5C3TA 2PR9A 4YXKL 4KQ0A 2P47B 2F7PA 2ZKXA 3HNVL 3UX9B 5F7HA 4E42B 5D4QA 5J6SA 4NUGL 4JDEB 3B7SA 5ANME 4QRTA 4WFFD 1U8PA 2B1AL 1P5UC 2BW4A 3CFTA 3ZKMC 2DD8H 5AVQB 4XNAA 2F7RA 3ARDA 1QLFB 2W9EH 1CR9H 2X9YA 3C6LC 1O5DT 5CGTA 3BCFA 4BFFA 4C4UA 2RALA 2FATH 2WOYA 4JFTA 3K4DA 3QEHA 2IG2L 4UT9A 4GUQA 1BF8A 1EXUA 1T66C 2A4ZA 3PL6C 4N8VA 4DSYA 2XWRA 3F65A 3T4AA 1B9ZA 1M9WA 4PJ9B 1W80A 2F8VA 2F19H 4PY7A 5ID0B 1GW0A 1RJLA 4XWGL 4JO4H 5FHAH 4KJYA 1JRHH 5E99L 1MFAH 2X0VA 4ZTOL 4IIZA 5D2NC 5C86A 3O45B 1T5XA 1INDL 3FUMA 4AKPA 3F6IA 3QZNA 2D3LA 2VE6B 5DD0H 1JDDA 1XIWD 3K2IA 3G7TA 3QNZB 1ZS8B 3CIAA 3SN6N 3UPCA 5DQJA 1O9WA 4MAUL 4GW5A 5E1AB 1WISA 1WBZA 2VDKH 1UWYA 5DRWA 2GB2A 4QTHA 2IPUG 3ZJAA 2EECA 4PHZA 1Z5LA 4JO1H 1ZVNA 1ROCA 3B5TA 4NZFA 4R2GD 1LO0H 3N40P 1SMOA 3CAFA 4IKKA 4DQOL 2HJLA 2R56H 4J27A 5DFWH 4CRPA 3MV8D 1B3IA 3BYYA 4S0TD 3ZY7A 4KZEL 3D3VA 5L0QB 4HK0A 1RXLA 2XTLA 3IK2A 4DUWA 2GFBA 5J0BA 5IT2L 3QXDB 4B96A 5DS8B 1MHPH 5INCA 2R0KH 1JRHI 4WF7A 3FRUA 4Y4HA 5CLTA 2ESVE 3SY0B 5T3ZL 3IGFA 2AJYH 3KE0A 4PJCB 4D2NA 1ECYA 2MTAA 3VG0H 4PRHE 4Z0BH 4OGQC 1ZIAA 3IU3A 3ARPA 3B4NA 1FO0A 1LP9F 4IJTA 3UAAA 4RZCB 3PV6A 1CT8B 5JW4M 2OSLB 4PRBA 4XVJL 4HSAC 3L6FB 4ADGA 3RBGA 2Z1PA 1A3RH 4AQOA 4N6RA 1PNCA 4YUEL 3OSVA 3OAWA 4JPVL 2XZZA 2F8XC 4ABQA 5K69A 3S2AA 2VLJA 2OXHA 4KRPD 1IAKA 1N7ML 4OV6F 2E3VA 4XP9H 2E76C 2GSIA 2FIRT 2RQ8A 3D4GA 3KVQA 2HG0A 2CH8A 4NRZA 1FV1B 3O3DB 1XSKA 5K59F 5T3XH 1RMFH 4XMUA