5CR8A

Structure of the membrane-binding domain of pneumolysin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
b'RNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pneumolysin
publication title The Crystal Structure of Pneumolysin at 2.0 angstrom Resolution Reveals the Molecular Packing of the Pre-pore Complex.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Toxin
total genus 22
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 5cr8A00
4HSCX 1S3RA 4BIKA 1PFOA 3CQFA 1M3JA 1M3IA 3HVNA 5CR8A
chains in the Genus database with same CATH superfamily
4UM9B 1QBML 3ECQA 3POCA 1I85A 5GZOD 3FN3A 3TCXA 3DGGB 1RURL 2FEJA 3HA0A 2G9HA 3CPLA 1ICTA 3G9VA 3ZHNA 2ZX6A 3R0MA 1HOEA 4MCYB 4AGMA 1BFTA 1KCKA 4IMLA 2F7OA 3TBWB 1FRGL 1CMOA 3VGDA 5BRZB 5ESVB 5C1MB 5E8OA 1B4LA 3UG4A 3N41B 4PW9A 1JGEA 1RIUH 1N0LA 4C56E 2IGFH 4ELMA 4PJBE 4KKZA 3BZ4B 4E68A 1RJLA 1CXHA 1O75A 4ALAL 4LFHG 4HFWB 1BAFL 4NXSA 3SKOA 4YLQT 1DUYB 4X5XA 2HT4C 1JGUH 2NR6A 2JELH 1FAIH 1P7KA 1E3XA 2J43A 3V0VA 5FO7B 4Q6KA 2PW1A 4ZPVA 3QXVA 1Z5LA 3ZPDA 1JRHI 4QI3A 1MJ7L 2BSSA 5T5FH 4HIEB 4XT1C 2FR4A 1A7QL 1NIFA 4N5ED 3C5SB 4M6OH 4IOSA 3B1TA 1GHFH 4WWPA 4YHYC 3EJZD 2KUTA 3PFUA 2ZCHL 5EO9B 4M48L 2TRYA 2VDPL 1NC2D 3NCWA 4JUSA 5E6IB 5JZ7D 1QLEL 4XP9H 5H37H 1HIMH 1LQBC 1LEIA 1S3KH 2G9HB 3CPLB 4NLHA 2M26A 4TLSA 4IMLB 4YR6A 3KPRE 2X1WL 4Z23A 1JZDC 4WWKC 5E8OB 4CVUA 1JGEB 1N0LB 1QTPA 4ELMB 3K6FA 4AG4L 2K78A 4Y4HD 1GGIH 1RJLB 1KY7A 4NM4L 4O2CA 3UTSE 2YPLE 2ORBH 3P11H 5I2IA 5FYKL 2EE2A 2YIHA 3DARA 1NBQA 1I1FA 4NQEA 4DAGL 5IFHH 3NN8A 3TN0D 3D1MC 2PW1B 4H13C 1UASA 3OMAB 4ZPVB 5J0BA 3PJLA 4ACPA 2X2HA 1MEXL 1MW2A 4M5ZH 3B5HA 5KSAC 4GG6A 2FR4B 3OKMA 4O02H 5DD1L 3TJHC 4M1GL 5B39A 2X09A 1SMOA 1GOFA 3MNWB 3BWZA 4FFZA 3GIVA 2VDMB 1V05A 4FJZA 1OM3L 3RDTA 4GIPD 2A6JA 2V2XA 2F58H 1U0QA 2ZKXA 5CUSH 5D1XA 4WI2A 5EEWA 4NQTA 1RZFL 5EO0A 3TT3H 3DUSA 3P3RA 4HLZG 2XZCL 3D5OF 4G1MA 5G4MA 2SODB 4G5AA 3QQ9D 5D93B 1XDTT 3X1GA 2VAJA 4AEEA 5K69A 2Q8BL 1LEIB 2E5EA 1QAWA 1O6TA 4FA6A 2J4WH 3SHSA 3KGUA 5DZPA 3MBED 5KOMC 3LX9A 2CIKA 4KX9A 1D5BA 4YR6B 2JB5H 2K8MA 3QIWC 4P23D 5AB9A 4FFWC 1FGNH 2RHEA 3QDMD 2F1BA 1DSWA 3UG5A 2V7HB 4KKLC 1Z9MA 3PHQA 1CXFA 3MCYA 2UUDH 4G8FA 3HC4H 4URTB 4N0UA 1K3IA 2IPTL 1WFTA 4ZS7H 3S2CA 1VFAA 2NY3B 3EGSB 4O2CB 5EZOL 1F1GA 4KMTH 1JV5A 4UU9A 5I2IB 1HDMA 3SD2A 2RJMA 1HOCA 3CBRA 1I1FB 4GW1A 4XX5A 4NQEB 3UC2A 3GMOB 4MGXA 5D7LE 5DURD 4TULH 2E8ZA 3NN8B 4ODVH 1RSFA 1L5GB 3T5WA 2M1KA 4EZKA 4U1GC 4LSVL 3VFGL 1YC7A 5L4FA 3U36B 3OKMB 2PYFA 4QRPA 3RHWF 4GLRI 5B39B 4HUVB 2NY2B 1P4BL 4WAFA 3GIVB 5FR3A 1KCVL 4PJHE 1DUZA 2A6JB 2H45A 4G9FD 2V2XB 3MRCA 3RDTB 4DGUA 2FZ3A 4ZW8A 2W9DH 1E4WL 1HS6A 4Z7WF 1N7ML 5D1XB 4AGOA 4EMZA 3L3DA 3D3VB 5EO0B 5CEZL 1KEML 3DUSB 4G1MB 4UM9D 2DLTA 4XH2A 5AVSB 3N85H 3ELQA 1INDH 2IPKB 1H9VA 4F7PA 4ADJA 4R5VA 3UYRH 3VGAC 3BP7B 2EDYA 2OYMA 2R27A 3BH8B 1T83A 2WXQA 2ZX7A 2JLPA 3AQZA 4Z18A 4KV5F 1FBIH 1Q0EA 1R3JA 4LXFA 5BRZD 3BSZH 4H1LB 5ACMA 3D4CA 4GRLA 4PJGF 2F7IA 4E0RA 3PHQB 1N10A 5JIKA 4KROB 4G8FB 4MJJA 4N0UB 4Z3GA 2XPYA 2OYKA 2DI7A 4RA0C 1VFAB 3MVSA 4FQJH 4MA1C 2UXGA 4XVUD 4F2EA 1PKQE 1MF2H 3UP6A 1JV5B 4UU9B 1HDMB 1SMAA 3VXUA 5D7JD 1HOCB 3SE6A 5AG8A 3JT0A 1HYSD 5HYJA 4GW1B 4PRAA 4FQLL 5CINH 1KJ2A 4ZAKB 4D0BA 2XN9E 2MCPL 2FQGA 4AYEC 5FPIA 3X11A 4YFLF 3H9SA 4J27A 4OCXL 5JXAH 3E2HB 4YHML 4QRPB 2VXTH 5IB4A 5C9KA 2C4FT 1B6UA 3BOVA 5DJ6A 2P46B 3U1PA 1YUKB 1D5RA 2CO2A 1DUZB 2J8UF 4EUPB 4ZFFA 2VDML 3MRCB 4Q74A 2FZ3B 2VN7A 2Y06H 2J6WA 4XN2A 5CEZD 5FGBC 5BZWA 3L3DB 1OCZB 4RAVA 5E6ID 4WHYH 3U1QA 3W0WA 5FOJA 4YZFF 2C7FA 4J1UA 2Z91B 4N2AA 4XH2B 2VDOH 2WXLA 4KTEL 5GJTL 4F7PB 2LTQB 3H2WA 3L4XA 4FQIH 4PJAA 4RWYH 4UM8A 3I9PA 2FDBP 1R3JB 3B37A 4R97C 3NP4A 4GRLB 2X89A 1N5AA 4PRHA 4NBYB 1N26A 1UWGH 1GIGH 3CN1A 3SQBA 3HMWH 1DQJA 1KLGA 3BUIA 2DLHA 2H32H 3AU0A 3MNDA 4KUCF 1KELL 3V4UL 1OP5H 3RKDD 4X7EC 2LVEA 4LVOB 4IJTA 1FA4A 1PIGA 3LVTA 5HHVH 2NR6D 1ZLWK 5HYJB 4PRAB 1AHWC 2WTPA 3O4LE 1KJ2B 4B27A 4D0BB 3OSKA 4H8HA 4NM8H 4L9LA 5TF1H 3BUTA 1QNIA 3GSQA 2BNRA 3NRPA 3X11B 1I8LC 2A6IB 3VWJD 3HI5L 4M7ZB 4HMCA 1CICC 1L3NA 3LKSB 4TNVF 3WDJA 4UYQA 2YUVA 4IOSD 1I3VA 5DJ6B 3JWDH 3BAKA 4YJZL 4OZHB 3TL5A 4BCXA 1BFVH 5DRWA 5BZWB 4Y7OC 5CP7B 3UTPE 3P9LA 4ZUTA 1XXDC 2QQKL 4RAVB 3W0WB 5DJ2A 1GC1C 4J1UB 1H3WM 1YMMB 4A2DA 4K3JH 1T7WA 5I8KH 4LP8A 1X44A 1BQ5A 2A99A 5DT1L 4PJAB 4OT1L 1LWJA 3HE7A 4D7PA 4K94C 4XBMA 4P2QE 5DEFA 1KN2L 5LXVA 3VI3F 1A8JH 1NC4B 3ARZA 2JQAA 2ZPKH 1N5AB 4PRHB 5JW3H 2DQJH 3G04A 3OAWA 2XDHA 3MJ8B 3SQBB 2X6BA 4XCFH 3WU1A 4UAOC 2NY3D 1DQJB 1KLGB 5AOKA 4JPVH 4JG9A 4PRDA 1ED3A 2N7SA 2WWMC 1L7TL 3OXRA 4QYAA 4P48A 1NUGA 2W9LA 5GQBA 3QFJE 1SMDA 4NQED 1AMXA 3HI6H 4HX1A 4E9YA 2JH2A 4UF7C 1AI1L 3HB3B 5CZXD 2YR3A 4LQ1A 3GSQB 3U82B 4X7DC 3RILA 5IQ7L 3HAEG 1BJ1J 2NY2D 2CCWA 3JSSA 2K4WA 3DX1A 3FULA 4A2LA 3VACA 3OQ3B 2V8LA 4L1HA 4GUCA 1FSKC 3ESPA 1GR7A 5E5MA 3RDTD 3V79C 1A3RL 3L3JB 2H6OA 3K2UL 1AO7E 3WNKA 1QSVA 5EF2A 4O9HL 5D1XD 5DRWB 2KC0A 3RBGA 3RB7A 3D3VD 2DPKA 4ZUTB 1G7LA 3TIEB 4KFMA 3ARWA 3UZQA 2X70A 4N2CA 5DJ2B 4K7PY 4AK1A 5E4EC 1C08B 1SGKA 3H7BA 4JRFA 1ADWA 4DW2H 2WQVA 1XGTA 4BFOA 5F7YC 3N06B 3GSWA 1SQ2N 3ZTNH 3RWCA 1KSRA 1FO0A 3NIDE 3HE7B 4GXVH 3EO0A 1GJUA 3BIKA 4N0CC 1MG3C 4F8QA 4BFNA 1G0XA 4HJTA 1EXUB 1WFOA 2Y7NA 1A6WH 1AYRA 4KROD 3G04B 5LVEA 5I26A 2QMJA 4YPGB 4N9GA 3MRNA 1O7VA 2YMTA 2ERJB 1MXGA 1GH7A 3IT8D 1ED3B 5I82A 4BSWA 3OXRB 1GYVA 3CLFL 4ZAKD 5IFAL 3BW9A 4UMSA 1UXSA 4PHXA 4HX1B 5E2UL 3WIIH 1KJ2L 2WWKT 1MAJA 1NAMH 2DMGA 4PY8J 2YK1H 1NGWA 1RKRA 4FULA 2W81C 4HU8A 3P3UA 3SDDC 3GXPA 4FMKA 1KEGH 3B7YA 4QRPD 4CN1A 4MWFB 3DETC 1K85A 3WY1A 1KPRA 2XG4B 5L2KA 4RAHA 4YXHH 1BIHA 3WE6A 3Q2NA 4XPGL 3VMOA 1CLYL 3MXVL 5AKTA 2OM5A 4DGIH 5LO7A 1IAII 1G7LB 4LLWA 3KPPB 4M4PA 3UZQB 4CAGA 1WAAE 3C6SA 5A3IC 3H7BB 4ENEC 5IZ7A 4GSXA 3ATEA 4GW4A 1XGTB 2GIMA 3WNPA 3NEOA 2XV2A 3GSWB 3PWPA 3D18A 1L4IA 3RWCB 4ZD3H 3EO0B 1G9MH 3BIKB 3MLSH 1XEDA 5F21B 4ANWA 3MTRA 3TF7C 3ARGA 3NOIA 3ECWA 3F62A 4GRLD 4JQIH 1MW3A 2QVIA 5ITFA 4Q89A 3BH4A 4YWGH 2COVD 3UBXA 4N9GB 1D6VH 3MRNB 5E8PA 5DJYA 2BJML 3T09A 3HS0A 3WFHA 4BWUA 2IQAA 4IW4C 1JYWA 4BSWB 3X13A 4NAMA 3LHAA 1UKSA 3BQUA 2Q5BA 4MQSB 5FDYA 3C60C 1FH5H 5AYUH 1IQWH 4LIQL 1D2OA 3A4DA 4NQXA 4PJXF 1UXSB 3KLDA 5FFLA 3ZZSA 3MUHL 2VT0A 2HP4A 4UV7H 3KLSA 1NGWB 3MJWA 3ZR5A 4NKDA 3LCYA 4IBYA 1KPRB 5L2KB 3WE6B 5AZEL 1CE6A 3OD3A 1R0AH 4B9PA 2AXHA 1EFQA 2X0UA 2KZ1B 4G6JH 3A67L 1MHHB 1UD4A 1FN4A 1IZJA 4LLWB 4NQVA 1FAKT 1EAOA 1IGCL 3W0WD 3K8MA 4JMXA 1YMMD 4O2FA 4GW4B 4PJ8A 1TFPA 5IVXA 3S9DB 3PWPB 1PX8A 4KKNA 4KVCH 2BCKA 3D18B 4LAQL 3ULVF 1TZ8A 5F72S 5EIIB 4JFXA 1NC4D 4ZRGA 3ARGB 4FKKA 2IOIA 5GGRA 4ZTPH 3AXLA 3QW9A 4PRHD 3FU5A 1MFAH 4I48B 5DHYA 5DEJA 1IEHA 4Z1PA 3UBXB 2Q76A 1BVKA 1ZT1A 4LOEA 2IDCA 5DJYB 3WFHB 2IQAB 4PB9H 2VAAA 3X13B 2YZ1A 3BQUB 3L4TA 1RU9L 2QR0B 3IE9A 4OIIL 4YDMA 5KANG 1FZKB 2J72A 2CE6A 1XTLA 1S5IL 3EHBC 2CLRA 4NKDB 4OD2A 1WQVT 1Z6JT 1NAKL 2Y7MA 3LQMA 4OAWA 1WA0X 4UQAA 4P3CH 4HAGA 2Z4QA 4GT0A 4LKCA 3V52H 2RCSH 4XNZC 1A25A 2CRMA 3EYUH 4RMRA 4Y0GA 5FCUL 5LCVA 3GMRA 4LLDA 4X4XB 2UY6A 1FN4B 1X5GA 1IX2A 2VLRD 1FZJA 2ZUUA 5ISZE 4YHKL 5E0FA 3HUJA 4MYPA 1GMIA 3IWVA 1RUMH 3ISRA 4O2FB 4XNXH 5C08B 4PJ8B 4BK4A 4AJVA 5IVXB 4FEIA 2FJGA 1MPAH 1UUNA 1D5XA 2BCKB 3HE7D 5JA8B 5CCHE 4PGEA 4IRJA 1MQ8A 5KG9B 1FO0L 3B9KA 5BUAA 4JFXB 1F4YL 3MLWL 3QEGL 4HC1A 1EA9C 2QFPA 2EP6A 2J71A 2E9BA 5DHYB 1M6OA 3GBEA 3TJEL 2Q76B 2VL4A 1ZT1B 4AVKA 3IMUA 5ALCH 4IJ3B 4XCNA 2V9UA 3L13A 4GMSL 2VAAB 3S35H 1TUPA 2PP9A 1SHSA 3EF4A 1SHMA 2Y7OA 3D39B 1WG3A 3ZE2F 3QFDA 2E8YA 3QR2A 4MNQA 4PRPE 1EZVX 3G08A 1HNGA 1W16A 4OD2B 2CLRB 1U6AH 4EDXB 1VGKA 1AQMA 5JIMA 1J05A 3EF7A 4OAWB 3F8UB 4GP4B 2PN5A 2HFEA 1BVLA 3D4GA 3CU1A 4LKCB 3L9BA 2OTWA 1XBRA 1B0RA 1SFHA 5E03A 3BZDA 1GZQB 3UACA 2P80D 1TPXB 3WTYA 4JVPA 3I9GL 3GMRB 5CJQH 1V5JA 4LLDB 3B2MA 3SKJL 2UY6B 2Y1AA 3NPSC 4ZXBA 1F3DJ 3ZDYE 2IBGA 1JZ2A 1F00I 2ESVD 1FZJB 3IDJA 1ONQB 2MH4A 1PG7W 3OMNB 4DVRL 3UCRA 5D1ZI 3ATAA 1TEFA 3AG3B 2I07A 3RGVA 4PPTA 1IAOA 1ZLUH 1LDPH 2R15A 3PUCA 1X4YA 2CM5A 4O4YL 4IRJB 1FVDA 4OB5H 1VCBC 4JFUA 4OM1H 5B39G 3VI4A 3B9KB 3S3PA 3AG4B 4WO4C 2H2SD 3I2CH 3O2WL 1Y1UA 1HHIA 1LMKA 1EAQA 3GRBA 4HHWA 4N28A 4NO0A 3VTMA 1M6OB 3HG3A 4NFBA 2PO6D 1ZDSA 3CHRA 2WNGA 3GSRA 3B9EA 3LKRB 1NGPH 4ZOAA 1SHXA 2AITA 2BRRL 1QR4A 3VTAA 3VXSA 4JX0A 1J5OH 1A6ZA 5CILL 2GAZA 1OLZA 1PCSA 4LPCA 4KQ4L 1KCSL 1BVNT 4PJ5E 3QFDB 3UC0L 2H6UA 4MNQB 5CSBA 1UADC 1U8JA 2X05A 2BVTA 2DQEL 1VGKB 4YC2B 4LLAA 1J05B 2FJUB 3EGXA 2EDMA 4JCMA 4H1LG 2HFEB 5L2KD 4XI5D 3K81A 5AENA 4FTVA 3GNML 2OTWB 2WZPA 1B0RB 4NRXA 1UM6L 4KO6A 3HJEA 1QW8A 1RZKH 3GUTA 1TCMA 4IBWA 1KXTA 1TJIH 4E41E 4ZXBB 3Q2WA 5KWYC 3IDJB 4KOBA 2WQ8A 1KY6A 3DGDA 4W9HC 5KAQG 1UT1A 4PJ9C 4OLYL 1KWGA 2JMRA 3UJJL 1JF1A 2I07B 3RGVB 1R34A 3AU1A 1IAOB 4IU3A 4PJCE 1EJOL 1OAQL 3LHPH 4PP1D 4E5XA 2BVPA 4KX8A 2OYLA 2KT6A 2R1XB 3EJTA 1HHIB 2XBDA 4PB0H 4EUPG 1KXHA 3EDEA 3KBEA 1LEKA 2DYPA 4AKPA 2TAAA 2IH8A 4JEGB 3GSRB 4KK8D 5E8NA 3ZJAA 3VXSB 4Z3TA 4UYPA 3SB3A 1A6ZB 3BQUD 2O5ZL 2GAZB 4GW5A 3NCMA 3NMEA 3OHXA 3P0VH 3UG3A 1OW0A 3U6RA 5A2FA 3AMKA 2B2XH 2Q3ZA 1RJYA 4AJ0A 1U8JB 1E42A 2ITCB 1HNFA 3L2MA 5H4ZA 3WIHH 3MOAH 2P42B 2W59A 3EGXB 3GXIA 5KVEL 3VGEA 1QP1A 5GIRB 1B9ZA 5DS1A 4FTVB 4WJG3 4Z7NB 1QG3A 4NRXB 5GJSH 1MRFH 3GUTB 3TIDB 2QSCL 1W2KT 5LCVL 2XRAH 1A6UL 1DEDA 5I19H 4OZIA 4JPWL 3S5LA 3B6SA 2VQ4A 3V5HB 5C08D 1RK0A 1JF1B 5E5RB 4ENZA 3AU1B 2VUOA 4E5XB 2ATAA 1T2QL 3A3YB 3CXFA 3MKGA 4R4NC 1BAWA 2Q1EA 3SODB 3QHFL 5FO9A 4TL5A 2ISDA 4BBWA 3SPHA 4HC1L 3QUZB 4AUUA 1SDDA 1FE8L 3FTSA 3RAJL 1LEKB 2DYPB 4P99A 4PRIE 1FFTB 2WSPA 2YXVA 2PW2A 3FQNB 1A3QA 3QNZA 2WXGA 3V6BR 3OJDB 3KYOA 5E8NB 5GS1A 1F5WA 5I75C 1A64A 5H35A 4GW5B 3FB8B 4B9KC 1IAIL 1IAIM 3D39D 3D0AA 3U6RB 2JJSA 5HD8C 3FQUB 2GBTA 3GINA 2FEDC 1OZTG 5FXCH 1LTXA 5LNEA 2UZXA 4EI0A 1ZIBA 1TEGA 4EJ1C 3EH1A 4FQXB 1HWHB 5F7UA 1P84J 3GSOA 3L3OB 4EI5D 2XWXA 1YEHL 1MUJA 3ATDA 5H8DA 1V3LA 2IAAC 4KRNA 4K4KA 2GFBA 5EU4A 4XWOD 3S5LB 2D4DA 2X2YA 3L95A 4OZIB 2YPKA 4TLKA 3TT1H 1EHAA 1RK0B 4MJIE 3FO1B 2NXYB 2O5XH 1YMHA 5MENA 1L9SA 5I24A 5IB3B 2E86A 2FLRT 3B9KD 4K3GA 4DOHB 2X9ZA 3E8UL 2PWDA 2FLMA 4IRZH 1JGDB 2NX5E 4Y4FA 3WFBH 2HA1A 5SWSA 4ZFGH 4JAMA 4NJAL 2JJWA 3ULVC 4S2SB 5TE7L 4BH8A 5C6TH 3HVNA 2PW2B 3PF2A 1I31A 3QNZB 2DQCL 3H2PA 4RAUA 3KYOB 5K1JA 5GS1B 5IWLC 3WY2A 1FWXA 1QWNA 4PJIF 4D9LL 4NN6B 1CFQA 3BRGC 3LZRA 2VLJD 3AM8A 2MTAA 5C0NC 4MNQD 3OR6A 1QUPA 4GRMA 5KVFH 4X7SL 4L0YA 3WKPA 3CVHA 3D9AH 3LS4L 3GHBL 5HI3C 3CZJA 5HDQL 8CGTA 3EFDH 3KPTA 3VXTB 3TFKC 3RIAF 3EJRA 1QATA 5IQMA 3V6ZA 3T0EE 4WFGD 4KPHH 4YSDA 5SX4I 3FSOA 1L3WA 4FF9A 3IJSA 4ZXBD 4TYUA 3GSOB 4PYHA 5E99H 2FLBT 5EU4B 5FW8A 2NY4B 2GFBB 1JGVH 4IBLT 3L95B 4ODTL 4WFHE 4NUGH 1XX9C 2OR9L 4JO4H 2FCBA 4AVHA 1I1YB 3BUYB 1YMHB 4JFHD 4KKCD 5I0YA 3RGVD 1P6FA 3MLYL 3QPKA 1NMBH 4Y9GA 2YBRB 1ZGLM 1UM5L 3UAAA 5HGAA 3A4EA 1E43A 5K9KA 4HKJA 3ZUNC 2D3VA 2XZAL 3ZRCC 3K72A 3F58L 1FPTL 4Y4FB 2CLZA 5LDUA 1PY4A 1YN6B 1LK2A 4BH8B 4G42A 5F9OH 1N3NA 2XIBA 2AQQA 1OAJA 5CJXA 1KB5A 3VXSD 2B4CC 3BKMH 3OZLA 1I9RH 3OX8A 2QSVA 3S3JA 1KT2A 1H3PH 4LOUC 1YN7A 2ALAA 3ORJA 5FYLD 3RDJA 3FMGH 3OR6B 3MREA 4GRMB 3BD5A 3DJRA 3E1F1 1UD8A 2EVGA 4IRSA 2K9UA 4N2EA 1AQKH 3CVHB 5DVOA 4YAQA 2ICWJ 4P2RA 5IBTH 4YHLH 3SDXA 3EBAA 3DYPA 4FTVD 4B3EA 1JYNA 3MAWA 3V6ZB 4DKFH 1P2CB 1PQZA 5T1JA 4HDIA 2GPZA 5KSBA 4G3YL 4JO2H 1EX0A 3IJSB 5A7EA 3WEAA 2L7JA 12E8L 5FS5A 4HHGA 1AG6A 3T3MF 4GEIA 3CK0L 2K7PA 1UJ3C 4XXCC 1SJMA 2G2NA 3WTVA 1RZQA 3IFPB 2ZXDA 3AG1B 1J1PL 3NCFB 4R84A 5TQ2H 2AV1A 4Q52A 5HGAB 5K9KB 4HKJB 1GGUA 3ARYA 4LCCC 1E9OB 3K72B 1A0QL 1KGXA 3QUZD 5C07E 2IGLA 4WW2A 4MXVE 4EDWL 3JUZA 5HHNB 5L7XL 1HSAA 3L4WA 3TFBA 1WC7A 2DYPD 3I3BA 3TLRA 4G42B 1IVLA 3K71A 3IFLH 3GB7A 1N3NB 4N1HB 2DF3A 4W4OC 2WJ5A 1YQVL 4JUTA 1KT2B 1BQLL 3HHSA 4H2CA 2UVFA 3SPCA 3AS3A 1YN7B 4G8IA 3EJCA 5F7FA 4ELDA 2YBGA 3S96A 2JTDA 4J3UA 1IFRA 1NMCC 4QDGA 3DGCR 3PV6A 5FGCE 4IRSB 2N7BA 2V7NA 4PJ7A 4NZTL 5DC4B 5EIIG 1P6AB 3KH4A 2VWEC 1LL1A 2YRLA 4P2RB 4EXPX 1JD9A 4W81A 3I85A 5JPNC 2WXPA 3SDXB 4FQXD 5E2TH 1Q90A 4DP4X 3UBXG 1WLHA 1PQZB 2X4NA 4M5YH 5KYWA 2D73A 5KVGL 4LPTA 5KSBB 3RGBA 1BREA 3DJZA 3IWUA 4XN5A 2HKHL 3T65A 2AC0A 4L4JA 2I69A 1R24A 3PU7A 3RPKA 1BQHA 2JCCE 1WUZA 1FL3B 3VUAA 2NXYD 1UFGA 1GMEA 1I1CA 2EH7L 1NMAH 1HXMA 1JP5A 1Z66A 2C34A 2CPCA 2W92A 3ASOB 1Q9OA 4JREC 4RGMC 1ACYL 1U36A 2AV1B 3QUMA 4JRYD 4G8GD 4EOWH 1WHOA 2E27H 1G7PB 2F5BH 2EE0A 2AJZB 1HSAB 1OB1A 5C0RL 3CX5K 2C9QA 3K71B 3GB7B 3PIQA 2DQDH 3QULA 3FPXA 4LNVA 1YSOA 4U0RB 2MFNA 1Z1WA 5ANMB 3ROOA 1CN4A 2ICWB 1A2YA 2ZNXA 3HHSB 4N0FA 5GRJL 5A43C 5B8CC 3RWDA 4J2XA 4U3XA 4Z7UA 4GQPH 4QGYA 5HI5C 3HCVA 3JTTB 4PJ7B 4XN9A 3CU7A 4MD4A 4OJFH 3PHOB 3CVHL 3K91A 3LH2L 2LR4A 4R5TA 4NX0A 2FH6A 1AY1L 1T6BX 3NH7H 3D06A 2DBLL 3R4DA 4F58L 2X4NB 3BPCA 2VJ0A 2OR8A 1A66A 5CXPA 2IG2L 3OQRA 5C0CA 1THAA 1QI4A 3N1MC 2NY4D 5A16A 2G0LA 4IMKA 1PFCA 3H85A 3HPLB 1HXMB 5EU6E 2NTFA 4M29A 5IESL 1DANU 5KVFE 1SHWA 1WTLA 3QUMB 2R4SH 3MUUA 2YD2A 2A9MH 2BLFA 2XY2A 3M8OH 1NFDA 2AGJH 1T7ZA 2UZYB 3CNKA 4TXVB 4Y4FD 3TVMA 4KKAD 1OB1B 5I8OH 2G5RA 5TGBA 1F3JB 2VITA 1G5AA 3BT0A 3PIQB 3R1GH 3A21A 3NK4A 4OGXH 2ZWYA 3QULB 3GHEH 4LCIH 1NINA 4J4PC 2W60A 2JQZA 4DP6X 4N0FB 1J1XH 1OTTD 4LSRL 2ZYRA 3U4KA 2HCZX 4Z7UB 1K4CA 3IGAA 3QJTB 3INOA 3HCVB 4FQHA 4F80A 3AB0C 4N20A 1QLRA 1FFPA 3PAZA 3FFCA 4A7UA 2WNXA 5E2VL 4KNSA 3WO4B 1TJGL 1TYJA 3L4UA 3BPCB 1XXFC 5T3ZL 5I16B 4MQXD 4LDCA 1BQUA 4B5ZA 4Z77A 2ZP0T 3QUXB 5A16B 1NIDA 3CH1B 3KVQA 2D9QB 4MNGE 3NSYA 4PLJC 2AERT 3ETSA 4LB8A 4PLOB 3NIGE 1ACCA 4HISA 3QXAA 2NTFB 1CG9A 3O6FC 4BQ8A 1JNLH 2PPCA 1GC1H 4GFTB 3UGXA 3O4OC 2HKFL 3M17A 1WCQA 3GD1C 4MLIA 3BEVA 1EV2E 1NFDB 3EO9L 3TVMB 3H6AA 4K94H 2WLIB 5EEYA 4JPKH 4P3WA 4P2OA 2PPAA 3DDFA 5IOPA 1H8OA 1NIEA 3II3A 4M7KL 2VITB 2UXVA 3VXMB 5MEPA 1A5FL 3CV5A 2HYMA 5DS8A 1WIUA 1GA2A 2W60B 3F7LA 4OF0A 3MNVA 3FC8A 5H94A 3BAIA 1DJGA 3RWFA 1UEMA 3BRDA 1ET8A 2BHUA 3IGAB 4FQHB 3AXHA 1OARH 3WJJA 1QLRB 3D0VA 1FFPB 3FSAA 5D5MB 3WS3B 3KZ8A 3FFCB 1I1AC 5GZNA 5DGQA 3JVFC 5GGVH 2PP7A 2QPFA 4UT7L 5CKGA 5KTEL 4RGOL 5TTRA 2NYYD 5T3ZD 3S37X 1BLNA 1TU2A 3FHQA 2HLAB 4Z7OF 3SPIA 4PP2A 5KVDE 5I30L 5IVZA 4Z77B 2WYZA 5D1QC 4BGLA 1PKOA 4LO9A 1UEYA 4U6XA 1JWSA 5DD6A 3GJFK 3SGDH 4UQIM 5IMOA 3LN5A 2EIEA 5IQLA 5T1KB 1E4KC 2ZICA 3NJJA 1PZSA 3DX4A 1CG9B 3QXAB 1RIHL 4NUQA 1IARB 2R9HC 4ZUWA 4AX3A 1NEUA 4FQCL 1MJJA 3DIVA 3Q1SH 3M17B 3F7PC 1NIBA 3FUMA 3QUML 2OZNA 1D2PA 3BEVB 2IEPA 3BWUF 4Z3HA 1HHHA 4NO3A 4FX5A 1IT9L 4QEGA 2BPBA 4P2OB 3GBNH 4MHHG 2XY1A 5E23A 4LRIC 3QAZC 1JI1A 4ZW5A 5DS8B 3MC0A 4PJDA 4BHUI 1GGBH 1AZNA 2GBVA 4N8VA 3MNVB 1QQDA 3VG9B 1YCSA 5E70A 3V0AC 3DX8A 3KM2A 1TCRA 5DZ9A 4E5XG 3QZPA 4YSTA 3LKPA 4UZGA 3B7UX 3D0VB 1XCQB 2HTLD 1CK0L 4YDNA 4BZ1A 2H3XC 3INUL 2C1PA 4A37A 4A2GA 1AOHA 1CFBA 1BLNB 2CKBA 1TU2B 4RRPA 4PP2B 4HIHA 1A3LL 1P7QA 5IVZB 5GS2D 4OZFH 1P1VA 4U6XB 3L5XL 5DD6B 3M07A 3STZA 4RMUA 4HOZA 3SYAA 3BFOA 3LN5B 5IMOB 4WF7A 4YSCA 2VKXA 4ZUWB 2FGZA 4GY4A 4F9PA 4F92B 2I25N 2Q3XA 1YY9C 1X5YA 1CLZH 2HT2D 4LCYA 5F9WC 1KIPA 1ZLSL 4XP1L 5HYEA 1WSST 1DZ0A 2VB5A 1HHHB 3NUKA 2AI0H 4L5FH 2ENYA 2NYKA 1XR8A 4Z7IA 4Z95L 4ZOCA 2DWDA 2VDRH 5INCB 1B4JL 5DHMC 2CBPA 5HHMB 3IJEB 5E51A 2V17H 5KYXA 3LH8A 1I9EA 4PJDB 3DHUA 3S5LG 1EHLH 1MIMH 2V9QA 1QQDB 1A1MA 2BWIA 1TF4A 1W6WA 3DX8B 3ESMA 4G43B 1XF3A 1TCRB 3MLTA 4JFDA 2YEZA 3MJ6A 1QTYT 3G6JA 4UAHA 3LKPB 4JMNA 1VEPA 5CR1A 3TURA 3EJYC 3O8XB 2VJ8A 4XPAH 4JO3L 4BKTC 1G7IA 2C1PB 5C0BE 1I1RA 3TNNA 5AAPA 4JRXA 4R90H 3NGBB 2CKBB 1HYRC 2EKSA 2WYIA 3NFSH 4HIHB 3H9HB 4OM0H 4YE4H 5J12B 1P7QB 4U1NA 3WL9A 1KJVA 1REIA 2EE9A 3QUXD 5F7BA 3HJ0A 1R3HA 5DRXA 5JIDA 4UILL 1AIFA 4J6RH 1D7CA 3OLDA 4ZMTA 3KGSA 5EIVA 4OIAA 5AEAA 1XGUA 1HHGA 4AQEA 2DQIL 1AZVA 5B22A 2ETWA 1U8PA 35C8L 1X5MA 5HDBB 3OKLA 1S7WA 1SZNA 4LCYB 2M2DA 1HN1A 5DQDL 4NO5A 2XXFA 2ENPA 3JWOC 3DSNA 1DBJL 2CDGA 2XWTA 4XP6L 1X7QB 2R51A 4IKKA 1XGQA 2HLFC 4MASA 2DWDB 3U7YH 1TETL 3VXMD 4DKTA 4Z78B 5HVHB 1X5FA 2PKDA 5HJ3A 4GKZA 4Z7VA 2AV7A 2GYSA 5KYYA 1M1XA 1KCWA 5KYXB 2WK2A 3F7QA 2BZCA 1A7PH 1U3ZA 4WV1B 5D7IF 4KXBA 1JERA 1SY6A 5DJDA 3AW5A 3KPMA 4JFZL 1HH9A 2IFFH 4N2DA 2DIAA 3EOTH 4KVNL 2H1XA 1FV1A 4JFDB 2YEZB 4C56A 4WDIB 5H2BA 2KZBA 1ZT7A 1AR1B 2WN3A 3FFCD 1YEGH 5EU7C 4AH2B 2QGDA 2G4EA 3JWNG 5F89A 1F6FB 2ZUVA 4LSUL 1CF1A 1G7IB 1S7UA 5KOVC 3VH8G 4DP5X 5E08L 2YAFA 2H9GA 2VERN 1BD2E 3TNNB 4JRXB 3DBXA 2EKSB 1C1EL 1I82A 3WL9B 2BMKB 5DRXB 4APQA 5E4OA 3D2UB 2X38A 3DJTA 1VACA 5T1KD 3VE0A 2W91A 1MI5A 1XGUB 5HVGB 5IROC 4AQEB 4UOZA 1A7NH 4YIQA 4YL4A 4JM4H 5D6DA 5DJAA 2IBBA 2WZ0A 3OKLB 5I8EA 1BXUA 3OZ9L 1AZUA 5F7KC 3UZEA 3A47A 4EZLA 3PPSA 2OXGA 2CDGB 2XWTB 3QE5A 4U6VH 4JGJA 4P2OD 4AENA 1AZBA 3FU8A 5DD0H 4BK5C 4ELKA 5HVWA 3QORC 4W70A 5I1HL 3ARPA 4GKZB 5HJ3B 2FTAA 1M1XB 4WGKA 1DVQA 3EJPA 2R69A 1IC7H 2R7EB 2IO5A 3IDMB 3P02A 5IGXH 2JIXB 4YEEA 5DJDB 4K3EL 3D50A 3KPMB 3KJ6L 3VVVA 1O7DC 3C5ZA 1V8HA 1SXCA 5CCKH 1FV1B 4J3SA 4C56B 5KBKA 4Q9RH 3V55A 4PJBB 5MP6L 3BDYH 4FFVD 5DZNA 4YSQA 5C70A 4NHUA 3T8MA 4PD4K 4RFOH 1NCAL 2R2HA 2YXWA 3UTSA 1ZD6A 3FH8A 1S7UB 1B4TA 1P1ZB 3MV9E 4BZ1L 4IBVA 2H9GB 3HTLX 4RA3A 5I1EL 4P07A 4GQ9H 1YG9A 1XF5A 3DBXB 4HMDA 2CKBL 1TQCB 1TJHL 4W6XB 4GNKB 2IWGA 4JM2F 4KDWA 1MFCL 5FM8A 1RI8A 3T4AA 3V10A 1VKXA 5HJDA 1YVLA 1VACB 2IVFC 4NWTL 3VE0B 4F24A 2VQTA 4X9YA 4YIQB 4UTAH 3QK0A 3OPZL 5FM5O 2HT3D 3GTVA 5DJAB 5I8EB 2X6UA 1KB9K 1R3IL 2EDWA 4YVNA 1AXSA 1TVDA 1UOWA 2DY2A 4U7MA 4YX2H 4AENB 2DQUH 3ZY7A 3DNKA 2OBGA 5TE4H 3WEXA 1MZYA 5HHMD 2ZCKL 3CZNA 2AEQL 5HDRA 2RBLA 3CFJA 1M2OA 3FYIB 4PHZA 2IFGA 2FWUA 1AXIB 5I0VA 3A6BH 4ABWA 2YLHA 3AUVA 3VSQA 3VXQB 3KPRB 4LOVA 5GGTH 3LXAA 2MQ0A 3ML8A 2AEPL 4FLOA 4M3JA 1K8IA 3C5ZB 3W2DH 3S8WA 3UAJA 2NQ3A 4AOFA 4NBZB 4DN3L 2ZOTA 1XSIA 4L0ZA 3QUYA 5JPMC 4NQDE 3O8XD 4LVHB 2WNWA 2VW6A 4XMWA 3UTSB 2R2HB 1A1OA 2YPLB 3O3BA 2OZ4A 4CGUB 2WQRA 5L8KB 2IALA 2Y2WA 4HKZA 4JGNA 1D9KC 1U95A 5D7LA 4L5FE 3EDFA 4TQEL 2JJTA 5D8JL 1P7QD 4EN2A 3ARDA 4ZTEA 5DJZA 3T4AB 3P73A 4LASL 2WVVA 2X0WA 4IBZA 1EBAA 3MR9B 3OAUH 5IHZA 4XP5H 5PCYA 2JKSA 4TSCH 2W95A 1CL7H 2AK1H 4HWZA 4QRTA 3V8CA 4HPOH 5EZLA 1OHZA 3B2VL 2Y6TE 2QMKA 1AXSB 3N04A 4LCUA 1KN4H 2Y5QA 4JZJC 3OVUB 3MLXH 2GEQA 1EUTA 2QPDB 2G3ZA 3HRZA 1CFVL 2NTSP 4XMLL 3QC6X 3GK8L 3WEXB 3US0A 3CFJB 3APDA 4JPSA 4NGHH 3BWUC 5HDLA 1JIBA 3SE4A 1G9HA 3FK3A 4MMZC 1U42A 1VHPA 3AT0A 1SY6L 5JTWA 1K8IB 3N9GL 1T89C 3QCUL 4N5UA 4WUKL 1JFHA 4JFDD 5DD5L 3RJQB 2OPCA 5EIQA 1AR1D 3QXTA 4I77L 5C6WH 3QUYB 1U92A 1VCAA 1IKNA 4HLEA 1PKQA 3TZVA 1A1OB 3QSKB 4FYSA 1H3UA 1XCTA 3Q5TA 3V4PH 2APWA 2R29A 4JRXD 4HKZB 1TO5A 3UJTH 5D7LB 1U95B 2XN9A 3VA6A 1Z9PA 3AUWB 1E65A 4HA1A 3ARDB 2QKSA 4GBXA 5CZVH 3VU2A 3D2UD 1T04B 3I6GA 3E0GA 3IJ9A 2JNZA 2WVVB 2FSEA 3PLYA 2E6QA 1JZ5A 1J9RA 2DS4A 1ZHBB 3PAVA 4NNPH 5IHZB 1GCFA 1CPUA 4MAYA 4PJHB 2CR6A 4PJGE 4HWZB 2OTUB 2EEXA 3TBCA 2ZWLT 5EZLB 4OGAC 1WBZA 3BLBA 1LWHA 1EBPA 3FAXA 2HXAA 2OS7A 4LCUB 2DQFA 5ES4B 2J2ZA 1U21A 3VFMA 4W9EC 5F3FA 3HRZB 3ZX1A 4AL8L 2VLKE 1BOYA 4F9LA 5DHDA 1NCBH 4FLQA 3IRZA 4ISVA 4WI7A 2R69L 2JIXD 4XPBH 1NGQH 4TNFA 2EVFA 2EDHA 3REVB 2YOAA 1ITCA 4FJ6A 4FGMA 3QQNA 2RR3A 4C56D 4Z3JA 1IKOP 3P54A 4R7VA 4CA4A 1TVHA 1PX3A 2OQJA 1PKQB 4PJFF 3TZVB 2NUPA 4RMVA 3FONB 1XCTB 1Q0XL 2BH0A 4MSWB 2PXYA 4F57H 4K2UL 1F86A 1N59A 3DMMA 4YDJA 2XN9B 2O26U 1U3NA 4WKXA 5GRVK 2K6YA 3CSGA 3KCPA 2C3VA 4ZYKA 4FLSA 4GBXB 3DURA 5H37A 1JF5A 4IK7A 1OPGL 3LPGA 3DX7A 3I6GB 1U3YA 1HINH 3FKUS 4OF8A 2DWYA 2A9NH 4BQBA 2FSEB 4J6IA 3U46B 3C2AH 3ILQD 3I6LE 4MAYB 1CTMA 4NSKA 4PWJA 1W6LA 4IEFA 3BN3B 1HCVA 1WBZB 3QB7C 3T0AA 3G5WA 3HNTH 1F8TH 1AMYA 4OCSH 3UO1L 4Y5XA 2J2ZB 1QFUL 3VFMB 5EF3A 1X5AA 2ZP9A 5DMKA 2YQBA 4I18C 3FFDA 3ULVH 1DBMH 3K2KA 3IBOA 1JFQH 1TQUA 3LRHA 4ISVB 4D3CH 4G80B 3DYMA 3GBMH 4A39A 3KPRD 1OANA 1GTFA 2ATKB 5T1DL 5DVPA 2F8VA 2ITFA 3QZWA 4YE0A 2CK0H 5TE6L 4UOW1 3GXFA 2AQSA 4Y19E 5D7KE 1TSHA 3FZUC 4JN1H 1I8IB 3NCYS 1TVHB 4G7YH 3T6XA 3S36L 4ONFH 4XVSH 2OQJB 2YPLD 3MFFA 4LEOA 2CUIA 2GSGA 3BPNC 3HR5A 3N5AA 4MJ4A 5L8LB 2EUXA 4Y2DC 2OZ4L 2PXYB 3L4VA 3QFJA 5IW1A 1SVCP 3MRPA 3O4LB 5FC9A 1N59B 1USZA 1DQDL 1DVYA 3SGJA 3P3TA 3ZBMA 4ZYKB 2C3VB 2QZQA 1LDSA 3DOSA 3DX7B 3MJGX 1LK3H 4K8RC 2PPFA 1JVKA 2CHZA 3AWFA 4OLZL 2BSDA 3L45A 3VI3E 2OJZL 3ABLB 4M61A 5MHSE 5B38A 1C16A 1IFGA 2BDNL 4NSKB 1SYVB 5AZ2L 1WP6A 1WBXA 4IEFB 4R26L 3SBWC 4LRNH 1E6JL 1EZUA 4YXKL 1QVOB 4GQQA 2IGTA 3NESA 5SX5K 2ZP8A 3WFEH 3BUPA 4B9ZA 4N2HA 4P2CG 5CBEA 1S7SA 3K1DA 1TZOA 5DMKB 4QXUL 2AQPA 4B9CA 4V33A 3FFDB 2A77H 2EUZA 2J1YA 4P2QB 1JCKA 5LXGH 2D7OA 1EO7A 2ZX8A 2B4CH 3NPZB 4UQEA 2EXYC 2D3NA 3TEXA 3UAJD 2AJVL 3CHQA 3QZWB 3LPFA 3WE1A 4JQXC 3BFQG 4I87A 2NZ9C 3QUYD 1E6OH 4HUNB 4R96A 2C4XA 3SE3A 3MFFB 2I7OA 4LEOB 1BEXA 3CBJB 4J7RA 2GSGB 2Q86A 3HR5B 4LDOB 4GUPA 3QFJB 3AQYA 5IW1B 4M7JH 3IMSA 4GP8B 5D7LD 3IU4L 1HC1A 1WWCA 2DJ4A 4LEXL 3GXTA 3ARDD 3VDBA 2A73A 2MHAA 2OW6A 2XLLA 3DOSB 4E9XA 4HIXH 5A2CA 4CW1A 2KLSA 4KJQC 1BJ8A 2Z65C 4M61B 2NY5L 5B38B 4JM2C 1C16B 1D5MA 1MKFA 5DVNA 1WBXB 2HH0H 1OOAA 4J39A 3HZ3A 3ESVF 4PW4A 1J0ZA 4WWNA 2F54E 1QLFA 1YHPA 3ULUC 2WO2B 4LLVA 2DL2A 1WAAA 2IAMC 5IKCA 1SDAB 1S7SB 3ECVA 4ZODA 4RRPG 1X5XA 5DXWA 4G7QB 4ZDHA 3RFRA 1VLXA 1JGUL 5BUGA 4PCYA 4TSBH 1FGVH 2FBJH 1CTOA 3ZSSA 2KDYA 2H2PD 5L4IA 4NB7A 1NANH 1PZ5A 2CR0A 4G7VH 3APNA 2F5AH 1A7BA 4MA8L 3VD1A 2ROXA 5FYKU 1MAKA 3TZVD 5DA4A 4AEIL 2Q86B 1I7UA 3QPQD 3U9WA 1JWMB 3KLQA 2HKAA 2CRIA 2XN9D 2GUOA 2ZOOA 3V2AR 1XH3A 3ZW3A 4GBXD 1A22B 4F91B 2MHAB 5HYSA 3BPOC 3WAJA 4HCFA 4XP9L 5HY9A 1HIML 3CMOL 1MN4A 3VJ6A 4CW1B 1JGLH 4JCWA 5TF0A 4YGVA 3BWAB 2ENSA 3BGAA 3MZTA 4OFPA 1D5MB 1HHKA 2EH8H 3QQDB 4M1CC 4MXWH 4OBSA 3FUEA 4UOQA 3GIZL 3CVCA 2F0CA 4YFEA 4G7SB 1M2VB 3G7TA 1OTUC 3RTQA 2WXNA 2Y72A 2R0KH 1QLFB 5GISH 5J06A 2H32A 4LLVB 3ME0B 4LHQB 4LBEA 5IKCB 4XMUA 1PJ9A 1NCTA 3LYRA 3N0AA 3MA9H 2D3LA 3TXAA 5GGUA 2O61A 5D72H 3RWIA 4ZDHB 4JPIA 1A21A 4GXUN 2YGVA 1CDGA 5IFHL 4QHKI 2CDFA 1X5HA 2ZKHL 4A38A 4ZNEE 4HJSA 3TTYA 3TA3C 3QEQA 5GGQH 4ELMF 2UZIH 2JE8A 3WSQL 2G60H 2GTWA 3I74A 4I3SH 3P9MA 1IJNA 3L3KA 2FECI 3O4LD 2NY6D 4PG9A 5H4YA 2GUOB 1CTNA 1E5BA 3TT3L 1RAMA 2VC2L 1XH3B 2APVA 2VE6A 4M02A 3E6FA 5HYSB 2VDOB 5HY9B 1MNUH 3VJ6B 1RZ7H 4N2KA 4IIQA 4P46A 5IOPB 5AVQB 2V3EA 1CFSA 2J4WL 1BIIB 2RTTA 3MRHA 3QDJE 4YGVB 4EN3A 4UB0H 5C0JB 1HHKB 2CCLA 2QL1A 4KC3B 5AW5B 1FGNL 2ZWKA 4L8SB 5I1CH 2VM4A 4EF3A 3UTPD 1TTGA 3RTQB 3HC4L 4TOYH 1B2YA 4PBDA 5ISZA 1PG7H 3DX9A 2H32B 4JG5A 4TF4A 3TJPA 1ZA3A 2C3GA 2VR7A 4LBEB 5AG9A 3SDCC 5F88A 5GGUB 3BZEA 2O61B 1MFBH 4TTDD 4JPIB 2D7QA 5SV4A 3KJ4B 4RBPK 4P2QD 5AKSA 1NBZA 4TULL 3IAQA 2H41A 2WN2A 5LB1A 5CP3H 2CDFB 4X6FA 2QADC 2ZX5A 2ZUWA 4P9HL 5IHLB 1OP9A 4H8PA 2XTLA 1N12A 3ESUF 1RMFH 3V9EA 4A67A 3CN0A 2AKRA 5GZOC 2RQEA 5I1IL 2JI3A 2AZAA 4F8TA 5IB1A 3QHZL 3QFJD 4XC3H 3P9MB 3L3KB 4PG9B 5F1SA 3EJJX 3S5ZA 4TLTA 2ZUQB 3R0NA 2VE6B 3E6FB 3QQ3A 1UT2A 3OAZK 3SEPA 3WEOA 2YAMA 3PXHA 4IIQB 4GG6F 1CFSB 3MRHB 1JNNH 4B60A 4I0PC 3VFPA 1AO7D 1QPPA 2O72A 4X5QA 3WAKA 3QC5X 4PWHA 2E7DA 3V0IA 5ISZB 1KC5H 3SOTA 3DX9B 5A6IA 3NCEB 2APXA 4OJEH 3SDAA 1MF2L 3KW8A 1JHLL 5CINL 4R4BB 3ZT5A 1NBZB 1VIWA 2PR4H 3FQWA 2FWOA 3NCCB 3IXAB 4LKXA 4IGBC 5JZ7C 4WSKA 4OCWH 4FKEA 3BVTA 3QO1B 5JXAL 4OI7A 4IU2A 2VXTL 2AKRB 1NGZA 2YA2A 4J5VA 5J9PA 2P8MA 2E7MA 5DZVA 3X17A 4MKTA 5IB1B 2ITDA 1FYHB 3KYAA 1M56B 1UXWB 4GIOA 1YEEH 5JXEA 2BIPA 2HWZH 5JMRA 2PF6A 4HOWA 1DL7L 1BZ9A 4PJ5A 3NA9H 4K3DH 4PRPB 5KAQF 4QO1A 4M8UA 5AKVA 4ALAC 1VGEH 4KUZH 3TH4T 4KHXH 2X4TA 2EDNA 3X3FH 1D5IL 3GKWH 2AVGA 2VIRA 4UANA 1IVTA 4JQIA 1UTDA 4FXTA 2D4FA 2X1OA 1EDQA 1O6SA 1UWGL 4E41A 3ZDYB 2YC1B 3AZUA 3ZDXF 3I50L 3L1OH 3GJFA 1IFHH 3BZEB 3SGEH 1S2EA 1BOGA 3HPJB 1SNRA 4MZRA 1JPST 4RX4A 2DDQH 5HHVL 5CHNB 2V5TA 4YLCA 3B7TA 1DFBH 2WINA 1FLRH 2A0LC 2YGPA 1NAMB 1MFVA 1Z9SA 2W38A 3LNFA 1HILB 4LT7A 4NM8L 1VSCA 4LKXB 1NM4A 2NNRA 4RGNC 5E8DH 3LZLA 5FK9B 1O9WA 4MA3A 5FUZH 2J5LC 4NJ9H 4IU2B 4EBQH 4TVPH 1NGZB 4Q4EA 5J9PB 1K6QL 2BP0A 5T1LA 3BT2L 2ITDB 3BPLC 3JWDL 3MBEC 3PP4H 3CVDA 1RQ5A 5T33H 2CPUA 3D4ZA 3RWEA 1N6UA 3SO5A 1BZ9B 4J3TA 4PJ5B 3EAKA 5AVXB 1TQBC 1ZEAL 2EDJA 2EDLA 4BH7A 2HUEA 5LNDA 4Q6IA 3MRKA 3P0YL 5ICXB 4B9GA 5L9DL 3GO1H 1IEAA 4FG6D 2VIRB 3C09C 4UQBA 2XN1A 2VZVA 2CR3A 3H42H 3S4SA 4OFKA 2O6PA 5HHOA 3PL6A 5JW3L 1JPTL 2BNQE 1O6SB 3RTQD 4CADA 4E41B 5EORL 2VDQH 1NLBH 3EYOA 4HZ1A 1JMZA 1RK7A 3C2SA 3GJFB 3AY4C 2IOOA 1RL1A 4N8CH 1BOGB 2UY7A 4XCYA 4ZMZA 1A7RH 2LVCA 1IEBA 4PJCB 2WINB 2E9IA 3HI6L 1Z9SB 1AHKA 4TSAL 3F01A 5G4OA 4PJAF 4C4KO 5FIEA 1RK1A 3P0GB 3VCLA 2JXMA 5F6IB 4QNPF 2EABA 3WEMA 1VA9A 1T5XA 3BCFA 2ICEC 2BP0B 2VRQA 4XBPA 3NACL 3OPUA 5F9AC 3RJOA 4EQ2A 3RWEB 2CJSA 2CZNA 1XGRA 3GPEA 1Q9WA 1MVUA 4Q6IB 4NOFA 3MRKB 4P3DA 2IC2A 5FA4A 2CQVA 1IGYA 4DW2L 4YOKA 4FG2A 1YEIH 2B3IA 2Y1YA 2VRAA 3WTXA 2P48B 1IEAB 3VXRE 3FTUA 4DKEL 5J6GA 4AYGA 1G9NC 4XXWC 1NFKA 1M1SA 2P5WE 1EJ6A 2TSAA 3S4SB 3U4BH 2ZKWA 3QIUC 3UABA 1OALA 2R0WH 5HHOB 3O3DB 4XNQB 4CADB 2IOMA 5T1MA 4B0MM 3EYOB 5ISZD 3MV7E 4Y5VA 2A1WL 3RIKA 4E9RA 1MREL 1U2HA 3DVNA 2UY7B 4XCYB 3WFDL 3JWOH 4MJIA 4PEEA 4UQ9A 3PHSA 4Q56A 5H37G 5TD4A 1IEBB 1RJCA 1CZ8L 3CFKA 3WIIL 1T3FA 1RK1B 4M6NH 5C2UB 2BX5A 3Q5OA 4BFKA 5J1AA 5KSUB 4PLKD 2NPLX 2NX5A 4Y1AA 2JXMB 4LPVA 3VCLB 2DJSA 4S0HA 3CFNA 1I85C 1HQ4A 3LRKA 4PRIB 1T5XB 5IQ9A 3CHOA 4AIXA 4ZMNA 2C9RA 1QFWI 2JB6A 4XP4L 4DN4H 1C5BH 4AITA 1RJZA 4RFNB 2OYPA 3UZVA 3HBGA 3BE1L 4DGIL 2L7EA 4PRPD 3CH8A 2P5PA 2WKOA 1MSPA 1MVUB 2ATPA 5DC2A 5BRQA 1OAYL 1GSKA 5FA4B 2XVBA 1IGYB 2HSIA 5I6NA 2XU9A 2AAAA 1LO2H 2RFXA 5D96B 1M71A 3SCMA 3QI9D 4OFVA 5I71C 5IVOA 5J6GB 2NR6C 3QZWG 4GPVA 3MUZ1 1XQ4A 3T0EA 1CLVA 4UI2A 4M93B 1DJZA 4JQIL 2DW5A 5D7SH 3DTXB 1NA8A 1MCEA 1VZIA 5JW4R 3QNXA 3DX6A 5T1MB 1D5ZB 2PCYA 3CFMA 3L4YA 4Y5VB 3ZKQD 2P1YA 4FZ8H 1TITA 3VFNA 3OKDA 4RNRA 3DVNB 3KBFA 3UFIA 4LU5H 1BLIA 2VSCA 4MJIB 4B9YA 1EAPA 2E7HA 3QJUB 1VPOL 3J7HA 1E8XA 4U1LB 3IGKA 2EACA 4BRVA 3BFWA 2C4FU 5KUKA 4GSQA 1BGXH 4HF5L 1URZA 4RVBA 5J1AB 2NX5B 6PCYA 4E36A 3F83A 2ED9A 5B38G 1NBYA 4GMTL 5AYQA 4OKVA 5D1QE 5ILTL 5IQ9B 4X6EA 2ZUXA 3OC5A 4NCDA 1QEXA 1R0AL 2JB6B 4NFCA 3X1FA 1KFAH 4N1EA 4S0SD 3RVVC 1RJZB 4NRZA 5HJGA 4PH8A 5BW7A 3ZE0F 3UZVB 3DPDA 1QFOA 1G94A 2DD8H 4PJ5D 5DSCA 1FP5A 1KGUA 1UHVA 1RUAL 3CCHA 4LEBA 2ATPB 1HL5A 2HG5B 1F4WH 1KBGH 3LS5L 4YDLC 3CXHK 3II2A 5I6XB 1TIUA 3AACA 3IN0A 3KWUA 3KPQA 4PJEE 3SCMB 1M71B 4B96A 1YZZA 4KVCL 4JZNA 1ETB1 3GF8A 3T0VA 3T0EB 5JDJA 4DUWA 2ZKYA 3B4NA 4TVPE 4FXLA 2GKIA 4OW6A 4Y4KA 3U30C 4BCYA 3FQ1A 4LSSL 4E41D 5IHUL 5JHDE 4PGJA 3FUIA 1PSKL 1LM8V 2WAQA 3ISWA 4LF3B 2OI9B 2I9TA 3OKDB 6FABL 1ZVHA 2B0SL 2QPSA 3FU9A 1EAPB 3G5YA 4WEUD 1PGRB 4OCYH 1N6QH 5D1XC 3MKKA 1IIKA 3MUY1 1P69B 1XR9A 3BAEL 4ZPTA 1MCDA 4DP8X 5JOPE 3CSBA 5C07A 3S3CB 2A4CA 1NBYB 2HX8A 3M86A 5ACLA 4KK9D 2R0LH 1ZS8B 4LDLB 4N26A 4WJ5A 4XE5B 2I32A 4OKVB 5EA0L 4BCZA 2VYRE 3HS9A 4X6EB 1JJUA 1NDGA 4PG2A 2PTVA 4WZ9A 3BLKA 3V52L 2RCSL 4NHCH 3UO8B 3IVKA 2BK8A 3SQRA 1RUKL 4WHCA 1MW1A 5AW6B 1E8ZA 3Q6FB 2B1AH 1MQKH 4ADIA 5DSCB 3LB6D 3PGFL 4A7TA 3LIZH 2BC4A 2Y25A 1JPGA 3IDNA 2VH5H 1F56A 3KPQB 5L8JB 4AYDC 4JZNB 2D0GA 4X98A 1N70A 3QYNA 3THML 3W9DA 4DEUA 1CXKA 4U2ZA 3E2HC 1GL4B 4X4KA 5F3BB 4IOFD 1MFEH 3C08L 3WS6C 2I9TB 4A7SA 4V1DE 3U2SA 4WHYG 4HBCL 1CD9B 2JCCA 4FNUA 4TUUA 3I02A 3S35L 2JKXA 3G5YB 2WBJC 5HYSG 3KE0A 2BP8A 5IVXF 5D6CA 2O6FA 1AD0A 1XR9B 4ZPTB 2NY1B 5C07B 4W6YB 3QWQB 3EYQC 2BW5A 3TBTB 3L5WA 5DJ0B 4PRID 5F7AA 1EXGA 5IMKA 1NDGB 2R8SH 4IHOA 3LDBC 1U2CA 2Y2TA 2AAVA 3D52A 4ODHH 4GRLC 2QGBA 1PX4A 4KQ0A 2FB4H 1CQYA 4DO6A 1EZSA 5LQBH 5DR5H 1GAFH 5FGCB 5CGBA 3RGHA 2FGWH 1MJUH 1EDYA 3D48R 3QUHA 2KL6A 3BN9D 3IYLW 1KYOK 1WYJA 2FHBA 4LVOC 2B16A 1LDPL 2KMWA 4X98B 4JNXA 3QJXA 4OM1L 5C2BH 4HUMB 4N4YB 3I2CL 5FECA 4MNHA 3G5XA 1AG0A 3V5KA 3WN5A 4M7ZC 1GRWA 1KJ3H 2O6CA 4GINA 5I6PA 3TCTA 5B1BB 4HQQH 1M05A 3O2DH 3U2SB 2JCCB 4MJID 1LEGA 3I02B 3HUJF 1O7SA 2Q2LA 1KGCE 4MA7L 3NABH 5EU6A 3H6JA 3COOA 4U2YA 2C3XA 4AQZA 2I60L 4ERSH 1NDMA 5J11C 3LEYL 4M43L 5D6CB 4YS4A 1AD0B 1P4IH 2NX5D 3FQ4A 4ZW3A 5KBPA 2VGLM 1DP0A 4JHZA 1C8QA 1DVSA 4BZ2H 2NY0C 2ZCLL 5I6KA 5IMKB 4GQZA 3NJKA 2X40A 3ABMB 2ZT9C 1T1YA 4IHOB 4RQQB 4AYFA 1HHJA 3GI9H 5KJ4A 1SBSH 2FHCA 5GGVY 4XC1L 2L4OA 3SE8L 4P5TA 4NI6A 2B08A 5DK0A 3WUWA 1NPJA 5FOBA 1JE6A 4PRNA 2P9RA 2QV2A 3TCLA 4JFQA 4OFIA 3RY6A 3N42F 1Z3GL 1XMWA 1ID2A 4LSQH 3T0ED 1TZAA 3HB3C 3L1FA 1R5IA 4L9LC 4ZFZA 5FECB 4MNHB 1DQML 3G5XB 5J13C 3BQVA 3V5KB 1MRDH 1E50A 1S78D 3L6FB 4PB0L 1N5YL 3VXNA 3OAYH 2K45A 1O7DE 1CD1A 3BI9X 2AJXH 4FTDA 1KUMA 2VXQA 4WFHD 1B0IA 5ELIA 4MNGA 1FL6A 3T4YA 1M05B 4CSTA 1LEGB 2VJXA 5EU6B 3QDGA 1CU4H 2DM2A 4ORZC 2VXUL 3LZFH 3GPSA 9PCYA 5DRZB 4IBUA 3PQYA 2RD0A 1M3IA 3S3SA 3VI4F 2E4FA 4ABUA 1EK3A 5BOZG 3DUHA 1CURA 5FM4A 3GLZA 2C3WA 2WXOA 4KO5A 1PAZA 2YFOA 5KSAA 1E3ZA 4MAUL 2Z64C 5JQ6H 3V0WH 1BBDH 4JPQA 4AYFB 4YHYB 3LRMA 2X6CA 1TZHA 3W3BA 5DFAA 3WKMH 2XRAL 4JDEA 4OLEA 2W9EH 4P5TB 5DK0B 4HXBH 3WUWB 3KPSE 3RVWD 1GZHA 2ERJC 2R0ZL 4I3RL 4LARL 4PRNB 4EIGB 2R39A 4YN3A 2EINB 3G5VA 5HTSA 4JFQB 5CCJA 1DQVA 3N2JA 4ZO8A 1MIEL 5FWRA 2GHWB 4K8RH 1E5AA 1R5IB 4ZFZB 2AXWA 5I1GH 5IEKA 2X9YA 4KU1A 3P77A 4KNUA 4MMYB 5AZUA 3VXNB 4AGPA 1ZJBA 4XOCA 2XWEA 1YEJH 1CD1B 2VLJE 1GW0A 1JD7A 2X9WA 5JUEH 1QFWM 1J5IA 4AV4A 3BAXA 4MNGB 4QOKE 5F70A 4N3TA 3T4YB 4AVJA 1AE6L 3NIGB 4CVXA 3EYVA 4X0KA 4YBLB 4YHIA 2VL5B 2XVKA 5EZPA 1L7IL 1C9SA 4TQIA 3QEHA 2NY1D 4B3VA 1IGTA 1BF2A 4HEME 1OSZA 5CSGA 5C07D 2AEIT 3TBVA 5L2JB 4ZX3A 2ZKMX 3RNKA 2EEBA 1ML0A 4WO0A 1BXVA 5LBSA 5KSAB 2V9RA 3BKJL 3RP1A 4H40A 4ONOA 3ZKND 3T6WA 4U1KA 4X99B 1HH6A 1O9VA 2N01B 2R1WA 2ALWA 1EH9A 5ICUA 3HC3L 4JL2A 4KAQH 1JXGA 1TZHB 1VADB 4JDEB 5I18H 5I1CL 2CH8A 4YHOL 1GZPA 1CBVL 3TT1L 1ID5I 2P43B 1G87A 4N1CA 3NAAL 4L3EE 4GAAA 4GAYA 4DJMA 5KN5A 5EMYA 1TTBA 3CQFA 4G70B 5HPMA 2ED6A 1OAXL 1GYCA 3NCXA 2ZOUA 4HLZH 4WK2B 4JY4A 3SYOA 2YD6A 4X6CE 5C6PB 5IEKB 4HJJL 4UQ3B 1ZXQA 2CMRH 2YOCA 3P77B 4IK6A 3RWJA 3ZK0A 5C6TL 3QJVB 4ZBJA 1ZDQA 3U25A 3U7WH 4ZMQA 5C0EA 5IIEA 2K8QA 2XZQH 4HU2A 3WHXB 4PV9A 4CVXB 4OZIF 4X5LA 1E2VA 3EYVB 2P3YA 2B3RA 3RUGA 3ULUH 1LLAA 1MWAH 5HYIA 3QEHB 5KVFL 1IGTB 2AJYH 1RFDH 1OSZB 5E2WH 4IOIA 3TBVB 2K4AA 4TNGA 3RNKB 3AT8A 3S4SG 1DO5A 1W72H 3EFDL 2WQAA 1KIRB 1BG9A 3FO2B 1WIOA 1GY2A 5CIPA 4XMPL 5HYQA 1HH6B 2R1WB 1TMCB 4MDRA 1CF8H 3ZDZE 3ARGC 3WJMA 2OMTA 1TKWA 1AXTH 3L3IA 3K5SA 1G7MB 1YNTB 3PNWA 3FT4B 3FQTA 2W0LA 1SRDA 4WI3A 5FGBA 1JGVL 1GZPB 2ZXBA 5LGJA 5I1KL 1AJ7L 1MFNA 3C75A 4NUGL 4XZUA 3HS0C 4JO4L 5GS0L 4J8RA 4JE0A 1KENL 1RV6X 4IS6A 5KN5B 5HPMB 1R17A 3DVGA 1IRAY 4O5LH 1B2WH 4GEJA 2YPVA 3IE4A 1I9IH 2G30A 1LO0H 4TNEA 4RISL 2J6EH 3ZIMA 2OMXA 4D0DA 5BNXD 5JIHA 3WNMA 3WKQA 2P8PA 2F7QA 3V4VH 4CNIA 5IIEB 5C0EB 3D05A 2N7AA 2VXQL 3BKML 3FT3A 4UQDA 5KW9H 2XBTA 4BM7A 3B8SA 1D7BA 4YDIH 2IANE 4CMHB 3BHBA 2HT4D 2N56A 4IOIB 2IH9A 4PJ8C 2ARWA 2CXGA 1LO5A 5CIPB 1CICA 3WHE1 3ARBA 2WLJA 2PWHA 1ZTXH 1NKOA 2DWEA 2OMTB 1TKWB 3L3IB 4AMKH 4P05A 3BD4A 3FQTB 5HHXL 4YDKH 2WVUA 5GS0D 4JRYE 4G8GE 5LGJB 4XZUB 4L1DA 2VDNB 4UDUA 1GKOA 3F12A 1IBYA 4TUKH 5AW3B 1EMTL 2P8LA 5DF0A 4BKSC 3SQOH 3T2LA 3DVGB 5BXFA 1BD2A 4KTGA 3ZIYA 3C6LA 2OMXB 2FATH 3RU8H 4D0DB 3GHPA 1UGKA 4R97B 5KVDL 3ZZLA 1A1NA 4MZIA 1C7TA 3FT3B 4S1SH 3SIKA 1FIGH 5DMIH 5HDWA 2AQ1A 3MRDA 4OI8A 2DH2A 1E7UA 3CSYA 3MV01 1OGAA 4XWOC 1SOXA 1BM3L 4AIZA 3ML9A 2A9DA 4XN4A 1ZVNA 3KXFD 3P4NA 5KSAD 3GLEA 3TJHD 1CICB 4IRJC 5E2TL 5LBSL 3ARBB 1V10A 3B2UC 4K23L 3BMVA 4NC0B 1IM3B 3UGEA 2DWEB 3DDGA 1OAUH 2ROYA 3C6EA 1WBYA 2IBZX 1DE4A 3MLRL 3DSFH 5JDSA 1EZVY 2YHGA 5D9SB 3T77A 1T1ZB 3LZPA 4GSDL 5HSFA 4WI4A 1EGJH 4UDUB 2WZ5A 3FN0H 1CGSH 1H15A 1QR1B 4OLXL 3RJDA 2WXHA 5DD3L 3RPIA 1I3UA 3QT2A 2PPDA 4KO7A 5BXFB 4EOWL 3MV9A 3SDXF 1BD2B 1JOIA 1WD9A 4L3AA 1FNGA 4K7PX 1F90L 2IQ9H 4FFWD 4YC2C 3LN9A 4W9CC 5KSBF 4KKLD 2EDBA 3EZJB 1A1NB 2HB0A 1D6EB 4X5WA 4UAOB 1SLUA 1ASPA 1DCLA 1JZIA 3LTVA 3QEUB 5EBWA 5LGHL 1C5CH 2EXWC 3MRDB 1XGYL 1AKPA 3O45A 3CSYB 4ZXBC 4CSZA 1RSYA 3OM3B 3SE9H 4F8PA 4M62H 3D69A 4AIZB 4FZEH 2E3VA 4WW2F 4R7XA 1MH5A 5J6SA 3P4NB 3RGVC 5F7HA 1QBMH 5FF6A 5E4IA 1CXLA 1X7TA 3CC1A 4GKNA 4U1IA 4JO5A 3LEVH 1FRGH 1FYTE 4OZFA 3VFOB 2OMZA 1QBLL 2PETA 5JDSB 3T77B 3AREA 3ULUE 1JHTA 4MB1A 4Y16C 4PJ7F 2DEXX 2VDNL 4NQDA 1H15B 5E4EB 4NZUH 2XX0A 4ALAH 4O51A 2W5PA 3RPIB 1BAFH 1T5WA 3T6QC 4NN7B 2ZOKB 3MV9B 2YKKA 1A6TA 2AGJL 4K5OA 5C3TA 3DI2B 2YPVL 5D2LE 4H8WC 3VMPA 4JK0D 4DVBA 3B2DC 5EBMA 3GMLB 4JRWA 1MJ7H 2HTKC 3BYYA 4QR7A 3R1GL 4X5WB 1A7QH 4WCYH 1JZ8A 4NO2A 4ZUUA 2GBAA 3PP3K 4LCIL 4OJDH 3RWHA 5EBWB 2E46A 3MN8A 1L9TA 1GOHA 1J1XL 1UZ8A 3ARUA 3O45B 3IM1A 1TR7A 4Q97A 2ZCHH 3E80A 5EUOA 3HHMA 4I9WE 3IJHA 2VDPH 3D69B 3IFNL 4CRPA 1ZV2A 2GCYA 3L54A 1MH5B 1JWUA 1QLEH 3AWEA 2J25A 5FF6B 3Q6GL 1J88A 3GYRA 4GKNB 4Y9FA 1IGML 5LJYH 1U4FA 4U1IB 1CUOA 2NNXA 3C5XA 4OZFB 3QWRD 4HALA 2OMZB 4E2OA 1Y1DA 2GJJA 4Z7UF 4AG4H 3AREB 4ODUA 4WY7H 1JHTB 2F53E 1QACA 4NQDB 2F8OA 1BWWA 4NM4H 3EIFA 4X8XA 1JNLL 3IPEA 3OHXC 4B6ZA 1GC1L 1OW0C 2F6AA 1T5WB 5FYKH 5C0BD 4Z8FH 4FD0A 1BW8A 1A6TB 2BY2A 3VDAA 2F19L 1T03L 1A7OL 5LKNA 1G6VK 2X7LA 4DAGH 4K94L 4DVBB 1VF5C 3SJVD 4F2ME 3H2QA 4HIIB 2PPEA 1ZTXE 2XVLA 1PNCA 5DD1H 1G9EA 4NO2B 4ZUUB 2QKIA 3RWHB 1EDHA 1UZ8B 3QCVH 2Z7UA 4DZBB 3O9WA 5E1IA 2JV6A 1WFNA 2B8OT 3U2JA 5EUOB 3WNNA 5TQ0H 1Y0LB 1RVFH 4DGVL 1Z9LA 5IBLD 4KZEL 1I7ZA 1OARL 3IJHB 4KI1A 4Y9BA 2X4QA 1NFDF 2NXYC 2XZCH 2GCYB 2GJPA 3CG8A 4P59L 1UD3A 2A9BA 1CICD 1FFRA 4XB7A 1OAKH 4XPHH 2VLKA 2Q0ZX 2QEJA 1K8DB 1TENA 2Q8BH 1IM3D 4FI6A 4IKLA 2DLGA 3BKYH 4OZGE 1HJBC 1JZ6A 1IC0A 3QR1A 2CJTA 3ZE1E 4JDZA 1CYGA 3DBSA 4ZMAT 2Z8SA 1XD1A 5GS1C 4ODUB 5GRWA 4NN6C 2R56H 5EZOH 3UTOA 3T04D 2E7LA 4G59C 2YMXL 1QSFE 1U9KA 4GAJH 2OCJA 1BD2D 3KW7A 4HJ0C 3ZMNA 4BEIA 2IV9A 1ZXKA 4FHBD 1MJ8H 5GRYA 1G9NH 1IAMA 1JXJA 5J56B 4YUEL 4BFIA 4CC4A 4MJHA 4LSVH 3S34L 2KH2B 1P4BH 2CKNA 2QKIB 4G9DB 3WUWG 3WD5L 2WWMD 3OB0K 4H44C 5AB0A 5AB1A 1E4WH 1N7MH 2NY4C 4DH2A 5I0WA 4QHLB 1A4KB 3G6DL 1A6VH 1WZAA 1G5GA 4JKKA 1I7ZB 5CEZH 2NQCA 3EHBB 2EYSA 2VLKB 2ZNWA 5DDHA 1F2QA 5ESAA 1QRNA 5DYOA 4GO9A 4R4FH 3JWNC 4KY1H 5FKAA 4XNZB 2VZ1A 1EO8H 3L08A 3RG1C 4JDZB 5LAXA 3C8DA 2NT1A 2Y5EA 3OSVA 4WNJA 1XGPA 4S1RH 3HOGA 5K1NA 1GS8A 1QEWA 2DMCA 3AM8C 2NSQA 3MV9D 5GSVA 2VMCA 4FQLH 3M7FB 2NT0A 4HEPA 4N0CD 5F9DC 4L8CB 2MCPH 4QRBA 4EAEA 4L5FL 1XH2A 2DMHA 2OX5A 3KWXA 4BFIB 4HUUB 4OCXH 5DUBA 4YHMH 4ZSOE 1MHCA 4UNTA 1FUNA 2B39A 1EHLL 1MIML 3NFNB 1NBCA 3BX7C 4M5TA 5GGTA 5CFHA 2Y07H 2VDMH 3ZDWA 3LEXA 2YQ2A 3QJOA 3HKFA 3QH3A 2X28A 1QTSA 1L9QA 3KWWB 3LXCA 3GXDA 4TPRL 3NJHA 3M1BA 4ZMXA 5AW4B 4XPAL 4CC1A 2FUQA 4P4RA 2C9SA 3K74B 4LEEA 3ZL2A 3W1ZA 2FL5A 4QXGL 4KTEH 1FZMA 1CIUA 1JXKA 3CSPA 4TUOA 5DDHB 5E6UB 5GJTH 4R90L 5ESAB 5DYOB 1CDCA 5L0QC 3NSJA 4PJDF 3FF7A 4XNMA 3MV11 5FKAB 4CGTA 2PWFA 2BP3A 1X5KA 5D2NA 3FO0H 3D34A 5HGBA 5LAXB 3KBPA 1MCSA 4J6RL 3NPSB 3S8FB 1UA6H 1IBHA 2ADYA 2QQQA 4LLUA 5CJXC 1XGPB 4C8XA 4Y19B 1OE2A 3GRWA 3LQZB 3WIAA 4NQDD 4PJ9A 4HKBA 4YSPA 5BZDA 1KWKA 2KQMA 1NC2A 2Y5TA 4YHPA 3ZT7A 4JFOA 4LESA 1KELH 3V4UH 3ZN6A 1QEWB 3TBSA 2DLIA 1A9BA 5JQHC 2ZF8A 5JHBA 2F1AA 5GSVB 2C5DC 3LKNA 4IRSC 1HL4A 1ZV5A 4YMPA 1UT9A 1CR9L 4RGNE 4E9QA 1D7DA 3O6ML 3HI5H 3PXLA 5DUBB 4HK0A 3LKQA 2PR9A 4JG0L 1MHCB 3ZT6A 4PSRA 4F8NA 3VI3B 3QUKA 1M6UA 4FFZH 3US9A 4Y4HA 1N67A 1NKGA 1GGCL 2P24A 3QH3B 5EWIH 3EOTL 5HDBF 4I5BA 2QQKH 2X41A 2CO3A 1W0YT 3LY6A 3R4RA 1RPQA 1KYUA 5CO1A 4AQAA 3OC8A 5DWUL 3TN0A 5KANI 2BSBA 3TNMA 2FL5B 1V27A 1FZMB 4TUOB 5DT1H 1PDKA 3BKCL 1QBBA 3PAYA 3APFA 4OT1H 5B3JF 1ANUA 4WW2C 1KN2H 4PTTA 5ADOH 2VQUA 2Y3NA 2OXHB 2F8XC 1SEQH 4YL9A 3KG5A 4LLUB 1II4E 1EVUA 3J2PA 1FG2A 3DA0A 4LL9A 1AZCA 4PJ9B 1GCYA 3G6JF 1WS7A 2XSKA 4AJYV 5BZDB 4MKMA 1NC2B 4YHPB 4JFOB 3UPAA 3FT0A 3PWVA 1JK9A 3TBSB 1A9BB 3K6DA 2Q3AA 3HN8A 3QWOB 1F45A 1OF0A 3ZZ1A 2C1OB 1S7XB 3EUDA 3WNOA 1MHEA 2HTLC 4I3GA 4HCGA 5ETUA 4P23A 5IQ7H 3L7EA 1XB6A 1MCCA 4KZDL 3BXNA 3LKQB 2OJ1A 1Z5YD 2C9PA 4Y2NA 1J12A 4W9FC 5G2NA 3QUKB 4K5PA 5KS9E 5IJBC 1S46A 5CEXA 5IGXL 1G7HB 3RRQA 3WO3B 2P24B 3K2UH 5E1GA 2ZUTA 4QRRD 4O9HH 1GGTA 4N0YL 3MYJA 4I5BB 4R0LA 2HJFB 4R8WH 1E5UI 4BFEA 3BAJA 1KDJA 2EDFA 2F54B 3V5DA 4HCRH 3EHBD 1RLWA 4XBEL 4AQAB 2XXCB 2Q7AA 3IGLA 3HC0A 3V4PB 2VLKD 5CJBA 5EOCL 2HT2C 32C2B 4Z7VF 5EU5A 5ID1A 4KK5C 5TJWK 2H4EA 1AACA 3QJFA 3DC0A 1H8LA 3SPVA 2XCMC 1JRHH 4PQXA 3VB9A 4UIKH 4JY5H 2K0RA 4Y1TA 3H0TA 4N2LA 3CN3A 1FG2B 2FX9L 3N55A 4P04A 4DK5A 4TTGA 5F1KC 1C8PA 3PWVB 5DC0A 3RVTC 4QKTA 5IFAH 4JDVA 2X9XA 4WEBL 2V3DA 1KJ2H 3GZKA 1PY0A 4NQSA 1M7XA 4LSDA 3N6YA 5ETUB 3TBWA 3L7EB 1Q38A 4KX7A 2OCCB 3WO4C 3I6LD 4XNAA 3QDJA 5IB5B 5CEXB 3UYPB 4NKIH 1HEZA 3Q8FA 2WSKA 2AXGB 4XPGH 4O00A 5GGTL 4FA7B 4KH9A 3MYJB 3NCBB 5FEBA 4XVOA 3BVNA 4OLUH 2NYZA 4XXDA 4IMKC 5D7JA 5L6YH 3V5DB 1M7DA 4G72B 3OJVC 2XT1B 4ZG1A 4MRBA 4D8PA 1JDCA 1E4XL 3WMSA 2DMBA 5EU5B 4XN1A 3TVMC 2F74A 2WCPA 2V6HA 3SPVB 2GY5A 2H6PB 5LAPA 5K9OA 1E90A 3QR0A 3NQKA 3IS1X 3DXAD 2FX7L 5IY5B 1VEOA 1SVZA 1YYLH 4Y19D 3OAUL 4G6AC 3AGVA 3WJLA 3X14A 3ZXAC 3GRWL 5J89A 1AANA 1LP9E 1UH4A 3MCG1 4TSCL 1LGVA 5E6IA 1CL7L 3PDOA 2CO7B 4FL4C 3O81A 4HPOL 3BESR 4JDVB 1KN4L 4XWGL 1TG8A 3RY5A 4WO4D 4GXUM 5IMMB 4BFJA 4NQSB 2VMJA 3QJSB 4JQVA 2F61A 4Q0XL 4Y89A 1L9MA 4OR1A 5MHSD 3QDJB 3L1EA 4Q9BA 5AZEH 1OSPL 3VSUA 2A74C 5J1TC 1HEZB 3EDJA 1P84K 5J3HC 2FQFA 3A67H 1DQLH 1CFMA 3BVNB 4XXDB 5D7JB 4JS7A 1IGCH 1JGIA 1M7DB 1JZGA 1X6NA 1T2JA 3KBHE 4D8PB 3CC5B 1OM9A 2JJVA 3NJIA 1PF3A 3VWJA 4LAQH 4OQ1A 5C9JA 1MRCL 3NSDA 4P8QA 4F7CA 3MNWA 2WIIB 2WNKA 3K4DA 2F74B 1XT5A 3BGFB 3DVIA 4P2OC 5K9OB 4OD3L 1SBBA 4GLRH 5JW5B 1U30A 4GG6E 5CWSB 2GEEA 3DX3A 3O41B 4N2OA 1GW6A 2WOYA 3JV0A 2OJEA 1EEQA 1U8IA 4YSOA 2CM6A 3T0BA 1U58A 5T5NG 4PJ9D 3X14B 3I6KA 1QFHA 1X4XA 2IADA 2BO0A 3VG9C 1KNOB 3PDOB 1KIUA 2YJQA 1RU9H 2MPVA 1ZA6B 4WUUE 4OIIH 3LPPA 2J1KA 1KCRL 4ZNCD 5DYFA 3WJJC 4PLNC 2CBTA 1S5IH 4LHJB 5GZNC 2C7UA 1NAKH 2V7HA 4OZFG 4OJCA 4ZFOA 1HK6A 4CVZB 1WS8A 2H0FA 1M53A 2VZ3A 3I6SA 3FPYA 2LQRA 1INEL 3EGSA 4RFEA 1I9JL 5CEYA 5FCUH 3FT1A 3BUQA 4DEWA 4DNLA 3G9AB 4PIBA 1J5HA 2F54D 4NNYB 5FFOA 3GMOA 2VR3A 2WP3O 2J8OA 2JKNA 5F6HJ 3ZOAA 3VFWB 1L5GA 4XRCA 2V4LA 4FCHA 2DKSA 2HT3C 5JPNA 3VWJB 4N8PA 3U36A 5C9JB 4HUVA 1UWXH 4N68A 3RKPA 4PVNA 4F7CB 3IAGC 2FO4B 1FO0H 3BEWA 2GK0A 2N1KA 1F4YH 3MLWH 3LXUX 3QEGH 1BZOA 2XNAA 2P49B 3HG2A 1JNHB 2K9FB 4U4BA 1YNKL 1U8IB 2OJEB 3TJEH 4D9RE 1U58B 2EIKB 2HRHA 3GUFA 4NBXB 3D3VA 3VM7A 1GPOH 2CBMA 4FABL 1KTJA 3I6KB 2IADB 5DUML 4FNLL 1KIUB 5FYJU 2E0PA 1A6PA 3ALXA 5EC1B 4XVJL 4KJYB 3ZDXE 2IPKA 2JKRM 3CFIC 4R4ND 3N44B 4Q6YA 1BZ8A 3BP7A 3HNTL 4LCCB 1I8UA 4OCSL 3BH8A 3PP3H 2E6JA 3Q9QA 4M8QB 1R6VA 1V7ML 2C7UB 4H1LA 4NP9A 1B3IA 1J8HE 4ZFOB 3F7RA 4D9QE 1M57B 2B5IC 1JFQL 2DQGL 4HHAA 4YLBA 2EC9U 3P9WB 4RFEB 4AK2A 2B1OA 1XD0A 3NZ8A 4PYGA 5CEYB 4WI8A 3SKJH 5BMFH 2BNQA 2CK0L 4K5NA 5J4MA 1BAGA 5AVWB 5AVRB 4ZAKA 2FEDD 5IHWA 4JN1L 4MX7A 4W6WB 4DVRH 4ONFL 4DPCX 1SXAA 4XRCB 4JR9H 2V0AA 3RVXC 3VXUE 2A9AA 4QUOA 5JPNB 1BZDA 1QO3A 1YYML 2GIXA 1E8WA 3BEWB 3GMQA 2GK0B 2YD5A 3IGFA 3MRJA 4QT5A 2XNAB 4L4TE 4EUPA 3H9SE 3O2WH 2P45B 3GXMA 4M1DH 1LK3L 1BMWA 4CKQA 2NMSA 2Q7NA 4ABQA 2UWEE 4LHUB 4UINL 2ZE0A 1IBZA 3SYCA 3TGXA 1GVIA 4W9LC 3WXWH 5JW4N 2BRRH 3LD8B 2Z91A 4JREB 3QDHA 1FLTX 1ZKAA 3DHJA 4RGMB 4KQ4H 4A6YA 3RZCA 1CWVA 1NL0H 3UC0H 2YA1A 2CRZA 1XIWC 4X50A 4P4KA 2EDRA 4HJUA 1KPVB 5F7EL 5AL8A 2WXJA 3V8OA 3ZTJG 5JOFB 4X9GA 3QDJD 1TXKA 1GJWA 5LXGL 4HHAB 3V7MA 1DLFL 3GNMH 3R7RA 1Q72L 1JNJA 5K9JH 2DWXA 3NZ8B 2NSMA 2I7SA 4OCMC 4ZZKA 1WZKA 2HRPH 3FUFA 2BNQB 5C0ND 4EIZC 1FNAA 1S9VB 3FQYA 1E6OL 3WFCL 4MX7B 3S0PA 2DOCA 4OLYH 1MLCB 1PZDA 1HESA 2BOBA 2PNDA 2PMZA 3UJJH 1CE1L 2A6IA 4O58L 3EDDA 5CGYC 4M7JL 4XN7A 1QO3B 3LKSA 3RNQA 1EJOH 1OAQH 2VMEA 3L5HA 3NVQA 3GMQB 3ZYZA 1UXLA 5ADPH 3MRJB 4QT5B 1I7TB 1BP3B 2I24N 2BNRE 2GJZA 4U6YA 2H47C 1AOZA 4DQOH 4OZHA 4Y7MA 2VXVL 3KHOA 1BYNA 3APMA 4J3OC 5CP7A 4YQXL 5IUCA 2Z7YA 2OL3A 1CDHA 1HL9A 1HCZA 4HH8A 1P9MC 4OQTH 1I3GH 4ZO6A 3QO0A 1YMMA 2J57A 2O5ZH 2PWEA 1DN2A 3RZCB 4BUHA 4A6YB 3PUUA 4KMQA 2OSYA 2APSA 4P4KB 4BIKA 1EWHA 1NC4A 3FTGA 1R47A 2J88L 2N4IA 1BZ7A 5KVEH 2HVBA 4IDJL 3MJ8A 3VXRB 5E9DE 5A6LA 2Y36H 4ZFOL 1DN0A 2P5WB 3U2IA 2FBJL 2Y7QA 1TQCC 3NJLA 5C0AE 3QZLA 1CFTA 2PTTB 3Q8AA 4LOUD 4APQC 1DJIA 2QSCH 4ZS6C 2APTA 5LCVH 5CLYA 1EFXA 4G7VL 4QHUA 2F5AL 1UM4L 4JHWL 1SJXA 4JPWH 2CIIA 5SWZD 4WKZB 4IKIA 4HEPG 4YSAA 4W9DC 3JXAA 2BOBB 4ATWA 1TT6A 5DHVA 3RNQB 3UZEC 4RMWA 1CQKA 3V9CA 1TSRA 5D71L 4BQCA 1T66C 3QHFH 4AL8C 1YNLL 1X9QA 2EZ0C 3UBXI 3L3JA 2GJZB 4U6YB 5EOQL 1MCPL 3PWJA 4JKNA 1WZ1L 5DO8A 1FE8H 3PGDA 3RAJH 3SKUD 4XAKE 5DHXB 2XA8L 3TIEA 2VLRA 2OL3B 3S36X 5AW0B 4MXWL 1C08A 1A4CA 1CD0A 2A5UA 2OSLA 2V2WB 3QO0B 3U1SL 3W5NA 5AVUB 1N2RA 1IAIH 3C5ZC 2LAGB 2VZUA 3O4OB 1IB5A 1A8ZA