5CR8A

Structure of the membrane-binding domain of pneumolysin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
RNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pneumolysin
publication title The Crystal Structure of Pneumolysin at 2.0 angstrom Resolution Reveals the Molecular Packing of the Pre-pore Complex.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Toxin
total genus 22
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 5cr8A00
3HVNA 3CQFA 1PFOA 1M3IA 1M3JA 1S3RA 4HSCX 4BIKA 5CR8A
chains in the Genus database with same CATH superfamily
3IGAB 3CCHA 5FOBA 2W92A 3CLEH 3DXAA 3NJIA 4NQED 1Q1PA 1UXSB 4UTCA 3BZ4A 4OQTH 4FJYA 1IAKA 2AJVL 1WBZB 2V33A 2H0PA 1PS3A 2LLLA 3QA3A 1H19A 1QFWH 4JM2A 4LLVA 5C0IA 3U25A 3PNRB 2F19H 3D25B 3REWB 3SE3C 4Z7UA 2K6YA 1NEZB 4N2NA 5FYKD 1OALA 4FFTA 1I7UB 5LGJA 4HSAC 2PXYD 1WAEA 3B7SA 4W9KC 3HN5A 4XXDA 4F33A 4PRBA 1JZ5A 2FECL 1ZPLA 1BBJA 3J07A 4P2QB 5AKSA 5DJ6A 2HKAA 5JDSA 3MLWH 4R4BB 3LN5A 5TFSH 3VU2A 2FT7A 3CLWA 3N9GH 4H26B 2Y06H 1CLZL 2ICEB 2H3XC 2Y2WA 3QHZH 5D55A 4MXVE 4XAWH 5DR5H 2G2NA 1ES0A 1D9KA 3D3VD 5L8JB 1KDJA 3NA9L 5E9AA 1IM3A 5LO7A 2A6JA 3RBSA 5EDXA 4S1DC 4LSPL 2DLGA 4DP9X 3RIKA 4NSKB 3OMNB 1RPQA 3ZOAA 4ZSOA 3QRFM 1GZQA 4KI5F 4MDIB 1LP9F 3S96A 2CKBB 4FOMA 2G30A 5GIRA 1CTOA 2ZF8A 5ID1A 4IOIA 2Z4TA 1G6RB 4PREB 4APXA 2NX5B 3O4LB 2R2HB 1KNOA 3BYTA 4JFPA 1GRWA 2P8MB 3QEHB 1CXLA 4L2YA 4ZAKD 5LN4A 2BHZA 1U4FA 3TNMA 3V5DB 3AG4B 1AS6A 1Z9MA 2V6HA 1GYAA 4Z18A 1VKXA 4BM7A 4B50A 2PYEA 2OSLA 1P1ZA 4JZNB 3TBYB 1FO0L 4EI5D 1B3IA 5DMIL 4PJ9D 4TOYH 2I7OA 2NXYB 3UTQA 1ZLUH 1J9SA 2A99A 1YN6A 3KJ4B 3DMMB 4AX3A 3VGDA 5FUZH 5TGBB 3NQKA 2P4AB 4KVNH 4DP1X 5L2JA 1HXYB 2GQHA 4FQIH 2E27H 1G9EA 2D9CA 1T2XA 1ZK5A 5F7LB 4Q0XL 3FQXB 4KRPD 4GP8B 4QRPE 1AR2A 3MV9E 2BMKB 2EIKB 4E42B 2TRYA 3NESA 4Q89A 5J13C 1UT9A 1YEWA 5AL8A 5KN5A 5KVDH 1IBFA 3BP5B 4MNGE 4KXDA 1JWSA 3ZRCC 3C5ZB 1ETA1 2FATH 1TU2B 1UWYA 1XGUB 4Q52A 3R06B 4KI5E 4ABVA 5GS3A 3OGCA 1U95A 4G9FD 4X5XA 1PAZA 3FW6A 3FTVA 5BO1L 2PO6C 3V8CA 2JB5L 3LIUA 3FBKA 5DJCA 3X1EA 1UM6L 1QNIA 3LQMA 4QYOA 4AW7A 5DUPL 1G87A 2H3NA 1YYMH 4KTDH 4LSVL 5KZCD 3K1KC 1QI3A 3FTYA 2OR9H 1JCVA 1IKNC 1TJGH 5FW6A 1KYAA 3U30B 4R5VA 3VG0L 4EZKA 1G4MA 1X44A 2DIAA 3PWPB 3QNYA 3LXUX 2Y5TA 1TMQA 1YQ2A 4L3AA 5FECB 3CWGA 5IBLC 2ENSA 1MHPL 4N2CA 1FE8L 4IRSC 3AXLB 3V0FA 2VAAB 5D5MF 1LWRA 4TSCL 1TZGL 2FSDA 1TUPA 4NRYB 5C7XL 2PP9A 1OTUD 1MOEA 1XGQB 2DYRB 2J8UF 3ERXA 3JTSB 3O2DA 3PGCA 4RAVB 2X4QB 3P4OB 4K3EL 4KNQA 4MVBC 1VHPA 2X12A 3AADB 3NSDA 1PFOA 4KKNA 1BW8A 3HI6H 4BWTA 4F80A 2ORBL 3Q2NA 5M94B 2J43A 4NGHH 1LMKA 1AGCB 5A7EA 3RG1C 1YEGH 2ALAA 3KL0A 2L4OA 4HCRL 4G6KH 3MRLB 2JJUA 1KJ3L 4DWHA 5IESH 1FJ1B 1OTSC 1IBYA 4JFFB 1F3RB 3RL2B 1E3FA 3EOAA 3FFCA 3KGSA 5ADPL 3TF7C 3QJFB 3HG1B 1KTJA 1U8KA 1JV5A 3UAAA 1BJ8A 3FONB 1I3VA 2X87A 2WZ6A 3VGAB 4DZBB 3QPXL 1NL0H 3M1BA 1T7XA 4PY8I 1ZV2A 1HINH 4JZJC 1LO4H 1HH9A 4GRLA 4X6DB 1QRNE 2FNBA 5D5ME 2OM5A 1RUPH 2QGDA 5E9DE 1WAAF 3KWWA 3X1NA 1I8UA 2QADD 2J8UE 1F3DJ 1BZDA 4K8RH 2GYSA 2EH7L 2MKWA 5AOIA 1XIWC 3RDTA 2FB4L 5IGXH 1FSKB 5DC4B 4B0MM 3VRJB 2EYTB 4ZXBA 4AEHH 4DPAX 2CBQA 4FYSA 5I71B 4U1NA 1D6EB 3SE9H 3COOA 4HT1H 4MA3B 5L7XL 2GT9B 2NUTB 1FH5H 2Y5EA 5D70H 4YHPA 1U8NA 4XP4H 4J3OG 2J6EH 1QLFA 1MAML 2K9FB 2H6PA 4MZ2A 4NQCA 4QF1A 4XN7A 1DUZA 4YSSA 2DQJL 3RB7A 3RDJA 3LN4B 4ZTOL 2EUZA 5DD6B 3L2NA 3TFBA 3ZKXC 2XKNB 3SDCD 3WNPA 2ESVD 3BGFB 3D18B 4OCSH 3TL5A 2EIDA 2CAKA 1J1OH 4OCMC 4UIKH 3KBHE 4RGMC 1U58A 1SDDA 4WO4D 5IQOA 1KENL 2HAZA 3DOSB 5HGDB 5ACZA 2ZOTA 4A63A 4EDWL 4ZUSB 4E9TA 1RAMA 3ZPDA 2WB7A 2XN9D 1FZJA 4F8PA 5ADOH 1EERB 5BQ7A 3GKWH 5HYQB 1KXHA 3DX9A 3MROA 4JN1L 3KPPB 2D7MA 1J1PH 2AEWA 2CMRL 3VD0A 3QBTB 3VI4E 3TIEB 4GPVA 1XSIA 4YBQC 4WGWB 2H45A 3ZU8A 4F2MA 4A6YH 3LKPB 2OTUA 4U1GC 1I1RA 4HUVA 4PY7B 2GABA 3FCTA 2R1YB 3GPEA 4XE0A 5GSVA 5GRZA 3L1OL 1ZVYA 1IGYA 3CFNA 1N64H 2I9TB 2IPKA 4HCIA 2DQTH 1P4IL 2C3GA 2Q5BA 3IDMA 4HF5L 1BQHB 2ZWLT 3MZTA 5ICUA 3L6FB 4ZRGA 1HXMB 5J6SA 2DQGH 2DQCL 5I2IA 5FDYA 2FGZA 2XOTA 4NKIL 3ALXA 1SOXA 1ECYA 4M7KH 4MD4A 4F7EB 5I17A 1WZAA 3BXNA 3RJDA 4HIEA 1XGPB 1EFXD 2OI9C 4QHUA 3LKOA 1KLGB 2YAFA 1N12A 5IHUL 3NCXA 1N6QL 1J87A 2YJLA 2M26A 1I1CA 4QPEA 3TV3L 9PCYA 2APFA 4OJFH 5KVFE 3RVXC 4JO2H 2Q87A 1R47A 3TWCH 1S7XB 1CL7I 4M1CD 1S7QA 5CLTA 3LIZH 3DETD 2XLLA 3NZUA 2JTYA 2RCSH 1RJYB 3OMAB 1ETZA 3TWCL 4ONFH 2JJVA 4LCVA 1THCA 4FQ2H 4N4YB 2RCSL 3MCKA 1JFHA 2ZCHL 3FCBA 3Q8FA 4XC3H 3H2WA 3BAXA 4FEIA 2B2XH 1FG2A 3AQXA 1A21A 5B8CA 2EILB 4M4PA 1IC0A 2B2XL 2ZP9A 3FSWA 2WYZA 4FTDA 4LCWE 1ZT4A 2VNCA 5FUCC 5IHBA 4JHZA 3QYCA 2XKSA 3O6LL 2VDKH 3H3PL 5DZVA 2JVUA 1S7UA 4IBZA 3I02B 4DGYL 1IB5A 4AJ0A 1AVAA 4RMBA 5JMOC 3U0TA 4H0GA 1GHFL 5IP4A 2ZWZA 1RJZB 3N1MC 1FN4B 3MMEA 5DJ0A 1J0YA 3VTTA 1DJXA 3DJZA 3VA2C 5GS0H 5IIEB 3GHEH 4B7LA 4ELMB 3P77A 3CK0H 4UBDC 4E9YA 4HP5A 3FUFA 3N41F 1TOXA 3R7QA 5CSGA 4C47A 2BP8A 3GHEL 1DQKA 1J8HE 4K73A 2R39A 1A9EA 1OAZL 3BKJL 2V3EA 3SGKC 2VXSH 3BIKB 1D5ZA 4WFGE 5FYLE 2VISA 4HUKB 1E9PB 4G8GB 2OYKA 1MJUH 2VXSL 1D7DA 2PR9A 3ATDA 2L7EA 2AMUA 4XXCC 1NEZG 4XVOA 5K9QI 5E2VL 5CZRA 5J5EA 4PG9A 4AUJA 3GSXB 4KX8A 3W0WB 5KS9B 3OMIB 5GZNA 3TYGL 1FNEB 3DJSA 4I1PA 3NH7L 4JKMA 4W9CC 4N2FA 4JQVC 2IGLA 5I8CB 5K9JH 4OZ4A 4LSQH 2FO4A 3IDNA 4XAKD 4R6UA 4A2GA 4J8RB 1R24B 1KV3A 2KHAA 3GMQB 2WWOA 4NN6B 2MPAL 1INDH 3IKCB 3LZRA 1OL0A 4LSQL 4O00A 3LKRA 1UG9A 2FUTA 2BWQA 1A8JH 4OI7A 5LN8A 1UH4A 4XPHH 1NJ9A 2V5SA 2HT2D 2K78A 3ARVA 3NJLA 4Z95L 3NSFA 2AXGB 3SYOA 2K70A 5LQBH 1C9SA 4AVIA 4NUPA 4MDJA 5L2KD 3F7PC 1P7BA 3BUTA 4NO2A 4RQQB 4N0YH 5DJDB 5BS0D 2VZ3A 2BNRA 1N5AB 2IWFA 2GSIB 1T7VA 2GJ6B 4WQOA 3EHBB 4GRMB 1FCCA 4N0YL 1IGML 1AQHA 1ADQH 3FO1A 5GGVH 1GMEA 4JQIA 3MJ9A 2B4CC 4JB9H 2D7TH 4HC1A 1CT8A 3RZWA 4BZYA 4MNHB 3HI1B 3JWNE 3Q6GH 5DTFA 3VXRE 5D7IF 1Q0YL 3QG6A 1LTXA 2V5YA 3N91A 3HE7B 3PHOB 3Q6GL 3QIBA 4FXKB 4Q58C 5D8JL 3G08A 1A1MB 2VGLM 1MHHB 4GY4A 5DUMH 4YBLC 1JUFB 1HH6B 1UATA 3QNFA 3ZKNC 3OBAA 4KJPD 2BIPA 4K5MA 1MCCA 4JW3A 5C08D 1IGFH 4JY5L 1R75A 3LRHA 2WXOA 2GJZB 1X9LA 3QIWA 2EUVA 4CMMB 3BH8B 1Q0XL 1YVLA 3OKMA 4GEJA 2DY2A 3KPLB 3E2HB 5ESQA 2HTLD 1REIA 3VFPB 1R33A 4ETQA 1SF3A 2X2HA 1GJUA 2ISDA 3P4NA 1E6JH 4K5LA 4AMXA 1FRGH 2OTWA 4PLOB 3T4AB 3RFZC 1PY4A 2X88A 1MDAA 1OOWA 2EEAA 3HBQA 2CIIA 2JKNA 3NJKA 1ZD6A 3WLWD 2WNWA 4MRCA 2OZNA 1TETL 5GJTL 1U8PA 4YNYB 4Z78B 1UB6A 3SGDI 3L9EA 2YUXA 1EIBA 3ZHLA 4XHJD 3OKOA 4MD5B 3TBVB 5DC0A 5EZOL 2CBTA 2VH5L 4KDTC 1EAPB 1JK9A 1KCBA 3IE4A 5IBTH 1I7RB 3BUQA 4OJAA 1NGWB 4MX7B 2DJUA 1N3NA 3O8XC 4X4ZA 3D30A 2O5ZL 4PRDB 2JCCF 5E70A 2P5WD 4PSPA 5E6RB 5T1LD 4XGZB 2YRLA 2GTZB 3A5VA 4LU5L 5CINL 3FULA 1CGUA 4MQSB 1Z32X 2V2XA 2J5LC 4H0IA 4KQ4H 4AG4H 3PJSA 4LLAA 5HGGS 4MNGB 1P6WA 4X99A 1K4DB 2I9LA 2YA2A 4AG4L 2F7PA 1AGDA 2FZ3B 2Q6WA 1NGXA 4F9LC 1KIQB 1LP9B 1VFMA 3MREA 4FKHA 1AO7B 3OZ9H 4LEXL 4AQAB 4TVSa 2CIKB 1A4KB 3RGVD 5B38B 2W81C 1I9IH 4LLYA 2ZSWA 3GMNB 1Q72L 3VXSE 1KTRL 1QASA 4TULH 4R2GB 2WV3A 4Y8AA 5JW3H 5I0VA 1U8HA 2YR3A 4YDNA 5J11C 1NPJA 5JPMC 3NIDE 2OSYA 5I1DB 4TQ8A 4QXGL 2X4TA 5EF0A 2F54A 3RTQD 4WHCA 4U1MB 3QULA 3ZT6A 3CFTA 1KCRH 4OZGA 4DTGH 4RWYL 1KWGA 3OC5A 1MRDH 1M7XA 2O1AA 3D48R 3E1F1 5CJQL 2ENPA 2CRMA 4Z8FH 1DBMH 3OQRA 1MRDL 1DDHB 1YEFH 1SVCP 2ZCLH 5LKNA 1ZA6B 4WDIA 1PY0A 2HN7A 5C0FB 1RERA 2QKIA 2EDLA 3QJVB 3QO0B 3RE0A 1UOWA 4QY8A 1NOAA 1TEFA 5A2FA 1URIA 1P6AB 3LDBB 2R56L 4W9LC 3SKUD 1U2YA 2EIEA 3U36A 4CMHB 4Y4KB 5CD5D 1GCFA 2FNWA 5TK2A 2W07B 5CF3A 4NP9A 4HMEA 5IJDC 2OMTB 1CDGA 5BRQA 1FGNL 4AQ1C 1OAXL 4GXUM 1HE8A 2IGFH 1DQJB 5F96L 4P2OA 1CGSL 4ONGH 5F21B 3UZVB 1IJ9A 5BRZA 1JNLH 4K7PY 3V9EA 1HSAB 3KS0H 2B9BA 4LMQI 1P4BH 3KYMB 3EXJA 4D9QD 4F7KA 2EEXA 1FYTA 1ZANH 2R27A 1QRNB 5DJ2B 4JG1H 5DVMA 5D5MB 1R9FA 1PZ2A 1TTCA 1GGUA 5E9DB 1ZVHA 3CSPA 2J8UB 1UKQA 3Q01A 3QNXA 3QQNA 5FYJD 1DVYA 4G6AC 4ESKA 4HOMA 4LNRA 2ZIDA 4ZUTB 1IFRA 1J5DA 3TF4A 3GNML 1CCZA 3HMXA 4OAWB 4PP2A 1YA5A 3CSBA 1LNUB 1KGUA 1OD9A 4HKZA 5EORH 1MH5B 4F57H 4J7RA 3SKMA 1BQHG 1RK0A 5LWYH 1E3ZA 4R84A 2B77A 2IDTA 4F1ZA 5I73C 5KVFL 1WTLA 4F57L 4X7SL 3HHSA 5FK9A 2CZNA 1YEIH 1AIFB 2K45A 3TH2T 5JXED 5TH2B 2ZICA 3C5SA 5DK3A 5JW5B 2R7EA 3UAJC 1ORQA 2CRYA 1AQDB 1H8LA 3O81A 2JJSA 2E7BA 4LVOB 4G9DB 3Q9QA 2G3MA 4IIQC 5JHBA 5KYWB 2GSGA 2WCPA 5CHNB 3SCMB 3SPVB 3AJ7A 5LDSA 4V1DA 5AW5B 2B1HH 2IH1A 1ZPUA 2X9ZA 3BPCA 4N25A 2GUYA 4D3CL 1WV7T 3A6BH 4N2HA 4UILH 3UTPE 5I6MA 4JLRB 3UZQB 3FT1A 3B9DA 3G6AB 2C9RA 1FL3B 3HE6B 3A6BL 2XWRA 1MCPH 2AMGA 1QSEE 1I1YB 1MREH 2GSMB 3MRCA 3VI4B 5ISZD 5J3HC 5JYLA 4QRSB 3ZN6A 4RFNB 2JI3A 3C2AL 4PB0L 4D8PB 2VXVH 4PJ8D 2XPGB 5JHAA 3ZHDA 3F83A 3ZK0A 4OKDA 3H3BC 4AYMC 2FEDD 2X40A 3LTVA 3TA3A 4BGDA 4H8PA 5FYLH 3ZTJG 4XZUB 3I6KB 3B6SA 1R5WB 1RD6A 2KT6A 3QXDA 4KNSA 5F7EH 1T4WA 3AREA 3ALPA 4TSBH 3GJFK 5F7WC 5HI3C 5JQ6L 2X10A 1OM9A 1CUOA 1KELH 4ENED 3MRQB 1OPGL 3AMKA 4FD0A 4IGBC 4M29A 3LNIA 5DO8A 1PG7L 5AG8A 3TZVB 2WUCH 1E9QA 4PS3A 4YHKH 4UIMA 2N0MA 4G8EA 4X6FB 4HS3A 4N85A 4QRRD 1MPAL 1SOKA 2J2ZB 5HPMB 3UZEA 1NCCH 1BJ1H 2QV4A 3H9ZA 4I7ZC 4JO3H 1G0YR 2QEJA 5F1KC 4HIIB 4KRNA 1ZDSA 3E9TA 1AZVA 3NCYP 4AYFB 2I26N 5JA9A 4M6NH 3KPNB 1XX9C 2DIEA 3VXQA 4YDIH 2FE0A 3QUZC 2Z0UA 1U30A 3IAGC 2XRAH 1QRKA 2Y4SA 1NFAA 2CPUA 2P24A 1A6TB 2BY1A 4PLKD 5G4MA 2H6UA 3LS4H 1CF8L 2NZ1A 2PCPA 3HRPA 4ODUA 2A6IA 4W4OC 1L9PA 4Y16D 3TO4B 4J3OD 3JWDL 2FWLB 3H2QA 1JXJA 4NQUA 3LKQA 2VQ1A 2CH8A 4FQLH 4O2EA 1QVOA 4X0NA 3ARGA 1LK3L 5C0RH 4LCWB 4UT9L 1WD8A 3VNZA 2VLRD 3QJTB 4HG4J 4TKWA 5LNGA 4QKTA 5IFJA 5C0RL 2H32A 3MJWA 2F53B 1P5UA 3GMPB 2WZ0A 5IWLC 1LO5A 2D73A 5E7BA 2UZIH 4YWGH 2C26A 1IM9A 4DP8X 2CNYA 3CVDA 2YAQA 5I8OH 4JJHA 3SE4A 3ASOB 5E8NA 4DKAA 3L48A 2Z4QB 4LGRB 4R7NA 1GMIA 1UYWL 5DFVC 5EBMB 4UDTA 4C83A 5I8OL 3P30L 4UM8A 2P80D 3O3DB 1TSHA 1H8SA 4BK5C 4PWKA 1ED3A 1Z1WA 5FFOA 1J86A 4XC1L 1J8HB 1J11A 3IU3A 4MAYC 4DEPC 5F7UA 1F8TL 3QUYC 2A74A 3S3CB 3F5WA 5AYUL 2NY7L 3DGGA 5IJKC 3KPOB 3DYPA 4PH8A 2AV7B 1JS4A 2UZXB 1IGIL 5GGSY 1YEKL 3ULVE 4LLQB 1Z3GH 5FGRA 1QW9A 4M1GL 4KQ3H 5D96B 3WN5A 3P0YH 3V4VH 4YPGA 5HY9A 3EFFA 3RWHB 2WAQA 2QLVB 1IILE 3P0YL 4WKZA 3IAQA 5L4JA 3NUKA 5IB5A 1KT2A 2UXTA 4P4KB 4F2EA 3VVWA 2DI7A 1PEWA 1FV1B 1H3GA 1ZMYA 3C6EA 4MCZA 2O6DA 4NB7A 2ZKMX 4J4PC 4G2AA 1TYJA 4KUZH 2NY0B 1NBZA 1L0XA 5CWSB 1ZTXE 4WVRA 1PLGL 2X44D 1WWBX 3V95A 2EKJA 3F7LA 2GIXA 3F64A 5FUCE 1T1ZA 1T6WA 4JDTH 1WPCA 1QKZH 2MOVA 2F8XC 2JXMA 4KDWA 5KVEH 1MQKH 1KLFA 1FVEB 4P2RD 4CDHA 4LRIC 2K0RA 3C8HA 2AKRA 3T1WA 1L9RA 2G5RA 2OK0L 4X6BA 4UYQA 1PJWA 2FHCA 4NBXB 4R4NC 5KANI 5IB3B 1KTKE 1U3HB 2D03H 4ZQTA 5K1NA 3V5KB 3PCYA 5LXGH 4N90E 2VKWA 2W0FA 4U3CA 3I6GB 2D03L 4JCLA 4KZCA 3D4ZA 1GVIA 3AUVA 3VXRB 5ABAA 3IGUA 3G5YB 4I13B 2CR0A 4TXVB 4GXVH 4FZ8L 1NCAL 3K2KA 1CZ8L 4XXWC 3SJVA 4FQXA 3TTSA 5J7CC 4YHYC 1XT5A 5E1AA 2BSED 3G6DL 1GGCL 5PAZA 3ULUC 1T66D 2R51A 1BXVA 3MLXH 4BWWA 1DP0A 4HKJB 3T2PA 3SE6A 1DYZA 3JTTA 3QUXD 3MLXL 2P8LA 2OMXA 2WN2A 2ZYRA 3B43A 4DPBX 3F12B 2Q7YA 4QRUB 5FR3A 4X6EA 4I0KA 1DR9A 1B88A 1YEDB 4CU8A 2BVQA 2X3AA 5B38G 1RURL 3H9YA 2BOBB 2GFBB 3PXLA 3A0OA 3V4VB 3G6JE 4RX4A 2ED7A 3K1DA 5DHVB 4JKNA 2R69H 1E8XA 2EXYC 3BWUC 5E4IA 3ZGIA 4JFHE 2ICWI 1UUNA 3RFRA 1NDMA 4I0PC 3AU0A 3CFBA 2XWBB 3D51A 4KROB 3RUGA 5I19H 2CRZA 5T1KB 3WXWL 4FFVD 4ZS7L 5EO1B 1I8KA 3NZSA 3KWUA 2C9UA 3TT1H 1XCQA 3LD8B 5C0NC 4AVHA 4LSRL 3FT4A 4X4ME 1NMCB 3O3BB 4DIXA 4P2QD 4OD2B 1QI5A 4B9CA 2EIMB 4JN2B 4DZ8A 3KYNB 3S5ZA 2H26A 5EZIH 4M6AA 1MWAA 3QSKB 4PRPA 3VFTB 2H9GB 4EAEA 5JOPE 1AKPA 1E5AA 3M1OA 3FQ2A 3WO4C 3PAZA 2X0UA 4J12A 3QORA 1OAYH 3MVSA 1H6FA 2JLPA 1OAQH 3MRJA 2YIHA 4FRWA 4AGLA 4KFZC 1T83C 4JFED 4W9JC 5JOEA 4AQEA 2WUBL 1EZUA 1UJ3C 1OAQL 4O51B 3EO9H 1KPUA 5F0LB 3MN8A 5DYFA 1U8LA 1HHKA 1JRHI 3IJEA 4DKEL 4FMFA 2NX5D 3O4LD 3H7BA 2C1OB 2WQUA 5E2UH 1KGYE 4UDUB 2BC4B 2DMCA 2APVA 2WM0A 4ADIA 3OPZL 1FFRA 1T04B 3OSKA 4LLDB 3FHQA 5IB1A 3WJLA 3D8MA 1H3WM 4TVUA 2FR4A 2XV0A 3DGCR 3SOBL 1YUHB 5LGHL 2NXYD 3P9MA 4BFIB 5I26A 5I5MA 4JX0A 4KI1A 4IDLA 3DMMD 3VXSB 3R1GH 3EOBA 4L29A 5INCA 1FNGB 5CD3A 3RZCB 3GRWL 3NIDB 4G8AC 5K9OA 1AHKA 1UH2A 2IAMB 4LMQE 4XNZC 3T4YA 5JUEL 4IMLA 4FFZL 5E00B 1OOAA 4TTDD 2X4NA 4GG8B 1TQCC 4HDIB 4XP1H 1RV6X 1OT2A 4LOUC 5KSVB 3MBWB 2JCCB 3SDDC 1MFEH 4OF6A 4PJIA 2X1WL 2KBGA 1KG0B 4PJ5E 4ZO8A 1ND0A 3T6XA 5DLML 4HEME 2XV2A 3PNWA 4Y2DC 5IEKB 3PREA 2CK0L 2EVGA 2Y9RT 2N56A 1S5IL 1C5DB 3GZOA 2E59A 3O6ML 5HHPB 4AQ8C 3JT2A 5I18L 4G11A 5I1HL 2MQCA 4L8SC 4KJWD 1JGVL 1A65A 2LAGB 1CL7H 2H2SD 1MZZA 5EN2A 4AIEA 3B8SA 3BKML 3EYOB 5A40E 3N40F 4FQJL 4PJ7F 4KKAD 1CPUA 2F2HA 5CJBA 1WK0A 2Q76B 2MJWA 4Q97A 5J13B 2A4ZA 1DO5A 2NT1A 3PWPD 1JGUH 5T1MB 4MSWA 2QVIA 5B3NA 4ZYKA 4H1LB 3NFPB 3ZGHA 1MFVA 1U8QB 5KSAC 2LW3A 5J56B 2WIIA 1A6WL 3T2LA 5AW7B 4ES8A 1MCKA 1RZPA 2NQCA 2FBJH 3VXNA 3EW3B 3Q2LA 5GS1A 3NDYE 4GS7C 2PO6B 2NNRA 4P3WA 5KJRL 3JV6A 5JHMA 4Y9FA 3UP6A 5FF6B 3Q43A 2FBJL 2X05A 5HHOA 2ZKHL 2HFEB 1EGJA 2E7HA 2GCYA 2GAZB 2Y3NA 4NZDA 1OCZB 3S35X 1G9MC 5AVVB 4R3SB 2IWGA 1EXGA 3U83A 3KYKL 1KYDA 3DI2B 2CGZA 3C6LB 4QRFA 3ULAB 3ZDYF 2H7WA 1HI6A 4GBXA 4M7ZB 1I9RL 1UADC 5D2NC 4MQTB 3ESNA 4FQHA 4IRSB 2A73A 4YFDB 4YHOL 5C6WH 3QCVL 1V10A 3DIVA 3IETA 1JTOA 3PGFH 3KGUA 4PJ7E 4O02H 2DLTA 4LLMB 3GDBA 4FF9A 4UV4H 1NINA 3OTTA 4XVSL 3D0LB 3RWIB 4BYHA 1LDPL 1B6DA 2EDWA 3PGFL 4P5TA 1XZWA 3RVWD 1N70A 2IV9A 2QPDB 3CDGB 1B4JH 3AY4A 3ZMRA 2Z65C 4CDGC 5KSBA 1L9TA 4UV4L 4TYUA 4KUCD 3X1BA 2D0HA 3GGWA 3MA7A 1H5BC 5IR1A 3FB7A 3KMDA 1UQSA 3WIHA 1MWOA 2LT9A 4WW1A 5A6MA 2IAND 3HG3A 2AVGA 2H3KA 3LKSB 4YHIB 4MJ5A 2GIYA 4I1NB 4XOAA 2OZ4L 3D2UB 3EFOA 3WLBB 4FXGC 5MEQB 5DS8A 4IBWA 3TFKC 1WC7B 2XXGA 3E6FA 3IMWA 5H2BA 4EIUA 4NXKA 4WUKL 1R5IB 4AT6B 5DJAB 4Y9EA 4DQAA 5J4MA 3HZ3A 5FWRA 4WI0A 1XF4B 1QSEB 4F7PA 3LMJH 5EU5B 3LZFL 4EEEA 4UTAH 3VXUA 3ARUA 1XCWA 5IUSA 4RGOL 3TPKA 4PM1A 4P48A 1FFTB 3WTVA 1BVKA 1MLCB 4O9HH 3Q6FB 4BFBD 4RH4A 4IHOA 1F4WL 3A6CL 1UFGA 3FFDA 2GBVA 3DIFB 5CGYC 1NBVH 3RU8H 5L6YH 1IZKA 1XIWB 3SE8L 3MRFB 3L3JA 5CZKA 1OP4A 3P3YA 3ULVH 1NWOA 3FYEB 3NPSC 3EG9B 2E76C 5L6YL 1P7KA 1LEGB 2UY6A 4PV9A 2GHWB 4KKLD 1VCBC 1N6VA 3RNQA 4LHJB 3AT0A 5HHNB 1E5ZA 2HJFA 4DN4H 2XDHA 1UEMA 5I1JH 2OMWA 2H0EA 1Y1UA 4XN9A 1Z7JA 2COVD 2XG5A 3IJ7A 3OAUH 1DQTA 4FXTA 4LLUB 3ZKXB 2E46A 3N44F 4WZ9A 2Z8WC 5BW7A 3BZFB 2WWKO 1ZTXH 2AEQH 4HPYL 4QWWD 4OZFB 5BNXD 1BJMA 4RGMB 3QUMH 2I60H 3Q8EA 4O02B 4Y5YA 1T7ZA 3SDAC 2AS5M 4HD5A 4JK0D 4HK0B 3WMSA 1HWWA 5JHLL 2CDGB 4UNIA 1JZGA 3KEHA 4RRPG 5B4MC 5KUKA 1X9QA 2DWXA 4PRAB 4BZ1L 1W16A 1MFBL 5JZ7C 1ZLEA 2JWYA 2H0FA 3MRBA 5MEPB 3Q1SH 4Z77B 2NT0A 4WEUD 2Z31C 1II4E 3SO3C 4NQEA 4S0TD 6PAZA 5IBUB 5CBEA 4ELDA 3SGDH 2ADGA 1OCCB 2B7DT 3UO1H 1GOGA 5F1OB 1BF5A 1U6AH 5ILTL 1MY5A 3B2XA 3CBKB 4U1GB 5D7KE 1FZOB 2NW3B 4LHUB 5CJXA 3V6ZB 3Q3GB 3UJIH 5TF1H 5I76A 5TE6H 1A4JA 3UBXA 1OCWL 2H8PB 2JF1A 2XWJB 4HGWA 2PXYA 2J8OA 2GITB 4PJDA 3BH4A 3AMLA 1XDTT 1YEJH 4N5EC 5H37A 3GTNA 1Q9OB 4GIPD 4BFNA 1KCVH 5DQ9A 2CXKA 5CGMA 2WWMD 1U9KA 1N8OE 1RIHL 2WXIA 4FYRA 3ZHFA 1T0MA 4NRZA 1OSPH 4UU9A 1XF5B 4PRNA 5HGAA 3UH8A 4FTVE 4FP8H 1NDGA 3BJLA 5DQJB 2X4SB 3JWNG 4PGEB 4HGKC 1MNNA 2OI9B 1I7TA 2CO6A 3MGTB 1RUQL 3WDIA 1GS8A 3RWEA 2W80C 3DSFL 4XP6L 3R18A 5C71A 2R2BA 5I0ZA 2J12B 1L3WA 2NTFB 1KV7A 2IQ9H 2NYKA 3KYOA 2IDSA 2ZUSA 4JFOB 2DI8A 1D2OA 2V2TA 4M43H 1FF5A 4LPWA 4HWUA 2YD4A 3MR9A 5FEBA 2FJHA 5E2JA 5IOKA 1BVLA 3ME0A 4WEBH 4IU2B 5GGUA 1ASOA 4GEIA 4L8BB 1K3IA 1RHFA 2QBWA 1HVXA 12E8H 4M1DL 2OP4H 3H8NA 2JFCA 5L9DH 5KYUB 1JTTA 5IZ7A 1KXTB 1D5MA 3MODL 1Q90A 3NSJA 5L9DL 4LEOA 4BCYA 5C70A 3L5JA 3LSOB 5FYKU 4DUVA 1ZHBB 1NCWL 4G8GD 4QD2E 5GISH 1MZYA 4BH7A 1DJYA 1AYRA 1H3PH 2B4CL 3IDJB 1IUZA 3MO1B 4JRYB 5DS1A 4R26L 2PYFA 3LN9A 2IIJA 5CEZL 3NFNA 5F7DA 2GKIA 1KPVA 2VC2L 1TVBB 1FDLL 4P3CH 4N8UA 5EF1A 3W0WD 4KTEH 4ZDHA 2PMZA 2F18A 4LASL 2OYLA 4Y5XA 1XBDA 4MJIA 2WTRA 4HK3J 1QR4A 1WBYA 2QPFA 2HVKA 2YPKA 3BLPX 3QUKB 4KTEL 2PKDA 1QPXA 3IXTA 2WXPA 1NGYA 2I69A 3MUZ1 1IAII 4J6RL 4GUPB 3DRQA 4UM9B 1R3KA 4L3FA 3ARDA 1RZGA 1NEUA 1VFAA 5AW1B 4NM8L 4LOVA 2XVBA 3W9EB 1Z2KA 2WJ7A 1C1EL 2ZUYA 2ITDB 1ICTA 3O45B 2DQIH 2P48B 5JR1L 3DKHA 3CH8A 4U1HB 5DJYB 5H35A 1FAKT 3GO1H 2Q1EA 3MLSH 2GJ6D 1KOAA 4GMTL 3EHBD 4X0KA 4Y19E 1F1DA 1WSST 4GKNB 3BP6B 4LP4A 3GO1L 1QPKA 2BS9A 4L37B 2GK2A 3FT3A 4FFWD 3MLYL 2PW1B 3A3YB 3ULUF 4J3SA 4DFHA 2DH2A 3PHQA 3X13A 1BFTA 1WFJA 3QZWB 3JT0A 1KIUB 1K72A 2LU7A 1UUSA 1P7QB 4E9WA 1DQMH 1M2OA 5F3BB 5TQ2H 3HE7D 5I6XC 1MCOH 5KYYA 4WU7A 2AJZB 1JWMB 1YG9A 4X5QA 3MNVB 2PLTA 4UAOC 1TZHA 4S1SL 8PAZA 1KCUL 2EIBA 3VRLF 1E5CA 2EJ1A 4OLZH 1SHWA 2BRQA 3DHMA 2F8IA 3DV4A 3NABH 1KTLA 5EU7C 3GRGA 5EOCJ 1EDYA 3BWUF 2J73A 3QDGE 2CJ3A 3DURB 4JZOB 4RBPH 2VLJE 4NENA 4ZNCD 1E6OH 4E5XA 1A9BA 3ABGA 2VC2B 2C9QA 2EIJB 3FDWA 4IRZL 3TJHC 1JHLL 3INUH 1A7PH 1TENA 4KK6C 4MJ6A 3P4MB 4K71C 1AS8A 3VFMA 1N4XH 3INUL 1FFPA 3TONA 4IKNA 1DFBL 5J0BA 4ERSH 3NSXA 3PXJA 5DQDH 2GG1A 2X70A 3QDJE 4B5EA 2OJEA 4YBLB 4NZUH 3WIIH 3ULUE 5FV1L 1BF8A 1J5IA 1ZRUA 3AAZB 3M8OL 4YSEA 2YLKA 4XOEA 4H1LG 2FJGB 4HPHA 3HS9A 1FQ9C 4X8JB 5E2WH 5E8DL 4ZX4A 3IXAB 2C9VA 1A1NB 4CU6A 5BUGA 3N85H 1Y0LB 3RFZB 3LH9A 1OT4A 1JWUB 1XB3A 3EDJA 1H8NA 3Q2WA 4PFEA 2J1KA 4QMEA 3MDJA 3E1ZA 2KYIA 3CE1A 3RAJL 2Y0SA 3VSVA 4X5RA 2VUOA 3GSOB 2Z8SA 1MI5A 2RQEA 3SDCA 3RDTC 4ZFZB 2X7LB 5I1GH 1G7QB 4K15A 4NQVA 1AD0A 2VZOA 3MV7A 4PJ5B 3KL3A 5H94B 5HDBE 1NA8A 5EO9A 1A14H 3PWUB 2F5BL 1KIPA 4HSQA 2CHZA 4KI5D 1F45A 1R5VA 2EXSA 3BDYH 1AO7D 4J23A 1SZNA 4JUSA 4FFYA 1DCEA 2NYZA 1PD6A 3BVUA 3VRIA 3CC5B 3C9NA 4BZ2A 2HX9A 5FA4A 5L88L 4UQ2A 3NCMA 1YEHL 2HT3D 5E4AA 2J5LB 2DJ4A 1I8MA 2Y25A 4I0CC 1W8OA 4NM4L 1RU9H 4CILA 2ZUUA 3KW7A 2G75B 1DBKL 3AXHA 1WITA 2EH8H 4L4TD 4Q8BA 4FNRA 1GGIH 2DWEB 4KKBC 1IC1A 3QZNA 5G5DA 1HILB 4IEFA 5CS7A 1RHHA 4DT2A 1F3JB 2DD8H 3ZW3A 1IAMA 4DP4X 1IARB 4AE0A 2NCEA 4X7DC 5HHVL 1DUYB 4PI0A 3LHPL 3QEQA 3L9BA 4YSDA 3REVA 1AGBB 2JQAA 1GXEA 4MA7L 5ACLA 4AMKL 3FTGB 4XMLH 4GUCA 2HT4C 5CEXA 1SHMA 3DHJA 5J11B 5JPMB 3WFEH 4YBHA 4TNWK 2IAAC 4AE1A 2XACC 3QQ4A 4JRXA 1TJMA 4R5TA 5DZOA 3DVNB 1AFVL 1I3GH 4HFUH 2DRUA 1S5HB 2WIMA 2FSEA 2VJ0A 2V7NB 3FUHA 5DCCA 5I6LA 4G6MH 2R8SH 3NIFE 1Z66A 1YN7B 5F0PB 4P5KA 5J6GA 3GSNA 1FVDB 1G7MA 4PJEA 4NO0B 4BFOA 4U1SB 1SMDA 2YRPA 3UYPB 3ETTA 2DAVA 3QJHA 4PJ7B 4HALA 2VLLB 5F7BA 2BIQA 1PZSA 3VAEA 2ZX5A 4UV7L 3K2UH 2YMOA 4PMFA 5IMKA 3CUPA 4HIXL 4OZHA 4P59H 1CDYA 3FQNA 3A6OA 4PUBH 2DQFA 2P42B 1CE1L 1KEMH 2VR4A 4MKMA 4Q74A 4JPWH 1QRND 4BFRA 4MCNA 2F5AH 3BDBA 2WMPA 4NT6A 2Q8BL 3A24A 3PQYE 4PUBL 4AQ1B 4AYEC 3US1A 1M53A 1E4WH 1R3IH 1BX2A 2PN5A 3OKDB 5EBGA 3ZE2E 1SJHA 4B5ZA 4OZFG 4EN2A 4NPYB 4OFPA 4GQZA 1MIEL 4YAQA 1ZLWK 3BLBA 3LNFA 3IU4L 2FQGA 4ALAC 5K9QG 3MLZH 2Y6TE 2V37A 2QFRA 3NOIA 3SIKA 5DK2B 4LCYA 1HWGB 3LEVH 1AC6A 5B8CC 5C07B 2WLLB 3OB0H 3ZDYB 4NCC1 3BVNB 3B3IA 5I6KA 2OV0A 1A0QH 3V4PA 3LEVL 2ENJA 1QQDB 2R15A 3GINA 1GYUA 4TMPA 5IBUG 5C0GB 3GZKA 1CB4A 4P9MH 1VFUA 3L4UA 2BNQB 5D72H 5DVNA 2X09A 4GG6A 4LHUG 1SF5A 4YXKL 2QVKA 3EYSL 2WHVA 1M7UA 2XZAH 3RVTC 2WD0A 1A22B 3BVVA 4G42A 4P5RA 2VB5A 2OL3H 4GAYA 3DV6B 5CIPA 5EO0A 5D2NE 5J6HA 2GIMA 3SCMD 4NNYB 2XZAL 1R4XA 5IMMA 5D2LF 2YPVH 2RD0A 1EWHA 3AROA 2JI2A 2CLVA 3GK8H 3D39E 2VXQH 4NNXB 2YPVL 5I73B 3S2CA 3I9PA 4N20A 3Q06A 1GW0A 3HE6D 4M6ML 1XXDC 4JY4B 4J39A 5I8KL 1NLDL 4ZFQA 1QBML 4YGVB 2WQWA 4EOWH 3CFJA 3NJJA 5DZJA 1INEL 1LE5A 3BPLC 1T1WB 4OZIF 3UBGA 5KUMA 5DWUL 3UTZA 3LZPA 4HUWB 1QSFE 4XP9L 3NCFB 4F3FA 1U41A 5GZNC 3WHE1 4IIQB 43C9A 2NNFA 2XG4B 4WFFE 1A4CA 3L4XA 3T0DA 1M71A 3U6RA 3N40P 5CP7B 3RPBA 4G7SB 3X14B 3BRDA 3QXTA 3K46A 4PJGA 3OKEA 4L1BA 3F7RA 5BS0A 3NIGF 3TT3H 4E9SA 2P7TB 3V7MA 4ZOBA 1NUFA 3NZHH 4QTIH 4R97C 5JORB 2ZXDA 1BZ9A 1MW0A 1ROWA 2CR3A 4OKVB 3TT3L 3W3BA 3TZVD 3RL1B 1WUNT 1E28A 2UZYB 3IFLL 3K6OA 4GO6B 1FL5B 5DMGD 2ZOKB 4FQ1H 1LGVA 2OMVA 4AEIL 3WIFB 5D2LE 4O58H 35C8L 3RWCA 1TZIB 3UG3A 1CG9B 1EJ6A 4A55A 2ZOUA 3OAZH 1OT1A 2HMIC 5LAXB 4OCWH 2BOCA 4MQXD 4AM0A 3HS0A 4KMTL 3WFBL 1IBGH 4U1LA 5T1DH 4A2DA 1WAPA 1YMHB 2PPAA 3N44B 1PW3A 3N6YA 3CFKB 1A2YA 5IKCA 5AWNH 4WW2C 5A2KH 2ADFL 3U4AA 2NY4C 1ACYH 1T80A 3BO8A 2B15A 4NKOB 3GXNA 1N0XL 4ZMAT 1BLNB 4LRNL 1HFUA 1HXKA 3PFQA 1OB0A 4FTVB 1JRHL 1RVFL 2YBRB 3DUUB 3TO4D 2O4EA 3O4OC 3VD7A 1FBIL 3K6DA 4XBPB 3QIBC 1F6LL 4NHCH 2NNAA 4KO6A 4TM9A 3S0PA 2R0WH 4A39A 2OL3B 2VDPH 1TQBC 3JWOC 1UGNA 2CLRA 4KQ0A 4MMZB 1OGAA 2HX7A 2XWDA 5D7HA 5FPIA 3NIGE 3HNTH 4LDLB 2CJUL 4WSJA 4WWPA 2VDPL 4GW5A 2F53D 4HYTB 5K5YA 5E6IA 3OKNB 4MJHA 4M9OA 5HI5D 5FKAA 4JANB 5IG7B 3QUZB 4N0FB 4XBEH 4OLWL 2V9UA 4Z7UF 4LP5A 2D31A 3PHSA 1BVOA 1LD9A 3WE6A 3S36L 3K3QA 4GQ9L 5IW6A 3QIWC 2MHAB 4NYLB 2CO7A 5BJTA 4QKXB 3NN8B 5FGBA 5F88B 4EDXA 2WVVB 4WJG3 1KXVA 2ATPA 2IH3A 4GOSA 4N5UA 3S8GB 2XZQL 2NNXA 1FLRH 3TJPA 5K1JA 1J8HD 2IWEA 5IB4A 1Q1JL 5F89A 5C3LD 1LEIB 2ZTBA 3I6LD 4RESB 1UXLA 3Q1EA 3VI3A 3L5XH 2GK0A 3TBSB 2VL5B 3C60B 3QZWG 3RWDA 3DVFA 5KSUB 3MYJB 3KPSE 3P1VA 1DVFB 2ICWB 2G2RB 5DD3H 1E50A 4HIHB 1QFUL 3LS5H 2PPCA 4U6TA 1VEMA 2CO1A 1JPSH 4XMZA 5D6CA 3DXAE 2GB2A 2AGJH 5AQ0A 4QLRA 2WO2B 2AXWA 2BWDA 4PVMA 4P4KD 2VR8A 3GI8L 3GMMA 2WLIB 4XO5A 5MERA 3ULUH 4PJCA 1XAKA 2ZUTA 1JHKL 2R4RH 1JZ8A 1PCSA 5GSRA 3W1ZA 1PZCA 2X2YA 4MAYB 1H6EA 1NKRA 4XVTL 3EADA 3QUYB 4I85A 2X4UA 4NO3A 4OSUH 4Y88A 5FYKE 1KEGL 3RGVA 2NY0D 1TF4A 4Z7UE 3HC4H 2DWDB 3CMGA 3CZUB 2P26A 1KC5L 5IQ9A 4RFOH 2OA9A 3CMOH 3L13A 3TEUA 3QT2A 2BFVH 2AXJA 1RSFA 2EDOA 3O2WH 4A37A 3HBPA 4R5XA 3ZYZA 2BP5M 1B2WH 4Y4FB 1MCEA 2WVSA 2D4DA 5AZEH 5D4JA 3GLZA 4OGXH 3TN0A 3D06A 3TESA 5J9PA 2BRRH 5ICYA 5FWQA 5CCHE 3WFZA 3QC6X 5CBAB 3CN2A 1BEYL 4Y19B 3TBWB 1S9VB 2F7IA 4PJFA 1N7MH 2WQVA 4QR7A 2BRRL 2B59B 1FORL 5D1XA 4Q9CA 2YAPA 1U3HD 2EC8A 2VDPB 3HFFA 5SWZE 1MSPA 1WWAX 5D1ZA 1UD5A 4XO3A 2NNCA 5AENA 5KBMA 4EZJA 4D94A 4ADJA 3Q05A 3ARFD 3UG5A 3KR3L 1AQKH 2F8OA 5BVJA 3GBDA 5HGBB 2EZ0D 3P2BA 2PWFA 1WGOA 1H6TA 1UT1A 3VVVA 5TDNA 3D7PA 4PWHA 3KXFE 3MRIA 2YD3A 1VENA 3GXPA 2UWEE 4NZRH 4Z0XA 1X5FA 2L8AA 1I82A 3BEWB 3GS0A 4WNQB 1XEUA 1GS7A 3LXCA 4CW1B 2Y2YA 2K7QA 2VLJB 1TZAA 2AEIT 2JKWA 1F4YH 1MCWW 4GO9A 5IMOA 4MJ2A 1LO0H 4ODWA 3L3GB 3L3DB 1TSRA 2YSSB 5MP6H 4EUPA 1VZHA 2DYPA 4LKXB 1XZ0B 3QWRA 4YHYB 4JFUA 5EU6D 1I31A 3U6XS 4KROD 4P2OC 4NI3A 4QDGA 4AYDC 3JVGC 2VN4A 3MJ8B 5T1KD 5I1CL 3QDJB 1UC6A 2QQNL 3GJFB 3KNBB 4YPJA 5CR1A 8CGTA 4J3UA 2WYTA 4FMVA 1CDHA 5DURB 4Q6IA 5HHQB 1QX1A 6CGTA 3TOPA 5ESAA 2VZUA 1Z6JT 2E9WA 3I75A 1IQDA 2HFFA 1FZMB 4L48A 5F3FA 4LSSH 4GXUN 4IM8A 1DTUA 4UTBA 1OAKL 3HW7A 4ZMTA 1WFTA 1TEGA 2OMZA 2L04A 1G5AA 2JKLA 2OLDA 4QXTB 4OGYL 5TQ0H 4AVKA 4I0PB 3G5VA 4QXVA 4K7PH 2NY5C 2OMUA 5I15L 3OWEA 3FRPB 4BFGA 5JXEA 4IBYA 4AGNA 3P3UA 2BCKA 4PEEA 4AV5A 2J4WH 5HDBB 3IJHA 3GEWB 4RMWA 1OP9A 1TQVA 2QR0A 3BLKA 3WY4A 3E8UL 3EJUA 1WCQA 4P06A 5EU7E 4MHHG 4U6HB 2LU5A 3QK0A 1OB1B 5E0QA 5FO7A 4XHQA 3FB8A 2C3VA 4RAUB 5LAPA 5K69A 5B1KA 1C5CL 2EKSA 4P49A 4O2CA 3WO4B 4F7MB 1JF1B 2DB8A 3BH9B 4AXWA 1VERA 4S1DD 4AV0A 4AENA 1KB5H 2JK5A 4IOSA 4XPTL 3VXSD 3BHBB 4B9GA 1PKQB 3QDHA 3FHEA 4NWUH 3LEYL 1UJ3B 1MUJA 1BFVL 4B9FA 4G80B 1XCXA 4XMXA 3BESR 3QFJB 2W60A 3CIQA 4UOW1 3UTTA 5FYJU 4HLEA 5JOFA 4JHBA 3AC0A 2E7MA 2Z93A 1COBA 5CSZA 1Z9LA 7CGTA 2Q7NA 4ONHA 2DEXX 1G9MH 5DRNB 3HCVB 3VQ2C 1U8JB 1DL7L 4ZJ9A 4KOCA 4CNIA 4Z0BL 4QRQB 4R0LC 1G9ML 1NAKH 1ZVSB 3ZYJA 4JDVB 2KZKA 3EO0A 4YXHH 2VM9A 3MUUA 1WT5A 3EGSA 2OQJB 2VLKD 3WJMB 5IVXA 5I1EH 3A4DA 4L3EA 25C8H 3RILA 3J27A 3VFNA 4YXHL 1XR8A 3B5HA 3PGDB 1UWEL 1CF1A 3P3RA 4WFHE 3O2VL 1D6VL 1PJ9A 4XPAL 4BDVA 1DDTA 2QQKH 4XNZB 5E94A 5DD5L 2PTTB 1SBBA 2VQUA 4EI6B 3TA3C 2Y07H 4FG2A 1X5XA 1TQCB 1HNFA 1VGEL 3GZPA 4X2UA 4YSAA 3CDCA 3BSZA 1U3JA 2CO4A 2R4SH 1G1OA 1MHCA 3AREC 3BVDB 3QWOA 3SDDB 2QSTA 4DP2X 3BCFA 4CSZA 2V7HA 3LRSA 3CTTA 1IZJA 5IOPA 2WXMA 3D0VA 4U0RC 3AU1B 4Y2DB 4OUUA 1W72L 4KXZI 1THAA 4G83A 1EPFA 4OFDA 3IDXH 3DX7B 4L0YA 1S3KL 3UAEA 4OQ1A 5GQBA 4AM0Q 3V79C 2BIHA 4P2AA 3DHUA 4ORZC 3RA7H 5IHZA 1FIGH 2PO6D 3CVBA 3VD9A 2DDQL 1ILSA 4L8SB 2ESVE 2VIRA 1T22B 1DQLH 2EQDA 3UZEC 2XX1A 3A21A 2PUQT 1UCBH 2EACA 3DJTA 1DQLL 3PQYB 4KJYB 3VMPA 4YHZL 5EUOF 1TMCB 1YO4A 5J1TC 1K2DB 1SY6L 2ZPKL 1HQ4A 5K39B 4QHLA 2IEPA 5DRZA 2UUDH 3W11C 3KM2A 4PJHE 3MACL 4R90H 4UI2A 4FJ6A 3DGDA 3M88A 5KSAB 1V7MH 5IBLD 2EC9U 4L2LA 1NAMA 3T0EA 2XBDA 1NC2B 1IEBB 1L7TL 3PRZA 4IRSD 5KOMC 1KB5B 2M2DA 3GXDA 3TIDB 1G7LA 1WF5A 1F97A 3HAEA 2C3WA 2BVYA 3KPMB 5IM7B 4GS7B 1SEBB 2DQ6A 1AGFA 4PW9A 1Q9WA 1T1YA 2EDRA 2OS7A 5ICXA 3S48A 3WXVH 3ARGC 3SQBB 3LV3B 4F2ME 4MVBD 2WQRA 4WTZG 3MRHB 4FNLL 3FSVA 5BQDA 2ED9A 3B2UC 3HC2A 4H44C 3NTCL 3FUMA 4WHYH 1P5UC 3DBSA 4MMXA 4GMSH 1B0GA 2CM6A 3NP3A 4R8WL 1TYEB 3MNZB 3TPUA 3GSRA 4FA7B 3GSWB 4UT6L 2X1OA 3ZSTA 4HIJA 2Z1PA 4HS8L 3ZUNC 5D2NB 1IAIH 4JM4L 3FOMA 3D2UD 3NJMA 3GUTA 3QQ3B 1ETB1 2KZBA 1OTSD 3I9GH 5DEGB 4P04A 8FABA 1IAIL 4KHTH 3D39B 2EADA 3RIFK 3E8VA 3UTPD 3MLUL 5EUOE 2RTTA 1MVUA 4HETA 2A74C 4EN3B 4LVNC 3N50A 4D9RD 1QSED 2Y7NA 5KANG 5IJBC 4F58L 5EEUA 1H5BB 2WGXA 4WWKA 4Y1AA 1QEWA 4XNQB 3X11B 1F58H 1NGQL 4PBVC 1VZGA 1UA6L 3V52L 3ALWA 3K72A 4RAHA 4N68A 1QSFB 3O0RL 5DI8A 2P45B 1CDUA 2X89A 3VCLB 3VXPB 1BPVA 3F6IA 4LARH 1BIIA 4FXGB 4PJAA 1NGZB 1XIWD 1Q94B 2QZ5A 4H88H 5DHDA 2YGQA 4GRWF 3SKOA 5E8EB 2P43B 3FT2B 4MJJA 5I82A 1HTYA 2YK1H 5AVSB 4JDEA 4ODHL 1ZT7B 2DV6A 2R23B 2CO2A 1L4IA 4QO1B 1LK2A 4NWTH 3U7WL 4X8CA 4M5YH 3IF1B 1WUZA 4Z5RA 2ZONA 3DIDA 1ZE3C 5GZOA 5SWSE 4NWTL 1R3JA 3FS9A 1UASA 5C0EB 1SGKA 2G5BB 4HISA 2DJMA 1E90A 1HHIB 1MCFA 4JE0A 1HU8A 5D2LB 1HJBC 5HJ3B 4N6RB 5DJ8A 1Y6MR 3VM7A 3V6OA 5FYKH 3RY6A 4TRPL 1HEJC 3WFHA 4M61A 1PZ5B 5GGTH 1HJCA 2BW4A 5E2TH 1ZHNB 4NC1C 1OHQA 4UB0H 3MGAA 2YEVB 3FZUC 4YZFF 3ZO9A 4BXSV 4QJ3B 4ZFGH 2J8HA 4WU5B 4PTTA 3NPSB 4FKKA 4QTHB 5FFLA 4OIBA 4ABUA 1JZ7A 3C8KA 3AQZA 2BSEA 3QC5X 2BW5A 3BAJA 5ICZB 3HNSH 1JD7A 4ELKA 1LM8V 2LU4A 4AC2A 2DWYA 1DEEB 1F00I 4ABQA 3VFWA 2YO3A 3QUXA 1CLYL 4XRCB 3T6ZA 2HG5B 3RWJB 4KFMA 3GDCA 1BXXA 3MQIA 3U1QA 4GRWE 2G60H 4YBQD 2BDNH 3FHAA 4WW2F 2HX8A 4OFYA 1VFOA 2YRBA 3NIGB 2HRPL 2E7CA 4LHUD 5GRJH 2D3LA 1QR1A 1CS6A 5G4OA 3DX6A 4ISVB 3REWA 3UMTA 3PDDA 3SDAB 4XB8A 1NEZA 5GRJL 3IJSA 4TNWF 1KFAL 4PB9H 1I7UA 4XAKE 2FD6H 3H42H 2WBJA 4IRJA 5TE7L 2XFXB 1OGSA 3TA4D 4POZC 5GHWH 1FL6A 1J5OL 1KXQA 3UERA 1P1VA 4R4BA 5CZVH 2VR3A 4G5ZL 5JQHC 4UM8B 3JQOB 2Z31B 2N01B 3SO3B 2O61A 1OGTB 3NACL 4JKPL 4YZFE 4CVXB 3I3EA 5AKVA 2X6MA 1CYXA 3CX5J 1A3RL 3UACA 4WK4B 5L2KE 1MIMH 2GTQA 1SJXA 1HSBB 2K6ZA 4WHTB 1M7IA 2X4OB 4QLWA 5CN1A 3KPSB 1RMFH 2AABL 2WLYA 5D71L 3BGMA 4WK2B 4JG0H 5GGSB 1ZEAH 1A7RL 4MDIA 4N8VA 4OCYH 4YK4C 1UKTA 2BNRE 4MFHA 2GY7B 3RVXD 3C6SA 4YDVB 2WCGA 3E6HA 1G6RA 5I6PA 3VFUA 4LOEA 5INDA 1G7HA 2AK1H 4XMPH 3DXAB 2P8MA 2X3CA 3BZ4B 3QEHA 3W57A 2VABA 1IAKB 4FL4B 3QORC 3ZUCA 1E4XI 5C0IB 3WUZA 1CGYA 2P1YA 1OO2A 1KJ2A 4JZNA 2WLZA 1T03L 3FCGA 3CZLA 4Z7UB 5LBVA 3O0LA 3STZB 4S11A 2V9QA 5I1LA 2DTSA 2XA3A 3TX4A 2PABA 4AGMA 5HD8C 2XTSA 2VKXA 4XXDB 4F33B 5IROC 4PRBB 2FH6A 3CLFH 1ANUA 2MTAA 2Y36L 1HXYA 4GFTB 4I3RH 5DJ6B 5JDSB 4NAJA 4GKOA 1WQVT 5C08E 2BVOB 4KK9C 1FGVL 3B37A 3RWGA 3WTTA 5SX5K 1DQVA 4JRYD 1YPZA 1LXMA 2BSDA 1MJ7H 4DGVL 3R8BB 2BMKA 1E5BA 5BZZA 4DETA 3PDGA 1LE9A 1MJ7L 2A6JB 3IWUA 1QWUA 4GLRI 5D1QA 5F1NB 1DLFH 4OQTA 5M7QA 2CCWA 2W65B 3C5ZA 4UBDD 5SWZB 4NFDA 1TU2A 1XGUA 2F9BT 1AQMA 4LKCA 1ZKAA 4N90D 2BY3A 2X2JA 1DLFL 3HC3L 4NLAA 1FLTX 2C1PA 5CCKH 5GIRB 2CG9X 1WLHA 4JO4H 4ZAKB 2H1LM 3GC3A 3S37L 3NDZE 2Z3FA 1B0RA 4APXB 3ECWA 3O2DL 4B60A 2W0KA 4JFPB 4P57B 4UM9D 3TNMB 3OAYK 3BVWA 5I5IA 3KXFB 5FFGA 2UWEB 5MEOA 2QFPA 3WD5L 2R0KH 1VKXB 3FQWA 4XNXH 1QWNA 3FRPG 2PYEB 1P1ZB 1HC1A 1PYWA 2ZKYA 4Q6KA 2VR6A 3PL6A 2HWZH 3TASA 4NC0B 3UTQB 4G3YH 4WLCA 3UJJH 5DEFA 3EJCA 1N10A 1YDPB 5F70A 1T1XA 2HWZL 5FECA 4OZGF 3FRUA 1JZ3A 1RUML 3AXLA 3MKGA 3OAWA 1KBKA 5CU5A 3UFIA 2VMCA 5IV2B 4N6QA 3PDOA 4TQEL 1IAOB 3JTSA 2FIRT 2IV8A 1KB9K 1O9ZA 3FB6A 5D7SH 4JFHD 3V2AR 4C56A 2HKFL 1JOIA 3KZ8A 2IO5A 4HWBH 5C0BD 5KN5B 4AQOA 2ARJA 3U46B 3IS0X 1JWSB 1P7QD 1ET8A 1XV8A 2WLMA 3UX9B 2ATKA 2CPCA 1MW3A 2H0JA 5DVOA 1AGCA 3VFVA 4B9JA 5EG6C 4X4KA 4HW6A 3OGCB 3AITA 1AXTL 2F0CA 2WWNA 4X5XB 1M1XA 5GS1C 3STBA 1KBGL 1BD2E 2B5IC 1SYSB 1A7OL 5DJCB 3MRLA 2VDNL 4QYOB 5KBDA 4UQIM 2H3NB 1UXWB 3MC0A 3M1CA 3ATBA 4JFFA 1WE5A 4XMKL 1AH1A 4NNPL 2E7LA 2XQYA 5CSBA 3HG1A 1MHEB 4Z3IA 1EJOL 1DCLA 3FONA 2XQBL 4M93C 1M7DB 4DZBA 1FZKB 3QNYB 5I6XB 2XXFA 5AB9A 4U6VL 4OZGE 4GBXC 3KBEA 3LH2H 4X6DA 4PJXE 1VJSA 3MAWA 4KZEH 4UAOB 3FO2B 4P5MB 4QHMB 4YMPA 1UZ6F 3MTRA 5DO2C 4LBAA 4KZEL 3QFDB 3BAKA 4X80H 2WZPD 4NFBA 3PGCB 4JFYA 1OK8A 3VRJA 2HPTA 3MXVH 4NUJA 4EVNB 2AZUA 3K4AA 4FX5A 3RKDC 5F0JB 1ZGLM 4E9XA 4NX0A 5LXVA 2N3JA 1D6EA 4LT7A 3MGOB 4MNQA 2FBRA 3S5LA 4E9VA 4M48L 1ZOXA 1YQVH 4H5SA 2GHZA 4K71B 1JV2B 1OARL 1RIUH 4O4YH 3ZBMA 4K5PA 2QMJA 1AJ7H 3HRZA 5AEAA 3LN4A 1AMXA 1RPUA 1JGEA 1AJ7L 3EOAB 3FFCB 2BHFA 2OMNA 3PWNB 3NP4A 2CDFB 3S7GA 4PJ5D 2HKHL 3BT2H 4U3HA 1U8KB 2AI0L 3VGFA 3MUJA 4D9QE 1AP2B 4DF9A 3EH2A 3EOTH 2WC7A 3DOSA 5SV4A 3LZLA 4I77L 3T0XA 4ZUSA 1S46A 2P3YA 5MI0C 3X12A 5DVKA 5B3JF 3EOTL 1FYTE 1MNUH 2WXKA 1HH9B 2ZOLB 4X6CE 3O8XD 1UZ6E 2P5EA 1CJYA 3MFFA 3NZ8A 5K33A 3SDYL 3IGLA 4J3WA 3FKUS 4I2XA 5IF0B 2JB6A 4FZEH 2VDNB 2N7AA 3RDTB 2AC0A 2N7BA 4H0LC 1ROCA 1XF3A 3QJXA 3RPIB 3UTOA 2BJMH 5HYJA 3B2VH 3CNKA 2DQHL 2G4EA 4U1NB 2R9HC 1A6VH 3OX8B 3R19A 3AFLA 4TUKH 3M17B 4Y5VC 1C12B 2BJML 2VXUL 2GJPA 1AZNA 2YQGA 1U8NB 4DHLA 4PGJA 4PWJA 2H6PB 1QLFB 5DD1H 3JV5A 4PBDA 3HZMB 4ALAH 2YOCA 3K4DA 4WNJA 1ID5I 2UVEA 5EMYA 3DROB 1EVUA 3L6FA 4OLYL 1MFCH 3GQFA 3WBDA 1HXMA 3DTXA 4K0OA 4YSTA 4QXUL 3OKLA 3S36X 5B3SB 5EZPA 4Q9QL 2OJZH 1K5NB 1J9TA 1I9EA 4GI9A 4XNDA 4LSTH 1EMTH 4M7JL 4Y5YC 3VXMA 5ACZB 1ML0A 5LBSH 1XGPA 5B3JE 1UOLA 4N2LA 4V1DE 1FZJB 2SEBB 3MI6A 1ZTMA 1AD9A 5K59F 3CX2A 1M6OA 1HKFA 3DX9B 3MROB 1AKJA 1TG8A 1OGPA 2ZJSL 3ZZQA 1S7XA 1I53A 1E27A 3AQYA 4C8XA 2IQAB 3CV5A 5HHME 3T6QC 1SYVA 4PAZA 2J6EA 4XCNB 5A2LH 4E9RA 4Z7VA 2XA8H 4KKZA 4F2MB 4HWEH 4WWID 3BVTA 5E99L 3CQPA 4HUVB 3IDGB 2V9TA 5CJXC 3FCTB 1UWFA 4XCFH 3LRKA 3T9WA 3QJQB 4YLBA 2WZ5A 5GSVB 1NC4A 3UC0H 3ULSA 4HJJL 2A6KA 4JO1H 1IGYB 4GRWH 1JYWA 2IPKB 1H6UA 3IDMB 2P46B 3QCUH 3B7UX 1QTYT 2R0ZH 1F6AB 4OVUA 3V4UL 4KXAA 1MCNA 3I02A 4TL5A 4V33A 1ZV5A 1EJ8A 5EUOB 2R0ZL 4QRRE 1AZRA 4TLTA 4Q9RH 3QH3B 1RJZA 3L3IB 4MD4B 4RCAA 5L0QC 4OBRA 3BXNB 1CXEA 4HIEB 5C07D 4Q9RL 5CM1A 1A7NH 1YJDH 4QHUB 3LKOB 3MLRL 1TTUA 1KPRA 4A6YA 2K4WA 1EZVX 1IFHL 4G72B 4YE4H 1A7NL 1J8RA 1HDMB 4JBSA 1XL4A 3NJNA 2ED8A 2BNQD 1NUDA 3BIKA 2VW7A 4LPTA 3THML 2Q9OA 4RMTA 1S7QB 1OW0A 1USQA 3HMWH 4KHXH 4G6AD 5I0WA 4ZBJA 4G8GA 4ZTEA 4A7GF 5KTEH 3RP1A 3LKNB 4BQ8A 3HMWL 4KHXL 5FKPA 2FHFA 3IGFA 2PR4L 1IQWL 3GSXA 1FYHB 2V2WA 4HIPA 5BZXA 1AG0A 3QXUA 5B8CB 1FFQA 5SWSB 3ZQWA 1ZLSH 2VLRE 2X1QA 4ZO6A 4PP1C 4NZ8A 5ITBH 5M95B 1ZT4B 4NKDA 2AJSL 2CM5A 4UQAA 5ITBL 3BKYL 1HOCA 1R24A 1S7UB 3MJ9L 4JQIL 5H8DA 2YD8A 5A2BA 4FCAA 4F9PA 4UQEA 2H1PH 4HC1L 3CC1A 5T5FA 3UAJD 3ARRA 3U0TB 2QSQA 1HIMH 4IW4C 4WK0B 5DJ0B 3MMEB 3BZDA 4Y5XC 2DLFL 3LIZA 2X6VA 2MNJB 1O6SA 3IJ8A 1N59A 1CFQA 4OLUH 4BXVA 4K2UH 4GW4B 3JWOL 5IT2L 3PP3H 2IG2H 4XBMA 1NH6A 2O5XH 1SLWA 4NJAH 2I27N 5BZWB 1A9EB 2A9BA 1I1AA 4NN5B 5I1AA 3AVEA 2QELA 2ICCA 4GRMA 2IG2L 3RJQB 3X1GA 5D7LE 1HZLA 2HA1A 3KPRE 3T3MF 1QPPA 3SPHA 4X42A 5J3HD 2Z7WA 4GRWB 3ARDC 3ZY7A 1HL5A 3L1GA 3BPLB 4R4FH 3VH8A 1GIGL 5D7KD 3S98A 4ANVA 3DA0A 4PG9B 1TNMA 2NY2C 3HI1A 2Y7LA 1SLXA 1JVOA 3RTLA 4IBLT 1G5GA 1XEDA 1IGCH 3UG4A 4XWGL 4FXKA 3QWQB 1AHWA 2NR6A 3T2QA 2A1WL 4DO6A 3MCLH 5FHBL 1NLBL 5DT1H 2A9CA 1A1MA 4QOKA 1IBHA 2ARJQ 1BZ8A 2FO4B 2VSMB 3IDNB 3IRCA 4OZ4B 3POCA 5HI3D 3RNKA 4KZDH 2V9RA 3QUGA 4XP5H 1OIOA 4R97B 4IGBD 4H7VA 3GM8A 4MKTA 3ZYIA 4F1SA 4H0HB 3CFUA 1NCBL 2ZXWB 4CMMA 4V2CB 2AK4E 3X3FL 4HA1A 2NDGA 4M62L 4J3VA 5BMFH 1BIHA 4MDJB 3QS3A 4NO2B 5DA4A 4N2DA 1IKFH 4JG5A 3A23A 3ZR6A 2BNRB 3LEXA 4P3DA 3UTSE 1TTAA 3T3ME 2XV6B 2Y7SA 3C5XA 3G9AB 2Y7OA 1H8OA 4ODVH 4Q56A 3RUGF 3FO1B 1SEQH 4HJGA 1PDKA 4WW2B 5EIIB 4Z78A 2NY4B 2X4PA 3IK2A 4PI2A 3D9AL 2IPTL 3KLDA 3GS4A 1DANU 4I5BA 5TE4H 1CT8B 1Q9KB 4J1UA 4WCYL 1PL3A 3HZVB 3P2TA 5F9JB 1DBBH 1R3LA 3TBVA 3O4OB 1ET7A 1EAPA 3R0MA 3QG6B 1YNKL 3NPZB 4OB5H 3QIBB 3B8YA 3BKCH 4FNPA 1NGWA 4XNAA 3G08B 3HFML 5ALCL 1TQBB 4HAKA 1CDCA 3OHMB 4JO5A 2NZ9C 1PLBA 4PRDA 4XCEA 5C08B 5HVFB 4XGZA 4TSAH 2PCFA 2VMDA 4K23H 1CFVL 2Z1KA 4ZMZA 4QRPA 4EO5A 4OIIH 3P02A 3MV9A 1UGKA 5T1JA 2FEEI 3KLQA 3QIWB 2YD5A 4MNGA 4QHKJ 5DFVD 1ADQA 5DFAA 4YDJB 4ETQB 1T3FB 2FZ3A 1FFNB 32C2A 3P4NB 3Q8CA 2ED6A 3QHFH 4NQDD 1U33A 2OTWB 1CD9B 4MAYD 2DICA 3QUYD 3P54A 3K5SA 4HEPA 4D0DB 2CIIB 3L9RA 3RIFF 5B38A 3WEXA 2ZSVA 4BA8A 1HX0A 5JW4Q 2E75C 4O2FA 3KS0J 4KXZH 4Y4HA 2VSDA 1U8PB 1UB6B 2A5UA 4PMEA 5E1QA 3EH5B 1RZKL 4I48A 1T2QH 3FQTB 5ENWA 3BQUA 2ZX7A 4JCWA 2A38A 1FWXA 4FULA 1E8YA 4IU3A 3BAWA 4FKEA 2PETA 5T1LB 3VE0A 3OR7A 4Y19D 3D0AA 3ECVA 3NJXA 1JERA 2ROYA 4QGTA 4JFEE 4KVPA 4MJ4A 4PJIF 2GI0A 5ETUB 1X5MA 4J4PD 1WZ1H 1DDHA 1NCJA 2LV4A 2LQRA 3Q5YA 3BW9A 1BV8A 1PSKL 4U1JB 4LNVA 1J88A 5F3HA 3QO0A 4S1QH 5DA0B 3PJSB 4CJ0A 1UM4H 2BH0A 2AQ3A 4HBCL 1GTNA 4JR9L 3BOVA 3CH1A 4X99B 3UPAA 5A2CA 2I9LB 5IQ7L 5JHDE 4OF0A 3GM0A 1AGDB 4OV5A 3HBGA 4QNPF 4Y4KA 3NG5A 3ARBC 3MSPA 1Z9NA 4ZX5A 4R4ND 1BD2B 2F58H 1DQJA 1L6PA 4RZKA 2NY5L 4HCFA 1BVNP 1KULA 3BJ91 5E6ZA 3CZEA 1EO5A 4LLYB 2VLJD 2ZSWB 1NMAL 3UZVA 1XGYH 2FYVA 3B9VA 2NSMA 1U8HB 1ILUA 1R17A 3HMXL 1QHOA 3QRGH 4I89A 2BZDA 1HSAA 5TF0A 2X4TB 1FC2D 3VD2A 2KZWA 2LLGA 1BXAA 3KJ6L 1UM5H 3KYMA 3APNA 3SO5A 2WSPA 4HXAL 3U82B 4LZKA 4Z7OF 4NCC2 1FH2A 3OXRA 4OZGB 4PJXB 3EZJB 1QRNA 3D87B 3IMBA 1TJIL 2EUXA 2O6CA 4PJIE 4TUJA 5E9DA 2A9ML 3H1ZA 3QDJD 5FO8A 5IEHB 2V5TA 3SDXF 2MQ3A 1QHQA 3ULUD 4M5ZL 2YWYA 2WQXA 3RHWK 4NPKA 1IC4L 4WDIB 4PS4H 3FQRB 2HN7B 1VPOL 4JAMA 1EEYA 3E7JA 4P9HH 4H8WH 4RMVA 4Z7WE 5DURD 5DZAA 5AOLA 1KUMA 4QY8B 3KM1A 1X5GA 5I6NA 3PP4H 2O5YL 4OAWA 2FVNA 3FO0L 1LNUA 1RZJC 1UWXK 15C8H 1RKRA 4MA8H 3UJTH 1V3KA 1NFKA 1CXIA 3CVIH 4OLVH 4P46C 2C4FU 3I84A 4YC2B 2OXHB 3UJTL 2EXYD 1IGTB 4F15C 3CVIL 2V17L 3P4LA 1U93B 4D9LH 4I0PD 1ZXKA 3SGJA 4P2OB 1GYVA 3ESVF 3WY1A 1AIFA 5KSBF 3O9WA 1VADA 3EO1B 2BVPA 4JL1A 4TNVK 5C0ND 2DTMH 4KOBA 3EXLA 1KWKA 3CHPA 3L4VA 3S97C 5I30H 1IKOP 2ZX8A 1U8MA 5KYWA 5CHNA 3SPVA 1E2ZA 4Z7OE 1QSZA 4HQQL 3NEEA 1FYTB 4X6CB 5GRYA 5J06A 3N1PC 2X9XA 1SLVA 2WXQA 4MXWL 4HXBL 3G6AA 3SDXE 2AF2A 4G7RB 1CTNA 1FL3A 4PSRA 3CVHH 2FQFA 3OF6A 3QNXB 1A6UH 1I1YA 4UQBA 1WA2X 4GAGL 3VI4A 4LAQH 2B8OT 4LNRB 4NJ9L 1J12A 3QISA 3IBEA 2NY3C 2R29H 4A7QA 3QFJD 2A4CA 2Q3XA 4D8PA 5JPNA 2XPGA 3FT9A 4DGIH 2Q8AL 4GIOA 4HKZB 5AB0A 1RK7A 3SKMB 2Z7ZA 1RK0B 1WG3A 2XY2A 4ZW3A 3FTWA 4NN7C 4YDZA 3GMOB 2J56A 5I0YA 3CQQA 4LPVA 4XZUA 5CUSH 3U48A 1TEYA 3HHSB 3W9EA 4RGNC 3EZ8A 3U0PA 5CUSL 4MYWB 5DZ9A 1RUKL 2IANE 2ERJB 2MCPH 3MBEA 4DAGH 1OHZA 1YNTA 3RYMA 1U8IA 3C5SB 3OB8A 2R7EB 2DBLH 3VFRA 3TZVA 1BQ5A 3K71B 1A3LH 3AT8A 3F3HA 7TAAA 1PZDA 2GSGB 2R1XB 4KAQH 2J2ZA 4HS6A 5HPMA 4V1DB 1L7IH 2CALA 3BPCB 4LOUD 4OCXL 2CD0A 3UCRA 3SDDD 4HJEA 4F93B 1RUAH 3GLAA 4PIBA 5C09E 3DUSA 4R0LB 5EWIH 3KPNA 4Y2DD 2P44B 1KTCA 5HDLA 3MRCB 5HHMB 2E56A 5EWIL 4L8DA 2B1AL 4OH2A 1XFPA 3QVAA 1ET5A 1A6TA 1YHPA 3GHBH 5B39A 4ETYA 1JN6A 3V10A 3DX1A 1CO1A 1CXFA 2W5PA 3T0WA 1JFQH 3D69A 3PQYD 4G59C 5F9OL 4BQ9A 4UUJB 4LCWA 1E4XH 3HS0C 3K5RA 2XY1A 3MV11 1M4KA 2XBTA 5EFIB 3B3BA 3AREB 1CU4H 1RSYA 2QVFB 1TLKA 1NIEA 3NFSH 1MRFH 2J25A 3QNZA 1S9YB 1E9OA 1IGJB 1JTPA 5KSAD 2DOCA 4LCIL 4QRRB 1NC2D 2ROXA 1FNSH 2OXGA 4GAJL 3CVHB 4AIOA 1MJJB 2EYRA 4G8EB 2Y1AA 3NCWA 4XPBH 3F62A 3GJEB 2QHRL 4XPBL 3V0VB 5HXMA 1BQSA 2BINA 1RZ8B 5AKTA 3ZMEA 1J8HA 2KS0A 3TEXA 4NS0A 4GLRH 4DVRH 1SMAA 1CQYA 4JJ5A 5E6IC 2ZWYA 3KPOA 3VXQB 4QCIB 3OR6A 2AV7A 3ARYA 5C2BL 3SYQA 1M2VA 2UZXA 4WRLA 1F42A 3FQ1A 4Y9GA 4ZMPA 1YEEH 3L81A 2PW2A 4Y16B 5HVHC 4KNUA 1JJUA 4R96A 5FM5M 3V8OA 5FGBC 3BRFA 2BFGA 2A6IB 4ODUB 1KXVC 4PTUB 4RRPA 2O26U 2VZ1A 3JTBA 2KKQA 3T2NL 3D39D 5I6OA 2VQ1B 2YA1A 4KH9A 1RJLA 1SM3H 4O2EB 4PY8J 3ARGB 4P4KA 5A7BA 2A77H 2I5YL 2YD9A 4EN3D 4WWNA 1P5VB 5IFJB 1WA1X 1IC7H 4UNUA 2H32B 1NANI 5JXAH 2ZD0A 4TQPA 1P5UB 5EZLA 5JIHA 1T0PB 1I7ZA 4KX9A 5CWSA 1IC7L 5JXAL 1IM9B 5CJ5A 1CLVA 2FQEA 2D3JA 4IKJA 2FRGP 2KZ1B 4WEMB 2ZG1A 3HPJA 1CR9L 4UOJA 4LVEA 1HT6A 2A9NH 4O5LL 1FCGA 4CRPA 1P7HL 1A8ZA 1UFUA 2JKXA 5HPOA 3TFKD 2VDMH 4LBEA 2VCOA 4MXQC 1ED3B 4BFKA 5GJSH 4MWFA 4M7LH 4OD3H 1ADWA 1CI3M 4X7CC 5EIIG 1TNNA 1Z5YD 3MRDA 4LVNB 1CI5A 1IC5L 4RISH 3U4BH 4XX5A 4M7LL 3ECBB 5D7LB 3KPRB 3V0WL 4LESA 2N4IA 3TBTA 5IB3A 1HOEA 1U3HA 3N1GC 1TCRA 3NK4A 1OAUH 4G6JL 3V5KA 3TYFB 3I6GA 4LCCA 1GGBL 3IEAA 4YPGB 3SKJH 3VXRA 3EFFB 5HY9B 1NOFA 2YLHA 4AW4A 4PYGA 3EFDH 3ET9F 1KCLA 3S88L 1EBPA 5CGYD 3TN0C 5IB5B 4N0UE 1DBJH 1KT2B 1O0VA 4FAAB 4RDBA 1W80A 3BWAA 2QGEA 4OI8A 5FCSH 3ETBJ 1T4KA 5D1XC 3CVCA 1OP3H 3PAYA 1E2VA 1WZLA 3ZL4H 1NBZB 3FQUA 1G0DA 2ZKXA 4HUUA 5TDPA 1NMBL 3MOAL 3IPFA 1DVSA 4UINH 3WDJA 2VN7A 4XVJL 5C6TL 1MWAL 1T1ZB 2AK4B 4LL1A 1NCDL 2VXTL 1YEDA 2JXMB 4G8IA 4NCDA 3FJTA 1OK0A 3W0WE 1KLFB 2CKBH 5AB1A 2GFBA 2E6QA 4LSUH 3V4VA 1D7FA 1DSFL 2X42A 3E3QE 5DRWB 4U49A 3UTSB 4X6BB 3T3MB 2XZCL 3UYRH 1HKLH 3SDAD 4DP5X 2GY5A 3L45A 2OYMA 1KSRA 3MBXH 4G8FA 1U42A 3UYRL 3W2DH 2JKJA 4KKRA 1AY1L 3L1EA 3O3BA 3F04A 1GAFL 3U1SL 1DBAH 5JZ7D 5AW4B 3MPCA 3NJFA 2Z31D 1GC1L 2X41A 4HPOL 1ZWIA 1AE6H 1KJVA 2H9GA 3WSQL 1U0QA 4CBPA 5CNHA 1RIVL 4MAUH 2GBAA 4ZQKB 4AGQA 5E1AB 2LHAA 2VDMB 3KPSD 1QP1A 2HYMA 1EEQA 2GJ6E 2AJVH 2XTJC 1G1CA 5F9AC 5AVTB 4KZ0A 3JTTB 4KY1L 4DERA 2P8LB 2DBJA 1ONQA 2Q7YB 1RY7B 3DXAD 1L9QA 2C1OA 4N5ED 3PFUA 4DPRA 5C2UB 3ARQA 3NEOA 3APFA 4ZT1A 4EJ1C 4YQXL 1EHLL 3MRNB 4L9LA 3T3PF 7PAZA 3O6FC 3CFBB 3RUGB 5DGQA 4OT1L 1SXNA 1CLZH 1PVHA 3PWLA 1XCQB 4PYHA 4FABL 1N5YL 1YMMA 4A2EA 1FNGA 3RZCA 3NA9H 2IAMA 3D5OF 3ROLB 3IBOA 2F08A 1TXKA 4I18B 4DZ8B 4LSPH 5I1IL 3BN3B 5E00A 1MWAB 2OR7A 4HDIA 4JHVA 3AM8A 1D9KD 2QZQA 3EJJX 4M6OH 5H4ZA 3K8MA 1QBLL 4IOFC 4BUGA 5KSVA 1QD0A 3MBWA 1BOGA 3EJQA 3N43F 4F37K 4JFEB 2WQAA 4M6OL 5SWZD 3EGXA 3CN4A 4FADA 1ZHKA 4BK4A 3CHOA 5EF3A 2R69A 3B2DC 1KPUB 2HPOA 2W0PA 3IJEB 5A1AA 1HYSC 2P8PA 1FO0H 2B0SL 3HKFA 5JHDB 5DMIH 2PF6A 3Q7JA 4PBXA 3TVMA 1EGJL 1F11A 2CUHA 3KXFD 5JYMA 3EYOA 1PMYA 4Q6YA 5KW9L 4YUEL 3Q0HA 1N18A 5CN3A 2FJFA 3OC8A 4PV8A 2PYED 5IB1B 4L1HA 1VIWA 2FR4B 2VERA 3SD2A 2ZCKL 2FL5A 3P9MB 1JIBA 4Q0XH 1PFCA 5T1MA 1WT5C 2XFGB 3EOBB 4A7VA 5CD3B 3Q8BA 2BOLA 4NPJA 5CGTA 2CXGA 5K9OB 4A38A 3ILEA 1AZCA 4JHAL 1T6VN 2F7OA 4IMLB 4YHNA 2HG0A 3IFNL 3VDCA 1M9WA 3U2SA 3JYCA 5FF6A 1L6ZA 4C54A 3L7EA 3CGTA 2CUMA 1FNAA 3LRMA 5JLZB 1X5LA 1R0AL 1Z5LA 4PJIB 5BO1H 2E6JA 1H3XA 1LP9E 1YC8A 3A4FA 2JB5H 5AOJA 4RNRA 1AO7E 1ND0B 1T0NA 2J88L 1UM6H 2WW8A 4C58B 3PNWB 4AUYA 3J8F7 4WV1A 4LSVH 5DUPH 3WI9A 3WIHL 1J1XL 3QXAB 4R3SA 4DGWC 1K8DA 5I16A 1YYLL 4Z7WB 2ZUVA 3C6LA 5IHWA 4XTRC 3WKQA 3N1QC 4IRSA 2ICES 1UWGL 1B0IA 3VG0H 1ORSB 2VWEC 2IMMA 5EN2B 2DLEA 4MCYB 3F7YB 1M9SA 2KC0A 3UPCA 1HCFX 1KN2L 4PG2A 3RWIA 1MHPH 1FE8H 4L4TE 1RZFL 4TSCH 1TZGH 5ACMA 4U3XA 4YL9A 4MSWB 1OSZB 4CN6A 5C7XH 4ZYKB 5F71A 3BT0A 2P5PA 4U1KA 5DC9B 1KN4L 4K3EH 4AVJA 3T0EC 1BMWA 3MXWL 4WAFA 5SX5H 3TCLA 3VXNB 5GS1B 2B5IB 2ORBH 4XO8A 5D4IA 1NIAA 2G9KA 4ZODA 4Z7OB 5MEQA 2YKKA 3P9LA 4TVPL 1QG3A 3L4WA 2FWOB 1FO0B 1JZJA 4TV3A 2VDOL 1R5IA 2GCYB 4AT6A 2QDWA 4U2YA 5DJAA 4BJLA 5HDRA 4HCRH 1XF2B 3SDXB 1KMGA 3TJHD 4MMXC 3I3BA 5EEWA 1KJ3H 4M93B 1YCSA 1XH3B 4KK6D 2HH0L 5ADPH 3EF7A 1YRKA 4G43B 3UGUA 1EHAA 4NUQA 3RX5A 1HI6B 2YXMA 2N59A 4GBXB 5AZ2L 3R4RA 5T3ZL 4HJ1A 2A73B 1O7DC 3OAYH 3T8XB 4HJ0C 1ZA3B 3QPXH 1BHGA 4KXCA 1I8IB 3DIFA 3CSTA 3FFCD 2F6AA 3MJ7A 2XIBA 5MENA 3S3JA 1SJMA 4GG6F 3GBNL 4YX2L 5KSBB 3FH7A 4NQQA 3GGWB 1LEGA 2IANB 1ASQA 2EH7H 1BAWA 1HNYA 2X6BA 4WWKC 3VXOA 4ZI8A 1VCAA 4WFHD 2FB4H 2YQ3A 2OW6A 1J9CT 4CADA 2YUZA 3EYVA 5IK3A 2AEPL 4NP4L 1EANA 2PWGA 2HFTA 2YUWA 3EFOB 1LQSR 5L7XH 3QQDA 5FS5A 3RDTD 5H2BB 1MEXL 2ATAA 4Z3JA 3B9AA 2B3IA 4M3JA 5T33H 3WMQA 1MAMH 1Q4NX 2R83A 3BZFA 5A2JH 5C09B 4LDCA 1HEZB 2DQJH 4ZTOH 2N1TE 1JDAA 4OU3A 3WS6A 4O02A 1U2CA 2CNZA 4F7PB 4J27A 4HK0A 2E9BA 3PABA 3VXUB 5GZOC 4LCUA 5H37H 5MI0B 1A6AB 4HLJA 3NCCB 4NQCD 4UQ3A 3V0IA 1HCVA 4CU7A 3OKKA 2AQRA 2M83A 5E6SB 4N1CA 3M86A 1BVKB 3MJGX 5FM8A 4PJGF 1KENH 1PD1A 3CFDB 4IHOB 3FFDB 3V6OC 4EDWH 3RY6C 4AC4A 4RIRB 1FI8C 4AZ8B 3BGAA 1RJCA 3EYUL 3L3JB 1AR1C 4GKLA 1I75A 5H4YA 3ZTJH 3QR1A 3PU7A 4JN1H 2VDOB 1I85A 2DN7A 1SHXA 1FZOA 1P7KB 4LHUA 3Q3GA 3RVUC 2UY6B 2CMRH 1WWCA 1S9KC 1WAAE 4PV9B 3CFIC 4KKBD 3P40A 2HLEB 4Y5VB 2WBKA 2EO1A 4RSVA 3DK2A 2HSIA 3FBQA 5DMYA 2H8PA 3KLHC 4HZLA 1ZLUK 4IS6B 3QQXA 5DUJA 4X4XB 2EUWA 4UTAA 5KOVC 2GITA 2XG5B 2ZWSA 5ESVB 4UZUA 2XQYK 3L1OH 5D93C 3MYZA 4B27A 4DKTA 2HT4D 3EDEA 1HN1A 5A16A 2A83B 4M5TA 3IDUA 1P4IH 4HF5H 3CQFA 1XF5A 4POYA 3HLAA 2FEEL 5DZPA 1PKOA 4WEEA 4MMYB 4Y5YB 4LAJH 4MA1C 2B3RA 2WKOA 1AXSB 1T7YA 1XQ4A 2X4SA 1BWWA 3BAYA 4G7YL 5DQJA 3WY2A 2HP4A