4LVHB

Insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
221
structure length
218
Chain Sequence
KLQQSGGGVVQPGGSLRLSCAASGFTFSDYDMSWIRQAPGKGLEWVSGILGGSERSYYRDSVKGRFTISRDNSRKTLYLQMNSLRAEDTAVYYCARHGSPGYTLYAWDYWGQGTMVTVSSASTKGPSVFPLAPSTSGATAALGCLVKDYFPEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKSCAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title Insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
pubmed doi rcsb
source organism Influenza a virus
total genus 27
structure length 218
sequence length 221
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvhB02
4NO2B 4RA3A 1CDYA 1U91B 4R97C 1N2RA 5C07B 4E5XB 1RUQH 1SMAA 3P4MA 2R1YB 3V4VH 3QO0A 4YHPA 4Z7NE 1N4XH 4KUZH 3THML 5FYJH 4HWEH 3BPNC 3GMPB 1RJYB 5H94A 4OLYH 3WEXB 1A3QA 3N85H 4RGND 1KIRB 5F89A 1TPXB 1T2XA 3SN6N 3TT1L 3PWPE 4JJ5B 4K8RH 5JHDB 1IT9H 4YHOH 1T1WA 4PJ9D 1DE4A 3LPWA 3OAUL 4X4ZA 1JUFB 5EDXA 2IAND 5TFSH 3FONA 4KGJA 1HEZB 3I6LD 3HNVL 1DBAL 1JWSB 2IBZX 4YBQC 1G1YA 5E1HB 4M1DL 5B39A 2R2BB 1J0ZA 3ARGB 3VRIB 1QSEE 3TBTA 1T66D 4YO0A 3RX7A 1CLOH 1A4KB 3RVXD 3RWHB 2JCCA 3Q1SL 3QUMA 3KJ6H 1TJIL 1ZLWK 1T4KA 4X6DE 5BVJA 5CFHA 2B0SH 5F1IB 1KN2H 1OAKH 5GSRA 3CXHK 4Y4FA 1DTUA 3PWLA 4PJEA 1ITCA 4RISH 15C8L 4ETYA 4X0KA 3TNMB 5EZJB 1G7LA 1IVLA 4G5ZH 1M71A 5D6CA 4HUVB 1WBXA 3SQOL 1DFBH 1JYWA 1GAFH 1RZKL 2HH0H 5I8OH 3QXUA 1U95A 4I9WD 2VDRL 4XVJL 5K9QG 1AXSB 2V2XA 3UJJL 1JVKA 2N7BA 4OZHE 1WWBX 4OQTH 1Z9OA 2H32A 4JM2B 4EQ2A 1LNUB 4KDTC 2XQBH 3RIFF 1J1XL 3BKCL 4LPYA 4YE4H 1IM3B 1FSKC 4Y2DC 1AHWA 4MCZA 4H8WL 4NQXB 3PHQA 2W0KA 1FL5B 1OGAD 1IAKB 2DDQL 3WIHH 4F3FA 3HG1E 3G5YB 5LCVL 2GT9A 2ESVD 3RPKA 3MV7E 3KJ4B 3I6GB 1CTNA 4HGWB 1JWMA 3FT4A 1Q72H 2NY1C 3KPPB 3L3HB 3G6DL 1G7QA 5CIPA 5D2NE 2R2EB 1M7DA 2YR3A 2BOCB 4S11A 2GSIB 2ENYA 2KQNA 2FATH 4WO4C 3ILPA 3NA9H 2RAMA 2DI8A 1XZ0B 3KXFD 5H37G 2OJZL 3TA3D 5I17B 1KGCD 3STZA 2Z8RA 4GAGL 5F7FA 3DMMD 5DJCB 3W0WA 1G84A 1JGVL 3RQ3A 1FPTH 4EUPH 1ZANH 2WBKA 1RI8A 1RJZB 4LRNH 4XPGH 5LGJB 5A1AA 4C56D 2EYTA 4KJYB 1IAIL 3D69B 5DHVB 5E8NB 3QUYB 1LD9B 3QP3A 2Q6WA 5EIVA 1A6TB 1E4WH 2ARJB 1UQSB 4KKCC 1WFUA 1PD6A 2P5WE 1OQXA 2YA0A 5FYKU 3Q3GA 5IEHB 3CFIC 3VDBA 5CCKL 4CJ1A 3F58L 5LBSL 2C3VB 3OF6D 4JHAL 3K80A 5E1AB 2JLLA 2IG2L 4IOFD 4Y1AE 4M6NH 1MCNA 1T5WA 3QWRD 1NGZB 4FRWA 5DHXB 5JO5B 3N1PC 1TQCB 2X4OA 4JFFE 2YZ8A 3P0YH 5C0JA 4HUNB 2DJUA 2V2WB 4BZ2L 1HHGB 4OCNC 3MRQA 4JVPA 1AE6H 1JTTA 3PG2A 3WUZA 2LVEA 4P46C 1WZLA 4OF3A 5ACMA 3H8NA 4Z7WB 5C0NC 1PEWA 5HPMA 4UNUA 2VQTA 4R2GD 4KKLC 4Y4KA 1NLDL 3UMTA 3O11B 4AZ8A 2WBJB 1DUYB 3SCMB 1GVIA 1RK0A 1T1XB 1KUMA 5E6ZA 4ZXBC 4R4BB 1CLYL 1XGRA 3LOWA 1E6OL 3ZE0F 4OT1L 1H3GA 1WISA 2UYLB 1JZ7A 5HDLA 5TDOA 3WO4C 3V0WL 3OGCB 4KRLB 1VCAA 5F1SA 3FN3A 1EHXA 4PRAA 2V9RA 2ZCHL 1QKZL 4CADA 3KYAA 3ZTJH 3OKLA 1QR1B 3QG6A 2AGJH 5C09A 3WFHA 3ZKQD 3U0WH 5HD8C 3EKCA 4I3GA 2Y6SC 5I15L 2OQJA 1N3NB 1WWCA 1YMMD 4I3SH 4PJGA 2OBGA 1BAFH 5F7EL 43C9A 5CEYA 3VFSB 1P7KA 3TJEH 4RBPK 1N2RB 2CGRL 3P4MB 2I26N 3C6LC 3QO0B 4YHPB 3T0EC 1HCVA 2MWCA 1W0YT 1VFOA 3QIWD 1KBGL 5H94B 4CMHC 4HUWA 3RKDD 1S7QA 3V5HA 1IQDA 1U3HC 4F7CA 3BHBA 5D9SA 1EFXA 1WBYA 4YQXH 5TE6L 1DE4B 3SO3C 1MCSA 4PJIA 3MV7D 5E9DE 3WFZA 3K8MA 5C08A 3UBXA 4EBQH 3R1GH 5HVGB 3FONB 3BKYL 5IFHL 5E94A 2ICEA 1FZMA 1X5LA 4S1QH 4XAWH 2OR7A 4P59H 1KLUA 5KSBF 2A38A 5B39B 5BMFH 2RHEA 3L5JA 5T1MA 2IF7A 4XP1H 1KCKA 3TBTB 4YO0B 5F7MC 3QPXL 5ISZD 4GRMA 2PTVA 2JCCB 3QUMB 1T4KB 3OKEA 1MJUL 4MA1C 4X6CA 5BVJB 3O2WH 4NQEA 5GSRB 4Y4FB 4DVRH 1A7PH 3PWLB 4PJEB 3BN3B 4TULH 1FNAA 4TPRL 4X0KB 1G7LB 4JZJC 1PKOA 3NBNA 1R3HA 2CUHA 1M71B 5D6CB 3GDBA 1WBXB 5INCA 1A7BA 4JFEA 3MACH 3RTQA 5KZCB 1U95B 3IDXL 3C5JA 3OL2A 3MV11 2G60H 5HGAA 1CCZA 2V2XB 4PRDA 2P5WD 5J12B 2QLVB 4LVOC 2Z0BA 4BK4A 5DZLA 3EYSH 3QEGH 4R90L 1LE9A 2H32B 3UJIL 5IFJA 4U7KA 2GCYB 3VD7A 2MPAH 1JGUL 1UH4A 4Y1AD 5E6YA 3MRRA 5MERA 4KZDL 3S96A 3A6OA 3PHQB 4RRPG 1HHKA 1CGWA 3UX9B 1WAAE 5FYLL 4F3FB 4PJDE 1EX0A 1ZV5A 2GT9B 4KHTH 4JDTL 1N6UA 1IM9D 1RUAH 4WFEE 3PABA 3ROLA 1JWMB 1L0QA 3FT4B 4YHNA 1G7QB 1KB5H 4R97B 5CIPB 2AS5M 1M7DB 4GBXC 4LVHC 4IIQC 2ZSWA 1MJ7L 3ILPB 1FYHB 1MIEL 4YHZL 1J5OH 1OGTA 2UUDK 1KCSH 4Q0XL 5T33H 3STZB 1MCKA 5IHUL 3UTTB 2DM7A 2EIEA 4N0CD 2RCSH 1OP3K 3UAJD 5C7XL 3CJJA 4Q74A 5IMOA 1A1NA 3LSOA 1A6ZA 3DYPA 1X4XA 3D85A 5DJ2A 4M00A 1EGJL 3AS2A 4J6RH 1HZHH 2BNUA 2F74A 3BZFA 3ISWA 4XCFL 1UH3A 2EYTB 1ORSA 3GJFK 1TETL 3QJHA 2M26A 1JF1A 1JFQL 3E1F1 1ES0A 2Q6WB 5CJQL 2EO1A 4BUGA 3ZT7A 5EUOB 1SQ2N 2KBGA 4ZUTA 1DVFD 3QWQB 4QWWD 4ODUA 5EB9A 2NY5L 1JYNA 3GSQA 3MLYH 5L7XL 2J4WL 4Y16C 3FHAA 4JRYA 5SWSD 1LDPL 5JMRA 1T5WB 5I76A 3VI4E 1XR8A 3WXWL 1I4FA 1OAYL 4LSQL 2X4OB 1Z6JT 2DD8L 5C0JB 4POYA 4OCMC 2XZZA 5J7CC 4XI5D 3MRQB 2CKNA 4XCYA 4YK4B 2YD6A 3S5LG 1NLBL 2Q76A 4G43A 5E9DD 5C0EB 2IPUK 1CGXA 1EIBA 2LU4A 5FV2A 5D2LF 5HPMB 4TTDD 2KPNA 5IHZA 4FTVD 3TVMC 3VGHA 4U3XA 3LKRA 3L3JA 1IC5L 3FQWA 5I1IH 1XGRB 3ARFA 4QT5A 4AY0A 1ZA6A 4U3CA 1OAUH 4RZCA 2PTUA 5TDOB 3RZCA 4PREA 2NR6D 1EEUA 3D3VE 1H3TA 5EFIA 3GM0A 5DI8A 2NY1B 4W6YB 1OP3H 3O8XD 2OTPA 3KPTA 4Z7VA 4PRAB 1BVLA 3NCYS 4CADB 1A6AB 3LB6C 3H7BA 2KUTA 3OKLB 3EYUL 3BGFB 4PG2A 1LO3H 3CSBA 1FZKA 1N26A 5C09B 3WFHB 3PWVA 4TSCL 3NZHL 4HH9A 2APBA 2KDGA 4MZ2A 1UJ3C 3D18A 3DVGA 4QNPF 1KC5L 2OQJB 5CZVL 5FGBA 5BV7H 4Y7MA 4MAYD 4PJGB 43C9B 5CEYB 3D5OF 1P7KB 4OCWH 1X5AA 2NY4D 1JIBA 4ZFGH 1RIVL 3SE9L 3RA7H 3MJ9H 4OJFL 3VG9B 3CX5K 4TOYL 1T2QH 1YYMH 4I0PD 2P8LA 4OD3L 5C71A 4HUWB 3O6FC 2K7QA 3LKQB 5KANI 1CDJA 1S7QB 1U93A 5KW9H 1IQDB 1T5XA 4F7CB 1K8DA 4YDJA 3BHBB 5D9SB 5DUML 1EFXB 1WBYB 5IB5A 1J9CT 1JPST 4OCXH 1DUZA 2A9ML 1PG7X 3BZEB 5J1AA 4PJIB 4WY7L 4JFDE 4WFED 5C08B 5TE7L 4B7IA 3UBXB 1EAJA 5L8LB 2FGZA 4X5LA 5E94B 1FZMB 2ICEB 4HS6A 3NCJH 5DRNA 5FUOL 2HYMA 4YGVA 1QSFE 1KLUB 1U8NA 1CVSC 5T1MB 4QRQA 5BCAA 1EO5A 3QIBA 3ULVC 4DK3A 1JZ5A 3JVGC 3I84A 4GRMB 2VLKE 5DD5H 5C6WH 3OKEB 2ZJSH 4X6CB 3ZLQC 4PBVC 5IESH 3VCLA 3U7WL 2E6PA 1C5CL 3H42L 5FYKD 3X14A 1L9MA 3CDFA 1R3HB 3MR9A 5EC2A 5INCB 4ZS7H 4JFEB 3UPRA 3RL1A 1K6QL 3C5JB 4X6FB 1NGPH 5HGAB 2DIBA 1Z9SA 1GYAA 4PRDB 2QQNH 5DVLA 4EDXA 1I1CA 4X8XA 3UXFA 3WO4B 4DFIA 4DGVL 1LE9B 2YK1H 2Q8AH 1ZKAA 2CRZA 5HYSA 5IFJB 2Y25A 3MRRB 5MERB 3FT2A 4R4NC 3S96B 3HKFA 3GI9H 4OM0H 1HHKB 5EZIL 5JW3H 1UJ3A 2R9HD 3P4OA 1KELL 4OSUL 2DKSA 1RJCA 3W11C 2VN7A 3PABB 3MYZA 1ZA3A 2XZAL 3ROLB 4YHNB 5KSAD 4WHTB 3VWKD 5LAXA 2DN7A 3LQZA 4B5EA 5E6IA 2AEQH 4X83A 1YY8A 3NTCL 4KTYA 2WWMD 5I8EA 4GOSA 2G75A 2ZSWB 4P23A 5BS0D 1U92A 3KLHC 5D70L 5L2KA 4R9HA 5IROA 5T3ZE 2H45A 3RDTA 1OGTB 2P5EE 4CMHB 2DWEB 1MFEH 2VDKL 1U3HB 5JOEA 4HJJH 4PRHA 4BFGA 1A1NB 4JN1H 3LSOB 1A6ZB 4DW2L 4D94A 1T2JA 1QRND 3Q0HA 4UT6H 1KTRL 4EZMA 5CINL 4JY4A 3D3VD 3D85B 4AENA 3MODH 5DJ2B 3N1GC 4KKBC 4P2QE 5K33A 2JELL 1AFVL 1MRDL 3ZT6A 2BNUB 2F74B 3BZFB 5D93B 2BY1A 2GHWB 3OBAA 1EEYA 1KTLA 4RX4A 3QNYA 1I7TA 3TV3L 4ZO7A 2XWJA 1ORSB 4P9HH 5GRYA 3H6JA 1JF1B 4XP9H 1OB1A 1ES0B 3EJYC 1PG7L 4HIXL 2RQ8A 4P4RA 2VXQH 4G8IA 4ODUB 5D1QD 5LGKA 5D7KD 1RUKL 3GSQB 1F8TH 2R0KH 3GHBH 3TBYA 4UTBH 3KPMA 4JRYB 1LEKA 4ODHH 3EJZC 3QDGE 5I76B 4K9EH 1XR8B 5DD3H 1I4FB 4N9GA 4OCSH 4A6YA 5L9DH 4PJFF 3GHEH 4DK6A 5HHXL 5CILH 3ULUC 4XCEA 4M8VA 5GGQH 4HMEA 2QJDA 1E27A 2AI0L 4XCYB 3PP3K 1CGUA 4LVOB 2Q76B 3JZ7A 3V52H 2IAMC 5IHZB 2HKFH 5GPRA 4I0KA 5DMGD 4O5LH 5MENA 5C6PB 4YEEA 1ZLUK 5IJVA 4LPVA 3LKRB 5ILTL 3WLBA 4Z7OF 3L3JB 4WEBL 3FQWB 2BRQA 2VLRB 3SDAC 1I8IA 3ARFB 4QT5B 1CXKA 1ZA6B 4RZCB 4GAJH 3RZCB 3VXME 4PREB 2PW2A 2OX5A 3QI9C 4U0QB 4ONOA 5EFIB 4JO4H 4K71B 4YZFE 3AY4C 4Z7VB 2H2PC 4IBLT 2GI7A 4Z7UF 5DC9B 4Q9RL 1BVLB 1SBSH 3O2DL 4XNYH 4OGYL 5E2WL 2WANA 3H7BB 2FNBA 1I3GH 2CDGA 2MKLC 3QCVH 1JHTA 4WUUB 1FZKB 1DQLH 3PWVB 3RWDA 4G9FA 4HH9B 1CBVH 3IKCA 1MCOH 3D18B 3DVGB 3BN9C 4LSRL 1MIMH 5GS2D 1BVZA 2FBOJ 4U1IA 5FYKL 5KSUA 1JNLL 5D1ZA 3S88L 4PJHF 4QOKE 3W2DH 3V7AE 4Z0XA 3UO1H 4XPFL 1CYGA 5DRZA 3V4UL 4PTUA 3T3PE 4L4VE 5EA0H 2P8LB 4D3CH 5F96H 4S2SA 2DTML 2EDOA 4WW1A 1T5XB 1K8DB 4YDJB 3DECA 3HI5L 2GQHA 5CHNA 5DA4A 3LEYH 5IB5B 4HC1L 2K7PA 4DZ8A 5J1AB 1SEBA 4MQTB 4ELMB 4YIQA 5KVEH 1E6JL 4EIGB 3VH8G 2WIMA 1TZGH 1CZ8L 2I07A 4CVUA 5DRNB 5KSBA 1MCIA 3KYKL 1NBVL 1VEPA 1U8NB 5I6XC 3K4ZA 4PS4L 3M45A 3QUXA 5T3ZD 3KGRA 4QRQB 4I2XE 3QIBB 4JFZL 2VYRE 4HFUH 3RX5A 4TUKH 4OGZA 2VN4A 3HUJF 4QXUH 3FB8A 3UTQA 1UC6A 1WF5A 2W0LA 1FFRA 5B3JF 4Q6IA 4P2QD 4PGBA 3BEWA 4AMKL 2B1AH 3X14B 5E24E 2B2XL 3DXAE 3TZVC 4DOHE 5F97E 3MR9B 4OLUH 3EDJA 1YC7A 5EC2B 1DBML 3UPRB 3BP5A 3RL1B 3PE9A 1UGNA 1WGOA 4M3JA 4A2LA 3VD9A 3RVTC 2W9LA 4EDXB 3SBWC 2AK4E 2AJUH 5D1XD 3VWJD 2JTDA 2DI9A 4JPVL 5HYSB 3HTLX 5HI3C 3NGBC 1JYVA 1KB9K 2Z31C 3QRGH 1GGYA 3FT2B 5DR5L 4HG4K 5SV4A 2BNRE 4MA8H 1QYGL 2X4SA 3VU2A 2OZ4L 1UJ3B 1OD9A 2YRLA 3P4OB 3H9HA 1S8DA 2G5RA 4AG4L 5GS0C 2VC2L 5K9OA 3MYJA 4KV5E 1ZA3B 3U4BL 4UV7H 5LAXB 3RVVC 3LQZB 2ZUYA 3P40A 4ZTOH 5E6IB 1W8NA 1YY8B 3MCG1 4LEXH 2D4FA 5GRUH 5I8EB 5I1GH 2G75B 4P23B 5E2UH 1U92B 3MRNA 5L2KB 3IS0X 2X05A 4GO6B 3H3KA 3B5TA 1C7TA 3RDTB 1B6DA 3RVWD 4NQSA 3S9DB 1KYOJ 4NRXB 4U1JA 4IRJC 1TZHB 3HNVH 4L1HA 2DBLH 4K3EL 1A9EA 5GS1C 2N7AA 1AQKL 4PRHB 3DVNA 3AREC 5ALBH 3VXMD 4Z78A 4JY4B 2XACC 1FZOA 3VG0H 3IRPX 3RJDA 2IGFH 3FQXA 3OKMA 3SPVB 4XWGL 3BWUC 1KIPA 1EEYB 1KTLB 3QNYB 1I7TB 3B5HA 2XWJB 2ITDA 4NO0D 1GH7A 15C8H 2IALA 1OB1B 4MDIA 2WNGA 3BRGC 1AD0A 1J86A 3UYRL 2B1HH 1D5IH 4NNYA 4ONHB 5DUPL 4P4RB 2QSQA 4UQ3A 1U0QA 4XVJH 2E7BA 3T0EE 4G8IB 2J88L 4OZFG 3VI3F 2BHZA 3O4LD 4PY8I 3CDYA 5I1EL 3TBYB 2VWEC 3ECBA 2IEPA 4MNGE 4NZDA 4QOKD 5ECJE 5C0CE 1LEKB 3QAZC 3TC9A 1JZ2A 4ZAKC 5D72L 4DN4H 4WFFE 4YHKH 4PBWD 3TZVA 4D0DA 3ARBC 3WN5C 1YY9C 3OTTA 4N9GB 5I1LA 3GO1L 5C1MB 3MRJA 2DDQH 4QRRD 2P48B 2DLEA 5LCVH 2HJKA 4XCEB 2XKSA 2NW2A 3F12B 2VRAA 1E27B 2X70A 4N1EA 5FA4A 1OQOA 1CFQA 3BE1H 3S98A 4ZOCA 4NP4L 5EBWA 3G6DH 4AL8L 3MOQA 4ZOBA 4S10A 4LCWA 1YNKH 1DQML 5MENB 4OQTA 3MLPA 5IJVB 3WLBB 1CFSA 4LVNC 3V5KA 5DVNA 3TYGL 1CR9H 5E5UB 3A67H 4GAGH 1IEAB 3NABH 4J4PD 3RWEB 1AJ7H 3CLFH 3KPSA 3WIHA 3GSOB 2FB4L 3QFJE 4V2CB 1G1CA 2CDGB 4UUJA 4IDLA 1AO7A 2AQ1A 1FGVL 1JHTB 3BKML 1FFQA 1I1AC 4AM0A 1FNSL 1YEKL 4LDEB 3RWDB 1H9VA 3IYLW 4G9FB 1QPPA 4CU8A 4D2NA 1RPQA 2HVKA 5GS1A 3P0GB 1JF5A 4U1IB 4KRPC 1KNOA 5DRWA 5KSUB 2WP3O 2J12B 2C1OA 5D1ZB 4G9DA 4Y4HA 2AK4D 5D96C 4HS8L 3UTSA 1SMOA 3UJTL 1ZLSL 2W9EH 4Z0XB 3ZYJA 5DRZB 4EI5C 1NL0L 1FL3A 2JJUA 4PTUB 5TQ0L 4WHYH 1YEHL 2VZVA 4RWHA 4EUPA 3ARDD 3UDWC 2IG2H 4WUKH 4KZEL 4S2SB 4HPYH 5AUMA 1YQVL 4WW1B 2ED8A 2NY6C 4LMQI 5A16A 1I7ZA 2E27H 1P84J 3E8UL 5CHNB 3QUKA 3B9KC 3BMWA 4DZ8B 5D7SH 5FGSA 5DQJB 3QDJA 5TJWK 4UBDD 1SEBB 4HEPG 4YIQB 3S36X 1AC6A 2HLFD 2I07B 1NBZA 4KKAC 2QTEA 5FKPA 3RVUD 5KSBB 3MV8D 2LTQC 1FV1B 2QQQA 5K9KA 1MEXL 1VENA 4O58H 4DEPB 5F9OL 3MRHA 3QUXB 4APQD 1N6QL 1NLDH 1RZIA 3OKDA 1VFMA 2GTWA 1M6OA 4JFYA 3BISA 3BP6A 1G9NL 1C5BL 3GSVA 3V7MA 1CLYH 2DTSA 3FB8B 1E6OH 4PJAE 4WWKA 3UTQB 1E0OB 5KVGH 3B2VL 5DK2B 5J6GA 1OAZH 4HXAL 3L3IA 4XVTL 4FNLL 4QRUA 5TF1L 4HUKB 5FECB 4Q6IB 2DQGL 1H5BC 4HLJA 4PGBB 1OHQA 3BEWB 3C5ZD 3VFUA 5LJYH 3TIEA 2AJYH 2ZCHH 1SEQH 2HRLA 1QKZH 2IAMB 5CEZH 5JW4Q 3D39A 4M1CC 3BP5B 2XTJD 2F58L 4NJ9H 3MBXL 2JB5L 5EWIH 2R29L 3FTGA 2O61A 1MF2H 1T21A 3H9ZA 1CXIA 1U36A 4G7VL 4YHYC 4LPTA 2Z92A 5GGVY 3F8UB 3NN8A 4OAWA 2VXVL 3CSPA 3GNML 2DLGA 4MD0A 3P11L 1EA9C 4BQBA 2D7PA 2FJHA 1MRCL 2RGSA 1HINL 5C0CD 4PLKC 3WL9A 1I1AA 4JQXA 2X4SB 1KBGH 4WFFD 3E3QE 1YEJL 1Q0YL 1F58L 1QA9A 3H9HB 4LLUA 1S8DB 4FQCL 5K9OB 3MYJB 3W9EA 2EDFA 1C7SA 4FFZL 4X80L 1GIGH 3MLWL 1P2CA 4JG0L 3O6MH 4RMTA 4KAQL 3ZKSD 3MRNB 1BFTA 4NQSB 4U1JB 1UCBH 5B4MC 3TIDA 1A9EB 1FCGA 1JN6A 1HHHA 4BYHA 3ZT5A 4HDIA 4FQQA 4CBPA 1Q9KB 3DVNB 4MNQA 1QNZH 1S7TB 4Z78B 3ES6A 1EZVX 5DS8A 1SVCP 4MXQD 4EDWL 5KN5A 2R4SL 5DJYA 3FQXB 4PIRF 3OKMB 4K7PX 3QFJD 2X9YA 3QQ3A 1KIPB 1WZKA 4OGXH 4KRMB 4JHBA 3PL6D 4AJ0A 1U9KA 4CU6A 5KTEL 4Y19E 2LVCA 4UV4H 4TPRH 4KUCD 2IALB 2VDQL 3MPCA 1MHPL 1QSZA 1AD0B 4NNYB 3LD8C 1WT5C 4UQ3B 3N06B 3WDIA 2NZ9D 4H26A 2DQTH 3S36L 4CVWA 5L88H 3RNKA 2J2ZA 5I74C 4FQXC 3U9UA 4G6JL 4I18C 1AKJA 4YXLH 3DX9A 5JZ7D 3ECBB 3O3EA 3U79A 2DQCH 4PY8J 1RSFA 3B9VA 4KTEH 5JPMA 4UINL 1CGSH 1FL6A 2CMRL 5DFVC 3RU8L 4EN3C 1UWGL 1MRFL 4U1GB 2ZPKL 4TSBH 4K7FA 3QYCA 3TZVB 4D0DB 2HKHH 4PJFA 1TDQA 2M2DA 3TLRA 5I1LB 1CGYA 3GKWL 3AVEA 4X9FA 2DQJH 2X89A 3MRJB 4DQOH 3K46A 2HJKB 1H8SA 2NW2B 4OM1L 4QHKI 2X70B 5FA4B 5SWZD 1CFQB 4OKVA 1T20B 5EBWB 4M61A 3VFTA 4N0RA 4LCWB 2HRPH 3QG7L 4OFKA 3MRMA 3ULVE 4RWYL 1MJ7H 2ZWLT 1CFSB 1YECL 3T77A 3QO1A 5J11C 3V5KB 5IVXE 1YUHA 2PCPA 1NUNB 3B9DA 6FABH 3H3BC 4YDLC 1NAMH 2K3TA 2C3HA 4Z7UA 1VERA 4P2RD 4NNPL 1SVZA 1PBYA 2NYYD 4BH8A 3KPSB 4LU5H 4G7YL 3G5XA 4ZSOE 4JKPL 4M7KH 3IKKA 5KS9E 3C2AH 2R69L 1X5XA 4OD1L 4UT7H 4UUJB 1NCCH 1AO7B 4AM0B 3A6CH 2LV4A 2HT4D 1KB5A 2FBJL 3DTXA 1O5DT 4XCFH 3T4YA 3GSNL 1F4YL 5DQDL 2HVKB 2ZUQC 3RUGF 4RGMB 5GS1B 1UZ6E 5DMIL 1KIUA 3BGMA 4PJHA 1XFPA 1KNOB 5DRWB 4TYUA 3AREB 1INEH 2C1OB 1MJ8H 4G9DB 4Y4HB 4Y16D 1DQTA 5BV7C 3C60D 3UTSB 1XIWA 4RIRA 2ZUXA 1MI5E 3ILQD 1FL3B 4GG6F 1A6WH 4LF3A 3X17A 1Q94A 4EUPB 1EUTA 1S3KL 3TO4A 4YX2H 1FIGL 2BVQB 5AUMB 4JPWL 2FZ3A 4XB7A 1V5JA 4CVZB 5A16B 1I7ZB 2SEBA 3WXWH 3QUKB 3VD4A 1GOHA 4LSQH 1NFDE 1NBQA 2Y36L 4DVBA 2DQIH 4K7PL 4M4RA 2W60A 1NEUA 5IB4A 3VJ6A 5T5FH 1NBZB 2Q87A 5FKPB 2PXYD 3TN0C 1BF8A 3TWCL 5FHAH 5E7FA 2WW8A 4HIJB 1IFHH 1KCRL 3T1WA 3WHE1 3MRHB 1B4RA 3OKDB 1RZIB 2Y06L 1JRHI 2GTWB 3HUJA 1M6OB 4JFYB 3O3DA 3BP6B 3C08H 3R0NA 3GSVB 3DI2B 4Z95L 2PETA 4WWKB 5J6GB 3QBTB 3S35H 4JN2A 3BQUD 3VFUB 3E6FA 3W9DA 5F88B 3TIEB 1EMTL 4BZ1L 3U9PL 1IC7L 1J05A 3TYFA 4PRIA 2AKRA 4PJ5E 3D39B 2P8PA 1RUPH 1C1EL 4Y19D 2VDOH 1KJVA 4XCCL 4FQJH 5JIPA 5F7NC 4LHUG 3FTGB 3LHPL 1T21B 1KC5H 2R0LH 5MEPA 2YC1A 4ALAL 3QPQD 3B8SA 1S7WA 4XBPA 5DJ0A 3NN8B 3P77A 4BSJA 4OAWB 4MD0B 2D7TL 2FJHB 3SE9H 1QSVA 4MD5A 3G9AB 5CSGA 3WL9B 1MCEA 1VESA 2DF3A 3GMRA 1I1AB 4LVEA 4Q97A 3ULUE 3VW3H 1KLFA 4XX1E 1HHJA 1OSPL 1QA9B 5SWQA 5EULV 4WI4A 4LLUB 2NX5D 2ORBH 3RGVC 2EDQA 5ESQA 5I18L 1FVDA 1I9RL 5DUMH 4H0HB 5TDPA 4KRPB 3W9EB 4CMMA 3SY0B 2OS7A 1CICD 5BZWA 5D96B 2ADFH 1P2CB 4N8VA 5CP3H 1G7PA 3T2NH 4D9QE 2R0ZH 3CLEL 4NQCE 1IMHC 2X4TA 3BDBA 4ENEC 1FO0H 1IEBB 3PQYE 4BJLA 3MJ9A 3L3GA 3ULVD 5TPWL 4L3EA 2DYPD 2ARWA 1JN6B 3CZJA 1HHHB 4KK8C 3TIDB 4KVCL 3HMXL 4P49A 4FQQB 3HNTL 2VISA 4MNQB 1MCQA 4HS3A 4OZIF 3ES6B 5DS8B 3QEQE 1H8NA 5KN5B 5TF0A 1OTSD 5DJYB 2I9LA 4JVWA 1CK0H 3TCLA 3QQ3B 4L8DA 3QRFM 1RJLA 1KJ2L 1T1ZA 4O02H 4LGPB 3TFKD 1A3RL 1FRGL 1BECA 2ZOLA 1X5JA 1X6NA 4KY1H 4X6BA 4LHJB 4P9HC 4RMRA 2IMMA 5JXEC 4LIQE 3FO9A 2VDNH 3RNKB 5J13B 5I1JH 2QHLA 1LEGA 5CBEA 3U9UB 3BRFA 1BJ1J 1AKJB 4G3YL 5B38G 3DX9B 3JSSA 4Z77A 3O3EB 3RPIA 1B2WL 5JPMB 5IGXL 5DLML 1J10A 1H5BB 1FL6B 2EEBA 4HEME 4HIEB 3UTPE 4OLEA 4GFTB 4K7FB 1T0PB 5HHVL 5DT1L 3MXWH 2Y23A 4P3WA 4J3UA 5GISL 2Z4QA 1I9IL 3KR3L 4K9EC 4OSUH 2CKBL 1Z0NA 4YHYB 4NQDE 3HLAA 5HI5C 4QHKJ 5FUZL 3U82B 3EOYG 5EOQL 1TJGL 3VGFA 3HNSL 4M61B 1J1PL 3AB0B 4HZLA 4Q6YA 3B2UC 1BFSA 2BK8A 3MRMB 4PJXA 1BBJA 4OI7A 3T77B 3QO1B 3OXRA 1M7XA 2X44D 4XC1L 4FXKA 1K85A 1YUHB 1QFOA 2PCPB 5I0ZA 3FFCE 3G5ZA 4OLVL 1D9KD 2VDKH 3JWOL 3K8KA 3N9GL 3H9SB 1H3PL 4OCYH 3VRJB 4Z7UB 1INQA 4ZPVA 1MWAL 4BH8B 4NZRL 1F2XK 4DW2H 1KEML 1FFNA 3G5XB 4H20H 2PN5A 3OZ9H 3SDCC 4YPJA 3DUUA 3MRFA 1X3DA 2EE6A 2Q8BH 3SKUD 2JELH 3WIIL 2E3VA 1KB5B 2EYRA 3BI9X 3DTXB 3TH3T 1HI6A 1ZEAL 3QHZL 3T4YB 1Q9LA 2BSED 4MX7A 4PJ5D 1TITA 5C07D 3KPLA 3BGMB 4ODSL 4PJHB 4K23L 1VACA 2R1WA 3U1SL 4N0FA 4HIXH 3MRKA 3GMQA 1YEGL 3KYMA 4H0GA 1XIWB 2ITCA 4RIRB 4KI5F 4FMKA 4LLDA 1CU4L 1MY5A 4NNXB 4P5MA 4LF3B 3KS0J 3DRQA 3VFPA 4GKNA 3TO4B 3CFBA 2R2HA 4XNQA 4LOUC 2FZ3B 1MFAL 4ZYKA 4PD4K 4Q58C 2SEBB 2DM3A 3SKOA 3MRCA 1A7NL 2DQEH 4Z0BL 2CXGA 3SDDC 1S78C 1NCDH 1A1OA 4DVBB 2W60B 4YFLF 5IB4B 5I74B 4FQXB 3VJ6B 2AI0H 5C0AA 4K3GA 2CR3A 3OKKA 3WNOA 3ARGD 5J9PA 3RHWF 5FA3A 4M1GL 1QBMH 4NQCD 4W70A 4LEOA 3WD5L 3K2UH 1OF2A 3VDAA 2ZUTA 3HUJB 3PQYD 1L0XA 4YDKL 5I1CL 4W4OA 2FL5A 2YMXH 5IBLD 5EBLB 4WEBH 2Z93A 2EXWD 5ESAA 3VFMA 4MGXA 4C58B 2VXSH 1U2CA 2W91A 3V4PL 3HPJA 2B4CL 4ODVL 5F7LB 4JN2B 3QEQD 4UAOC 3MNZA 5F70A 3E6FB 3W9DB 3MLSH 2YD7A 3SKJH 2EDRA 4Q9RH 1X4YA 1PKQE 4XNZB 1J05B 3TYFB 1JI1A 4PRIB 2AKRB 5GZOD 4LAQH 1KJVB 1DLFL 4IS6A 4Z7NF 4CL7A 5J11B 3QR2A 3MBEC 5EU3A 5ADOL 5MEPB 4JANA 1MSPA 1S7WB 4F57L 4XBPB 3P77B 4PJ7A 1RFDH 4YXHL 3SE8H 1A3LH 4TUJA 4R4FL 4MD5B 1SJVA 4XPFH 3PGDA 3GMRB 4QRPA 1SYSA 3ESUF 3OR6A 4NZTL 4BFIA 4PP2A 1MQKL 1A64A 1HHJB 1E4KC 3A6BL 5SWQB 3WLWD 1CF8L 2ZUQB 5HYIA 1FVDB 3HI5H 3GMNA 4Y5XA 5HDQH 5TDPB 3ZE2E 2O5YL 3HE7A 2BSRA 2AJVH 3GK8L 1KULA 4CMMB 4HUMB 1J1OL 2JIXB 5SX4H 2XY2A 4DN3H 3ZYZA 5BZWB 1WK0A 3L5XL 1UVQA 5BV7B 1BD2A 4N8VB 2YPLE 1G7PB 4YH6A 1JGDA 1TCMA 5IHLB 4R0LC 4FQ2L 2NCMA 2XRAL 2JCCE 4X6DF 3I2CH 3L3GB 4L3EB 4PS4H 3NIGE 4L5FL 2Y07L 1NC2D 3DO7A 1DZBA 3FFCD 2VISB 5KOVC 3SGEH 5FAAA 4HS3B 3UTOA 4MSWA 5CJXA 3WJJA 5IR1A 2VH5L 2QQLH 4GT7A 3O2VL 1CE6A 1DANT 1YA5A 2I9LB 1N0LA 1T6VN 3V6OC 3WNLA 3T09A 3TCLB 5GRWA 3S6CA 1ORQA 1RJLB 4XP6L 2R56L 5DC0A 1T1ZB 5D7IF 1QLEH 3GBNL 4NZJA 5JQ6H 2V9TA 1BEYH 5GIRA 1AXTH 3C8KA 3Q6GH 1ZLVK 4GSDH 2VDPH 4X6BB 3WFCL 3PV7A 2YN5A 1JNHA 4RCAA 4PUBH 4RNRA 3QDME 2VJXA 4AH2A 3FO9B 5L0QB 5FGRA 1LEGB 5BRZE 2R0WH 5TH2A 1RZKC 4Z77B 3RPIB 4Y88A 4KTDL 4TVPE 2XTLA 4JGUA 4NUGL 5B39G 4HQQL 5ACZB 5DR5H 5HHQA 4F7PA 3QA3A 3NCMA 4WCYH 3N1QC 4K2UL 3SOBH 4H8WC 3HLAB 2C7UA 2EE9A 1PLGL 3B9AA 3BXNA 3U4BH 5F7YC 3FMGH 1G6RL 2HLAA 2Q7YA 4KJQD 5D7JD 4JQVC 1WC7A 4K3HA 3W0WE 43CAA 5IHBA 3EZJB 4PJXB 2A77L 1BBJB 5C86A 3OXRB 4FXKB 1UJTA 2ZKHH 4HGMA 3X3FH 1E4KA 3G5ZB 3QJFB 2H1PH 4NHCL 4L8CA 1T80A 1INQB 4HKXA 4ZPVB 2C9AA 4K3JL 4FQHA 4ZUUA 1FFNB 5KJRH 3EAKA 3QB7C 3DUUB 3MRFB 3MV9A 1A21A 1L0YA 2W07A 3PF2A 1QFUH 3X3GL 3RUGA 2EYRB 3SGJC 4JFQA 1EAPA 1HI6B 3TT3H 5CJ8A 4GKZA 2RR3A 2GJ6E 1Q9LB 4AK1A 2IJ0C 4IRSC 4ACPA 4MQ7A 3KPLB 2APVA 4YUEH 3O41A 2XN9E 4TNWF 3BD5A 1VACB 2R1WB 5HYFA 4N0FB 1EO7A 3GMQB 3MRKB 5HDOA 4GG6A 3VH8A 2ITCB 5C9KA 1P4BH 4ZUSA 4LLDB 4HV8A 1ZGLA 4P5MB 5BVPL 1NCAL 2ID5A 3DRQB 1SM3H 3VFPB 2D0FA 3CFBB 2R2HB 3WUWB 4XNQB 3O6KL 1LO4L 4ZYKB 1YEEH 1AY1L 2YKLL 4LIQL 5K59F 4QRSA 4HWBL 5D72H 3CMOH 5ESVB 1DL7H 2W1NA 2BP3A 1LDSA 3SKOB 3VFGL 3MRCB 1OSZA 4JKWA 1CD0A 1IGMH 1A1OB 3UROR 2L0DA 3QDHA 4FZEL 2E9IA 5GRJH 1LP9F 2F8OA 5C0AB 3OKKB 2FDBP 4KDVA 4WFHD 4I1NB 5J9PB 4AL8H 5FA3B 1KIQA 5T1DL 1E4JA 4RGNC 1P9MC 1OF2B 3BD4A 3O3AA 1SBBA 2BFVH 3O81A 4PRNA 1DP0A 2Z93B 3VFMB 5C3TA 2R1XA 1DBKH 1INDL 4LSPH 4Y4FD 4PJ9C 3D6GA 2ZCKL 3HPJB 1WEJH 1XR9B 3RKPA 4YEFA 2XPGA 4U2ZA 3MNZB 1B0RA 1YC8A 5T3ZH 4CKVX 1CQYA 2FB4H 4DTGH 2BSTA 1N8ZA 1JPSL 1FGVH 3BKMH 2VXUL 4E41A 4OIAA 4IS6B 1FNSH 1WZ1H 1JK8A 3FT3A 1T66C 1QO3B 2YXFA 5EU3B 5HTSA 4KJWD 1JGLL 4HF5H 4OZGE 4JANB 3RVXC 3AS1A 3QDMD 2WWKO 3M8OL 3SJVE 4PJ7B 5BRZD 1FYTA 1CXLA 4NFBA 1FJ1A 5DZOA 4TUJB 1ZLSH 4MD4A 1NQBA 4FZ8H 2UWEF 2FHBA 4H88L 1WJ3A 4IM8A 4QRPB 4FFYH 4TVPD 1SYSB 2QBWA 3OR6B 3EOAA 4KZEH 4PP2B 3MUHL 5C08E 1F4HA 3CXHJ 3IFLL 1K9TA 4IRSA 3TH2T 2XFXA 4Y5XB 2NXYB 3GMNB 5JR1H 3HE7B 1JNNL 2BSRB 4XPHH 1AQDA 3UPAA 4OFIA 1RMFL 3LCYA 1UVQB 3IRZA 1BD2B 1CL7H 2J5LB 4BZYA 3HC4L 3D9AH 3U30C 4TVSa 4S1SL 1JGDB 2LE9A 1CD1A 4IDJH 4NBXB 4PRBA 4KK6D 3I75A 3W0WD 1Q0XL 5I75C 4F9LC 3OR7B 5E2VH 1ACYH 1ZTXL 4JLRA 4OZIA 4NQEE 3CFJA 3DO7B 5EOCH 4JVUA 4JHZA 4MSWB 3RL2A 1CE6B 4FQ1L 4HPOH 5DFTA 1J8HE 3HZVA 4OGAD 2XOTA 3LS5L 1P1ZB 1NGYA 2NY2B 4R8WL 2FGWL 1ORQB 4B53A 4FNLH 3S3JA 3CVHH 2DQGH 3KPRA 2B5IC 3P2TA 4UOW1 3T3ME 1UB6B 5GIRB 3TBVB 3C8KB 3MX0A 2NY0B 2R4RL 2QADB 2QQKL 3TA3C 1RAMA 2FJFA 4HKZA 1Q38A 4U6VL 3DSFL 3DMMC 4M7LT 1A6PA 1JNHB 3GRWH 4O4YH 4YDVA 2EKSA 4RNRB 3VXUE 4EXPX 4AH2B 2XN9D 2X1XR 1S9XA 4O2EA 1WAAF 5TH2B 1FIEA 4DJMA 1QVOA 4XHQA 2C26A 5JIHA 4UAOB 2XIDA 2IANA 4XXCA 1JE6A 4EOWH 5JOFA 4NJAL 4E0RA 3P11H 1AR2A 3IFNL 5LQBL 1HINH 4F7PB 2X4RA 4N8CL 4LL9A 4F2MA 1GC1L 3O3UN 3QA3B 2XA3A 1XCQA 1TJHL 5DUBA 2DRUA 4FMFA 5C9JA 4YHML 1U41A 2C7UB 4RAVA 3VFSA 5I71B 4Y4KD 3BXNB 4XPAL 2YBRA 4JM2F 3L7EA 4IOFC 1S5IL 4LHQB 2HLAB 2Q7YB 3IDUA 1WC7B 43CAB 3OPZH 5LG1A 3HRZA 4W81A 4DCQB 1F5WA 5BO1H 5MHSE 3WSQH 3MLXH 4X7SL 4JFXA 4G8GE 5DJXA 3RIAF 1JNJA 4UIKH 4BK5A 2VLLA 4L8CB 4YHIA 4HKXB 1EVUA 4ZUUB 3O0RL 2ADGA 4J8RA 2XZCL 2OI9B 2X4NA 2OXHA 3QUML 5C09D 4L8SA 3MV9B 3JWDL 5EORH 2R4SH 4QXGL 1ZHLA 4R2GC 3AS3A 1S7UA 3RUGB 5FM5M 2X10A 4JFQB 1EAPB 5J89A 1DN2A 4R0LB 4GKZB 4JCMA 5KTEH 2R39A 4LK4A 1BM3L 1OGAA 4MQ7B 3O41B 1G6VK 2R2CA 5LXGH 1NDMA 1AGBA 3IB4A 3KHQA 2E6JA 4M43H 2WBWB 1MCRA 4GG6B 3VH8B 4MQXD 5HVWA 4JAMA 4ZUSB 1OCWL 4JO2L 5DURB 4HV8B 1ZGLB 1A47A 3T0AA 5F71A 4HLZH 1VADA 5CJOL 1EFXD 2NY5C 1UWGH 3P9MA 4QRSB 1MRFH 1UWEH 2P46B 1QQDA 5C08D 4QCIA 1OSZB 3AMLA 3IGAA 2EDDA 1GGIL 4TVPL 3VXNB 2P8MA 3LS4L 1SYVA 5AWNL 5F3HA 3QIWC 5DD0H 1KIQB 4C56A 4WU5B 1RV6X 3RKDC 1P4LA 5I16A 3O3AB 5FHBL 4WW2C 4PRNB 1IEHA 4JPKL 2PKDA 1MCLA 1YECH 5TE4H 4P5KA 1YNTB 2P1YA 4HKJA 5C0RH 2R1XB 4NQED 1TVHA 4MQSB 2H9GA 2DLFH 3ZKXC 2ZP0T 1A7QL 3LRSA 5IT2L 2F19L 4O51A 5JA9A 4P2OA 2XPGB 3OF6A 3MXVL 1B0RB 1J8HD 4Z7WF 4XHJD 3T65A 3SKNA 2VZSA 3B3IA 4JFED 3RTQD 2R69H 2ED9A 1N8ZB 1F13A 1PEZA 3S3SA 3STLA 3CX2A 2VE6A 3OKYA 2IQAA 3PGCA 3MOAL 4E41B 5GGTH 2VLJE 1PDKA 3HAEH 2H3NA 3TH4T 1JK8B 3FT3B 3ZE1E 3HI6H 3GSNH 3IVKA 5DQDH 3PWPA 4I77L 5FDWA 2M8XA 5DMIH 4X5XA 3LMJL 4KVNL 3DSNA 1WIUA 4F58H 3NZ8A 3DURA 1IAMA 3IU4L 1PJ9A 1FYTB 1RZJL 2AJXH 4JB9L 1FJ1B 3D0LA 1A4JA 4MD4B 1NAMA 3ARXA 1JTPA 2XKUA 3OAZK 3EOAB 1OLLA 1RZFL 5JHLL 4JPWH 1NKOA 5JTWA 2ZUUA 12E8H 2P44B 4IRSB 2P24A 4OV5A 3VFWA 5IVNA 1UXSA 1QSEA 4XAKE 2Y36H 4W68A 4X6DA 1CD1B 3L3KB 2YXMA 3WFEH 5HGBB 4WV1A 4PRBB 4WFGD 3I75B 4DKEH 4JLRB 4OZIB 1RZ8A 1RQ5A 3CFJB 3D85D 4K94L 4Y8AA 2VDLH 2CLVA 3RL2B 3ZKND 2MTPA 4Z95H 2VB5A 3HZVB 4O00A 3S37X 4NWUH 2W0FA 4NKIH 1WVZA 1U8LA 2GK0A 3QNZA 3KPRB 3QIWA 5IJKC 1MCPL 2EH8L 5L2JA 4S1RH 2NY3B 3NFSH 4LPCA 1KTKE 4RGNB 1FGNH 2FJFB 4HKZB 3Q5TA 2WLYA 4WW2A 5KSVA 4PYGA 3P9LA 1C1EH 4N0CC 5GQBA 4YDVB 3UAJC 3IJYA 5D5ME 2EIBA 2ZSVA 1T03H 1BQLL 3HG1A 4JRYD 1BZ7A 4PJ9B 4UDTA 4O2EB 2WSKA 5IMMA 1QVOB 1OP9A 4QYOA 4G8FA 1NEZA 2IANB 2FRGP 5JOFB 1K3IA 5B21A 5D2NA 4PJEF 4E0RB 5C92A 2D7TH 3FN0H 4TUOA 2X4RB 1NH6A 5DMJB 2VQ1A 4O9HH 4AEHL 5B3NA 3CFCH 1PX4A 1XCQB 4FN0A 5DUBB 5IW1A 4ZG1A 5C9JB 1CE1L 1DVFC 3DWTA 4D8PA 4QWWC 4XXDA 3UZVB 4RAVB 5IB1A 4UT9H 1D6VH 2YBRB 3L7EB 1EHLH 1A7RL 3L5IA 4P3CL 2BDNL 1ADQH 3V2AR 1MAMH 2GK2A 3ARFD 5JW4R 1M1SA 2FEDD 1F6FB 3NAAL 4X9BA 3RZCD 1A9BB 5LGHH 2FSEA 2ENSA 3INUH 2CQVA 3MLUH 4ZD3H 1HHIA 1TQBB 4GXVL 4JFXB 1CVRA 2YZ1A 5D7LE 5FYJU 2VLLB 3I9GH 4FHBD 4YHIB 4XI5C 3HMXH 5E8EA 2VSDA 1W2KT 5LVEA 1OD7A 5HYSG 2ADGB 4J8RB 2YWZA 2X4NB 3BDYL 5C2BL 1KXTB 2C1PA 3U30B 4TTDC 4MJ5B 5A2KH 3PWJA 1N64H 4L1DA 1CLZL 4LSVL 5I30H 3JV0A 5CP3A 4LPUA 1J11A 1FRGH 4EQ3A 1OGAB 2WUCH 5ID0A 4R26L 1WUNT 4QTIH 5EO0A 1IBGH 4XNUH 1NDMB 4JFFA 1AGBB 1FO0A 2NR6C 4XMPL 5D71H 3B8YA 3O8XC 3LDBC 2HAZA 3ORJA 4JAMB 3G6JB 4G3YH 1XGTA 4KXZH 1QFWI 1EJOL 1KCVL 3DPBA 5FV1L 3FO1A 3MLRH 1VADB 1DJSA 4IOIB 1P7QA 3EUUA 4GRLA 5HHVH 1QQDB 4GG8A 4QCIB 4MAYC 4N0YH 3IGAB 2OL3H 5EUOF 1RIUH 4AYFA 1JWUA 1A6VH 2A9NL 1MCHA 2A1WH 3EO0B 2NY4C 1LP9A 2P8MB 3OAYK 4OZ4A 1SYVB 2APXA 3S37L 4L9DA 4JFOA 4XAKD 3KLDA 4NM8L 4RFEA 1ZT7B 3F7VA 1TJGH 2CDFA 4I5BA 3HNSH 4I0PC 1MCDA 2BVUA 1YEDA 2CLRA 1CXEA 4C56B 3BKJH 1UXWA 1P4LB 5I16B 1A1MA 4P5KB 4LHUA 2DMCA 3L1OL 4XC1H 2GUOA 3MRIA 1TVHB 2H9GB 3CK0H 1IKNA 4XP5L 4M8QA 3LRSB 2V5TA 1H3PH 2OXGA 4O51B 3NCYP 4P2OB 4G9FE 1MWAH 2D0HA 2HVJA 5JDJA 3T65B 2ZG3A 3SKNB 1I8MA 3B3IB 3VGAC 2DMBA 3STLB 2HTLD 2EECA 2ZUSA 2VE6B 2IQAB 3PGCB 3QCUH 4O2FA 1FE8L 5HHME 3MFGB 3FQNA 4MXWL 1OAXL 1QEWA 3IVKB 2DQHL 3NA4A 3RAJL 3PWPB 2YPVH 3MJ7A 4X5XB 1V7MH 3O6LL 2HFFA 3NZ8B 3DURB 3U1SH 3WKML 2UWEA 2ZOKA 3QH3A 5KVDL 3TJHD 3D0LB 2NY7L 1A7OL 1A4JB 1NAMB 1JZ8A 3HR6A 2XYCA 1NGQL 5IUSA 3CU7A 5C0BE 2EO9A 1MFAH 1DANU 4JFHE 5MI0C 2P24B 4OV5B 3VFWB 5E6ID 5HVFB 5KSBE 5LWYL 1RZ7H 4LSUL 1UXSB 4NYLA 1QSEB 1FLRL 3BT2H 4UOJA 4P23D 3DGCR 4QGYA 4JPIB 5L2KD 1YEIH 4LASH 3RDTD 3EO1B 4XP4H 3GMPA 5EU6E 4X6DB 2PNDA 1J0YA 5I19L 3LQAL 3UPCA 4WI9A 4WV1B 4JGMA 2JJSC 4CVXA 4HHAA 4PRHD 4TRPL 4FQLL 1F3RB 2VIRA 1RZ8B 3RY6C 3WD5H 3WJLC 1R0AH 2R9HC 1FC1A 5F9WC 2QSCH 1NAKL 4YDKH 2CLVB 5D7LD 2V17H 5KSAC 3VWKC 4JG1L 5B38A 2BHYA 3GSRA 5DDHB 4M6MH 3QHFH 2WWMC 3ZKMD 4RA0C 3ULVH 2V6HA 4M02A 1F42A 1U8LB 1EHNA 2GK0B 5H2BA 3QNZB 3QIWB 1HIML 2R2BA 5L2JB 4ONGL 4I3RH 1MCFA 2Z8WC 2ZCLL 4M7ZC 5B8CC 4LSSH 3TF7C 4LCYA 4WW2B 5IIEA 5KSVB 3P9LB 4H1LG 4ZDHA 3WCYA 3IJYB 4U1MA 4WEUD 1WAAA 2ZSVB 2E5EA 3HG1B 2MNUA 4KRNA 3DBXA 2EEDA 1BZ7B 5F1IA 5DD1L 4UDTB 4HT1H 3ZKXB 3GUTA 1N5YH 3MV7B 5IMMB 5D8JH 4F57H 5EPMA 4QYOB 4L4TE 1NEZB 4Y5YA 3AMKA 3HMWH 4LPXA 1Q1JL 5D2NB 5HHNA 4KV5F 1LO0H 2F15A 1B88A 2J1KA 4P4KA 2F54E 1FZJA 4TUOB 1H3UA 1FH5L 1UCTA 1GGBH 1HCFX 2VQ1B 1I3RA 1V7NL 1X5FA 1R3IH 4M93B 5IW1B 3RFZC 4D8PB 1T7YA 4XXDB 5D1QC 1G7JA 4JM2A 3TCXA 1BFVL 1EFQA 5IB1B 4R7NA 5MEND 1KACB 5DSCA 3NVQA 4DGYL 4XTRD 2YUVA 1BZ9A 3OWEA 4C57C 3ARZA 1KT2A 2FSEB 3P0VH 2UZIL 1HHIB 1YNLH 2A6IB 1QLFA 1GHFH 1CDHA 4C55A 1RURL 4L5FH 1SY6H 1Z3GL 4BQCA 5E8EB 1PY9A 2P5WB 4HKBA 2WIIA 3E2HB 3I6LE 4F33A 2BNQA 2VH5H 3LKOA 3QCTL 3UZQA 4G9FD 2C1PB 5DMGC 1QLRA 2DM4A 5ICYB 4CN6A 3PWJB 2AJ3A 3HZKB 3GBNH 4OF8A 4M62H 3EOTL 5D1ZD 4KK5D 5ID0B 4IMKA 3ULSA 1NCNA 4JFFB 2AEPH 1FO0B 1LEIA 1SJHA 4M6OH 1QBLL 4P5TA 4OTXH 1RHFA 4XNXH 2DQDL 7FABH 1XGTB 1E4XL 3QUYA 3FO1B 1TTFA 4I9WE 2EXYD 2XWTA 3NH7L 2EDLA 2CLZA 2BOBA 1P7QB 3B9EA 4GRLB 3ZTNH 5D2LE 1OPGL 4NHUA 1QD0A 4GG8B 5C0BD 3MRLA 4M48L 4JFHD 1YYLL 2E7HA 1JWUB 3FO0L 3V5DA 4K2UH 4JFOB 5AYQA 5HGGS 4U1SA 2HT3D 1IGFL 1ZS8A 3QUXD 3RWGB 2MHAA 1Z9LA 1NGZA 3CNKA 4RFEB 3F7VB 2CDFB 4I5BB 2Y9RT 5EU6D 2JB6A 3ULUH 32C2A 4KMTL 1YEDB 2CLRB 1G6RH 4G6ML 4U1KA 4JZOA 1UXWB 2ESVE 1A1MB 3T04D 2OLDA 4KK9D 4LHUB 1HHGA 1MNUH 2GUOB 3REVA 3BSZH 2YOCA 4KQ4L 1F90H 5DWUL 3QUZD 4GS7B 4M8QB 1DVFB 4XMLL 5D1QA 2AABH 3CDGA 4MJ4A 1LK3H 2RFXA 2HVJB 1A14H 3ZL4L 4XC3H 3U4EA 3ZZ1A 3SCMA 3BAEH 1FBIL 1VEMA 1NUFA 4O2FB 4DAGL 3FQNB 2K1MA 4X6EA 4KKNA 1QEWB 2ICWA 1JI2A 4U1LA 5E99L 1WITA 3HE6A 2FX8L 3QH3B 2ZOKB 4Z7VF 4JE4B 5E9DB 5IBTL 4JFDA 3LEVL 3S34H 2HFEA 4NWTH 3QDJE 3IFOA 4IHOA 3SGDH 2IFFL 1BHGA 1IC1A 1N3NA 1F3DH 4X4ME 1F4WL 5ADPH 1QSFA 1F2QA 3QULA 1I7UB 4A6YL 5FYLE 2VDML 2VZTA 4NYLB 4NFDA 1RU9H 4KROB 4M5ZL 4MJ6A 5D1XC 5GGVL 2VLKA 3VWJC 5D6DC 3O8XB 3LDBB 2NPLX 3GBML 3LKNA 3GMLA 5F6IB 5FYJD 2Z8VC 4CVXB 5H8DA 2MCG1 2QKIB 4HHAB 1OP5K 3B6SA 1U3JA 5IQ7L 4BQ9A 5FO9A 2VIRB 1KB9J 1FNEA 4K8RD 3CMGA 4X9IA 1DBJH 4JY6A 1ZOXA 3DIFA 2YUXA 2NY4B 4ELMF 5B38B 3JXAA 3CVIH 3GSRB 2ZCKH 3EHBD 4EUPG 1G9NC 2O5XH 4Z6AT 1ZGLM 4IEFB 5H2BB 4GAFB 1I8LA 3MOBH 3K1KC 3RVWC 2D9CA 3BESR 4H0IA 1RUMH 4LBEA 1PZ5A 1KJ3H 4LCYB 4Z8FL 5IIEB 3QNXA 4ZDHB 2FX9H 3ELAT 3HPLA 3NACL 4U1MB 4QLRA 4PJDB 3BYTA 5EU5B 3DBXB 1XF3A 1JGLH 3GUTB 3LH2L 4R7DB 4WU7A 5EPMB 3M8OH 4Y5YB 5E56A 1MFBL 3VXSA 5HHNB 1BLNA 3PV6A 2ARJQ 3C6SA 4ZQKA 4KHXH 2DQUL 1YMME 4P4KB 1FZJB 4OIBA 3VGAB 2BJML 2F5BL 1HNGA 4H88H 3WNKA 1I3RB 2VNCA 2P5EA 1T0NA 1FP5A 3LIZH 4XH2A 2QSTA 3ALPA 5JIKA 2YPKA 4NGHH 4QXWA 3WNMA 5DHYB 1G7JB 4LCWD 3IDYC 2GCYA 4R7NB 5DSCB 1MAKA 1BBDH 3AM8C 3H7LA 2IBBA 5GS0H 3HC4H 1TCRA 3PP4L 1BZ9B 4LFHG 4MNQE 4S1SH 1JZ3A 4J3TA 2HP4A 1KT2B 2FX7L 4PJ8A 3BVNA 1CFVH 3KPSD 1Q0XH 1QLFB 1KYOK 1YEFL 4D0BA 1DQJB 4HKBB 2WIIB 4HJ0D 4MA7H 4PJCE 2BNQB 4F33B 1AO7D 1W72H 3CFEA 3LKOB 3VWJA 3MGOA 4DZBA 1QPXA 5INDA 5K9JH 3LS5H 4W4NA 1QLRB 3VXRE 1JPTL 3UTTA 5ISZE 3ZTJG 2AJ3B 4HGKC 4KC3B 3SQBA 3LN5A 3QDGA 4UILH 4Y4HD 3RBGA 3UTSD 1YPZE 3ULSB 4FABL 5F9WB 5JOPE 1VKXB 1LEIB 2DBJA 2FEEL 2OM5A 4J4PC 1SJHB 3KHOA 4PJFE 1KV3A 1JZ6A 4P5TB 1ZLWH 5F7KC 2BVTA 3AAZA 4RFOH 3UYOD 5EIIA 4KQ3L 4N0UE 1BFOA 2XWTB 1LMKA 5IWLC 2CLZB 1UFUA 2BOBB 3QDJD 3U0PA 3IFNH 5EUOA 4NHUB 3CVHA 3MRLB 4F8TA 4N8CH 2P4AB 3MROA 3ULVF 4KDWA 5FYLD 3V5DB 3WO3B 3VXMA 5IVXF 4CU7A 3D3VB 4U1SB 2AK1L 1ZS8B 4B7LA 3GRWA 2MHAB 4TSAH 5CKAA 3MLVL 3JV6A 4XPAH 1BWMA 1WWAX 2JB6B 3ARDC 32C2B 4U1KB 4JZOB 1YJDL 3C09C 2Y4SA 5KS9F 2BRRH 4WWKD 4JRXE 1RUQL 3CXDH 3T2QA 1WZMA 4YXKH 3V4VL 3REVB 4LRIC 1I9JL 4JRWA 1N4XL 1RZGA 4LP5A 4KUZL 5FYJL 1Q9WB 4HWEL 4MVBD 5C0EA 2YN3A 4UBDC 5D1QB 4OLYL 4UU9B 4CNIA 3CDGB 3N85L 4RAUA 2HLFC 5L6YH 4GW5B 2RFXB 1UZ6F 4KDTA 3RVUC 3F6LA 3U4EB 4QOKA 2J8HA 4K8RL 4LCUA 4Y2DA 3AM8A 2CXKA 1IT9L 5JUEH 4YHOL 4APQC 4L4VA 5CLTA 1UA6H 1NMCC 5ALCL 4U6YA 4OLZH 4X6EB 5TFSL 4GRWE 2ICWB 3O3BA 4HMCA 5I2IB 4OF6A 4U1LB 3O45A 3HE6B 3BIBX 1A6AA 1CI5A 1AI1H 1PX3A 4JFDB 1A6UL 4WO4A 3T0XA 3C5ZC 1LGVA 1OCWH 2HFEB 3IJSA 1CLOL 3IFOB 3QQ9D 4IHOB 2PR4H 3KJ6L 1QSFB 2XTJC 1IGCH 1UT9A 2B0SL 1A22B 1KN2L 3QULB 1OAKL 1ZHNA 4I2XA 2D7OA 3MLZL 4J7RA 4RISL 5SWSE 4MJ6B 1KENL 2VLKB 1P84K 4HWNA 1GGIH 4TVPH 3P30H 3FQTB 3LS4H 1DFBL 1IKFL 1GAFL 2HMID 3LKNB 3GMLB 2HH0L 5I8OL 3LKQA 2UV3A 4FQIH 5B3JE 4MNQD 1WTGT 3B6SB 4OQTL 3DXAA 5FO9B 1KFAH 1B0GA 1IGIH 3BZEA 3MCLH 5EBMA 1FNEB 4V1DE 1YN7A 3MUY1 4JPKH 4JY6B 2XQBL 2LABA 3DIFB 4YE4L 1OARH 3PHOA 2P7TA 1D3CA 2AXGA 2RBLA 4FTVE 1C16A 4YAQB 2F19H 3BPLC 3F7QA 3MRGA 2IFGA 1NGWA 3VXRD 5ITBH 4LBEB 1PZ5B 1Q72L 4MJ2A 2BNRA 3QNXB 1NDGA 4NQTA 3HPLB 3IAPA 1V05A 1AKJD 4NOFA 5EC1A 3BEVA 1UH2A 1XF3B 4P46A 5JOPD 3ULUF 4MXQC 4WU7B 3ARYA 4KVNH 4QHNB 3VXSB 4YFDB 1BLNB 2D9QB 3PV6B 3C6SB 3PL6C 4ZQKB 2X89D 2QV2A 5IVOA 4JQIH 4ZXBA 1FPTL 4X6FA 1ZANL 1UM4L 1ONQA 4LRNL 2P5EB 4XPGL 1FVCA 1T0NB 4C4KT 4XH2B 2HFGH 4K3DH 2NZ9C 2YPKB 2E7LC 2X7LA 4WTZG 5GGTA 3HAEA 4YC2C 2APFA 5JZ7C 4Y5VC 3ALWA 4RBPH 3NCEB 4FFVD 3VXTB 4P2QB 5GRXG 1G7MB 1L6ZA 1TCRB 3C5ZA 2FHFA 3FQUA 5I8KH 5DGRA 1I85C 4PJ8B 2OJEA 3BVNB 2ERJC 5JXAH 4JRXD 5TGBA 3OB0K 4WHTA 5IFAL 5CUSH 4D0BB 4M6NL 3SDYL 4FP8H 3C6LA 3CFEB 4JKMA 3KYNB 3ARRA 3T0EA 3NPZB 4UMGA 3VWJB 3VXPA 1B4JH 3MGOB 3PGFH 4DZBB 3BPNB 4ODTH 5INDB 2IQ9H 3VI3E 2DWEA 4MNGA 5C0CA 3V8OA 1ZVSA 1U3HA 4LAJH 1AE6L 1MCWW 3LN5B 3QDGB 4M7JH 4PPTA 2LFGA 1XIWD 3VE0A 4ZFOA 3QISA 2F53E 5GZND 4L4JA 2NYYC 4QTHA 4YWGH 1CS6A 4BQ8A 4N8VG 5AG9A 5FYKE 3TO4D 3BDXA 3IDNA 3AAZB 1IQWH 5EIIB 1MAJA 2HWZH 4P2YA 4PR5A 1YQ2A 1BFOB 2HT4C 3RX8A 3DROA 1U58A 3LEXA 3U0PB 3GEWB 2YHGA 3CVHB 1EDQA 2P49B 2EDKA 5F7UA 2E8ZA 1HKLH 2BVPA 4AEHH 1U8JA 3MROB 2ZNWA 1CFTA 3MA7B 3VXMB 3OXSB 2AGJL 3C60C 3U0WL 1MFCH 3ILQC 5M94B 2Y5EA 25C8H 3JV6B 4JZJA 4P0DA 5DXWA 5CD5D 1OW0C 1A7RH 5I1KL 1XT5A 4AEFA 3TJEL 3OV6A 3WDJA 2EZ0D 3E3QC 2IPUG 4LGRB 1RZGB 3LZFH 5IB2A 4V1DD 2JE8A 3FL7A 4M5YH 4P9MH 5BS0E 5SX4I 4CNIB 2IMNA 4RAUB 3U36A 4PRID 4ERSL 2EDNA 4P57A 2PXYC 4QOKB 4LCUB 3IETA 1FSKB 3ARPA 4Y2DB 4KMLB 5FXCH 4YQXL 5C2BH 2J6EH 2FO4A 2VLRA 4L4VB 3T0WA 2N4IA 4U6YB 4A2MA 4Q2ZB 1MHCA 1QRNE 1TIUA 4CDGC 2UUDH 3R1GL 4EBQL 3KLAA 4YJZL 1ADQA 3FZUD 3O3BB 5I0DA 5A3ID 4HIIB 3SGEI 4Q9BA 5CAYB 2YA1A 8FABA 4S1QL 4XAWL 3O45B 3C5SA 3RBSA 5FGCE 4GBXA 4XMPH 4IIQA 4M03A 1CXFA 4WUUA 3BQUC 4WO4B 3OKOA 4XP1L 3K4DA 3IJSB 4UNTA 4R3SA 3DUSA 2QHRH 4L3CA 5IV2A 4CRPA 5IF0A 1BZQK 3R0MA 2OK0L 35C8H 1OTUD 3GJFH 4DGIH 3QXWA 4ZOAA 3O2WL 5CSZB 4HK3J 5D7KE 1ZHNB 4DVRL 4I2XB 4TULL 4XVUD 3TPKA 3QPQC 2AV7B 4L3AA 4PJAA 3S37H 1JF6A 5MP6H 3MACL 4L3ED 5IMKA 2G60L 3ZYOA 3F7YA 2XY1A 3EDEA 4GQ9L 4MAUH 1KJMA 3DXAB 2H2SD 4DOHB 3EYSL 3QEGL 4FXGA 3NOIA 1B0GB 5EBMB 1IARB 1YN7B 3L5WA 4ELMA 2MPAL 4UB0H 3L1OH 3REWA 4PG9A 3PHOB 2P7TB 1NFKA 2AXGB 4U33A 2W9DH 4WVRA 1C16B 1CICC 4Y16A 2AK4B 1LQSR 3TESA 4NN6C 2E9JA 1AGCB 2OL3A 1HYSD 3WUWG 1U8IB 4KHTL 2ICWI 3MRGB 3ARDB 1UWXK 1RUAL 1NGWB 2B4CC 4LLQB 3C09B 3WXVL 3BFOA 2IPKA 2BNRB 1KB5L 1NDGB 1DQDH 4JO3H 5F21B 1PGRB 2E8YA 5EC1B 5FK9A 3BEVB 4P46B 2DLHA 2F53D 1N59A 1NANH 3MUJA 1OTSC 3GJEA 3H3PH 1KCSL 1YZZA 3X11A 3O6LH 5T33L 5JNYA 2W38A 3MNVA 3TVMA 2FECI 2RCSL 5DK3A 4XPTH 3JUYA 4ODBD 4NCC2 3TFKC 5CGYD 4ZPTA 1CD9B 3QWOB 1MWAA 4ZXBB 1S7VA 1XGYL 1ONQB 4ZMAT 1FVCB 1BQHG 5J57B 4HULB 1HZHL 1MVFA 5ICZA 3ZHDA 2X7LB 3HAEB 3LN9A 4U49A 1FLRH 3NIGF 3WMSA 5HYJE 3GSNB 1S7XA 4NPYA 2YD2A 1BOYA 9CGTA 1P4IH 3C5ZB 3ZSTA 3FQUB 4C54A 4M7LL 4V2BA 3K3QA 1UB5B 2OJEB 4Y19A 1Y0LA 3MLYL 5TGBB 4ONFH 4L9LC 3BUYA 1NAKH 2KQMA 4W6WB 3C6LB 3T0EB 2VOTA 1J8KA 3VXPB 3P3YA 4EJ1C 4NRXA 4MNGB 1TZHA 3O6FA 4LDLB 1H15A 1R24A 5C0CB 3CPLA 4HK3N 1ZVSB 2KL6A 1HIMH 4G6AD 3LRHA 1FNFA 4FFWD 4QHMA 3JWNC 1GPOL 5JDSB 3VE0B 3SO3B 3AFLA 1D9KC 4ZFOB 2A6DA 4F9PC 1L7TL 4QTHB 3VRLE 3GB7A 4MB4A 3RIFK 3SPVA 3JTTA 3IDNB 3RP1A 4YPGA 3IJHA 3K7UA 5I1IL 5KVFL 3BPLB 4PR5B 1OAUL 4NZUH 1IGYA 3DROB 1U58B 3LEXB 4NKOA 1GZPA 4ONHA 4U2YA 5JQHC 1KCLA 3JVGA 2BVPB 1U8JB 2BXZA 5IVXA 5AZEL 1B3JA 4FS0A 5C0AD 3OHXA 4HW6A 1JCKA 4MA1B 1KCUL 1CFTB 1LO3L 2VXTH 5EZOL 4JFPA 4J2XA 1W0WA 2F5AH 2YUWA 1TPXC 3LRGA 4ZSOA 4JZJB 5KS9A 3WFBH 1WCBA 5BV7L 4MXVF 1N0XH 4DGYH 4XVSH 2APTA 3QDAA 4OCWL 1LO2H 2R8SH 1PFCA 4ZFGL 2G9HA 3RA7L 3MJ9L 3F12A 1MREL 1VPOH 5IB2B 1T2QL 1YYML 1C8PA 3OG6B 1FVEA 1Z3GH 1T89C 3U36B 1CL7I 1WICA 4P57B 5KW9L 5CEXA 5T1LA 3IETB 1A0QH 3QCTH 1PY4A 3ARGC 1MI5A 3LQMA 4MS8D 1MHHA 4OCXL 2FO4B 2O26U 5HGHA 2CIIA 3PDGA 1OT1A 4RSVA 2BVOA 1MHCB 1IEAA 3KLAB 5IBLC 4YFEA 4LSTH 3RWEA 2EXWC 2ERJB 3EOTH 3NCJL 3GSOA 4ZTPH 4WIQA 8FABB 4L9LA 4GMTH 2D0GA 3C5SB 2H8PA 3BH9A 3QT2A 1FFPA 4QRPD 4GBXB 4LVHB 6CGTA 4IIQB 5GHWH 1VGEH 3OKOB 2Z8SA 4J23A 1SY6A 3UP1A 3BD3A 2DQDH 3DUSB 4R3SB 4L3CB 5IV2B 1E4XH 5IF0B 5DD5L 5HDBF 2BY3A 5GZOC 5GSVA 3T4AA 2FO1A 3GMMA 3HE7D 4GMSH 3NH7H 2ZJSL 5IESL 4D9LH 4Z18A 2CIKA 3O4LE 1BD2D 3ZDZE 4NUJB 3VFRA 5M95B 2JKXA 3DGGB 4F9PA 4PRPE 4PJAB 3U2SA 1FAIH 1AD9A 5HYJD 1F97A 5IMKB 4JGJA 5F1NA 1YDPA 3DHJA 3F7YB 4R6UA 1KJMB 2XKNA 1L9NA 4QRRE 1P7HL 1MVUA 1EO8H 4XPBH 3DVFA 3SGKC 3WYRA 2AJSL 4G6MH 4FXGB 4H1LA 3WLWC 4PJ5A 2YK1L 5DQJA 2Q8AL 4C59B 2MQ3A 3L5WB 2NY2D 2D7MA 2H41A 5E0QA 1RD6A 1HH9A 3REWB 3EO9H 4PG9B 4U6XA 4Y16B 4OM0L 1FV1A 2NXZD 4HXBL 2EKJA 2Q3AA 2NY0D 3PP3H 4G6KH 2QADD 2OL3B 4HBQA 4OZGF 3VMOA 3LV3A 3ZL4H 1B90A 3D87B 5F8RC 2ICWJ 1NCWL 4MB5A 1KPUA 1PW3A 1FBIH 2EDYA 4LLVA 4GKOA 1ZLUH 2IPKB 5A2JH 2AEQL 1F4XH 5DK2A 1KN4L 2Y7QB 5FK9B 4MJIA 2BCKA 1ZSDB 2P47B 5FECA 3IDJA 1N59B 3GJEB 1QFWH 5FCUH 1HE7A 1T3FA 3MFFA 3X11B 2IAMA 5JNYB 3TVMB 3MNVB 1MFEL 1NJ9A 3WNNA 5HHPA 4HCRH 5DD6A 4HAGA 4IJ3C 4WRLA 4ZPTB 1TENA 4JN1L 1MWAB 4UT6L 3SDAA 1S7VB 4N1CA 2A2QT 4HBCH 5JLZA 4OLWH 3MODL 4HMDA 5HGDA 3QI9A 5ICZB 2YEZA 1CDBA 4X9HA 1EEQA 4A6YH 3AY4A 1WWWX 3F65A 4XP9L 1ND0A 1S7XB 3QEQA 3THMH 3V8CA 4NPYB 3O9WD 1TQCC 5C2UB 1FLTX 3GBMH 2VXQL 3L3OA 1DLHA 3TT1H 1X5GA 1MFNA 4Y19B 1Y0LB 3W82A 5HYEA 1F8TL 1HXMB 2DJ4A 2R0KL 3GHBL 4UTBL 2EDJA 1KG0A 3BUYB 3MV9D 4ODHL 4Y8DC 3MV8E 5D4QA 3OAUH 3T0VA 4U6TA 4YLQT 1WFOA 1V3MA 4K9EL 2PO6D 5DD3L 4XRCA 1I1RA 1OM3L 5JA8B 4PP1D 2MJWA 4KJQC 5D7JC 5L9DL 3O6FB 1DBAH 5E5RB 4PGZA 3GHEL 1H15B 1R24B 3IXTA 2IH1B 3CPLB 5CILL 2GITA 4M1DH 5GGQL 1Q9KA 3SGKA 4QHMB 5E08L 1S7TA 1AR1D 2V9QA 4Z8FH 3V52L 2AW2A 2YD5A 2A6DB 2HKFL 3Q1SH 4O5LL 3GB7B 1TJIH 1G7HA 3JTTB 4U4BA 4YPGB 4NQDA 4BSWA 2AP2A 2OMBA 3IJHB 1UADC 1BOGA 3QHTC 3S3PA 1R3JA 3RWIA 2XTJE 2C4FT 3ME0A 5ENWA 3P4LA 1MFBH 1IGYB 3NIDE 4GAJL 4F37F 3SQOH 3VXQA 1V3JA 5HVHC 5CLWA 4WHYG 4NKOB 1GZPB 1I3VA 1RZKH 4JO4L 3M17A 1TFHA 5L8JB 2VDRH 5F9DC 1FORL 4LP4A 1SBSL 1T7XA 4XNYL 5IVXB 1IAOA 3OJDA 4NT6A 3UJJH 1NC2A 1I3GL 3OHXB 4ZO9A 3QCVL 1IZKA 1NCTA 3HC0A 4JFPB 1DQLL 1W0WB 4PRPD 3SEPA 1CBVL 3KNBA 1MCOL 1J1XH 4ZSOB 3DARA 5KS9B 1WCBB 3BKCH 1MIML 4OI8A 2A0LD 4OFPA 1BGXL 4J1UB 4H8WH 4PJBE 3VFVA 5SV3A 5DO2D 3CCHA 2G9HB 1R3KA 2FX7H 3CH1B 3W2DL 4FA8A 3SBWA 3KG5A 1UKTA 4LLWB 5EA0L 4D3CL 5F96L 1T20A 3BUTA 1FVEB 4ODWA 3EFDL 3BIKA 5I9QC 3OB8A 5CEXB 5T1LB 2Z31A 4E41D 2JK5A 5F93C 2AV1A 4WI8A 1MI5B 1JGEB 1MHHB 1ZHBA 4KI5E 5HGHB 2CIIB 4PJXF 2OJZH 1G0DA 2BVOB 4H25A 3QEUA 1ZT1A 4UI2A 1W0VA 1TZGL 3TBWA 5I73C 5EOCJ 1L7IL 2BHUA 3DX6A 4Y4FC 1JGVH 3FRUA 4L9LB 4RDQG 2H8PB 3BH9B 1FFPB 5IOPA 4E42A 1QG3A 4ODXA 4HFUL 3L95A 1D7FA 4TUKL 1G0YR 2KZ1B 4IRJA 1IAIH 4QXUL 1W72A 5GSVB 2MSPA 2Q1EA 3T4AB 3GMMB 5J12C 1U6AL 4GLRH 2CIKB 3AREA 2B39A 4KJWC 2X4UA 3VFRB 1I75A 1D9KB 5CCKH 3F58H 5LBSH 1Z2KA 4JHAH 3U2SB 5DTFA 1AHWC 3AC0A 4KWUA 1AD9B 3PNWA 2BVQA 5F1NB 1YDPB 3X12B 4CVZA 1JPFB 2XKNB 1MVUB 3HN3A 1EK3A 1PKQA 4H1LB 4PJ5B 5FUCE 4EIZC 5SWZE 3CFDA 3HB3D 2VR4A 3BP7A 5ETUA 4BZ2H 1HH9B 3OMZA 3QRGL 1I9JH 5BZDA 1LE5A 4U6XB 3KPRD 4MA8L 3DV6B 3ZE1F 2NY3D 4FQPA 4HIJA 4HWUA 3F6IA 3S8WA 3LV3B 4ZAKA 4HAFA 3LVEA 2DMKA 3PUCA 3ARBA 3WN5A 4AIXA 4KK6C 4DFHA 1KPUB 4D9RD 4UV7L 4LLVB 4WGWB 4G8EA 3W5NA 4P2RE 4ZTOL 1UYWL 4OT1H 1OAQL 5ALCH 1QBBA 4LEXL 5GRUL 1G6RB 5I1GL 5E2UL 3AGVA 3V0WH 4MJIB 2BCKB 3L5HA 3IDJB 1JJUA 3BP4B 5GRZA 5F88A 4OGAC 5DQ9A 1EBAA 3P4NA 1T3FB 1I1FA 3MFFB 5CS7A 5E2JA 4G80A 2DBLL 3MUGA 5HHPB 1NJ9B 4PLNC 5DD6B 1A6UH 3HHRB 4YR6B 2YPLA 5AG8A 4B0MM 5ALBL 4NQCB 3SDAB 5CEZD 3ZDXE 5FM5O 1RZJC 5I15H 5JLZB 3VG0L 3PQYB 2IGFL 4YNYA 5HGDB 2GAZA 3QI9B 5F7EH 4OB5L 2YEZB 5HPOA 2Q7NA 1MJJA 3OKNA 3MLZH 2CGRH 1BIHA 1ND0B 1KENH 4PJ7F 2ICCA 3QEQB 3PWUA 5T3XE 1V8HA 2PF6A 4KXZI 1IKFH 2OR8A 2B1HL 1D5IL 3L3OB 1DLHB 4S1DD 5CZXD 4NN5C 5D7IE 3RNQA 3SDXF 4YK4C 3LKSA 5TE6H 1KG0B 1ZWIA 3SY0A 4XBEL 5HSFA 3D48R 3JV4A 4DN4L 3QDMA 4Y4KC 4YHKL 4EI5A 3LPFA 3LN4B 4XRCB 3BKYH 5IFHH 5BRZA 4K94C 5D5MF 3UDWA 5E8PA 1IEBA 4DUVA 4ESKA 4Q9QL 4RMUA 3VA6A 1NSNL 5J1TC 2PTTA 3IXTB 1PG7W 4OBSA 2MCPL 4KMQA 1TVBA 2EICA 2GITB 4KI5D 1T04A 3B9KA 3BE1L 3QPXH 5F9AC 1JHKL 5FFLA 3AXLA 3JBG7 1YNKL 5IBUB 1MHEA 1G7HB 1MJUH 2PYEE 3BGFC 3QXTA 1CWVA 4NQDB 4BSWB 3U83A 1V3KA 4WI6A 1BOGB 5I6XB 1R3JB 3RWIB 1CR9L 5ENWB 3A67L 2HFTA 1XH3A 3VXQB 2FH8A 1K8IA 2OR9L 3NABL 1G9EA 1AJ7L 3CLFL 4TTGA 1JMZA 3M17B 3IDXH 1UM4H 1IAOB 3OJDB 4NT6B 1NC2B 5BOPA 3FFCB 3VG9C 3VXOA 4ELKA 3HC0B 4R90H 2W92A 4MQXC 3UJIH 1H5BA 1MFDL 3KNBB 4HIEA 5ELIA 1ULVA 3DETD 1JGUH 2NTFA 3MV01 4KZDH 3DV4A 4IJ3B 2NX5E 2BX5A 3VFVB 1K5NA 1O7SA 3MQIA 3PJSA 3CCHB 5FYLH 1U8KA 1R3KB 2W9EL 4C83A 2GJ6A 4P2OD 4JDTH 3V0VA 2J8UE 1FG9C 5IFAH 3FAWA 4WUKL 2XN9A 4HPYL 4ODWB 1NEZG 4XB8A 3BIKB 3SDYH 3NGBB 2Z31B 2D2OA 2JK5B 2AV1B 2ADJA 2E27L 4DKFL 1MIEH 4YHZH 1OTTD 2WUBL 5D7SL 2X1WL 1ZHBB 2EYSA 3PWPD 5A2IH 3FCTB 4Q0XH 3FB7A 5IHUH 4H25B 3E0GA 1ZT1B 3KAAA 3QEUB 1W0VB 3H9SA 3TBWB 3VRJA 5C7XH 4J3SA 4ZUWA 2FR4A 3DX6B 5K59E 3FRUB 4JHWL 4O58L 5E2TL 4EEEA 5IOPB 1EGJH 4E42B 4XHJC 2KH2B 2E9WA 1TTGA 4ODXB 4YGAB 3L95B 4LCCC 3RTQC 5D7JB 5IM7A 1BQSA 4IRJB 1TETH 5CBAA 1W72B 1JFQH 3QXVA 1MCJA 1LP9E 1CFBA 5KVGL 5CJQH 1AGEA 1QSED 1WLHA 1OAZL 3CC5A 1BX2A 4HUXB 3S97C 1U3YA 1D5XB 2X4UB 5H37H 2AJYL 3BW9A 1SEQL 2NY5H 5CEZL 4NNXA 4U6HA 5DTFB 5L7XH 2J4WH 2A74A 5KG9B 3PNWB 4NJ9L 1LDPH 3VGEA 3FKUS 1T83C 5T3XD 5EWIL 2CO6B 1MF2L 4XBGA 1OAYH 5HVHB 1PKQB 2DD8H 5I1KH 1WT5A 2WINA 3RRQA 3CFDB 3BP7B 2IBGA 5ETUB 4RGOL 4FQXA 4I18A 5BZDB 1LE5B 4OZGA 1NLBH 2P42B 4EN3A 3SJVA 3QAZB 5F89B 4ZAKB 4ERSH 3NMEA 3CSGA 3ARBB 3WN5B 1EV2E 4Y89A 3HG1D 5EBLA 1IC5H 3MO1A 1T1WB 1KXVC 4G8EB 2FD6L 2UWEE 1GIGL 1PSKL 3O6ML 2XG4A 4IRZL 4G6FB 4WTZA 5D93C 3ZKNC 3M1BA 3VDCA 5DQ9B 1UCBL 1ZXQA 1DR9A 1I1FB 3P4NB 2PYED 4G80B 5I9QB 2Y5TA 3MUGB 4WNQA 4U7SA 3EYUH 2V5YA 1C12A 2YPLB 3QZWA 1ITBB 2C3XA 5C07E 3NIFF 4LVNB 5FOJA 4TSCH 1QNZL 3NZHH 1CDUA 1OWWA 4OD2A 5CGTA 5CZVH 2OK0H 4YNYB 2XZQL 2OTWA 5I73B 2GAZB 4HUUA 5GJSL 2J6EA 1RVFL 3HZMA 2Z9TA 1MJJB 4OGXL 3OKNB 1RIVH 4UV4L 5JHDE 3QIUD 4OJFH 1VB9A 4NO5A 3PWUB 1C5DA 4TOYH 1NC4D 1J8HA 1TNMA 4OD3H 4LCCA 2DQTL 3IAGC 2DJSA 5L88L 2I24N 5BOZG 4N5ED 4GQ9H 5BQ7A 3RNQB 4YXLL 3LKSB 2DQCL 1FCCA 1ZWIB 4KTEL 3LQAC 2JIXA 4OV6F 2A9MH 2DLIA 3S35X 1CGSL 4WY7H 3JV4B 5TE7H 3GJFA 3VXUA 3QDMB 3QFDA 4TSBL 1E28A 4EI5B 2HKHL 1AHWB 4MCZB 5BRZB 5HYQA 5FUOH 3HZYA 4PLJD 5E8PB 2DQJL 5T1KA 2EDHA 4WWID 4DQOL 3ARFC 1T83A 1CLCA 2PTTB 2FEDC 1TVBB 3EFFA 2NY6B 4JFFD 3RZCC 5ANMA 4YBLC 3DX7A 1T04B 3B9KB 4NDMA 2D7NA 4K71C 3WXVH 5HJ3A 4ZFZA 3AXLB 3HFML 2HRPL 3LKPA 1MHEB 4Y2OA 4PG2C 1MOEA 4WTWA 2CH8A 2LTQB 4NC0B 3TN0A 4FOMA 1P7QD 4GRLD 3U7WH 2EDWA 1C5CH 3H42H 4NRZA 1CT8A 5I1DA 6FABL 1XH3B 3MSPA 5FGBC 1NAML 1K8IB 4MWFA 5HI4D 3BYYA 4GRWH 4LU5L 4WEMB 3W0WB 1K6QH 4M7KL 4YHLL 3C2AL 1XGYH 2RB8A 2W65A 4UT7L 1NCCL 3VXOB 4G8GA 3A6CL 1M7IA 3IF1A 5C0GA 4DGVH 4ELKB 3MNWA 1A02N 3EYQD 2NTFB 5ACZA 2L7UA 3I3EA 4LHUD 3DV4B 4X98A 3SGDI 3B5GA 1K5NB 3PJSB 2OMNA 1INEL 1MJ8L 2BNQE 4M7LH 3Q3GB 2GFBA 1U8KB 5EZIH 3K8LA 1HNFA 1KELH 4LARL 2GJ6B 4C83B 3ZDYE 4ZNEE 3V0VB 5T3XL 4OIIL 1A6WL 4XGZA 2XZAH 3N1MC 1FC2D 2XN9B 4YX2L 3W5MA 2F9BT 3HCVA 4RDQF 3NTCH 1DCLA 1ZHKA 2ADJB 2E6QA 5D70H 2X1QA 4F37K 2HN7A 3QIBC 2VKWA 3VGBA 2EYSB 3QJFA 3FB7B 4ZS6D 1ETZA 2DQIL 4NN5B 3FRPA 3RGVA 5E70A 5T5FL 2FR4B 4GXUM 4ZUWB 1GPOH 4JDVA 5FHAL 1QACA 3ARWA 3GMOA 5CINH 5EBGA 1IFHL 1HK6A 4TQEL 1L7TH 1AFVH 4Y4KB 1MRDH 3NCFB 1RK0B 3C08L 3TV3H 5IM7B 5CBAB 5KVFH 2HTLC 4Z7QE 5EZLA 4RFNC 3TGXA 1AGEB 3CC5B 4KROD 2AERT 1BX2B 3S35L 1PG7H 1X5KA 1BIIA 1U3ZA 4TNVF 3BW9B 2EDEA 4RMQA 5EO1A 5AZEH 1P6AB 1RUKH 4U6HB 3QG6B 3EW3B 1KCUH 1RUPL 2A74B 2VDOL 3FAXA 5EZOH 3TJHC 4FQJL 5JHDD