4LVHB

Insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
221
structure length
218
Chain Sequence
KLQQSGGGVVQPGGSLRLSCAASGFTFSDYDMSWIRQAPGKGLEWVSGILGGSERSYYRDSVKGRFTISRDNSRKTLYLQMNSLRAEDTAVYYCARHGSPGYTLYAWDYWGQGTMVTVSSASTKGPSVFPLAPSTSGATAALGCLVKDYFPEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKSCAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system
total genus 27
structure length 218
sequence length 221
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvhB02
3AU1B 1D3CA 2B7DT 3PL6C 3HTLX 4WU5B 1ED3B 7FABL 1X5YA 3CFIC 3Q6FB 1UB6B 1QG3A 4LARH 3HRZA 1NC2A 1W72A 4FS0A 5E94A 2D0GA 3KS0J 1OAYL 3HR5B 5F7UA 4LPUA 2ICWI 4UT9L 5KVMC 4ZUSB 3L3OA 3GM8A 1CLYL 3TPUA 3L7EB 1CLOL 3QRGH 5GS1A 3QFJD 3SE9L 1FHGA 2ESVD 3ULVE 1QA9B 2NY4D 2DKSA 3KPSD 3KXFD 4XP1H 4JN1H 3ULUC 3DVFA 4PRDA 4GQ9H 2K9UA 4PJIE 1GGIH 5JW3L 2I5YL 4KVCL 5DT1L 3UYPA 2IADA 5E4EB 3ZLQC 5CIPH 1A1MA 3V0VA 5LCVH 2Q76A 4DKFL 1QRND 3HZKB 4OLWL 1TNNA 1MEXL 3C2AL 5J13B 1OARL 1R0AH 4F7CB 3TCLA 3UTSD 2D4DA 2VR5A 3PQYD 4I18B 1WAAF 1UZ8A 2AJZA 4NC1C 5EBLB 3GUTB 3CFCL 3VXNB 1XEDA 2DQIL 4KTDL 5E6IB 4NRZA 1GPOH 3QG6B 5FA4A 4YWGH 3C8KB 3IKCB 1IFHH 1IM3B 1IILE 4ZD3H 2QQKH 4GLRH 3VI3F 3PHOA 3MRNA 4N0YH 1YPZF 3LKOA 1MQKL 3VFSA 5C0CB 1RUMH 3EOAA 1XGRB 3R1GL 2DYPB 3PP3K 5C09B 5MP6L 2B4CC 3KPRB 3B9KA 5I17A 1YUHA 1U58B 2XA3A 4JY4A 4DVRL 4DZ8A 3OAUL 2XPGB 3KPLA 2OMBA 4KJPD 4WW2F 3QT2A 2A6JB 3IU4H 4GH7B 4M6OH 2H26A 2B1AL 4HULB 1ONQA 3LDBC 5DRXA 2MQ3A 4X7SH 5DJ6A 3VD3A 3O3AB 5E8EA 1HHJA 4Z7QF 2N4IA 4HUUA 4CN1A 2MHAB 4OZGB 5JDSA 2HVKA 2XWTA 1FO0H 5HD8D 3T4AB 4P4KD 3C2SA 4NHUB 3BGMB 5EUKB 4C55A 1FLTX 4EN3C 4IJ3C 3QUYB 2P8PA 4X9FA 5EZLB 5IBTL 4AJ0A 4CMMB 3HR6A 2IANB 1NBYB 4N5UA 3MSPA 5I66A 3QUXC 3KPNB 4C4KO 4FFZH 1UB5A 3LN4B 3S5LB 3ARFB 3WO4B 3H9SE 3IB4A 2LV4A 5C8JB 1CXEA 2FSEB 1BX2A 4DN4H 4GAJH 1OB1B 3MNZB 5F70A 5EC1A 3WJJC 4AH2B 4HFUH 3QDMD 1PSKH 3OXRA 5F3HB 4D0BB 3IYLW 1ODAA 4LEOA 2XNAB 3OV6A 5CJQL 5KJRH 5KZCD 2XN9E 5DLML 1K85A 3A67L 4GQPH 2L4OA 3LKRA 2IQAA 5EZJA 3GHEH 4K3JL 3SO3B 1K4DA 3W2DL 4R4FH 4YFEA 1LO0H 5KSUA 5D2LA 5LAXB 4PJBB 3UBXA 3C6SA 4HIHB 3F5WA 3THMH 3ZYZA 1GIGL 4W4OA 1HEZB 1ZA3A 3BN3B 3FZUC 4OBRA 1RAMA 3TJHC 1HWGB 2ICEB 3I84A 1R5VA 2H1PH 3CVHA 4NM8L 3P9MB 3G5XB 1RZJL 1I8LC 2W9EH 1OQXA 3QG7H 3EJYD 3IU3B 1DQDH 3HE6D 1XCTB 3L95B 1U95A 2QSCH 2P48B 1N0XH 4MZ2A 3D3VB 1AR2A 1INQA 4MCZA 2XIDA 3U4AA 2OQJB 4P0DA 3RIFF 4GW4A 5DC9B 2V5RA 1TZHB 5E4EC 5I15L 4D9QE 3I75A 4M61B 3UJTL 5J06A 5DGRA 4PREA 1ZLVH 3FRPG 4AG4H 5LBSH 2XWJA 1M4KA 1YMHA 5MEPA 3ZDZF 2RFXB 3VU2A 1R3KB 2A9MH 4OD1H 1RZ7H 3EJZC 4HWNA 5J13C 1P7HL 4IRSB 3S6CA 3BAEL 5JOFA 4NFBA 3UC0L 4I18C 5HHQB 3VG0H 1UWEL 2IH1A 3MYJB 4HAGA 2FECI 2NXZC 1LD9A 4PJEB 4HAFA 3CSPA 3V6FB 4AIXA 4AEHL 2DQFB 1A6PA 3DX9B 43CAA 3PF2A 3I6GA 5I1CL 4ELME 5DMIL 1BZ7A 4PJ5A 4TNWK 4YHIB 3BD4A 3VFGH 4CL7A 1PAMA 5IVXF 1SYSB 1B90A 1PKOA 1S9VA 4L9DA 1J5OL 1RJYB 2AXFB 1U93A 1RK0A 5DA0B 4QWWD 4HCRL 4RQQB 5FYJD 3FB7A 2V2XA 3ABZA 3B8YA 3WFDH 3O6FB 5H35A 1OAZL 4CMHB 2HH0L 3HC4H 3QJHA 1FZJB 2EDHA 2C3VB 4M48H 3V6ZB 5DHYA 2H3NA 3BXNB 1KFAL 1A3LL 3MV8A 3FB6B 4CJ0A 5JORB 4K7PX 1AI1L 3RWGA 4RAVA 1S7UB 1ZLVK 2BOBB 4IDJL 1LILA 4BSWB 5JA9A 2BJMH 4PRPD 3BKJL 3MO1A 1E4WL 2BX5A 2XZCL 4M5ZL 2H41A 3RWJA 4KJWC 1K5NB 1ZA6B 1FDLL 2Z31D 5T3ZD 1FZMB 2FNBA 2KKQA 1FNSL 2HRLA 4RX4D 4PFEA 3ARFC 2NXYD 3WO4C 1MY5A 3U79A 1IL1B 1MVUA 2AJXH 3EYUH 5DO2D 3M1BA 3PP4H 5AZ2H 4XPTL 1DDHA 3QCUL 5ALBH 5I71B 3BJ91 4QRSA 3H7LA 3KYOA 1X5JA 2J5LB 4UQ3A 4JM4H 1QQDA 4I3SH 2VDQH 1G0DA 4EZMA 3OKYA 3PGFL 1VFBA 3K8KA 4G8GA 5KN5A 5L2JA 3IKKA 2JELL 4WCYL 4IOFD 4GAGH 5EN2A 4YBHA 4G80A 5FYJL 3VD4A 1QSED 2W9DL 12E8L 3SE3A 4QRPA 3X12A 4LPYA 3LQZA 4LHJB 3MRRB 1X44A 2QV2A 2YPLB 1ORSB 4J3WA 3DURB 4QXUH 4O5LL 3DJ9A 2XZQH 3UDWA 2VAAA 4G6ML 4NZTL 1IQWH 1RUPH 1NC2B 2X4RA 4A2LA 1WFOA 4ODBD 4F9PC 1A7BA 1G9MH 2OTPA 2NY7H 5IESH 5C0AB 1Q0YH 4LLMA 2ZZUT 2EYSB 5T3ZL 3GO1L 5JIPA 3TPUB 2EH8H 3DXAE 1XR9B 3E6FB 1D7FA 1I3UA 4JHWH 2OJEA 3I9GL 2UZIL 5J1SC 1R5WB 4FQQA 1CTOA 4PRDB 1S5HA 4IRSC 1WZ1H 3MRFB 3U2SA 1CGWA 4I77H 2DAVA 2IADB 3MGOA 5GRVL 2D03L 1A1MB 1BIIB 2FJHA 3TA3A 2F19L 1H0DB 1G6RL 3AS2A 1YYML 1RIUH 4WFEE 4PJFB 4BYHA 3QCVH 3MGAA 3W0WE 1SJHA 4G9DB 4QY8B 3C08L 5IHBA 1UZ8B 2AJZB 2H32H 4PUBH 3IFLL 3RVXD 3SDXB 1IGCH 5CINH 1FNEA 5D72L 3TIDA 1FPTH 2ZSWA 3EHBC 2QSTA 4M02A 4NRZB 4PGCA 3UROR 4KK9D 5JXEA 2ZOKA 3V9FA 1MRFH 4KKCD 5J9PA 5JR1L 4UAOB 4Z77B 3KR3H 4H1LH 4UDUB 3PHOB 3MRNB 2FD6H 3LKOB 2OK0L 1B0RA 1AGEA 2MOVA 3EOAB 1BVLA 2ZUUA 1BM3H 3UO1H 3IFNH 2GT9A 4M5YH 4CMHC 4PRHB 4UZGA 4NNXA 5I17B 4JY4B 4DZ8B 1BD2D 3DROA 3KPLB 4Z7NF 3O0RH 1JV5B 3MGTA 2X1OA 2DLTA 5JW4R 1MHPH 4KAQL 4XNYL 1ONQB 2BHYA 1LEKA 3WS3A 4EI5B 2V2TA 5DJ6B 2D7NA 5E8EB 4TQEL 3FHQA 4KUCF 5MERA 1T7VA 1FAIH 2VXUH 1NFDB 4F80A 3GMNA 4AYFA 1XF4A 1EAPA 5JDSB 3FN0L 3GMMB 3ARRA 2X89D 4PJAA 4XX1G 4XPAH 3MLWH 3T0BA 3DUUA 3RGVD 5I71C 2F8VA 3V5DB 5I1IH 2J5LC 4HIIA 5EBMA 1OGAD 4C56A 3RIFK 2FYYA 2K3TA 1S3KH 1UB5B 5SWSD 2XZAH 3QDAA 3C5ZA 2I9TA 1DANT 5C71A 3NOIA 1VPOL 3MBXL 3E2HB 1BX2B 5J11B 3NZHH 5D7KE 1JVKA 4XB8A 4HXBL 4BUHA 5F1OB 4TUKH 1I3RA 3QFJA 1SJVA 1KOAA 3OXRB 4LEOB 4O4YH 4MAYA 4HIEA 4GSDH 3SKMB 1WIUA 3KVQA 3KPSA 3V4PH 5I1GH 2IQAB 2W60A 3RAJL 5EZJB 1A3RL 1FNHA 1K4DB 1SMAA 4RZCA 5D2LB 5IMKA 3UBXB 3F5WB 5KSBF 3UJIH 5IHLB 4P9HL 5F9OH 1ZA3B 2EE6A 1BBJA 4KKBD 5EOTA 3UTTD 3N1MC 3JV4A 3OBAA 4AQOA 1LE9A 4IIQC 1QRNA 3OJVC 4ZS7L 3I6LE 4FN0A 5DEFA 3CVHB 1EA9C 3FB8A 5EU3A 5DRNA 3UTSA 3T2NL 3BE1H 1F3DH 1MPAL 4MCZB 4NQED 5F8RC 1CD1A 3PGDA 4NFDA 2BVQA 4GW4B 1UZ6E 5TE4H 1KYOJ 4LSTL 4X6DB 2R2HB 2UWEA 4ZNEE 2VDNL 4S1SH 1PY9A 4PREB 2MCG1 5FFLA 3LRSB 5E2VL 2XWJB 5MEPB 1F97A 3GBMH 5TDOA 2CDEA 4AY0A 1LO5A 4MSWB 1S7XA 2X1XR 5K9OA 3SKJL 4RGOL 4UILH 5JOFB 4YBQD 1QYGH 1JN6B 4U0QB 4Z7UE 4XB7A 2BNRA 3N0PB 1MCIA 3MCKB 4GRWB 5GHWH 2J1KA 4AMKH 1FG2B 1DFBH 1ROWA 1LD9B 1HSBA 2R0LL 3S34L 5JUEH 1QBMH 4FFYL 3BEWA 3I6GB 4UTAH 3T0EA 4V1DB 2C4FT 2AEQL 2PNDA 1BZ7B 5F9DC 4PJ5B 3RIAF 1L0XA 4JFDD 3GEWB 4UAOC 3OKOB 5F96L 5IFJA 5IFHL 1KIRA 1UH4A 1NL0H 2ICES 3HNTH 2BY0A 5EZIL 1JHLL 1GGBH 4XC3L 5L2KB 4ALAH 1N5YL 4P4KA 3P9LB 4G6FB 4RFEA 5FM5O 5IJVA 2E5EA 4MD5B 2VDPL 3F12B 1EGJH 1T3FB 5FKAA 1RK0B 2P44B 3HB3C 4QHNA 3AS3A 1JHTA 3FB7B 2V2XB 1A6AB 5D7IA 4OBSA 4PJGB 5I8OL 4EI5C 4X9BA 3VFRA 4I48B 4XP6H 2H3NB 4JAMB 3QDMA 3MV8B 4XC1H 5J6HB 5TPWL 2QHRL 3RWGB 4XXCC 4HUWA 1RZFL 3RUGE 4JKPL 5H2BB 1PBYA 2HJKA 2AQ2A 1TPXB 4OV6F 1E4XH 2R2CA 3GBNL 3RWJB 25C8H 2CRIA 4R97B 5CWSB 4MMXC 5F7WC 1IC5H 5GJSL 4U6YA 4JG0H 4N8CH 1MVUB 4R96A 1MFDL 5J11C 1DDHB 3E0GA 1HHHB 4F7TA 5IBLD 4QRSB 1A6VH 2Q7YB 5DD1H 2FLRT 4UQ3B 1QQDB 5DF0A 1KJMA 3HE6A 5JIKA 1VFBB 4G8GB 5KN5B 5TDNA 3CGTA 2W91A 5L2JB 3LEYL 2H2PD 2J7LA 2X41A 3TBWB 5EN2B 4HUVA 3BZFA 1XGQA 1IKFH 1NGZB 5C3LD 3ZO0A 4W4OC 5D7LA 1JK8A 4XXDB 1OY3B 5ETUA 1J11A 3ETBF 1L7TL 4EUPH 2EDYA 4ZPTB 3IXAB 3FFDA 3QEQB 3OHXA 1G84A 3RJQB 2R4RH 2FX9L 2XA8H 3UAJD 1L7IL 2VAAB 2NLJB 3JWOC 3S5LG 1XFPA 3QQ9C 2LFGA 5IB3A 4ONGH 2X4RB 4PV9B 2X42A 2DRUA 5TDPB 2JB5L 3P0YH 1T0MA 2AK1H 4LLMB 5I8KH 4IMLB 4HFWA 4WI8A 4D3CL 3VFTB 1AKJD 2PW2A 4JO1H 4HW6A 3CNKA 2AEWA 1T4KA 1I3GL 4WWKA 1N2RA 3NPZB 3GFUA 1VGKB 3T3PE 3D1MC 1GOFA 4L3ED 1HDMB 4FQQB 4PJDF 4EQ2A 5C6TL 3R06B 5I0DA 3LS5H 4WNQA 2NNAB 3CIQA 3F6LA 3U2SB 1JE6A 3MGOB 3NFSH 2JCCF 4LOUD 4PJCF 2FJHB 5CP7A 5EB9A 2D7TH 3OZ9L 3TA3B 1I7TA 8CGTA 3B5GA 4MS8C 3CVIH 4HGKC 3ARGD 3BSZL 3C6LD 4K8RD 5IFAL 3ARSA 2C3XA 4U1NA 3VMOA 1UKQA 4U6VL 1FFNA 1U8JB 1FNEB 5DFWH 3TIDB 1ES0A 1HSAA 4N90D 5I2IA 1DQLL 4P5MB 1C5CL 4G9FD 4PRPA 2ZOKB 1JTOA 4ZTPL 1A4JA 5J9PB 3TYFA 1MJUL 1OD9A 2XRAH 5D6DA 1C1EL 1B0RB 5DJ0A 1BVLB 3QNXA 1EPFA 4BZ2L 5KVFH 4NNXB 3BT2H 1X4ZA 3SY0A 3NCBB 1F58L 5TQ2L 1CR9H 1CF8L 2NY3B 4RMVA 3KPPA 4I13B 4AK1A 4P5KA 1NCDL 4AIZA 3ULUF 4MDJA 4JM2D 1UQSB 1YEKH 2VZOA 4U1GB 4UNTA 1CE1L 3WS3B 2V2TB 4R97C 5MERB 3P0VL 4D0CB 2ZUSA 1QFUH 1FH5H 1J18A 3GMNB 4MCYA 4UMGA 4BJLA 1BQLH 1XF4B 1G6RA 4Q9CA 5LGHH 2BVEA 4O02L 3FQNA 4M43H 1G1YA 4BFBD 3DUUB 2V7HB 4H8WH 2P5WD 3U7WL 4HXAL 4N0FA 1YC8A 4Y1AE 2CMRH 1QFOA 4C57C 2GJ6D 3DWTA 3IRZA 3U30C 4HIIB 2LVCA 5D71L 1CDJA 5EBMB 3KLHD 2F5AH 4C56B 1BAFH 4ODVL 2I9TB 3C5ZB 4WTZA 1R3IH 4Y2DD 4HKXA 1NMAH 4D0DA 4ZUVA 3SE4C 3EO9L 1OTTC 3BJLA 4DN3L 3L5JA 1I7ZA 4HK0A 5CEXA 1YY9C 4PD4K 5J56B 5A3ID 1RK1A 4XVJH 2ITCB 3D87B 4JRYE 4OFKA 2R0ZL 3WD5H 2Y5EA 4YDIH 2W60B 4ODWB 4RZCB 2VLKE 3UTOA 3PWPE 5IMKB 4WFGE 4X7TA 1HZHL 3RIAK 3ARYA 2A6DA 3O6MH 5GQBA 5EOTB 5C0BD 3NACL 3JV4B 3TT1H 2Y36H 5ELIA 3FAWA 1LE9B 5D8JL 3DVGA 2HKHH 4Z7VE 5DEFB 2HMIC 2AK4D 4RDQF 1JJUA 3FB8B 1F4WL 5B22A 4KUZH 5DRNB 5HHXL 1BFSA 3L3HA 1IC4L 4HJJL 4PB0H 5DK2B 2ARJQ 3IDXH 1QHOA 2VB5A 4FQPA 5D2NC 1I8KA 5F1NA 1I8IA 1MCWM 3LZFL 4JFZH 1G6VK 4XCEA 4NQCD 1MFCL 3PGDB 4AEIH 3G6JE 3GI9H 4HD9A 4XVSL 2AKRB 3RVTD 2EZ0C 2UWEB 1FV1A 2APXA 3D0LB 4Y19D 5T3XH 4HT1L 2RR3A 3V8OA 3CD4A 5TDOB 2CDEB 2FGWH 1VA9A 2PW1A 1S7XB 4GOSA 1FN4A 2CRMA 3E1F1 3REWB 2BNRB 3B2VH 1KTKE 3S88H 1HSBB 1T1ZA 3CFDA 4W6XB 3K4DA 1EJOH 3BEWB 3T0EB 1I1YB 1KPRA 1OD7A 5IFJB 2IFFL 5CLWA 1G7HA 4GKNA 4WFHD 4R90H 4DW2H 1TMCB 5F7LB 5DDHA 3QRGL 3HLAA 3ULVC 2X89A 1QKZH 1KGCE 3K81A 1JWSA 4XP1L 4RFEB 3HC0A 5F7HA 4IRZH 3FOMB 2DS4A 5SWZE 4LL9A 1GGIL 2VLRE 1NJ9B 5FKAB 3KHQA 5IF0A 1CDYA 4QHNB 1PKQA 1JHTB 4XP4H 4BELD 4MXVE 4U1GC 5SWSA 3BZEA 5LCVL 2WWKT 3W9DA 4FQCH 3VCLA 3ALPA 1JRHI 4WI6A 5IMMA 3ROOA 3S4SG 1ZLSH 2VZ1A 1FYTA 3GB7A 3VGDA 4W81A 3VGAC 3ARBA 2C7UA 3M8OH 4NNPH 4PBVC 4PGZA 5FGCE 1IAIL 4HLZG 2HVJA 3CC5A 1GPOL 1A3QA 5ESQB 3BH9B 5BZDA 3MLXH 4XZUA 1IFHL 4ZD3L 3NTCH 1PX3A 1J05A 3VRLF 5GRZA 3BZDA 1M71A 4N0YL 4ORZC 3QXAB 5HYJD 3RZCC 2HTKC 3ULUH 1RUML 4P5TA 2CR6A 3IGAA 4X8XA 5ESVA 4Y8AA 5H94A 4X6CA 4N0UE 2R1WB 4PJXA 4FQHA 5JPNA 5TDNB 1DL7H 4OIIH 3IU4L 1FL6A 1G0YR 3RY4A 4WI5A 1T03L 2X4SB 1NEZA 5BJTA 4X7SL 3IFOB 2IAMB 5D7LB 1JK8B 5DMYA 5JHDD 5IM7B 1V3KA 4RMSA 5E08H 2V5YA 5GS2H 3SDAA 1Q9OA 3OHXB 4YFLI 1GGCL 1AXIB 4CRPA 4OZGF 4WUKH 3L3KA 2GKIA 4GG8A 2Z35A 5DHVA 4HH8A 4HJ0C 5EU6E 1MJ7H 3GHBH 5C2UB 1CFNB 2ADGB 3SGJC 4FFZL 5I1KH 2B4CH 2WK2A 4HFWB 3ALWA 1X5KA 3QDGA 4DN4L 4JFDA 4GAJL 4X5WA 1A5FH 1N8ZB 1YEHL 3L1OL 5FHBH 2GK0B 3MLRH 2QHLA 1GH7A 4FXLA 4WWKB 4ZQKA 2OCFD 3LKQB 5DJ8B 1PSKL 3QDJE 5KJRL 1P4LA 1MCWW 3QO0B 3V5HA 4WNQB 2APWA 4OCWH 3GHEL 3V6OA 3MJ9A 4R4FL 4TOYL 3CPLA 1LO0L 4G3YH 4JHZA 4GFTB 2ZSVA 2R56H 1P84K 2BNUA 4YHNA 4OGAD 5DMJB 4E41A 4PJBF 15C8H 1VFUA 2H1PL 4M7LT 1QBLL 1YEFH 2JLLA 4BKLA 5GRWA 2CKBA 5D7JA 2MCPH 2W9EL 4UT7H 3QG7L 3BPNB 2AABH 1DQDL 3LD8C 1IGYB 2QSCL 1HSAB 1N0XL 3B5HA 5K33A 5I2IB 1CL7H 2JIXD 4OT1H 3QAZB 4FZEH 5IT2H 5J12B 5JTWA 4JZJC 4ZOEA 4ZFFB 2BVOA 3DXAB 5FO8B 3WE6A 3BMWA 1KCRH 4AG4L 5DC0A 2PO6A 5LBSL 4KZDH 5LVEA 3QI9C 3QNXB 3QWRD 4DCQA 5AUMA 5SX4H 3CX5K 2E7CA 4KI5E 2HTLC 4U49A 2DQEH 2A9ML 1KLGA 4PJ7E 1RZ7L 5I1JH 4LBEA 5EIIA 3L3DA 3SY0B 3QXUA 3KPPB 4JFFD 4AIZB 3VG0L 1CICD 4FMKA 1OAKL 4YIQB 3MMEA 1ZWIA 1U8QB 1G7MA 4DGIH 4PJEF 5FYJU 3RKPA 2H9GA 2NY6B 2HLAB 3ZL4L 1WC7B 4Y88A 2VERN 3O8XA 4MCYB 3VFGL 1AC6A 4PJ8A 5A16A 1ZEAH 5TQ0H 1D9KD 3FQNB 5DD3H 3QQ4B 3CJJA 1EVUA 1EZVY 5F71A 4PS4H 4IRJD 2ITDA 1ORQA 3WFDL 5DR5H 3S3SA 1ZE3C 3OAZK 4F2MA 4RGMB 4P2QD 1G7JA 1GHFL 2IAMC 1AO7D 4D0DB 3HC4L 5CJOH 1T1WA 4ZUVB 1J10A 3QHFH 1BVZA 3V7MA 3B4NA 2X4TA 5CEXB 4EI6A 1RK1B 3DYMA 3MV7D 1PD6A 2ESVE 1FFQA 4L3EA 4JGUA 5B39A 1NC4B 1MJ8L 3D2UA 2BJML 2VQTA 2P5EE 3KXFE 1FFOA 2VXVH 4ZYKB 3MLUH 4RWHA 1QUNA 3KYKH 3VH8A 1KELH 4EVNA 3V4VH 1B0GB 4K9EC 5ANMA 5HGDA 1S78D 3QXTA 4PYGA 4EKXA 2E7MA 3ILPA 5GZOC 2AJXL 4FG6D 5AZ2L 1EO8H 2EDQA 3ARGA 1V3JA 3L3HB 4Y1AA 2DQCL 3BRDA 4JM4L 2VDQL 3PQYE 2DICA 3QEGH 4HWBH 3GSXA 1I8KB 3ISWA 5F1NB 1CVSC 5FDWB 2OS7A 1NLDH 1TVHB 4NRXA 4XCEB 2HA1A 3SDDD 4BFIA 1MQ8A 4GAGL 3ARTA 3D0VA 3MRQB 1FV1B 3DHMA 3LCYA 4LLYA 2VABB 4Q0XH 1NDGA 3HA0A 2PW1B 4RFOH 3PWVB 2AS5M 1FN4B 4QXUL 4FQ2L 2XZQL 5TH2B 1ZT7A 1UWGL 4LCUA 5GSVB 3DETD 1O7VA 3BPNC 2ZCLL 3HFMH 1IQWL 1L6ZA 1RUPL 1RFDH 3CFDB 4JPIA 4JM2A 5T1DH 1UGNA 2YRPA 4JJHA 1G9ML 4CVUA 1TCMA 5J12C 2NY7L 5IESL 1KPRB 1Q0YL 4CVZA 2AEIT 3IETB 4GKNB 5IEKA 4Z7VA 1QSFD 5DDHB 4MQSB 2EH8L 4QXTA 1LP9E 2A6IA 4R3SB 1I9RH 4U2YA 1N3NB 3CU7A 4JHWL 4HMEA 4NO2B 2HG5A 3O81A 4ESKA 2NY1C 5FUCE 4YO0A 2P5WA 3IRPX 3QSKB 1WZ1L 1H8OA 3RY6C 3FFCA 4U6XA 3FQWA 4Y5VA 4I77L 1F42A 3MRDA 2LTQC 3W11D 3MLTA 1OSPH 3WNLA 3PWJA 5ACMA 4OZIA 2MKWA 2QQLH 2B2XL 3VCLB 2PCPB 2NY6C 4X7FC 1RIUL 4LDEB 3ROOB 4PGEA 2WBJA 3QCVL 3EYSH 1FYTB 3MLZH 3BOVA 4LSPH 1GC1C 1JNLH 4PUBL 3ARBB 3BI9X 4PJFF 1IGCL 5CINL 1XGPA 1FPTL 2HVJB 3CC5B 3MZTA 4OLXH 1KTLB 5BZDB 5I8CA 4HC1H 3SDXF 3JTSA 2W9LA 1MRFL 1H15A 4XBEH 3S35X 1J05B 3UJJH 2FD6L 9CGTA 5EBGA 5C0BA 4JFOB 4RGMC 4LNVA 2DWDB 4P5TB 1BM3L 3IFNL 1MIMH 3IGAB 4MNGA 5ESVB 4KKAC 4PJXB 2GEEA 4N5EC 1PJ9A 3WN5C 1R5IA 4L9LB 1QLFA 1VERA 4MJ2A 1UA6L 4NM4L 3WNPA 1MHPL 1NEZB 4FQXB 3BDXA 4GRMB 4NQCA 5C1MB 3MRCB 5CIPA 1FAIL 1K8DA 1JGEB 1RU9H 4D9RE 1FJ1A 3SDAB 1Q9OB 4Y19A 1RMFH 2EKSA 1NFDF 2UYLA 5JW5A 5KSAB 4OCRH 3RUGB 3L3KB 2JJTC 4JANA 1CE6A 4GG8B 4QYOA 3GSVA 4NQUA 1N64H 5I1IL 3TVMD 2ZKHL 1RURL 3ZKXB 3DTXA 4YDJB 5DUPH 1IBGH 1D5XB 3CSGA 2XZAL 3NH7H 5DVNA 2QKIA 4J1UA 5CHNA 3IAGC 1IRAY 2YK1H 3QDGB 3VFWA 3NZHL 4LU5H 4GBXA 3VXTA 3T1WA 4TUKL 4GG6E 4LLVA 4G43A 2V2WA 4O4YL 3OSKA 1Z0NA 4GSDL 3V4PL 3OKMA 4HMDA 3BDBA 1MI5E 2W65A 3CPLB 5MEOB 2BNUB 5ICYB 3D48R 4LHQB 5F9OL 5L8KB 3JSSA 4E41B 5D2LF 4NOBA 3VMNA 4Y5XA 5F7MC 1ZLUH 4ODXB 2DM4A 3VWKD 4KV5E 5BVJB 2CKBB 5D7JB 4FQIH 2M8XA 5IWLA 3BE1L 2VDLH 1BZQK 3ZYOA 3TIEB 3C09B 3C8DA 5CD5C 2V5SA 3DRQA 1MAMH 4GS7B 4IOIA 1KBGH 3RJDA 3EOBB 4ZUUA 2QADB 2B5IB 3Q0HA 4XPHL 3IT8D 5HYIA 4UV4H 5GRXG 5L9DH 4EDWL 1NUDA 3P73B 4YXLH 3PABA 3K74B 5TE4L 1U8NB 2BVOB 4JB9H 3O9WB 3WE6B 4S1SL 2F9BT 5IGXL 5T3ZE 4NO0A 5ICXB 5HYJA 3GBML 5AUMB 2NPLX 1XF1A 4X7CC 4X6DF 2C26A 4TULH 4LCCB 5B3JF 1ZMYA 1BOYA 2CK2A 2E6JA 1IGIH 2EH7H 1QYGL 4C59B 2F53D 5GHWL 3ARBC 4AMKL 2OP4H 5JUEL 2X9YA 1QBML 3LH2L 1G7MB 4UTAL 1ZT4A 4M4PA 3SKOA 2Z92B 1XGYH 4AIOA 5HDBF 1S5IH 2E7LC 2XY2A 3O8XB 1QSEE 4NUJB 5DVKA 1NL0L 5C0EA 5JHDA 3HNTL 4PJ8B 5A16B 2DI7A 3VFVB 1HOCA 4R8WH 1YNLH 2RHEA 1BEYL 1A47A 4P5TC 1GGBL 4LLDB 3WDIA 1DBAH 1L9MA 4ALAL 4KUCD 2WUCH 4QRUB 1ZLUK 3F7RA 3C60C 3MJ8B 4Q74A 3VI4F 1WF5A 2G5RA 4OCMC 4W68A 3TZVB 4O58H 5DURB 1J88A 3VW3H 3BPOB 4L9LC 1ORQB 3ARED 3L5HA 3BRGC 2V5TA 4J6RH 2ZNXA 3GNML 5IJKC 3DSFH 1X6LA 1HINL 4FQXC 1GSMA 1G7JB 2QQQA 1K6QH 5JDJA 4QOKD 4MJ6A 5DJYA 1T1WB 4MD0B 4QXGH 3MX0A 1F3DJ 4XP6L 2X4TB 4PJGF 3ZKNC 4EI6B 3SDAC 4L8DA 1WBXB 5KSAC 3D2UB 3MNWB 1ERNA 2ZJSH 5FXCH 2CLRA 2FCBA 25C8L 4Y89A 3WNKA 3ZKXC 2GK2A 4EVNB 5HGDB 1IC5L 1YMME 4JG0L 4N8CL 3ILPB 5HYSG 4LSVH 1I1AA 3UYRH 4Q9QL 2PXYD 5E8OB 1LE5B 4FXGA 3VWJD 1KIPA 3KPMB 1A6VL 4Y1AB 3U6RA 3WIFA 5DD1L 1MCJA 5ACLA 1BOGA 3GSXB 4KDWA 4OD2A 4UINL 2JIXA 1JMZA 2EXWC 4BFIB 5B38B 4R2GC 4U3CA 3VGFA 3QYCA 3GMQA 4ZS6C 1IKFL 4DUVA 1WAAA 3G5ZB 3M45A 4IM8A 2IPTL 3SBWA 4HPYH 3FRUA 2H45A 3QWRA 4CAGA 2R4RL 2XA8L 5HVWA 4WHYG 1ZT7B 1NGYB 1X4XA 1MJJB 4LCUB 3DSNA 2VLKB 3NFNA 1YPZA 3WHE1 2YD2A 4JFFA 1BD2E 3X13A 1Y18A 4ONGL 4H0IA 1CICA 1U8HA 4JPIB 5AAWA 1MH5A 3CSYB 2QADC 2B5IC 2ZG3A 2WAHA 3P0YL 1A6ZB 3G6AA 5I8KL 4CVZB 4WEUD 5IEKB 1ACYH 4DKAA 4Z7VB 4Y8DC 1OF2A 3VXRA 5IMLB 2Z91A 2WM0A 3O9WC 2A6IB 1R3HA 4WW2A 5BS0A 4RFNC 4TTDD 2GI7A 2HG5B 4UOW1 4JHAL 2NYYC 4BH7A 1IGML 2ZCHH 1T5XB 2YXMA 4LCCC 4M1GL 3LS5L 4XHJC 3VD7A 2UV3A 3FFCB 1FNLA 4Y5VB 5I6XB 1C16A 4OAWA 3MOQA 2Q8AH 3OPZH 4JDTH 3GSUB 3NFSL 1Q38A 4IRJA 4YPGA 3PWJB 1Q9WA 2D7TL 4CW1A 4TUJB 2DOCA 3CVHH 5DK0A 4F3FB 1MVFA 4ACPA 4U1MA 5K59F 5IKCB 3VXSA 3P40A 3CVIL 5HHOE 2GTZA 4PGEB 3KPQA 2WBJB 3JWOH 4JO2H 1U3YA 5I1EH 1VFMA 3JVGC 2MNUA 1JUFA 4M7ZB 1GL4B 3S96A 3ARPA 3U4BH 4C54A 2Y72A 2YBRB 3TWCH 3TZVC 1A7PL 2WLYA 1TJGH 3T4YA 5E5MA 2XRAL 4R4NC 5IBUB 3BPOC 1F00I 4EDXA 1WBYB 1SEBA 5E00B 5CZXD 3UTTE 5K9JH 5KVFL 1VACA 3BT2L 4GRWH 3ULVF 4JFHD 1A14H 1CR9L 5I16A 5GZND 5SWZB 2VLRB 4PGJA 2HFEA 2DJSA 5EULV 2KZ1B 3RX8A 1QLFB 4LIQH 3UTPD 4EEEA 5EBWA 5HI5C 1YEKL 4P23C 2NR6C 2CPCA 1T7YA 3KPOA 4PJIF 3MLYL 5E99L 3SDDA 5KTEL 4KROD 3GSNB 4NQEE 3PXHA 5DK3A 5FGBC 3IDNB 2FIKB 1BGXH 3EAKA 3EOYG 1FH5L 2D7QA 4ZFZA 4HPOL 2DQTH 3SJVA 1BQLL 4OD3L 5BZWB 1FJ1B 3E8UH 2EKSB 5D1XC 3WNOA 5LGHL 2BCKA 5JW5B 1WZKA 4M43L 4QHMB 3W39B 2BVYA 4XVTL 5EUOA 5FGCB 4JANB 1CE6B 4QYOB 2H32A 3TF7C 3GSVB 2CMRL 1AJ7H 4LAQL 2VDMH 4JFYA 3RDTD 2F5AL 1FIGH 5DJXA 1BAFL 1CGTA 4HZLA 3AC0A 4J1UB 1NMAL 4NZUH 1FQ9C 4GBXB 5T3XD 4D8PA 4GO6B 4XNUH 4NDMA 1D6VL 6FABH 2GJZB 1OQOA 2GIYA 4N0UB 1QPXA 4XVJL 5A2LH 4K3EH 4RGNB 2OTUB 4MLSA 3WIIL 4YDIL 3DX8A 4PD4J 3U9UB 4YDKH 2W65B 3QULB 4Y4KA 5K9QI 3O4LD 1RUAH 1J8HD 2YD6A 3CMGA 3ZKQD 3TT1L 1A2YA 4Y5XB 2OSLB 5JHLH 1VCAA 2HKHL 3RI5F 4M93B 3HG1D 5KS9E 3WHXA 2QLVB 4KUZL 4LCIH 3TCXA 4BZYA 3DRQB 4JQIH 5EU6B 1U91A 4ZDHA 4HKZB 2XG5A 5DJZB 5E2WH 1U8IB 2P8MA 4JFZL 3B9DA 2H6PA 5FKPA 2C4FU 4G8FA 3H3BC 1G7PA 4AEIL 4WI2A 3GI9L 1NCBH 2AJUH 4FZ8H 5J6GB 2VYRE 1UACH 2XTJE 3UEZA 5E2TL 4OV5A 2VXQL 5HHMD 3PL6D 4NO0B 5H37H 4LLAA 2FGWL 2FGZA 4Z7WE 4KJYA 1CVRA 2UWEF 3EUUA 5BW7C 4TSBH 1TQCB 1S7WA 3B2VL 4MXQD 1EERB 2IALB 1LGVA 1MREH 3INUH 3NCYP 3K2UL 3V95A 3SKOB 4HV8B 4JCMA 4R90L 4DW2L 1V7NH 4JQXA 3WUWG 3ULUD 2DQUH 5C0EB 4P2OB 1Y6NR 2KH2B 1MCPH 2ZUVA 1QKZL 1FVCA 2DL9A 1BF2A 3OWEA 5TGBA 3W82A 5IMOB 3D85D 4IRZL 2LVEA 3PDDA 2DWEA 1A6TB 4LLUB 2Z8VC 5C0NC 5KG9B 1MCHA 1C08A 2WINA 3DMMD 4MNQE 1M6OB 1HQ4B 2PYEE 3MZGB 2FL5A 2YWZA 2VH5L 4LRIA 3D25A 4MJ6B 3PHQA 5GS2D 4PTTA 2VL5A 4PJ7B 3WFCH 1R3LA 5ADPH 4JDVB 2IFGA 3AY4A 4WI4A 2BSSA 4NQXA 3WL9A 4L8DB 1ND0B 2X4UB 3M8OL 3TH2T 1H9VA 5GGVH 5C0GA 4UT9H 1U3HA 2CIKA 2COQA 1IEBB 4QHKI 5E6ZA 3NTCL 1XF3A 4PP1D 3ULVH 1CLOH 3PWUA 5ACZB 4Y16C 1I1AB 3ULUL 4TVPL 2AXGA 4ZAKA 1UCTA 1KIPB 4ISVA 2MFNA 3U6RB 5FCUH 1SY6A 1QBAA 2P49B 5KVDL 5C0RH 1JNJA 1BOGB 2AGJH 3CH1B 2DLHA 1Q94A 4K55A 2I5YH 5DT1H 5JW3H 4OD2B 2NY5C 4OIIL 3IS0X 1T83A 2HJLA 4ODUA 1IT9H 2D4FA 5F93C 4LFHD 3UP1A 3VXQA 1EUUA 1JWUA 4G9FE 3ZT7A 1ZGLM 3FT4A 4OLWH 3F7VB 1MEXH 1BBDL 4NHCL 1MLBB 4QF1A 5JW4Q 4EN3D 5FO7A 5E08L 1HIML 3HZYB 4LVOB 1DP0A 4PJ9C 2HT4C 5DRZA 2G5BA 4M93C 5FM4A 4R0LB 2G75A 3QUXD 4KTDH 4WUKL 4QNPF 1F3RB 4NT6A 4X99A 2P5EB 4HJGB 1ZK9A 4LSQL 4MXWH 3NFNB 5ESAB 3RWIA 3HE7A 4XX1E 2E9JA 1MJ7L 2DM7A 3KWWA 4HGWB 4N9GA 1SEQH 3UYOD 5I1KL 4X9HA 5HPOA 2X4OB 3MRPB 2B4CL 1CN4A 3SQOH 3TO4D 2AV7A 4K7FB 4GW5B 3VXRB 1DQJA 5MP6H 3MRKA 1A5FL 2VLMD 1NBVH 5FHBL 4N1HB 3MLRL 4WW2B 5BS0B 2EDDA 3VG9B 4DVRH 1I1FB 3CFBA 2YUVA 1IGFH 5T5NF 4BH7B 2DBJA 1TQCC 3OR7A 3STLA 1ZKAA 2W38A 4OCWL 3TJHD 4OAWB 4G3YL 2GJ6E 3EKCA 4U0RC 3EGSA 1CXHA 5IG7A 1Q9WB 3MUHL 2EIEA 4OGYL 15C8L 4DEPC 3VXSB 3MRHA 4QOKA 5BO1H 2VLLA 1EHLH 1CFBA 4EUPA 4KI1A 1YEFL 1X5AA 4P2OC 5KVGH 2MCPL 4UT7L 1JUFB 5DI8B 2AABL 2WQRA 3ZT6A 1RI8A 1E4KA 3BYTA 3G5VA 2D9QB 4GRLB 2NY2B 4JFPB 4WU7A 4M4RA 1CL7L 2E8YA 3QUKA 1F3JB 4X6FA 2R8SH 4FZEL 5IT2L 4KK8C 3IJSA 2WNGA 5CBEB 4G8EA 2P24A 4G6AC 3IJYA 3T4YB 1AQDB 2EYRA 3BMVA 4NJAH 3ESVF 5KOMC 4EDXB 3EJZD 1LP9B 1SEBB 2VUYA 2AERT 4F37F 2G9HA 1MLCA 1CFQA 4KI5C 2VQ1B 2PXYA 5I1JL 2AK4E 5E6ID 2C3WA 3T8XB 3VWJA 3MNVA 4K3JH 4YXKL 1TVBB 4L4JA 5AD0A 3S36H 4PRIE 4Y4HA 1GIGH 3BFOA 3QNZB 5EBWB 1VEPA 4MWFB 2WLZA 1KTDB 1JGUL 4DGIL 4POZC 5C0CD 2DYPD 5C09D 2FBOJ 2J8UE 1WT5A 4ZFZB 3RI5K 3KPRD 4NM8H 3SJVB 1RZJH 3MPCA 3VXUA 2BY1A 5TQ0L 1BJMA 1I1AC 5DD3L 5JPMA 5EUOB 2A74A 2P42B 5D6CA 4LF3A 4ZPVA 4PS4L 5DJXB 5ILTL 4OIBA 4O2EA 2OMNA 5I15H 4HZLB 1K3ZA 3I6KA 5DR5L 5F88A 5F7DA 5TE7L 2EICA 3HRPA 5CJOL 4EQ3A 3RVVC 4DUWA 3QHFL 1IAMA 2EDEA 4WFHE 5ISZA 3QUYD 3SBWC 4F58L 3UC0H 1AGDA 4KHXL 4U1HA 3FRPA 5C0JA 2IAND 4QKXB 4KJWD 1UWEH 1S7TA 4R0LC 5LKNA 4YJZL 4AEHH 2IPKA 1BFOA 5IB4A 1SHMA 4LSUH 5HJ3B 1IGTA 3ARFD 2VXVL 3MLUL 5E2JA 4LKCA 4Y4KB 4DWHA 2VLJE 3KYKL 1KELL 2DQGH 3BP6A 4NPYA 3VXME 3CUPB 1EBPA 1HHIA 1A2YB 3VFNB 5T33H 1FNGA 4PRBA 4WEBH 2FB4H 2NW3B 5DQ9B 4BK4A 4TUOA 2Q87A 3BGAA 1J5OH 1U91B 3MR9B 1CT8B 3QEGL 4HWBL 5C0IB 1KV3A 2BNQE 3O6LH 2X4QB 1NLDL 2H6PB 2Y6SD 4WI9A 4G8FB 2OXGA 5IUSA 3DO7A 1QPPA 1PYWA 4PR5A 3LS4H 4Z8FH 4P9ML 3P11H 4L8BA 4GG6B 4R7NA 3GK8H 4Q0XL 1XR8B 1A3LH 5HHPB 5C6PB 2GSIA 1MUJA 4NO3A 2E7HA 2VKXA 4RFOL 5K9QG 4K7PL 1B4JH 3OMZA 3D3VD 1JWMA 4FOMA 4Q6IB 5MHSE 1MI5B 3RQ3A 4H0HB 3HFML 4HKJB 4GRLC 2NY2C 2HP4A 1D5IL 2FR4A 3EO1A 1D5ZA 3WJLA 1S8DB 5F72S 3CDFA 5F89A 1ZHBB 4UQ2A 4F8TA 3T09A 3PXJA 4IRSD 1EVTC 3QCUH 3OKDA 1I9RL 4I2XE 1UJ3B 2LAAA 1SVCP 4UBDD 1NCAH 2DBLH 5TGBB 3PGFH 1PZ5A 5HD8C 4GAYB 5FUCC 4R26H 3RA7H 3SDCA 1T66D 2YKLH 3L7FA 1TJIL 4LQ1A 4NKOA 4WCYH 3KLDA 3IVKA 3QIBA 2YD8A 4Q97A 3HI5H 2WINB 1C08B 4ORGA 1OSPL 12E8H 1YA5A 2CRYA 1N6QH 4YGVA 2FL5B 1MCEA 1F11A 2QQLL 3D25B 1X9QA 2ADIA 1UZ6F 2A2QT 2D31B 4AL8H 1WGOA 1PG7W 3DRTA 4PTTB 2VL5B 1UXSA 3VD9A 4O5LH 4Z0BL 4L1HA 3EYSL 3EHBD 2DMKA 4JKKA 3MLZL 4ENEC 1KPVB 4LSPL 1KT2A 1JNLL 2FX7H 4OZFB 3SGDI 4ZXBB 1YC7A 5IBUG 4J8RB 5C0GB 1MCDA 3J7HA 1QSZA 3O6FD 1U3HB 5SWQB 5MEQB 4XBEL 4JRXE 1EO5A 3O4LA 3UJJL 1XF3B 3RPIB 2A83B 4ELKB 3GIZH 2ATPA 5DEGB 3GIVA 5C07A 2R23A 3PWUB 1CFSA 1UXWA 3FN9A 3W81A 2G60H 2GUOA 3I9GH 2C1PA 4DJMA 5FA3A 1MIML 3K8LA 4ZAKB 5GGSA 2UZIH 2DD8H 4L8SA 1I4FA 3HG1A 4NSKB 4C83A 2JCCA 2DQDL 1UG9A 2F54E 2BY3A 5DVMA 1EZVX 1SBSH 4U6HA 3VXQB 2M26A 2V17H 1GC1H 5GGUB 1P5UA 1AFVH 2WBKA 5FO7B 3AS1A 1RU9L 3D39A 3AXLA 2P43B 3PL6A 3UX9B 1RMFL 3OKEA 3IFLH 1G9NC 5D9SA 5HYQA 4OCRL 5HVHB 3U0TA 1MFBH 3QISA 1I7RA 4N0CC 5E24E 3RWIB 1N64L 1T89C 3HE7B 3VI3E 1A9BA 3U83A 5DUPL 3RUGF 1IBGL 3EDDA 1WVZA 3KWWB 3CFJA 4PJHA 4N9GB 3S35H 2P7TA 2OK0H 1YMMB 1ULVA 1UH3A 5L88H 2AV7B 3N1FC 2YK1L 1DQJB 2YPLD 3CMOL 1BQHG 4F37K 4LU5L 4UIMA 1JYNA 3O2WH 4HKBA 1ZHKB 1Q9LA 2AV1A 3ECBA 2J4WL 4WO4B 5L8LB 1NC2D 3OR7B 3K4AA 1FZOA 3ALXA 4Q6IC 2XXCB 1MNUH 5C0AD 1OAQH 4TQEH 4X9GA 3ZSSA 4XMLH 1MCLA 3CLFL 5DQJA 2CDGA 3MRHB 3N06B 4GKZA 5C08E 4BH8A 1QFWH 4LVNB 4O00A 4P2QE 3T0DA 1AO7E 4FQIL 3EYVB 3QFDA 4O51B 4CVXB 5ECJE 1UJ3C 4OJFH 5ERWB 3CDGA 1CD8A 1MAML 2PTTA 4WU7B 3EYFB 3MV7E 3DBXA 2P1YA 1KBGL 3O2DH 3QUKB 4JN2A 1EHXA 3QQNA 1HK6A 4LDLB 3MC0A 4X6FB 2E8ZA 2A77L 5L9DL 1VPOH 1SYVA 4UT6L 2P24B 3IJYB 4QTHA 4P3CH 2EYRB 4YXLL 2ARJA 4HS8H 5BXFB 3STZA 5D1ZB 4JB9L 4KKNA 1NCTA 2Z31C 2D0FA 3MOBH 3NN8A 4LRIC 1I3VA 1NAMA 1OSZB 3WLBB 2G9HB 3FOLA 2G2RB 1CFQB 2NXYC 4ETYA 3V7AG 1KJ2B 4TULL 3H9HA 4FQ1L 5DHXB 3RAJH 3FO2A 4OCLC 3AY4C 1DJSA 5J1AA 3QQ3A 1X5GA 4Y4HB 2OP4L 1JGVL 4ZXBC 5KSVB 4HBQA 3GMRA 1WV7T 5DTFA 1CD9B 4AT6B 1FC1A 4KY1H 2XOTA 5CZKA 1XGYL 4ZS7H 1S5IL 5HHOB 4XP5L 2CDFB 1WQVT 2MTPA 2ZUTA 3MRGA 4P2RA 3VGGA 4EN3A 3PV6B 3VXUB 1MHEB 3HZMA 2YPVH 3AAZA 4R8WL 3T2NH 4QCIA 1A1OA 5AAMA 1K4CA 1U2HA 5JPMB 1DBAL 4YDLB 1KCSH 2Q86A 3HB3D 3A6CH 3QUXA 1MPAH 1W0YT 4JVUA 4HX1A 3LKNA 5JNYA 5EFIA 2OZ4L 5BMFH 1VHPA 3EDKA 5E56A 1U42A 1H3GA 4LSTH 4O2EB 3WJJA 1FIEA 3I6KB 4WW1B 3U46A 1PQZA 4J6RL 5F88B 4AEFA 2F5BH 3ZDZE 3DSFL 3ZE2E 4JPWH 4QXGL 3ROLA 4B53A 5ISZB 4UB0H 1QSFE 4S1DD 1I85C 2EYTA 4FTVE 2J2ZA 1PW3A 4F33A 3Q6FA 3EOTH 3QUZA 3WS6C 3LEVL 1KF9B 5SV4A 5HVHC 5DUBA 2IPKB 1BFOB 4URTB 3H0TB 2WIMA 2ZJSL 4K23H 3HR5A 4LKCB 1L9NA 4UI2A 1QO3B 4S10A 5F96H 4ZUSA 1A7QL 1IE5A 1UYWH 2KBGA 3HUJE 3BP6B 5IVXE 4XAWH 1GXEA 3WXWL 1RD6A 1I8LA 1MCCA 4L4VA 1JHLH 4LSVL 3UYRL 4Y2OA 4PRBB 1QA9A 1N5YH 3FT3B 4TUOB 3MCG1 2C1OA 3NGBB 4F7EA 4WO4C 1YZZA 3U7AA 5EG6C 3FAXA 1DLFH 1ZOXA 5E9DA 4CN4A 4ZSOE 5I8OH 4KK9C 1PYWB 4ZFGH 3IF1B 4PR5B 5GGRY 2VZTA 3CAFA 4L8BB 4R7NB 4F7CA 2GSIB 4I18A 4M1CD 4NO3B 1QFHA 3GUTA 5EBLA 3I50H 5TPWH 5IEHA 1AY1H 2EXYC 5DJDB 3NBNA 3IKCA 2PF6A 3X14B 1IM3A 1NCCH 1JIBA 3QJFA 2FR4B 2YZ8A 4XMPL 1JTPA 3EO1B 2AQ3A 2Z8WC 1FNFA 3OF6A 3IDJA 3QZWB 5AZEL 3KJ4B 1ACYL 1MFDH 5F89B 4UQ2B 5KS9B 2DYPA 3BEVB 5D1ZC 3KPRA 4E42A 3OKDB 4XNMA 1U58A 4LNRB 1DQMH 4Z7VF 3ZKSD 3TLRA 3MJ9H 2ZCHL 3SDCB 1GYAA 1UEMA 1QNZH 3L7FB 4HWBA 4NKOB 1ZVHA 3RGVC 2YA2A 3QIBB 4V1DD 5LQBH 1OTUD 1CGUA 4PJ5D 5HBBA 2EE3A 3OPZL 4JDTL 1T04A 4ORGB 3O3AA 4MVBC 4YGVB 2XTJB 2MHAA 1X6NA 3UPAA 4OZGA 3G6JF 1D5MB 3F6IA 3HNSL 2CKBH 3DRTB 4Z7WB 1HXMB 5L2KD 1I1CA 3JWOL 4G6FD 4OF3A 3QNYA 5FF6A 5I1EL 3IFPA 1NUGA 1DBBH 4EOWH 1NBYA 4YDLC 3X11A 2HLFD 5E95B 4R4BA 4U1IA 2L0DA 1CDBA 4HWEL 3KPNA 5I9QB 3U4BL 4Q9BA 4WGWB 3S5LA 3ARFA 3VRJA 2ZUWA 1T2JA 4YPJA 1TJGL 1OB1A 1YDPB 3MNZA 5LWYH 3GIVB 5C07B 4AH2A 4J12A 1CFSB 3BP4B 3MV8D 4KKBC 5FA3B 5GGSB 4L8SB 1I4FB 3LEXB 5K9JL 1RZKC 2FZ3B 1A14L 5I8EB 5LAXA 4P99A 4PJBA 4HIHA 1N6VA 4MNQB 2VN4A 4LIQL 2PYEB 1HEZA 4BZ1H 2AJ3B 1Q1JH 2ICEA 4MXVF 1CDUA 4HG4K 2HT3D 1WISA 2DQTL 3D39B 3G5XA 1TETH 3E8UL 3OKEB 2EDLA 2CLVB 3GI8H 3L95A 4G8GD 3U0TB 5FYKE 4Z78B 1DQLH 1R3JA 4F7PA 3TH4T 1AJ7L 4F9PA 3NGBC 4NCC2 2OQJA 4YBQC 5IVNA 2ICWB 2F53E 1EAJA 2HRPL 3QWOB 4FXKB 2O93L 4DVBB 1V7MH 1TJHH 4PJHB 5MENE 1TZHA 3BZ4B 2P7TB 1C1EH 2DMBA 4M61A 3T3ME 1YY9D 2Y5TB 3WLWC 3QEQD 3CK0H 4NZUL 2YS4A 1OL0A 2RFXA 3LV3B 4XNUL 1OM3H 4MGXA 4IRSA 1Q9LB 4RMQA 2AV1B 3ECBB 1KJ3H 1KENL 2B0SH 5TQ2H 3BQUA 4PV8A 1F4HA 4AZ8A 5IW1A 1CFVH 1FZOB 3QH3B 3DX9A 4G9FB 4UUJA 1T6VN 1RUAL 2CO7B 2HMID 3ZKMD 4HDIB 5DQJB 1AQKH 4GKZB 5JHLL 4D9LH 4PRAB 3U9PH 1MCFA 4KRPB 3DV6A 3ZE0F 3RP1A 3QFDB 5FYLE 1RJYA 1EFQA 3EYQD 1R24B 1ZANH 2PTTB 2YUWA 2AXFA 5D71H 5T1MB 1CGVA 4S1RL 1KNOB 4ODVH 1U8OB 4X4ME 5E2WL 3LQMA 1C8PA 4RQQA 1QBBA 2B20A 1SYVB 3TA3D 1NFKA 1Y6KR 1NCBL 2AJUL 4FZ8L 5ABDE 3ARVA 1MCRA 1UACL 2C3VA 1PZUB 2XTJC 3V6ZA 3NN8B 1NAMB 1FFRA 1J7VR 3FB6A 5DWUH 2R0ZH 4TSBL 2BOBA 3L3IB 1NCNA 5JXED 2R29H 3Q2CA 5KSBE 1OT1A 3HHRB 2PYFA 1HZHH 3I2CH 5A40E 1K5NA 2O5ZH 2Z93A 4X9IA 3GMRB 2B8OT 1MREL 3INUL 3OR6A 4U1JB 5I9QC 5DTFB 3KPTA 4X4XA 5D70H 5D8JH 4Z95H 3ULVD 5C08A 4IOSD 2GAZB 5B8CB 2QR0B 2DQUL 2A1WH 4I9WD 3MRGB 4P2RB 4ZO8A 2VDOL 4IJ3B 3AAZB 5DJAA 2NY3D 1IC4H 1A1OB 3ARUA 1HH6A 1MCPL 5EPMA 4E0RA 1NMCC 2Q86B 1H3VA 2ARWA 1FORL 4QEGA 3LZFH 4HX1B 5EWIL 1IJ9A 5EFIB 1MOEA 2DM3A 4MYWB 5FK9A 1PQZB 5IW3A 1FC2D 4HUMB 3MXVH 3QEHB 3MXWL 5E5UB 3Q6GL 4XBPA 4L5FH 4Q58C 3MRRA 4FP8L 2YPLA 2I24N 2EDTA 2IMMA 3WFCL 1Y0LA 4XPBH 3RPKA 2EYTB 5CSBA 5ADPL 1X5ZA 4AM0B 3CXHK 1PX4A 4KI5F 5IROC 4F33B 4PJ7F 4CVWA 4R7DB 3QUZB 32C2A 4PRIB 3VD5A 4C56D 5DUBB 3C5ZD 3SHSA 5GGVL 3H42H 3PP3H 2VIRA 2HTKD 5C0AA 4IIQA 2IFFH 2EYSA 2P47B 4W6YB 2XQBH 2J8UB 4PRNA 4H0GA 3ULVL 3QEUA 4WJ5A 1XR9A 1ZSDA 4L4VB 4RISH 3E6FA 1NBZA 1W0WA 3QXWA 4OF6A 4MAYD 4L3CA 1OP3H 1R5WA 4OZHE 2C1OB 3C6LC 4K8RC 5F3BA 2SEBB 5FCUL 3MRFA 5C0RL 4KQ3H 5BVPL 4F7EB 4WTZG 1HCVA 2AGJL 5C6WH 1VSCA 2AI0L 3GSNH 1RZGA 1IT9L 2OZ4A 1YN6B 5E9DB 1EUTA 1BIIA 4KMLB 3C5SB 4LAJH 3ZHKA 1JRHL 4LCWA 1LO3H 1H0DA 4U3XA 4J3OC 4PJFA 4X6EB 4OFVA 4G9DA 4QY8A 5F1SA 4DOHE 4KRPC 3QHTC 5GJTH 3SDXA 5IEHB 2NXZB 4YQXH 5MI0B 2CXGA 5JIHA 1IAIH 3S4SA 3T0AA 5JMOC 1H3PH 1Z9OA 1DEEA 4JPKH 4MXWL 3FQXB 2VLJB 3QJFB 4Z77A 1EEQA 2Z9TA 2ZG1A 4UDUA 5E1AB 1AR1D 1SEQL 5CILL 3VXMB 3UTPE 2DMCA 3IDJB 3TM6A 3H3KA 3C5JA 3SQOL 4UTBL 5D4QA 4PRHA 3BISA 1NBVL 4E42B 3N85H 4XNMB 2A0LD 5CP3H 2NY5H 3GSOA 2BNRD 1A7OH 1MFAL 4G8IA 1IGFL 2Y06H 5BRZA 2BNQB 4HGMA 1A02N 1X4YA 2FATH 1JV5A 1DQQB 4CNIA 3T0ED 2WMPA 3WEXA 1OP3K 1T03H 1VKXA 2EIZA 1WLHA 4EI5A 1T04B 5L6YH 1S7QB 4OI9A 1NFDA 1GOGA 2FEEL 3S37H 1XZ0B 2EIDA 4JREC 5DZLA 3GMMA 2CK0L 5JXAH 1JHKL 5BO1L 1GGCH 4Y2DC 5B8CC 1EHLL 4XXCA 3LRGA 5CGYC 3I3EA 3QNYB 5FF6B 5DSCB 5T3XE 5KVGL 3KDMB 1WCBA 3IFPB 4S1QH 5CZVH 4UOJA 1FNAA 3QCTL 3V5DA 5I0ZA 5A3IC 4EIZC 3X11B 4MQXD 4CU8A 4R4BB 4U1IB 4N0RA 2R8SL 4IMKC 2WIIB 5JMRA 3VRJB 5DJCA 3OKLA 3PG2A 2HTLD 3SOBH 4KGJA 4NJAL 1YEHH 3L1OH 2NTFA 3TH3T 2ADFL 1T1YA 4PJDE 1RUKH 3QIWB 1P6FA 3CFKB 4J7RA 3F58H 1NANH 1EMTH 3TFKC 4XCYB 3SKMA 1LP9F 1F45A 4OFYA 4QTIH 5JZ7C 2YA1A 2AAVA 3BIAX 3SEPA 4OQ1A 5GRJH 4TOYH 4PJCE 4X6BA 3QUZC 3R8BB 3S36L 5IB2A 4NZDA 2F58H 4RMUA 1UM6H 3NAAH 2BDNH 2X5PA 2DQJL 1T6WA 2FEDC 2VZVA 3MV01 4OCYH 1Q0XL 1QLEL 1QBLH 3RVTC 1T5WA 5K9KA 2VOTA 2VN7A 5HHME 4NYLB 1R3JB 4F7PB 1F5WA 1S7RB 4MAUH 2DI9A 2FHCA 5EUOF 4JRXB 2FX8L 2IAMD 3FO1A 1IAKB 5D7LD 1JPSH 2F74A 4X6DA 2R2HA 2E7BA 4XTRD 1BREA 3DO3A 2JJSC 3LRSA 3C9NA 4GLRI 1UM4H 1DBJH 4MSWA 1JPFA 3RGHA 3BQUB 1JN6A 2F54B 3MCKA 4PV8B 5IW1B 5F21B 3JTTB 1FG2A 3MRLA 1OAKH 5MI0C 4GAFB 4RSVA 5LG1A 2FO4A 1DVFB 4LSUL 4UUJB 4V1DA 4YX2L 3VE0A 3OKOA 2DQGL 3ZTJG 3ZL4H 1Z2KA 5EU7E 4WWKD 2MKLC 1S9YB 3AMLA 5T33L 2AJYH 3BWUC 4MJIA 2R0KH 1MIEH 4GMTL 3DV6B 4WEBL 3C87A 2FB4L 5L2KA 4DAGH 4Q7DA 3P9LA 1HYSC 2XV6B 4MD5A 4J3UA 3F12A 3WIHL 1T3FA 4KJQD 2NCMA 3O6LL 3TESA 3UZQA 4P46A 5MENA 2NX5A 2VSCA 1A6AA 2RAMA 4PJGA 4OCXL 1E6JH 1V3LA 2GTWA 1GHFH 2D9CA 3OQ3B 2X6MA 3AFLA 3LS4L 4I48A 4Z8FL 3U0PB 3BW9B 3GKWL 3P11L 3GK8L 4JAMA 3MLSL 3SGEH 1MCQA 2ED9A 5J6HA 3BESR 1YQVH 5AG8A 4GG6F 1MJ8H 1B4JL 5H2BA 5HGGS 3O45B 4M3KB 3HI1A 4P2CG 1JL8A 1MCKA 2YC1B 3QZWG 2PYFB 4DQOL 4K9EL 2Z93B 5CWSA 4YR6B 5F7YC 3OR6B 5HGAB 4MA3A 4RIRA 3BIKB 3LKSA 2ED7A 35C8L 4X4XB 3PWLB 3UTQB 4U1SA 5C08B 1CK0H 1KPUA 3DARA 3QXDB 1YEJH 4P2QB 5ALCL 1HHHA 4LLWA 5DJAB 3M17B 2Q7YA 2DQCH 3QIWC 1HH6B 5EPMB 1NCAL 2DBLL 4E0RB 5HVFB 1MAKA 4KV5F 1NQBA 1MFNA 4R26L 1RUQH 5CMAA 3RA7L 2YKLL 4A2MA 2N1KA 1C7SA 4KQ4L 3TBWA 4NC0B 2ZUXA 2DLEA 2NY6D 3HI5L 1Y6MR 1NGZA 4WFED 3SE4A 3T65B 1WFUA 5FK9B 1JF1B 4L1DA 1N6QL 4XXDA 1CTNA 4PPTA 1G1CA 4KH2A 4AL8L 5D1QA 2YZ1A 4XBPB 2N56A 2FJGA 3IXAA 4ZPTA 5GRYA 3QEQA 1Y0LB 2BXYA 2J12B 1YJDC 4FQ2H 1TVDA 1UWGH 2NLJA 3AM8C 2ZCLH 4MD4B 2FX7L 4JQVC 32C2B 4PV9A 3U48A 1HYRC 5TDPA 2VIRB 4IIQB 4IMLA 5F6IB 3VFTA 4PRNB 5F8QC 3QO1A 3GIZL 3ME0A 3QEUB 4KKAD 4WJ5B 5C0DA 1ZSDB 4RRPG 1NBZB 1NKRA 1W0WB 5DRWB 3WFEH 1XF2B 2G60L 4L3CB 5I1AB 1VGKA 4JFEE 4HZAA 4A6YB 2DD8L 1HDMA 3R06A 5D2NA 5F3BB 3P4LA 2NNAA 3BQUC 5C7XH 2R9HC 3SPVA 5JIIA 3UMTA 1F6LL 1RZGB 1SBSL 3B9AA 1DVFC 2Q7NA 1MHCA 3QA3A 2B2XH 5M94B 4JCLA 1YNKH 4KK6C 4LCWB 3RVUC 2V17L 1KCVH 1GC1L 4OI7A 3LSOB 1AFVL 1ZVSA 5B39G 1KLUA 1I8MA 1LDSA 4FTVB 4L4TE 1HILB 3L5WA 5E8NB 5CKAA 1U8JA 4BQBA 3QHZL 3S4SB 4WUUE 2OX5A 1MFBL 3VH8G 4P5MA 1DEEB 4OCSH 3IDMA 1LNUA 5D7KD 5CS7A 4JZOA 3HUJB 1A4KA 3S35L 2R2EB 3SN6N 3C5JB 3VFUA 2Y25A 5L88L 1QVOB 5IIEB 2VE6A 5C0CE 3O2WL 4P3DA 5DA4A 5C09E 3K46A 3GSOB 2EE2A 4G8IB 4PJIA 1V3MA 5BRZB 1D9KC 5DS8A 1UQSA 4CNIB 1UA6H 4NM4H 4MMZC 3WEXB 3JXAA 1QLRA 4M8QA 1VKXB 2I27N 1MNUL 2EIZB 1OAQL 2VISB 4D0CA 4KWUA 4XMLL 4OQTA 4XP9H 3RL2A 4CN6A 2LU7A 4WHCA 3UZEA 1B3JA 2NZ9C 2BY2A 5CD5D 3ZDYF 1DEDA 4Z18A 1QFWL 3MOAH 3HAEB 2V7HA 4QRRE 4WGVB 1WCBB 3KGRA 5J0BA 4OJFL 2ZKHH 1RURH 4YHKL 5GSRB 2IANE 1U92A 1OTSC 1D6EA 3O2DL 2YPKA 5J57B 1FE8H 1BFTA 4KDVA 5DJCB 3RZCA 4P3CL 3OKLB 3HPJB 4PB9L 4HS8L 4NQDE 2F8OA 2NTFB 1YEGH 1FYTD 1T1YB 2XY1A 3MOBL 3SCMB 4KK5C 1KSRA 1DUYB 2R39A 3ARBD 2ITCA 1Q9KA 2RJMA 2PR4L 2WP3O 3MTRA 1ZS8A 1GOHA 1I9EA 5EORH 1S9KC 4EJ1C 4Q2ZB 4ODWA 3RVWD 4KZEL 3IDGB 4X6BB 5IB2B 3MV9E 3JUZA 4ZFOL 4XNQA 1J12A 1WZMA 2NZIA 2P8LB 2X9WA 3OG4B 4P5TD 4KY1L 4MLIA 5F6IC 4Y4FB 4JVPA 1T5WB 5K9KB 2YPVL 2Y9RT 5DK2A 1ZHLB 1KCSL 4M7JH 3A6CL 3SGJA 4PLJD 4XPHH 2FJFB 2FRGP 3TC9A 3VRIA 1KCUH 3D3VE 4FQXD 4EDWH 3H9SA 5BMFL 4APQB 3FO1B 3LPWA 4XNXH 3MRIB 2AKRA 3B9EA 2F74B 5JW4M 3ZKND 2F5BL 5IGXH 3D0LA 2IC2A 3SDAD 3C9NB 4JPWL 1PY4A 4HQQL 3UTZA 2AEPH 3NA4A 5KSAD 1JPFB 1WITA 2XN9A 3MJ7B 2VC2H 4TVSa 4UB0L 3HZVA 4OZFH 4HWZA 2K1MA 1RSFA 3REWA 1XH3B 1FVDB 4QLRA 3ULSB 3MRLB 2MQ0A 3EOTL 2FO4B 4PJEE 2GFBA 3LH2H 3QIUB 4YNYB 4K23L 1ZT1A 3VE0B 3QDGD 1I1YA 3L9RB 1UYWL 4OB5H 4M7LH 4XAWL 2RGSA 3W11C 2CUMA 3LPGA 4MJIB 1BEYH 1NMBH 5HXMA 1TIUA 1SY6H 4XH2A 4X5XB 3FOMA 2KL6A 4YHLH 1HI6B 3MA7B 5ENWB 4JZJA 1NJ9A 3RWCB 4ZS6D 2CO6B 4P46B 2ADJB 1DLFL 5MENB 2NX5B 4CJ1A 1DSFH 3GNMH 4E41D 4JKWA 1HINH 3TBSA 2GTWB 3QI9A 4ZFGL 1FP5A 4P59H 3QPQD 4BUGA 5HYEA 5D7JD 4LRNH 1YYLH 3HI6L 1KN4H 4ZUWA 3GMPA 3I50L 3VGHA 3ILQC 1AY1L 3KAAA 4H20L 2QADD 4KXZH 3HI1B 3BKYL 4O2CA 5ESQA 2ZOLB 3Q5TA 1AD0A 3BH9A 4ELMA 3NIGE 1NCCL 1IEAB 3HPLB 4QGYA 4MA3B 5D5ME 4RIRB 3O9WD 3LKSB 4GXVL 4CGTA 1LO4H 1T2XA 2PO6D 4U1SB 3QXAA 1JNHB 1KPUB 3BKML 5FB8A 4Q9QH 2NYYD 4XHJD 4LLWB 4FABH 5GXBB 1OVZA 3SCMC 2R1WA 1DQML 3T0WA 3U30B 5HYSA 5KS9F 2UZXB 3MJ9L 4NN7B 5CMAB 3WIHA 4UINH 1QNZL 3AROA 1TCRA 5LQBL 3D18A 1BFVH 2X4SA 2IJ0C 2GY5A 3IFOA 2IAMA 2X2YA 4FFWC 3O8XD 4PG2C 4B7IA 5IK3A 3B43A 3GZKA 3BP5A 2IPTH 5IM7A 4PJ8D 3K80A 5D1QB 5DJ2B 2FJGB 2CKBL 4R6UA 4YHMH 5HTSA 4JFXB 4Y4FC 3TGXA 5HYFA 5BCAA 4WHDA 3LQAC 2WWMC 3RTQB 4PY8J 1TQBB 4Z7WF 1DBBL 3TZVD 4EOWL 5DURD 3G04B 3BN9C 5CJ5A 1CFNA 2ADGA 1J1OL 5IHUH 4ZODA 1VEOA 5ITBH 5DVLA 2CKNA 5F1IB 1NDMB 4APQC 2UVEA 3QO1B 4OLUH 4N9OB 2QBWA 1FL5A 1JPST 5LWYL 1N8ZA 1OWRM 5C0DB 2GK0A 4N8VG 3O3BA 2BFVL 5EOCH 1KJ2H 3LKQA 5DJ8A 1T20B 1VESA 3O3EB 4JHAH 3WYRA 1DUZA 5D2NB 3D2UD 1IGMH 3QO0A 4M1GH 3P77A 5HI5D 1SJXA 2NR6D 3VWKC 2WQ8A 2DKMA 3VFPA 3SPVB 3NFPB 4PGBA 1N0LA 4POYA 4I3RL 4PIRF 1L0YA 4NWTH 1B2WL 1OAUH 4NUGH 1MHCB 3QIUC 3MFFB 4BZ1L 3QA3B 3GMOB 1Q1JL 4OGXL 2F8XC 1CU4H 1NGPH 1ZVSB 1KLUB 1I8MB 3N1QC 1TETL 3OTTA 4Y1AD 5KOVC 3L5WB 3OB0H 3RBSA 4X98B 3GI8L 4HG4J 3GGWB 1IGYA 4P49A 1CGSL 4S0TD 1FVEB 4L8CB 4WI3A 3IDMB 1TTUA 3BUYA 1A7PH 1LNUB 4JZOB 1A4KB 1V7ML 1TJHL 4P46C 4ZFFA 1E4XI 3DXAA 5FO8A 3VFUB 4YHYC 1RZKH 2VE6B 5JO5B 3CK0L 3P30H 4PJHF 4OZHB 3B6SB 4P3DB 5GISH 1OM3L 3CLEH 1OPGL 1KJ3L 2B0SL 2VLKD 3RY6A 4PJIB 1Q72H 4YEEA 4OZ4A 2RQ8A 5DS8B 4PLKC 1CFVL 5IV2A 1QD0A 1QFWM 3BDYL 4YIQA 1QLRB 3MLYH 1U8QA 4M8QB 4N8PA 4OM1H 5E99H 4Z0XA 4HUXB 5KTEH 2HLAA 3MQIA 1NAKL 3RL2B 1WC7A 4JO3H 1KB5L 4HPOH 4RAHA 1P2CA 4LPXA 2YD5A 4OD3H 3NCMA 3W0WA 4XCFH 3AREC 3F7PC 1AQKL 4L4TA 4ONHA 3VGAB 4D9LL 3U9PL 4IHOB 1R6VA 4OSUH 3QQ4A 4XVTH 2ZPKL 3BPCB 3X3GH 3FFCD 1P7QA 4LAQH 1O7SA 1ZANL 4NN7C 1U92B 2VAJA 3OB0K 1D6EB 2YPKB 4U6TA 2YRLA 5E1HB 3BUTA 3RZCB 5E4IA 3U4EB 2WBJD 3RWDA 1GGUA 1M7IA 2ZP0T 1D6VH 1WEJH 1FZKB 1XIWB 5D1QC 2VSDA 2GSGB 5HPMB 1Q9KB 5DWUL 3WIIH 3MREA 4YHOH 1ZS8B 3DGGB 3WN5A 3M07A 1NC4A 4PY7A 4WHTB 5HI3D 2R29L 3BHBB 2ZCKH 3RTQC 4MDIB 1TQBC 4ZYKA 3EDFA 3H3PL 1J1XH 3I2CL 2O5ZL 5D2LE 1QRKA 1OGTA 2NMSA 5D93C 1NUFA 3LKPB 4XNQB 5CBAB 1EV2E 1B0GA 4P57B 3Q3GB 4J3TA 5D70L 4Z95L 4YHZL 3PDOA 1KGCD 3RWFB 5J7CC 2A1WL 1MWAB 2JJTA 3HMWH 5E70A 1VADB 4JKLA 5FUOH 3TP4A 3I3DA 5SWZD 2VLRD 4DTGL 5C0ND 3N1GC 4DK3A 3ARDB 3CDCA 5FDWA 2W07A 1TVHA 3WFHA 3VRIB 2EECA 2DIBA 3H9SB 4OLZH 3WV0A 5F7EH 1KCLA 2DI8A 3O2DA 4OUOA 3ZE1E 3MRQA 1JGDB 5GGQH 5E2TH 4NRYB 2VXQH 5I74B 3MXVL 2VABA 1HKLH 3UTZB 4L5FL 2XN9B 3PWVA 1AH1A 1G7IB 3HZVB 4XPBL 3CSBA 4HWZB 3WDHA 5TH2A 4NOFA 1AXTH 5GSVA 4PG9A 1JF6A 1SJEB 2X44D 4TTDC 4BSVB 1X7QA 3D69A 4GRWE 1FGNH 4JG1H 2GFBB 5FHAH 3CXHJ 1LQSR 3H42L 3K2UH 1ZT1B 1PG7X 4TRPH 4ZFOA 3IETA 2XQBL 4GBXD 4PJ5E 5DMGD 1IZJA 1YNTA 4RISL 3LIZH 4R3SA 2GYSA 4Y7MA 5GIRA 1N3NA 4NO2A 1IKNC 2J8UF 1JZ2A 1JZ8A 3LD8B 5F6HJ 4RGND 3REVA 4XH2B 4QRQB 1HE7A 4KQ3L 4LPTA 4JZJB 4H1LG 1INDH 4H8WC 4KVNH 1FGVH 5T1KA 3GSNL 3RWEB 3P9WB 3V5KA 3S98A 3A6BH 4ZNEA 3WXVH 3MLVH 2VH5H 4TSAH 2NQCA 3TBSB 3QI9B 2R0WL 2PCPA 1LO3L 1LVEA 4UIKH 4HHAB 2CLZB 2ERJB 3I85A 1HH9B 5IR1B 1TDQA 1CLCA 4ZUWB 4Z7UA 3GMPB 3NZ8B 3RY5A 3FT2B 3MV8E 5GJTL 4YQXL 5FOBB 3WFBL 4O2CB 1H3PL 4JPKL 1KTLA 1AD0B 4ELMB 3CZFA 1EEYB 3UCRA 4HBCH 4P4RB 2E7LA 4M9PA 1P9MA 3VGEA 3DECA 4NO0D 4JFOA 4NBXB 5FB8B 2DWDA 4TVPH 4K8RH 2CUIA 4WV1C 3FQRA 4X5LA 3N85L 3VXPB 1XIWC 3C60A 2NY5L 5HYSB 5KVDH 1A7OL 2Y06L 4JO4L 2WUBL 1NGQH 2FATL 4G5ZH 4Q9RL 4L9LA 1IM9B 4G8GE 1TCRB 4CADB 2OBGA 3D18B 1KEGH 5IJKA 4FQXA 4GRMA 1T0PB 3G9VA 5INCB 3DUSB 3MRCA 5F9JA 5L6YL 3T0VA 1BBDH 4H26B 3HAEG 4YGAB 4NHCH 5IK3B 3TJEH 3BP5B 2VXSL 3RDTC 4P2OD 4MB3A 1JGEA 4Z6AT 1HIMH 1TFHA 3S37L 3QPXL 4LLQB 4QHLA 4QRPE 5JXAL 3ZDXE 5KSAA 4BQ9A 3RUGA 4XPFH 4WVRA 2X9XA 4S1QL 4KK8D 4LSQH 3KG5A 1G7QA 3FMGL 4UV7L 5CZVL 2HJFB 5IW6A 4G6AD 4YDJA 1REIA 1D5XA 5L0QB 2NW2A 2EDNA 4ETQB 3ARDC 5C92A 4PTUB 5JQHC 1CBVH 5FEBA 2VL4A 4J4PC 5A2FA 5I1LB 5LXGH 3SOBL 5FM5M 1FL5B 1NAMH 3O3BB 4NKQB 1RIHH 5I74C 1RUKL 3G08A 3F58L 5GRUL 5C0FA 1EMTL 1DUZB 5EO1B 3P4NA 3MYZA 3P77B 1W2KT 2DJ4A 4I0CC 1MFEH 2OM5A 2P46B 4QTIL 2VUOA 3H6JA 3X3FH 1MRCH 4K94C 5HY9A 3VFPB 1TTFA 2DB8A 5GRJL 4PGBB 3LOWA 4P3WA 5MEOA 3G5YB 3V7AE 5ICYA 2F58L 5E2UH 1WWAX 2X7LB 1UM6L 3NAAL 4OGYH 4YK4B 2BDNL 1I1AD 3OGOE 2ZUQB 4TTGA 4OCYL 4ODXA 1OW0A 1KN2L 5BVJA 2C5DC 1LWRA 4YE4L 1Z6JT 3TIEA 1H5BB 3H8NA 2D7OA 3OAZH 4H25B 3EOBA 3WCYA 5FO9B 2ICCA 4MAUL 3MRMA 3BUYB 1JCKA 3P73A 2QSVA 3RVVD 1RPQA 4MXQC 1JPSL 1U8NA 4XPGH 3O9WA 4F9LC 2EC9U 1JYXA 1A1NA 5ICXA 1UM4L 2FIRT 1DBJL 4JFEB 4WTXA 2EDWA 1ADQL 2NY1B 4LCCA 1VDGA 2ERJC 2OR9H 5F9WB 2P5ED 4B5EA 4I9WE 2MJWA 5AWNH 3CCHA 4YXKH 1E27B 4OZ4B 4BFEA 2LTQB 3ZMRA 3EO0B 5IV2B 3RFZC 4LP4A 1JGUH 4Z0XB 4CDHA 1C5BL 1NBQA 4HS6B 3VXRD 2Z92A 3NIDE 3HS0A 1BQSA 1P2CB 5EU7C 5BS0D 3DMMC 4NUJA 4OLYH 3W0WB 4L4TB 4ONHB 1FL3A 2AJYL 3VFVA 3JVGA 3GBLA 2R0KL 1S9XA 1MIEL 4LLDA 4PJAE 4DAGL 4WUUB 4QRUA 2IBZX 1P7QB 3MJ8A 5TFSH 1EJ6A 1C12B 1C5DA 3TZVA 1Z3GH 5ILTH 1FBIH 1T7XA 3IDYB 4XI5D 4C56E 4UNVA 1HQRA 1E6JL 1KIQA 3VXSD 5TE7H 4MD0A 3RWDB 1M7IB 1TXKA 1J0JA 5J3HC 4PP1C 1BMGA 4F58H 5LGJB 4KHXH 3ELAT 3QFJE 3OX8A 3GRWL 4GRLD 3EDEA 1MCBA 2NY2D 3MREB 1WBXA 3WN5B 1YQVL 4PY7B 1XCQA 3MNWA 2OL3B 3KPSE 1U8MB 4P23A 2N7BA 5KAQG 1EEZB 4OCNC 4XWOD 5FGBA 1OLLA 1EXUA 4JHBA 1OGTB 5L0QC 4G6KH 4RWYL 1FYHB 2Z8RA 4EUPG 4KDTA 3V0WH 3PDOB 1CK0L 1KB5A 1L6XA 1YEJL 4TYUA 3B5TA 5D1XA 2ATKB 1QRNE 5E8OA 3VMPA 1LE5A 2JTDA 4QRRB 3LN5A 3KPMA 4ZOBA 3CFEA 1EFXB 4XAKD 3UTSE 4JFQB 1S7SA 2AJSH 1RUQL 3MBEB 2FH6A 5F7FA 3WFHB 2DF3A 3RNKA 5B38A 1CXKA 3IJHA 4ZUTA 1J0KA 1CL7I 2VJXA 4Y5YB 4NQDB 3G5ZA 3VFMB 3SJVD 1MSPA 4P9MH 4ENED 5A2JH 1K8IB 2UWEE 4YK4C 3WNMA 5DD6B 2V9RA 5CJXC 2ZUQC 4JRYA 3TO4C 3TYGL 3O41B 1NFIA 3N9GH 4YZFE 4K7PH 5SX4I 1NGYA 1MJJA 4PG9B 4NGHH 2VLKA 4TSCH 3PWPA 5SV3A 2IQ9H 1H5BC 1X7QB 2BNRE 3D69B 3MV9B 2MSPA 3ZSTA 1D5IH 4MX7A 4OM0H 4I0PB 3KLAA 1DN0B 3G9AB 3CSYA 4G6JL 1A6ZA 4ZFOB 3VA2C 4NFCA 4FA8A 3T0EE 4OLVH 4YHPB 5BV7B 5IMLA 2BSRA 1IC7H 1YNTB 2DQHH 1HHKB 1GAFL 5GIRB 3P4MA 3WFEL 1N4XH 1EX0A 3R0NA 4PLOB 3REVB 3S7GA 3WUWB 4LHUB 3TT3H 3GJFB 1T5XA 1HCFX 2DLFH 5F9WC 3H9ZA 1TJIH 3B3IA 5C7XL 5AYUH 4Y4KD 3G6JA 5TF0A 3BO8A 5T1KB 3GSUA 1WWCA 3V5KB 1JF5A 4NQVB 4D9RD 4F8QA 4TUJA 4F3FA 1IAIM 5D7IE 1YJDH 1YNKL 3HCVA 4NC2B 5IKCA 2O5XH 1KCVL 2X05A 5BW7A 4Z0BH 4F7MA 4FQLH 2KQMA 5IB5B 3O3UN 3ZE2F 4N0CD 5E8DH 3AB0B 1VFAA 2D0HA 4Z7UB 3WO3B 3QDME 5EC2B 3OL2A 3MJ6A 3TN0A 2I60L 4OCSL 5E6IC 2YBRA 3CZFB 5DEZA 1JZ3A 3RX5A 4XGZA 2HT2D 5EZOL 1I9IH 3IDYC 1WBYA 5E00A 5CEZH 3HUJF 1CFTA 3FQRB 2HFGH 1NLBH 2VXTL 3MUZ1 4MNHA 3O6KL 4PGDA 3C60B 2DQDH 4XVUC 3DX7A 1MI5D 5SWZA 2VLRA 1CS6A 1RJLB 1YEIH 5CJ8A 1W0VA 2Z4QB 1T1XB 1J0ZA 1FFPA 1QZ1A 3GSNA 5F9JB 4GXUN 1BF8A 2PETA 3IDNA 3ESUF 2FIKA 2R1XB 3R0MA 2DIAA 4XP9L 5BZWA 5D7LE 5B4MC 1G9NL 5FOJA 4QHLB 2VR4A 2FWOB 4QNPE 2Q6WB 2W59A 3MOAL 3TBYA 3IDIA 3D5OF 4QHMA 3W39A 4OI8A 2CUHA 2R1YA 1G7QB 5IW6B 3QUYC 1WK0A 3NMEA 3NCFB 2EDOA 1BLNB 2NW2B 1F4XL 3QUMB 5D5MB 3MBEC 1DTUA 1N7MH 1FE8L 4OTXL 1DBMH 4Y16A 4Y5YC 1UCBH 2BRRL 3CMOH 1WSST 1I1RA 1DQTA 3MUGA 1YEGL 3GSQA 3LHPH 1P4IL 3T2OA 2GJZA 5DD0H 4N0UA 3G08B 2J4WH 1TTGA 4KKLD 5C0FB 1JZ6A 3P4NB 5F97E 1BQHA 5CP3A 4ZXBD 2OTUA 5EU5B 5EORL 2BVPB 1P5VA 4LASL 5HY9B 4R2GB 3U9UA 1IEHA 1U3HD 3SO3C 3QULA 1B6UA 1WCQA 4NCDA 1G0XA 4I0PC 4OLEA 2LU4A 3CLFH 1LO2H 4XCNB 2Y6SC 5FYJE 1KIUA 1W8NA 4PJ9A 1M7DA 2OSLA 3NIFE 2IG2H 4ZAKD 3HNVH 1HN1A 3BD5A 5BV7C 2VITB 5IHZA 1WUNT 2YUXA 4LP5A 5DFVC 4JLRA 2X1QA 5EU6A 4NZRH 4HKZA 2DKUA 1F4YH 5DJZA 4M7JL 3HRZB 1U8IA 1V8HA 1W72B 1UADC 2FDBP 5E94B 4BK5A 2A77H 1KCUL 2JKXA 4KHTH 1N26A 1F4AA 3MRMB 4LCYA 4UT6H 1DCLA 4PRPE 1F90H 4XNXL 3L3OB 2K7PA 5J6GA 4JVWA 2YOCA 4PBWD 4NQTA 1A1NB 1ZV5A 4RFNB 4B7LA 5GS1B 3VJ6A 5HHNA 2AEPL 3QDJA 1QR4A 3PNWA 1AC0A 1HHGA 2VC2L 3ARQA 4FQ1H 1LK3H 1PVHA 3S8WA 1GGTA 4GMSL 2BERA 3AB0C 3HE7D 3CCHB 3T08A 1UENA 4LMQI 2OR8A 4G7VL 1JGVH 4UBDC 2IALA 4NKDA 1P53A 3ZTNH 4YAQA 2R4SH 1YMMD 3PWNA 1T66C 3V0VB 4HV8A 2Q76B 2OTWA 3HS0B 3SGKC 4OB5L 1J0IA 4XP5H 4M7LL 1P9MC 1WZLA 4ZO6A 4P2OA 2E9WA 4A6YH 1FL3B 3TCLB 2ZNWA 1S9XB 1NMBL 4WO4D 3IXTA 1SY6L 4MQ7A 3L5XH 1J0HA 1FLRL 5IMOA 1KUMA 2GITA 1CQYA 4YHLL 1LMKA 5F44A 5FA4B 2J6EH 2JK5A 1C5DB 2OZ4H 1A6TA 3RKDC 2DM2A 4LLUA 3MJGX 5KG9A 5GS0C 1M6OA 1HQ4A 1DSFL 1HQRB 3WBDA 5ID0A 1KIQB 3VFSB 2RB8A 4P59L 3O6FC 2BOCA 4U3HA 4PJ7A 1QFPA 3T3MF 1U8LA 2EXYD 4YH6A 3B9KB 1S9WA 4LRNL 2GJJA 1YUHB 1YYLL 4JDVA 1ADQA 1KN4L 3OX8B 2I25N 3B8SA 2Q3AA 1ND0A 4FHBD 2X4UA 3LEVH 4MQTB 1ZHNA 2BVUA 1XCQB 4YDVA 1B4RA 3TBTA 3OJ2C 2BHZA 4P23B 1JFQH 4LSSH 5A1AA 4JDZA 2H26B 4HLZH 1EXUB 1A7QH 1IEBA 5B21A 5DRXB 1KJVA 5D1ZD 1HHJB 3FO9A 3U0WH 4HUUB 1LO4L 3TO2A 3WXWH 5ACZA 2Y1VA 1KB5B 2B1HL 5I75B 2MWCA 5D1XB 1F6FB 2HVKB 2XWTB 4LGRB 5T1LA 5KAQF 3LN5B 4FABL 5J4MA 3CFEB 2P8PB 1KULA 3CH1A 1S7SB 4Y4HD 4MVBD 2HFTA 3RNKB 5I66B 2LE9A 3IJHB 3K7UA 4ZUTB 1BFVL 1DZBA 1A6WH 5HHOD 3F7VA 1CCZA 1MLBA 5EC1B 3VXUD 3S9DB 3HZYA