4DQOL

Crystal structure of pg16 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
QSALTQPASVSGSPGQTITISCQGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG16 Fab Heavy Chain
publication title Structural basis for diverse N-glycan recognition by HIV-1-neutralizing V1-V2-directed antibody PG16.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dqoL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dqoL02
2WBJD 3ARGB 1PAMA 1T7WA 3ME0A 1AHWC 2FL5B 5I75C 3HRZA 5DDHB 3GO1L 1MJ8H 1VGEL 2IWGA 4P4KC 5FOBA 2EH7H 3DI3B 2X1WL 1GIGL 4KTYA 5GGTL 1MFBH 5INDA 3VGHA 3MRIA 5ETUB 3CXDL 4ZS6D 1NCDL 4DJMA 2HFTA 3QFDA 2CDEB 3MCKB 3QHFH 1D5IL 4G7YL 1MFAH 4LCCA 1CGYA 2NTFA 1C08A 3SE4A 4MD0B 4JHWH 2GJZA 4KVCL 1N0LA 1HSBB 2HLAA 4L1HA 3L3OA 3FJTA 5TQ2H 4NRZB 3RJDA 5DUPH 4MAYD 4S1SL 1AGEA 3F62A 5SWZA 4D0CA 4OLUH 3VXRA 5FECA 3V4UH 4QT5B 1PDKA 1VGKA 4A6YB 1KXTB 3QHTC 2FECI 2NLJB 3HNSH 3T2NH 1KTDB 2A6IB 5DWUH 5DK0B 4GXVH 5D7JB 3OAUL 5DJZB 2R0WL 3ULUC 4D9QD 3PL6B 5L88H 1U3HC 2B4CL 1P2CA 4YR6A 2FDBP 1J1PH 1P4BL 4WHTA 3RVVC 5C09E 4PJGF 1QRNA 3ULUF 4KJPC 4JANB 1UWXH 4GW1A 5I73C 2XTJE 3STLA 4RQQB 2HFGL 3B8YA 2E7CA 2R0LL 3B9DA 1JGVL 4XMLH 4KVNH 2D03L 5JQHC 4HWBH 2AK4D 5I66B 3QDME 5LXGL 1WIOA 3RY5A 1CE6B 4XP5H 1MLCA 4LEXL 4LIQH 1MCWM 2YN5A 4OZFA 1U36A 5EO9A 1SJEA 1LDSA 5TDPB 1JHLH 5FDWB 4OZ4A 4OZHF 3U83A 5CIPB 1OTTD 5LG1A 5EOQH 4LSQL 4YDKH 3T8XA 4YHNB 3H9SA 4PLOB 1UWXK 4ZMAT 4NO3B 1LDPH 1MHCB 2AEIT 5MEQA 2B20A 3O2DA 4O2EB 5C6TL 1QFOA 3D39E 4HK0B 3AS2A 3VWJA 3IFLL 4WGVB 1A5FH 3QIUB 1NANH 4GS7B 5K9KB 3WFHA 4S2SA 2QADD 4WJ5A 4ELMB 2I5YH 3D85D 3S37H 1BFSA 3RZCD 3KPNA 4KK9D 4L8DA 4IIQA 2DN7A 2UZIH 4NOFA 4NT6A 4MD5A 2VC2H 4NZRH 3GJFB 1NCNA 1OAZL 4QHKJ 4R7DA 1G84A 5GJTL 4KZEH 1CFNB 4LGPB 5KOVC 2CLZA 4OCWL 2IMNA 3ULUH 3IU3B 4HWNA 5IVZA 3G04B 4M62L 4DTGL 1MI5B 4NQDD 1H3UA 1JNNL 4CADB 5BOPA 4N5UA 2DQTH 3DV6B 4C56D 4ZFGL 4Y1AA 4QY8A 4OCNC 4DQOH 3PWJA 5EU7C 3M1BA 1RV6X 1OP5H 3O41A 1YEIL 4P2YA 4PJIB 1ZA3B 1D5XA 2IBGA 1LO5A 4KHXL 4J3XA 3CX5K 1Q72L 3O11B 2R4RL 4OFDA 4XC1H 4K55A 3HI5H 3HN3A 1AO7D 4UI2A 3RUGF 5FYKU 4NO5A 4K8RC 5IUSA 5EBGA 3CDCA 5JMOC 3ZLQC 3BYTA 1RZGA 1JF1B 5EUOF 3NIFE 1OTSC 3ZTNL 4X7DC 2Z31D 1R0AH 5C0IB 3RU8L 4OUUA 3OKKB 3D3VA 5IR1B 1ZLSL 2HKHL 3MRHB 5JORB 4B53A 4HPYH 1OP5K 5CZKA 2P42B 4HWBA 3RIFK 1L9MA 4TTGA 4RBPH 3QQ9C 5T33L 5F7EH 1EZVY 1NCAH 3JWOC 1DE4B 2W9LA 4LNRB 5E5UB 1A0QL 4G8IB 2CUHA 3HHRB 4NHUA 5T3XH 2EE6A 2FD6L 1WSST 3DIFB 3TPUB 5E03A 4NRYA 4PP1C 4FS0A 3VRLF 3L3GB 1FLRH 1HINL 4GFTB 4HCRL 2V9RA 1IAKB 2UV3A 2AERT 4ZO8A 4OIAA 3LKNA 1X5XA 3IFPA 4LFHG 1A7PH 1KJ2B 5ICXA 5FF6B 1S7SA 2WBJC 4IDJL 4FNLL 3DXAB 4RBPK 3B5HA 4FQXD 2X4PA 4K71B 3HAEH 1NSNH 2HFEA 1KC5H 4ODWB 2FATL 4WI5A 3KPLB 2X7LA 1NFIB 3TO4B 1M05B 1RMFL 4XVJH 4YC2B 3ZYIA 2O5ZH 4ZS6C 4KKAD 2VRAA 4Z7QF 1G7IB 5C09B 1MAML 2HJLA 3RX5A 4NQCB 2MHAB 4P59H 2BFVL 1SHMA 1BWMA 1JPFB 2D3VA 3GRWL 4BYHA 3OBAA 1CR9H 1AQKL 2VYRE 2P24B 4K8RH 3SJVB 1U3HA 1FIEA 4MAYC 1YPZE 4U0RC 5IEKA 4ELKB 1T22A 4BKLB 4FFYH 1B88A 1AXTL 3RTQA 5IK3A 4QRRA 2H6PA 5KZCD 1ZHBB 4M7ZB 4IRJB 4Z9KB 1DUYA 1U6AL 2LV4A 4XNXL 5BXFA 5ANMA 4Z0XB 4JVPA 4XX1G 1HOCB 2AGJL 3JWOH 4KMLB 5J9PA 3VFWA 3VFMA 1FYHB 5IMMA 1NBVH 5BW7C 2DQUL 1DN0B 3CVIH 5IBUG 4H26B 4LNVA 3V52H 5IQ9A 2NY3B 2AP2A 3WNPA 5I2IB 1FO0B 1VADB 1RZFH 4RISL 1CFTA 3BGFB 4PB9L 4ZOEA 3QCTL 2R29L 3REVA 3R0MA 4K3DH 1FL3A 3RBGA 4MJ6A 5A40E 5I8OL 3RP1A 1U8JB 4QHNB 2BOCB 2VDKH 4JRYE 2VZVA 3IDXL 2QQLL 1N7MH 3NFPA 3BKJH 4NKDA 5EBMB 4WHCA 3GSNL 2Z8SA 3V5DB 3PDDA 5EO1B 2XFXA 2A83A 4LRNL 3BGMB 6CGTA 1OTTC 2AK1L 3HUJE 5HJ3A 2JF1A 4KI1A 2EDXA 4TUKH 1DBBL 1WV7T 2RB8A 4ENED 4H20H 1QR1A 3UBXA 4TQEL 5CMAA 2D0FA 4JGMA 1S7QB 3FMGH 3HZYA 5C0BD 3C5JB 2VDRH 4YE4H 5FYJE 4UIKL 4PV8B 4IS6A 4KJYB 3G6JF 2BJMH 1N0XH 1QSVA 3M07A 1B6DA 1OSZA 5C2BH 1XGPA 2W9EL 3VFVA 2GJ6A 4AMKL 1LEGB 5DQ9A 1FCGA 2E8YA 3HAEA 1CDYA 2N7BA 4F9LC 1SBSH 2UWEB 2QADC 4NM4L 3GIZL 4KDWA 5I19H 2NY4B 4Z5RB 5C0CA 4P9HL 2VE6A 2H26A 3DSFH 3R1GL 1D5MA 4KK9C 5IMOA 2ADIB 4MJ5B 3NZ8B 3WMSA 3SGJA 3UTTA 3CUPB 3F6LA 1OB1B 4QRQB 3TBSB 1AXSA 1S7RA 1CZ8H 4JLRA 4PJ7F 4XC3L 4OI9A 5EOCH 1ZLUH 3PGDA 2AEPH 4O4YH 5I17A 2E7BA 3F12A 4OFVA 4K3EL 1YEHL 2E5EA 4G6AD 4PR5B 4KRMB 1I1FA 2DQFB 3NCYP 3MFGB 1J8HB 4MJ4A 3UXFA 2IQAB 1WWBX 3HFMH 3RY4A 3IAPA 1N8ZB 1RIHL 5DJAB 1ZWIA 1RZKL 1WBYA 3BT2H 1JPGB 2YPVH 1A1MB 3H2WA 3KPOB 1K8IB 3MRQA 5C07E 1ACZA 1ZLUK 5ISZD 2Y36H 3SCMD 4KI5D 4Y4FB 2IPUG 8CGTA 1AP2B 2J2ZA 1I8KA 3GMLB 1FE8H 2C1PA 5J13B 1S9WB 1WTGT 1S7WA 1IAOB 1F58L 5F9JA 5DSCA 3DRQA 5CGYD 1ZGLP 2PUQT 2W38A 4Y4HA 1P53A 3NIDF 2A6KA 3BZ4B 3FB8B 4JRXB 2XWBA 4QF1B 1UB5A 2ICWI 2J4WL 1A6WL 4DN3L 4QXTB 3BEWB 1HI6A 1OAXH 3REWA 1KLFA 1F6AA 3NFNA 2ZKHL 4JFEE 5FYLD 4S1RH 2EO9A 4OFPA 4MMXC 2FWOB 2WP3O 3GMNA 3WO3B 4FQXC 1KFAL 1QSZA 3OR6A 4JM2D 3D0VB 3KJ6L 5GSVA 4M61A 3MLSL 1MQKH 1G0DA 3GZKA 1BMGA 4RA3A 3BH9A 4JB9L 4MAYA 4CU8A 4CAGA 1FVDB 4KKAC 4WUUE 5DD5H 4NHCL 1A6AA 1TQBC 2AJXH 4GG6B 5BV7B 1KN4L 3PWUB 2EDJA 4NUGL 2NW2A 3BH8B 2X41A 4ZSOB 5F96H 5F89B 1EEQA 3BE1L 4OLVL 3U2SB 4OB5L 3MRKB 4R8WL 4PIRF 2QV2A 3NCJL 4ACPA 1PKOA 1KCRL 4B41A 4HV8B 4M5ZL 3L1OH 5K9QG 3P4OA 3W0WD 3WYRA 1WIPA 4MNGE 2EDQA 3WUWG 1CD0A 4P3DA 4XNZC 4JO3L 4MYWB 2VZUA 4TULL 5HHOD 3FAXA 4TUOB 1O7VA 2BDNH 2VQ1A 2XICA 1MCQA 3LZFL 3K1KC 1RHHA 5HHME 3DURA 4ZNEA 1J12A 4JKKA 1E6OH 4ZTOL 5GGUA 5KAQF 5L7XL 4KUZL 1OWWA 1S5HA 1YEDB 1HHIB 2OK0L 1ZVHA 5IT2H 5HVWA 3MRPA 2VO5A 2NY5C 3H3BC 3CVHA 5E4EB 3EOAB 1BQHG 5E5MA 4Z8FL 1A6ZA 1YMMD 3T0EE 5E2UH 5C0AE 2YPLD 5EU4A 1FGVL 4WUKL 3GSVA 1AIFB 2DJSA 4XP9H 1H3GA 4LU5L 2PCPB 3L3DB 3GSQA 5LJYH 1JVKA 4G7VH 2DQHH 2HVKA 1HCFX 4GMSL 2DQEL 1R6VA 4P9ML 2X42A 4TN9A 1FIGH 2FH6A 2NY1D 1TJHL 3I6GA 5KSBB 4ENEC 1FNGA 1TTUA 4EUPH 3CGTA 4O9HH 3IJSA 3MV01 2E6PA 2VDLH 2HT4C 4HLJA 4K94C 3RZCA 1I85A 3L7FA 4JZJB 1RI8A 1WAAA 3GDBA 1RIVH 3QEQE 4MB3A 2C4XA 4PJHB 4YHOH 5HGDB 3LAFA 1N59A 4NOBA 4ZOBA 5HHXH 2XA8L 4U2YA 4WNQB 1J5OH 7FABH 1T1YB 4NQDA 4W6XB 4G8GE 1P69B 3LN5B 1ZT1B 3TO2B 4N0YL 4XVSH 4LDLB 3WNOA 3Q1SH 3IU4L 4FFVD 4DAGL 3BVNA 1FZJA 5CJOH 5F3BA 3Q0HA 4ALAL 3LEYH 4UUJB 4NKQB 3OZ9H 1RD6A 4H0IA 3BUYB 4JO2L 5DVOA 1PKQE 4L4TE 4K7PL 5GZND 4CN1A 2Q20A 4JKWA 3LKSA 1YN7B 2PW2B 5BO1H 3BHBB 5DTFB 4CGTA 1ITCA 5CP3H 1DANT 4XRCB 1KB9K 2CLVB 4I4WB 3H3PH 4YFLF 4G6AC 4Q6YA 2DLTA 35C8H 4ODUA 4RGMB 5EULV 2Z31A 1IEHA 1OARL 5EO0B 1QNZH 2PR4L 2EDEA 2DAVA 4HFWA 1INDH 1U8OB 4KTDL 4MQ7A 4OIIH 1Q9WB 4LK4A 2D31A 3QIWD 4I3RL 2R2CA 2NY5H 5EU5A 3ARBB 4J3UA 2B5IC 5B39G 1U8HB 5TF1H 3MRGA 4JFEB 3ARFD 2H8PB 4KROD 5CEXA 5KJRL 3QFJD 4IRSB 3B3IA 3SCMC 2EDFA 4KI5C 4X83A 3IAGC 3MYZA 5HY9A 1HYSD 5DD1H 2BNRA 1N5AB 1TZIA 2WP3T 5I9QB 4BFGA 1MUJA 2QHLA 1URLA 3RDTB 4KI5F 4R4FH 3O8XD 1T5XA 3B6SB 4GAYB 4L9LC 2IPTH 4M00A 4K94H 4WUUB 5GISH 1U8MA 3NFSH 5E8NA 5DD3H 1WEJH 5CGYC 1EGJA 5GRUH 5I71B 5J4MA 4ZPVA 2F8XC 4B7IA 4FQXA 2A74A 5LCVL 4K3JH 5C08E 3VE0B 5KG9A 3ULSB 3BSZL 5D1XB 5T3ZL 3HA0A 5IG7B 1T21B 3N85H 5J7CC 5FUCE 4L29B 1JNHA 3VXTA 3QRGH 2XT1B 4QO1A 1CT8B 4LSVL 1M6OB 1OGTA 4WEMB 2P8LB 3BOVA 1HXMA 1NKOA 5KSAB 1YNLL 4WEUD 4JM2C 2XQYG 3WFBH 2FCBA 5DFTA 5HDBE 1DVFD 2Y6SD 2AW2A 4JDTH 4OLEA 4YDIL 2WUCL 4O2FA 2I27N 3SO5A 2UYLA 3VXOA 3VXMD 1BZ9B 4BSJA 3OKMA 4JM2F 3HPJA 3HCVA 5DT1L 4M6ML 3WHXB 2CDFB 4F7CB 3MGTA 5HHMB 2WK2A 4M7JH 4ETQA 1KPUB 3LKPA 3CMOL 43C9B 2MCPL 1FG2B 4N9OB 1MFDL 1E4WL 4OCRH 4YUEL 2PW1B 4XNMB 4YZFF 4DVRL 3RAJH 1Y6MR 3VGFA 5ICZB 5C0JA 2OZ4L 3W5NA 3KPRD 1MFNA 1T6VN 1IQDA 2QR0A 1NMCB 3MO1B 1XCTA 4YHMH 3PXHA 5HYJB 4Q6IC 4LBEB 3MNVA 1YY8B 1G9EA 1TJGH 4HWZB 2JB5H 2GK2A 5D7SH 1YJDL 1ZA6A 3RGVA 3MBXL 2PETA 5B3NA 4Y2DA 2HN7B 1CD1B 2V5SA 1IE5A 2OSLB 3BJ91 3U1SH 2JJSA 1BVLB 2E7MA 4Z7NE 2YZ8A 4FQIH 4OUOA 3KYNB 2MPAL 3IFNH 3I75A 4RFOL 2VQUA 3TLRA 4P48A 1BFVL 4NWUH 5KVEL 2OYPA 1J86A 4NQED 5IEHA 5F1SA 1JFQL 3V4PL 2A77L 1UACH 4QOKE 1PG7H 4HZAA 3QXUA 4YDJA 2HG5B 3ROOB 1JN6A 5FYLH 1H15B 2BSRA 2FLRT 2W0LA 1C5DA 5JW3L 4MXVF 3INUL 2ATKA 5C0BA 1G7MA 2DL2A 3EYVB 4HFUL 3IDJA 4ZODA 4XHJD 3NBNA 4JQXC 3FFCE 4ONFH 3ZTJG 1W8OA 3MNWB 4L4TB 4EJ1C 1UEMA 2A38A 4HW6A 4R26H 2CXGA 2NY1C 2E6QA 3IFOB 3D2UA 3OX8A 1V3LA 4HGKC 4PB0H 4GT7A 2YUWA 5GS0L 3PWVA 4L8BB 1U42A 5JQ6L 4CVZA 5E2VH 1U8NB 2R23A 1NGPL 3NABL 1HHHA 2R1YA 4DK6A 1G7PB 1KLUA 3B2VL 5DK3A 1B2WH 2BNQB 3VFRA 3QCVH 4WFGD 1PYWA 5SWZE 3VXRE 3AGVA 4PJEF 4FFVC 1EMTH 1ZOXA 3MX0A 3IXAB 1P5UA 3OV6A 4NN7B 4Y5VC 1NUNB 1N6UA 2AXGB 4H5SA 4LCYB 5GZNC 1MVFA 1RFDH 2J8UA 2FX7H 1DDHB 1ZMYA 1LK2A 4UILH 4S11A 3ZKXB 3BWUC 3KXFB 4PRBB 4TUJB 5D70H 1A9EB 4M02A 1W0WA 2AJZB 4B50A 4WFFE 4BQBA 3QIWC 5C08B 1QRNE 4FTVA 4E0RB 2HJFA 2DQDH 5IB1A 4UB0L 5ILTL 4GJTB 5FXCH 3L3KA 3V6FB 4L9LA 2ESVD 4XPAH 3CC5B 5TFSL 3QO1B 1NGQH 3ARFC 4XPHH 5JXED 3CAFA 1FORL 5EUKB 4KROC 1EO8H 4HH9A 4U1JA 3GMQA 1D7FA 1G6RH 4RA0C 4ZFOL 3RIAF 1HYSC 2OQJA 5ADPL 4OBRA 2DQGL 1I8MB 5FCUH 2VITB 5JOPE 4MA3B 3G6AA 4ZS7L 1UZ8A 1V7MH 3O8XC 1P7HL 1T1XA 4OV5B 3NCEB 3MRMA 3W81A 2CKBB 3H9SE 5IW1A 4ZDHA 3DV4B 1U8PA 3CX5J 4PRAB 3U36A 4CVXB 4F7PA 3N50A 2VLLA 1RULL 3FQWA 4Z77B 4GW4B 1JI2A 2J7LA 1I1AB 2LQRA 4XGZB 4AIZA 3TBTA 1QD0A 3GI8H 2VLRA 1YQVH 1UWGL 1IZJA 4MX7A 4OIBA 5HGHA 3SBWC 1B0RA 3WS3A 3X11B 3HPLB 4LLDA 5DVMA 3R4DA 1DVFC 1FC1A 2Y6SC 4NP4H 1VGEH 1KB5H 4I5BB 3EFFA 4KRPD 2VL4A 4Z7WA 2A6JB 5FGBA 3DARA 5SV4A 1AGBA 2FHFA 3NN8A 4HIHA 5IMLA 2QHRL 3CDYA 4U6VH 3CZFB 4FXLA 4LLMB 4CBPA 1CLZL 4Y1AE 2F74B 2EC8A 3K1DA 1MRCL 4PJFA 4AG4H 4KVCH 4AEIL 2AV7B 3W0WA 4F37F 5IW6A 3DO3A 4M6NL 5IB2A 3WL9A 4WW2B 2P5WB 1GGBH 1ORQB 4M48H 4RGND 3PP4H 1HKFA 3SDAD 4YBQD 5T1DL 3GSOA 1OGAB 2IANA 1XF4B 3D3VE 3OAUH 2VLJA 1YYLL 4XVTL 3LS4L 4NN5C 1WZ1L 1YMMA 3O2WH 3DGCR 4LVHB 5HGBA 1CFBA 1P4BH 4X5XA 1X5LA 4APQB 1G6RA 1REIA 1T04A 2HFGH 1TVHB 1Q0YH 1CCZA 4Z7OE 1KG0A 3QUML 2GJZB 1Q9LA 4U3CA 4GRLD 4NGHL 4G9DB 4JFQB 4PRNB 3JV5A 4ZTPL 1AGEB 5SWZB 1BBJA 2O5YH 4JHAL 1FH5H 2CGRH 2YSSA 3BWAA 3MR9A 4OGXL 4XHJC 5J56B 2WIIA 3DROA 2XA3A 5KVMC 3U4EB 3VGEA 4KKCD 3C6SA 2GSGA 2WBKA 2FB4H 3BIKA 3V4VL 2EYTA 1XGYH 3P30L 5CEZD 4WFED 5D7LD 4Z0BL 3E6FB 2VR5A 5FGCE 1QHOA 3CFDB 4YR6B 1LEKA 5C6TH 1J05B 3H3KA 2ENSA 4X4XB 2NY0C 4OFYA 4E41D 1M7IB 2OR9L 3ZZ1A 4FZ8L 2X09A 1BJ8A 2ZZUT 4GW1B 2XN9D 2BOBA 1FJ1B 5EU3B 1KB5A 4HAFA 4NNYB 2V2XA 4Z7VF 1GGIL 3OGCB 1N3NA 4OZFG 4EI6B 4QXGL 4I77H 4JFHE 3HNTL 4WTXA 1M1SA 3Q5TA 5KS9A 3QIWA 2X4SA 2Y23A 2L7UA 3C5ZD 5H35A 2W1NA 3KDMB 4YDVA 4QRRE 5T1LD 1U8IA 2BC4A 1K2DB 1JNNH 3OJ2C 1FL6A 3QFJA 3OKEB 5ANME 1EHXA 5DRZA 2LU4A 5D7IF 4EOWL 4GSDH 1UXSA 2A73B 1VKXB 1YEIH 3OKNB 4UT9L 3B4NA 4Z7UF 1KTLA 2GCYB 3SDDA 4X6CA 4OD2B 1AQDA 1F4XH 1Q72H 4QHUB 4O5LH 5IFHL 5C70A 5JPNB 4OLZH 3W11D 5JXEC 5JOFA 5DHVH 1FZMA 4Y16B 1XF2B 4IMKA 3RU8H 2FZ3B 3MMEA 3CFBA 1J10A 2CLZB 4BQ9A 2VDMH 2YXFA 1TCMA 3F65A 1LO2H 4PTTA 2LAGB 4C55A 3V0WL 3KLDA 1U95B 2W0FB 3SBWA 1TTFA 2YEZA 5DGRA 5I8EA 2HVJA 4UT7L 1MIEH 2AAVA 4QRSA 1R3IH 3HMXA 1LQSR 4XAWH 4QGYA 4WI9A 4HLZH 3NTCL 2LU3A 4WY7L 5I15L 1UXWB 4RAHA 4HCRH 2PYFA 2GJ6E 5EOCJ 4UAOC 3VXQA 5FCSH 5DK2A 3TZVB 5DZOA 1OCWH 3C09C 4LSRH 5C0CE 2ED8A 1MCOH 1RUPL 4FNLH 4PY7B 2WW8A 3KYMA 1PEWA 4KRPC 2FATH 1FN4B 3UTTE 1EBAA 5I74B 1IM3B 3FONB 2BCKA 1R5WA 3WFCL 1RMFH 3LVEA 4BH7A 3G9AB 5BZDB 1M4KA 4JE4B 1EAPB 5HBBA 1I75A 4DGVH 1CGWA 5JR1L 1BBDL 4LLYB 4NO2A 4P5MA 1DBKH 2BZDA 1FFRA 5ALCL 4E42A 1NLBH 4I0PB 4OBSA 3T04D 3HLAA 4U3XA 3BD3A 3GRWH 4JDVA 3PQYD 1J18A 1CXEA 1G7JB 3RA7L 4ZFOB 5FO8B 3GFUA 4KMQA 4Q9RH 2NZ9D 3KPSD 4AQOA 3SGKC 2ORBH 4JHBA 2ARJB 3C6LA 4RGNC 1AD0B 2DM4A 4NKMA 3SDAC 4R97C 4XP6L 2Y72A 4YBQC 1RUAL 4NQEA 2XOTA 3KR3L 1BVKA 1JGDA 4XMPL 2APXA 5I8KH 2X4PB 2H3NB 3FFDB 1PFCA 1SYVA 2Y5TA 1KTKE 1GAFH 1U6AH 3ES6B 4FXGB 4XNXH 2VLKD 5BRZB 3RL2B 2Q7YA 1XGQB 2V2WA 2Q86A 1JWMB 2F54D 2AGJH 5CZVL 1BD2A 3BO8A 4XPFH 4DFHA 5JHDB 1FZOA 4LSSH 4NYLA 2Z0BA 2IQ9H 3BAEL 5CJQL 5DMKA 2KDGA 4ONHB 3MRNB 1JGEA 1H0DA 4RISH 4HIJB 3P11H 4L1DA 5GS1A 4Z7QE 1DLHB 3VGGA 4UINL 5FDYA 2HT3D 4GRLC 1FFNB 2VH5H 3DHMA 3Q6GH 1TTGA 5CP7A 1OP3H 2X4QA 2GTWA 1Y6NR 4OCMC 3WHE1 1T5WA 3GSNH 1TPXB 4JFPB 3C8HA 3SO3B 4P5TB 1T7YA 3WD5H 1NCBL 4D2NA 4KKCC 5IK3B 2ZCKH 5HDOA 2FIKA 2NX5D 3LQZA 1JPSL 5A2KH 1NL0H 3E2HB 4X7SH 3HR5B 1IGCH 1FNSL 1YN6B 1R3JA 1LHZA 1VA9A 3B83A 3QPXL 4K7FB 4KXZI 4IM8A 3D25A 1QYGH 5E9DD 3MJ7A 5FM5O 1OP3K 1F6LL 4HQQL 4DZ8B 5L0QC 3BXNB 4AMKH 4NBYB 4CJ0A 1CFTB 1A6VL 1C1EH 5E7FA 4OJFH 3BD5A 4MJ6B 4P9HH 4XWOD 1WFTA 5FHBH 1RUMH 5LBSL 3S5LA 3R1GH 2O26U 4PRHB 1J9CT 1Q1JH 1X7QA 3ARQA 3BP5A 5DRNB 3W39B 4NZUH 1G1CA 3MCG1 5J57B 1JTOA 3C5ZC 3QWRD 2XFXB 3QNZA 4TSAH 4I48A 5EDXA 5EZLA 4F7TA 3UBXG 2ESVA 2HRPL 1JWUB 4PJBA 3MV7D 1C5CH 3MLWL 1IMHC 1MCWW 2WANA 1S7XA 3EYSH 1QR1B 1DQML 1MCPL 3U7AA 3GSRA 5DJ8A 2ILLA 1I3RB 1DUZB 4G8FB 5FYJL 4ODTH 1KIQA 4UIMB 3VI4E 2Q3AA 3QWOA 3HAEG 4N5ED 4ZNEE 3HI1B 2BSED 1KIPA 1UVQB 4PGDB 5IB3A 2GJ6B 1FGNL 3U6RB 4LLUB 2H32A 2JELL 1ZVSA 5F8QC 5DD6B 1UGNA 2VXUH 1GVIA 2CO7B 1UWEL 4HPOL 4OF3A 4LQFL 3NPZB 1AY1L 2IAMD 2R0ZH 3K8MA 3U7WL 3BDYL 5JTWA 3B9EA 4NQVA 3HC0A 1OD9A 3TIDA 5D93B 3TESA 2VAAB 3MYJA 4G5ZH 1MFCL 4LPUA 4DVBA 1T0MA 3F58H 1JNLH 3P40A 1CDBA 3O4LA 1ZANH 2AJVH 4MA7L 1H5BA 5H94A 2DBLL 1KCSH 2DKSA 4PJ5D 4W6YB 5K9QI 3TT1L 1UYWH 1YNKL 2EEBA 4H0GA 2NZIA 3AAZA 4MDJB 2WV3A 3VFTB 3S35H 1WAAE 3ZDXE 5HHVL 1B0GB 4HC1H 2JIXB 2ZSWB 1WBYB 4XPBL 4LCUB 3O6FA 1RU9L 4NQDE 4R2GB 3MJ9L 4UOW0 4ZXBA 4QYOB 5JLZA 4U6XA 1A14H 1D6EA 1NFDB 2C9AA 5EC1B 5IIEB 1ZHKB 2ENYA 3FQRB 3I3DA 3RWIA 1NUGA 2XWTA 3QI9B 1I1YA 3QNXA 5I0ZA 1KPVB 4M7LT 3MJ8B 3G08B 3EZJB 1DQDH 1P5VA 5F6IB 5TDNA 3EYOB 4N0UB 5J1AB 3MREB 5IVXF 4K2UH 2J6EH 4HXAL 2A6KB 4PJDF 5TJWK 2EDOA 4PUBL 4XXDB 3AB0B 3B8SA 3EOTL 4HZLB 4LLWB 1JGLL 2VZ3A 4NQSB 1N64H 3IDGB 3HTLX 4PJCB 1FFPA 4KFZC 5CJ8A 1NGYB 1UM4L 3REWB 4LVNC 3QA3B 4J3SA 2NZ9C 4UDUA 2EIBA 5DRXA 2VDQL 1D6VH 2GUOB 2XZAL 1LO4L 4FZEH 5IQ7L 4MA1B 4FFWC 4LVOB 2BNRE 1L0XA 3JVGA 4IJ3B 4G43A 4U1MA 5F7DB 3FOLA 3S34L 4RAUA 2XRAL 3UTZB 1JPTL 5D7JD 2C3VB 5FUZH 3UZEA 3QDJD 3PL6D 5E6IB 1AGFA 1YNTA 4ZTOH 1IGTB 3LS5L 5JW5B 1NBYB 1Y18A 3DYPA 1D3CA 32C2A 3T3MF 4FN0A 1JYNA 1EERB 2HT3C 3MNZB 1QOKA 4GRMB 4HJ0D 5F7YC 4HWEL 5FO7A 1KOAA 1CL7L 4J2XA 1FDLL 2VQTA 1GHFL 1F42A 1A1NA 1U8KA 5EC2A 2VLMD 1I4FB 2DQEH 3EO9L 1CGSL 4H1LH 2JCCB 4P9MH 4LDOB 2IJ0C 1TJHH 4XBGA 5AZ2L 2EE9A 2D7MA 3HMWL 2B1AL 2CR3A 2GSIA 4P3DB 4YBLB 1LNUA 4AIXA 4DN4L 3EDKA 2FJGB 3DUUB 5D96C 4JFOA 2R56H 3KAAA 1KIUA 4L4VA 3QP3A 3GHBH 4KK5D 5T1LA 1HKLL 3VDAA 4H25A 1NJ9A 3FOMA 2O5XH 3PIQB 1UQSA 4ODXA 4XWOC 1W72B 5DZLA 1BIIA 3IU4H 2ED7A 3GSVB 3K2UL 4EDXB 3FB6A 4QCIB 4YWGL 2J6EA 2HVKB 1BGXH 3U0TA 3VD3A 3DTXB 3GMOA 3PHOB 2Y7QA 2GAZA 2D0GA 3P9LA 5L2KB 2V2TB 1IC1A 4ZPTA 3D87B 3QIBB 1MI5D 3KPMB 3G5ZB 3LDBC 1D9KC 3VFOA 3SE3A 5F7HA 4O58L 1U92A 5I8CA 1IAMA 3GHEH 3VFSA 4N5EC 1T0PB 4WO4A 3NPSB 3SPVA 1KELL 2B1HH 2E9WA 1MWAL 4HHAA 1YECL 4KZDH 4MD4A 1QSEA 3DX8B 3ET9F 4MLSA 4OD3L 5IF0B 4ZAKB 1IL1B 5IHBA 1UM5L 1JPST 4ONOA 3T4AA 5E08L 2BY2A 3FT4B 5C0BE 4F3FB 2IAMC 5GIRA 1FNFA 1A3LL 4LDEB 4LCIH 5JNYB 4G8EA 4D9LH 4J4PA 1T83C 2ITCA 1O0VA 5K9JH 2KBGA 1ZAGA 2EDBA 4HF5L 3MRJB 3UDWA 2EICA 3TV3L 2CRIA 3O3AB 3GKWH 2ICES 3OR7A 3NH7H 3JUZA 3P0VH 1YYML 4NDMA 5D72L 3Q3GA 3TN0A 5GGQL 5DHYA 1QFWL 5IMKA 1JBJA 2ZP0T 2AJUL 4H1LA 1E28A 3PWLB 4HJJH 5HYSG 4JM4L 1OSPH 3LKOA 5JIIA 1J11A 5E00B 3QJHA 4PP2B 1MPAH 1T3FA 4JVWA 4X9GA 5TDOB 4ZQKA 3U9UB 1CG9B 4DW2L 1TZIB 4F15B 3RI5F 4CU6A 1RUKL 3DXAD 5FAAA 3T2PA 5I1LA 3WFEL 1GC1L 3WE6A 4YDIH 2ZOLB 1KIRA 3PQYA 2HFFB 1QLEL 3EO1B 3V6OC 1T1ZA 4ODHL 2XV6B 4XMKL 5DEFB 2J8UE 3KPSA 2Y06L 3H7BB 2CXKA 5GGRB 3TO4D 4CL7A 4Z95L 3RPKA 4M6MH 4YK4B 4PS4H 5DJCA 5E8NB 4CNIA 1D5ZB 5A2JH 2LTQB 3WSQL 2XQBL 1TQCB 5IV2A 5C09D 2A6DB 2EDNA 5HYEA 3DMMD 1E4WH 3VGAB 3GBLA 3U7YL 1WFOA 4FTVE 1QFWI 2XTJD 3ESUF 1MNUL 2VLKA 1KCKA 1H8OA 3BUTA 3SJVD 1KPRA 4LRIC 4XNQA 3BPLB 4RNRB 1AR1D 3IJHA 2JJTA 4YHLH 4U31A 3DBXA 4OT1L 5EU6A 4Y5YB 2H9GB 2G75A 1OTUD 2CD0A 1TCRB 2WAHA 5D7JC 3N0PB 1EUTA 4L8SB 4LPWA 5TGBB 3TBVB 4IRJD 4JPIA 4PGBA 3PL6C 1T2QH 3HCVB 4WCYH 5I76B 2P46B 2DWDB 3CXHK 4I3GA 4CJ1A 4ETQB 4PG2C 3MODH 3SDXA 3LKPB 2X05A 2DTMH 4OKVB 3FB5A 5D1QD 2NX5A 1MSPA 1JF5A 1M71B 2DQJH 3PV7A 4U1IB 2NY3D 3IDNB 2DLHA 3LN4B 4TPRH 4IRZL 2VLRE 3NCCB 5TH2A 4HJ0C 4JREB 1CICB 4HFUH 5IGXH 4QRPB 2IADB 4R6UA 2FH8A 4ZYKA 4Y5XC 5TE4H 1J1OL 2X4OA 4OLYH 1J87A 1XF1A 3BP4A 3U4BL 5MERB 1IARB 1EAJA 2ADJA 2RQ8A 1FCCA 2ZUYA 2ATPB 2DYPB 5DHXB 4R4BA 2Z9TA 2ZSVA 3CLEH 4Z7WE 2R8SL 4G9FB 3RWCB 3NIGF 1SM3H 5L6YH 4Y2DB 2NXZD 4TNWK 4RZCB 3QULB 2W07A 3RI5K 4D3CH 4O51B 1FBIH 4I3SL 5JQ6H 3L6FA 5BS0B 4GUPB 4KK5C 1INQA 1R24A 1LP9F 3NABH 1LWRA 4PJFE 4F58L 4YAQA 4GS7C 1A64A 2YD6A 3W0WE 3D69A 4PJXF 3B2VH 3R06A 2QLVB 4FQLH 1NUDA 2YA1A 3E6HA 2BSRB 4V1DA 4XCFH 3FT2A 3IDIA 4WV1B 4MWFA 5FKAB 1HWGB 2X89D 1YY9D 3F7YB 3FO9A 4UV7L 1F4YL 5I1HH 1KEML 2VSCA 3EGSB 2IANE 4YHKH 2VLJE 1FAKT 3LRHA 1V8HA 3OX8B 3SKNA 3HE6A 2V5YA 2V9QA 1YMME 2GT9B 5E7BA 4L5FL 4HS6B 4Y8AA 1RJYB 3WXVL 1UM6H 3WXWL 5LWYL 1IBGH 1F2QA 1J8HD 3ARZA 5FKPA 4DKFH 3SOBH 3MV11 5ILTH 4NCDA 5TFSH 3SKJH 1U58A 5ACZA 1HHHB 4IEFB 2QQNH 1KLUB 5AWNH 1DFBH 1EA9C 1OF2A 5E1AA 1GCFA 1OPGH 4PJ5A 5E2TH 3O3BA 4KPHL 2ITDA 4FQJL 3TBWA 1JTTA 1VSCA 5C6WH 1ZT4A 3MSPA 4JN2B 4HJGA 4QNPE 3O6ML 1EJ6A 25C8L 2HH0L 3FQUA 1YZZA 4HDIA 3QXDB 2V9TA 1P4IL 1L7TL 2J8UB 1VDGA 2DI9A 5CINL 5KW9L 2BVQA 5DMJB 4U1GC 1AGDA 3VRJA 3S36X 2L4OA 4AEHL 5C7XH 3FHAA 1BP3B 3QAZB 4JCLA 3ARGA 1MJJA 1R5IB 2FL5A 4M4RA 4JRXD 4A2LA 5FHAH 1QSFB 5DDHA 4OSUH 3TJEL 2AJSH 5ETUA 3TWCL 4P2OA 4M5YH 4OQ1A 2DIAA 1IC4L 2ICCA 3RWEB 3BZDA 3MCKA 2XTLA 1QBLL 5FB8B 5KS9E 1TIUA 3G5XB 4EZMA 3TT3H 1B90A 4HMEA 5I6XB 1NCCL 3G6AB 2IF7A 1F4WH 2LU7A 2P1YA 2DF3A 2GHWB 4P46A 3TO4C 4NRZA 1ZGLM 3W2DL 2YMXH 4YC2C 4LRIA 1GPOH 4UNTA 4W4OC 1GYAA 3KVQA 2HKFH 3QFJE 4ZDHB 4M1CD 1MWAB 4GAJL 4QT5A 5HYIA 4A6YA 1L6XA 1XR8B 3NAAH 3O9WB 4F7PB 2PTVA 1EHLL 3AUVA 3C08L 1KJMB 1A6PA 3DMMC 1HH6B 2NLJA 3FQWB 4XBEL 2XZCH 1KTDA 2A6IA 2XTJC 4X6CE 5DK0A 5DURD 4M6NH 5D7JA 4JY5H 5DJZA 5EN2B 1MJ8L 3PL6A 4GRWE 2EH7L 1XFPA 5HGHB 1MFBL 1EHNA 4JRYD 1AR1C 2F9BT 1I7RB 4PD4K 4JANA 3VD4A 3QHFL 1MFAL 3T3PE 1N6QH 4RQQA 1OTUC 2LVCA 2BNUB 1WZ1H 2AEQH 4JHWL 4IRJC 5I66A 2R39A 5KSUA 1UCTA 5TQ2L 5KSVB 1CE6A 4OLUL 4ZNCD 2VUYA 3V4UL 2OR8A 5TDPA 4JJ5B 5D1QC 1H3XA 3C5SB 5FDWA 3OL2A 3QUMH 1INEH 2GQHA 1Q9OB 3HNSL 4Y2OA 1BVZA 3HZVB 1WC7B 4NGHH 5CIPA 3T2NL 3BRDA 5IROC 1X5AA 5CJXC 4X0KA 5DWUL 4F7MB 4YHNA 1Y0LB 4GXVL 4YHZH 4X8JB 4LGRB 3WL9B 3KPPB 3QRFM 4JHAH 4NO3A 4YLQT 3ALPA 5L88L 1MHCA 2L7JA 4E5XB 3EFDH 4O2EA 1J1PL 4HK0A 1DQJB 3H9HB 4NJAH 4MNHB 1G9NL 1RVFH 2IANB 3QIUA 2BY3A 4FOMA 2IH1A 4PV9B 2VJXA 4XMLL 4KVNL 4ELMA 2NXZC 4HWBL 4NQXB 1G0XA 5J1TC 1XCQB 4U7KA 4X5XB 2CDGA 4XP5L 2DRUA 2W0KA 4LIQL 5J6HB 4ZUUB 1FYTB 2ICEB 3GJFA 4GOSA 4PJ9B 4BFIB 2X4TB 5EIVA 1F4AA 1CFNA 2Z8WC 1JHLL 2JB6A 4LGSB 1YC7A 3G04A 3UP1A 1MI5A 3ALXA 3LMJH 5EOQL 1HH9B 4YDKL 3H7LA 4MJ2A 4CADA 5C07D 4NFDA 3WJJA 1LDPL 3MR9B 2ZUWA 5BMFL 1YY9C 1FNEB 1EDQA 3DX6B 1NMAH 4NQEE 4PJIA 1S9VB 1ZA3A 3MUGB 3O11A 3VH8B 1Z9MA 3NIFF 3UEZA 1PQZB 1X9QA 4YHYB 1UT9A 3MROA 3L3IB 4R7NB 2I5YL 1BD2E 4JKPH 1LEKB 3IAQA 1JUFB 1MCHA 1JF1A 4R96B 4JR9H 3S37L 1WWAX 1CU4H 5C0IA 2YD7A 4AH2A 2UZIL 4M7LH 2C1OA 2VC2L 3OKKA 4NZRL 1FO0H 1PW3A 3QDHA 5L2JB 3WIHH 3MRHA 4JG0H 5JORA 2V5TA 4Y19A 3TH2T 3ARBD 2YD8A 4P23B 4JG1H 4JFED 2EO1A 1A7BA 1XMWA 2IBBA 4KJQD 3EYQD 3QBTB 2AQ2A 2VDPH 4IRSD 4KTEH 1DE4A 3LQMA 4G8IA 4DQOL 1MFEH 2QL1A 2APVA 1KYOK 3MLTB 3OGOE 5C3TA 3TPUA 3Q2CA 3L3GA 1DZBA 4AM0B 1GL4B 5J13C 1U8IB 1JE6A 3BFOA 1IAKA 4RMSA 3VWKD 3HI5L 1FL6B 3ETBF 3ZT7A 1NANI 3QEUB 5J12B 1PG7W 1SEBB 3H0TB 5DJDB 4WUUD 4JJHA 5E8OA 5BJTA 5T1MB 3ROLB 1KJ2A 4WY7H 1KCVH 3NA9H 3DXAA 5JW4N 1R0AL 5LVEA 4H8WC 4ODWA 3KPLA 2F5AH 3TO4A 3PWPA 1Z9OA 4M43H 4X80H 1KCUL 2X9WA 4XHQA 2V5MA 1G7IA 5F7EL 5E99H 4KAQH 5D1ZB 1NLDH 1NCAL 3UTSA 1YPZF 1QBBA 3MMEB 5KSAD 4NQCA 4B5EA 5CBEB 2MHAA 4MGXA 5HI5D 1JPFA 2GFBA 2ESVE 2Z93B 1FLRL 2P24A 4PJBE 3SJVA 4L3EB 1JRHH 1RAMA 4M1CC 4GLRI 5ALCH 4WI3A 4ELKA 4BKLA 5HHMD 1NBQA 2ERJB 5MHSE 5C8JB 1GGUA 1PLGH 1DLFH 3K74B 3O4OB 1RURL 5BV7C 1ZHBA 1SMAA 1NSNL 4X6BB 3V7MA 1KC5L 4WI7A 2X70A 3ZE1E 3V6BR 2VNCA 4Z0XA 5C0AD 2QTEA 2DKUA 1HOCA 2ZG2A 4RIRB 2O5ZL 1ADQA 3EOBB 2AS5M 3F8UB 2DMCA 1ZK9A 1DN0A 4H26A 5J89A 2OTWB 5I2IA 1FO0A 1VADA 5FM5M 5D2NB 4P59L 3O4LE 2UVEA 1CR9L 4K8RL 1U8JA 2DJUA 2VDOH 3GK8H 4MS8D 1J88A 1IGFH 2BOCA 2IMMA 4H88H 3HUJF 3UBXI 3BAEH 5EBMA 4NO2B 4P5MB 4P2CG 4YH6A 3V5DA 3FRPA 5F7NC 4FFYL 5GGTA 4H8WH 1UKQA 3BGMA 3AS0A 4ESKA 2W9DH 2CKNA 3V0AC 3EIFA 3FHQA 1S3KH 3GSUB 2R69H 1S7QA 1KJVB 3N1MC 3ZDYE 3C5JA 1NCBH 5JDSB 3JWOL 2K3TA 4PV8A 1NBVL 4KJYA 3VJ6B 2C4FU 3BJLA 3L5WB 1NC2B 3CVIL 5DI8A 3I9GH 4L4TD 3KPTA 3V52L 1SYVB 2UWEA 4Y8DC 1RZFL 3CJJA 2CPCA 3NACH 4Z5RA 4K3DL 1RK0B 4BZ1H 1C5BH 4RGNE 2D7TH 2X89A 2VXSH 4NYLB 3E3QC 3IXTB 2R1WA 4KKLD 2ADIA 4MJ5A 1N7ML 3BKJL 4JZJC 3NZ8A 1H0DB 3BESR 5BV7H 2Y1VA 3CUPA 1OB1A 4QRQA 2H2PC 4JKMA 5A16B 5DJ2B 1QACA 2V7HA 5CP7B 4TRPH 2H41A 4H20L 4HX1B 2BNQD 3DETD 2PYEB 4PR5A 2OP4H 2DQFA 2VDRL 1J8HA 4YE4L 2IQAA 5DZNA 5GS3A 3LH2H 2BJML 3GEWB 1N0XL 3UYRH 5C2BL 1N8ZA 1IGIH 3BZFB 5L8LB 5HI3D 1DQMH 1MCPH 4OV6F 1SBSL 5F7WC 1JPGA 1A1MA 1KEGH 3KPOA 1T03H 1K8IA 5I19L 3WJLC 3C9NB 3MV9B 4Q9QH 3KXFD 1FC2D 4Y4FA 2HT2C 3D25B 1AP2A 3X17A 4BUGA 4RMUA 4P2QB 5C08D 3GMLA 3ORJA 3V8OA 1ES0B 5HVHC 5D5MB 4WTWA 1CVSC 1S9WA 5FA3B 1CZ8L 4FQPA 3ARBC 5CEZE 1IAOA 4U6YB 4WFEE 4KWUA 2AEPL 1SYSB 4O4YL 1E4KC 1NEUA 4KJQC 4UQ2B 5ABDE 3EYQC 3BP5B 4IRSC 2ZUSA 3BZ4A 3FB8A 1JV5B 3LPWA 1OHQA 3BN3B 1UC6A 2NW3B 5I9QC 4JRXA 4QF1A 2OJZL 5EZLB 5C2UB 3HFML 5CEYB 4QXTA 2Y4SA 3BEWA 3EYFB 1S7UB 3ZMRA 3VWKC 1NEZB 5F44A 3HZMB 4KY1H 2YPVL 1AHWB 4HIEB 3GSRB 5DJ8B 5I71C 1LMKA 5I75B 1RQ5A 2FWOA 2Y36L 3QWOB 4P4KB 5CSBA 5HHVH 2HTLD 4L4VE 4RFNC 3D0VA 1I1AD 3HB3D 4YX2L 1WZLA 2DI7A 4KJWD 3X14B 3CVHL 3MUY1 1ZVSB 4TVPE 2YRLA 1FVDA 2FR4A 5J3HD 4IHOB 1RUQH 1JCKA 1EFXD 3WKMH 3EO0B 2A9ML 1YMHB 3B43A 5KOMC 3GGWB 4GG6A 4PBVC 5KSAC 3TIDB 3ZYJA 5BVPH 5C0DB 3PWUA 5HI5C 4ZSOA 5GQBA 1JZ7A 5F89A 1VB9A 1JK8B 2K9UA 5ERWA 4CVUA 1OAXL 3U2SA 1DSFH 3MRKA 1HCVA 2GITB 1JZ4A 2BVOA 3UX9B 2FO1A 3QCUH 4HXAH 2EDKA 2VZTA 4S1RL 4PUBH 1WQVT 3UPAA 2KH2B 4OLWH 3WO4C 1TZGH 4HV8A 4KQ4H 12E8H 5F7LB 3ULVD 1ACYH 3QUZD 3CFIC 1QA9B 4UDTB 4X4YB 1LD9B 5BZWB 4LAQH 4X4MA 1QSEE 1MQKL 1N2RB 4NIKB 3T0EC 2VR9A 4GXUM 2MFNA 1ED3B 2P5WD 1M7XA 4ZXBB 5JLZB 5DD5L 1PX3A 1CDGA 3BKCH 3GBML 4NWTH 2W91A 1NMCC 4GG8B 2AJXL 1G7HA 1YEDA 1HHIA 2OL3B 2YRPA 4ODVH 1OGAD 2FO4A 4WI6A 4OZHB 2IH3B 2Z35B 4OF5A 1I1YB 5F96L 5JIKA 3BMWA 5E4IA 1KENH 4MS8C 5GXBB 1XH3A 1AIFA 5TDNB 2DM7A 2PCPA 3L3DA 4BSVB 3RWHB 1AFVH 2R4SH 1VFMA 3MGOB 1TXKA 1QLFB 5HI4D 1P9MC 2YHGA 5KSBA 1FDLH 4LEOB 3DRTB 3PGFH 1QPXA 3O6LH 5IKCB 5DRXB 3KHOA 3I02A 5FIEA 5SWZD 3VXRD 1EXUB 3C60A 3EO9H 3RPIB 5H8DA 1WTLA 1J1XL 2BDNL 1SJVA 3T09A 4XNUH 4JFDA 3S4SB 4PJHA 2WMPA 2XIDA 4G43B 5AZ2H 1CTNA 1XZ0B 2NQCA 3DUHA 4OD1H 4U1NB 3STBA 3T65B 3PQYE 2XZQH 4HUMB 2OJEB 1T1YA 3CXHJ 5C0RL 3DECA 2CRZA 3LN5A 4HD9A 1ZT1A 5DJ6B 3TO2A 3KPSE 4HGMA 5E2UL 1YNTB 4XP9L 2OM5A 4NQUA 2OCFD 1HKLH 4WFFD 3S7GA 4UUJA 1OAQH 1QRND 2DQHL 1HQRB 3PDOB 4G7VL 3BUYA 2QQQA 4W81A 1GGTA 5TE6L 4KK8D 4GAFB 3RJQB 5HXMA 3NCFB 2XG4A 5IJKC 1A4KB 2I07B 1YN7A 2PW2A 2VLKE 1DQLL 2AVGA 3BHBA 4P57B 1FIGL 4XRCA 2CLVA 1SBBA 4I4WA 3RUGB 3DETC 1BZQK 5JIHA 4O9HL 3AROA 2VDLL 5D6DA 3WLWD 5HTSA 4MJIB 3GMPB 5EUOB 1U8OA 3SE9H 2XI9A 1Q9WA 5EU6E 5JOPD 1RIVL 2BSTB 2ZG3A 5HHXL 4OM0H 1H9VA 1AJ7H 5HI3C 4J3WA 1J5OL 1U8HA 7FABL 4YDLC 1LNUB 3VXSB 1U3ZA 2HP4A 3H9SD 2H8PA 3ZKXC 3T0AA 4IRSA 4RFEB 4DGYH 1CLYH 1U2CA 4XVSL 4DUVA 4XCNB 5EG6C 4JFOB 2VWEC 2Q8AH 1S7VB 2XKUA 1N5YL 4KK6D 3SDXE 4QTIH 5AD0B 5CJOL 1CDJA 3VFGH 1UH3A 3LEYL 3PV6B 4W70A 3OZ9L 2NX5E 2NY7H 3RDTA 3W5MA 3GM0A 1WZKA 2VERN 5DR5H 3B6SA 4GAYA 3KLAB 1UQSB 4YPJA 3CNKA 5E08H 1TENA 1BIIB 4OGZA 3H3PL 4PYGA 35C8L 2CIIB 1TDQA 3ZL4H 1INDL 3FTGB 3VE0A 5FM4A 4V2BA 3P9LB 3ULSA 5D1XA 2NY5L 5IG7A 2E8ZA 1SVCP 4ZPTB 1T21A 3OAZH 2ZPKH 2WBJB 4HKZB 5HDBF 3VFOB 3LPFA 5TF1L 1XF3A 4L29A 1HIMH 4X7EC 1CGTA 3C87A 1M6OA 2QKIA 2AJUH 2P8LA 4JZNA 4WO4B 2HTLC 5DD1L 3MXWH 2YD3A 1I1AC 3HB3C 5T1KA 2WINB 4KJWC 1BZ9A 4R4FL 4TSBH 4OTXH 4AK1A 5J3HC 2ICWA 3TZVD 4V1DE 2IPTL 2AV1B 4K94L 5GISL 1QEWA 3WHXA 2CDFA 3NFSL 4AT6B 4F7CA 1PX4A 5DD3L 1WEJL 2XPGA 5GIRB 3OAZK 3FQNA 1NQBA 1KPUA 4G8EB 43C9A 3OJMB 1FG2A 4K3JL 2ITCB 4OCYH 2CMRH 4ODHH 4XMKH 5AZEH 2YC1B 4OCXL 3S8WA 1HNFA 5MENB 2Y06H 2PW1A 4XNMA 2IFFH 1HILB 3SE8H 3GIVB 4OZGA 2BVTA 5ICZA 2XNAB 1DEDA 1U3YA 3N85L 4LPXA 3WIIH 1CIUA 3OR7B 2EKJA 4H1LG 2X1OA 1BQLH 1UJ3B 3QRGL 5CBAA 4I0PD 3U7YH 4M1GH 3MO1A 1FV1B 1OQXA 2BVPB 2P44B 1OAKH 5HYJA 3QUZC 3ULVC 4Z7NF 3D5OF 4DEPC 4HWZA 4NKIH 4JDTL 5BCAA 1HDMB 4WW2C 4XPGH 1CD1A 2OSLA 5A2LH 5JO5A 1BVLA 4HS3B 4RCAA 4PJ5E 3KYNA 4OT1H 3ARSA 4X9HA 5DLMH 2AK4B 1R3KB 5I1LB 5IVNA 2J1KA 1KV3A 2MOVA 2VAJA 2ZOKA 2MSPA 2QQKH 15C8L 4OCRL 2HG5A 1CDUA 1QP1A 3ROOA 4R9HA 2CKBH 1H15A 4HAGA 2EIEA 3RAJL 4JFZH 3EYVA 3GMMB 5JHDD 5HVFB 5DFVD 4UZGA 1YDPB 5TE7H 2DMKA 3SEPA 4LCCC 3MNWA 1NAMH 3GUTB 3G6JB 4L8CB 4YHML 4ZFFB 1T2JA 2BHZA 4ZO6A 5HI4C 3SE4C 4ISVB 1QFUH 3IFOA 4YFLI 1TJGL 2JB5L 3MC0A 5KN5B 4PD4J 5D7SL 3IS0X 3U1SL 5ID0B 3U4BH 4FQIL 2FBJL 3IFNL 1F00I 1FAIH 1YEJL 3QJFB 4ODSH 5DMGD 1U8NA 5JA8B 4NWUL 3RTQD 3D85B 2Z91B 4U05A 1AKJA 5M95B 1G7PA 4PJ7B 1MCIA 1PG7L 3OHXA 4PGBB 5FYLL 5FYKE 2BNQA 2WWMD 2RCSH 4G6KH 2PNDA 4JQVA 1RZ8B 3IF1B 1WVZA 3IXAA 3ULVH 1PBYA 3ARRA 4ONFL 2AXGA 4LCYA 4KK8C 4DWHA 2EEDA 3MBEA 4C56B 4NRXB 4LF3A 4FQ1H 1DDHA 2ZNWA 1EH9A 4NZTL 3KXFA 4PB0L 4F2MB 4PRBA 3WLWC 1A9EA 2AJZA 2KZWA 2X4OB 2DLIA 4WRLA 4E0RA 3BDBA 8FABB 1HEZB 2MKLC 5E2VL 1PSKL 4M9OA 3CC5A 1FNHA 3QO1A 3RKDD 1T89A 4L5FH 5EUKA 3WEXB 3HC4H 1B2WL 4BM7A 3PNWB 2Y25A 2D7QA 1EMTL 4KK6C 3AS3A 1I8MA 2VITA 3EZ8A 3HC3L 3IJYB 4MA3A 4OGYH 3VWJC 2Q1EA 2GJ6D 5DJ0A 5LAXB 1KF9B 4OV5A 3AY4C 1CFQB 2FX7L 2CKBA 3RQ3A 5IHLB 5FA4B 2NTSP 3FT2B 4UILL 3D1MC 3DV4A 4PRAA 2CK2A 2K7PA 1U2HA 4PG9B 4CVXA 3WDIA 4POUB 4JN1H 4AZ8A 4IIQC 2HH0H 3AMLA 4GW4A 4CVWA 2VZSA 4C57C 3UTTD 2DQDL 3RL1B 3R8BB 3JSSA 5I1CH 5KW9H 5IM7B 5F88B 2Q3ZA 4XPAL 4ELME 3OG6B 1NGQL 4XPHL 4AEHH 1EO8L 3X11A 3X3GH 3HPLA 1ONQB 3RVTD 1G6RL 2DIJA 1MCKA 4I5BA 5GS2D 5D4QA 3TJEH 5FCUL 1U58B 2A6JA 4EUPB 4LHUA 3LEXB 3V79C 1QUNA 1WICA 1FQ9C 1H8SA 4QWWD 1MI5E 1X5FA 1KYOJ 4R2GD 3CZFA 4MXWH 3JWNC 4LLMA 4PFEA 5SWQA 2YD9A 2F74A 5DMYA 3VDBA 1GXEA 2HTKD 1NCCH 2FIRT 3P77B 2AV7A 4PJIE 3RWGB 3ZT6A 5F71A 3TCLB 3X13B 4HULB 3GI8L 3QI9D 4WW2A 3X3FH 1YQVL 2P5WA 1ORQA 3UTPE 1EBPA 3O2DH 1Z5LB 3WNKA 3QYCA 1IEAA 3EKCA 3IGAA 5KZCB 1IKNC 3B5GA 1T2XA 4XBEH 4I0PC 4Y4HD 3UPCA 7CGTA 1MJJB 4X5LA 1ROWA 5B21A 1OGAA 1LE5B 3T77A 1MRFH 1XF4A 3GB7B 3OJDA 1MF2H 4IOIB 1KB5L 4NP4L 4Y19E 1AE6H 4P2OB 4Z7OF 1SMOA 4U6VL 3MRLB 4APQA 1S7TB 2X1XR 3CFKB 3SKMB 1TVHA 1FPTH 1UENA 4AG4L 2GEEA 1OL0A 4G9DA 4JFQA 4PRNA 4P46B 3V0VB 1JF6A 4YNYB 3LY6A 4JFXB 1GGBL 3DLQR 4M48L 5DFVC 4C54A 3VW3L 1F5WA 3PP4L 4M8QB 3U4EA 5IBTH 3DXAE 5CKGA 4ZUVB 2D7NA 4CW1B 5D71H 1CVRA 3LD8C 3PWPE 4GW5A 1W2KT 3E6FA 3O2WL 4FQCH 3HZKB 3CFDA 5MEPB 1J05A 4X4XA 5AEAA 3SO3C 2PF6A 1M7IA 1G9NH 4Y0GA 5DMGC 3UTSE 3CH1B 3RTQC 4HKJA 2OZ4A 1EEYB 4NQCE 1FJ1A 1FLTX 5EU3A 4F8QA 4NNYA 1Q0YL 3OGCA 1JWSB 2WWMC 5KSUB 3SJVE 3E2HC 1LK3H 5T5NF 2BRQA 4EI6A 2DM2A 1IFHH 3RIFF 1A6UH 2O5YL 4Z6AT 1FH5L 2CGRL 2AI0H 5K9OB 4G42B 1MCCA 4Y7MA 3KDMA 4NN6C 2RIKA 2FB4L 2HJKB 1A9BB 1K2DA 4X0KB 3TVMB 4CUCA 4AQ1B 1XGYL 3OKEA 4FA8A 3LKRA 1YUHB 5BMFH 4RWYH 4K3HA 2A73A 1VKXA 1SJHB 3IRZA 3OKNA 1FFQA 1A7OH 2GCYA 2WBWB 2B5IB 2F53B 2DD8H 2RJMA 4OD2A 4QHUA 5CWSB 1NGXB 3B9KA 2F5BH 4C4KO 5JPNA 2P8PB 3AY4A 5A1AA 5ISZB 3LV3B 3RKDC 5KVDH 2IH1B 2RGSA 3QIBD 3RWFB 4Y16A 2CDGB 1U9KA 2V5RA 2MTPA 4HIIB 4I77L 1XF2A 5DMIH 2FZ3A 1X5IA 1YEGH 3H6JA 1IKFH 2MJWA 2RR3A 3VXPB 2JB6B 2WLYA 3EDEA 4RMQA 5I16A 5ESAB 3CDGB 4YO0B 3S88H 3LPGA 3U30B 1U95A 3CIQA 3VGDA 1Q0XH 2W0FA 2YKLH 4ZAKD 5GRVK 3ARTA 1A4JB 3P9WB 1LO0H 4GSDL 1VCAA 5DUMH 3QHZH 4XT1C 3FN0H 3SGJC 2DQIH 1UA6H 1UXWA 1F4XL 1K3IA 4O5LL 1OT1A 1AD9B 3CH8A 2X4NB 4GLRH 4OLZL 3TZVA 2UWEE 2YRZA 3MROB 2PO6A 1MJUH 4PY7A 3G6DL 5CJBA 3RVTC 3SHSA 4WI8A 4BQ6A 4AH2B 2C1OB 1FN4A 3QQ4A 4I2XB 1IM3A 3FONA 1HHKB 1GRWA 4Y19B 3EJZD 4QWWC 2VDML 5BZDA 1KCUH 1LO2L 1EAPA 5GJSH 2DIBA 4R2GC 3UC0H 5C9JB 5FEBA 3LHPH 4PPTA 1ZLVH 4ZD3L 4LLYA 1IKNA 5DVLA 1W8NA 1MIEL 4I0PA 1R3IL 2YUXA 2LAAA 4XAWL 4U7SA 2HTKC 5GRYA 1J8HE 2BNRD 3IKCB 2NMSA 4RGOH 4AYFA 1S9YB 3DX9B 1IVLA 1G7JA 4LASH 3QI9C 3DI2B 4ZFOA 5FO8A 3H42H 2NY2B 3LEVH 4R4ND 1FHGA 2ARJA 3HS0B 5E8OB 1AD0A 4LKXB 1OCWL 4Q6IB 5BJTB 4LSRL 3GM8A 3MLVL 3RY6C 1EO7A 4Y4HC 1MCOL 3JUYA 5LGHH 2G5RA 3AB0C 1RURH 1ZLVK 3N06B 2H3NA 3FFDA 1B9ZA 4H0HB 5JUEH 1CK0H 3O45B 3ES6A 4FHBD 4FXGA 5BRZA 3RL2A 4AL8H 3PWPB 1XGQA 1P4LB 1JWMA 1F6FB 3ARYA 5JHDA 5IJVB 2PXYB 4DGVL 3RHWK 2VZ1A 2C3HA 4LVOC 5F9WC 4ONHA 3UTSB 1DBKL 3MRNA 4DFIA 3UJTH 1NLBL 2Z8RA 5JA9A 4HIJA 3OTTA 4JRXE 5INCB 4DUXA 1DLHA 4LSDA 2GFBB 1FFNA 1EJOH 4PLNC 1Q38A 3B2UD 1CXFA 5F9DC 4Q9RL 3D6GA 1NBZB 1P7QB 2ORBL 3LQAC 4IOSD 5EZOL 4JFPA 4ZG1A 4P5TA 4N8VB 2P8MB 5GS2H 4UOJA 1F13A 2QEJA 1FFOB 1OVZA 5I8KL 3SY0B 3I3EA 4WI4A 2X70B 1GAFL 4HUUB 1MJ7H 3GMRB 3HR5A 3Q6FA 1HYRC 1YN6A 4XPFL 3ARPA 1MCDA 4K7FA 4KC3B 4LSSL 4PJEB 2VXVL 3ZDZE 2IQ9L 1QR4A 3HI6H 4DZ8A 3BXNA 4GG6E 1GH7A 4C4KT 4LHJB 3P11L 2DYPD 4ZSOE 4G9FD 1EO5A 4YBLC 3BW9A 2FGWH 2VH5L 3RGVD 2JE8A 3Q6GL 3FRPG 4PRHA 4Y2DD 2BHUA 1F45A 3BQUA 5DRNA 1TZHB 3W39A 1B4JH 1WISA 5FO9B 3WD5L 4ZUSB 2Q8BL 2YOCA 4AIOA 2ZCKL 1JWUA 3ZE2E 3VI4F 2XZZA 4X4ME 4YFEA 4ZOAA 5MP6H 2CSPA 2XKSA 1A1OB 2ZWLT 1NL0L 5EZIH 1C16B 1CD9B 4MB5A 3BMVA 4HUVB 1I3RA 5BOZG 1DUZA 4JO4H 4X7SL 1IGCL 4G8FA 4NSKB 1XAUA 4OCLC 5ESQB 4UIMA 3HI1A 4WENB 1UVQA 1QYGL 1QFHA 4K3GA 3ARFB 4PGDA 5DI8B 2EYRB 5EZJB 3VFUA 3K46A 1A2YB 1F90L 4KROB 3U6RA 4LLUA 1VENA 2NXYB 2IG2H 3WN5B 3KNBB 1C1EL 3D2UD 3QIBC 5DD6A 4OJFL 5FHBL 1RUML 1K4DA 4I1NB 5TF0A 3RZCC 2D9CA 1Q1JL 2R1WB 4NZUL 1I85C 1FSKB 2VAAA 4TSAL 3NMEA 3HG1B 3BZEB 2B2XH 3CU1A 3QZWB 3RX8A 2V7HB 4CKVX 4YXLL 5KSBE 3ZDXF 1C5CL 4ZAKC 1WAAF 5AYQA 1X4ZA 1G0YR 3EYSL 4AY0A 3G5YB 1HWHB 3E3QE 3QO0B 2OJZH 2UUDH 4ODTL 1K3ZA 4MDJA 4JFDE 3VFTA 5I1KL 4PJHE 1CFSB 2MQ0A 2MQCA 1B0GA 2JIXA 2ZSWA 2W60B 1QLRB 4LCUA 1BX2B 4PTUB 3H9ZA 4HEME 4PJ8B 5DEGB 4Q74A 2D2OA 2DQCH 4QYOA 4KHTH 1DVFB 2VXUL 3JWDL 1NFDA 1JMZA 2Z31C 2CH8A 3AC0A 2R0ZL 5EC1A 3VXMB 5IIEA 3CMGA 1ZHKA 3TNMB 4FTVD 4YX2H 3FQRA 3OAYH 4HGWB 1Z9LA 4G5ZL 1QSFD 1Z3GH 3CVHH 3EJZC 3F58L 1JNLL 3PE9A 3QI9A 4HH8A 1W72H 4PYHA 5CEZL 1KPVA 2UUDK 3MJ8A 3ESVF 3G08A 3QXTA 1ZANL 2A9MH 2AJVL 5HGGS 3EYOA 1UH2A 3BKYH 4N0UA 5I1IH 5J1AA 1KCSL 3MREA 5TQ0L 3RY6A 2PTTB 1YEEH 4C58B 3RNKB 4JGUA 4XXDA 1CD8A 3M17B 3UZVB 4M6OH 1Z6JT 1UYWL 2DLFH 4HZLA 4LLWA 4M3JA 4HKXB 3S35L 4NQSA 3IDGA 4PJCA 3QDAA 4OF8A 5ENWA 4HC1L 1NGYA 3QA3A 5E70A 1CDHA 4R4NC 3OAYK 3SKOB 2GUOA 1XT5A 1XGUB 2LTQC 3JTSB 5JIPA 1TQCC 1A14L 5E8PB 4P4RB 4BJLA 3BX7C 3VGAC 5JW4R 4G6JL 3I6LE 3OXSB 5DQDH 5F7DA 3VCLB 4X6DA 3UTZA 3OXRB 3MLUH 43CAB 2VLRD 2C3VA 5KVFH 5SWSB 5EWIL 2FR4B 3PDGA 1K5NB 1MHEB 5E6IA 1DQDL 3BPLC 1IGTA 3GSWA 3GBMH 4YXKH 5JW5A 2IFGA 4K2UL 2J6EL 1NBYA 1VPOH 3OB8A 3ZO0A 3VD5A 4MAUH 4Y5YC 2E9BA 3MNZA 1N64L 3ALWA 3PJSB 4GRMA 5ERWB 1DBAL 1BJMA 2X9YA 3B2UC 3R0NA 3KYOB 2YBRB 2BVOB 4OLXL 1WCQA 4FZEL 1D6VL 5ITFB 1I4FA 2DS4A 4UV4H 5B8CA 1G7QB 3MUJA 2P5EB 1I9EA 4F80A 2JCCA 4BFEA 5IFAH 2KQMA 1X6LA 2NY0B 2EC9T 4K7PX 4Z7VB 4JREC 4UNUA 2J8OA 5FUZL 3QG7H 1U41A 2VN7A 2FJGA 1J1XH 3DUUA 3NVQA 2Z92B 1F3JB 2A9NH 1K85A 2G5BB 2XACC 3ZKSD 5BVJB 1G7HB 1E4JA 2FO4B 5C0RH 2IAND 2C5DC 3PIQA 2VLJD 4U6HB 1JZ2A 1W72A 3SGEI 3RGVC 1CXHA 5D8JH 2C3WA 4OZGE 4Y2DC 1XH3B 1EGJH 1R3HA 2JJSC 3ZKND 5TPWL 5D7IB 4QCIA 3K4ZA 4EDXA 5LGKA 2I26N 5TE6H 5CKAA 4Z7UB 1P6AB 1S78D 3BEVB 5HYJE 3M45A 3DTXA 1DQLH 3PHOA 4X7TB 5L2KA 3DO7B 3RFZC 2V2TA 1A47A 2EDDA 2M26A 3BPOC 3QIBA 2Z4QB 3O3EA 3KPMA 3G5ZA 4X5WB 4WFHD 1L9NA 3I02B 1KACB 3C60B 4WV1C 1A3QA 4UU9A 5FK9B 1PZ5B 4U33A 4JFDB 1JP5A 2R56L 3GHBL 5IWLC 3DX8A 4JCMA 4XB7A 3AMKA 2O5XL 5IF0A 4ZAKA 3VFPB 1IL1A 1RZJC 1YC8A 3FT4A 4F3FA 2E9IA 4WDIB 5JNYA 1MRDH 1N5YH 4OFYD 4OQTA 1BGXL 2DI8A 4WEBH 3MACH 2GJJA 2AQ3A 3BP6A 3MRJA 1VFAB 1DBJH 4KRLB 1IC7H 3O3AA 1KGCD 4N8CL 4MZ3A 1GOHA 1P1ZB 1LVEA 5AG9A 1EEZB 2XY1A 3GHEL 4UAOB 2E7LA 2FX8L 2F58L 3PWLA 3MJ6A 5SV3A 2KPNA 5A2IH 2B1HL 5AUMB 1I3VA 4M1DH 1MCEA 4KZDL 3DVNB 4DKEH 4D94A 5E00A 4PP2A 3GSNB 2BNQE 3BPNB 5TDOA 2GTZB 4G6FB 1OY3B 2B39A 3U9UA 1CG9A 2J8UF 4LCIL 4D9LL 3SDDD 4LSPH 2ZOLA 1NAKH 2HFFA 4NZDA 2VXQH 3AVEA 3EO1A 5K9JL 3PGCB 4AJ0A 5DEFA 3QUYA 6FABL 5FGSA 5GGRA 3H7BA 3WBDA 1RJZA 1D5ZA 3WKNA 4KV5E 2OTUB 2R2HB 3KXFE 5T5FH 3GKWL 4JFYB 3NH7L 2VWEE 3P0VL 4S1DD 2A6DA 1DCLA 1IQWH 2EDLA 5C0ND 4OCXH 4PJAB 1ZEAL 4KGJA 4HJJL 3E8UH 3C8DA 4A2MA 1RZJH 1OSPL 4R97B 3LRSA 4X6FB 3HE7A 4PBWD 4L3ED 2Y9RT 1XF3B 1MPAL 4RNRA 3OJVC 2QKIB 2BXZA 5JW4M 1MH5A 1OD7A 4JZNB 4Y5YA 2H9GA 5I1EH 5T1KB 2I60H 1UB6B 1TCRA 2MCG1 3I6KB 4L8SA 2M1KA 5TGBA 3TBVA 1XIWB 2ICWB 4N90E 5I76A 1QEWB 1NCTA 4PS4L 2DWDA 2XPGB 1UADC 5F6HJ 3FQNB 4FQQB 4GRLB 5LGJB 1IT9H 4OKVA 4LSUH 1M71A 15C8H 1TETH 1IJ9A 4U1IA 3IDNA 2AKRB 3LN4A 1MAJA 3QG6A 5FGBC 5JMRA 3WDHA 3K0WA 3A6CH 4OZGB 1I7UA 2VISB 5F3HB 1CICA 4EIGB 4UBDD 4QRPA 2IADA 4Z7WF 3K3QA 4GBXB 3ILPB 4TTDD 1MCSA 5CBAB 4TOYH 3UMTA 5MERA 4YHLL 3EW3B 5I0DA 3A6BL 5D7LB 1B6UA 2DL9A 3CFEA 2ATPA 2DYPA 1ZHNB 4G9FA 3RWCA 2B7DT 2YWYA 3PHQB 5GHWH 1IGYB 2VL5B 4PJFF 3MRFB 1I7TB 5JO5B 5IHZB 4RZCA 3QULA 2XN9B 1T2QL 2FBJH 1N4XH 4O51A 3C6LD 4WCYL 4ZFZB 1DANU 4YEEA 5BS0A 1YEJH 4FABH 4GUPA 2B0SH 3MODL 3ULVE 2DTML 3THMH 1NC2D 2EIZB 2ZOKB 2DQJL 5B39A 3AREB 3NCYS 2BRRL 2OI9C 1CDCA 4TPRL 3NZHH 1B4RA 3UJJH 3C5ZB 2P5WE 1A7RH 4XCEB 1BD2D 2IALB 3ZKNC 5IGXL 4WV1A 3JBG7 1KULA 5FKAA 5TE4L 2JK5B 3F7YA 4OLYL 4LHQB 5B38B 1S78C 5IWLA 3EUUA 1OGAE 3EGSA 3WFDH 2P7TB 3U82B 3P9MB 2R1XB 3CLEL 3S9DB 2GT9A 4NZTH 1SM3L 5GGSB 3MLRH 5L6YL 3E1F1 4HS6A 1RJYA 1DBMH 1E27A 4M9PA 4QHMB 4KU1A 3WHE0 4D3CL 1FBIL 1PSKH 5CCKH 5KANG 3MUZ1 3T1FB 4XP1H 1AKJB 4XI5D 3OHXB 4CMMB 3BD4A 4QNPF 3ZSTA 4YHYC 4FQLL 4OCSH 5E94B 3JV4B 1C12A 1O7SA 4XCFL 4HBCH 4A6YL 4JAMB 4JN2A 4XXCA 3VG9B 3HC3H 1BLNB 1QQDA 4P2QD 5CSGA 1GGCH 3QXDA 3MBEB 4G6MH 2O61B 5I1HL 4LF3B 4V2CB 3FO2B 4NUJB 4YQXH 4YHKL 3CPLB 4F9PA 1E6JL 4LCWB 5H2BB 3MQIA 2ZG1A 4X98B 1R5IA 1UM6L 5EIIB 2ZNXA 1IBGL 1I9RH 4Q97A 5GSRB 5I1GH 1QSFA 4LSTH 4DKFL 3SOBL 4R0LA 4XNYH 3SKJL 3A0OA 4M93B 5KS9F 4WU5A 2QQNL 5AWNL 1DFBL 1U91B 1BFTA 4UTBH 3AM8C 3ARWA 3RWEA 1OPGL 5E2TL 1BM3H 3FQTA 4D0BB 5KVGH 1BEYH 5HPMB 5IVXB 5FB8A 3VD9A 5MHSD 3G5XA 4PJDB 3SDDC 1FNLA 1E4XI 2X1QA 4PRIB 4LOUD 2J88H 5DJ0B 5DVNA 3D0LA 3P73B 3W82A 4X6CF 3MLYH 2VSDA 3MXVH 1MWAA 2LVEA 4KQ3H 5I1JH 1XR8A 3O9WA 4S1DC 3MV8B 1KJMA 5C7XL 4GRWF 1HH6A 2WSKA 4IMKC 5C0NC 1NFKA 3U0WH 2AABH 2FSEA 1W0VB 3HNVH 5FHAL 1GZPB 1KUMA 3O4LD 5EN2A 1WFUA 2BY0A 4OSUL 3WDJA 1VEOA 1HHJB 3T3PF 5I30L 1A3RH 1VFUA 4IDLA 2AJSL 4M5YL 1FNAA 2NNAB 3BRGC 1I7RA 4HUXB 5ESVB 1A6TB 3FL7A 1EV2E 2ERJC 3MOQA 2F54B 3ULUD 1UKTA 1CQKA 2BNUA 3TT3L 4LHUB 1F4WL 1P84K 3O6FD 5KSVA 4DUWA 2YMXL 1GPOL 3BKML 4ZXBD 2HKFL 5SWQB 3V8CA 1WJ3A 2OXHA 4N1EA 4JDZB 3NAAL 1MCFA 4JJ5A 3C5SA 4EVNB 5L9DH 1FG9C 1Q9OA 3HZVA 1WC7A 2XZCL 4U1SB 3T0WA 5D2NC 3QDGA 3S3PA 4F7MA 4PRPB 1Y0LA 5HHPB 4X8JA 1XR9B 3D18B 3KPPA 4JY5L 1DQQB 1PEZA 4UBDC 3VW3H 4OKDA 4E5XA 3O0RH 1GGYA 4TTDC 1IEAB 3IGAB 4M4PA 3I3BA 1DQJA 1IAII 2VN4A 3H9HA 1DL7H 4MNHA 1J0KA 3T77B 3OJDB 1N6QL 4GRWH 5F9OH 4OI7A 4PV9A 3VXNB 3GJEB 3EAKA 2AEQL 2IBZX 5E9DB 4NQXA 1FVEB 3JZ7A 1K6QL 1XCQA 2A0LD 1H3PL 3C6LC 3NCMA 1F4HA 5T3XD 2WZPD 1LEIB 5J6HA 4ZUUA 1FYTA 3MCLH 2ICEA 5FUOH 4PJ9A 1AGCB 4BFIA 1VFOA 2X4TA 4R90H 1I3GL 4X99B 3LIZH 1INEL 3VMOA 2MKWA 1EPFA 3MTRA 1HH9A 3MOBH 4YHZL 4FP8H 3H9YA 3HMXH 1BQSA 1KN2L 3DX7B 1KJ2L 1X3DA 3MV7B 3EFDL 5MEOB 1FNEA 4YPGB 3EYUH 3DX6A 3DUSB 4KRNA 1S9VA 3MUGA 2YPKB 1D9KB 2KKQA 4NJAL 1K4CB 3VH8A 4HG4K 5GS1C 5C3LD 1RVFL 4LLAA 5F1NB 1PQZA 4D0DB 5HD8D 5BRZE 3WUZA 4GW5B 4U6TA 4P3CH 3AXLB 5J06A 3L3IA 4R7NA 3ISWA 1CBVH 1JUFA 4JPKH 5JHDE 4JFFB 4R96A 5DD0H 5E6YA 3ZHLA 4Z18A 4MJID 3KYKH 3LCYA 1R3LB 1T1WB 4HKJB 3IDYC 5L2JA 1IRAY 4XI5C 2IAMB 2J3SA 4P23A 1CFVL 1YEFH 2ADGA 2EH8H 3VXSD 3LMJL 4ERSH 3KJ4C 2EXYD 1DR9A 4RDQG 4OF7A 3TYFB 3MLTA 4XAKD 3PABB 2HRLA 1TNMA 3IDUA 1CTOA 4L4VD 1NMAL 4AM0A 4I18B 3QQ9D 4FG6D 4TVPD 3BP7B 3QEUA 5DJDA 1SEBA 3H0TA 3T0VA 2WLZA 3AM8A 3LKRB 5T1MA 3ROLA 2FJHB 1PVHA 4JKPL 3QEGH 1X5JA 1XGTA 4JR9L 2YUVA 3VGBA 3QQ3B 5B22A 1CU4L 3S3SA 3B9KB 3MPCA 4M7LL 1G7LB 1FO0L 3WIHL 4JG0L 1L0YA 4EN3B 3TC9A 5CSZB 3OPZL 5GGRY 3ARDB 4GKOA 4JG1L 4OM1H 2E7HA 3G6DH 4PRHE 1CF8H 2FYYA 5H37H 4PJBF 5D1ZA 2LABA 2VDPL 1VACB 1QKZH 4KTEL 1KJ3H 4LPCA 5EA0H 3VA6A 5IOPA 3O2VH 4DOHB 1Q9KB 2VDNH 4WO4D 2QSTA 5IB4A 1MFEL 5CBEA 4LOUC 2X5PA 2VR4A 2Z93A 5I16B 3SDCA 1QSED 1LILA 3V5HB 4L3EA 4BZ2H 4ZD3H 5CUSL 1WBZA 4F7EB 1RJLB 3E0GA 3KLHD 3O3DB 3QUXA 4XCYB 3ZE1F 3IYLW 3S36H 1HSAB 1KCVL 5C8JA 3NA9L 3ZE0E 4J4PD 4HBQA 1NDGA 3RVUD 4X6BA 3R8QA 3FT3B 5MEND 1ZE3C 3NGBC 1Q8MA 2F5AL 4DKAA 1H5BC 2PO6B 4RIRA 4M43L 4X80L 3MLVH 3EOBA 1I7ZB 3I2CH 1D5BB 5E8DH 5E99L 3P0YH 4KAQL 3TN0D 1NLDL 3F7QA 4HUNB 1QO3B 5HDQH 3QDJB 2C26A 2OTWA 3MUHL 1T7XA 1OT2A 3DYMA 3MRRB 3QQ4B 4LPVA 4E9LA 5D2NA 4HUWB 1A7NH 2P48B 4CN4A 1U8LB 5J8OA 3O6FC 1MCRA 1FVCB 3V9FA 1JRHL 5EPMB 4EBQH 3TCXA 4ZXBC 2IC2A 1MEXL 5D2LA 3ZDYF 1PLGL 3JV6A 3C8KB 3I85A 1DLFL 1CYGA 4Y5XB 1PD6A 3GSUA 1KLGB 1ZGLB 2AQ1A 4YHPB 5EZOH 1KJVA 4OI8A 3JTTB 5JDSA 3L5IA 3P4NB 3RWDB 1NFDE 3VJ6A 4NPYB 3L5WA 1NC2A 1MHHB 4MB4A 1F02I 2H32H 1LP9B 3OKLA 5F1KC 4PJXB 1C8PA 1HXYB 1RK0A 4KDVA 2ZUQB 1ORSB 1ZTXH 2VDOL 3GK8L 2A0LC 4XX1E 3W9DB 2VXVH 1IGFL 5E56A 4N0UE 4H88L 3Q5OA 3MA7B 3QXWA 1JRHI 3IXTA 1FRGL 3GI9H 4BH8B 1RK1A 2RBLA 5EBLB 3JVGC 5CS7A 5EU6D 3K80A 4G80B 4H8WL 5GRJH 5A16A 5DJ2A 4PJCE 3BISA 2W9DL 1S3KL 3L3JB 4L9DA 2R69L 4HX1A 1QVOB 1CE1L 3N1FC 2PYEA 5T5NG 4WWKB 3JWDC 3FRUA 4KMTH 3DJ9A 3RNQB 4EDWH 4I0KA 2Q8BH 2EEAA 3I9GL 4X6DE 3BZFA 2YA0A 5HD8C 3QNYB 3FB7B 2ZCLH 5K59E 4EXPX 3NACL 4BSWB 3Q6FB 3KS0H 3C9NA 3MV9A 2CIKB 4BZ1L 4QRTA 1C5BL 2R2EA 3T4YB 2D7TL 2VXSL 3ZYOA 4P2QA 2OL3H 1F90H 4CU7A 4RX4A 1T66D 1ES0A 5D5MA 5BV7L 3TH3T 5FA3A 1K8DA 1NDMB 3GSXB 4FQHB 4OZIA 1BPVA 4U6YA 3BW9B 1SYSA 3QWQB 4UQ2A 5F7MC 2EXYC 3BQUB 4TRPL 4JPVH 2GY5A 2AXJA 1JV5A 1Q94B 3ECBB 2OP4L 3FAWA 2NW3A 3N1GC 5EIQA 2JCCE 3U9PH 3VFNB 4U1GB 2UZYB 3LH2L 5CEYA 4J12A 4FG6C 4QXUL 3UYRL 4YXLH 3EYFA 1S7UA 1NEZA 5IESH 2JLLA 3HZMA 2YK1H 1JIBA 1IGIL 1UCBH 4MCYB 5ADOH 4V1DD 3OB0H 1AHWA 4HIEA 1KEGL 1T03L 4RMWA 2EDRA 4Q9QL 3QUMB 1HN1A 4P4KA 5I1KH 4MMZC 3U46B 1CXLA 3VFUB 4XWGH 3W11C 3T0DA 2GYSA 3X14A 5HHNB 2H1PL 4UT6L 1DTUA 3HE6D 4IHOA 2N1KA 1U8QA 3JWDH 1K4DB 3EO0A 3SE3C 4JPWL 1YMHA 2X4UB 3FKUS 3GGWA 3MA9L 3BI9X 2D9QB 1UZ6E 5C0GB 5FFLA 4D9RD 4WO4C 3OB0K 4NO0B 5C0DA 1KB9J 1NC4B 5CEZH 3MFFB 5L2KE 4R3SB 2J8HA 4G3YH 1JK8A 1L7IH 3OF6A 2BXYA 2IPKB 3DMMB 2GITA 5IHUH 5TQ0H 2XTJB 3KLHC 4KY1L 3B9AA 5HGAB 2X6MA 3CSYA 2DBJA 4PJGA 5CD5D 4J4PC 3QDMB 3RVUC 1QA9A 4UDTA 4X4YA 1LD9A 5BZWA 4Y88A 3BIAX 1N2RA 3UDWC 4Q2ZB 1ED3A 5AYUH 1WWWX 1RUQL 3TP4A 5E6ZA 3WKML 5LQBH 1UJ3C 2QJDA 3L5JA 1P7KB 3TN0C 5DJXB 4G6JH 4GG8A 3ARGD 5HVGB 3BRFA 2OL3A 2J5LB 5BVPL 4OZHA 3VXUA 4TVPH 2IH3A 2Z35A 5EWIH 1IC5H 4UTAH 3QQNA 3D39B 3FQXA 4DCQB 4P2RA 3F7VB 1DN2A 5D1QB 4P2OD 1DSFL 3MLZH 1GOFA 3QCUL 2CLRB 5IBUB 4NNPH 3N1PC 3QEHB 4OLWL 1TZGL 5F72S 3RWHA 4BSVA 2Y07H 3SGEH 4KQ4L 12E8L 3MGOA 3UTOA 1QLFA 1ACYL 2WUBH 1DBAH 5ENWB 1L6ZA 4LAQL 4LEOA 3DRTA 4P46D 1FP5A 4ONGH 5FYKD 4OLXH 5IKCA 3P3YA 1EXUA 1PZUB 3RPIA 2W59A 1EZVX 3S4SA 3BKCL 4NWTL 1T0NA 2NXZB 4X6EB 2MNUA 1XZ0A 5E95B 4U1NA 3T65A 4X6DB 1XF5A 4ODVL 2OJEA 3WLBB 2HT4D 4KH2A 1M7DA 3T2QA 1ZSDB 5C0FB 5DJ6A 1EUUA 1Z0NA 3TYGL 1KENL 2UY7A 3G5VB 5GRZA 3GSWB 2JJTC 3LKQB 5EBWB 3UJIH 3PDOA 3T08A 1HQRA 4ETYA 4OGAD 1AFVL 1A4KA 2I07A 2R4SL 4P57A 4EI5B 4ZO9A 3RUGA 3SQOH 3PGFL 3O6LL 5TPWH 4MJIA 3GMPA 5EUOA 5B8CB 1ZT7B 5D7KD 1TVBB 4YIQB 2HMID 4XNUL 2VABB 2BSTA 2APFA 2QSVA 4OD1L 4P5KB 5CHNB 4DZBA 2Y5EA 2XZQL 4XCCH 3SDXF 4PBXA 3VXSA 2BX5A 3TVMD 2BK8A 1DP0A 4RFEA 1IEBB 4XCNA 1S7VA 3BN9D 5AD0A 1HQ4A 1T66C 2F53D 3PV6A 4ZUTB 1I9JH 1OAQL 3QIUD 2R0KH 3KLAA 5JW4Q 1C7TA 4JO1L 2APWA 4NKOB 3TA3B 1QPPA 1R3HB 3VG0H 5D9SB 4LAJH 4QRPE 1BAFH 4ZO7A 2CIIA 2W65A 2AJYH 4IMLB 4ZUWB 5I1DB 1KNOB 3SE9L 3FTGA 4FXKB 2R9HD 1IGJB 4MNQA 3TFKD 1QZ1A 4G9FE 4OM0L 4N1CA 1AJ7L 2WBJA 3O3EB 4HKZA 3FO0H 4N8CH 3D9AH 1VFBB 3OWEA 1IM9B 4DGYL 1CLYL 4UU9B 2FX8H 2F58H 1U93B 2Q8AL 5E24E 5BS0E 3VMNA 1YPZB 4QTIL 2WINA 3VFGL 3AFLA 5CLWA 2NY7L 4HUKB 4HXBH 5DR5L 3HE6C 3TJHD 3UTPD 2AV1A 3FN9A 4BK4A 3OKDB