4DQOL

Crystal structure of pg16 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
QSALTQPASVSGSPGQTITISCQGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG16 Fab Heavy Chain
publication title Structural basis for diverse N-glycan recognition by HIV-1-neutralizing V1-V2-directed antibody PG16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dqoL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dqoL02
4BFBD 4JRXD 4HEPG 5D2LF 3BMWA 3LOWA 4DOHE 2CKNA 4X6CE 3SGKC 2H9GA 3T0EB 5C70A 2XQBH 1IEAB 4HV8A 32C2A 5DQDH 4PJ7E 4ZDHA 5GS0C 5TF1H 5B21A 3EJZC 5GZOC 1N6QH 3MV8B 3VFVB 1U8HB 3VFMA 4MCZA 3E6HB 1S7WA 4FXGA 4X98B 4CJ1A 3ULVF 3V6FB 1CR9L 2B39A 5IOPA 4LSVL 1AGBA 1OARL 3CDFA 3IAPA 3KYOB 3OAUH 6CGTA 3TN0D 1CFVH 1XR9B 1LEKA 2CSPA 4LFHD 1BP3B 3MRKB 4HIHB 3MV8E 3WIHL 1I85A 3QQNA 1L0XA 3WJJC 4RA0C 2EDYA 2VZVA 3QIUB 4HKJB 3MR9B 2GT9A 3L3KB 4G9FA 4R8WH 5IVZB 2DBLH 5JA8B 4U6TA 2RAMA 4OF0A 1AC6A 4PGEA 3DARA 4YHMH 4OLWL 4P5MB 5FHAH 5MENA 1Y0LB 3O41B 2EZ0C 3GKZA 2C7UA 3PHOB 4F33A 1E4WL 1IM3B 3C8KB 2X6MA 5D7IB 4LDEB 2ERJB 4BH7A 1QVOA 5C0IA 1S5HA 3LMJL 5TE6L 3I3DA 3TJEL 1KEMH 3MV9A 3NIDF 5KOVC 3HB3D 4FXKB 1RZKH 5HYQA 1N26A 4ZFGH 2RQ8A 1IM9A 2FX7L 5M95B 4KKLD 1RVFH 3MSPA 3RZCC 1WT5A 3GJFK 2BNRD 1JF5A 3X14B 3HI6H 5E9DA 4CW1B 1N4XH 4UV4H 2JJTA 4Z7VF 5F6HI 1JJUA 2PYFA 5AWNH 2YD1A 4AT6A 4R96A 1EXUB 4HMEA 4Y5XB 4HWZB 3O6ML 4OZHA 4OCNC 5GS1B 2ORBL 1KENL 1YECH 2R69H 3S88H 4LSRH 1JPSH 3V0VA 3MNVB 1LHZA 3CMOH 2NY3C 3V6BR 4HPOH 1I3RA 5HBBA 1BPVA 4LLUB 3FB6A 2FEDD 3D48R 3KPSA 2X4SA 1X7QB 4EI5C 4WUUA 1P7QB 4K2UH 3OKDA 3HG1A 5ID0B 5ERWB 5EORH 3H6JA 5FYKL 5HXMA 5HYSB 5C8JB 5DMIL 1K2DA 4TNVK 2RCSL 2NLJA 1KPRA 1MHEB 4XP1L 2QQLL 4JG0H 3WLWC 1U93B 2MTPA 2ICWI 4IOSD 4LHUD 4TNWK 3DV4B 4X9FA 5FYLE 3WDJA 5I8OL 3CUPA 1N59B 1JE6A 4PJEB 1HNFA 1MVUA 2NTSP 3DVNA 3QQ9C 4I8DA 1HH6B 1SEBB 3O4LB 4MAYA 3FONB 1PKOA 3VXMA 5T3ZE 2BC4A 4NKDA 4WY7H 4JHAH 3R8BB 3QHZH 4PJEE 5CD3B 2HLAB 3HZMA 3MACL 3T3PE 2WINB 4HXAH 5EU6B 3O4LE 4XMKL 2NW2A 4JJHA 1DLFH 2YOCA 4MA8H 4MQSB 3O4OC 1B0GA 3ETBF 1F02I 3RZCB 2ESVA 3DNKA 1J8HA 3MRGA 4BUHA 5FHBL 4S1DD 1C12B 2JCCA 2OTWB 5A40E 3DTXA 1CE1H 3G9AB 1JGEB 4YHIA 5EU6E 3U7YH 2NY1C 1SJEB 2DI7A 2CH8A 4X0KA 3ZDXE 4KRPD 1ZLUH 2E7BA 2GI7A 3IFOA 1A6ZB 2NY3B 3BW9A 2HFFA 1UWGL 4XVSL 1M71A 2G5BB 1F4YH 4N1HB 4DW2H 1LEGB 2NY7L 5LXGL 3ILPA 2Y07L 3BDYL 3S5LG 4EI5B 4DKFH 5J6GA 4CJ0A 5CJXA 4KUZH 4HC1H 4PLNC 1NBZB 3MOAH 1A4JA 4UNVA 2EE6A 4JPIA 3CFKA 2B2XH 3MQIA 3WHE1 3DETD 2P45B 4TVPL 2FB4H 3FB8A 4NQEA 3U6RA 3HMXL 3TO4C 5JR1L 1NSNL 1YEJH 5D7LA 1U8NA 1XH3A 5IW1A 3WNOA 4WCYL 3RVVC 3D39A 5C0CA 1TTFA 4HGWA 4PLJD 1BLNB 3KR3L 3QDJB 3GJFB 3QRGL 1IAKB 3QDAA 1GHFL 1AKJB 1AHWA 4ZOCA 1DANU 2P1YA 32C2B 4ZDHB 3MREA 3S3JA 2ITDB 1RZJC 3MYJA 3KPPB 3RVXC 1V7ML 1QLEL 2BX5A 3FB7B 2UY6A 4X5WB 1MI5B 1SVZA 2BVEA 1JHLH 1S7WB 4JO4H 4WU7A 2AJYL 2CLRB 1M05B 4MMXC 1SMOA 5IIEB 3ARPA 4NZTL 1A7NH 3O4OB 1YY8A 2JK5A 2CK0H 1UACL 2DMKA 1IC5L 2P47B 4XNUH 3IDGA 1DSFL 5TE4L 5GZNC 1MI5E 1DJSA 4IRJA 2B5IC 3H9ZA 1DBML 4PGEB 3TBVB 2NY1B 2IBZX 2YXMA 1IL1A 1CGTA 4F33B 2Q7YA 4MAYC 2J8OA 3LH2H 3QEHA 1RHHA 3SDXB 4I3GA 5C0IB 4R90H 4JZOA 1FC1A 1S5HB 3NIFE 2YRZA 5ALBH 3VG0L 3T0DA 1BBJA 4MXQD 4P9HL 3MV9B 4QYOB 4HUXB 2WWMC 4GQ9H 5HYQB 4ZPVA 5EBMA 4YXKH 5B38B 1VFBB 3MROB 2OL3H 3TCXA 4URTB 2EECA 3T0ED 3ZLQC 3GMNA 3SDXE 1NCCH 1V5JA 3ECBA 3SDDD 1CFTB 3MV8D 3V6OA 4UB0L 1UJ3C 1W72H 3MV9E 5E5MA 5IUSA 4K3GA 1YYLL 3TO4B 2GUOA 1Z6JT 5F6HJ 1ZVSA 4F80A 2EC9U 1S7RB 2OJZL 1U41A 2CR6A 1OGAA 4Y2OA 4DCQB 4KI5D 4J7RA 1FL3A 2L7UA 3BZDA 5HHXH 3NZHH 1CS6A 4ODSH 3U7AA 3V0VB 4XBPA 4EDWH 4KVNL 1U58A 1I3RB 2MQ0A 3QIUD 4QGYA 4RFOH 3IFNL 1HI6A 2EDNA 3FB6B 3QXAA 5HYJE 2V5TA 3VJ6A 4HK3J 2A74A 5B39G 1L7IL 2GW5A 4WUUB 2QLVB 1F6LL 3O9WA 4PJBB 4KK9D 3WYRA 5IKCB 3OKDB 1KIPA 4NN7C 5C0RH 3H9SD 1QFUH 2R8SL 4MNGB 1K2DB 3ZYOA 1BJMA 3JWDH 3D0LA 1LDPH 1GOHA 3FCTA 4GMSL 2YRPA 3RWJA 1CGUA 1RUKL 2VDML 3ULUL 1U3ZA 4U2YA 2YEZB 3LCYA 2ZOKA 2GK0A 4WUUE 2SEBB 2ICWJ 4W6XB 5HHVL 4PJBE 5EZLA 3CUPB 3HA0A 2OR7A 4I3RH 3TF7C 2JELL 1XFPA 2B5IB 5L2JA 1MVUB 4MNGE 5JPNA 3RI5F 5CHNA 1ZSDA 3S36H 5EIQA 5DJCA 4MX7B 4AL8L 2IALA 4F2MA 4MAYB 4PJ8C 2AEIT 4XMPH 4DZ8A 4HKZA 4M02A 3H9HA 2B7DT 1UQSB 1ACZA 1IGYB 1PLGL 5GRXG 4E9LA 3GM0A 4XP9H 3IDNA 4QGTA 4JO3L 1RJZB 1H5BA 4LLMB 2BHUA 3FQRB 3B2VL 4OZGA 1S7QA 1NFDF 3UJTL 3VXRB 4XNXH 2NW2B 2WIIB 4FQXC 1B0GB 1MIML 5ID1A 1WAAA 5HHPB 1D9KA 1J8HB 3MRGB 1H3WM 3IXAA 4G8GB 3P73A 5I2IB 3HPLB 2UWEB 3P4NA 2AJSL 4MMZC 5GZOD 5C07D 4HJ0D 1YEHL 2FJGA 1UJ3B 1P7QD 1QSED 2JCCB 1T21A 2PN5A 1RUML 4NO5B 1X5HA 4ODVL 5AYUL 3VXRE 4F7MB 1PSKH 4A2LA 3O6FD 3ZKNC 2VIRB 1JBJA 3BKYH 5BV7C 4FP8H 3UTQA 3X17A 4G8GE 1J8HE 3UJIH 5FK9B 2VDOL 2UWEE 1PBYA 4XWOD 1OAYH 1G6VK 5BO1H 1KFAH 3K4DA 3DROB 1OW0A 3DJ9A 3T3MF 2JCCE 1M71B 4R3SB 3ILPB 2VZSA 3LY6A 5JORA 3ZE1F 1UG9A 1TZGH 1NJ9B 1T66D 1UJTA 1DUYB 5DHVH 1EEYA 1JK8A 2P49B 1BFVH 1MJJB 1FNSH 2EZ0D 5DMGD 4NN7B 3JV4A 5BV7H 4JN2B 5E0QA 4GAYA 1A4JB 1AD9B 3B3IA 5J4MA 2P48B 5KVGL 4XCFL 4J3TA 1LD9B 4JPIB 3CFKB 4YR6A 1Q72L 2JB5L 2KQNA 5IM7A 2HFTA 4IEFB 3TBWB 1UM5H 3G6AB 5IV2A 5C0FB 4WW2F 1TJHL 1JWMA 3PJSB 3EJYD 5DJAB 1T6WA 1DL7L 1TQCC 1XH3B 5IW1B 5KSVA 1JNNH 3V5DA 4HGWB 4H0HB 4JAMA 4OLYL 1FVDA 2IQ9H 2J4WH 5JDSA 3UXFA 4PJ8B 2EH8L 3RUGF 4O2FA 3MREB 5T3XE 4KJPD 1Y6NR 1OAZL 5GGQH 2FX8H 3RNQA 4OLXL 5FUOL 2BY3A 5ESVB 3TN0A 4NRXA 4NNPL 3EDDA 2XZAL 5IG7A 3WFEH 4DUVA 2A0LD 4FQXB 3VWKD 2NY3D 3MLTA 4LSUL 1HZHH 2CMRL 3VU2A 2R29H 3IDGB 5F7DA 4MB5A 1IGFH 2CO7B 2OTPA 2CKBA 4EZMA 2EEDA 3IGAA 3WEXA 1J87A 4CVXA 1OTTD 1JGUL 2X4QA 4P59H 4L8SC 5BV7B 4FFZH 2HT4C 4OFPA 2NR6C 5EUOA 2Q7YB 1QOKA 5DRZA 2Y5TA 4Z0XB 1ZGLM 3WLWD 3QEHB 4P3WA 1CL7H 3LKNA 2ZUYA 4JFPA 2FX9H 4LASH 4JZOB 2K1MA 3LEYL 1GSMA 3RIFK 1BBJB 2FATL 4P2QA 3GSUA 2HJFB 1H5BC 3QDJD 4ZPVB 2I24N 4ODXB 3N1QC 4MD5A 4XAKD 2MWCA 3GO1H 3NN8B 4X6EB 4HHAA 4ONHB 4R4FH 4NQCD 1ORQA 1NQBA 3PWJA 35C8L 1EFXD 4ODTH 5FA3A 4W6YB 4ZXBC 4LP5A 3MRMA 3SQOL 5DLML 4F7PB 4LPXA 1M7IA 3H7BA 1B4JL 1WFNA 2H1PH 1ZVSB 5LGKA 3D3VA 1TQCB 1BQUA 2J88L 3QFJA 1OGAB 1RV6X 2GIYA 3B2UC 4AEFA 2DJ4A 1JPFB 5HI5D 3LS4H 1CFQB 2NW3B 1N7MH 4P9MH 3MA7B 4MS8C 3RDTD 2FIKB 1JIBA 2ZOLA 4MWFA 4XCNA 1U58B 2QSCL 4LKCB 1JZ7A 1HI6B 3QXAB 4MVBD 5JW3H 5J12C 3MXVL 4M7JL 4MJ2A 4MCYB 1B88A 1OGAE 2NY1D 1OT1A 2NXYD 5F70A 3QAZC 4EI6A 4GRWB 1AD0A 2OTUB 1GGCL 4LQFH 3ZYJA 1I9IH 2XT1B 1F5WA 4TN9A 2FD6H 3WIIH 1B2WH 3D0LB 1CBVL 4LHUA 5KAQF 2ZCKH 1QQDA 1F4XH 4EEEA 3QPQD 4NHUB 4KKCD 2BRRL 3X13A 4IRSC 1S9KC 2BFVH 2VRAA 2A6JA 3ALWA 4GRWE 2VC2H 5GGVL 3OJ2C 3O2DH 1EX0A 4EOWH 5DGQA 5JPNB 3BEWA 1GGUA 4L8SB 2W9DL 4LCWA 1KCSL 5K9OB 3LQAH 2IFFL 1X5IA 3NCEB 4F2MB 2FDBP 4JFXA 3LZFL 4LU5L 4NQXA 2C9AA 3FFCA 1BMGA 5C0BB 2GITA 3TNNB 4MXVF 3CFDA 3F5WA 3C9NA 1GC1C 4O2EA 4OSUL 3H9HB 2OYPA 4ELKA 3ZHDA 2VLRD 2EE3A 4RAVA 1YN7A 3W9DA 4FHBD 3C09C 1HCVA 5EFIA 4QHLA 1S9WA 4BZYA 4OCRH 1H5BB 5CKGA 4OZGB 3NTCH 4ZO9A 2ZZUT 4K3JL 4YE4H 4IJ3C 3JWOH 4JM2D 4NRZA 5BOPA 4XPAH 1G7PA 1DLHB 1UENA 2LE9A 3HKFA 3P4NB 4QT5A 4ZXBB 1QFWH 3HMWH 2VAAA 3VDCA 4Q9RH 4BZ1L 1V05A 1MLCB 2EYSB 4OZGE 3PWLB 3O0RL 4OZFH 5FGBA 5T5NG 4H1LA 4P57B 3G5YB 1IKNC 5INDA 5E94B 4GW4B 1MFCH 3VWJD 5I1JL 1H0DB 2E6JA 3L5XH 5I1AB 5GZND 5I71C 4RNRA 2GKIA 5JO5A 3K8KA 1QEWA 5J12B 3WL9B 3NA9L 3P9LA 2AEQH 4OCXH 3K3QA 4PS4L 4RMRA 2FLRT 4E42A 3QAZB 4FFWD 3JV4B 3FMGL 4JFDA 5E2VL 4EUPA 4KDVA 4RMUA 4MSWA 3QO0A 4YEFA 3RNKA 2FBJH 2D4FA 2M26A 3GRWL 4YR6B 4N8VA 4WEBH 4KDTA 1MCQA 3RAJH 4LVHC 3RHWK 3OMZA 1OAQL 1P4IH 1ZT4A 3KDMA 2Q8BL 1NLDL 1JWMB 4L8BA 4IRSB 2ATPA 5KSVB 1RJCA 5IVXA 3ULUF 3V5DB 3L3IB 3HAEG 3L7EB 4LEOA 3KLAA 1II4E 1YJDL 1BBDH 1FVDB 1MFDH 5DYOB 3MCKB 1Z9SA 1OQOA 3IJHB 1PEWA 2B8OT 4AIOA 3FO1B 1WTLA 3UX9B 3RX8A 3IS1X 1QFWM 3MRCA 4U1MB 1KJ2A 4PRBA 4KROD 2O61B 2LABA 4X6BA 1DBBL 3D25B 3VI4F 3GB7A 3C09B 1A9BA 4J12A 1AXTH 5KS9B 1CT8A 2NY5H 3PP4H 5JHDA 4IJ3B 2PR4L 4CADA 3ROOB 4WFGD 3VFUB 3DMMD 3EYUL 4Y1AD 5B39A 1U9KA 4Z7WA 3ZE2E 4ESKA 1EHLL 1BVZA 1QSZA 5T1MA 4C56A 1YDPB 2O5ZL 5C86A 1YQVL 3UTSB 2E5EA 2CKBB 1SY6H 4M1DL 4AG4H 4BZ2H 4GMTH 3WEXB 1Z9LA 2ZG1A 2R1XA 3PDDA 1WFTA 2OK0L 4M3JA 5IBTL 3WS6C 2X5PA 1F2QA 4OIIL 2NZ9D 2VLJD 5DRZB 1C5CL 1N6VA 1LO5B 3BESR 1PDKA 2DQIH 4HW6A 4P2OC 4XP4L 1IC1A 4JFPB 5I71B 5IHLB 2IH3B 3AAZA 4FQJL 1T1ZA 2M8XA 2ITCB 4P2QB 4RWYL 3ME0A 1YNKH 2FJFA 3GSUB 4ORZC 3FN9A 1I1FA 3OBAA 1BZ7B 3VXUD 4NGHH 4YPGB 5E95B 4I0KA 2DM3A 1DQTA 3KWWB 5ICZB 1ORQB 3P30L 4N1EA 4U7MA 4HS6B 4LDLB 5LAXA 3PWJB 1IAIL 1KIUA 3SOBH 4I4WB 4LVHB 3BPNC 3L5IA 3HC0B 1BZ9A 2HT2C 4P2QE 2BK8A 4NNYA 1T20A 3UTZA 1AGFB 3BN9D 3UPCA 3A6CL 4M43L 1A6WL 2AABL 3BFOA 3MOBH 1KB5B 4IMLA 5FFLA 3QFJB 4FQXD 1KIQA 1BJ1H 2R4RL 4XH2B 1HDMA 2B1AL 5CZVH 4PYHA 3G6JF 5AUMA 4V2CB 1T6VN 4LAJH 5EZIL 4MWFB 1P69B 4DQOH 1CIUA 4MB4A 4OCMC 2MJWA 1QA9B 3D3VE 3H9SA 2ZCHH 3RL2A 4TSBH 3P0YH 3QHFL 4U6XA 2OZ4L 3QFJE 5DJ8B 1J0ZA 1IGCH 2VUYA 2C3WA 4Y5VA 5BZDA 5CUSL 4Q0XH 3I6GA 3KYNA 5DXWA 3OJVC 3S5LB 2W0KA 1WZ1L 3MNWB 5GRUH 2BVPA 1QQDB 3MV7A 4YGAB 1UXSB 2IGFH 3FO2A 1A7OL 4K07A 5I18H 2DN7A 1NAKL 5BJTB 4OCYH 3BIKA 1CGSL 1TPXC 2QHRL 4U2ZA 2XV6B 2I9LA 1JYXA 4GRLD 2IAMC 2ZUSA 3BT2H 3BEWB 1XGQB 3CLFH 4LCWB 1A7BA 3CPLA 5KSUA 4KJYB 2WP3O 4L4VD 2R0LL 5F3HA 3D9AL 3GGWA 4NJAH 4NQXB 2G60L 3FFCB 4MA3A 4YXHL 4P2OB 2EDEA 5JW5A 3C9NB 1MPAL 4LBEB 2ZJSH 4N9OB 1EHNA 1IC7H 5KW9H 4XAWH 4RAVB 1YN7B 1Q9KB 4W4NA 4NWUL 1LDSA 1UKQA 4LCWE 2UUDK 4Z18A 3HE6D 4NC1C 4RISL 3W82A 4FABL 2KKQA 5FOBA 1FFRA 3NIGE 3FFCE 1WTGT 2X89A 3PGDA 1G7PB 1BOGB 4MDIA 4ZUUA 5TDPA 2HKFH 4S1QH 4JVPA 4RFNC 1R24B 5AAWA 1OAXL 3QWQB 4G80B 2R4SL 1LP9F 1SYSA 3BPNB 3O6FA 5AEAA 1WWAX 1RZIB 1BREA 3ZYIA 3BP6A 2AS5M 4LPWA 1QR1B 5F9WC 3CDGA 5IFHH 4K3DH 2V9TA 4OD2B 4ERSL 2DKUA 4Y4FA 2ATKA 1E6OH 2V17L 2YUZA 3FOMB 3CNKA 2UVEA 1R3LA 3EUUA 3VI3E 3NAAH 5KJRL 3CFEB 4O2CA 2UYLA 5JO5B 4E41D 3VG9C 4IOIA 2AK4A 4K8RC 4X8JB 2CRMA 1MJUH 4OD1L 5F1SA 3L5WB 1BF8A 4ZPTB 4NZUL 2HT4D 2F8VA 5JQ6H 1A4KB 4M9PA 5C0EA 4MSWB 3QO0B 1A8JH 5GRWA 3RNKB 5ILTH 5C0BD 3TPUA 1CDYA 3VFSA 3VXNA 1YC7A 3ZDYE 5IROC 1PY9A 4U1HB 1GZPA 5EZOL 2FZ3A 3KDMB 4YBQC 4K8RH 2Q1EA 4J3XA 1TPXB 3WKML 5ICYA 2ATPB 1GXEA 4PV8B 4EDXA 1DQDH 4P2RD 2IAMB 3STLA 4KGJA 3KPOB 2G2RB 5DRNA 4XP5H 2W9LA 3BZ4A 1T2QH 4V2BA 3X3FH 3WS3A 2HMIC 4PUBL 3BAEH 1ZOXA 3P0GB 4PGCA 5F9OH 1I3GH 3SY0A 3MRCB 5BRZA 1KJ2B 1T22A 2UUDH 5D96C 2Q8AH 3EYSH 1Q9LA 4AEHH 1R3IH 1CU4L 3LKQB 3VWKA 1TTGA 1KYOJ 3T2QA 1A9BB 4I3SL 1V7NL 5JHDB 3O3BB 4CADB 3NCJL 2DI9A 3MRJB 25C8L 4MS8D 1J5OL 4I0PD 4OQTH 5B39B 3RVTD 1IQWL 4OCWH 4RFNB 4HCRH 3U2SA 1CLYL 4GQPH 5T1MB 1BQLL 5DA4A 2DLGA 1CF8H 2EH7L 5I8CA 4YHKH 4QTHB 4NC1E 5KN5B 3B9KA 5F9WB 5ADOL 2WP3T 3HLAA 5JHDE 5MHSE 4K3EL 4LOUC 1EFQA 3DX8A 4RGND 3HNTH 5CBEB 1U92A 4ETQA 3Q5TA 4PJ9A 1FO0B 1MJ8L 3OKMA 1T1ZB 2XKSA 3VG9B 2IG2H 3IB4A 2FJFB 1RK0A 3BI9X 4NQCA 4S2SA 4TSAL 4I5BA 1QO3B 1NANH 5E56A 1D6VL 4AEIH 4K94C 1R3JA 4ODHH 4HZLB 1BGXH 4QHKI 3KLDA 5ABDE 1OL0A 3NFSL 5F21B 5HHOB 4WFEE 3T1FA 2A9ML 1J1OH 5EBGA 5LAXB 1ZE3C 4NM8L 2V5YA 1UKSA 4XCCL 2X9WA 3VMOA 3RPIA 4XC3H 6FABH 5HSFA 1KULA 5FKAB 2WAHA 1T20B 4HPYH 3UTZB 3CX5K 1IT9H 2EXYD 3RA7H 3EW3B 3PV6B 1Z3GL 5IR1A 5E2TH 4K94H 4LNRB 4Y4FC 5HHOE 1KIQB 4PTTB 2DYPB 3C5SA 1C1EL 5FM5M 4FQCH 4FQIL 3TYGH 5AUMB 1N64L 3UTSD 3KLHD 1ITBB 3BRGC 5D96B 3EYQC 3RL2B 1HQ4B 1QKZH 4UOW1 3T0XA 1NCUA 1SJXA 2QR0B 4JPKH 5DO2D 5BZDB 4H8WH 1F3JB 2E6QA 4NDMB 3KYNB 4JO1L 1HINH 5DJDA 2DAVA 5KZCB 5E7FA 1I1YA 5TH2A 3UTTB 3MV7B 1RJYB 2OX5A 4HT1L 1NGZB 2BMKB 2HFGL 1I7ZA 1IZJA 1V8HA 5GGRY 3HNSL 4QNPE 5F9JA 4P3CL 4BFGA 1XGPB 2A6KB 1KCVH 2IPKB 1RMFH 5F3HB 1RZ8A 3UTTE 3MV7E 3GGWB 3H2WA 4U1JB 5E99H 2PTTA 4XHQA 2J1KA 1ZEAH 2HWZH 1B9ZA 5H2BA 1IGTB 2XQBL 5MP6H 3B83A 5DQDL 5TF1L 1N6QL 5BQ7B 1GGYA 4RGOH 2VDLH 4ISVB 4ZUUB 4MDIB 1M7XA 4JFQA 4K7PX 2QEJA 5CSBA 3WBDA 4Y19B 5DJZA 5C0JA 1W0WA 5HHQB 4HJGA 5E8PB 1VGEH 4WUKH 2VLMD 4WHTA 1SYSB 1B4RA 3OAUL 1KNOB 2JIXD 1CFVL 4GKSA 5C09D 4G8EB 4UUJA 3RBGA 3B9KC 3ULVH 3S7GA 4YZFF 4L4TD 4ZTPH 4Y4FB 4R8WL 5DMKA 2DBLL 3QCVH 5HGBB 2VISB 3DXAB 3SCMD 5CGMA 3W2DH 4YHML 5FHAL 4QRRA 3C2AH 3E8UH 3P9MA 3PGCB 1BF2A 5CEZH 5IHZA 2QHLA 5IFAH 4IOIB 1YEDA 1UZ8A 2AK4B 3ARFA 1LK2B 2E9WA 4UINH 4YHOH 2PCPB 1W0VA 3CFJA 4M6NH 2GSGA 1KEML 1I1AA 1SM3H 1RZKL 3BXNA 4K71C 4ZFGL 5I17A 3U46B 4ETYA 4OUUA 5KSAB 3ARUA 1JGDA 2X41A 1NGQH 3O3AA 4F58H 1RVFL 2AK4E 1GZPB 3OJDB 3CDYA 1ZLVK 2FZ3B 5AZEH 1AJ7H 4EDXB 3HI6L 3ARBA 3JVGA 1YPZB 1TITA 4P2YA 5I76A 5FYJH 4KH2A 5E8OB 1N4XL 1VFAA 3BZ4B 3HC3H 4UV4L 5AWNL 1WCQA 4X6DB 2VR5A 3UCRA 1NC4B 1AGEA 1VPOH 3ZKMC 1ADQH 3WS3B 1WF5A 1YECL 2HT2D 3SY0B 5BRZB 3S88L 4LSRL 1JPSL 2C1PA 4P48A 4WFFE 3CMOL 2A73B 1P4LA 2DF3A 4HPOL 2BZDA 3CH8A 1UB5A 4XBGB 5F71A 3U9PH 1UA6H 4U6HB 3OJMB 3GSQA 5SWZA 1P7KB 3MUZ1 4K2UL 1AR1C 1IEBA 3VMNA 5EORL 5EO1B 5BRZE 1MREH 1G7LA 2VMFA 3MUJA 5FF6A 3KHOA 4JG0L 4JPVH 4PJGB 2VLJA 1XIWD 2X10A 3B9KB 4PR5B 1U3YA 2YPLA 3CMGA 3KG5A 4NQVA 3L9RA 4ZAKD 1OD7A 2GJ6D 2EXWC 3LPWA 4UOJA 1KLFA 4ETQB 5EH1A 3GHEH 1UFUA 4ENED 5FUCE 5CEZE 3VXUA 1EVUA 3OKMB 1WBZA 3EFFB 1U2CA 2W1NA 4PJGE 4JB9H 4V1DD 3O3EA 2WNGA 4WY7L 1RK0B 5KVMC 4JHAL 3EO0A 4I5BB 3E0GA 3TA3D 5TE7H 1R3JB 5C6TH 4ODBD 4QHKJ 1FFNA 1T7VA 1WFUA 2YPKA 4K71B 1JZ3A 1ZLVH 3EGSB 3OR6A 3KPLB 4JFHE 1NMBH 4HXAL 4JHWH 2YR3A 2H32B 1DLFL 4MA8L 1CD9B 4QXUH 4OZIA 2VB5A 2FYYB 4Q6IC 3SDAD 5J1AA 5F7UA 1BECA 3V6ZB 4G6AD 3BEVA 3BGMA 5FYJE 2X4UB 5D71H 1KJMA 4P4RA 1CE1L 3QEGH 5FO8B 3U7YL 5DHVA 4LEXH 4P2CG 4QOKD 3ARFC 1YN6A 1UCBH 3N9GH 5HDQH 4PJHF 3PP3H 2FRGP 1ZGLA 4DW2L 1F4YL 4OB5H 4CGTA 1BIHA 5I1CH 1I1AC 2ICWB 2WQRA 3HZKB 4DKFL 2COQA 4QHUA 4FFYH 2Z91A 4KUZL 3ZDZF 3Q48A 4HC1L 5DJDB 1IGJB 3GKWH 3MOAL 5E6IA 4AMKH 1DANT 3C5ZD 4K8RD 1DCLA 5EU5B 2D7PA 1KTDA 4JVWA 4PJXF 5ALCH 2B2XL 4Z77B 2FB4L 3ARBC 3JVGC 1BD2D 3LKPA 4IM8A 4OF3A 1YEJL 1FLTX 3GJEB 3U30C 2VE6A 1RZ8B 4LLAA 5C0DB 3FQTB 4NBZB 3VGHA 3LPGA 3HAEB 1X9QA 4FQQB 2WLZA 3HE6A 4WIQA 1J12A 1CXHA 5GJTH 5FA4B 4ZNCD 1JZ8A 3A6BH 3WJLA 5L0QC 4MQTB 4PY8I 2YHGA 4NQSA 3QI9A 3VFNA 3MFFA 5D1ZD 3S34H 1S7SB 3QZWA 4X6CF 1JHLL 4CMMA 4JO4L 2XIDA 1N0LA 1F13A 4DGIH 5C0JB 3UDWC 4HJGB 1D5IH 1A7NL 4PGDB 4PJDF 3GMOA 4M61B 4OAWA 3IF1A 4LAQH 5JXAH 4PJFB 4BK5A 1FL6A 4Q6IB 2CK0L 2X4OA 4WI8A 3B9AA 3AVEA 4XNUL 3S6CA 5A43C 2X05A 4JDZA 5DMKB 3TH4T 2B4CC 5MERB 4D0DA 1I9EA 4WI5A 3BD3A 2IPTH 4TUJA 4WJ5A 2ID5A 4PJFE 3SKNB 5EBWB 2JJSC 3MODH 5IHZB 3DSNA 1O7SA 2VAJA 1J0JA 3LH2L 3ARFB 1INQB 3NVQA 4D9LH 4R90L 2NY4C 4Z7OE 5ALBL 5F93C 3CFJB 4J3SA 3WFBH 1FFPB 2GSGB 3FN3A 3PIQB 2B4CH 1I1AB 1NGYB 4DZBB 1I1CA 1OP3H 4GQ9L 1JL8A 2OJEB 4KJWD 5ESAA 5EZJA 5H94A 4QRRE 4YXKL 5KBNC 2OL3L 2IWGA 1MRCH 4QWWC 5D7KE 1R5IA 3O3AB 1MCOH 2ADIA 3R1GH 3DECA 2VUOA 3UAJD 4QRSA 1NCCL 2OR9H 2HTKD 1AXIB 1S9YA 4U33A 3TVMD 4ZQKA 3ARBB 1W72L 5E6YA 4M7LH 1R5VB 5FGCE 5D7IF 5DK3A 3U30B 2Y23A 4Y19D 4PRNA 5DS8B 3T0WA 2BVYA 4UI2A 3JXAA 4Q2ZA 5D72H 3MRLB 5HHXL 3NZHL 4ODSL 4IMKC 1UH4A 2XRAH 4EDWL 1OGTB 4P46C 1UB5B 5L0QB 3L5JA 4RFOL 1UGNA 4WHYG 3D0VB 4OF7A 1L6ZA 4FG6D 3DXAD 3DURA 5SWZB 1JZ4A 4HIEA 1KPUB 5DZNA 3DBXB 2EYTA 1FNGA 1QFUL 5LG1A 5E6IC 3MUHL 5BMFH 3HUJA 3JWDL 1IAOA 4ZS6D 1LDPL 4LDOB 5IF0A 1NC2A 1Q9WB 2CDEA 2HVJA 4NSKB 2FHBA 2NY2D 4MJ5A 4YHLH 3W5NA 5SWZE 4OI9A 5D7JC 1JZ5A 2YPLB 1KXVC 3VXQA 4JFOA 3PNWB 4IOFD 4NQVB 4BKLB 4NFBA 4O51A 4I3RL 1XGRA 3E3QC 5KSAD 2EIEA 4TULH 4QY8B 3QWOA 1CWVA 3W0WB 3S9DB 2V5RA 1TVBA 1U8MA 5EO9A 1WBZB 2ADJA 2O5YH 4M5YH 3O3EB 3WJLC 3MJ7B 4WTXA 3MRHA 4XMPL 3CFCH 2YPLE 2NY4B 2QSVA 2FWOA 3QI9C 3RTQA 4JQVC 4NN6C 3TCLA 1QLRA 4XP9L 1NC4D 3MLVH 1FFNB 4L3ED 2IF7A 1XCTB 1FFOA 5GIRA 1HN1A 4ZOEA 3OR6B 2RB8A 4R7DA 4XNXL 3W0WE 1G7IA 2AW2A 4OZFA 5CLWA 4MGXA 3NFPB 3ZE0E 4PJEF 4OZIB 5IMKA 2VR9A 3MRQB 1ZHKA 3EHBC 5J1AB 4KTDH 3DGGB 3T3PF 4G3YH 1R3KA 3ULVD 2W0PA 2YUWA 3H7LA 5E8NA 1EIBA 5SWSB 3QPXH 2V2TA 3QXWA 3V52H 4HLJA 5DJ0B 2A1WH 5IESH 3T4YA 1KJMB 2MOVA 4ZUVA 1PSKL 4P0DA 3OXRA 4WRLA 4DGVH 3BKYL 4YQXH 1JTTA 1HXMA 4FP8L 4GS7C 4OZIE 2XG5A 3UJIL 2GAZB 1OAYL 4HK3N 5BO1L 5B4MC 1KFAL 1YN6B 2DQHH 4P46B 1MHPH 2HJLB 3D18B 5SWSE 1X5ZA 2EEBA 4PP2A 1M7DB 5C0ND 1V3KA 1WEJH 3W39B 4NWTH 3ZDXF 4NYLA 5JIPA 1TZGL 1FGVH 1BFVL 1FNSL 3RWCA 5BV7L 1J10A 3CXDH 3SGJC 2VDNH 4KDWA 4O00A 5E6IB 2AV7A 1YUHA 3RY5A 1AQKH 2IH1B 4LPUA 4LKXA 3TC9A 3QP3A 3QFDB 5FYJD 1UM5L 2P8LB 5D7JB 1SJHB 4JKLA 1CTOA 3C5JB 3QQ3B 1S7VA 1JNNL 3I3BA 3VGGA 4HH8A 1PG7H 2P5WD 3U0PB 2GTZA 1CGYA 2IQ9L 2J4WL 3G04B 2P7TA 4TYUA 1YMMD 5A2KH 2HKHH 3H0TB 2ZUQC 3OSKA 4PY8J 4RGMC 3TIEA 5K59E 4NQSB 2VXTH 3QI9B 1G7JA 2V9QA 4NN6B 3E3QE 5GGQL 2FX8L 1I9RH 2JIXA 2OP4L 2VH5H 2HP4A 4PLOB 5F7KC 5C09A 1BVLB 3NH7H 3WFEL 3GMOB 4OAWB 3KLSA 5IJVB 1MCFA 4L4TA 1HE7A 1HZHL 3D1MC 2FLBT 2R29L 4D0CA 5HVFB 1IGFL 5DFVD 3GBLA 3RWEA 3UTPE 5DD6A 4Q7DA 5DF0A 4Q6YA 4KGLA 3F7RA 5D5MA 4P59L 1RU9H 4FFZL 4GS7B 4TUJB 5F7LB 1UZ6E 3RIAK 5C2BH 3R06B 5C92A 4AENB 1CL7L 2CJUH 3KGRA 4GXUM 5B8CA 4JRWA 4LASL 3SBWC 3VGEA 3L6FA 3RTQC 2BHYA 3OB0K 1U8OA 2AQ3A 3QUYC 2EXWD 5EU4A 3T04D 3JV6A 5ESAB 5H94B 5DRWB 5F97E 4JKKA 4PRIB 4G6MH 3GO1L 3SGEI 1BAFH 3NIFF 4R4FL 1NEZA 2XZQH 5ETUA 2P8PB 4QRSB 4BSWB 4WO4D 4ZYKA 3BRFA 1HYSD 4XNQA 4ODTL 1S9YB 1WC7B 3T2NH 2CXGA 1G6RA 3BPCA 2H1PL 3SDXF 4PRIE 1T4KA 2IBBA 3GIVA 4ZSOA 1BFOA 3UZEA 5SV3A 1T1WA 4F37K 3MBED 5KSBB 4Q2ZB 3G9VA 5DEGA 1D7FA 3LS4L 1N7ML 4P9ML 1FVCA 4WI9A 4BQ6A 4NO3A 3MGOA 3OKLA 1T7XA 2BCKB 2ZUQB 2PXYD 2DM2A 3JSSA 4RGMB 4XXCA 3LPFA 3WUZA 5JW3L 1LE5B 4OGXH 3QEQD 5EUKA 1ZHBB 3DURB 2GJZB 4K3HA 3RY6C 4HIEB 2KZWA 4MZ3A 5E08H 4JCLA 1KN2H 3BYTA 3IFPA 2EYTB 4LQFL 3MJGX 4NZDA 1I9IL 2FD6L 3HC4H 4XPHH 4OM1H 5TPWH 3WIIL 3HUJB 1B2WL 2NMSA 4G9DA 5IF0B 1FZKB 1NC2B 2YD3A 4JLRB 2ZCKL 1F4XL 1LK3H 2YWZA 3MCG1 3VXOB 5DDHA 4B41A 2ARJB 2ZSVA 4F7TB 1TIUA 4O51B 1A0QH 3FOLB 1MF2H 4AH2A 2BFVL 2VC2L 4XHJC 1I7TB 3O2DL 3QQ4A 4OTXH 3R4DA 4EOWL 4FS0A 3HUJE 4R97C 4BH8A 5IBLD 1EUUA 2A38A 3LQAL 2QL1A 4PJBF 5EO9B 3OB0H 4JR9H 3TA3A 2ADJB 1DQJA 2YA2A 4ZFOB 5CKAA 1D6EB 3QJHA 3SDCC 3RTQB 1T0NA 3QUYB 2X4PB 1QLRB 3CK0H 4IS6A 1CXIA 4OCRL 1N2RA 3NTCL 3L3HB 4R7DB 1G7IB 4TPRH 4YE4L 3JWOL 4DVBA 1EV2E 4XPAL 1KYOK 3QULA 1ZHKB 1P5UA 3SN6N 1FG2B 2WQ8A 1T1YA 1N5AA 2GSIB 1RZ7H 4POYA 1QFWL 5EOTB 1S7TA 3EJJX 3HMWL 4Q9RL 2MNUA 3QIWA 3MUGA 1GL4B 4JZNA 3V95A 2EKJA 3K1KC 4ZUVB 1FV1B 4MD0B 2GTWA 4QOKA 3OXRB 1G9MC 5DFWH 2DOCA 1HHKB 2ZUXA 4JCMA 2R39A 1CXLA 5CWSA 1MFCL 3Q1SH 2HT3C 1OWRM 2CIIB 3PG2A 4UIMB 4LCCA 3L5XL 4PRPA 1VESA 1WCBA 4PP2B 1ONQA 1Y6MR 3MRBA 4NQDB 4OV6F 5CP7B 5E5RB 4P5TD 2UWEF 2AEQL 3C5ZA 1NBVH 4OCXL 1G9MH 1PKQA 5F1NB 1EH9A 2VZOA 5DJ2A 1UVQA 2JCCF 1BD2A 1YNTB 1INEH 2FBJL 1MRFH 2VZ1A 4W4OA 4MHHG 2NY4D 4WEBL 4DKDC 4LKXB 4G42A 1QBLH 3RAJL 4NQDE 4Z7QE 4X4YA 1P4IL 5E8EA 5F96H 5K33A 3S96B 4GO6B 2UZXB 4QWWD 5IB5A 3GSOA 3U48A 2GTZB 4R97B 3KPMA 1FNEA 1BBDL 3ULSB 1MFDL 3IDYC 2C3GA 1MFAH 3PF2A 1N8ZA 3LKSA 3LB6D 5D1ZA 1RUQH 2CDGA 2BDNL 3F65A 1YY9D 3IT8D 3SDCB 1KJ3H 3U1SH 1CDIA 5FO9A 1MJ7H 3FL7A 4U1SB 4XI5C 2PTVA 2F15A 2W38A 5FYJU 1LGVA 1AXTL 2NY5L 3PP4L 4FMFA 1F3RB 5EN2B 4I9WE 5E2WH 1KEGH 3RGVC 1OB1A 3OX8A 1Q1JH 4XCEA 4JFEB 3BO8B 3LKOA 4HH9A 5GRVK 3LV3A 1P84J 3ARXA 2HN7A 1SY6L 5DD6B 4AG4L 2VL5B 4GMTL 4BZ2L 4Z7NE 4MAUL 1KELH 3GI9H 2VZ3A 4WFHD 3HRPA 4Y16D 2V2XB 4JFEE 4N0CD 3G6DL 4X9IA 1AP2A 2DQIL 3OKEA 4LSQH 2Y6SC 5HGGS 2AAVA 1U8OB 1EJOH 1KLGA 1BWWA 1YNKL 2RIKA 3JV6B 2XXCB 4GAGH 4JM4H 4Q97A 3UJJH 4NGHL 4JJ5B 3TVMA 3I2CH 3OR7A 1XF4B 5ETUB 4LF3A 4ZYKB 2EDHA 4XTRD 1QPPA 3LEXB 4F7CB 3L3JA 3SOBL 1KXQE 3KPRD 5GXBB 1INDH 2VDPH 3BPCB 2C1OB 2PYED 3MOBL 2KPNA 3GIVB 4MNQB 4ZSOB 4QHNA 4GG8B 1FJ1B 1T1WB 1I4FB 1ZT1B 5DEGB 1YEKH 5ENWA 3IDYB 3EHBD 3I50H 3F8UB 1FVCB 5CZVL 4U1LA 2Y5EA 4DQOL 3ILQC 3DRQA 3KXFD 3QUKA 3GSNA 4HFWA 5EUKB 1A1MA 2ZCHL 43C9A 4TSBL 4MNQE 4LSDA 3P0YL 3C2SA 4ZSOE 5DJYA 2V2WA 5D1XA 1TJIH 4JRYD 1IGCL 1E4XH 2J8UB 4Q0XL 1T7WA 4U31A 5HD8C 4NO2A 3RGVB 3MA9L 3QXDA 2IGFL 3UBXI 2N56A 2WZPD 1AO7D 1S9VA 5I18L 4GBXA 4OCYL 4KMTH 3AREC 5D4QA 3N1MC 4U4BA 1A2YB 1RZGA 1G0DA 2Z93A 3BT2L 2J8UE 1XCQA 3CLFL 1QP1A 3G08A 4UQ2A 3DO3A 2Y1VA 4MQ7A 5IQ9B 3RWGA 1HHJA 4NJAL 4EN3D 4GRWF 5FCSH 1F90H 5D2LA 3Q6FA 4OZ4B 2FJHB 3QJHB 3DUSA 3SHSA 2H2PD 5I8KH 4RFEB 1FDLH 2ZJSL 1T0NB 3WFDH 1IC7L 3RJQB 4XAWL 3VFOA 5KW9L 1KCUL 1T2JA 4OFDA 5DD5H 2P24A 4IS6B 3T08A 1HKLH 1N2RB 1B0WA 1UWXH 5MI0C 2C3HA 3QUZC 4NO0B 1UWEH 4OD3H 1RHFA 1ZA6B 2Z31C 3MLWH 3WUWA 5J9PB 3QULB 1NH6A 2HKFL 4S1QL 1AGDA 2QKIA 4LCUB 1A6PA 5DC0A 5ELIA 4D9RE 1Z0MA 4EVNA 3IYLW 3CC5A 3MUGB 3EDJA 1MCCA 4JZNB 3D6GA 4A6YA 1RD6A 5IFHL 4K3DL 2VITA 1FN4B 4WNQA 2N4IA 3BDBA 3HR5B 5CINH 1E6OL 1K4CA 4OIBA 4OZGF 2CLVB 4ZUWB 4LCYA 1LO0H 1R3HA 4PRPB 4LPYA 3NAAL 5INCB 4G8FB 1X44A 2FO4B 1ED3B 3MRBB 1A3QA 1XAUA 3BZFB 4UILH 4JO2H 5EPMB 3RL1A 2XA8H 1MJUL 3UPRB 4PRHD 5JNYB 2ARJQ 4U1IA 1EBAA 1CVSC 3TZVA 5JQ6L 5DJ2B 1UVQB 3TWCH 1JWSA 1LNUA 4KK6C 5ILTL 5IFJA 2NZIA 4PRPE 1CYGA 4R4BA 3GMQA 2IAND 4M4PA 4GLRH 1WBXA 2VDRH 5KVDH 2P5WA 3QNXA 1ADQA 1VEMA 5DC4B 3BQUC 4JQXA 1NL0H 5E8EB 4K8RL 4LGSB 2EDDA 2C5DC 5H35B 3AREB 4TTDC 4YNYA 3ESUF 4P4KA 1DQDL 5IB5B 4Z7VA 1RZFH 3GSOB 4XP5L 3KPMB 1T2QL 5F89B 5I1GH 5DRXA 3X3FL 4PIRF 3D2UB 3NMEA 2CDGB 1G7QA 4PJAB 5JXEC 3BAEL 5F9OL 4LLYB 3O11A 2J6EA 1HWGB 1I3GL 2R1YA 4JN1H 5FO9B 3WDHA 2Q8AL 3FT4A 3EYSL 4NN5C 1DUZA 3AB0C 4AEHL 2ZUUA 1R3IL 2D9QB 2VDKH 4J4PC 3RIFF 1WZLA 4AM0A 1OD9A 5MI0B 4JDVA 3QUZB 4BSVA 4PJIB 2VXQH 3EYOA 2Z31B 2OBGA 3NACH 4OQTL 4PJAE 4YAQA 3OX8B 3QUMH 2FCBA 4OCWL 4HCRL 4XCEB 1IAMA 4M8QB 4TUOB 1TCRA 3FQWA 4GBXC 1CF8L 1AC0A 1BIIA 2HN7B 3S4SA 5IVNA 5J3HC 4YHKL 3PQYD 4PJIE 4UV7H 3ZE2F 3QIBC 1UB6A 2GHWB 4LGRB 5C9JB 3EZJB 3BIBX 5TJWK 3OHXA 3HNTL 4XB8A 4GH7B 4RA3A 5KS9F 3OKEB 3HE7A 2D0HA 2QADD 3HZYA 3EAKA 5GGRB 1TDQA 4YIQA 3SE3A 5DK2A 2IG2L 1JF1B 3PHQA 3UO1H 1U8KB 3M07A 1NMAH 2WW8A 3TV3H 1WWWX 4WO4A 1Q9OA 4HG4J 4U1NB 4AEIL 3I84A 4ODHL 2VXSH 2CPCA 1BGXL 3THMH 5FM8A 1FYTA 4C57C 4GKZB 4YH6A 1J1OL 1K3ZA 3CSPA 1EMTH 5IMLA 2VN7A 2ZSWA 4XC3L 6FABL 5GQBA 5T1LA 3BQUB 4Y8DC 4HUUA 3BUYA 4HPYL 5FCUH 2EIDA 4MNHA 2IQAA 1IT9L 2APFA 1R5WB 2PO6C 3RA7L 5AAMA 4EJ1C 1HSBA 5E2TL 4I18A 2PW2B 4OFKA 4K94L 3PDOB 1BFTA 2PXYA 1H8SA 3L3OA 5ENWB 3D85A 3QH3B 1GIGH 4LARH 4RIRB 1RURH 4FQCL 3TYGL 3L7FB 3VXSB 1ZXQA 3QUMB 5D1QC 3MRFB 5HGDA 4HIIB 5HYJA 5IW3A 3BJ91 3U4EB 3EOTH 1G7HA 1IAII 4HFWB 1QKZL 2YSSB 1AI1H 3AB0B 4NN5B 4P5KB 5SX4I 43C9B 5DJYB 4JPKL 1I8IA 1X5KA 3BH8B 5E00A 3N06B 4MQXC 2W9EH 3BVNA 3TZVC 5E6ZA 2D7QA 4HKXB 2VQUA 2HT3D 4H8WL 3INUH 2XWBA 3JTTA 2V5SA 4UBDC 3VXSE 1HINL 4NO2B 2P5EB 5L8LB 2VABA 4L9LA 2BVUA 3MJ9H 1G9NC 4PG2C 1S9VB 5BS0B 3I75A 1EVTC 4GBXB 5CJ8A 3LN4A 2QJDA 4P4KC 5ACMA 5A16A 4RMSA 2F54D 1U3HA 5F88A 3U4AA 1KCVL 3QIBB 2D31A 5GGTA 2YMXH 1EAPA 3C6LC 5B3JE 3CCHB 5DSCA 2Y06H 1RMFL 2P5EE 1FL5B 5E99L 5HY9B 3FB5B 4PP1D 1FLRH 4M6OH 1G9NH 2XY2A 3Q6FB 5BS0E 1I8MA 4JHZA 1DTUA 5C0AA 1ZEAL 2HWZL 2AKRB 9CGTA 4PJCB 4J8RA 3FTGA 2A83B 2FR4A 5MP6L 1NAMB 5DTFB 2YC1A 1A6UH 1F4AA 3FZUC 1MWAH 4ZO7A 4RGOL 4DEPC 2VDLL 3FQNA 1FVEB 4OGAC 3WUWB 4JREC 3FO9B 1HYRC 4NPYA 3EO1A 1VGEL 4WUKL 4PJCE 1EHXA 1YMHA 4QF1B 3IS0X 4G6KH 3IDIA 3RHWF 3T4AB 3NIGF 3MRNA 2W0FA 4A6YB 5IP4A 5JPMB 3ULVL 3VRLE 5I1LB 2PO6B 4XPTH 2HTLD 2VITB 3RZWA 4WNQB 4ZTPL 1WQVT 4ODUA 3QCVL 4TQEH 3W2DL 3HRZB 3C2AL 4AK1A 4P5TA 5D1QB 1D5MA 3HE7C 1IJ9A 3L1OH 5DK0A 3RP1A 2MQCA 4YJZL 5CEZL 5EBLA 5ISZD 5IFAL 5JQHC 4X7TA 3ZYZA 4X80H 5DQJA 5A3ID 4UINL 4YHOL 1P9MC 5KANI 3VI3F 4WTWA 4M6NL 3TZVB 1P1ZA 2GK2A 4PY7A 2ED8A 4Y5YA 1N5YH 1SM3L 4YDVA 3S35H 1VKXB 2V7NB 3OKYA 5IFJB 1X3DA 2DQFA 1IKFH 2XWTB 1NGQL 2BNQA 4F58L 4Z95H 3TYFA 5ANMB 5AZEL 4OF5A 1AJ7L 1GGIH 2QQKH 3LD8C 5CD5C 4P4KB 3VD9A 2XPGA 3WNPA 1JGLH 2VTFA 3EYFB 5B3NA 5FYJL 1F58H 1WUNT 3C6LB 3HC3L 3ZDYF 1T89A 1Q0XH 1EDQA 1VPOL 3DRTA 5CJ5A 1ADQL 2R1YB 4BUGA 5DI8A 5ANME 1KPVB 5CILH 2K3TA 3FN0H 3MLXH 4R7NA 5E8DH 1DUZB 5CSZB 3RWFA 4C83A 4MJ6A 4AM0B 3U9PL 2VO5A 3QO1A 1UA6L 1MHCA 1CICA 3MGTA 2AJZA 4DEPB 2ZCLH 3PWNB 1ETZA 4XRCA 4JREB 4HWNA 4M1CC 2HAZA 3VRIA 3AROA 5I1IH 3U0TB 1C16B 1CFSA 3TO2A 4RZCB 1L7TH 1F97A 1J86A 4MXWH 4JPVL 4QHMA 1FH5H 5DQ9A 4Y16A 5JW4R 1U3HC 1XGUA 3UP1A 5I16B 5H37G 1UB6B 5EG6C 5KVEH 5CP3H 4FTVA 2CQVA 2IFGA 1T1XA 3GHEL 1XF2A 2I07B 3HE7B 3HZYB 1U8QB 4NC2B 5E4EC 4ACPA 4Y88A 4JB9L 4MLIA 3K46A 3QDGA 2DWDA 3VGFA 5TE7L 5F7EH 1ZTXH 5C6TL 2IADB 1H3PH 1QRNB 2BSRA 1EZVY 3KPRA 3UYPA 2X2YA 3UZVB 2H26B 4OI7A 3IVKA 1FYTB 4KJQD 1NMBL 4JHWL 5IMLB 2ZSWB 3TM6A 4CUCA 3P0VH 4QXUL 2EIZA 5T1LB 4R9HA 4HUUB 5L2KB 3AC0A 3QUZD 3LD8B 2VERN 4BELD 1S7UB 3SE4A 1QRNE 2EDWA 1OT2A 5J0BA 2NTFB 4M62H 3SGDI 4L3AA 3L3OB 5D71L 3KXFA 1FYTE 2H2SC 3QEGL 5DJ6A 1IQDA 3SQBA 1GZQB 1MIEH 3F7QA 3O8XC 4JRYA 4K9EC 4LEXL 5L2KE 2Y4SA 4CVZB 3OPZH 1OWWA 1G7HB 3WHXB 4M7ZC 3ES6A 1UCBL 3N9GL 1I1RA 2LAAA 5HDQL 5T1KD 5F44A 3ARGC 4Y4HC 2PUQT 5D6CB 5DT1H 5E00B 2IJ0C 5C08D 3BVNB 5I1CL 4Y5YC 1AO7A 5FEBA 4NT6A 4UU9B 1SQ2N 2YD9A 4GUPA 3GKWL 2P8MA 3HI5H 3MTRA 1VFUA 2AJ3A 4AMKL 3I75B 2XKNA 1SYVA 2DL2A 5ALCL 2BJMH 2IMNA 1DN0A 2B20A 5LKNA 3IU3B 4WW2A 3K2UH 1K3IA 2XZZA 3P4MA 4EN3A 4OF6A 1KGCE 1EAPB 1K85A 1FQ9C 1T89C 3S3SA 3H42H 1RJLB 2EDJA 5GS3A 3BUTA 1SBBA 3ARDC 2VSDA 3X11A 1NDGA 4QNPF 5K9QI 4G6FD 1U3JA 5GGUB 1DE4B 3LRSA 5E4EB 3RUGA 5GJTL 4U1KB 4G43B 4WVRA 4KQ4H 5DD3H 3A6BL 4NNXA 4YDJB 4GJTB 3RVUD 1ZK9A 1ZA3B 1A6TB 1CICC 3ZHKA 3EOBB 3S34L 4JGUA 1NGXB 5J56B 5DJXA 4I1NB 5CZKA 3T65A 2F53D 1MFEH 4GG6B 3SDYH 1FHGA 4UQ3A 4DGIL 3QCUH 5C0AE 5GGSA 4NPYB 3N0PB 1D5IL 1U8LA 4N0FB 5DD0H 4XWGH 3WV0A 3Q3GA 1RULH 4LAQL 5JXAL 3FFDB 3IDIB 2Y7QB 4ODWA 5F9AC 4PRAA 4KK8C 2DLIA 2ED9A 3I3EA 3CZFA 4ODUB 4ZOAA 1TVHA 2GQHA 2P5ED 3S37H 3JUYA 1NGWA 4LIQE 2IPTL 4Z78A 1JTPA 5ICXA 5JLZB 1C5DA 1RY7B 1LO3H 4PRHA 3O8XB 1S9XA 3NCYS 2BVQA 4N5ED 5EBLB 3MODL 2A6IA 4L9DA 4B53A 2LU3A 4M7ZB 4YWGH 3QDMA 2NY6C 2NY0D 3ARGB 1MCWW 4Y4HB 4D9LL 4OKVA 1HHGB 3WFBL 4PY7B 3GNMH 4Y5YB 4YDVB 5F3BA 4IIQA 5JOPE 3DGCR 4XPFH 2DQFB 1MRCL 2XWJA 2BNQB 1MCOL 4MB3A 3EKCA 2OMNA 3CVHB 2OR9L 3EZ8A 4JFFB 2VLLA 5DURB 5HGAB 1S8DA 4PD4J 3F6LA 3H3BC 4P23A 4M7LL 3KYKH 5EOQH 3C60C 3ARDB 1IZKA 1GAFH 1YYMH 4FFVD 3HMXA 4HK0B 4HAGA 1AGCA 1ROWA 3QUXA 2BNQE 4QRTA 1C08B 5D72L 3S97C 4F9PC 1E6JH 4X4XA 1PFCA 4JFFE 2XRAL 5JZ7C 1T7ZA 1NDMB 5EU3A 2R1WB 4GXVH 2BSTA 5HGHB 1U95A 2EIBA 2AXGB 1CICB 2BSSB 3T09A 2NX5D 3MGTB 2AJZB 3CLEH 4PJ7B 4X6FA 3L95B 5JW4Q 1X5FA 1ETZB 4CVUA 4XRCB 2Z4QB 3F7YB 1YPZF 3GM8A 3OKNA 4R26H 2P4AB 1HEZB 1MCKA 1KIRA 1Y18A 3VFRB 3AGVA 5BMFL 3I85A 1XR8B 4X6DF 5D9SA 1B0RB 1CD1B 2Z92B 5FM5O 1DEEA 2YN3A 2DM4A 3UPAA 1MY5A 4YHLL 1XGUB 3VXTA 1AE6H 1MELA 2MHAB 5IVOA 1XZ0B 3PABA 3KNBB 4TULL 4LVEA 4D3CH 3O2VH 4LVNC 5KTEH 4Z7UA 3IDUA 3BDXA 3BSZH 4IHOB 2O5YL 4M5YL 2NQCA 4HIJA 3LDBC 3QDGB 2NY6B 2WUBH 3CFCL 3LKRA 2O5XH 3E6FA 2Q6WB 5GS0H 1A3RH 5IB2A 5IK3A 1NFIA 1JI2A 3MLVL 4C4KO 1UEMA 1OTSD 4PJGF 4BM7A 3IVKB 5FYLH 3STZA 5J11C 1JNLH 3IXTA 2AV1B 1K8IA 4OUOA 4FQLH 5HJ3A 1XGTA 3QDGE 1UYWH 3CSYA 4KTDL 3UTOA 4G3YL 5BW7A 2HG5A 5T3ZH 3SJVD 8FABB 3QPXL 3KPQA 5FIEA 3K8LA 2A1WL 1QFPA 4NRYA 5IESL 4HKBB 3C60B 1QUNA 1P84K 4DGVL 3FT2A 1I7RA 5I75C 2DQHL 3FT3A 4R2GD 2XTJC 1MHPL 3MOQA 4I2XA 1E28A 4HFUH 4MJID 1WEJL 2EO1A 4M9OA 4NWTL 1F45A 1FGVL 4XMLH 4NT6B 4OGYH 3L3DB 3DLQR 3EBAA 4X8XA 4GUPB 3T0BA 1EPFA 2UY7A 5I74C 4H25A 1S5IH 3CXDL 1VACA 4APQA 2P8MB 4YHNB 2VDNL 2W65B 4F8TA 2DLEA 4U6YA 3OG6B 2EKSB 3RKPA 1AQKL 5AD0B 2YD4A 1SYVB 4CMHC 1ZAGA 3LSOA 3VXPB 4WENB 4NFCA 3WMSA 1DN0B 3I6LD 1SEQH 4F9LA 3HS0A 4KKBD 4QCIA 5T5NF 3WFHA 1KB9J 4P23C 4LFHG 3F62A 4FQHA 4U0QB 2ZUVA 1QRND 4Y4KA 5A2FA 2CK2A 4QXTB 4WDIA 2A6DB 3DX7B 1PG7L 3DSFH 3QUXC 4HWBH 3BPLC 5TDOB 4WI2A 4LVNB 3JUZA 5FYKE 3QNYB 3RUGB 2UZIH 4LLWB 5CD5D 3HI1A 4NNXB 2HKHL 3LDBB 4XC1H 5DFTA 1JZ2A 1OF2A 3JBG7 4Z5RA 2VXTL 1QSFB 4RX4A 5LJYH 1ZHLA 1P7HL 3M1BB 4I48B 5DJXB 4XGZB 5CSGA 1J88A 1I9RL 1CVRA 5GSVA 1NGPH 1WITA 2PW1A 2VH5L 5J11B 5GGSB 3NH7L 1EBPA 3BWAB 4HUVB 1KG0B 3RUGE 4KRNA 5IB3A 1EERB 3DUUA 3CAFA 3Q3GB 5HPMB 4ODWB 5JHLH 1QSFE 5HHMB 3PWPD 4LNVA 5BXFB 5HPOA 1V3JA 2OMBA 1CLZH 2NXZC 1IC4H 3CZFB 4XP6H 5E2JA 5ISZA 2GCYA 3HNVH 4Z78B 1RU9L 2X4TB 2F5AH 3VGDA 3GJFH 5C2BL 2BVQB 4K7FB 5I75B 3CFBA 2VDQH 2X1OA 1BVKB 4NKOA 3CD4A 4ZUSA 4RAHA 5HHME 3QDMB 2XNAA 43CAA 2CJUL 2XTJB 2DDQH 4GKNA 4C4KT 1I85C 3VE0B 2HJKA 4PJFF 1P2CA 4L8DB 2DLHA 4XVUC 3MRDA 3FQUA 3VGBA 2X4NB 4G6ML 1HILA 1BHGA 5I74B 3QJFA 4P9HC 4Z7OF 1BAFL 1JWUA 3BKCH 4L8CA 1MHHA 3QDME 2XZQL 2XTJE 4GW5B 3BH9A 4CMHB 1D5BA 4D0BA 5IEHA 5BW7C 3QWRD 3UYRH 4TUKH 5FDWB 4P23B 3T2NL 4HS3A 3ALPA 5T5FH 4LHUG 1ZHNB 4ZFZA 4Z76A 1JN6B 1CGVA 1AGCB 3QUXB 1X6LA 3BPLB 3BKJH 3G6JA 1BX2A 3LAFA 3PL6A 1WT5C 4UDUA 5F72S 1DVFD 4OGXL 1OSZA 4RMQA 1U8IA 4TVPE 2BRQA 2K9UA 2VLKB 5EULV 5E08L 4HBQA 5MEPA 2JJTC 1KN2L 5IHBA 3U4BH 1KLUA 3HC4L 1Y18B 1NCBH 4OM1L 4XPHL 3P77B 2XN9D 5F7WC 5TPWL 3QBTB 1FE8H 2FEEL 5IMOA 4Y4HD 3BRDA 3NFNA 1DEEB 2H9GB 4XNMA 4FOMA 1LK3L 4HV8B 2VLKE 5CEYA 4J6RH 4Y4KC 3ZSSA 2NXZB 1PZ5A 1A0QL 2W60A 1MF2L 5IB1A 3VFMB 4MCZB 4OTXL 1IGIH 5EU7C 4FXGB 3FJTA 5IOPB 4Z7UB 2CIKA 4UNUA 1AGBB 5IW6A 4FN0A 4JR9L 2J7LA 1WIOA 3OXSA 1LEKB 2NYYD 5CLTA 1OLLA 4H1LG 4D9QE 1I3VA 1RZJH 3RWDA 1DR9A 4N1CA 4QRPD 3CK0L 2GT9B 4G9FB 3STZB 3C6SA 3IXTB 4Z7UE 5F1IA 4TPRL 4OLVH 4PJ5A 4NCC2 5MENB 3U83A 1MCNA 1QD0A 3DI3B 3DI2B 1XGTB 2C7UB 1E27A 3IJYA 1LP9A 2E7MA 2QV2A 2X09A 3B9EA 1RZ7L 4BH7B 1QVOB 1EEZA 4EUPG 3KPQB 5FAAA 4G9FE 3QNZA 3BOVA 4NRYB 4OT1H 4GW1A 5I8EA 4N8VG 5MENE 4U49A 2WBJA 1HSAA 1CLOH 1IM9B 1UADC 5C08A 3Q1SL 4FNLH 3GUTA 3S98A 3AMLA 5MEQA 3UBXA 2X70A 3VFTA 4OZIF 2DTMH 5E9DB 1NBVL 4UTBH 1RIVH 2JE8A 3NZ8A 5CZXD 3IDXH 1G9ML 4AT6B 4WWKA 5CMAA 2PYFB 4NBXB 5HYJB 4CU7A 4R96B 3LIZH 1LO2H 4OZHB 5H37H 3TJHD 3TEUA 1INEL 2JF1A 4G5ZH 3MZTA 4HG4K 1MRFL 2R0KH 3LSOB 3P4OA 1QBLL 1HQRA 4QCIB 4QRUA 4Y4KB 5E9DE 5F96L 2NNAA 1W8NA 3KPSB 5ACZA 1H8OA 2X4SB 1MRDH 4OZHE 5CJXC 4LLVA 1TVDA 3HG1B 4BFIA 4RSVA 4GKOA 1MFAL 3PL6C 4MA1C 2Y72A 1RUQL 2NLJB 1KPRB 3UMTA 5L6YH 1OF2B 5SV4A 1KJ3L 4POUB 3U1SL 2ICEA 2I9TA 3ULUE 1MJ7L 4NHCH 4CRPA 3KPSE 3RWIA 1ZHLB 1ACYH 3RWHA 5EU7E 5F7NC 3MNZA 3U0WH 5GSVB 3HG1E 1WZKA 4YO0A 4X4MA 5K59F 3MLUH 3DVNB 2UVFA 2XTLA 5E2WL 5J57B 3DUUB 1KEGL 1Q1JL 1AHWC 1B3JA 3QB7C 3VXMB 3CU1A 2BC4B 4NKDB 3O81A 1ITCA 4KRMB 1HIMH 5BVPH 2VZUA 5T3XH 4YX2H 2XG4A 4LLDA 3HZMB 1KELL 2GCYB 3UZQA 1F3DJ 3GI9L 1VADA 1U6AH 3QDHA 5FB8A 5GRJH 5MEOA 4NM4H 3VXME 4G8IA 1GOGA 2ESVB 5GS0D 1T83A 3EJZD 4H26A 1CG9A 1A7QH 2HJKB 1P2CB 1EJOL 2EO9A 4JANA 4GAGL 5FYLD 4JM4L 4KMQA 4O9HH 4IRJC 5K9QG 3DTXB 3UJJL 4YHIB 3KYMA 3N85H 3I2CL 3A6OA 4X0KB 5I66A 2AEPH 2ESVE 3BH9B 1Z9OA 3IFOB 4LMQI 4MA7H 4R0LA 4XPBH 5J1TC 5T3ZD 1SHMA 3BW9B 1ZS8A 2HFFB 3GRWA 1INDL 2VDPL 2GY5A 2N7AA 4PGBA 1XT5A 4ZFZB 4UAOC 5J6GB 2XZCH 1A7RH 4Z76B 1RIUH 2XFXA 1YEKL 2BY0A 3O4LD 3I50L 1UM4H 3PL6B 4NUJA 4Q9CA 4MA1B 1NBYA 4H5SA 4HLZG 4Y2DA 1YEFH 1XF3A 3V6OC 3FB8B 4NQEB 3X3GH 3U6RB 5E4IA 3SQOH 5MEPB 1VEPA 5D7LB 1TJIL 4WWKC 4JRXA 5F7YC 1U8NB 4EBQH 4WI4A 3G6JE 3D39B 5C0CB 5EU6D 1U8PA 1KLUB 1E4XL 2OM5A 4DAGH 5DHYA 5GRVL 2E7CA 4Z8FH 5IMOB 3RZCD 1AHWB 4KZEH 5IEKA 5KSBF 1HCFX 4XX1G 1QBAA 4NQEE 2E7LA 4KMTL 3MYJB 5D7LE 1NLBH 1WICA 3OF6D 3D39E 5C0CE 3O9WC 5L9DH 4WU7B 2R23A 4KK5C 1YZZA 2CIKB 2XICA 1ZLWK 3SO3C 3N1GC 3DX6A 3TIDA 1GGCH 3V5KA 2R2BA 1YY8B 2YUVA 4UOW0 1F90L 2APVA 3OXSB 3FAXA 2JK5B 3HUJF 5I8KL 1FDLL 3WFDL 5AYQA 3UC0H 3RWDB 1KCLA 4EI5D 3IRZA 3D5OF 5DD5L 4M03A 4X5XA 1HKLL 4IRJB 1UWEL 4OD3L 4GRWH 4PJ5B 1KTKE 1G7MA 3VCLA 4S1RH 3MLWL 3BP4A 1IL1B 2HRLA 2DIJA 3MLSH 3IJYB 1FZMA 5HDBE 5K9KA 5IMMA 1QR4A 1KC5H 3L3GA 1ULVA 1RHHB 2P42B 1EEZB 3DX9A 1S7XA 2I60H 1DBJH 3QNZB 2BY2A 4GW1B 1NUDA 4UAOB 5I8EB 1B6UA 3W9EA 4PJ5E 1J18A 3QQ9D 5EBMB 2DLFH 4MDJA 3AS0A 5CINL 3RVWC 4JKPH 3ET9F 1NKOA 1AKJD 1LP9E 2BNRA 3BPOC 3GMNB 2WSKA 1LO0L 1D9KC 1MUJA 4WGWB 1T83C 5MEQB 3ECBB 2X70B 1HXYA 3VFTB 4UILL 5E5MB 4JO2L 1MI5D 1QFWI 2XA8L 4UTAH 2GUOB 4WWKB 5EWIH 4KKAC 4YUEH 3JWNC 3TWCL 2OZ4A 3AY4A 2DIAA 1P53A 5DWUH 1FL3B 4BK4A 4JY5H 2DB8A 4XBPB 1F6AA 1HQRB 2VDRL 3V6OE 5KVDL 1OW0C 4QRUB 1NL0L 2C4XA 4XVUD 2EYRA 2G75A 4G9FD 4O58H 1VENA 1WSST 3VJ6B 2A74B 1ZWIA 2VZTA 1RZFL 3O9WB 2GFBA 4LLVB 4Z7QF 3RQ3A 3FHAA 2E9IA 5F8RC 1KIPB 5I1GL 3FRUA 3MLYH 3SO3B 1J0HA 3RIAF 3F7VA 4Y2DC 1YJDC 3FCTB 3SKJH 3RWJB 4JN1L 1PGRB 1XF1A 2ICEB 4POZC 1F11A 2ZOKB 2GK0B 3MV9D 2VDKL 4DVRH 2G5RA 5EZLB 4FA8A 2AK1H 2AVGA 4AIZA 5I1HH 4HBCH 5L2JB 3PWPA 3WNMA 1K4DA 2VXQL 5CHNB 3NACL 5L8JB 1ZSDB 5DJCB 3QUML 2D7MA 1IILE 2IALB 1C8PA 5DUBA 3CU7A 3IU4H 1ZLSH 3DYPA 3B5GA 1F8TH 2FH8A 4HKZB 3TO4D 4DZ8B 3GMLA 5HYJD 3ZT5A 4LLDB 3MLRH 4N9GA 3RVVD 3IDNB 5GPRA 4UV7L 4KU1A 1MAJA 2IBZY 3TN0C 4F37F 1S7QB 4OV5A 5FB8B 2DBJA 3GMMA 4YBHA 3BPOB 3H8NA 4G8IB 4Z7NF 3NPZB 3OKKA 5ID1B 3GSWA 1D9KB 2N7BA 3IXAB 1FORH 7CGTA 3P73B 4EIZC 3IKCA 4L29A 1GYAA 4H26B 1GC1H 1K6QH 2VXVH 3IETA 3MRRA 3KPSD 4M48H 3RVXD 1FBIH 1VGKA 1E4KA 1KJVA 2FJGB 3UO1L 4WUUD 3V0WH 1FZJA 1NMAL 2BOCA 1T21B 4JZJA 3G5XA 3TV3L 1AQDA 3MXWH 2VXSL 3KYMB 3QWRA 3THML 3WLBA 2CXKA 3JZ7A 3UTQB 1WAAE 1U0QA 1EMTL 1I9JH 3HB3C 1T3FA 3WNKA 4PV9A 1ZS8B 3LEVH 1XF5A 5FCUL 3F12A 2CKBH 1JNHA 4U6VH 5JORB 5CGYC 1FYHB 3DYMA 4KKLC 4OCSH 1F42A 5EOCH 4FQ2H 4R6UA 1EEYB 1JK8B 2XFXB 4E0RA 1I75A 3WXWH 1GIGL 1DVFA 4LARL 2K7PA 1RURL 4GAYB 4MAYD 1A14H 3B3IB 3MZGB 1NBYB 4H5SB 4Y2DB 2YD7A 4HIXH 4QEGA 1XF3B 2AERT 3EOTL 5IM7B 1AI1L 4L4JA 1AFVL 2XN9A 4QO1A 5IV2B 3RX5A 1TETH 2WWMD 1TZIA 4PB9H 2W9EL 3VXRD 2H41A 3V79C 5HYFA 1U8PB 5TDNA 4ELMA 4YGVA 3INUL 4JAMB 1AIFA 2L4OA 5DHYB 5FV1L 1TLKA 4G8GD 1J8HD 2R4RH 5JDSB 1IEHA 1WIUA 3MJ9L 1Q94A 2UZYB 5HTSA 1MCDA 2OLDA 4KTYA 1GJIA 4O2FB 4PJXA 2Z9TA 3CX2A 4JRXE 4DN3H 3V7MA 3RNQB 1KB5H 2R23B 2YMXL 3TN0B 4NRXB 2YD8A 3K4ZA 1DEDA 2Q7NA 2Y06L 5IG7B 1KT2A 1JI1A 5CJQH 4G7YH 1FLRL 1MFBH 3MLTB 1T04A 3LHPH 4M6OL 5LGHH 1AXSA 4BQBA 2J8UF 3JTSA 3WSQH 2YK1H 2D7OA 5F7DB 2EDKA 4YC2C 3AU1A 5BVJA 5J6HA 3LN9A 5FV2A 3ZT6A 4WI3A 1A6UL 3IGAB 5CIPA 4CVXB 3SPVA 4X6CA 1MWAL 2B0SH 2X4QB 4XZUA 2QQQA 3SE9H 1HOCA 2W92A 4LSSH 1WWBX 2PKDA 4KHTH 1FZMB 5EUOB 4PJDA 5K9KB 2Y5TB 2AXFA 4HDIA 4GSDH 3LKNB 4G6KL 3DX9B 3QA3A 1S7XB 5DD1H 4AYFA 5T3XD 2E9BA 4OFYD 4KMLB 4XPTL 3T0EA 1IEAA 4MD5B 4NWUH 1QFHA 1KUMA 4S10A 4TQEL 4L1DA 2BNRB 5EUOE 3MV8A 3SDDA 4HHAB 3VFVA 4FABH 1U8HA 4PJ8D 2DJSA 3E6HA 3RGHA 3L1OL 4X98A 3V6FA 4HF5H 3D69A 4LRIA 5FA3B 3CSBA 3MRMB 4X80L 1M7IB 3A67H 3H7BB 1RI8A 2EICA 4KRPC 1XR9A 3D3VB 1CDHA 3PWVA 5FGBC 1KBGH 3MRKA 1N5YL 2BNRE 4HIHA 3S35L 4HKJA 3QIUA 3CH1A 3L3KA 1XEDA 3CJJA 1CFBA 1IKFL 1F6AB 4WEMB 3WD5H 4F15C 2ZOLB 3EOYG 4XCNB 2EC8A 1J1PH 4Z95L 4P5MA 3BKMH 1M1SA 3PHOA 5FGSA 1GGIL 1IM3A 5ITFA 2QQKL 3C8KA 2DQEH 4LK4A 1ZWIB 5D93C 1JGLL 5D7IA 1IBGH 2PETA 2E7HA 3ZKND 2GFBB 1F58L 4H1LH 3MPCA 4EI6B 1AD0B 4DTGH 1Q0XL 2J5LC 2BVOA 4FXKA 4LHUB 4KDTC 1Y6KR 5FOJA 5CILL 3FN0L 1YNLH 3MLXL 1F11B 5E8DL 4PLJC 2DM7A 4YC2B 2BP3A 3X13B 5JA9A 4X83A 4H0GA 2A6JB 2L0DA 3X14A 4EUPH 2ZCLL 3K8MA 2BXYA 2JLLA 2I25N 5E1HB 4JFXB 1BM3H 1EXUA 4HWZA 5I1IL 1A3LH 2GITB 4LHJB 3CFDB 3F5WB 3ISWA 1L7TL 4O2EB 4ELKB 5GS1A 4MXWL 1FH5L 1J05A 3DHJA 4PJAF 4N9GB 1CIDA 3W9DB 5EFIB 4QHLB 1S9WB 4LSPH 1OGAD 1CU4H 5KVEL 4OV5B 3QISA 5C07A 2C26A 3GMMB 4NRZB 2Z8VC 1BJ8A 3P11H 1X7QA 1MAMH 1P7QA 3GSWB 1QSEA 4PJIF 4WTZG 4YPJA 3IKCB 4L29B 5ID0A 5ERWA 1IQWH 3IETB 1KJ2H 4QT5B 3ARYA 5HYSA 4KAQH 5C8JA 1KJVB 1BWMA 4PRDA 2VAAB 1G84A 1FZJB 1CLYH 3O9WD 2YA1A 1F2XK 1HHHA 3EDFA 3GMPA 4L5FH 4RAUA 1MHEA 1ZVHA 4KRPB 4DK3A 5IQ7H 5F7EL 5I15H 4FQ1H 1ZTXL 4H1LB 1H3PL 1U93A 5INDB 3MYZA 4KY1H 2V7HA 3TT3H 3ZKXC 3WJJA 1Z2KA 3DV4A 4PJEA 4MXQC 3FHQA 4CN6A 1T3FB 4F15B 1OSPH 3P0VL 1T7YA 4RNRB 1QEWB 1HH6A 1SEBA 1YC8A 1JNHB 2M2DA 5D93B 3P9LB 2E3VA 4E42B 2F58H 4FXLA 4KXZH 4JFDB 4EUPB 2NR6D 1C7TA 4U3XA 1NANI 3SDDC 3WO3B 5CD3A 2J5LB 4IDJH 1JRHH 1MIEL 4N8VB 1FO0H 2D4DA 2WINA 3OPZL 4OJFH 5EU6A 4D94A 2ZUWA 4KI5C 3TH3T 1ZT4B 5L88H 4L8BB 1QFOA 5DT1L 3RZCA 1KXTB 3RVWD 5IVXB 4JDTH 4JFDE 4ELMB 4YGVB 4DKEH 4LEOB 3KLAB 1FNFA 3V7AG 5I19H 2OTWA 1BJ1J 3HI5L 3OF6A 4MD4A 4ZXBD 1JGEA 4M93C 4HWBA 4KK9C 2KQMA 1SJEA 3QZWG 4PRBB 5E2UH 2BJML 2Q86A 1FP5A 4ORGA 1FAKT 4X6BB 1QYGH 5IVXE 3K2UL 3GB7B 4ELME 2RGSA 3B2UD 3H42L 3AM8A 1CT8B 4Y5VC 2G5BA 1LEGA 1KT2B 4EI5A 1T04B 1AXSB 4PJXE 4Z7WB 3IFLH 4JKWA 2VL4A 5L8KB 5B3JF 5DD3L 4KQ4L 4C56B 3AU1B 1J1XH 5J6HB 4HT1H 2Z8SA 3PE9A 4Y0GA 2R1XB 3NBNA 2ADGA 5M7QA 2ZWLT 4XZUB 3HFMH 3ZKXB 1MFEL 3SDYL 4Z7WE 3QCUL 4YBLC 1NFKA 4LRNH 2JJUA 5DMJB 4JY6A 5DD0L 1FIGH 4C56E 4G7VH 4XWGL 2G9HA 3QDJA 1RULL 4I77H 3AAZB 1SVCP 4IRSD 1IAKA 1AKJA 4ZO6A 4HLZH 3WXVL 2K7QA 4PJCF 2OQJA 1I1FB 5LVEA 1EO8H 1EFXA 2ITDA 3KPPA 4HJ0C 3S37L 3SDDB 4PJDE 3F7PC 5ADPH 3FB7A 4X5WA 1MI5A 3VRLF 2ZPKH 3I6KA 1LO3L 2DRUA 2CLRA 1M05A 3D69B 4J3OC 5IIEA 4YWGL 3O6FC 1BZ9B 4JKMA 3T0EE 4NNYB 2R0ZH 1HK6A 4Q58C 3PWVB 4PYGA 4YK4C 3RDTA 4IMLB 4XWOC 3GNML 4CN4A 1PD6A 4MJ4A 2CD0A 3CH1B 1IFHH 1HDMB 4XPFL 1S78C 4OBRA 1RZKC 4M93B 1T66C 4YDKH 4KZDH 3TBVA 4HC1A 4KI5E 3KS0J 5DMGC 2DQCH 4XCYA 5ITFB 3ZMRA 3H9SB 3BISA 4U6XB 3SDXA 3KYKL 5EOQL 1K5NA 3ABZA 4Y5VB 1GAFL 1YYML 3I6GB 2BVOB 4QYOA 4HUXA 1E6JL 3QG7H 4AY0A 5B38A 3EJYC 2BVPB 1VFBA 1CCZA 3D87B 3MROA 3FO2B 1REIA 3H9SE 4TRPH 4GXVL 5CGYD 4P2QD 5D7IE 3BIKB 4HMDA 3AS1A 1OAUH 5ECJE 1B6DA 2MQ3A 2I9LB 2LVCA 1CFTA 1ORSA 3CLEL 5AZ2H 1A1OA 3TO4A 3CPLB 5KSUB 4R26L 2VLRA 3QHTC 4YBLB 1FFQA 5DGRA 4KJPC 3EIFA 2YKLH 1S7RA 4MA3B 2V6HA 4DCQA 3ROLA 5JW5B 2D7TH 4O02H 1T03H 4UT6H 1NCWH 1J05B 3D3VD 2A0LC 3GFUA 4JM2A 1RUAH 3VWKC 3QFJD 4OZFG 1AE6L 4RWHA 1YEEH 2OS7A 1PEZA 3AM8C 1ZLUK 2YPVH 4U1GC 5IHUH 5C07B 1CDUA 5FOBB 1LO4H 3PGDB 5TDPB 4D3CL 1QSEB 3O2VL 4PJBA 5KTEL 5IKCA 3BSZL 3KPNA 1OTTC 4NP4H 2H8PA 3O6FB 4MNGA 4PRDB 5FUCC 2WUBL 3GMPB 1HHHB 4RAUB 4RDQG 3MGAA 2O5XL 4XX1E 5GS0L 3BP6B 1A3RL 4YK4B 3VWJA 2X1XR 3CDGB 5C07E 2YEZA 1A9EA 4HX1A 2V7HB 3LQMA 1VA9A 2ATKB 4ONFH 2SEBA 1QSEE 5FYLL 1JNLL 5EDXA 5EO0A 1QSVA 1DQMH 4FQLL 1R3LB 4PJ9C 4UT9H 4CVWA 2OL3A 4O2CB 2UYLB 1UYWL 1FSKC 2MMXA 4F7EA 4MX7A 3VMPA 5T3ZL 1VFMA 1X4ZA 4LCWD 1OLZA 5C0EB 1UQSA 1IGYA 3K4AA 1W72A 4HAFA 3FFCD 3TPUB 4P2OD 2DQGH 3VFSB 1RJZA 4LLMA 3FQRA 3VXNB 5LCVH 4B0MM 3VXRA 2EDRA 2WIIA 5CJBA 3PWUA 3PXJA 5ICYB 5HHPA 5HI5C 4HFUL 4G8GA 5I2IA 3HPLA 3RDTC 2UWEA 3STLB 1WV7T 4XMLL 4OGYL 1UJ3A 5DRNB 5D8JH 4MVBC 1S5IL 1UXWA 4NO5A 4MD4B 4F7MA 2H32H 2VIRA 4PGCB 2R69L 4ZMAT 5C71A 5EIIA 2NXYC 1T22B 4DN4H 2Q86B 1SEQL 4ORGB 1Q9LB 5FK9A 3VWKB 3OG4B 1DP0A 3VA6A 3DMMA 3DROA 4Y1AA 2FSEA 4X9BA 4U1GB 4R3SA 3RU8H 2FHFA 4KV5E 3QPQC 3DSFL 1NJ9A 4HWBL 4KKCC 2ZUTA 1DUYA 4NKMA 3BN3B 1MJJA 3U2SB 3ELAT 2UZIL 2VJXA 4JN2A 1AD9A 4XC1L 1R0AH 5I8CB 1FAIH 1LD9A 4JFDD 2ADGB 3HLAB 1NCDH 2DI8A 3TBWA 3G6AA 1BZQK 5LWYH 2R2CA 3DX8B 5C0FA 1NGPL 3M8OH 3PJSA 4YHZH 3C08H 5DJAA 1U92B 2CUIA 5CJOH 2HRPH 4OFYA 4JY6B 4N0RA 2G9HB 4PJ9B 3SKMA 3UEZA 3I02A 1FSKB 5JHLL 4J1UA 4TOYH 2YZ8A 1EEQA 4JM2C 4CKVX 4PJ8A 2IAMD 1CLZL 1NUGA 4NQCB 4S2SB 2D03H 2OQJB 1MCJA 1GGBH 1IC4L 4XP6L 1NEZG 1EFXB 3QHZL 3E2HC 1UKTA 3FRPA 1FGNH 1JYWA 1F3DH 3HNVL 3T1FB 1NBQA 2F5AL 2EDTA 3I6KB 2Y9RT 3QDJE 2A9NH 5ESVA 4XAKE 3HAEH 2VDQL 1NCAH 1G9EA 4GG6F 3QCTH 3RPIB 3CX5J 4FQXA 5JDJA 2DDQL 4NQCE 1T5XA 4NCC1 3ZO0A 3VDBA 3RDTB 3VWJC 4WTZA 5JHDD 5IR1B 5MHSD 1PG7X 2XI9A 3C5SB 2ZKHH 5DUMH 3BKCL 2DS4A 1F4HA 1K8DA 4C56D 1JMXA 2F8OA 4LL9A 2NXYB 5I73C 4FFWC 5TQ2H 1OVZA 4XCYB 3UYRL 4M6AA 4TUKL 4Z0XA 1JVKA 4XBEH 3DHMA 4U0RC 1K5NB 5T5FL 15C8H 4WFED 3RJDA 5GRZA 2HJFA 3BKJL 3HZVA 4ODXA 5TH2B 1I1YB 1QZ1A 4KVCH 4GAJH 3NN8A 1A6VH 1EGJH 4GRLA 3JV0A 3M17A 4X6EA 3KJ6H 1JF6A 3WO4C 4ONHA 2FECL 1I7ZB 5KVFH 4L4VA 5F9JB 1PY4A 3TH2T 1ORSB 1A1OB 5HHOD 4F7PA 3U4BL 5JUEH 2VLRB 4KROC 3V9FA 1NCBL 2PTTB 2I5YH 2O93L 1BFSA 2R15A 1FE8L 3ROLB 4YBQD 3KYAA 2DQTH 5H2BB 1JPFA 4M1GH 1OP5K 1CFQA 2NW3A 3JWDC 3MA7A 4JFZH 4JM2B 1LILA 1LE9A 2FIKA 3F58H 4J6RL 3DMMC 3MC0A 4PBVC 2DYPD 4LKCA 4DJMA 2VLRE 3E2HB 1IGIL 3V2AR 3GSVA 4MCYA 2HMID 4JFQB 4PJ7F 5DJZB 1W0WB 5DZOA 2OTUA 3KPNB 4WHTB 4P99A 2H8PB 5IBUG 1GH7A 3O6LH 4GKSB 4UUJB 2NZ9C 1A47A 1RZJL 4XPGH 5CS7A 3VWJB 1A9EB 4HUWA 4HX1B 4ZS7H 4NHUA 5KZCD 5LQBH 3UTTD 4E41A 2XXMB 4OLVL 3MV7D 5DVMA 5EO0B 4QRRB 5A2IH 3P9MB 1U42A 2OL3B 1S3KH 4L8SA 5K9OA 5I73B 4F7EB 1YEDB 1UZ8B 2KBGA 5C0BA 3TNNA 4LOUD 1W0VB 4OT1L 1VCAA 2EC9T 5I9QC 2CGRH 4U0RB 5D70H 1W72B 5FGCB 3BXNB 1CDJA 5I17B 4OUUB 4NKIH 1CLOL 3BN9C 1JGDB 4FNLL 1JMZA 2X4RA 4P2RA 4WU5A 3ALXA 3WO4B 2Q20A 3PWUB 1C7SA 4GAFB 1EK3A 1DLHA 2DTML 4ZXBA 3ARQA 5I76B 1QTYT 3Q0HA 1RIVL 4UTBL 2X89D 1VFAB 3IDXL 2BY1A 3T77A 1FRGH 1MLCA 4L3CA 2EYSA 3LIZL 4KROB 1UXWB 1AGEB 1LO2L 3PWLA 1OP5H 4P57A 3G5YA 4G5ZL 5EIIB 5I1DA 2R0KL 5E94A 4YHYC 4GW4A 2C1PB 5I1EH 1P4LB 1A1NA 4I0PA 4BA8A 1CD8A 1H0DA 2VQ1A 3DMMB 4Y1AB 2FSEB 4Y4FD 5I1AA 1QNZH 3GSQB 4QXGH 3KAAA 1BQHG 1MRDL 1S78D 3WIFA 3WL9A 2DD8H 4LSTH