3D05A

Human p53 core domain with hot spot mutation r249s (ii)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
193
structure length
183
Chain Sequence
SVPSQKTYQGSYGFRLGFLVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 183
sequence length 193
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d05A00
3EXJA 2J1XA 4A63A 4IBSA 5LGYA 3QYMA 3D0AA 2BIQA 4IJTA 4AGPA 1IO4C 3ZMEA 3Q01A 5G4OA 3WTVA 1GZHC 4IBZA 4LO9A 2P52A 2X0WA 1HJBC 4G83A 5ABAA 4XR8C 5AOLA 3QYNA 4GUOA 2PCXA 3TS8A 1GZHA 1HJCA 2X0UA 1H9DA 5AOIA 2J1ZA 1EANA 4IBUA 4HJEA 3WTTA 3WTWA 3VD1A 1EAOA 5KBDA 3D07A 2IOOA 3EXLA 4AGLA 4LOFA 5AB9A 4IBTA 4IBVA 2J1YA 1T4WA 4AGNA 2J21A 2XWRA 2BINA 4IBQA 5AOJA 5AOKA 3D09A 4GUQA 3US1A 5LAPA 3VD0A 5A7BA 4AGOA 1KZYA 2J6WA 3US0A 2VUKA 1LJMA 2ADYA 2WGXA 4L0ZA 4IBWA 1EAQA 2OCJA 3D08A 2AHIA 4QO1B 3D06A 3WU1A 3WTXA 2H1LM 3KZ8A 2FEJA 4L18A 1YCSA 4IBYA 4L0YA 3WTSA 3Q06A 3WTYA 1HU8A 4MZIA 3VD2A 2MEJB 1E50A 5G4NA 5AOMA 4AGQA 2IOIA 2J20A 5ECGA 4LOEA 2AC0A 3D05A 4MZRA 1TUPA 2ATAA 4AGMA 3KMDA 3IGLA 2J1WA 2BIMA 2X0VA 2XWCA 4G82A 1UOLA 2RMNA 5BUAA 2GEQA 2BIOA 2YBGA 5G4MA 3IGKA 2IOMA 3WTUA 1CO1A 1TSRA 2BIPA 3Q05A 4KVPA 1CMOA
chains in the Genus database with same CATH superfamily
3C5XA 3IXAA 4HYTB 1UACL 4U3SA 5FYKL 1KBBA 2Y5TA 3SPJA 2ZUQB 5T3ZD 2YSSA 3LQZA 2CJUL 2HLAA 3Q5TA 3U4AA 4UTAH 1NICA 2G5BB 4JLRA 2Y07L 1AGBB 5I9QB 2YARA 4UUJA 4XP9L 4JFPA 3LPPA 1ZJBA 3GIVB 5C08B 4IGBA 3S3SA 5I16A 1I9IH 5KSAB 4QMEA 4Y1AB 2YD6A 5HVWA 2VQ1B 4M7ZC 3ARFC 3QDMB 4U3CA 3QZOA 5F9OL 1U3HC 5INCB 4L0PB 3PWPA 3T2OA 5GS1A 3KM1A 1A6TA 2UZXA 4MFHA 3RI5K 3X1NA 1SYSB 4S10A 4JREC 4IOFC 4HIEA 1GGCL 1QFWM 4LEEA 5K9KA 5KYXA 1JWMA 2JKRM 5I75B 3W38A 4PJ9D 1Q4NX 4N1HB 4ELKA 2DQFA 2G4EA 3AVEA 3GRGA 1G9NL 4Q58C 1U8IA 3LEVH 4B95C 5LBVA 2OYMA 2WWKT 3NACL 3QP3A 3WIFB 1YY9D 1ZGLM 1RJZB 3X2QB 5DC4B 2ORBL 2Y6TE 2VAAA 2EE9A 5GHWL 4JJOA 1Z9PA 1E27B 4D0CB 4EQ2A 4ZAKC 4HGWB 1J05A 1UWXH 3KXFB 2ZUVA 1H6TA 2K9FB 3LN5B 1PZCA 5EEZA 3SE4C 1M57B 4WUUD 4L4VD 2A0LD 1RV6X 2ZJSL 5JW4M 3BMWA 2DWEA 1JAEA 5DWUH 1JCVA 1Q1JH 1MKFA 3U48A 1CR9L 5EEUA 1MCBA 1MFDH 1U2CA 5HHNA 4HS8L 3FCGA 4LAQH 1DDHB 1J8RA 3MA9H 1S78C 3PWNA 1DQLL 4D94A 2F68X 3FN3A 1FL5B 3LXCA 1RULL 1MCWW 4QRPE 2X1WL 1BCIA 1XEUA 1O7VA 3EFOA 1XQ4A 4OQTA 5KG9B 1I3UA 2ENQA 2Y0SA 4N2AA 5HDRA 2XWEA 2X9YA 3SOTA 2CO7A 2JJTC 5EU3B 2EVIA 2XZQH 3VXUB 5MP6H 1M53A 5IJVA 2D7TL 4QYOA 4FQ1L 4DQAA 2EXYD 1AKJD 3WD5L 2R2BA 4AZ8A 4DO6A 3P0VL 3DHUA 3ENEA 4KMLB 4OF8A 4G59C 4WU7A 5ESAB 3VFNB 4PLNC 3TO4A 4BYHA 2NUPA 1XSIA 3OAYH 2CIIB 2VH5H 1BZDA 1TETL 3WL9B 4KQ3L 1R47A 2FWLB 4R4FH 4AVKA 3DPBA 3KH4A 2B08A 3BUYA 3VFWA 3VWKC 4J3OH 3PY9A 1PKQE 3CX2A 4TNFA 3DX1A 2IAMC 3EYFB 3MXWL 3TWCL 2J1XA 4H1LH 1J86A 1Y18B 1KGCE 3DVIA 5J1SC 1YJDC 1QFOA 1DL7L 3L08A 3QB7C 4DP7X 3ZTNH 3VA6A 4PLKC 4CVZA 2P45B 2X0WA 2H3NB 3FUJA 4R7NB 2E0PA 1TQCC 4HJ1A 4AQOA 3F85A 3AU1B 3EH5B 4NWUH 4Y5VC 1A1OB 2XOTA 5JPNC 2WSPA 1JGUH 4PYHA 3RGVD 4QRTB 1MQ8A 5EEVA 4K71C 4QHNB 1FYTE 3NDZE 2PR9A 4P2RB 3MLVL 2K3HA 4PYGA 4DFHA 1YEDA 1J9SA 1GHFH 3T0EB 3DJSA 3ES6A 4KY1L 1LNUB 1Q9WA 3E80A 1ZVNA 4HXBH 2HKFL 3JUZA 4FA6A 2WIIB 4PJFA 2ETWA 1RFDL 2J1YA 3E8UL 4WHTA 3ZQXA 2DQGL 1W0WA 2ATPA 4M1GL 1OARL 4JFWA 4P5TC 1B0WA 3KPSA 4ZQKA 5E00A 3RVWD 1AACA 2R83A 3SPCA 4L9DA 3WELA 3CJJA 4YDVB 4PJEB 3H42L 4OD3L 3CV5A 4WFGE 2A2QT 4KNSA 3WJLA 1UB6A 2NR6D 2KERA 5FAAA 3SDDB 1TTRA 5DGQA 1WD9A 4RWHA 2A99A 3ZBMA 4AEFA 2IF7A 3KYMB 3NVQA 4UOJA 2DBJA 3EJYC 2PYFB 4JG1H 1KPVA 4K3EH 4N2CA 1T7YA 2CO1A 4TNVF 4BA8A 1YEIH 2JKTM 4POZD 5FB8B 2UVEA 4NWTL 4RFOH 2NNAB 1N70A 2L3BA 4HKJB 4OCXH 4JE0A 5SX4H 3U1PA 4UT9L 4FEMA 1JZDC 1T04A 1OSEA 4P99A 4FQXC 3T3ME 3QUGA 2WWOA 1XZ0A 1WYJA 3AG1B 4IIQB 1J1XL 3GBMH 4NSKA 3OQRA 4MZIA 5F6HI 2NQ3A 1P9MA 3PGCA 3UZVB 2VR6A 3LS5H 4OZHF 5F44A 3BISA 1XR9B 4LSSL 1JZ8A 1OT2A 1MFCL 4OUUA 3L7FA 1CFMA 4XO9A 4GBXC 3LPGA 4UBDC 4IU2B 4PRAA 5CU9A 1YQVH 3RBSA 4BELD 4CC0A 4UV7L 4YHNB 3NIGF 2WLJA 2UY6B 2EZ0C 1A14L 1DJSA 1IGYA 2NY3D 4OCWH 2A1WL 3A67L 1FBIH 3NQKA 5EOTA 5A2BA 3V6OE 5DURD 5MI0C 1F5WA 2AJXL 3APDA 2AK4A 3BGFB 3IJ9A 4LNRA 2WUBL 3HW7A 1SY6A 4JY5H 3VI4B 4M7KL 4IKJA 4NQDE 1J0ZA 4UILH 3S4SA 2QKIC 3UBFA 4EDWL 4UNTA 1GR7A 4M5SA 4LCYB 2EXWD 2OTUB 4FLQA 1A9EA 3MACH 3GYRA 3UADA 3WY4A 3B9KC 3OKMB 4J3WA 4XBEL 3TJPA 4FXKA 3MFFA 4WZ9A 3KWTA 5IHLB 3HZYB 1BXXA 1UA3A 2YPKB 1IAMA 1WF5A 1PG7X 2J71A 4O4YL 2LE9A 5GJTH 2PTTB 5F8RC 4FXGC 3ZHFA 2C7UB 4HK3J 2J4WL 3N9GL 3MRLB 4JVWA 3U4EA 4YLCA 3QXDA 1KCVH 2WXLA 3LQMA 3GZQA 3LRKA 4CGUB 2VLKA 4YBLB 5A2AA 4U3HA 4OCYH 4AG4L 3WEOA 1N12A 3ATBA 3ILPB 3D39D 4PB9H 5BMFH 3QZMA 3APNA 5CWSA 1MCDA 2E9BA 1DANT 1NC2B 2OJZH 3GXDA 1T4WA 2NY2B 3IJSB 2ZWSA 4LCIH 1AQKH 5AVQB 2UZIL 1GJWA 2IPUG 3WE6B 3CIQA 5IW1A 3CMOH 5EOQH 3IWVA 1JZJA 2P8PB 2EDEA 2R39A 4AQEB 4DQOL 1P7HL 1FAKT 4BUHA 1TCMA 4L4TA 2X3BA 1MFAL 3CHSA 3L4VA 3NMEA 5IVXE 4J12A 3MJ9A 4ICXA 5F72S 2CDFB 2ZKXA 1BXUA 4W9LC 5TK4A 4AV5A 5LNDA 1KJ3L 4OZFH 3DUUA 4U6HA 4WUUE 4L4VE 3TIDB 5EC1A 4GEJA 4A2EA 3O0RH 2VABA 3OMZA 4Y9FA 3LXBA 4M02A 4BWWA 4HOXA 2DQEL 4QTIH 4BFIB 4E9VA 1JSYA 2JH2A 2WLLB 4P23D 3R06B 4NAQA 4L18A 4FERA 4RGOL 3NFSL 3MRHB 3G08A 4I0KA 4F58L 2YRZA 4JPWH 4WV1C 3MLRH 1NIEA 5DC2A 3SOBL 1BFTA 1ND0B 4XCNB 3MNVB 1P7QB 1WHOA 2COQA 2UZPA 2D03L 1DBJL 4ZS6D 5I76A 5EFIB 4HSAC 3NRFA 1U3ZA 1FNEB 5I1AB 4QHKJ 4FQHB 5LHDA 3X3FH 4BSVB 3BUIA 1JS4A 3D30A 4HJSA 1JTTA 1VIWA 1FN4B 2Y72A 4JDEB 2VYRE 4UIMA 1U92A 3C60B 3UBXA 4CUCA 3PDOA 3F6JA 2YAEA 3AT9A 4RISH 5DZVA 2W0FA 1OGAB 4K3JL 3PHAA 4LHUA 3CN4A 1HXYB 2H0FA 3HAEA 1E5AA 1NUDA 5I71C 2XNAA 3D9AH 3DRTA 3U79A 2F8IA 4A7QA 3F3HA 1I1AC 4E5XA 1OGTA 3A6BL 3X12B 5CNHA 2VKXA 5D1XD 1AO7D 3KVQA 5E2WH 5DVOA 1NDMB 4OJAA 4ENEC 5LDUA 3GMNA 3T77B 1DSWA 1U8HA 4WI7A 2BXYA 4HIIB 4OW6A 4ZUTB 1BHGA 2V5YA 1UZ6F 5C07B 3QWQB 2VDLH 2XBZA 4DZ8A 5IFJA 2BNUA 2CO6B 4FNLH 4BZ2A 1RLBA 2O5YH 1AD0B 5FHAH 1E9QB 1HIML 4LU5H 4XNZC 3ZL4L 1KEGL 4HJEA 3SGKA 3W1ZA 4LLYA 1NMAH 3B8YA 3EF7A 4HS3B 3HTLX 4EIGB 4MD0B 1THAA 1OV8A 1GY2A 1RK7A 3L1EA 3CSFA 4OSUH 5ABZA 4L37B 4QKTA 5FKPB 5GISH 4NAMA 3DO4A 4ZUWA 4F7MB 2Z7UA 3CFKB 3U0TB 4A1RA 4PUBL 4LQFH 5LAPA 5DEZA 4L8SA 1L7IL 1DVQA 2QT6A 1MCPL 4RIRA 5TF1L 4YSSA 2HVJB 1C8QA 5C0AD 3QFJA 3K2UH 3QC5X 1TFHA 2QADD 2R23A 3H2QA 3JWNE 1NCJA 2IJ0C 4AKOA 2FO8A 5B3JF 1KTCA 3Q2VA 4F7CB 3GRBA 4KO6A 4BSWB 3INUH 2X9XA 1JNLH 4DGWC 3NFPA 3KWXA 3ECQA 1DBAL 1FFPB 3PNWB 4Y4HA 4XN4A 5EO1A 1MW1A 2WUCH 2LU7A 1KLGB 1HU8A 2E3VA 4Q6IB 1I3VA 1E5BA 1VA9A 2MEJB 1ITCA 3CTTA 3GSUB 4JFDA 4YHIB 2QPEB 3HUJE 5J6SA 2WLYA 1EBPA 4YZFE 1AGBA 4DEUA 3SDCB 2NXZC 3K2KA 1RUQL 3VD5A 2WO4A 5KSAA 15C8H 3H3PH 4GRLB 3MUZ1 2VQ1A 3QDMA 1AGFA 1D6VH 3HI5H 4QGYA 1MREL 1ZVHA 4D9QD 2H5UA 5D7IB 2O6DA 3EGDA 1OT4A 3NCWA 1GMIA 1RI8A 3QCTL 3WUWG 4HLEA 2Q8AL 1HILB 3W2DL 5D1QA 1RZKC 1EO7A 1SDDA 3U0PA 4G8EB 1QBLH 4J3OD 1I9RH 2WPGA 1MCCA 1HKFA 2Y7QB 5CGYC 4CAGA 3NRQA 1N6QL 2CIKB 5J3HD 2QGCA 3FFCD 1X5LA 2WQXA 1V05A 5SX5H 5CD3A 4YBQC 1GZHC 4ZDHA 2FATL 2GITA 1E27A 5GGVH 3VU2A 1AYRA 4JM4L 3ESUF 2WZ0A 4HEME 1OOAA 3EOYG 1BECA 4TOYL 3WAKA 1SRDA 1I1YB 1KNOB 2CDGB 1MPAH 4X5XA 3J8F7 3VDCA 3HPJB 3IJYA 5L2JA 2JELL 2YPLD 3L9YA 3EG9A 3ZZSA 1LO0H 3OKYA 3D39E 1CGSL 4MD5B 1C12B 1XSKA 4ZMNA 1E4WH 4OB5H 4PJIE 3BAWA 4AEHH 4AXWB 2FZ3B 4R7DA 4F7KA 4BKLB 2J1KA 2Y1VA 1A0QL 1Q9LA 6TAAA 3FOLB 4Z78B 1T6WA 2C34A 3QFDA 5MEOA 5IJDC 2YMTA 4O9HL 3QA3A 5E4AA 1NFIB 3N44F 1S7SB 1TDQA 2CALA 4XNUL 2Z8WC 4QRPB 3RWEB 5DJ2B 2DLFL 2EE2A 1INDH 4R7VA 2PCYA 4AT6A 1M7XA 1URZA 3EYUH 2BSCA 4JG9A 2YGQA 3NT0A 3MDJA 3P4NB 4LLWB 1ECZA 3S3DB 2HVKA 4ANUA 2H32H 3RURA 4RFNC 3QW9A 2ARJQ 2F54A 4F15C 5J12C 3H9HA 4OFPA 5EC2A 4QRFA 1JD9A 5AKTA 4HF5L 3NZ8A 3O45B 3TCXA 5FLUA 3DO7B 4XPTL 2B1HL 1PKQB 2Z7ZA 3GUFA 3HZKB 4LDOB 1KTLB 3TP4A 3ESVF 4G1MB 4OKDA 3AZUA 3JWDH 1J0IA 1G7MA 1F58H 5MERA 2P44B 1CU4L 3EJTA 5AQ0A 4P5SA 1GC1L 5FWRA 2ADFL 1IKFH 4LKXB 4M62L 2GTWB 1FVCB 2GYSA 4NZDA 4R7NA 4CJ0A 1KELH 2MNUA 4DUVA 4AITA 1DVFD 4F24A 1NPNA 2X05A 4X5WB 4LOUC 1FYTB 3Q8AA 3I85A 4QHNA 3WNLA 1C08B 3I2CH 3U0WH 1VESA 4I4WB 2YA1A 3DVFA 4KTEH 3T0EA 4K7PH 3KNBB 2GUOB 1WZ1L 2DOCA 3M7FB 3TWYA 3CXDH 3D48R 3DX3A 3CBKB 5F0MB 1MUJA 2ERJC 1BQKA 5D1XE 1NBZA 5FW8A 1AO7E 4B9CA 2OMUA 3ZDZE 1CFTB 3VRJA 1ICTA 3GMMA 3IDXH 4DT2A 3QPQC 4DGIL 4OFYA 5GZOA 1ZT4B 1ZXQA 3MBEC 4XAWH 5ID0A 2A38A 5JLZB 1HJBC 1UOVA 1Z5LB 5GSVB 3SQBB 1OQXA 4Y1TA 4AQ1B 3B7RL 5F0LB 2EIBA 3U46B 1OHZA 5HHOD 5A40E 3HG1A 3MO1B 1PQZB 3KPTA 1KCUL 2WWKO 3DTXA 3KYMA 5FK9B 6FABL 4M48L 5FM5O 1KEMH 3VM5A 5BO0D 1X9UA 2AQ2A 1P4BL 3FRPB 3WKQA 4KU1A 5EF0A 4IW4C 3NJJA 2O30A 4GKZB 1QR1A 3KWWB 4GNKB 4X4XA 3T3MB 3BWAA 2VDNB 5CIPB 1C5BL 3FQ1A 3IM1A 5CFHA 1FWXA 1AHWB 2AAVA 2J21A 3DC0A 2RACA 3EJPA 4FLSA 1TVHA 4IIQA 4OLUH 5IBTL 3MBXL 3HS0B 4PRDA 1MWAH 5AYUL 4XP5H 3SKOB 3WI9A 5BXFA 3ZQ9A 4AE1A 3L3JB 3AXIA 2GAZB 1Z3GH 3WFDL 2CKBA 3C9NA 5C0AE 5A2KH 1AG0A 5A7BA 4W6YB 3MODL 4HLJA 4XBPB 4AUUA 1FFOA 1LJMA 4JKPL 2R56L 5LDSA 4N9OB 4Z7QE 3RIAK 3ATAA 3MN8A 4GRWF 4XXDB 3GK8L 2MHAA 4FYSA 3WS3B 1CFNB 4LHJB 1QYGH 1OAUL 3VI4A 1FZOB 4NQDB 3X14B 5IBLC 2ZAIA 4AIZA 3ARFD 5HYQA 4R7XA 1U3HD 4PJFF 2Y1ZA 2QR0B 4BUQA 5ITBH 3Q06A 3CK0H 3O9WB 1WIUA 1KCSH 2NUTA 1JRHL 1QEWB 1F6AB 3A4EA 3RJDA 3FTWA 3KHQA 5HYJD 1KFAH 3GJFH 3GZKA 4ABUA 4KI5F 2BK8A 1WDAA 2PLTA 4NGHL 1KB3A 4IOFD 4JHWH 4NQQA 1WWWX 4IDJL 4LVOC 2A6IA 3HS9A 5AZUA 3H6AA 5F1KC 4N22A 4J3XA 1NZRA 3MRLA 3IMUA 4Z7NF 2ZWLT 3CPUA 3K2IA 4P3CL 1Z9OA 3E38A 4EAEA 1GVIA 4HQQH 1S9XB 2ZUYA 4OCSH 3DV4A 1NMCC 3EO1B 5BZDB 3OAZK 1HH6A 1T3FA 3IU4L 3FOMA 5IROC 1G7IB 4U49A 4DEPB 2YGVA 1JYXA 4MJ6A 1W72B 2H8PB 2LFEA 3FF7A 3WEXB 3APMA 4PH8A 5LWYL 3LN4A 3FFCE 2Z0UA 5EWIH 4ZFQA 4ZW3A 3ARBC 1OAXH 2N4IA 1N3NB 5FGBC 4OUOA 3MRGA 1NEPA 5KTEH 1G9MC 5IVXB 5FYJH 1AZNA 5HBBA 4LPYA 3JTTA 2AVGA 4NB7A 1CIUA 5DQJB 1XGYH 2GT9B 3E2HC 4WUUB 2Q7NA 4L4VB 1CXEA 1LE9A 2YPLE 4YDIL 4JFEA 2FEEL 4HC1A 3WY2A 4HUNB 4JN1L 4PJBE 4GQRA 5IQ9A 4MAYA 3BJ91 3QUMH 5GGTH 1KIQA 2XG4B 4FA7B 4N9GB 4OLEA 2P43B 2Q86A 2EEAA 4JM2A 4JHZA 4KJQC 4DP6X 3AXLB 2IQ9L 5E9AA 3RPKA 1PBYA 2GI0A 2Y06L 1P84K 4LSQH 3MV8D 3AT8A 5DU7A 4N1EA 4KKBD 3BUTA 3O2VH 3EYSH 1A6WH 3ZYOA 2QSCH 1EFXA 2ZKHL 2Z35A 3FT3A 2FBJL 3OPUA 4CMHC 2X2IA 4K5PA 1II4E 3FQUA 1SFDA 5E56A 1TVBB 1AKJB 1ASPA 3MRCB 3RDTC 1CN4A 5I1AA 5JPMA 1DQML 2IAMD 1XFPA 3IWUA 1U8PA 4BM7A 3PQYD 4XI5C 1OSYA 1FGNH 1ETA1 4YHPB 4WI9A 5B7FA 3BKYH 3LIZL 1E3XA 1T1XA 3PXHA 4A6YA 4GY4A 3WHE0 4HKZB 5L4MA 1R5IA 1X5KA 3Q8EA 1Q0XH 1CK0H 1WPCA 4A68A 5KN5B 1FVEA 2DKUA 2D3JA 4MKTA 1H3GA 3BAXA 1NWOA 2QQLL 4N8VG 4NM4H 5CXPA 5L2KD 3MREA 1YEKL 4TL4A 5D6DA 1BZQK 4YXLL 4L1DA 1LVEA 1WBYB 3IDGA 1KDJA 1EJ6A 4CBPA 1ZHNA 3SE9H 3GJEB 1CL7I 2WKOF 2XTJD 3CN2A 2IDFA 4MMZA 5HDBE 2BRQA 4R4NC 2XICA 2WW8A 2A6DB 3FN0L 1X5ZA 4KVCL 3V4PH 4JZNB 1DLFL 3CLFL 3X11B 2XFGB 2Z64C 5E1HB 3RGVB 4ZUTA 2VDPB 3UTTD 3QG7H 1D7CA 4P5TD 4TTDC 4YDLB 4YXHH 1J0JA 2Y7LA 2YAMA 3TC9A 1FORH 1MJ8L 1DQQB 3NEXA 3GXIA 2DI9A 5H8DA 2WAHA 1P4UA 1K72A 4HCRH 4ODWB 2LU4A 5IJKA 2D9CA 3N5AA 1CZ8H 4JGMA 3I9GH 3PCYA 1P4IH 3TEWA 1NM4A 2G2RA 2ZCKL 4WKZB 3UDWA 4M5YH 3C5SB 2OYLA 4FFTA 3WENA 4ZMWA 4OM0H 5IZ7A 3U0TA 1HEHC 1QVOB 2W92A 3Q5OA 5HHOE 1U6AH 4I77H 3P4OA 4RAVB 3OKEA 4JFSA 2HVJA 3RWHA 1DANU 3UGEA 4YE4H 4ZTPL 3V5HB 4KUZL 4ZO6A 2BM3A 2W88A 2YEQA 1NM9A 1R5VB 4KK5D 2APVA 1BXAA 2FLBT 3G6JE 5GRVK 4XXCC 5JYLA 4B7IA 4Y2DC 2Z4QB 2X41A 4GBXD 4RQQB 4BSWA 1A4KB 3ZKMC 5I0ZA 4MNHB 4MQSB 1OSZB 2R0ZL 3RPIB 2VJ0A 1P5UC 1BGXH 1YYCA 4MDIA 2LHAA 3DSFL 3HUJB 5T3ZL 3HVDA 2BCKA 2J44A 3IDYC 2FWOB 3PV6B 3TH4T 4X6FB 2UZYA 1S7TB 4LSPL 5AUMA 2YPVH 4GUQA 5KS9E 3SDCA 2W95A 2NY3B 4MJJA 1UGKA 2XWDA 3AWGA 3K6FA 4IRSA 1QUPA 3E7JA 2A6KB 3FQ2A 4RDQF 1HE8A 1MRCH 1YECL 5DURB 4GXFA 1R34A 3B9KD 5HD8D 4D7BA 2EDDA 3DBSA 5AZ2H 3RL2B 4ALAH 1EV2E 4G6FD 3UP1A 1FDLH 2ZT9C 5IB4B 3RP1A 2G75B 3S4SG 3BZFA 3LHPL 5LJYH 4FQCH 3K80A 2ADIB 3KGRA 4KMTL 1HILA 1X7TA 4JGJA 4K2UL 5H4ZA 1A3RH 2QHRH 3DGDA 4UV4L 5KSUA 4XVTL 1HXMB 1OF2B 4LCWD 4RA0C 5EOCH 1F0LA 2OX5B 5BVPH 1J8KA 1CGUA 5HYJE 2SODB 3ZPDA 3RTLA 3BKCH 3FCSA 3T3PE 2VM3A 3ZTEA 1W72L 5GZND 4I3RL 3H2WA 1TJHH 3UMTA 4Z3HA 3QIWA 3GM8A 4ELME 2B15A 4Q7DA 1FSKC 4UZSA 5BV7L 5C86A 2XIIA 3HRZA 3K6OA 4IJ3C 5BUAA 4LPXA 3O2DL 2WY3B 4PWIA 5L7XL 4TF4A 3HZ3A 1F4AA 3FQRA 4M5TA 3D39B 1HKLL 2VLJD 3MROA 2DYPA 4PJIB 2QQKL 1VFOA 3CQFA 2XZCL 1TQBB 4FQJL 1T5KA 2K4WA 4AXWA 4Y5XC 3ARED 5I2IA 4HSQA 4S1RL 3TNNB 2GJJA 4YXKH 5T5NG 1PSKL 1A65A 2DWYA 3KYKH 4O2CA 4DN3L 1RZJC 4Q2ZB 1NFIA 3KJ4C 1R1CA 4QRPA 1LDSA 2QFRA 1GGYA 4PQXA 3NCYP 2FHCA 4N86A 2BSTB 1J87A 5T1MB 3P2BA 4I5BB 3G5VB 3RNQB 4LMQI 3U4BH 3P4NA 4MJ4A 1YMMD 3CLEL 2Q0ZX 3GSRA 2A74C 1CDGA 1RZGA 3SKMA 4UNIA 4ABVA 3DX7A 1PG7L 3GRWL 3PIQB 2ED8A 4P23B 5IMLB 3JV6B 3VD1A 4CBZA 3MV8E 4PRIE 2EVGA 2Y7MA 3NJIA 2YN3A 1CGTA 3HZKA 3QJRB 2AEPL 2X4PA 2KL6A 2RALA 4U1JB 5M7QA 3W81A 4ONFH 1HINH 3T2PA 4K9JA 2HKAA 3PHOB 3VU1A 1FZMA 1HQ4B 1J12A 4N2KA 4RMWA 4B27A 3RL1B 3H8NA 5IOPB 3QJHB 1INQB 1ZHKB 3ARQA 2AJUH 3P9MA 3S35X 2G5RA 3GS7A 3BEVB 1EEQA 5JW4N 2E9GA 2RTTA 3PQYE 2H0PA 3ME0A 2PW2B 4DUWA 1M56B 2HP4A 3UBXG 1U8LA 3K8KA 2Y7OA 4X5WA 4ENED 3D85D 2VDPL 1G9MH 2VM9A 5JNYB 3BT2H 1E5CA 2OCCB 4I4WA 1TO4A 1U0QA 1E0OB 3W0WE 3NCCB 3Q6FA 3IETB 3SGJC 3V0HA 5IP4A 4AL8H 5KOVC 5L2KE 1KYUA 1QW9A 2HTLC 3P11H 3WTSA 4F1SA 3S88H 1RPUA 2BHFA 3BVNA 5D1XB 1AO7B 1KTDA 1CFSB 1OT1A 1L9MA 3HR5A 3ZDZB 3U4KA 1JPSL 3FQ4A 3LNDA 4PREB 2XTJE 2OJ1A 3K0YA 4P46C 4WDIB 5JORB 2XN1A 2ZPKL 4YSQA 4GMTH 2JKNA 8FABA 5JLZA 1TZ8A 4E42B 3UTTE 3SQBA 3T0WA 4YE0A 4IOIB 4P9HL 3P4MB 3CFJA 2XWTA 3HLKA 4LKCB 4XMLL 3MO1A 2X89A 3LMJH 1U93A 5FK9A 4E41D 2VXQH 3F5WA 4U6YB 3MGTB 3UGXA 3RI5F 1OOWA 2B0SH 1WA2X 5JQIB 1J1PH 3FRPA 4H0IA 2BOBB 3U9UB 1HSBB 3U7AA 1ZPLA 1INEL 3V2AR 2F5BH 5ICYA 1P1ZA 3BSZA 4IKLA 4P9MH 4R0LA 1JNJA 3NJVA 3CBRA 1ZLUK 3UCRA 4HUWB 1Q1PA 2OLDA 4IM8A 2EDNA 2AJVH 3L48A 4YDZA 3TBVA 3VFGL 5IM7A 3TBYA 3RVUC 5ICZA 2FYVA 2AQ3A 4JFHD 1SXBA 1BZ7A 1PVHA 2E59A 5C0AB 5FYJD 3ZMNA 4E9TA 3VGAC 4Q9QH 2NTFA 2QADB 3L3OB 4JY6B 1QR4A 3ARVA 2VDQH 3ZE0E 3BQUA 4XBPA 1HN1A 4JFXB 4XPHH 1H9DA 1IC5H 4K7PX 1HTYA 5E6ZA 4Z7QB 2YOCA 5DC9B 4KC3B 5TDOB 4GSUA 1SJEA 1XF5B 2Y7SA 1CIDA 2Y23A 4NZ8A 4AH2B 1FZOA 4MA8H 4NQDA 3MRFB 1GMEA 1KV3A 1CYGA 5E51A 4G9DA 1CLOL 3ZT7A 1G4RA 3TEZA 3M1OA 4JO1H 3IKKA 3BZ4A 4MCYB 1K8DA 3NCEB 4B9KC 1UKTA 3O9WA 4XE0A 5C0FA 4PGDA 1WIOA 3MOAH 4FAAB 1A6VL 4PJEF 1XWVA 1ZEAH 1IGFH 4EUPG 3WFEL 1BZ9A 4WY7L 4J6IA 3T1WA 1B9KA 3UJJH 1L7TH 1IRAY 1NLDH 1VJSA 4GS7C 1M9SA 5F3HB 2FYYB 2OJEA 1DVZA 3TH3T 5L9DL 4XMWA 4PJ8C 1K3IA 3BAEL 1M7DA 5F9DC 1I8MA 5KVDH 1C16A 1SMAA 4G5ZL 1YY8A 3SBWA 1W8EA 1JUFA 4H1LB 2VXSH 4B9GA 4CW1B 2VLRD 5E6YA 3FFCB 4HZAA 5I18H 1G7PA 2V9TA 3QFGA 3VRIB 5IESH 2AFNA 3EUUA 2FUTA 5AW3B 1KENH 3J7HA 1F90L 3TBBA 5D1ZD 4HK0B 3ZLQC 5EUKB 2XV0A 4WW1B 1GOFA 5E4EB 2PYED 2UY7B 2YPLB 4JFUA 3ULAB 2L4OA 4NKQB 4MD4A 1F86A 2VLJE 4PJBB 1EAJA 2VISB 3WHE1 1RPKA 4Q97A 2ADGB 2N1KA 4NOBA 5DK0A 4K5MA 4KH2A 3ELAT 1JZIA 3FT9A 2IWKA 1TMQA 3V4VB 4U0RB 3VI4F 4OD2B 5D7JA 4XCCL 3OSVA 5GGVY 1YQ2A 2H4EA 2DMGA 1E8YA 2G3ZA 2C9XA 3N06B 4KZDL 3B2PA 3CHOA 3TBTB 4HK3N 3M46A 2QMJA 3NK3A 1ZD6A 3VVVA 3QRBA 4MXWL 4LRNL 3NUKA 3IDJB 4EMZA 1A7NL 4B60A 3HG4A 5DA4A 1TEGA 3L95B 2CO2A 3N04A 1YMME 1GY1A 2CG9X 1JZ2A 3GLAA 5IHUL 3VWJC 1A02N 4HFUL 4AJVA 4XPBH 1ZAGA 3L7EB 4PV9A 1ZANH 3HNVL 4PJHA 5KJ7E 4LLVA 2R2HB 1UFUA 5FXCH 4NJAH 4KH9A 4BRJA 1L4IA 1A7OH 1P7KA 1L9PA 3LSOB 4BKTC 1A4CA 3BVVA 3VJ6B 3D07A 5DS1A 2AI0L 3S2AA 1A6ZA 1R6VA 2HJFB 4V2CB 2WQAA 5JHDD 4PN6A 2BHUA 5DK2A 4HWZA 4DF9A 4LOUD 2E8YA 2Q20A 1A7PH 4G8GD 4QDGA 4RVBA 4NFCA 3GBDA 4P0DA 3OB0H 5CBAB 5HDBB 4UTAL 4OLXH 3P1VA 3R4DA 5GPRA 1DVFB 2A6DA 2C3HA 3E0GA 4NC1C 3X11A 3ASWA 2X4UA 2PCFA 1I9IL 5ESVB 4KDWA 1D5ZA 1GGIH 1RZJH 3CE1A 3BVTA 3ZZQA 1AHKA 1DN0A 4JVUA 4OF5A 1FV1B 3K6IA 3P30H 1BVOA 1ZLDA 2O5ZH 4JM2F 2AQPA 4AQ8C 2PN5A 3LXAA 3MXVH 3CDYA 3WKPA 3G5YA 1KJMB 3IXTA 1PG7W 5GRJH 5DHDA 2FK9A 4B53A 4PP2B 2D9QB 4LEXH 4KPHH 4U1NA 4PU2A 4ODUA 4Z7UE 4ZNEA 2ZXQA 1QRNA 4XPGH 3LEVL 4TYUA 1EJOH 1QPPA 4JY4B 43C9A 2C9AA 4ODHH 4P5MB 5FX3A 2R69A 2BS9A 4Y4FC 5HHOB 4K7PY 4FN0A 4JVPA 3GD1C 4M61B 1CFQB 1YEGH 1KGIA 3OXSB 3MKKA 3SJVD 3ECBB 1ORSB 4L1SA 4Y19A 4E41E 4R3SA 5IT2H 3C8KB 2PXYD 4U1MA 2DQCH 1TU2A 4W81A 4X5RA 5FUCE 4AYBA 4DTGH 5KEZA 4NEHB 3G6JB 2EYTA 2H1XA 3M88A 2GFBA 3GLDA 4DZBB 3EH4B 1AGDB 5JHLH 2K78A 1T7VA 1QFUH 1A4KA 5DWUL 1D9KC 4NN5C 1Q1JL 2PNDA 1MFDL 3MRRB 2VZVA 3OLEA 2MKLC 3FO1B 2VJ8A 1MCJA 1CWVA 3M7OA 4FJ6A 4LAQL 3RPIA 1IKNA 3PWLB 3WAJA 4BQ9A 3INOA 1UH3A 3U25A 2DN7A 4HMDA 4JFHE 5C9JA 3C12A 5FYJE 2HWZH 1CE1H 3PV6A 3TNMB 4CC4A 1DUZA 5KS9B 4I0PD 5L4IA 4L9LA 3WS6A 3QQ9C 1I7TB 3MRDB 2WYHA 3B3IA 2EH7H 1XV8A 4JFFD 1CI5A 3BWUC 4LAJH 5LG1A 1ZHBA 2F7PA 2XZQL 3AB0C 3ESNA 2A6KA 3JT2A 3OG4B 5MP6L 1LEGB 1DE4B 3WCYA 1BVZA 1EXGA 1U36A 4NQVA 4XCEB 3VX0A 2APFA 2VUOA 3ARFB 3HHSA 2VH5L 3UBGA 2VN7A 1JWSB 1U3HB 2F2HA 4HMCA 5HHXH 2VDRH 1NINA 2OL3H 3QH3B 5AB9A 1Y1UA 2GJ6D 4R4FL 1J48A 1JERA 1RD6A 2IG2H 4KK8D 1HXMA 1B9ZA 3TJHD 2OX5A 2MCAA 5HYJB 3IMWA 1KG0A 4LIQH 3T3PB 5IMOA 4H13C 1EEZB 1TEFA 2A4CA 3MRPB 4JREB 1XMEB 1VFUA 4NRZB 2Y5QA 2VB5A 5FDYA 4CILA 2EKSB 3C2AH 3HVNA 5E6SB 1QSZA 4ELMB 2E86A 3OZ9H 3QQ3A 3ZTNL 4U2ZA 3FUMA 4LNVA 1QWNA 1L3NA 1P2CB 4MNQE 5AAMA 4QO1A 3C5JB 5GIRB 2PUQT 4KTGA 2YAFA 3QJXA 4S1DD 2K9UA 4FCHA 3GSNH 4NWUL 4X80H 2VLLA 3QJFA 1JGUL 3ZYIA 4HBQA 1WQVT 2JCCE 4KFMA 3B3BA 4PEEA 5T5FA 2UV3A 2P1YA 1XCTB 4IOSA 1GHFL 3BP7A 4H25B 4QTHA 4EVNA 1XD1A 4L0YA 4ZOCA 5AW2B 2VLRE 4HUXA 4HXBL 4QHMA 3IDNA 1HZHH 4W4OA 5DJXA 5F7EH 2MMXA 3L4WA 5DMKA 3B37A 2ITCA 4YIQB 1RAMA 3IAGC 1BZEA 5E6IC 3SHSA 2GSGA 2BSTA 4KZ0A 4C59B 4DFIA 2OR9H 1IX2A 3BSGA 3G5VA 2VDLB 4KVNH 4P57B 5B1JC 4LPUA 2P8LB 4WWPA 5HY9A 4L8CB 3S9DB 1ASQA 3DYOA 1PZBA 4JFYA 1M6UA 1DHKA 1TZHB 3PYCA 4JG1L 3BO8A 2YOAA 4K3EL 5DZNA 2F7RA 1YEIL 3MV8B 3QDJD 4PRIB 3RDTD 4FI6A 4RFOL 3TN0D 2GCYB 3QNZA 4OCXL 5AW7B 4HW6A 5KBNC 1IAIM 2GSIB 2R59A 3O3BA 4HALA 3VFTA 1G94A 4XI5D 4XCYA 4NNPH 1L0QA 3IAPA 3ZHNA 3GBML 3U6XA 5DF0A 4R84A 2ZX5A 3LS5L 1BWWA 5IOPA 2MOQA 3QULB 5EU4B 3HE6A 3TPKA 4XR8C 2IAMB 4APXB 2EDTA 3TS8A 1REIA 3PQYB 1YQVL 3BN9D 3HBPA 5E2UH 5HGBB 2CDEB 4OCWL 4U1LA 3L81A 1YPZA 1FBIL 1KULA 4QXTB 1MW3A 1KPRA 4XHQA 2WBJA 1CXLA 1IFHH 4J4PA 3G9VA 1QSEA 3W0WB 4DO4A 1TQCB 4R4ND 3UAJA 4M6AA 3BFQG 2LOEA 2ZP9A 4Y5VB 5JHDE 4JY5L 4NAJA 5L2KB 1Y6NR 4UILL 4TUUA 4TTDD 3UTZA 5D1XA 1JN6A 4G8GE 2QDWA 5KWYC 4NCC1 2X4SB 3MACL 1OTTC 2XTJB 1GJUA 1JPEA 2F74B 4PBDA 2Z1KA 4PJCA 4X9IA 3FQNB 3S5LA 4F7PA 4JRWA 5C3LD 3U36A 4HCGA 5JDSB 1CURA 1FPTH 5IV2A 2EIKB 2WKLA 1XAUA 4MJID 5EPMA 3UTTB 3FAWA 4E42A 3SDAD 1R19A 4P5TB 1WZMA 4PJ6A 5GJTL 3P4MA 1R5WB 4TSBH 1IGJA 3TOPA 1L6XA 3QO1A 1KCVL 5JIMA 1JXFA 4OCYL 3UYPA 2XYBA 4PB9L 4P4KD 3IPBA 1MAMH 1OWRM 2CM6A 4WHCA 2KH2B 1KLUB 3JV4A 1P1VA 3G04B 5DRNB 4NN7B 2WQVA 3JQOB 5GRXG 3WHXB 4NKOA 4GOSA 1KB5A 1UYWH 4N2EA 4LCIL 1AQKL 1A2YB 3P2DA 5JMOC 1WCQA 3D0VA 3CMOL 4Y2DD 4HZLB 5EOQL 4WEBH 3Q8BA 2XQ0A 1AY1H 3ZKMD 3DXAD 4WTWA 2X0VA 5C0AA 3SJVE 3ATDA 1WTLA 4L29A 1S3KH 1J9RA 3ZE0B 4JY6A 4ZO8A 1KXQE 1UHVA 1EZUA 3P02A 5E5RB 1T80A 2KI6A 1E5ZA 4IRJC 1LWHA 5TE4H 2HT4C 5FEBA 4GBXB 3O0RL 4B41A 4AYFB 3BDYH 4HJGB 5E2JA 2HLFC 4FG2A 4FI8A 4IHBA 3GMOB 4QTIL 3L1GA 2TRHA 1OTSC 4FQIH 4LLMB 2GY5A 1DBMH 1N64H 3L3HB 1XH3A 5A2JH 4WU5B 1EVTC 2M8XA 4ZW7A 5TDNB 4JPWL 2WB1A 3MLRL 2BPBA 2XU9A 3IYLW 3SPIA 1OAKH 5ENWB 4V1DD 1S7RB 4IBZA 4LO9A 2YD7A 2EEFA 2XCMC 4KRMB 4O02H 4B9FA 4YNYB 5INDA 1G7HB 2NSXA 4JFFE 3BW9A 3W82A 1P53A 3MUGB 3B9KB 2JCWA 2UYLA 4G6FB 2ZOLB 1DP0A 4BFNA 3X3FL 3HC0A 1GKOA 4RSVA 1I4FA 3RWJB 5KSBE 1XGQB 3I6SA 3W39A 4I18C 1NGXB 5E9DD 3RDJA 3OKOB 4FXGB 4J23A 4WTXA 4X8XA 2GJ6E 4RISL 4XO4A 4CVXB 4LCWB 4NO0D 4OT1H 4AGLA 1D7FA 1KCRL 5JA9A 1FC1A 1O6VA 1PDKB 3C6LD 3REVA 3T3MF 3D9AL 4YUEH 4N0FB 1ZT1A 3E3QC 2IGLA 3FFCA 3ZO0A 2CO3A 5B3SB 3FRUA 4YR6B 3HFFA 2XTLA 1UB5B 3HMWH 2V2WB 2IADA 2P9RA 5E2WL 2WZPA 1MH5A 3EGXB 4TN9A 4ZXBC 3WG7B 4ODTH 1WC7B 1J5CA 4JO4H 2CU9A 5C0GB 1HHJA 2YN5A 1F02I 2EIDA 2UY7A 5JO5B 2VLJB 2BNRD 5AW0B 4PJBA 3I9AA 2IALB 2VDLL 2XWBB 3RU8L 5CEXB 2AHIA 2XUWA 4U1IA 3GO1L 3W5NA 5HVHC 4FNLL 1MHHB 2O5YL 3AREB 5FHAL 3V5DB 4LU5L 3V4VA 1XSJA 3I84A 2F18A 5JW3H 2CHXA 5BNXD 1AFVH 1NMAL 5J9PA 1SHXA 3QZWB 5J8OA 1L5GA 2RAMA 2HXAA 5AB1A 3P3UA 3TBTA 1F3JA 1IQDA 1HE7A 1HL4A 4OSUL 1F1DA 2XI9A 4I8DA 2JV6A 4LK4A 4MB4A 5GISL 4F5CA 3OX8A 1NGZB 2CMRH 2WNWA 2E56A 4LP8A 2OMZB 3UBHA 1YMMB 1BPLB 4WV1B 4YHYC 5IBUB 4YOKA 5F7DA 3T6ZA 4LQFL 2MNWA 5AVWB 4N2HA 2P24B 2K45A 3QEUB 2JTYA 4LE8A 1R3KA 2Q6WA 1PAMA 1DJXA 3EKCA 3K2UL 5ANHA 3TFKD 3KYAA 3UTPD 1RSYA 1WK0A 4UOZA 3S8GB 3QDJE 3WYRA 5GGUB 3IN0A 1YC8A 1M2VB 3INUL 4FXKC 3CQQA 1SXAA 1JNLL 2JLLA 2FWUA 3AGWA 3K4AA 4ZUVB 2DAVA 2K6WA 5EZPA 1MWAB 2WUCL 2Q2EB 3UIYA 4GKNA 4MQ7B 4PRBA 1ORQA 2JK5B 4TLSA 4WUKH 5TDPB 3STZB 1G84A 32C2B 4PRPD 2UX6A 5DVNA 4X4ME 5IVXF 3L6FA 4G80B 2ATKB 3B4NA 4HV8A 2HTLD 1IGIH 1QRKA 2GQHA 5EHFA 4PG9B 3DGGA 15C8L 3H3PL 3WJJA 1XTMA 3D85B 1NWPA 4GAYB 3PWJA 4FZ8H 3HHMA 4DKTA 1D6VL 2XWXA 3V10A 1RJYA 5D6CA 1VSCA 3RIAF 2BNQA 3BLBA 1Q9OB 2ICWA 3QUZC 1N6UA 1FV1A 2AITA 1LEIB 3JUYA 3QIBC 3MNWA 5PCYA 2OZ4H 5EH1A 5KJRH 1BLNA 4I1NB 4YEEA 4QHLB 1KJMA 1B6UA 4XMZA 4AYSA 1QBLL 4XNZB 4Z7UB 5ID1B 1I9RL 3GJFB 4NIKB 1PU0A 5E0QA 2AVFA 4A2MA 1CDIA 4N28A 5CLYA 3HZVA 4U0QB 3PXLA 4MJIE 4Y1SA 3ARDA 2CNYA 4DSYA 1HWHB 2KDGA 2JVUA 4KX9A 1XAKA 5GGVL 3QJOA 4M61A 2H7WA 1GIGH 4E41B 1KACB 1TZAA 4E0RA 2O6PA 3A47A 3T8VA 1MPAL 4UQ3B 3D2UA 3P73B 5F6HJ 3ALWA 4G7SB 5E1AB 5GGSY 1YNTB 1A4JA 1LO0L 4RBPK 1UOKA 5IIEB 1E4WL 4OB5L 3MV7D 2Y25A 4QRUB 3MU3A 4AEHL 3QI9A 1E9PA 1R46A 2YBRB 3F6IA 5BZWB 1HNFA 3FO1A 4NUJA 1CICC 3QNYB 3PWLA 1BOGB 3QGVA 4BDVA 1OCZB 4H5SA 1C7SA 3RVVD 3DXAE 1CG9B 2WLNA 5J89A 1V3JA 5FDWB 4AYMC 2V9RA 4I88A 2VMDA 3IEAA 2JI3A 3FU0A 3FTYA 3ILEA 2EE6A 3QEHB 1LE5A 3PJNA 3EYUL 3MRDA 4R4BB 5FYLH 2QBWA 3RX7A 3RVTC 5EU5B 1K4CB 2H45A 3DIFB 2VMFA 5HJGA 3RNKB 4CSZA 1H6FA 3VB9A 4XCEA 2YEVB 1EZLA 4AWJC 4EN3D 2F1BA 1PZ2A 1QABA 3CVIH 3SN6N 3BX7C 1GTNA 3KYOA 3N43B 4XGZA 4V1DE 4PMFA 1QNZH 2A5UA 3DWTA 1HHGB 4PJ8D 5IB2A 3KDMA 4GIAA 4NRZA 3D3VA 2EH8H 3L4TA 3N0AA 3IRCA 2EKSA 3JWDL 3O41A 4X99B 1F58L 4XVSH 4OQTH 1IKFL 5C0CA 1S7QA 1P2CA 3GT6A 3ECUA 4WI6A 5BZZA 2MWCA 4PTTA 4KRPC 5C1MB 1KELL 1XR8A 1L6ZA 3B56A 3OHXB 5K9JH 5E9DE 2JCCB 4ZAKA 4RZCA 1NCGA 3I2CL 3U0WL 4NT6A 3FSAA 1HOEA 4XN7A 1AQHA 1BYPA 4KTEL 4K7PL 1WCBA 2VLRB 1YZZA 3FB7B 3MRNB 3SE4A 3HB3C 3QIUC 4Z8FH 3CXDL 5D55A 2GIYA 4MVBC 4PJ7E 2O6EA 3K6SA 5JYMA 4R7LA 5B38G 2BSEA 3MRQB 3HUJF 1BVKA 5BJTB 5D4JA 3OKDA 2YZ8A 5D1ZB 1RHHA 4GINA 4WJKB 3VA2C 5I0DA 3IDXL 2WLMA 2X1PA 2PYEB 4XAWL 1GZPB 2E7DA 4CN4A 5TE6H 2BNRE 1M7UA 4P57A 1S6NA 3BKJH 3K2MC 4JEGB 2QQQA 3MZGB 4PJ5D 2R1XB 2ZTBA 1UJTA 3QEQA 4FLHA 4L8CA 2D4DA 2XFXB 2IV8A 4HGMA 4JO3H 1T6BX 5E8NA 1HS6A 4A38A 2HMIC 1NEZB 3DX9B 2JJTA 2MSPA 1O9VA 1KEML 1KCLA 1YCSA 1N67A 1PCXA 3LKSB 4GRWH 1Q94B 4XMVA 5AVRB 4PRIA 1XL4A 3KD4A 1EPFA 4RFNB 3VWJD 4TL5A 4RFEB 1HCFX 3LRSB 3SE8H 2AJZA 3NCMA 3VSQA 8PAZA 1DYZA 5BS0E 1ROCA 3TXAA 5C2BH 4KKCD 1G0XA 2VDOH 5TH2B 4S2SB 1MWAL 4XP5L 3VWKA 2ODIA 1M71B 2W5PA 3MV9A 5HI4C 3QULA 4EDXB 1ZSDB 4N3UA 1Z3GL 1G7QB 2DLTA 2IAMA 1WWBX 2W60A 3GMPB 4IRZA 1AXSA 3BLPX 3EOAB 4GP8B 1ZV2A 4ZFZB 4LEOB 4H26A 5D1QC 3HPLA 3UTPE 1HWWA 4G5AA 4JZJC 4UDUA 5D96C 5K9QI 3ILQC 3IFPB 4WK0B 1AQMA 4ZFFA 1IL1A 3W0WA 5I0XA 3RY5A 5DJ6A 3VQ1C 1VGEH 1IM3D 1QOKA 4KDTC 1G1KA 4KV5E 5E95B 1BQHB 5FYKU 5JHDB 1QYGL 5JPNA 1XX9C 2F8VA 1LGVA 3CCHA 4G8GB 4QY8B 4CMMB 2BSSB 5ITBL 4ZX3A 3CK0L 2M83A 4EO5A 4PRPE 3X13A 1KCSL 2F74A 2J3SA 4O2FA 2Q87A 2Q3ZA 1JRHI 3ZZ1A 1A3LH 3SO3C 3GMRA 4KJWC 1KFAL 2ZX6A 1UQSB 1IC7H 3FQXB 2RCSH 1QBBA 3KPLA 4JHWL 4QAMB 2P5WD 1S5HB 1U8QB 1KLFB 3N0PB 2D3VA 3KYNA 4W9KC 4LSUH 5CCJA 2J8UA 1BYNA 1R3LB 5AOIA 5C0IA 3IGUA 2O1AA 3QDGD 4G9FA 3FO2A 3QZBA 2O6FA 1PD0A 2IIJA 1KT2B 4UTCA 3B83A 3EUDA 2OXHB 4HQQL 1ACXA 1IBZA 3ULUC 4K9EC 4RMUA 1NOFA 2EDKA 1SY6H 2JJUA 4NQCD 4OCSL 5EZJA 1ZGLA 4RX4A 4ZFOB 3V0VB 2YWYA 2Z7WA 2CE6A 1KYOJ 4LIQE 5F7LB 4XMPH 3G04A 1G1CA 1JK9B 4GI8A 3HEIB 1SN0A 5EWIL 4PR5A 1EWHA 3O6MH 4JRLA 2WVVA 1OAXL 1WIPA 1CT8A 1JHTB 4PJXE 3BIAX 3CZFB 1D9KD 3MX0B 4FQXA 4KJPC 4MYPA 2FL5A 3SJVB 3VSUA 5KTEL 3CFBA 5FYJL 4Z3FA 1M6OA 4XRCA 1AC6A 1EK3A 2NY5C 2PXYB 2AXHA 3PL6C 4X98B 4YN3A 1XGYL 3VFOB 4ES8A 5JIIA 1LP9E 3VYNA 2R0KH 4HG4K 1Z9SB 3PGDB 5ELIA 4CGTA 1BF2A 1O75A 2D2OA 2FEEI 2J5LC 4G71B 4MX7B 4JPSA 1KCBA 3MV7E 4W70A 3QUML 1ZLVH 4HJGA 2GBUA 5GGTL 3ROLB 3TBWB 4FP8H 3QQ9D 1GS6X 4JRXA 3M1BA 3QHZH 2I5YH 2CPCA 4DGYH 3VH8B 4OGAD 5I30H 1RVFH 4JO5A 4LSQL 3CWGA 4JQXC 3CC1A 3AQYA 4N90D 3E1F1 3NZSA 5TDNA 2WINA 4HOWA 3O2VL 3EYSL 1XGRA 3O8XA 1A6WL 5SWSA 4I0PB 5ENWA 4ATWA 2QSCL 2QKIA 3SPGA 5GHWH 4PBVC 4KBPA 4JFFB 5DJYA 3TT3H 3IRPX 2APXA 1BJ1H 1SXZA 3NJNA 2H0EA 3NIGE 3MJ9H 4GP5B 4E9QA 1R3HA 1JPFB 3T4AC 1UA7A 4X4YA 5KSBB 1FGNL 3T8MA 4LVOB 4HETA 1BEXA 3BKYL 4IU3A 4P2CG 3OKOA 5DMJB 1ZWIA 2GJ6B 1PL3A 5I82A 1JVKA 4G6JH 1BLIA 2AQ1A 1UATA 1Q0XL 1CK0L 1J5OH 1PIFA 1BF5A 1T6VN 2VZOA 5ISZA 5HHVH 3L3GA 4N0FA 4ISVA 5FO9A 4NM4L 1KSRA 3Q01A 1NMCB 2YMOA 5J1AB 5I8EA 2OKMA 3CFNA 4UTBA 3K74B 2ZG3A 3AFLA 5CS7A 3SE9L 5FO7B 1RZ8B 2XRAH 2PCXA 2G3MA 1YG9A 1PLGH 4KK6C 2WXRA 3V4PL 4WI4A 1EAPA 3QAZB 4OKVB 1KIUA 2IFGA 3QG7L 3UJIH 4HVBA 4YXHL 5CEXA 2WVTA 1TETH 2DLGA 3KPOB 4ZMYA 1MCRA 1FORL 1WZKA 2R7EB 3AG3B 2XY2A 4RGMB 1PLAA 4M8QA 5E8EB 4HCRL 5AVXB 3SPVA 2DQJH 3HAEH 3L4CA 1H5BC 3K0WA 1U3NA 2G30A 1CZ8L 3I50H 3I9GL 1P4IL 5AKSA 2NYYC 3TONA 3ABLB 3NJFA 1AHMA 3BD4A 2BERA 3KBPA 2H0JA 2V7HB 1XHHA 3JV0A 4TTGA 1OAZH 4M5YL 2IAAC 4GI6A 4OM0L 4PJ5E 4DESA 3ARWA 4WV1A 1P5VB 1K5WA 1YVLA 3J07A 1FH5H 1ZVSA 4IGBD 5DHVA 1U6AL 3EAKA 1KF9B 4I77L 2AXFA 5B22A 2VR9A 5C70A 1OB1B 3QEUA 5BUPA 4NUGH 4CMHB 4YE4L 1QW8A 5D2NC 4YVUA 3QDJB 4PP1C 3PWPD 3RDTB 3PWUB 4BZ2H 3NIDE 1KJ2A 1TPXB 7CGTA 4J3OF 5F6IB 3WSQH 2TSBA 3GUTA 5FLVA 4FMVA 4CL7A 3ULSB 1MLCB 4KX7A 4GW4A 2J20A 5DD1H 3TCTA 4DP9X 1BGXL 2E47A 1RZ7H 3OMNB 1ODUA 4B97A 3STZA 3ZTCC 4LSRH 5HVFB 2NZ9D 3MR9B 3GSQB 1QUNA 2ZAHA 4W9IC 3FUEA 2YPVL 2VDQB 3CPLA 4ZYKA 1I1AA 2VR4A 4W93A 5FYLD 2LU5A 1U2HA 4V33A 5B4MD 3RWGB 4ZTEA 4GAYA 1MRCL 3K91A 4PJBF 4ODVH 1I75A 5AZ2L 2DI8A 4ALAL 2W65B 3BIKA 3Q13A 1FDLL 4G1EA 5DGRA 4NC1E 5F7HA 4FQCL 2XWJB 4DCQA 1IFGA 3L5WB 3VE0B 1HEJC 2R0LH 3EIFA 1L9TA 2VRQA 1A3RL 2QHRL 4DK3A 4NNYB 1MFNA 4PW4A 1NBVH 5A6MA 1HI6B 3S5LG 3O11B 5BVPL 1N5AB 3NPZB 4OJCA 5EOCL 3WFHA 4ZFOL 4LLDA 4PWEA 4UDTA 3WFCH 3ZE1E 5B8CC 2K0RA 3W9DB 3BKCL 2B8OT 4MJIB 3VG0H 3O6LH 4L1LA 2P5WE 3SDAB 4XCFH 4OAWB 1TJHL 3CHXA 4F20A 4XO5A 3TASA 5G2NA 2OTWB 3LEYL 4PWGA 3QUXC 1LWRA 3QDGE 3PJSB 5B3NA 4YFDB 1ZDQA 5ESQB 2YRLA 4NP4H 1JYWA 1CE6B 3L13A 2ARJB 5FGRA 1VADA 4X7TB 3TO4D 2CBMA 5E1AA 5I1GH 1QPKA 4ZFGH 4P4KB 1MRFH 4NQCE 5K59F 1TZOA 5C71A 5J0BA 4JPVH 1Q9KB 4UAHA 3D25A 4FQQA 2WNKA 1U8NB 1A7RH 1IEBB 4YXKL 1KJVA 4Y2DB 2YFOA 4PWHA 5B39A 1QI4A 3KYKL 2NY0D 1DVTA 2ZF9A 4AOFA 3DXAB 3OGCA 1CG9A 1QQDA 3KLDA 3IBOA 1JF6A 1JK8A 2XPGB 4ILDA 5HDBF 1TYEB 2OXGA 4UYPA 3NPSC 3VFVB 1P5UB 2BOCB 2NSMA 4X8GA 1PY0A 1ZA3A 2WBKA 4XC3H 3ROOA 4ADGA 3U4BL 1ROWA 1WBZA 3IPEA 5ITFB 1BIHA 1X5FA 2CBTA 4C83A 1K4CA 2YKKA 3RNKA 3CXFA 1BYOA 3CNKA 5H37A 3U82B 1Z5HA 4AMKH 5DO2C 2V0AA 3PDDA 2B9BA 5G5DA 5D2LA 1X4ZA 1ZPUA 1HEZA 3EADA 4E9YA 4MMZC 3S3JA 5KVEH 2CLZB 2FE0A 3PE9A 4N90E 1J5IA 4OF6A 4V1DB 4X6EB 3ECWA 4ONFL 1HINL 1VF5C 4MZRA 2RJMA 5C09A 2NY6C 3P0GB 1MHCB 2B5IB 3KPSD 2VR3A 3VFSB 5ADOL 4G6KH 1FH2A 1AH1A 4HSCX 4NQXA 2AJUL 4UMGA 4JR9H 1GOHA 1NDGB 4MNQA 3G9AB 1IBGH 1GS7A 2YQBA 2ICEC 2C4XA 3MRJB 2UWEE 5IJKC 3UG3A 5DSCA 5E9DB 3FO9A 4K8RH 2BIPA 2ZXBA 1RIVH 1I31A 1SYVA 1FSKB 4NO0B 1QHQA 1T2JA 4W9ZA 3TYFA 1G9ML 1AIFA 1NGWB 3BT2L 2QTVA 3K6DA 3UDWC 3C6LB 3VXRA 1Y07A 3GWJA 2NY5H 2ZF8A 4GXUM 2CR0A 1HCVA 2PCPA 4WFED 4AL8L 3C6EA 4FJYA 3P11L 4DUXA 2CNZA 4PJ7B 2X09A 4JKWA 3S88L 5EN3A 1WZLA 3TA4D 3WGUB 1MRDH 4LFHG 3VFRA 5BJTA 1VACA 3A24A 4NJ9H 5D93B 2IPUK 2R0WH 2EECA 4RRPG 4MNGB 2B20A 3C8HA 5KS9F 3HNTH 4GMTL 5C0JA 5IB5A 1GZPA 1KXTB 2V7NB 2BNRB 3PAYA 1QI5A 3F12B 3CSYA 3P9WB 3VXMA 5ILTH 4ABWA 4XVJH 2R1XA 5BRZA 2P49B 2XXMB 3BP5B 1A9BB 2XFXA 4P5KB 3LMJL 3LS4H 1NEZA 1QG3A 2FHBA 1CXIA 2DWXA 2IH3A 2VXQL 5IF0B 3FB6B 5D7KE 2B0SL 3LKSA 1T83C 2AK4D 4F8NA 4PRNB 4XH2B 1J1PL 3LN9A 2A74B 3QORC 3P9LB 3LVEA 4S0HA 5DR5H 1MZZA 2MFNA 3V0WH 5FHBL 4PBXA 1HH9A 4IRSC 2F5BL 4P9ML 3T3PF 4C56A 4Y9GA 3T0DA 1B0GA 3FC8A 4YL9A 5H94B 2AJVL 2X44D 3LQAC 2OQJA 3EZ8A 3MGOA 4L8BB 4ELMF 1ZSDA 1G7LB 2BVQB 5EO9B 2XJLA 1G7QA 2ZSVA 3CDZA 1QKZH 3EOAA 3IFNH 4Q9QL 3AXHA 3TZVA 1KIRA 3U1SH 2CA3A 2VSKB 1E3ZA 2AJ3A 2OMBA 2VDQL 1DFXA 3BKMH 3FL7A 2RGSA 2BFVH 4OD1H 1I8IA 3PWPE 4XPHL 4P2OC 1IC5L 3OKLB 3VCLB 1TJIH 4F8QA 2VLKD 1U8OB 3PAUA 4MBRA 3QPXH 3OC5A 4PJXF 4MA8L 3QIWC 1FRGH 2X12A 3FB5A 4DVRH 3T2NH 1ED3B 3Q8CA 5LN4A 1BREA 2BSSA 3AWEA 1U4EA 4JO1L 5FA3A 4YAQA 4PRPB 1J9QA 3HRZC 4ANWA 4TNEA 5HJ3A 3MOAL 4G6AD 4HLZH 4TXVB 1A6AA 3JTSA 4OH2A 5IHBA 1ZEAL 1HHIB 4IHOB 5FYLE 4E9SA 4L4TD 1JPST 3ASOB 1IGFL 5JXAH 2CKBH 3LPFA 4YPGA 5KUMA 1LD9B 4QAWA 3UJJL 1DN2A 5E1QA 1EHLH 5MHSE 4XO8A 2N0MA 1L7TL 1NLDL 2EUZA 3MBEA 3MLXH 3FCTB 1WEJH 2WOBA 5D4HA 2F7QA 4P06A 1M3IA 1OO2A 2VDRB 2OL3B 2OXHA 2DQHH 1HWGB 3H7BB 1KTRL 3ZHLA 4ZUSA 2WLIB 5KVDL 4V11A 2PWHA 3MTXA 3CFIC 4XPAH 4M9PA 4MRBA 4N26A 1BMZA 2VXSL 3P40A 1FVDB 5TFSH 4CADA 1O9WA 5CSZB 5I18L 5I1IH 1NTDA 4PJXB 2XTSA 3BPLC 5CILL 1D7BA 2VR8A 4GG8B 5IESL 3TV3H 1AD9B 4Y4KC 3L9BA 2I7OA 2FH6A 2ZUSA 3CZFA 4OJYA 1IGMH 2P47B 3L3KB 1ZE3C 1D5MA 2WSKA 1UZ8B 1KENL 1YAZA 3R8QA 5I0VA 4UU9A 3II1A 2IBZX 1A1MB 3GSNB 3KWUA 4F93B 4MMYB 1LP9B 2IPTH 3OR6B 5CJQH 3TTSA 5IVOA 1JGIA 4JL2A 1JPTH 2CHNA 2PWFA 3MV7B 4BHUA 2Q8AH 3JWOH 1S7WB 4ERSH 4TUJB 4C4KO 4K7FB 1BD2A 4HUVB 2F53A 2IGFH 4LHUD 5EIIB 3F7RA 3VH8A 1NUFA 3RVTD 3T5WA 2CLVA 3WNMA 5DTFA 4LGRB 1K8IA 2SEBB 2KQMA 3MPCA 3BD5A 2BP8A 3RZCC 4OU3A 1T1YA 2EIMB 1X5IA 3U7WH 2CBQA 4AGOA 3H6JA 3CH1A 4JM4H 5TPWH 5DEFA 1UGNA 4QWWD 3NIGB 3SE3A 2XVLA 4HIJA 3ZR6A 2WGXA 4NHCH 1N2RA 4IBWA 1XVSA 5L0QB 4XPBL 3OXRA 1JPFA 1ZANL 2EILB 4XNYH 4D8PB 1XH2A 4HC1H 4YS4A 4ZNCD 4F7EA 4NJAL 5E23A 4EN3B 1A7OL 2KHAA 2GJ6A 4DWHA 3UZQB 4GS7B 1OP3K 3WTYA 2DF3A 4NDMA 3P77B 4PJ8B 3AABA 5I8CB 3HN5A 1B6DA 4D2NA 3KPSE 4RETB 4YDKH 2ATAA 1JPGB 1X3DA 3V6ZB 1CUOA 1A7PL 3L5HA 1EGJA 5DJCA 4BZYA 5H35B 4HX1B 5IROA 1BAGA 3GMQB 1I8UA 3NJMA 4OLXL 3FT2B 3HB3D 3V7MA 1E9OA 4QRRA 3GXTA 3ZE0F 4DNLA 2WB7A 4MVBD 3QG6B 3ARBA 5GXBB 4Z7NE 2WQ8A 4R96A 5FGBA 5I17B 4I0CC 1EZVX 1GGIL 1RZJL 1W8OA 2IPKB 2VUYA 3QFJD 5AWNH 1A25A 2E46A 4R0LC 3KPOA 3GSVA 4DERA 4FX5A 3FU3A 3IF1B 3P30L 4OZ4B 5BQ7A 4WFEE 2OK0H 5K93A 2O5ZL 5AFAA 3F04A 3GHBH 1MDTA 3MXVL 3HBZA 4HISA 3A4FA 3GBNH 1ZOXA 4EN2A 5GRJL 4KPHL 1WLHA 4ONGH 2J2ZA 1FG2B 2FNWA 3BQUC 3ARRA 3LZPA 4UF7C 4BXVA 4APQC 4XPGL 1RUAH 1ZGLP 1EJOL 4JFDD 5I19H 5JA8B 1XGUB 3H3KA 4JZOB 4ODHL 4PJ5B 3EBHA 1M1XA 1VLXA 4L2LA 6PCYA 3WIAA 1P5VA 3O4LA 5JOFB 2HH0H 2VR7A 4MDJB 5KSAD 5KZCD 1YEGL 3OKNA 2IV9A 2VZ1A 2F1EA 3QDMD 5F7NC 5HGDA 1KBPA 4IQHA 5IT2L 2VDMH 1NQBA 2DQCL 4RMRA 3DVNB 4DTGL 2AK4E 2CRZA 2V9QA 3RDTA 4XNQB 3FUFA 5HI4D 3VWJB 4BQCA 3F7YB 5FFOA 1MLBA 5A16B 1QFUL 5JHLL 3MYJA 4ADIA 3ULSA 5D1QD 1QEXA 5AW9B 3QPKA 4A2HA 2X6MA 1DEEB 2GY7B 2EYRB 4EI5C 3MOQA 1R3JB 3ZKXC 2H2PD 3BOVA 3FNKA 3GTTA 4KWUA 4YLQT 2BC4A 4X4MA 2HWZL 1CE1L 3MR9A 3HI1A 3QISA 1ETZB 2FDBP 1G9HA 3EYOB 2ZOOA 2GKIA 2EH7L 2PP8A 1Q0YH 2F6AA 1NOLA 2NDGA 4FNQA 3RWGA 2XDHA 1KV7A 5C92A 3H9SA 5FCUH 4QLWA 4LB8A 1IM3B 4AVJA 4NXSA 1SDAB 4KJWD 1PZ5A 4KOBA 4JAMB 5HGAA 5DYOB 1FAIH 2HJKA 3AS2A 1E6JH 1OD9A 5HHXL 2VDRL 2OL3L 5F7KC 1UWEL 1EJFA 2FJGA 2G2PA 2VNCA 2IG2L 3STLA 3B9VA 3SGDH 2X40A 2K3TA 3MTRA 3EFFB 3WIHA 3ZE1B 4A55A 4LIQL 3IFLH 4WAFA 1TIUA 1ANUA 1LO4H 2DMKA 2OMWA 3TA3A 2P5WB 2IBZY 4L4TE 2LABA 2NY1C 3C2AL 5F7BA 4OFVA 5AZEH 2CUIA 3OZ9L 4XZUB 1KIPB 1DCEA 5D4IA 4UQ2B 1KBVA 3SQRA 4IKKA 2I60H 2W0LA 3QDGB 5EZLA 2WWMD 1A21A 1BX2B 4FTVA 4FOMA 3H53A 3GSNL 4K8RD 5J11C 4X80L 1VFMA 3W11D 1U8MA 4AK2A 2F54D 5HPOA 1KZQA 3L17A 4LVHC 4NQCB 1LK2A 5FO2A 3UAFA 4Y16C 4ORGA 5TGBA 1SEBA 2HT2D 3S98A 3QR0A 2HFTA 1A64A 5DJ8B 3CVHA 1ZRUA 1FFTB 1MVFA 2JXMB 1U8NA 3GC3A 4J8QA 1ET5A 5DD0H 4CDGC 2RHEA 4XXCA 4ZSOA 3ZMEA 1PKOA 1KFGA 4BK8A 2ZE0A 1D9KB 4NN5B 5F7EL 1C5CH 4IKIA 4YO0A 5F1NB 2XPGA 3VXSA 3CC5B 1AZZC 3GSXB 1OAQH 1P5UA 3OZKA 1MF2H 2OR9L 4FYTA 4R6UA 1IEAB 3C08H 2W9LA 4KVNL 5ITFA 1JZGA 3IFOA 1M7IA 2VCOA 2V3EA 1FIEA 1DQJA 1U8KB 2E9WA 2BJMH 1JBJA 3OWRA 3EYVB 3ARGC 3V6FB 5DJAA 4IBTA 2P7TA 3NJKA 4JPIB 5IHZA 2K7PA 2KT6A 3OC8A 1CVRA 4WW2C 1OM9A 4JUSA 1F41A 1CC3A 1CQKA 3ZKNC 5SX4I 1X7QA 4PHXA 5IEKB 4PD4J 4Z7UF 3MA7B 4F3FA 2R1WB 3TBSB 4NNPL 2LT9A 1PMYA 1UD5A 4P2YA 2L7QA 5DVPA 3VFSA 1XB3A 3RIFK 4ANVA 2WK2A 3G5XA 3MBWA 25C8H 1S9YA 4ETQA 2NCMA 2J56A 5GZOD 4OFYD 1LO5B 3FTGA 5FO8A 4OV5A 3QQDA 5HSFA 1EAQA 2UWEB 1AR1D 4WJ5B 3AS3A 3O3EA 4XBGB 2BO0A 5IHHA 1IGCH 5E2UL 3HG1D 3WMQA 4X7DC 4BEIA 2CLRB 1JP5A 1JDCA 2XQYG 3D5OF 5HI3C 4MS8D 1VHPA 1IFHL 1ZE3H 1KBGH 4PRHA 3N3EA 5DD5L 1E50A 4LSDA 2QGEA 3BYTA 3MHZA 3NH7H 1F2XK 4LCCC 1JIBA 1H6EA 1TJMA 2VWEC 1SLVA 5B21A 4BA0A 2DTSA 1T0MA 2HFFB 1HAUA 2ZWKA 1JVLA 4Y5XA 2YQGA 1E28B 1LM8V 3BVUA 3ZK0A 2HX9A 5E8OB 4H2CA 1FPTL 5CMAA 4QXWA 2V7NA 3QFJE 2E6JA 3ZRCC 2NYYD 4MA7L 4OR1A 3LIZH 3BP5A 3KPNA 1HK6A 1OZTG 4TSBL 5E6IB 5FW7A 3EOBB 1AXIB 2FQGA 5LXVA 4LVNC 1TZGH 1IKNC 5IF0A 1HX0A 2ITDB 2YAPA 5I1EH 1JE6A 3FB6A 5D2LF 4PRNA 1OANA 1MCNA 1V7NH 2A74A 2YLHA 5HDWA 3NABH 2NRDA 1TQWA 3IXAB 2ZYRA 1MAML 3J27A 1KMGA 4Q52A 2Y5TB 4UOQA 3GNMH 5E5MB 5I73C 2YSSB 3N44B 4NI6A 1TT6A 3LQZB 4QXGH 5BS0A 2HLAB 2FT8A 2WSDA 4JFDE 4PP1D 3BGMA 1UYWL 1TYRA 1UM6H 4JLRB 5ADPH 2CUAA 4CDHA 1KUMA 1T66D 2PPAA 3F00A 4UUJB 5EULV 4JFPB 4Z0XA 4L8BA 4WEBL 4YC2B 4LPVA 4IGBB 5I16B 4M29A 1AY1L 1W9XA 3UG4A 3O6FC 4FKEA 4IYKA 3DJTA 1YEEH 2Z8VC 1PLBA 1S3KL 4YL4A 4PJDA 2BP0A 3PUCA 1NEUA 1SOXA 3PWPB 5GS1B 1A6TB 3OKLA 3MRMA 3X1GA 5TE4L 1FCCA 1MNUH 3CQPA 3BVWA 1XSOA 3M86A 4MCMA 2KLTA 5K9KB 4RGNC 2WBXA 1JWMB 5D1QE 5KYXB 4EZKA 5I6LA 1MELA 1HHHA 3CGTA 2DQFB 1RY7B 4KKPA 4ZS7H 2V5TA 1TLKA 2ZXWB 4FQIL 1DBML 1N64L 1U8IB 3MLWH 2VDNH 2QTEA 3BSZH 5AAMC 1AG6A 1WITA 1OAKL 3R1GH 2VAAB 1NFKA 4O02L 1T89A 1CJYA 1FNLA 3MNZA 4TLKA 5FOJA 2ZUXA 1YN6B 1J05B 3RPBA 1Q72H 1YC7A 2WLHA 3SBQA 4P46A 3QCUH 4JFED 1PNCA 3NCYS 4WTZG 5CO1A 5K9QG 4ELDA 2DWEB 4Y7OC 1WVZA 4MAYD 4FA8A 3AY4C 1NPUA 3ZVVA 1WHPA 5KVEE 5MEQA 1E4KA 3AQXA 3T65A 4JM2D 2WLIA 3MCKA 4OT1L 4XNDA 2OI9C 3T6WA 4AM0B 2P8MB 4WWKC 5F96H 1O0VA 3PWNB 4UQIM 5C0ND 4YUEL 1FVDA 3DDFA 4X5LA 5DJ0A 3D4CA 2EUVA 1BZOA 4S1SH 4N6RB 1EFXD 3NP4A 1OIOA 3HMWL 2J72A 2ZICA 3Q2WA 2CO7B 3L3KA 4KI5C 4JW3A 4AJ0A 5C7XH 5IJVB 4ODTL 4GUPA 4QYOB 2R2BB 4AZ8B 4JO4L 5A2LH 4Y0GA 4WU7B 1WT5C 1WS7A 2F54E 2ZSWA 2NUPB 3AMKA 3OR6A 3TO4B 1CDJA 4B5EA 4N24A 5DS8B 1ILUA 4U05A 5DJDA 3ZJAA 4DP2X 1E65A 3DPBB 2AZUA 5JW5B 3BUYB 3VFWB 1TQVA 5TJWK 5JW3L 1DBBH 1GGUA 1AFVL 1CDHA 3HE6C 3CG8A 2NY0B 4AGPA 3WTVA 1UFGA 1AJ7H 4BFKA 5LBSH 2K6YA 5DHYB 1IIKA 2MCG1 4OVUA 2EDQA 2DJ4A 4CVZB 2CMRL 5CBEA 3O81A 2P4AB 4OGQC 1Z3RA 3DA0A 3UROR 1AGEA 4MWFA 5JUEH 5H37G 2B3RA 2OSWA 2DIAA 2Z92B 4D8PA 5HHMD 4RRPM 4BRVA 4GRWB 4JKNA 5H2BA 1YEDB 1CXHA 1RIUH 3ES6B 1Q9WB 4PVMA 4WEMB 1S9WA 1E90A 1H8LA 4HKXB 1YHPA 3O2WH 4WHTB 5CZRA 3THMH 1W0WB 2ADJB 2ATPB 4PVLA 5DUBA 2ZNWA 4N2MA 3AACA 4NO3B 3KPSB 2VDOB 2OSYA 2WXQA 5E00B 4GO9A 5E9NA 2AABH 4NZRH 2G9HB 2FR4A 4Q14A 4WUKL 1Y1DA 5CJ5A 4HX1A 5H35A 1KZYA 1AQ8A 1UB6B 3GMQA 2X10A 5F8QC 3S5ZA 1GYUA 3DX2A 1SN5A 1MWOA 3I3BA 4KGJA 1IGIL 2EDRA 2XA3A 4Z7NB 1NPJA 1NCOA 1RXLA 5LVEA 1N4XH 2H1LM 3LKOA 2IPKA 4FZ8L 4WF7A 2FX9H 3D12B 3SY0B 3B5TA 4BH7A 4KI1A 4I1PA 2H3XC 2H6OA 2NT1A 3FSWA 2EQDA 2OZ4L 3T2QA 4BIKA 5KJRL 3OAZH 4G42A 4MA1C 3KPQA 3N1QC 1XZ0B 5DO8A 5SV3A 1G9NC 3ESMA 4PFEA 5DZPA 1LILA 1UKSA 1DQDH 3FH7A 4P48A 4HIXH 3B7YA 2GSMB 3L7FB 5I0YA 3Q44A 3K72A 3HE7C 3I6GA 1IGYB 3DUSA 3QZNA 4IRSD 1FHGA 1XF4A 4DK5A 4R2GC 1GIGL 3IB4A 5ICUA 1S7XB 5KSBF 1LDPH 1FI8C 4YHYB 1E40A 2AK4B 1OE3A 3DHMA 4LNRB 2PR4H 4XNQA 3UAAA 4AC4A 3U2JA 5EDXA 1O7DC 4GW5A 4XNMB 5CN1A 3S4SB 3VMOA 3WUWA 3FSOA 4GRMA 1FG9C 1GGTA 1A9EB 4HUCA 5D5MA 1VPOH 5D2NE 3B5HA 4P59H 2EKJA 3JXAA 3NTCH 4PWKA 1OP5H 2MOGA 4FXKB 3MFFB 4R97C 2JKXA 4OIBA 3ZGIA 3BRDA 2R69H 3QIWD 1ETZA 2WVUA 2EDWA 4FDWA 5FYLL 3ORJA 4XNAA 3U4EB 3QXDB 2EXTA 4FL4C 4WWOA 3CHQA 2A9NH 1NANH 1IM3A 3PHQA 5E2TH 5IY5B 4K94H 5EBLA 3UL4A 4KX8A 4QI3A 1OHQA 1MCEA 1NJ9A 1FO0A 2DYPD 4L1HA 2JF1A 2UXTA 5JIHA 5CWSB 1HYSC 1I7RB 4YK4C 3NJXA 1TNMA 1V3LA 4JDZA 3CVIL 1OSPH 2W59A 3FTUA 5IW1B 3PGFH 4AQ8A 4KXAA 4Q0XL 3O3AA 5TD4A 4L4TB 2PW1A 3FU9A 1GOGA 3FTZA 3KLAA 2EH8L 2FIRT 2LAAA 3NEOA 4PJAE 3I74A 4QRPD 4XVSL 1G9EA 4OQTL 2B1OA 1W0VA 4K5NA 4L0ZA 4M3KB 4WI2A 3DUUB 4OI8A 2NXYD 5EU7C 4JMNA 5EC1B 4JFEE 1JGEA 2OMYA 1TR7A 3MLYH 1OAJA 4M43H 1VERA 3V0GA 5K9JL 4Y4FA 4JX0A 4HFWB 4HPOH 3DJRA 3VXOA 3N40P 4MJ5B 3TLRA 3BH8A 5LNGA 2CHDA 4OY9A 2Z1PA 3G08B 1S7UA 3REWA 2LW3A 2D0FA 4MQXD 4NUMA 5DFVC 4Z8FL 5FKAA 5L8KB 1D9KA 3QNXB 3AITA 3QUKA 5JW4Q 1NFAA 4EPSA 5D7LE 3BPCA 1T5WA 3CMGA 4R5XA 5TE6L 4YLBA 2L7EA 3BKJL 1ZLWK 3GZOA 4UIMB 1U92B 1EQWA 3RZCD 3UBXB 2WN3A 2I26N 4JO3L 3BAEH 3PDOB 1FFQA 1OEZW 2W0FB 3S8WA 3EYVA 3V6FA 3HG2A 1IAIL 4TM9A 5T5FH 4AE0A 4BD4A 4G5ZH 4PLJC 2N3JA 4JPIA 2XIDA 2XNAB 2VZUA 3EJSA 3SYAA 3BYYA 3VYOA 4E5XB 4MXQC 3OQ3B 3CVBA 4X4ZA 3MA7A 2EYSA 3SE8L 1BQSA 1BBDH 2VSCA 2ZOKB 5E8DH 43CAA 2Z7YA 5C2BL 1G5AA 2VDOL 3GMNB 1U8HB 3BFOA 1VDGA 1FF5A 3RWCA 3DPDA 1OTUD 4DZ8B 2UWEA 5IFJB 2CH8A 2ZAGA 1R17A 4P8QA 2BNUB 5HHME 3POCA 4JANA 1FFNB 5AVTB 5KBDA 1KN2H 2X89D 5LGKA 1JGLH 2C26A 3EO9H 2F5AH 4LLYB 4WGKA 3FTXA 2O61A 1B2WH 1VGEL 2JI2A 1RQ5A 5C3TA 2V3DA 5IHWA 5DZOA 5CEYA 2OR7A 5D8JH 3WJMA 4I9XA 2YGNA 1U2YA 4ZUWB 2N7AA 1PF3A 1DJZA 35C8H 3HB3B 1A3LL 3QIUB 2ZXEB 4GW1A 4IS6A 5HYSG 1IC7L 3LHAA 4U1HB 2RCSL 5E03A 5FM4A 3FULA 1I8KA 3QFJB 2PP9A 3DX0A 2OV0A 3CFQA 3QI9C 1AOHA 1XIWC 3NESA 3A6CH 4YBHA 4YGAB 3VGEA 2C1PA 3F2LA 5I0WA 2G4GA 3NSCA 3BQUD 3CXHJ 5E6IA 4CN1A 4ZPVB 4IBYA 2DQTL 2G2NA 2CUHA 4X9BA 2ITDA 4LEBA 2FECL 2GG1A 3NFPB 3ALPA 1SY6L 4NQDD 5EO1B 2Z31C 2YXFA 4GAGH 1ZXKA 3D05A 4XMPL 3LZFH 5E5MA 1UXMA 3CX5J 3MAWA 1MCQA 4JFDB 5AALA 1UD4A 3VSTA 3O9WD 3BQVA 4LSVH 3QK0A 4G82A 4YSTA 3APCA 3OMIB 3O6ML 5AVYB 5A2IH 5C0EA 3LTVA 5KZCB 4YFEA 2VDKH 3B2UC 3MLZH 3OGOE 1AGFB 1UWGH 1DJGA 1B2YA 4D7PA 1IC0A 1OE1A 1J10A 4EI5D 4G3YH 3EGDB 4TQEH 2YD3A 4GXUN 2R0KL 2YJLA 4FZEH 4C4BA 4Q9CA 2PETA 4TQ8A 4HIHA 4ZD3H 4QTFA 2P46B 1KGWA 3IS1X 5D1QB 1UM5H 4FP8L 1SDDB 1EXUB 2HTKC 2J55A 4HIQA 4JZJB 3SBPA 3U0PB 3QHZL 3RX8A 5D96B 2I5YL 3JWNG 4DGYL 1CLYH 1SM3H 3O6KH 1T21A 5CCHE 5I30L 4PJ7F 1RVFL 3VGBA 3HBQA 3HC2A 5CM1A 1YMHA 4ZMAT 1TTBA 5CD3B 1KB5H 1CFVH 3MGAA 4ZDHB 4MZ3A 4Z3IA 3QYNA 3BZDA 5I26A 5BVJB 1YEWA 2GITB 3FZUC 4NHUA 3MUHL 3KAAA 3TT3L 1YN6A 4CKQA 3NP3A 5CJXC 2PP7A 1WFMA 3JVGC 5ACZA 4UYQA 3WUZA 1MFBH 2ICES 4UT6A 3MJ9L 4X5XB 1M05A 2VN5A 3IJYB 4YX2H 1NCTA 4YWGH 5L2JB 3EG9B 5ERWB 2V37A 3NGBC 1UZGA 3AS1A 2NY1D 3LIUA 2CWRA 1H15A 2VZTA 4R7DB 4EJ1C 1E42A 3KPPA 3OKKA 4QRQB 2WWNA 4Q74A 1Q9LB 3IAQA 4G6JL 4M1CC 5D7JD 3QFDB 4AM0A 2P8MA 5CINH 5MEOB 3Q48A 1J5OL 2DWDA 1L0XA 1HL8A 3QA3B 5HHVL 3VUAA 3UIZA 2YAQA 1S7VA 1ETJA 1GZQA 3BFWA 4R90H 3UC0H 1B0RA 4N6RA 4NS0A 4Y16D 4AT6B 1QFHA 3E6FA 2XRAL 2HVKB 1FL6A 1GL4B 1PLGL 5D1ZI 3A3YB 2F54B 1D2PA 3H9HB 3SDDC 5EC2B 3LD8C 2D7MA 5DS8A 3UJIL 4H0GA 3I9PA 3NZ8B 1RJLA 1EZSA 1IAKA 2AXJA 2NW3A 3DI3B 2JKIS 4KV5F 4LSTH 2JJWA 4JJ5B 5JW5A 1ZSHA 3PUUA 3CFCH 4HAFA 4IRJA 4MB5A 2DQJL 2XLLA 2J5LB 2Q1EA 4HKBA 3VI3A 2N56A 3HN3A 5LCVA 3I50L 5DHYA 1ZS2A 4N8VA 1ZLUH 1G7MB 3MUY1 5MERB 4GKLA 3LH8A 3SYPA 4D8OA 4FG6C 1NGYA 1OAZL 1ZIAA 3IGFA 2WNXA 3U6RA 2Y3AA 3IDMA 3ZKND 3IGAA 4GI9A 4H4NA 4KJYA 1K2DA 3C6SA 3LB6C 1FH5L 3CDCA 1BFSA 1KYOK 2Z92A 3HS8A 2D31A 4NUGL 2XG5A 3F6LA 1SMOA 5EDSA 3NYKA 4BZ2L 4PGEA 2GHWB 5A7EA 4Q9RH 2KKQA 3V4VH 2FNBA 2FX8H 4MB3A 5F1IA 3OJ2C 4AX3A 4F9PC 4U7SA 3T4AB 4HKXA 3WSQL 4X7SL 1MUJB 4JCWA 4KRLB 4OLVH 3F05A 1NBZB 2ADJA 2ED6A 3FUHA 4I18A 2OMUB 1SEQH 2OSXA 3CU7A 4NO3A 4MAZA 1QSFA 3VRJB 1BWMA 3APFA 2WMPA 1E8XA 1D5BA 5DD1L 5EU6A 1IVLA 2D7NA 1BW8A 5EEXA 1RZ7L 2G9HA 3GMMB 3DV6A 3F7PC 1QRND 1HESA 1WRFA 2R1YA 3FQTA 3QJSB 4LSRL 1WISA 5C0RH 2IH8A 1AR1B 1SDYA 2HX7A 4FXTA 2J1ZA 3D4GA 3L9RA 2X4TA 3HG1B 4TLUA 3SKUD 4BH8A 3LKNA 4WI0B 1Y0LA 1N9PA 1BVLB 1LP9F 1WTGT 4BUGA 5BW7C 3DTXB 4G72B 3R4RA 2HFGL 4Y19D 4MAUH 4ODVL 3BAYA 4ZXBA 1ZLEA 1D7DA 2FX7H 2Q7AA 3GDCA 1DVYA 3SY0A 3RY6A 4URKA 1X44A 4X0KA 4YBLC 4KGLA 2BIHA 3F58H 3FHEA 2RH0A 4F37K 2X2YA 1QR1B 1VFAA 2V8MA 4X4XB 3BWAB 2R0LL