3D05A

Human p53 core domain with hot spot mutation r249s (ii)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
193
structure length
183
Chain Sequence
SVPSQKTYQGSYGFRLGFLVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 183
sequence length 193
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d05A00
1EANA 1LJMA 4IBYA 4IBQA 1KZYA 4G83A 4G82A 4KVPA 4AGLA 1CO1A 4GUOA 3IGLA 3D07A 1E50A 2IOMA 1T4WA 1HJCA 3Q05A 2J6WA 4AGMA 2YBGA 3WTUA 3ZMEA 1HU8A 2X0UA 4IBZA 4IBUA 3EXLA 3VD0A 3D06A 3D08A 5A7BA 5ABAA 4QO1B 3Q06A 2VUKA 3WTWA 3D0AA 5ECGA 4XR8C 2RMNA 3QYMA 4GUQA 3US0A 3VD2A 5AOKA 4A63A 4AGQA 2XWRA 2FEJA 2ADYA 2IOOA 5BUAA 4AGPA 2AHIA 3QYNA 2ATAA 4AGNA 1EAQA 3WTTA 5LGYA 4LO9A 3D05A 5AOLA 2BIMA 4L18A 2P52A 2J1ZA 2WGXA 5G4OA 4IJTA 4L0YA 5G4NA 2H1LM 3IGKA 1CMOA 3WTVA 2PCXA 5AOMA 1EAOA 5LAPA 3US1A 3WTSA 2J1YA 5G4MA 4LOEA 4IBWA 3D09A 3WTYA 2BIQA 1TSRA 4IBSA 2MEJB 5KBDA 2X0WA 4IBVA 1H9DA 5AOJA 3KZ8A 4L0ZA 2BIPA 5AOIA 2AC0A 3TS8A 1IO4C 4MZRA 4HJEA 4IBTA 2J1XA 2J20A 2XWCA 4MZIA 3EXJA 4AGOA 3Q01A 1TUPA 1HJBC 2BINA 1UOLA 5AB9A 3WU1A 3VD1A 2GEQA 1GZHC 4LOFA 1GZHA 2OCJA 3KMDA 1YCSA 2X0VA 2J21A 3WTXA 2BIOA 2IOIA 2J1WA
chains in the Genus database with same CATH superfamily
2A73A 3JWDH 4B0MM 1MHHA 4XBGA 1QVOB 2ZKHL 1SOKA 4N2CA 4JFED 5GSVA 1B9KA 4TLSA 4PU2A 5EBGA 4AT6B 3CH8A 3POHA 1G94A 4QXUL 1FIEA 1JCVA 2YMXL 5IQ9A 2DKSA 5CCKL 1TQTA 4GO6B 2OMYB 7FABH 1HU8A 1O75A 3KPSA 3OAYK 5E5RB 1TJHH 4KWUA 5TQ2L 1E9PA 4FQXB 4UINL 1XGRB 1Q9OA 5DVOA 2VISB 5GGUA 4NZJA 5C71A 1A64A 3QUMH 4Z7UE 5F1NB 3WUWG 2Z35B 3STZA 4XAWH 1VADB 3BQUB 3F00A 5IG7B 2K6WA 5KSUB 1UWXK 1KPUB 5FECB 4XOAA 3VXRB 5AVYB 3L7EB 4JDVA 3QNFA 4HFWB 3QAQA 5EEZA 1JD7A 4B95C 5JPNB 3TT1L 3AREB 3D33A 2YD8A 3NJKA 1PD6A 1SFHA 1RPKA 3MRFA 2GHWB 5ALCL 3KXFE 4RWHA 3NH7H 2FD6H 4OQTL 5MENB 1KV7A 2A9BA 3BXNA 5CIPB 1QW9A 3F04A 4IOSD 4QRTB 3SE4C 2HAZA 2KQNA 3MXVL 4M61A 1FNFA 3UZEC 3NG5A 3O41B 3RL1A 3WFBL 4IRSB 2BVYA 4NZUL 3C5SB 4RGNE 5CBAA 1B0RB 3NCEB 2JTYA 3HRZC 2FR4B 2EDJA 2AV1A 1KGJA 1FO0L 2X9XA 4GG6A 4N68A 3U1QA 1EERB 3WNIA 3T0VA 5IMOB 4DH2A 3UPRA 3MNWB 1MWAA 3MKKA 4K73A 4WNJA 2Z7UA 4IGBC 3MV9A 1EX0A 1CL7I 3AU0A 5EC1B 4MDJB 3NJFA 4J4PD 1ZKAA 1K8IA 1HHKB 1S7UB 4AY0A 3GJEA 2BVQA 4W9LC 5A2CA 5FXCH 5I6MA 1PKQE 3RGVD 3WBDA 5JW5B 5M95B 5IMKB 3SN6N 1FZKA 4DGVL 3CDZA 3OHXA 25C8H 3Q8BA 4O9HL 3EBHA 2OX5A 1JPSH 4X6BB 3VXSB 1NC4A 2NY6B 2IPKB 5AUMA 4EKJA 4XMLH 4AVIA 3IETB 4KKLD 2IADA 2NLJA 6PAZA 1RHFA 1R5VB 2YXFA 1A6WL 5E9DA 1BVZA 1O7DE 3G5YB 3O8XA 4QNPE 3THMH 2PYEE 3GWJA 2J2ZA 2MTPA 1WWBX 4LCIH 1NZRA 2OXGA 2XBDA 3BIAX 2EINB 3ARFD 4WWID 4X4ZA 5D5MA 4FKHA 4K8RH 2GUYA 3CZEA 1WGVA 4LPYA 3Q1EA 3C6LA 2YD6A 4P3CL 3ZKXB 1ZLUH 4JRYA 1QSFE 1EFXD 5D72L 5E56A 5BOPA 1M71A 3P30L 1DSYA 2Z6FA 1NIFA 5C3TA 1M2VA 2E9IA 1DTUA 2Y2YA 2ADIA 2A9AA 4N25A 2A77H 1NBCA 4FYTA 1KXTB 1R3JB 2CGRH 3QZLA 5I8CB 1GHFH 1XZ0B 5C92A 1N0XH 1G9MH 5A2BA 3QK0A 3MQIA 1T1XB 2IH8A 3D0VA 3C5XA 3U0TB 4GMSL 3O0RL 3WFHB 1MZYA 1Z0NA 5HYSG 5CP7B 2XACC 3FFCD 5DRWA 3QEUA 2UWEE 3QE5A 2GTQA 1FNAA 4PRHA 2B1AH 3FDWA 1D7CA 2EEAA 3MA9L 1KLGB 2WQ8A 4FFVD 5DUML 3WAKA 5I5JA 1FG9C 1WEJL 4J5VA 1SVCP 3RWHB 1J5DA 3UROR 2JJUA 5E5MA 1RZGA 3BESR 3IDGA 5LBSL 3V7AG 2CLVB 1UFGA 4GP8B 3D25B 4PRDB 3US0A 5BO0D 2W0KA 1CUOA 1XCQA 4JZJA 3L6FA 3ZDYB 1K6QH 3ZTNH 1F4XL 2ICEB 4WSJA 1NGWA 5K1VA 3I50H 4PJDF 4ZXBC 3GXIA 3VXQA 3T8MA 4DK3A 3Q5TA 4G80B 3BRFA 1YY8A 5DRXA 2FUTA 1MUJB 1DJIA 1R5WA 2ID5A 3GIVA 5C0AD 2KZ1B 1F58H 3FQ1A 1VCBC 5IT2H 2V7HB 1PQZA 3FO0L 3UBXB 1QLFB 5CBEB 1JSYA 1QSEE 3BSGA 4NBXB 3DX3A 1KNOB 4I77L 1FPTH 1V7MH 4PJXA 5TGBB 3RZCB 4RSYA 3QIBB 3ZYIA 5MP6H 5C0DB 2Y36L 1HL4A 4TNWK 2OQJA 1PEZA 4Z76B 3ZDXF 4TUOA 4Y4FC 4U6XA 5LN4A 3DK2A 3FMGL 7CGTA 1XF3B 1YDPB 4KXDA 1DEDA 5LBVA 1U9KA 1N5YL 4Q9RL 4NKIH 1T3FB 1G9NH 2G9KA 3S96B 2HFFA 1BW8A 3AQDA 1N3NB 2AGJL 1G1OA 3P2TA 3PY9A 2K6YA 2E7DA 2IXQB 4JFTA 5C08E 4LCVA 1HC1A 5EO9B 4H8QA 4LCWA 5ISZD 5CZRA 4HC1H 3JTBA 2E7LA 1XGYH 4E9QA 3O81A 4E5XG 5K1JA 4PJ5B 1TZOA 4FCHA 5D7EA 4BUQA 1KIQB 3PWUB 5I1GH 1ZOXA 3QEQB 1JDAA 5I76A 3OMAB 4XN2A 3WIIH 5GRYA 3MLUL 1FSKB 2DIEA 1KJ2A 3BSZH 5SWZE 4NX0A 2EDHA 5CINH 3WFZA 3UL4A 4ZMOA 5E00A 1G6RL 3TF7C 3FHAA 4MA8H 2DM3A 1DUYA 2PO6B 5DI8B 4P2RA 4EZMA 4GQRA 3RNKA 1AHWC 1VJSA 1WBZA 4YIQB 2XVGA 1F2QA 1RZQA 4MJ6A 3N0PB 2Z31B 1TO5A 1A6TB 3HOGA 3HG4A 3K81A 3GZQA 4JM2D 3IGLA 3BIKA 1IJ9A 1MELA 4C54A 3ESUF 4YQXH 1UXWA 3BH8B 4K7FA 4KO9A 1IEBA 2B9AA 3D18A 3QIUB 2V17H 3H3PH 5MHSD 3A22A 2R2BB 3LKPA 1BFTA 1Y07A 2NOYA 2P8MA 3FTGB 5GHWH 2E6JA 2QBWA 4K3JL 4QD2E 3MJ9H 5JMRA 1YECL 2WKGA 1A1MB 2VTFA 1MLCA 1X5KA 3I3BA 2DQFA 5ACMA 3KWVA 1XQ4A 2IEPA 2DQTL 4KROB 3BO8A 1RV6X 3GSNA 1CK0H 4MJ5B 1B4RA 3RX8A 3ZOAA 1K5WA 2ZNXA 1JZGA 3PXJA 4F7CA 1YMMB 2VO5A 2N59A 3AB0B 3K72A 4FTVA 5B1BB 5I30L 2DJ4A 4RWYL 3NYKA 4ORGB 4XC1H 4AI7A 4N90E 2QGCA 4HGKC 4QRRD 3ZHDA 2ITFA 1RD6A 4WLCA 1S5HA 1J0ZA 2IGLA 1X5ZA 2CLZA 3ZVVA 1M7DB 3NIGF 2GB2A 3VI4A 2A74A 4JL1A 1AE6L 3OGCA 5B3NA 1YAZA 1E3XA 3AG3B 3FO2A 5D70H 3B5GA 2BIMA 4UOQA 4Y1AB 5KS9B 2DD8H 4LF3B 2W91A 4RZCA 5CKGA 4NN6C 5IHUL 3QXUA 3GXMA 5G4NA 1KULA 3TBBA 5JXED 3PE9A 3ME0B 2EH7H 3CUPA 3Q48A 2NY4D 1JNLH 3VFOA 5F0PB 1QUNB 3D51A 1ADQA 3GJFH 1OIOA 1JNJA 5ERWB 3KPPB 4UBDD 5JIMA 3MRCA 3B37A 1ZA3A 2QQKH 2B4CC 3KPRA 2UXGA 3LSOA 4JB9H 4ZNCD 3DBSA 3AAZA 3PHSA 4LE8A 4LQFL 2DQGH 3TJEL 4PGCB 3ZQ9A 4AQEB 1W9XA 4HJSA 3PQYA 15C8H 4HJJL 5CJBA 3VFPA 4AMWA 1U3HA 4JFDA 1JZ2A 1HJBC 4EI5C 3QDME 5I8EB 3BZ5A 3MCLL 4HS3B 3HPJB 3ZMNA 1KB5B 4P2OB 4LVHB 4EZLA 1N5AA 4XMUA 1ASPA 2BHUA 3TYFB 1NDMB 4FQIH 3GMQA 4QF1A 4OT1H 3HBGA 4WV1C 3CFBB 2UZYB 1MW1A 4FFZL 5JIIA 2EXYD 5EOTA 4HXAH 2A6IA 4C83A 5IW6B 4XMXA 2Y7QA 4KV5F 1L6XA 2XETA 3DMMC 1OSZB 1QLRB 2VDQH 3ILQD 2AQSA 1EEUA 1T4WA 4YBHA 3X1NA 3T1WA 5HGAA 5EN3A 4UV4L 5IWLC 3MLTB 1OCWH 2O4EA 3IE9A 2VQ1B 3KLQA 4MB4A 1MIML 4ANWA 2J25A 4TF4A 3RIAK 6CGTA 5FHAH 2NW2B 3Q8EA 5E08L 2MNUA 3WKYA 3RJDA 4XOCA 3ULAB 2OMVA 1QBLH 4OM1L 5LCVL 3UAJA 1KIUB 2B5IB 3PREA 5H4ZA 5BO1L 3EYVA 2IIJA 3SDXB 2DLFL 5G5DB 3UMTA 5L8LB 5IM7A 1NANI 4WUKL 4IK6A 3WY3A 5GS1B 2AQRA 2W94A 3QQ9D 2XN1A 1Q0XL 2VAAA 1NEPA 2WXNA 4PV9B 2AJSH 2YUVA 4OZHE 4BCZA 3F3HA 3KWXA 4MJID 1AR1B 4PS7A 2Q7YA 5F7LB 5K9OB 3ZGHA 4NQDD 3WS3A 1A22B 2PCXA 1NCBH 3AY2A 4MS6A 1ZLUK 3QORB 5B22A 5ACZB 1ETJA 3SE3A 3ARXA 1DL7L 4R2GD 1OARH 1W8OA 5SX5H 4M43L 2QDWA 1AKJA 2PW1B 1G7PA 2AJVL 3Q13A 5DDHB 4PJCB 3FCTA 1EEQA 4QGTA 4U3HA 1ZA6B 4Z3GA 3O3BA 3ZTEA 5KJ7E 3AGVA 2N3JA 4HUNB 4YAQB 3IJEA 1XSKA 1KJMA 3AFLA 2XPYA 4JKPH 3GQFA 3SE9L 3FO9A 4KDVA 2C9RA 3VB9A 4XPTH 1SM3H 1UM4L 3S2CA 3GXFA 4OV5B 3FFCE 1CZ8H 2ARJB 1I3RA 2MCAA 3U1PA 3D9AL 4J8RA 2QEJA 2X87A 5EZJA 5ID0A 4HU8A 2BO0A 3FFDA 4EIBA 4AXWB 2X4TA 4ES9A 1PEWA 5HYJA 5IHZB 4DQAA 3DHJA 2NNAA 5AENA 3BVVA 2LU3A 1VPOL 2P1YA 4X2UA 4ZUTA 3UERA 5KBMA 5TK4A 2ATPB 3CFMA 1QRND 3NIFE 3RL2A 4UB0H 5D2LF 2VXVL 3WFCL 2XWTA 2BS9A 4P5TA 4LSRL 5FPIA 2BLFA 2E0PA 5C0AE 3OJDA 5TE7L 2QSTA 3CZSA 4G83A 4LCUA 4XCCH 4PBDA 4NO5B 4OM0L 3TO2A 2CO3A 1NJ9B 4AV4A 3JWOL 4IEFB 2AITA 2EYSA 1S6NA 4FZEL 4JFPA 2K3TA 5TH2A 5KW9L 1IC5H 4DAGH 1JIBA 4FQHA 5JOEA 4HIIA 3CHRA 1H3VA 5IMMA 3EYQC 4HIEA 2QMKA 1MRCH 4BK8A 4MB1A 1XR9B 1H3WM 4LCCA 4K3DL 5DC0A 4CDGC 2ITCB 3VQ1C 2CO2A 1FVCB 3VD9A 5KJ4A 1GRWA 1HXYB 1A14L 1SJMA 3KHQA 3M6DA 4Q56A 3UJIL 3KBHE 3T0WA 1PYWA 4L37B 5HGBA 3ERXA 3QARA 4GKNB 1ET7A 4UZGA 3DX2A 3BP4B 3EHBD 1N18A 2NXYD 2D8KA 5EDXA 1XL6A 2QSVA 4N2DA 2V33A 5FLUA 5J4MA 5ISZE 5BQ7A 1A9BA 1AP2A 1YG9A 1G9HA 5F72S 3GS0A 4L3EA 5BUAA 5EN2A 3OAZH 1TXKA 4O02A 5FYJD 4OLZH 2P8LA 2C3GA 5T1DH 2GSIB 4LO9A 5EPMB 3LQAH 1XHHA 3QUXD 4QRPA 4Z5RA 1INQA 4LPXA 3CSGA 1WDAA 2FO8A 2F1BA 1D6EB 4FFYL 2X6MA 4P9HH 3TNMA 4JJ5A 1XZWA 2GT9A 1I85A 4GS7C 1KCBA 2CKBH 4NNPL 3RTLA 3OAUH 4Y2DB 1MNUL 2HJLB 1ULVA 2VN5A 2VITA 4M1CD 5D6DC 3BEVA 1CLCA 2ZOWA 5KS9F 2X5PA 3KYMA 2CJ3A 4KXCA 4XPAL 4LKXB 4YNYA 3HZVA 3TLRA 3OG4B 2X0WA 3X17A 4BCYA 4Q6KA 1WAEA 4P9ML 3NGBB 3Q8AA 5EA0H 3DO4A 4FXGA 3VU2A 32C2A 3SDAD 3IXAB 1MRDL 4TNEA 2XWDA 5HHVH 1I9IL 4MZRA 1M1XB 3RBSA 5ICZA 1FRGH 4L1LA 3VFNA 3OXRA 3O4LA 2NNFA 3LS5H 2LHAA 2OBGA 1KEMH 1OGTA 2OTPA 3O3EB 4M8QA 1GAFL 2ICWA 3MTRA 1XH2A 4LVOB 3ZY7A 5DO2C 3IFLH 4Q6IA 3C5ZB 4PJGA 3KNBB 3UBGA 1A5FL 5E8NA 1DCEA 5C0BA 4E9XA 4IMKA 2OJZH 4P57A 5CZKA 1OHZA 1YZZA 4QRRE 2IH1A 1RUQL 1CWVA 2DJMA 3KMDA 2BZCA 2ODHA 1WZMA 3DRTA 3DX7A 4UU9A 5AVTB 1WG3A 4CMMB 4JHWH 3SGEH 2MH4A 5IGXL 4L9LC 4WCYL 4IBYA 4NEHB 2DOCA 1GY1A 2C9XA 4HK0B 5SWSD 3AS0A 2J8UB 1ZXKA 3EH1A 4S11A 1PLGL 2OSLB 3KYKH 5L7XH 4JFYA 5DJYA 3LZOA 4KMTL 1YAIA 3ZL1A 1MKFA 1FVEA 4ILDA 3VFRB 3GC3A 3V52H 1SN5A 1MOEA 1B6UA 3ULUD 1BZ9A 5DHMC 1DLHB 2OMXA 1B3JA 5J6SA 3IDNA 3INUL 2WXIA 3IRZA 2UVFA 3LNHA 1KBGL 3NPZB 4PJ9D 3GJFK 4V1DD 4AUUA 4HT1L 5DGQA 2I07A 4C4KT 2A9DA 4PQXA 1KCKA 1X4XA 3B2PA 1U8IA 3S3DB 1YEEH 4UT6L 1PG7H 2AK4A 3HNTL 4AIOA 1P7QB 2WBJA 2Y6TE 2NYZA 4U6VL 1S78D 5KVMC 3QYMA 2QADC 2WOYA 3VGDA 3B7RL 4ADIA 1KFGA 1I53A 4N20A 2AHIA 3OF6A 2XDHA 4WHTB 5C0CD 4AK2A 3K6SB 2VXQA 3DHUA 2NYYC 4OB5L 4G42A 1INDL 3CDCA 5D4HA 4ONGL 4R4FL 2W0LA 4KH2A 1A7QL 2R29L 2ZX7A 4U49A 4Z0XA 3IJHA 4ZW7A 3B7UX 3U7WH 1WZLA 2Z7WA 3EFOA 3IK2A 4MS8C 3DPBA 3GMLB 1ZVYA 2KHAA 3QJTB 4IBWA 1AHKA 3AWGA 3QW9A 1AO7A 3PL6C 4F3FA 1LD9B 3K8LA 4M1DL 3OVUB 1V3KA 1HSBA 2DWEA 3BKJL 5C09D 5E4OA 4JO3L 1BBJA 5L4IA 1D5ZB 2XQBL 3FT0A 5E4IA 3RVXC 5A6MA 3FUNA 3SO3C 3QQNA 4YZWA 4YX2H 4GP4B 3RA7H 2ED8A 3DK0A 1TQCB 5FYLH 4WO4B 1KIRB 4WHDA 4ELMB 4MMYA 3NK4A 3V4UH 1RULH 2ERJC 3FQNA 1RK0B 4PJCF 1ROWA 3QH3B 4LVNC 2WTRB 5DFTA 2EE2A 1TQUA 2EIZA 3BVNA 3DROB 2B16A 2X40A 3CDFA 3N0AA 3NJMA 4NYLA 2C9SA 4LLVB 3ATEA 5I2IA 4EN2A 4Y5VA 3GMRB 4DN3L 3HC4H 2E8YA 4X6CF 2AQTA 2YGVA 4OZGB 4K8RD 4KJPC 1L5GB 3IU3B 4PI2A 3WEMA 2DDQL 3NZHL 3KLSA 1O0VA 3ASWA 3C5JA 4LEEA 4NUGL 5KSBE 5I18L 4XBPA 4TSAL 2DQ6A 5DS2A 4MJIE 4F15C 3SIKA 3N42B 4JN2B 4WDIB 3V0HA 4EBQL 4B9FA 1FYTA 1RJYA 2P3YA 3B9AA 4QHLA 3S88L 4L5FE 4PJAA 5BV7L 1RUKL 2BXZA 2LLLA 4PW3A 4MMXA 1P5UC 2X4SB 1JG9A 1U91B 5DEZA 2YAHA 2CNYA 5SX5K 1QHOA 3FJTA 4HFUL 1E8WA 1SVZA 2KI6A 3NAAL 4BH7A 4JE0A 4A39A 2K8QA 1ZY9A 4HF5H 3WO3B 4G8EB 2VLME 3FO1B 2BOLA 1KT2A 4H1LB 4XNAA 1BLNA 4NBYB 5FF6B 4G9FB 3TO4D 2WWNA 3V6ZA 3LHPL 4NUJA 3FCUB 3GSUA 4NCC2 4IRJA 1SMDA 2E27L 2EH8L 1HEJC 3W39A 3HHSA 3RTQA 1OM9A 2AVFA 4A6YB 1CLOL 4JHZA 5GGVY 1BJ8A 3HC0B 1NGPH 4HJ1A 4Q9CA 4KK5C 3QUZA 3CVIL 4HBCL 1TLKA 1MN4A 3Q6GL 2H3NA 4YFLF 3VQ2C 1ASQA 4AG4H 1WT5A 4APXB 4DPCX 1T04B 4Y19A 3PWLA 2UZPA 4YHPA 2YOCA 4GP5B 3FU3A 1EJOH 4X6DA 5CZXC 1ECZA 2B2XL 3NN8A 2H9GB 2FEDC 1S7RA 4CGUB 1EGJH 3DXAB 1L9RA 1JK9A 3QCUL 4U0RC 3LIUA 5DC4B 3LZFH 1JV5A 4PWGA 4N9GB 4PS3A 4NQSA 3PYCA 3V0GA 2E86A 3AQYA 2R1XB 3OZLA 1H9DA 1SY6L 3DSNA 1VEPA 1RFDL 3MUGB 3RPIA 1UACH 4UTAL 3VH8B 3N1GC 4J2QA 2F74A 4N8CH 5HHOB 1R0AL 1FNEB 4LLDA 1ZT7A 2F9BT 4R83A 2ZICA 3CFJA 5CJ5A 2FECI 3GI9H 1MCSA 3PNRB 3ARPA 4MNGB 5KVDH 1RIHH 1AI1L 4XWGL 1EPFA 4LKCB 5AW3B 1YC7A 4JQIH 3HCVA 3DIVA 5JPNC 4M48H 2X9WA 1XF2A 1S9YB 2ZONA 1RJLA 3MRQB 3U79A 3W2DL 4NPJA 5FYJE 5ADPL 1KDJA 2D0FA 2ORBH 4XCNA 5ITFA 3OAZK 1NDGB 1ZT4B 2ZP8A 1QR1B 2J4WH 3N41B 4AM0B 2JI1A 3ARBB 4K9JA 5KYWA 1MJ8H 1S9VB 5FYJU 3VWKB 1OW0C 3B2UD 3PGFL 1J5OH 2NRDA 1CBJA 3UC0L 3LKQB 4FYRA 5DA4A 1RZIA 5GGQH 4CJ1A 4PRAA 4JLRB 2QV2A 3ALPA 1TTFA 3PGCB 3M07A 3E9UA 2W95A 2O6DA 2WXMA 4PRIA 5AB2A 5KANG 2J8UF 4X5WA 3ZTDC 2JKNA 5I1DB 1GL4B 5HDWA 5KVGL 1T1WA 3HI5H 4YO0B 1UXSA 2O61B 1W0WA 1JGEB 1BAGA 2BSDA 4BDVB 3ULVE 2CA3A 3RFZA 3CGTA 2A4CA 3EUDA 4Z7UB 1C5DB 1UCBL 4JUSA 3NJXA 5AVXB 2GCYA 3WGUB 4DKEL 1WWCA 4PB9L 2P80D 5ALBH 1HNFA 3VFMA 4XX1G 2PPEA 2ENYA 4HCRH 3M45A 1WAAA 3KLDA 2BDNH 1XB6A 2FGWH 5IJDC 2PETA 3H55A 2X2YA 1U6AL 1ZE3H 1PY9A 2ZOKB 1E3FA 4JHAL 2E47A 4YPGA 3W1ZA 1MVYA 5DT1L 2WQXA 3PS6A 4GSDL 4LESA 2ADJB 3QA3B 5CN2A 5IQLA 3CHSA 3MV8A 4K15A 1ZV2A 1NDTA 5I1KL 3BAKA 1RIVH 4YSQA 1IMHC 2IANA 1NFDE 1BD2A 3M86A 4KK8C 5SWSE 3GSOB 1Z0MA 2VDRB 4J6RH 4IW4C 1TVDA 3D50A 4MQXD 4RGNB 2Y7MA 4I0PB 3SY0B 3TBTB 4QOKA 4BRVA 5DR5L 5AAWA 4HEPA 1TCMA 3QR0A 3S5LA 2FRGP 1CDIA 4G6AD 4N22A 4LOUD 2AJYH 4H88H 4MCNA 3WFDH 5CFHA 1HT6A 4P4KB 1XL4A 3LN5A 4A7TA 1VZIA 1WWWX 1BIIB 4Y9EA 2P5WD 2XIBA 3QULA 4LSVH 1SZNA 4OZFB 4V1DE 1KG0A 4HWUA 1IQDA 5FGRA 3MRBA 4HA1A 3FC8A 4HGMA 3ABMB 5BNXD 3OB8A 4NHCH 4GB9A 1ETZB 4TNFA 5E8PA 4A2DA 4G7QB 2X89A 5F9WC 3MLXH 1PKQB 4MAYC 1HEHC 2NXZB 3P0GB 4NKOB 1VFBB 2R0WL 3NFSL 2YPVA 2ARJQ 3RWFA 3WJJA 1UZ6E 1JHKH 3WENA 1VZHA 4ELMF 1L3NA 3PCYA 5C0CE 2D9QB 4RIRA 3G04A 2DYPA 3X3GL 2PYEB 2YXVA 3AY4A 1V55B 1CICD 2FB4L 3NCJL 5F7DA 1GZPA 1E2WA 5C8JA 3K4ZA 3DARA 4AZUA 2AANA 4R8WL 1NC2B 1SEBB 3EH2A 1QSFB 3AT8A 3WUWB 1FG2A 3AMLA 2A1WH 4OZGF 3RZCC 1AZUA 4QCIB 3ZKNC 3TZVD 3UG4A 4GOSA 2GVYA 5IMLA 3EO9H 3PNWA 5GZOA 1JZ4A 1ZLVH 3SKJL 5KJRL 5L8KB 3H9YA 5BS0A 4DF9A 1TU2A 5C09E 4WQOA 2KERA 2VDPH 2ZXBA 3EJPA 2QHRH 1AQKH 2CM5A 4W6XB 5LJYH 1RP8A 4C56D 4MB5A 5DHVA 1XO8A 2NSMA 3B1UA 4FQLH 4ZO8A 3CU1A 5JOFB 3NA9L 4XX5A 4OI7A 4ODTH 5DWUL 4H8WC 3NSYA 2OMTA 4AH2B 3MLYL 4OF6A 2C1OA 2X9YA 3SPVA 2UWEB 1DQKA 4FQJH 4XXCC 3SPCA 4RNRA 4QXTA 4YDMA 1TJIL 4BQ9A 4AK1A 2OMNA 4EIGB 2ZG1A 3CCHB 5H2BA 1KWKA 1TJXA 2X4QA 4EI6A 1RZFL 3CWGA 3V4LA 2X38A 3OX8A 3B2VH 2G5UA 5CD3B 2VXUL 3FCBA 3KH3A 4HPYL 4Y16C 4P06A 4LHUA 4O2CB 1T20B 2IAAC 1PNDA 2CO1A 2H26B 2P24A 5J0BA 2VSKB 3KWWB 4GFXA 4FGMA 4ZYKB 5CEXA 2DQCL 1RURL 1LE9A 1CMOA 1NLBH 5GSRA 1HI6B 4OD3H 1E6JL 3O4OC 2C3HA 4S1QL 4DSYA 2PO6C 2CG9X 1OTTC 2HKAA 5FKAB 3E6HA 2QPUA 1OAKH 2JI3A 4LSQH 3ESPA 4KUCF 1QSEB 2FT7A 2PXYD 4FQQA 3T9WA 5EWIL 4XNUL 3QIWC 3W11C 3O2WH 5IB2B 3U83A 4YSEA 1E4HA 4LL4A 1KPVA 3V6OC 2BSSB 4KX7A 4XP1H 5D7JB 5T1JA 1SDDA 3FUJA 4KJWD 3W0WD 1H0DB 5FW7A 4Q9QH 5GRVL 2NQDA 3WDIA 1E28B 3DV4B 3JV5A 3E8VA 4TVUA 5KAQG 1JZ6A 4GW1B 1RUAL 5C08B 1LO5A 5EZIH 4ONOA 2I5YH 5FUOL 1MAMH 4HDIB 3JV4B 5DD5H 3MRJB 3FHQA 2LU4A 1FF5A 2NCMA 2VJ8A 2JVUA 4M6OL 1A7OH 1U92B 1S5IH 3WTXA 3RJQB 2AV7B 1RK1B 1MCPH 1WHOA 3FU9A 5F7FA 4LQ1A 4UILL 1OSPH 4O5LL 3OKEA 4FI7A 4OD2A 1GGIL 5SWZB 4P23C 4X80H 5HYSB 1IFGA 3FOLB 3V0WL 5ECJE 4F92B 5I5RA 4KRPC 4XPBL 3AITA 2JKLA 1DFBH 5F1SA 1T0MB 1N8OE 4G7RB 1PSKL 2DWSA 1T6WA 3FUIA 1SXZA 1S7VA 3BKCL 5D96C 3I6LD 1Q1JL 5C0EB 5ESAB 1GPOL 3UO8B 1TQSA 3FAXA 4PJIF 4OCLC 5A6IA 3TL5A 5KBPA 3ARDB 1WRFA 2FT8A 3MXWH 4N2MA 4EQ2A 3BLBA 2FIKA 3F84A 1QEWB 3D39A 3FB6B 3WTVA 3CNKA 4YSUA 2BNQD 4G59C 1A7PH 1URZA 2Q8BH 1I1AB 4EVNA 3VD2A 5FO7B 4JFFA 2EYTB 2LE9A 3QQ4B 1CXEA 4ZTPH 4WSGA 5FB8B 2Z91B 2EDWA 3QI9A 3A21A 4OVUA 5AALA 1MJJA 3REVA 1OAYH 2Q76A 4OZ4B 4Y4HB 2VLKA 2J6EL 4YS4A 2O5XH 3ECBB 4P2OC 3D85A 5JIDA 3DVIA 2K7PA 4Z7UF 3RVVD 1CQKA 3D2UD 1DBKH 3GKWL 1JHTB 2OI9C 4X9YA 5ESVA 3GIZL 4J3SA 3A4DA 1NFIA 3VXUA 1YPZE 4GAYB 5KYXB 3BW9A 2CRIA 2R0LH 3KJ4C 3K4DA 3MRDB 5B39G 3A5VA 1W2KT 4M56A 3I75A 3MRNA 4FFWD 3S6CA 3C60B 4YLQT 3DOSA 3JT0A 4CN4A 1KBBA 5ENWA 2GUOB 3S36L 1TETH 1KY7A 4E5XB 5KN5B 4JRXA 3L7FA 1KXQA 5C6TH 2JJSC 4MJJA 3SDCD 4LP8A 3KLHC 5B7MA 3S35L 1HIML 1VESA 1A6VL 3G5ZB 3MBEC 4NN5C 1N8ZB 2OSYA 3CXDH 1TQVA 3GKZA 3RKDC 1O6TA 4OIIL 1I3UA 2Y24A 5DQ9B 4Y0GA 2QZQA 1T1YA 2VW4A 3TV3L 1HHGB 3HR5A 1T83C 3I85A 3HE6D 4G5ZH 5IR1A 2DIJA 3NRPA 3TCLA 1PZ3A 1ZDSA 3F5WB 7TAAA 2WANA 4XNYH 1RL1A 1IKNC 5F7AA 3GMOB 4W9JC 3Q3GB 3MLWH 4UUJB 2ADFH 5JHAA 2Y23A 1F8TL 3HLAB 3MCYA 2EDKA 3B6SB 3QJVB 3VI3E 3MVSA 5A6LA 1VF5C 1MCQA 1NCDH 2PR9A 5DJDB 3G6JA 1HOCB 4TTDC 1IBBA 2OTUA 4B7LA 5I75B 4ZPVB 4N0UE 4XB7A 1TENA 1TVBA 2PYFB 4QUOA 4M7LL 1BFVH 1CS6A 5EFIA 3GGWB 2WN2A 3D08A 4C4BA 3IMTA 4F33A 2ZX9A 5A1AA 1CT8A 1QI3A 2X1QA 3GSRB 3Q6FB 3E7JA 4B97A 5BV7C 1KOAA 2CXGA 3DSFH 4DUXA 3EYSL 4MB3A 4AYFA 1DR9A 1HL8A 3FL7A 4E9VA 1NGXA 1PZUB 1LP9A 1IM3A 2P5WE 1UH3A 1YLBB 1O9ZA 1U8PA 4FG6D 4WFGD 3TIDB 3WI9A 3RWIB 3B7SA 2JCCE 3BE1L 1FZJA 4ENEC 3HFFA 1YEHL 2BNRD 4FQ2H 3GMPA 3RGVB 2VLRA 3QJFB 4KKAC 1VENA 4R97C 2XWZA 4S1RH 2VQTA 4PLKC 4HUXA 1HHJA 4ERSL 5D2NE 2XN2A 5F1IB 3CZUB 4LLWA 2UWEF 4RGMB 2BIHA 2VXSH 4KHXH 4NO3B 2BSCA 1N2RB 3VFUB 4AYEC 1CFTB 4OGYH 1KTDB 4JO4H 2FO4A 1UJ3A 2AQ1A 3APFA 4TLTA 2F5AH 3V0FA 3ARFB 1MQKH 1AKPA 4BQCA 1BCIA 2XV3A 2PCPA 4MA7L 4OZHB 3MV9D 4MHHI 3FRUB 3QQDB 3MOBL 1JPFB 1EFXB 1EHLH 4YLCA 3LRLA 1E43A 1RKRA 1U8KB 4PRPA 3LZNA 2CM6A 2FBJH 3WL9B 1CVSC 2COQA 1TZGL 2LW3A 1FBIL 2KDGA 1M05A 3X1BA 3QJHA 4YR6A 4XH2A 5EZPA 4YBLC 4PRBB 1ZWIB 1CG9B 1YEKL 4X50A 1ZLVK 1HINH 5KYYA 5DSCA 4YWGH 1ES0A 3RI5K 4KNTA 4QRAA 1M7IA 5FYLD 4E0RA 4PUBH 1MFAH 4HAKA 3QQ3A 2CDFB 2NR6C 3DX4A 5F96H 4Y4KD 5MEQA 2IGFH 2EDMA 2P44B 2WVVA 3FFCB 3ZHFA 1ZEAL 4LEOB 3P3YA 2ZYRA 5BUGA 4IKKA 2R0KL 2YSSB 1G1KA 3C6LD 1R19A 4AZ8A 5CJOH 3GI8L 2A9CA 2YN5A 3OLEA 1RUPH 4DO4A 1KN4L 5DHEA 4M5YH 5LNEA 2BM3A 1BVLA 1WZAA 3NIFB 3GBML 2ZCKL 4BSVA 1VGKA 1YQ2A 2Y69B 5EBWB 2VZUA 1TZHA 2WVSA 4MQTB 2YBGA 2NX5D 5C0AB 3W9EA 4NQVA 3JSSA 3DO3A 4P8QA 3BP7A 1HZLA 4TSCL 3L2NA 3U4BL 1KGIA 4AM0Q 1L0YA 1U8OA 4D0CA 1M42A 3IDJA 2B9BA 1HH6B 1V7NL 3M7FB 2V9RA 3QNXA 3U30C 5H94B 1WE5A 5I8OL 3QFDB 2J5WA 3D30A 4MA1B 4XHJD 4ONFL 3UP1A 3G7TA 4JY5H 4Y88A 3QHFH 3HHMA 4OCSL 4NBZB 1T7WA 3U9PL 4PWHA 1LTXA 5D7IE 3VYPA 2OKMA 3TESA 3FTSA 1B0WA 2AXGA 4WWKD 1ZTXL 4F20A 3WEOA 3MUZ1 4P46D 5LGYA 2A4ZA 5ISZB 2L4OA 4NXSA 1F0LA 4HPHA 1WFJA 1CYGA 3OKKA 4HSAC 2HJFA 5D1XC 2X4PA 1A6UL 4AQ1C 5E95B 2OL3B 1U8MB 3LH8A 3BGAA 2FYVA 5HGDA 3UC2A 2MQGA 1NFKA 4R7XA 4NO2A 2VC2B 1LEIB 3B9KD 3QFGA 4PP2A 3FONB 5BOZG 3C08L 3FPYA 5ICXB 5FA3A 1LQSR 2BJML 1G84A 4LIQL 4I3RH 2DJUA 4LGSB 4FRWA 4YFDB 5AVSB 2GIXA 2R69A 1F4HA 2XWBB 2CRZA 2R8SL 4BFIB 1S3KH 4XP9H 3I6LE 4IYKA 4JM2B 1DVZA 1NMCB 3F7VA 1OSEA 3ZGIA 1E7VA 2VDKH 1KIPB 1ILUA 1NBZA 3FSAA 4LCWD 4XO8A 4IJ3B 3UO1L 1A2YB 3HHRB 3C8KA 3DNKA 3KPLB 1A3RH 2HT4D 3CK0H 1AHMA 3FUDA 4KOCA 3BDYH 2VDLB 2NCEA 1N4XL 1DQDL 1B4JL 2PWHA 1HKFA 5KSAC 3WHE0 2Q6WA 3VDBA 5GISH 4QY8A 5T5NF 2A38A 1C5CL 5IBLD 1QO3A 4MNQA 1F90H 3RIFK 3ZZQA 1JF1A 1X5AA 2X0VA 3VCLB 4P2RD 1QFWI 1H3UA 1PDKB 4G7VH 2AVGA 5A2JH 3UTTA 4JO1L 1LL1A 1F3RB 4ZMVA 3ABZA 3HS9A 1A6AA 4CRPA 4TQEL 5LWYL 3QWOA 4QRRB 4GUOA 1J9CT 3P11L 3U0PA 1SXNA 1AJ7L 3HKZA 4HHAA 3ZR6A 1H6UA 5AYTA 2Z1KA 4Z9KB 3TBSB 1UWGH 5MEPA 2JKIS 5FGSA 2WXJA 4JVUA 3ZPDA 3I6GB 3V5DA 1MREH 4WHYH 5D5MF 5C3IA 1OP5H 1OB1B 2GBTA 4KFZC 4UQ2A 5EEVA 3VFSB 1WUNT 4F57L 1J8HA 3AGWA 2NY4B 1A4AA 2IAMA 5M94B 1LP9E 5FV1L 2ENSA 4CW1A 1MFEH 2BFVL 1CGSL 4UIKL 4EUPA 1OSYA 1YUKB 3EOAA 4OLWH 5IVXA 4ZS6C 5F3HB 2N7AA 1A4JB 3IF1B 4L3CA 4QRUA 5CCJA 4E68A 4WO4C 5CILH 1P1ZA 2X7LB 2A6KB 4ZXBA 4TVPH 5CIPH 1VFOA 2HVKB 1S7TB 2VL5B 4MKTA 4HIQA 4NOFA 2ZUXA 4WI3A 4TUJA 4W9KC 1NUNB 2OMZB 3N91A 4ES8A 3ES6A 3JTTA 4WNQB 5DZAA 4U1KA 1GGBH 3TPUA 2W9EL 2WMPB 2OMUB 3ZYOA 1CYXA 3S3CB 1BX2A 3MNZB 3UAFA 4I48B 3DVNA 2EILB 4FEMA 4PVBA 3SDDA 1J9SA 5JYLA 1SLXA 3GMMA 1E5BA 4Y4FA 4EAEA 4OKVA 5HYEA 4KY2A 3BPOB 2C7UB 3WEXA 5D7SH 1CVRA 2FSEB 5J3HD 1COBA 5IBTH 1LO0L 1J87A 3QUGA 2HFEB 2XG5B 2KL6A 3L3KB 5KYUA 3ORJA 1U8QB 1JF5A 1ND0A 2IV9A 2YR3A 1WFTA 2VKWA 3LIZH 2ED7A 3FRPG 4MVBD 1JFQL 5DRZA 3UTQB 3NPSB 3VGEA 2EVFA 1HWWA 3I74A 4ZUWB 4OZHF 1U3HD 3U6RA 1S46A 2BVOB 4U3XA 3SKMB 3ZKMD 4PJXF 2GY5A 4IM8A 4GEJA 2UY7A 5DJCB 1N64H 1W16A 2QHLA 2VABA 3BN9D 1SUHA 5LGHH 3KL0A 3MACL 4WFGE 4OLVH 2GSGB 3IFNL 1NMAH 4QRBA 2EADA 3N43B 1LE5A 2XNAB 1Q9KB 3BLKA 3HN5A 2J3SA 3O9WD 4ZFGH 1KN2L 1UZ8A 4DGIH 4WK0B 2BS8A 4JDTH 5T1LD 5GRZA 4GXVH 5INDA 3HC2A 4AV5A 3RNQB 5DJ6A 2ZSVB 4LGPB 3QDAA 1EA9C 2R27A 3Q44A 5DQDL 3SQBB 1ZHKB 2WBKA 4F80A 1K4CB 1EZVY 5DK3A 2XOTA 4U2ZA 1WH0A 4NENA 1D5MB 1QBML 4CC4A 1W0YT 3ABLB 5KSBB 4K2UL 4Z7IA 1IFHL 2DLGA 1E9OB 4MJIB 5JHLL 1GOGA 4PJHA 4MMZB 1H15A 2VWEC 1I1RA 1I7TB 1QAWA 3F58L 3NIFF 3P4NA 4NQDB 5I17A 1T22B 3OSKA 4MBOA 1UVQA 3PDOB 1U41A 2X4UA 2XA8H 3EJZD 4R2GB 4C57C 4IHOB 1PNCA 2R0ZL 5GGRB 4FLRA 3SGKC 4GBXC 4D8PB 3TBYB 5ECGA 1IAKA 5I0DA 2DQDL 4O2EA 4JBSA 1UASA 4XR8C 4L48A 1ZT1B 5FYLE 1KTLA 3IJYA 3N55A 1I7RB 2V5RA 5AW8B 2WXPA 5C7ZA 5JW3H 5DJZB 2XICA 3JV0A 1IM9A 3QFJE 1ZHNB 2R56L 1XTMA 1SJVA 5HDOA 1YN7B 1G9EA 4MD0A 1LO2L 2A6JA 2VDMH 1CFNB 5MERA 3X12B 1CE6B 4Q6YA 2G4EA 5I1EH 1EEZA 1QRNB 2BHFA 1DJXA 3ZLQC 3CXFA 1URIA 3FUMA 3B5HA 1ACCA 3ARBC 5EBMA 3X14B 1KCSL 1BMWA 3PP3H 3IDIA 2NX5E 4WF7A 3TA4D 3ML8A 5TPWL 4OF7A 4I1PA 4X4MA 3VI4F 2BP0B 1S7SB 2FX9H 1YNTF 1CU4H 3IBOA 4PTUA 4NO0D 2F54D 1NAKH 3W56A 4E41D 1NICA 2ZXAA 1WV7T 3MCKB 3FPXA 1PPIA 3G6DH 3VXNB 1O7VA 1Q9LB 4Y5XB 3ARRA 4XP4L 2E59A 1E3ZA 3F6LA 4IQHA 2E3VA 4EI5A 3GLAA 4YHNA 2WINA 3HMXL 4G7YH 4JM2F 4NB7A 5EEUA 3UCRA 1BOGB 1X5YA 3EJSA 5GRJL 2FH8A 1GMIA 3HUJA 3ARTA 4OH2A 4P5TD 5IF0B 3BEWA 4GO9A 2SODB 2PWFA 4N6QA 5D1ZB 2MCPL 1AD0A 4IS6B 2CPUA 3EHBB 3SJVE 2NXYB 4ZPTA 5FKPA 4WV1A 2XWXA 4I9WD 3QO0B 2OL3L 2FX7H 4XNXH 3D0LB 2OA9A 3KG5A 2W60A 2EABA 1OD7A 2VC2L 3MOAL 2CO7B 1B2WH 2FZ3B 4XCFL 1QR4A 3M8OL 1A65A 4LB8A 4TOYH 3QUXB 2NY3D 4APQA 2IFFL 1DEEB 3CVHA 4LNRA 5F89B 4KQ3H 3IGAB 5IV2B 1D3CA 3DVGA 2Z65C 4Y1TA 5GPRA 4ALAH 1BBDL 4DCQA 4UQ3B 5L4FA 5E1AA 1KCRL 1KBVA 1MCBA 4HJGA 3L1EA 4QWWC 3C12A 5JQ6L 1OGAE 3I6SA 2Y2TA 4BH8A 5DMKB 2ZCZA 1UA6L 4LASL 2CKNA 5ANMA 2I60H 4OLXH 3H4FA 4PJEA 1YEGL 1QBAA 3LV3B 2PF6A 1RCYA 2Z92B 3SDAB 4M7JL 2G2PA 1V8HA 2BWQA 4IDJH 2OULB 3QWRD 4P5MA 5KVDE 1J5IA 5IB4A 2J88L 3H9HB 5L4MA 5B1KA 1CXLA 2ALWA 3SKOA 3MLSH 2HG5B 2Q86B 4G6MH 2VDNL 2F7PA 4WWOA 5IB3A 3TH4T 4DQOL 4R7DB 3DC0A 3U46B 3WLWC 4HH9A 4ZMQA 5LB1A 1JBJA 1Q0YH 4UIMB 3DOHA 2M1KA 4FQ1L 3BZFB 2ED9A 3A6CL 4IBSA 1E6OL 4Q0XH 3HZMA 2MIZA 4Y5YC 3TTYA 1NFDB 3GT6A 2H32B 1XIWD 4S1DD 4I2XA 4ZAKC 2IF7A 5SWSB 4CSPA 4UMSA 1QSZA 2E5EA 3OKNA 3C09B 1SDAB 3AUVA 5JR1L 2VE6B 4YVUA 1OP5K 2MNWA 2UX7A 1J18A 3FQUA 1MCDA 4F9LC 1AFVH 1QFOA 4Z7QE 4NAQA 3WLBB 4BV1A 3W82A 3HC3H 4V1DB 3VX0A 5D1QE 3RDTD 4PJ9B 1CFVL 3L1FA 5EU4A 5IOKA 2OXHB 1FJ1B 1VLXA 1KB5H 4YXHL 4LHQB 4N8VA 1KEGL 1JNHB 2IBGA 3VWJC 4FD0A 3HZ3A 1GSKA 3GXNA 2AJXL 4YDVA 2Z3FA 1M7XA 2VT0A 4KPHH 5AVRB 5ABZA 4HKZB 4ZDHA 2FL5B 3UCQA 4MXVE 2BVPA 4NZFA 2X1PA 5C7XH 4KJQD 3TU6A 3N43F 4XC3L 3EGDB 2P45B 4D9QD 1F6LL 3NJLA 5D8JH 5C0CB 2BVEA 3ETTA 1QRKA 4K5MA 2BOBA 4N6RA 4WU5B 3MNDA 1ACYH 2P7TB 5SV3A 4XCYA 4LRNH 4IBUA 3MX0A 2YO3A 4TQIA 4D0BA 3L81A 5CAYB 4E9LA 1NMBL 2H6PA 5ABAA 1NIDA 5DHDA 2YAEA 2O6EA 5FCUH 1FNGB 4HMEA 1FV1B 4B27A 4X8JA 2Z8SA 1TITA 3SY6A 1OP9A 2P48B 2YPLD 4ZFOB 2WBJD 5LN8A 5EU3B 4N1CA 2EEFA 5CCHE 3EBGA 5H8DA 2D0GA 4NQCA 4NM4L 5C09B 1VKXB 2NY5L 2H41A 4UV7L 1J5CA 1ED3B 2EE3A 2JXMA 1OVZA 3SGJC 2GW5A 3OF6D 5E99H 1M57B 1FGNH 1ID5I 4LEBA 3HS0A 1OQOA 5E2WH 3S4SA 2J57A 4OLEA 4Y9CA 1U8LB 2OJEB 3VGBA 1KTJA 2DBLH 5J11C 4OQTA 3QXAB 2BP5M 2CGZA 4WENB 2AJUL 4KVCH 4ETQB 3MLRL 4JFQA 1UB6B 5T3ZD 3I9GL 3U0WH 4XHQA 5FS5A 1OAQL 4KK9D 5J06A 4BHUA 4FADA 3CSYB 3HJEA 1MFBH 4Z8FL 1BAWA 5J12B 3TN0B 1U58B 4LLMA 2Y1AA 1TKWB 5HGHB 2BHZA 1EVTC 3KCWA 2LLNA 1I8IA 2DKMA 2XN9A 3ARSA 2B15A 1HEZB 1BZ8A 1FO0A 1L9PA 3L9RB 3QG7L 1IAIM 1R3HB 3NDYE 4H44C 4N2GA 2YEZB 4UTBL 1N10A 4CVWA 1PZDA 1DJSA 2WUBL 4M1GH 1ESOA 3EUUA 4E9TA 1E8XA 4N2LA 2LGNA 5DEGA 4G6KH 3L95B 2WNKA 4L5FL 2DTMH 2HT3C 4U3SB 4A2LA 5LAXA 3KM1A 5GS0H 5HPMA 1HWHB 3ARDC 2GTWA 5A16A 4WKZB 4TNWF 4FI6A 1USQA 5D71L 1RMFH 5F0MB 3FCSA 4UMGA 3SKNB 1XGTA 1H3GA 5KVEE 4UI2A 5HYFA 2BY0A 1NBVL 3O6KL 3V0JA 5GS3A 4NT6A 1I1AC 3BH9B 3QEHA 5FGCE 3TA3D 3X13B 3UAAA 5EORH 4FL4B 3TO4B 2ESVE 1BZEA 3KEHA 2LTQC 3LNGA 4BFGA 2I9LB 2BWIA 2NY7L 5FUZH 1D5RA 2GK2A 4F8QA 4MAUL 3DO7B 4DW2L 4O02L 5JDSA 5HYQA 3OLDA 3QNZB 3T2NH 2F8XC 3MUY1 4O4YH 2RH0A 4PCYA 2PKDA 4PWKA 4G71B 3BGMB 2HJKB 4NWTL 2XTJD 1A3LH 5ITBH 3WJMB 3UEZA 3H7BA 2LABA 4WUUD 5JHDD 4H25B 3A4EA 4D9LL 5E8DH 2RFXB 4HUVB 3FQXB 4JO2H 4X5PA 2R1WA 1ORQB 1T4KB 4RMSA 3PP3K 1JCKA 3LNFA 3SBPA 3NACH 1UURA 3U2SB 4D0DA 5SV4A 5L6YL 2F54E 4E41E 1TPXC 2N1TE 4G8IB 1F1DA 1O7SA 3MR9A 4ZD3L 1AQHA 4PM1A 2AXFA 3CC5A 3QPQD 1MCLA 1U0QA 4BUHA 1UXLA 2Y7SA 4YEEA 3MV7A 3INOA 2JE8A 3KYAA 4ZW5A 4P5SA 2HFTA 3QUZD 3LH2L 5LBSA 5IEKB 1F6FB 5EOQH 1CFQB 1VRSA 1E9QB 1UD8A 3RVUC 4J1UB 1M3JA 1M6OA 3BX7C 1I9JH 2CIKB 2OYMA 4U6TA 1N26A 4HHWA 3H9SA 2WD0A 2EIMB 5E6ID 1LWJA 1RZ8A 1W0VA 3L3HB 4UM8B 5SX4I 3WIHH 1RHHA 3L3IB 2HVJB 1GYUA 4UM9D 4PLJD 4I9WE 3P4OB 3O8XC 3JZ7A 2DYSB 1BSIA 2E4TA 3ULVF 5FYJL 3U2IA 1H5BA 3UZVB 3L3DA 2ZWZA 1LNUA 2ZUSA 1C5BH 2Q8AL 3ROLA 4DP2X 1UOVA 2V5MA 3LEYH 5AZEL 4OLUL 4Q9BA 2A5UA 5F44A 1IARB 4AMKH 4YDNA 2C7FA 1YPZB 1YNLH 3P54A 4JG0L 4ZUUA 1GIGL 2F6AA 1A1NA 1OTUC 1ORSB 4NKDA 2GJJA 3LVTA 4XZ4A 3VTTA 3UJTL 1DSFL 4KQ4H 5DQJA 2PWGA 2QL1A 1IT9H 1T5WB 2V8MA 3C9NA 4JY6B 4NGHL 4WZ9A 2IH3A 4PJDA 1NFDF 2DMCA 4RRPM 3UZQA 4RMUA 4ZNEA 3O3DA 1FE8H 3EFFB 1HQRB 1ZLDA 2DJSA 4XP5L 2AMGA 1P4IH 3QRGH 3HE7D 1AYRA 4FNRA 2X05A 2J8OA 1EXGA 1DO5A 3UTOA 1WZ1L 2BC4B 5HHPB 3ULVL 3BVDB 1XV8A 4OJCA 2JB6A 4HX1B 5E4EB 5JW4Q 5IQ7H 3K6FA 2HLFD 2VM3A 1EO7A 1CLYL 4ODUA 1IAIH 5DMJB 3LKOA 4YLBA 4IBQA 4X5QA 4QLRA 2H2SC 1GGUA 3EYOB 4JZJC 4W4OC 3DJSA 3LXAA 1F4YH 2WV3A 2X53A 3D07A 4XMWA 2CPCA 2VZ3A 2ATKB 2DLEA 5IK3A 3P2BA 4KUZH 4ZUVB 1IGMH 3MROB 1OB0A 3LD8B 2F7RA 1JGLL 1P84K 5AYUL 3VI3B 2G2NA 2I85A 2Y7NA 4J23A 4QHNB 1QKZL 2BVTA 4PRID 1FH5L 5F9JA 1GTNA 2FYYB 2IV8A 4XVUD 3WSQL 5LQBL 1UZ6F 4X99B 3W3BA 4LLYA 3JWDL 3FF7A 1PY0A 2EXWD 1MSPA 3ISWA 4N0UB 3TWCH 4E9YA 2Y3NA 4BCXA 1TZAA 4XZUB 5I6LA 1LDPH 5B8CA 4ABQA 3GJFB 4TM9A 3SZ6A 3ZE2E 2VXTH 3CHQA 2QFRA 7FABL 1MQ8A 3B3BA 1NM9A 1TJHL 1GGYA 4YGAB 1WC7A 2MPAH 1LK3H 4XMVA 2P5WB 1A3QA 1EBAA 3RVWD 4HXBH 3QUML 5A2FA 5E5LA 2WP3O 4XAWL 3EGSA 4L2LA 5DWPA 4TVPD 1C16B 1AGBB 5TTRA 3T4AA 2JCCB 5AZUA 3TT3H 4GKSA 3VTMA 2E7LC 3QPXH 1X5JA 2EC9T 5B39B 3PHOB 1BXVA 2GAZB 4ZMAT 3MJ7B 4NAMA 3IJSA 2AJZA 3FQ4A 3SD5A 4B9ZA 5D2NB 3NH7L 4L8DA 3QXVA 4OIBA 2FD6L 1QFWM 2H1XA 3EZJB 3OKOA 5AL0A 5LXGH 1QVOA 4U4IA 1NCJA 3JVFC 3ATAA 4AT6A 5TFSH 1CICB 1SHXA 4NZTH 3U4EA 4OFYD 4QYAA 1IBFA 4GIPD 1U33A 4FXKB 2X70B 5CSBA 3VU1A 2OMYA 4DUVA 4P5RA 4DUWA 4OZIB 2VDQB 4ZFOL 1WP6A 1FC2D 4FQXA 2XWCA 2HLEB 2VISA 5C0RH 1TZ8A 2YPLE 3U7AA 2A83B 1GGTA 2KZWA 2Z35A 5F1NA 3TZVB 1VADA 2FJFA 3BQUA 5AWNH 5IG7A 1WITA 5KSUA 1MPAH 3MRKB 1KPUA 3C2AH 5EUOB 5FECA 1BQKA 4JFXB 3NA4A 4LSTH 3VXRA 1NGQH 1IGCH 3L7EA 2D31A 4HFWA 4FNTA 3KH4A 3CVCA 3GRWH 4HUWB 4BM7A 4C56B 5JPNA 3AREA 1UATA 5HJ3B 3OPUA 4K23H 2HT2D 2HZHA 1ZPUA 1F41A 2DYPD 2PW2B 1UENA 25C8L 4PLOB 3ASOB 2XKNB 1JPSL 4PG9B 5CIPA 3WE6B 1PZAA 4QRTA 1TMQA 1Q9WB 4XMLL 3H56A 4GRMB 4KXAA 1FDLH 3O41A 4P07A 1X44A 4IRSA 4C4UA 2AW2A 3P3TA 4FFZA 3THML 4BINA 5I1AB 2B1HH 4K5LA 3C5SA 4LCIL 4UWQB 1B0RA 1EXUB 4JK0D 3T0ED 3OQ3B 3B9VA 3GK8H 2A74C 4K8RL 2FR4A 4BKTC 3NK3A 1BMGA 1AACA 3OWEA 1KZQA 4XE0A 4B9GA 3AG2B 2EKSB 5IMOA 4HGWB 4DPRA 4XO5A 4NRZB 3A6BH 2HMIC 4MDJA 4JM4H 1Q8MA 5E0QA 3FB5B 2WNXA 2PXYB 2A77L 1WPCA 1HHKA 1JK8B 1S7UA 3WO4B 3OTTA 4H1LH 2CGRL 4POZD 5JW5A 1GHFL 1U8CB 2K0RA 3FB7B 3HB3D 1Q94B 1N0XL 1G9ML 1TQWA 4LAQH 2XRAH 4P04A 3FHEA 5LCVA 4A6YH 3VXSA 1YEJH 4X6BA 4GAAA 1D5BB 1RJZA 2IPKA 2XXFA 3IETA 4UCFA 4IKNA 3W0WB 1NEUA 4LHUD 1K3ZA 2B1AL 3GUTB 3G5YA 3FKUS 1MZZA 1ITCA 5D7IB 2B59B 1AG0A 2V9UA 2VZOA 2DMKA 3ROOA 3ZE1E 1Y6KR 3M7OA 5I73C 3IS1X 1UTDA 4HLZG 2DWXA 2Y72A 1K6QL 3ZTNL 2J72A 3I50L 3NFPB 4R0LB 3KLAB 4B3VA 2VOTA 2FX8H 2XTJE 5I28A 4G6FD 1F58L 4PV8B 4WUUE 5IT2L 5JHDE 2NDGA 1KXTA 1R3JA 4KHTH 4XOEA 5I8CA 3V7MA 2F1EA 2BZDA 1FPTL 1V7ML 1XZ0A 5C2BH 5MP6L 1T1XA 4HETA 4IU2B 4MYWB 3U0TA 1E4JA 4F58H 3KPMB 1A02N 1IB5A 1G7IA 1WBXB 5CP7A 3CMOH 1WTLA 1KLGA 5KAQF 1YPZF 4NKIL 1G9NL 3RWHA 1J1OH 2Y6SD 5DEFB 3ZDZF 1NFAA 2ZSWB 1QFWH 4BFJA 1L0QA 3D25A 1NA8A 2J12B 4PRDA 3GXUB 3KWUA 2BNQB 3UAJC 3VFTB 2ICEA 4WHYG 3O6MH 2V4LA 4HC1L 1UHVA 2CE6A 1XGYL 4G80A 2WZ0A 2X9ZA 2WYHA 4BQ6A 3B9EA 4XVJH 2XZZA 5HHXH 4HWZB 1N0LB 5ETUB 4OF3A 1ZVHA 5I1GL 2A4EA 2C3VB 3SODB 1CDBA 3T2OA 8FABB 2V7HA 2X44D 1UWEH 3SGDH 3UBXA 1QLFA 5CBEA 2QGBA 1KNOA 3L13A 1CIUA 4XTRD 3WIIL 1ANUA 2XZQH 5TGBA 2J5LC 3UYRH 2R2CA 3BSZL 3QIBA 4XXDA 4J28A 5CINL 5IVOA 5C0DA 5TE4H 3D2UB 4MA8L 5F88B 4AIZB 4AVHA 1GYWA 4Z76A 5GZNA 4Z7NF 3LZRA 3OMIB 1XF3A 1YDPA 1OTSC 2CKBB 3T2LA 3D39D 3MZGB 2XZAH 4L8BB 4YBQD 2CNZA 1T3FA 2VH5H 3SE3C 3S96A 4YQXL 3MGTB 3VI3F 1N3NA 2OW6A 5CP3H 4TS6A 3VXPB 4B9JA 4CA4A 2V17L 3H3PL 2IXQA 1DUZB 4XNZB 2YWZA 3QXDB 5EO9A 4PJ8D 5GHWL 5L88H 2QSCH 1LM8V 1FC1A 3MJ9L 1ODUA 3IWUA 4S2SB 1UJTA 4ZX5A 1Z9OA 2NY5C 4PJ5A 4N0YH 3QR2A 4OUUB 5FYKH 5C9JB 2Z4QB 5CO1A 1CK0L 1ET8A 1KIQA 3PWUA 1YMHB 3BPNC 3QEQA 4E2OA 4KTEH 2GJPA 3MJ8B 3BPLC 5PCYA 3HE6B 2CR0A 1G43A 4XO4A 3PP4H 4XC1L 1MFVA 5G4MA 2PO6A 1C7TA 3P3SA 4YC2B 4YHML 3FBQA 5J8OA 4YIQA 2EQDA 3LZPA 2IH9A 2JCCF 2VDRH 1EJ8A 3IJ7A 2D3VA 2VR8A 3AMKA 2Z31A 1A6TA 3IT8D 4JGMA 2DH2A 5D70L 3MCG1 2LT9A 3QIWA 3T0XA 3BH8A 3QQ9C 3KS0H 2DD8L 1ODAA 4URKA 3QVAA 3QIUA 4CAGA 2R2BA 5IQ9B 4EN3B 3O6FB 3F05A 2EH7L 3FTGA 3JWNC 4OZFH 1AXSB 3EYUH 1JNLL 2R1YB 2YA0A 1A1MA 4DP5X 5I9QB 1RZPA 4KDWA 1OCZB 2YD1A 4PY7B 3WYRA 2ICCA 4MJ5A 2OZNA 1QACA 1V05A 1S2EA 4LPTA 1J05B 4JB9L 4LCCC 4ZMTA 4X0KB 2DH3A 1YMMA 2DLTA 5TF1H 5EIQA 3D7PA 4ORGA 2DQGL 5LKNA 2ZJSH 1BAFH 3U48A 1G7HB 1U3NA 4TVPE 5B7EA 3OR6B 4DTGH 5MENE 3TEYA 15C8L 5B38G 1UT9A 2Q0ZX 3P3UA 1M7DA 2BNRB 1HX0A 5FCSH 1U8HA 4Y1AA 5KS9A 3T3MF 4LF3A 1ZLSH 4GRLD 2AI0H 1I9RH 3BFWA 1SJHB 1LO3H 3GBNH 2G4GA 3GO1H 1Z5LB 2WLIB 3G6AB 3ME0A 4FQIL 1WSST 2MQ0A 4OT1L 4ODBD 5HP5A 2WCGA 1ZIAA 2GBAA 4F9PC 3UG5A 2A3TA 1QUNA 3MGOB 4HXAL 4LHUG 1H6FA 1I85C 3B43A 5ERWA 3KPPA 2CHNA 4J3OD 4ZOBA 1JGDB 5L2KD 2QVFB 2VDQL 2PTVA 3BDXA 5CFAA 4ISVB 4X9BA 1OCWL 4HS8H 3NCYS 4PGCA 1T7YA 5GRUH 4AQEA 1AIFB 3EO0B 3DOIA 5FHAL 1J0IA 3LXCA 5KBKA 4Q89A 2DS4A 4UNIA 2XXGA 1SDYA 4DGYH 3G9AB 2I26N 2IWEA 5I8EA 4R3SB 1QBLL 1ZSDB 3MI6A 3HPJA 4HS3A 1KB5A 4P2OA 5G2NA 4NDMB 4MD5B 2GITB 1O9VA 1SJEB 2XYCA 1DANU 2XV6B 3TYFA 4Y4KB 2OXGB 4S1SH 4YPJA 1NDMA 4X6EA 5D1ZC 4BSWB 3EHBC 5IIEB 4I89A 4Q6IC 3VG9C 5FV2A 3CFBA 2UZYA 1QYGH 4IMKC 2FHCA 3CBKB 2R29A 3FRPB 5K69A 3D2TA 3WTYA 5IW6A 2BIQA 2IO5A 4U1MB 2NUPA 2FWLB 3QUYD 3T0EE 1OSZA 1QLRA 2D7QA 4M6AA 5J6GB 2AJSL 4L0ZA 4BJLA 1UA7A 3QUXC 1DBAL 3MLTA 2VQ1A 1R34A 1NCBL 1JS4A 1F42A 3K8KA 2NX5B 5D55A 3PF2A 2NW2A 2WZAA 1OARL 3KR3H 5F7EH 2O6PA 1KJVB 3IM1A 4BKLA 3GFUA 5GS0D 5ACLA 4L2YA 4HG4J 2CD0A 4CSSA 1T83A 3QPKA 1KIUA 1TEYA 2WM0A 3EG9B 2UUDH 3TNNB 4BWWA 1MCRA 1M53A 4MJ4A 3SDXA 4JKPL 1A8JH 4XPTL 3ZDYE 5G5DA 1SM3L 3G08A 1L9OA 1CZ8L 2F5BH 4N87A 2V8LA 4ETYA 4L8SB 5GS1A 4RFEB 1EANA 5AD0B 3ULVC 2WLYA 3GXDA 3KE0A 1FORH 5AOZA 4Z23A 1OOWA 1P7KB 4WWKB 3PG2A 1CXIA 1U8JB 2IOMA 3SJVB 4PV9A 2ZX8A 4RAUB 5IHWA 1RZKC 3BFOA 4P46B 3BKYH 4UB0L 5K9OA 3OC5A 2APFA 2VCOA 2Z64C 2Y22A 3BMVA 4HG4K 5F7HA 1MVFA 3QORA 5ACZA 1OALA 4M5ZH 4PBVC 3WXVH 1HKLH 5FDWB 2X6BA 4ACPA 3PHQB 3F7KA 4XMPH 4JHBA 2O5YH 4GAFB 1SVBA 4LXFA 3B9KB 4I4WB 3LN4B 4XCCL 5DDHA 2D0HA 1MW0A 4G8GE 1EHAA 4PJCA 1ZA6A 4AYDC 4MNHB 5DUMH 5EOCH 4YAQA 3H54A 3JWDC 4JPVH 1FZMB 1IC5L 4DAGL 4KDTA 3MJGX 3G6JF 5I15H 2AJ3B 4OV5A 3CLFH 1I8UA 2ARJA 1E5AA 4W81A 3V95A 4XVSH 1NGZA 5AVWB 2YFNA 1MRCL 4LK4A 5AAPA 2IDCA 4AXWA 1TG8A 1W72B 1OGAB 1F56A 4PJ9C 1EBPA 3APNA 3D87B 3R19A 3J07A 5F8QC 3CQFA 3NIDE 2ATPA 4GW4B 1LP9F 4YXLH 2R7EB 4PMFA 4LBEB 1GC1H 2HP4A 5C0IB 2WWKO 2WXHA 4UQBA 4Y5VC 4IGBD 4P2RB 4OLZL 4MJHA 4W9ZA 4NO5A 5T1DL 3I3EA 1G5AA 5CGTA 1OCCB 1NJ9A 3LQAL 2JB5H 4TRPH 4IEFA 3AS3A 5H37H 4DVBB 1AZNA 1M56B 1P1VA 4P9HL 3HG1D 5FAAA 5DFVC 1KJ3H 3WHE1 1KTBA 3QAZB 2NSQA 2CKBL 2W5PA 1Z66A 3OAUL 2QFPA 1T5XB 3NJJA 5AVQB 5IFJB 4KXZI 1SY6A 3UTSD 4AVJA 3TH2T 4AQAB 4XCEB 1XR9A 2BINA 1C8QA 2ITCA 1FVCA 1WBYB 1UUNA 4UTAA 3TOPA 4KTYA 3R4DA 1HXYA 4P4RB 2ISDA 3VX1A 3KYNB 1P69B 4L37A 3QZWB 4GKNA 1PZ5A 4EXPX 2CCLA 3BP4A 2WN3A 5EA0L 2PWEA 3OZ9H 3V10A 3GS4A 4Z7QB 2DAVA 4MCZB 4YHIB 3UTTD 1Z32X 5CKAA 4K5PA 5HHVL 5D1QB 2B14A 2WXFA 4KMLB 3EH4B 4L3AA 2ZUUA 1FRGL 3LS5L 4IRJC 4J3OG 1S5HB 1KEML 3LDBB 3UH8A 3RTQC 1NCOA 3F83A 4WEBH 3LS4H 2CDGB 5EPMA 4ANVA 3TPKA 1T1ZB 3IFLL 2DYRB 3TC9A 1ZK5A 2W88A 4B9KC 1D6EA 2OJZL 1TQBB 3DGGA 2K9FB 2ZXCA 3HNSH 4E9SA 2ZCHH 1OL0A 1WT5C 3J27A 1Q4NX 1ZCRA 4Y2DA 2HJLA 4M9OA 3T04D 4RESB 3TN0C 5IP4A 3IB4A 4YHZH 4WEEA 3Q43A 4JHWL 4ZX4A 3I9IA 5F6HI 2ZWKA 3WY4A 4NOBA 3VRIB 4LKXA 4DIXA 5ABDE 3DRQB 3KYKL 5L7XL 2E7BA 2WCPA 1MY7A 8PAZA 1TTBA 4M6NH 5DMGD 3E80A 3V52L 2H0PA 5EU7E 2IG2H 3IXAA 1RPUA 2XY1A 1M1XA 4AKOA 3F7RA 3O3EA 1G9MC 1U3HB 3HAEG 1YEEL 2P52A 1I7ZB 1PG7L 4U3CA 3C5ZA 4FLQA 3KNBA 2VW7A 3TEUA 4ODHH 5IROA 1XAUA 4RMTA 5INCB 3RJOA 2HSIA 4XT1C 1EAPB 4PB0H 4XN5A 3O9WB 1BOYA 4JREC 4CMMA 3LNDA 2KPNA 2XYBA 4GKLA 1IC7H 4PJBB 5DJ0B 5T1LB 3MRGB 3L1OH 2Y4SA 4LLUB 4HK0A 1TSRA 3V0IA 2EECA 2J8UA 4WHCA 1AZRA 2OSLA 5BXFA 3IPBA 3E2HC 1F13A 5F6IC 3VFRA 3IXTB 3NP4A 1NCHA 4FG2A 3U7WL 4OJEH 4NSKA 2FLRT 2WIIB 1UXMA 2B7DT 2JQAA 4H0LC 5L2KE 2VJ0A 4GO8A 4MDRA 2G5BB 4QTFA 3UTZB 4DEPC 5J89A 3AXLB 4U6HB 4X8CA 1OPGH 5DFAA 2NT0A 3VRLE 3CG8A 2DMBA 4HIJB 4YFEA 1WK0A 4QXVA 1P7QA 4KKPA 3T2QA 1D5XB 1BYPA 1CDCA 4M7ZC 2UY6B 2BHYA 4KRLB 3NTCL 2IDUA 5DGRA 4YX2L 3RA7L 5FYLL 2H0EA 4Z3TA 4FJZA 1C08B 3V4UL 1RULL 3P4LA 5A43C 4WTWA 5EIVA 3RFZC 3FUFA 3WFEH 1BVKB 4GQPH 3H2PA 4WHTA 3EGXB 3K6SA 5FGCB 3PJLA 4A37A 2UYLB 1G7JB 4DP0X 4K71C 1JF6A 3FT1A 1IEAB 4ELKA 5KVFH 1AC6A 1IAMA 3HC4L 2G0LA 2ZUVA 1T2JA 1U93B 1OAJA 3GMLA 4TL5A 5C3LD 1ET5A 2WTPA 3ZZSA 5DZNA 4DFIA 3L4VA 4HPOH 1RIUH 2Z8VC 4WGKA 3MSPA 4C58B 3Q06A 2X2JA 4YHLH 4L4TA 4DHLA 2R23B 4K0OA 1CXHA 2F08A 3DUHA 1UD6A 5DHYB 4L1DA 1D5ZA 4GRWH 4PJ7E 4AENB 5AAWC 2OTWB 2MNJB 5I71B 2E9GA 2R4SH 5E6ZA 1MRFH 1NPJA 2W0PA 2DQJH 4WO4A 1KIRA 1ZANH 4ELMA 4NO0B 2F54B 1RK0A 4HSQA 4E41B 2H4EA 1LWRA 2IBZX 3QH3A 3R1GH 3I9AA 5EZJB 5LG1A 2WTRA 3ZHNA 4KZ0A 3PU7A 2V2XB 2D03H 2UUDK 3DROA 1LVEA 4HF5L 4BZ2H 2L7JA 1O9WA 5E70A 3GHPA 4GH7B 5JW4M 3GMRA 4LVEA 3CPLB 4OZGA 4KU1A 1E4KA 1L5GA 1JGIA 3IU3A 1LEGB 3BRDA 2P46B 4NFCA 5EOCJ 3DTUB 4P5TB 2P26A 4K07A 2M2DA 1NGPL 3WJJC 5FFGA 5DZ9A 2L0DA 3WIFB 4RLDA 4AG4L 1N59B 2Y07H 4JN2A 3VGAC 2I24N 4WDIA 4AYBA 4M3KB 1EJOL 3CV5A 3H2WA 4O58H 2MHAB 3AY4C 2E7HA 3LD8C 2BCMA 1JUFB 4M5SA 1Y18B 2GJRA 4UOZA 3TJHC 1EGJL 2ZWLT 2WO4A 4DVRH 3CFCH 2X4SA 1U91A 3AC0A 4U33A 5AVVB 3IDMB 1JP5A 4AJVA 1ICTA 1NAMH 3LZFL 4QGYA 1IBDA 2NY3B 4K7PY 3RWEB 5FO2A 4R26H 4UAHA 4ZT1A 4EI5D 2VDLH 3DUUA 1NSNH 4AQOA 5JTWA 3QDHA 3T0AA 2CUMA 4Z3IA 5GZOC 4G8EA 3FO1A 3QHTC 2E4FA 2GSMB 3CDYA 4H1LA 5FF6A 3S8GB 1SN2A 4G9FA 3SBWA 4PGDB 4OI9A 5EEYA 5GJTH 4A2MA 1UACL 2O6CA 3FSWA 4A6YA 2O5NA 1H8NA 3ARGC 3GB7B 4N8CL 4F1SA 3MV01 1JTPA 1OM3H 3S37H 2ZXEB 4KVPA 3GI9L 5EN2B 4I5BB 2KQMA 3DMMD 4APXA 2CGYA 2VJXA 5KVDL 1T04A 1RIHL 2P8LB 4BFEA 4BGDA 1LK2B 4JQIL 3R4RA 2FO1A 2YD4A 4M48L 2I27N 3CPUA 2BW5A 3F62A 3FTWA 2H9GA 4UNVA 3DX8B 3PV7A 3DXAA 3N1MC 4ZMYA 3B83A 3BI9X 1JZIA 5D2NC 5E7BA 4DN4H 2ORBL 1JXFA 2YPKB 4HS6B 2NY2C 4BYHA 3UJJH 4YSAA 2J4WL 2QR0B 4X83A 4N9GA 1UT1A 3PUUA 4H8WH 1MJ8L 1LEKB 3HG1E 1PFOA 2Y06H 4F8PA 2YA1A 2R1XA 2IPTH 3FOMB 4XN4A 3ESOA 4MXVF 2V3FA 1J5OL 1SEQH 4GT0A 4BGLA 3Q5OA 3UTSE 2DPKA 3KDMB 4G70B 1XIWB 1YN6B 3VH8A 5GGQL 5HHOA 1UM5H 3QCVH 4MHHG 2HWZH 5CS7A 3B4NA 3T0DA 1QASA 1ZMYA 5KWYC 3A67H 3LKSB 2YXMA 4N1EA 4I0KA 4MNGA 3RX5A 3HI5L 4FJYA 2ZP0T 3LY6A 5FYKD 3K4AA 4LKCA 4PY8I 5CM1A 2BSTB 35C8H 3VSTA 3RDTB 5K9JH 2J6EA 1S9YA 4N5EC 5I19H 3MRQA 3FQTB 5B4MC 3EOTH 5ALBL 2YD7A 1D7BA 3DI2B 4HCRL 2VRQA 1NDGA 3DX7B 1ZT4A 2BDNL 3F6IA 2F53D 2FGWL 1QR1A 4AM0A 2EIJB 3ARBA 4QRFA 3BAEH 4GAGH 1S9VA 2YQGA 3GMNB 4LCYB 3FT3B 3VWKA 2ZOLB 3MO1B 4XI5C 1YYCA 4XWOC 2XJLA 1PY4A 2HLAB 2D4DA 1J9RA 3AWEA 1NCTA 3ZL2A 2BNUB 1RIVL 3LKQA 3OMNB 5DK0B 4E36A 2I7SA 4JLRA 4AIEA 3C6SB 3PGCA 4XB8A 4XMKH 2R2EB 4J6RL 2HRLA 1UKTA 4Q4IA 5I1DA 3CD4A 4R7LA 3ATFA 2I9TB 2KZBA 4YO0A 4F2FA 2RBLA 2O61A 1AQMA 2WZ6A 2AJYL 2P49B 3P0VH 4H88L 3U36B 3WFDL 4BDVA 2PCYA 5GQBA 2YPLB 2WBJB 2CSPA 4Z7UA 1C5DA 4LSVL 1CTMA 1JGVH 1TTGA 3QEGH 4P0DA 5B1JA 2PCFB 3G5WA 2VZTA 3SPHA 3MFFB 2WYIA 4NHCL 1O5DT 4HUMB 2ZOKA 3MLXL 4NM8H 4MCYB 1T80A 3RI5F 2NZIA 3KXFA 3QA3A 3QI9C 2YK1H 3HPLB 3RRQA 1IFRA 3CN3A 4ZFZB 1JHKL 1QQDB 4Q14A 3EYQD 3HZKB 4JFHD 2P8PB 3A4FA 3GSOA 1PCSA 1X7SA 4J3XA 3TBTA 5E6UB 4I0PA 1F1GA 4TUKH 3SY0A 1OKEA 3RGHA 1NBYA 1X7TA 5CHNB 4FA6A 1FVDB 5IKCB 2IWKA 3E0GA 4G5AA 2F58H 1EUTA 4P4KA 3GD1C 2A1WL 1IX2A 4L8CB 4YXKH 1BIIA 3NQIA 4HD5A 4IKLA 3IGUA 3EO9L 3LRHA 1QATA 4CILA 4Z0BH 1OD9A 4A7GF 1SXBA 1ETZA 4JZOB 2AZAA 5FHBH 5T1MA 2VDPL 1PKQA 2JCWA 1AQKL 2QHRL 4NKOA 1VFBA 1E7UA 4FQLL 5I0VA 5CLZA 3NZ8B 4ODTL 5MEOB 4HWBH 2VMEA 2FEEI 1YYLH 4LGRB 1J1XH 4FQJL 3WN6A 1MNNA 2ZUQB 3VFVA 1G7MB 2AXHA 3C6EA 2PYEA 3TA3B 3VSUA 3ZE1B 4HJTA 4JKNA 3EBIA 5JIHA 3K91A 4Z7VE 2MEJB 3EYFB 4KO5A 3O6LH 5I6XC 3B2VL 4XBPB 5HVHC 1NC2A 1SEBA 5T1KD 1QSFA 1DP0A 2JKRM 2MKWA 3WUWA 2EEBA 1X7QB 1RJYB 4QCIA 1NLBL 2WNWA 4F2ME 2XXMB 1OGPA 1PBYA 4OD3L 4JPSA 2XTJB 4P9HC 3TBVB 1JI1A 4HW6A 4WUUB 5JHDB 3A3YB 1OAKL 1JNNH 4LSQL 1YEFH 1CD9B 5D6CB 1KB9J 3NCYP 5DO2D 4N8PA 1A21A 3ARYA 1UD2A 1E4XH 2W1NA 3O2WL 3CFUA 3HBQA 5JOFA 2UX6A 1HZKA 1D5IH 4YZFF 3U7YH 4C55A 2JSFA 4NQXB 4AH2A 1FL3B 4W1TA 1R9FA 4XP1L 3BVWA 2UWEA 4NUJB 4ZZKA 5LVEA 1HVXA 1R3KB 1WQVT 4GI9A 3WNNA 2ENQA 4Q9QL 3ENEA 2KMWA 4YDLC 3CCHA 1ILSA 2X4NB 2XG4A 3G5XB 2F7QA 3QUZB 5CD3A 5EZIL 4BFBD 4RGOH 2I5YL 4O2CA 1MAML 1T20A 3L3OB 5DD5L 2H26A 1XSJA 4W4NA 1AH1A 1G87A 3ZRFC 4ZYKA 5HSFA 1KB9K 2F7IA 1A7OL 1E5ZA 5E6IB 1HI6A 1S5IL 4ONHB 4X7FC 3ZE0E 5JZ7C 2YD2A 3LX9A 5FKAA 1MCPL 1HHHB 5BJTB 4UM9B 5CU9A 1X6LA 3V2AR 1OSPL 1QSEA 4B6ZA 5HI5C 2DM2A 2ARWA 4LMQI 3WIAA 3D0AA 4X80L 5IB2A 2BSSA 3HMWH 5IFHH 4EN3C 4LPWA 3O6FC 1DFBL 1NLDH 5D7JA 1HXKA 5JORB 2QADD 1TJGH 3GHBH 3L4XA 4HD9A 3WKQA 1H0DA 4W70A 4WK2B 1E28A 3DV4A 5J1AB 3IAGC 3T4YB 5L0QC 3MXWL 4GW1A 4XVTH 2A99A 4LSUH 4MKMA 5C08A 3T8XB 1R46A 4N5UA 4HDIA 4QJ3B 3JV4A 1QA9B 5EG6C 4MBRA 5JIKA 4M7LT 2CALA 2ZIDA 1A7PL 1U92A 1AZCA 4MS8D 2CBPA 2Q8BL 3HE7B 2XQ0A 4NCDA 1XF2B 1IQWH 2AV7A 3HZYB 1RK1A 2X1XR 3RB5A 4ZTPL 1OOAA 5DUBB 3ZE2F 3PL6D 1OAYL 4ZOCA 5FOJA 5HVFB 3FK3A 3LEXB 5CGYC 5AKTA 5DD6B 5HI4C 3O3AB 5SWZA 2O5XL 4UNTA 1RUMH 1B0IA 2DQEH 4JHVA 3UTPD 5DJAB 5HYSA 2F7OA 4JRWA 3FOLA 4JVPA 5EH1A 5IQOA 4X5RA 1DBKL 2WUCL 2ZX5A 3KBEA 3RVXD 2VZ1A 1X9QA 2DM4A 1UWYA 5G55A 5I6KA 1KXVC 2O6FA 3GPEA 5CCGE 3CE1A 4FQPA 5C0EA 3IMVA 2R0LL 3ULUH 3QJUB 5D7KD 1CD8A 3ARDA 3KEDA 3PV6B 2PMZA 4PRIB 1FGVH 1QEWA 1WLHA 3L9YA 4GT7A 3FB6A 1K2DB 3MLZH 2VMJA 3NUKA 1TETL 1FFNB 2BY1A 4HIHB 4DJMA 3A4AA 1YSOA 2JI2A 2ZKYA 1I1AA 5C6TL 5CMAA 2OV0A 5FO7A 2CIIA 2EYTA 5CEZH 3ZL4H 3QQ4A 5FB8A 3O2DH 2Z91A 4LLAA 3CXDL 2JJTA 4G82A 1P9MC 5FYKE 4Y4HA 4LP4A 4UOW0 3NCWA 4G5ZL 3ECBA 4OJYA 2V9QA 4QXGH 3IMUA 4ZMPA 1RQ5A 1T7VA 5CEYB 1BGXH 5CLWA 4AL8C 1JHTA 9PCYA 4XNYL 4FABH 2F53E 3II1A 3LQZB 4H8VA 3MLWL 5FWQA 2OMWB 3S4SG 3UXFA 2ADFL 4GAYA 5KYXA 5F9DC 4KITB 3NRQA 3MRDA 4PGBB 3V5HB 1NCDL 4QMEA 3C60A 3CZFA 3C8HA 1FFPB 4LEXH 1DZBA 1KB3A 1IE4A 4E5XA 2GUOA 5J9PB 5KN5A 1TEGA 3TVMD 1QD0A 4QDGA 1GKEA 3B2XA 3V4VH 1BFVL 4IIQB 3O2VH 2VERN 1EZUA 4PB9H 3G5ZA 4KK5D 1N8ZA 4ESKA 1L9TA 1T89A 3GEFA 4NLAA 5BRZD 2APWA 3DSFL 5DQ9A 4DEWA 1MI5D 1HHGA 3NSDA 5CUSH 1L4IA 2N56A 4ICXA 2OK0H 3QHZH 3BAXA 4LPCA 4IJTA 5CZXD 2IGTA 3QZPA 4KTDH 2FEDD 3F5WA 2VDOH 4R5XA 5H35B 1Z5HA 3RWFB 4R5TA 2XPGB 3GMOA 3Q3GA 3E9TA 3QDMA 4UUJA 3RWCB 3K2IA 1DVYA 4DOHE 3EDJA 3HLAA 2I69A 4XN9A 1MG2C 2HTKC 3B6SA 4S1RL 1TCRB 2DYPB 1TVHB 2IDTA 3MRHB 5DJ8B 3S36X 2M83A 4RA3A 5I0WA 4WWKC 4DP4X 1G0YR 5DJDA 5F7DB 1GZPB 1HOCA 4IOSA 1VACA 1T0PB 3SCMC 5C8JB 1LGVA 4PWFA 3BC9A 5AOJA 3W57A 3S35X 3LPFA 1DN2A 4ZPVA 4KHXL 2VXSL 4C59B 4JFHE 2PYFA 3IRCA 4ODWB 4OGYL 4OFDA 4JO4L 1HCFX 3PAYA 3ZE1F 4UT9H 3GGWA 2F5AL 3EF7A 3TXAA 1AZVA 1MQKL 5DZVA 3T0EB 1EEYB 1QWNA 1XCTB 1TR7A 1NUDA 3EDKA 3Q6FA 4CVZA 4CU7A 2EDQA 1F4WH 3GTTA 1X5IA 1EHLL 4NP4H 4JKLA 2DQHH 4QHUB 5KOMC 5B38B 3H0TB 2XFGB 2FBJL 4JFOB 4PS4H 3RY4A 5GGVH 3CN0A 2HX8A 2YRBA 4KI1A 3TIDA 4YSTA 2OMTB 4J4PA 2IAMC 3RWIA 1S4IA 2GHZA 2GK0B 5EF3A 1J0YA 3CTTA 1HINL 2EUZA 4O2FB 4YWGL 3QJFA 5KSVA 4N8UA 3HB3B 5BVJB 4E42B 4PUBL 4OCRH 1MFAL 4KAQH 3SQOL 4W4OA 5JPMB 5F96L 5IB1B 5F1IA 2IGFL 4K94C 4MRBA 1VSCA 1WFMA 1FH2A 1IC4H 4FQCH 4LHUB 4GUCA 3BQVA 4CSZA 1ZJBA 1PLBA 1Y7VA 4NO3A 5C97A 1N2RA 4LLQB 1XR8B 4IRZH 2E9BA 1CFTA 1WD8A 5CJOL 1KV3A 3BWZA 1Z6JT 4G7SB 4BXVA 7PCYA 5E1IA 1RUPL 3ARFA 4H8UA 3FTVA 4M5YL 2B0SH 2NPLX 2QKIB 3EJRA 4QO1B 4OZHA 1HHIA 1P5VB 1UZGA 2VDMB 4OJFH 5D93C 3FRUA 3FQWB 3QQDA 1JPFA 1EFXA 3WKMH 5JHLA 3KPOB 5J1SC 5JUEH 3FB8B 1F5WA 5B3SB 1U8KA 3SDDC 2WXLA 3WL9A 1AY1H 4XO3A 3BDBA 5E2TH 4GQ9H 2BCKB 1X3DA 2ENJA 4G6FB 4YDKH 4OCMC 5I74C 1ZWIA 3MV11 1CG9A 1SMAA 2OSXA 3OQRA 4G8GB 4B9PA 1FQ9C 5GJSH 2DICA 4FMKA 4GMTH 1WFUA 5FO8B 2MWCA 2NY1C 5L9DH 2CDFA 1MW3A 3DV6B 4A2HA 3FFCA 1LO5B 3V6BR 1MAKA 1AGCB 2BWDA 4JY5L 1XGZA 4LEOA 5H37G 4AITA 1GCFA 3QHFL 3RILA 2YSSA 2X3BA 3L4CA 4FYQA 2ZWYA 4F7PB 5D1QC 4KK8D 1JPGB 2MQ3A 4AYSA 4PCSA 1QX1A 4WEMB 5BVPH 3NIDB <