3O6LL

Anti-tat hiv 11h6h1 fab' complexed with a 15-mer tat peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
217
Chain Sequence
b'DVVMTQTPLTLSVTIGQPASISCKSGQSLLYSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11H6H1 Fab' light chain
molecule tags Immune system
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
total genus 55
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lL01
1RUKL 3P4MA 3CPLA 5FKPB 3O0RL 4PJ7F 4X6DE 5HDQH 2IANB 1A8JH 5E8NA 1S9WB 1YNLH 4LCWE 1UKQA 5LWYH 3I02B 5ID0A 4P9HH 3I3BA 1XZ0A 2AP2A 4OBSA 1FLTX 4HK0B 4BQBA 3BH8B 3RWIB 3KPNA 4AH2B 3VA6A 2Z8SA 1ZSDA 3JZ7A 4ZUVB 5JPNB 2J8UE 1U8JA 3X3GH 4OCYH 3F62A 4YDVB 1AD0A 2IALA 5BO1H 1CIUA 4LSSL 4U1MA 4OD2B 5I1JH 3V6FB 5MERA 3TZVA 5IJVA 3MA9H 3EOTL 1NFDE 2ILLA 1FG2B 1R3KA 2FH6A 3E6HA 4LPVA 5HYJB 1E27B 3O3DA 1H3UA 3HPJB 3T65B 5EORH 3TBYB 1S78D 5I0DA 4F9LC 3I6KB 3RPKA 2P5WA 2QADD 4EXKA 5H2BA 4M6NL 1YMMD 1UVQB 1DBKH 2B0SL 2H2SD 2IG2H 3O2DA 4OCLC 2I9TB 4F7TB 3BD4A 1FZKA 3W81A 1ZS8A 5T3XL 1UYWL 3QBTB 4X4YA 3VDBA 5IGXH 5KSUA 1C1EH 4OV5A 2CJUL 1H0DB 1I3VA 4ZPVB 5LGHH 4G9FB 5I1AB 1F4YH 3BMVA 3MBEC 5C0FA 4MSWB 4PP2A 5FDWA 3VD4A 4XX1G 1IGIL 3RX7A 2XNAA 3PWJB 1V8HA 5B4MC 1LGVA 2NY5C 4FQXD 2L0DA 5CMAA 2BVYA 4MS8D 5CGTA 2EKSB 3QWQB 3VD9A 4ZD3H 1BAFH 4M7LL 3GEWB 4XP9H 1A3LL 3D39A 1R3IL 1HSBA 1G84A 4F7PB 1WWWX 2VOTA 4P4KA 4C83A 1FAIL 1V7MH 5D2LA 2JCCB 4I48B 1MEXH 4TULL 1ZANH 3SDAC 3MBXL 4PG2C 3S7GA 5FYJH 1T03H 1MFAL 3A6BH 2BDNH 4LSQH 4WU7A 3RWDA 5C3LD 4OT1L 2OTUB 1MCHA 1M7IB 3BP5A 3MA9L 3ZDXE 2B4CL 2ZCHL 3TN0B 3O6MH 3QUMB 2BSTB 1VEMA 5BRZA 5EO1A 5FYKD 5CAYB 3CAFA 2D0GA 2AS5M 1IGYA 5C0DA 5A3IC 1NANI 5D7SH 4BH8B 2AQ1A 4RNRA 4E41D 1U3YA 3BJ91 5E6IA 3MMEB 4JB9H 4MMZC 3TO4A 1N2RA 4U7MA 5FYKU 3KLDA 1A5FL 5CJ5A 1KPVB 3OMZA 4O5LL 4YDVA 2JB6B 1ONQB 4L29B 2HLFD 3MRPB 1HSBB 3HKFA 1UWXH 3HI6L 3DX8B 4QY8B 1JBJA 2R23A 2MQ3A 2BNQB 2I60L 1E28B 1I4FA 5CJXA 2V9TA 1T21B 2DM7A 5AZ2L 2C4FT 4K8RL 2EICA 1UFUA 2AEWA 4S0TD 2GT9B 4OLXH 3ULUE 2GJ6E 3F12A 1F58L 1D9KC 2WIIA 1N3NA 4JLRB 3GMOA 4UMGA 1AO7B 2AXJA 4ZFZB 2BSED 4YUEL 3X14B 3IDJB 1A4JB 3ECBB 4PLNC 6CGTA 2QSQA 5D1XC 2BVOA 2VLJA 5JW3H 4PUBH 5D4QA 3A6BL 3TF7C 1NBZA 3AU1B 1DTUA 3GK8H 1LO3H 1D5IH 1HZHH 2X6MA 5DQ9B 3D0LB 3OKKA 5D8JL 3QNXA 4OLWL 4JN2A 3O6KH 4QTHB 1GC1L 5E2WH 4NJAL 1DBAL 1QTYT 1AIFA 2Y4SA 1J87A 2E8ZA 1L0XA 2VZ1A 4UILL 4P2CG 1EJOH 4U1NA 4CBPA 4P2RD 4NUJB 4UT7L 4RRPA 2W9DH 2HJKB 3GSNA 4JANB 2OR7A 2IBBA 4L8BB 2XTJE 3MBED 3TO2A 4Z7NF 2CJUH 4KV5F 4H1LH 4QOKB 2HRPH 2IADA 1LK3L 2DAVA 3L3HB 4BH7B 2J1KA 3SPVB 1CS6A 1P53A 1NBVL 5F3BB 4ZAKB 3TJHC 4DN3L 3INUH 3CDCA 3FMGH 1PQZA 3A67H 3X11A 1SEQL 4OTXH 5IIEB 1ZHLA 3WN5B 4DKAA 4YHMH 4WEUD 3DGGA 3L3OB 5K93A 3BYTA 3EO9L 4HUVB 3N9GH 2GUOB 5T1MB 4YDIL 4TVPE 4X83A 3BEVB 4WHYH 1IEAA 4OAWA 1PKQE 4UINH 4P9HC 1QFWL 4Y4FB 2Y23A 5JQHC 5EOQL 1I8MB 4HF5L 4LLYA 4EBQL 4RFOH 2OSLA 1JYVA 4HWNA 1NFKA 1KTKE 4ZQKB 3WYRA 1ULVA 1YNTB 3QJHA 1GYAA 5I0ZA 3TEUA 1MCEA 5CLTA 1JWUB 2YUZA 5TE7H 2D0FA 4MXQC 5CSZA 5EN2A 3HUJE 2AVGA 4X6DA 5HGBA 5JNYB 1U8KA 4M7ZB 3NZHH 1HYSC 3LKQB 2ZUVA 1XIWD 4EI6A 5SWZA 1K85A 1FIEA 3V8OA 3CVIH 3RVTC 1RHFA 2W9DL 1T83A 1N4XL 2Z8VC 1E6JH 4V2CB 1FV1B 4TVSa 5AAWA 2MJWA 4L3EB 1JZ5A 2ADGB 3REWA 4YR6A 2CGRL 4L9LB 2NNAB 3DIFA 4XPFH 4M1GL 4FTVB 1WFUA 4MB3A 4X7FC 1FGNL 2XWBB 1JMZA 3SDDB 1RMFL 1I1AD 3BE1L 5DVNA 5FAAA 5KG9A 1R3HA 2OL3L 3HG1D 1PG7H 4P2OA 4H8WC 1JFQH 3VFSB 3KS0J 2P8LB 5D1XD 3PV6A 1CGXA 3I3DA 3VFUA 2O93L 3PWPB 1JPGA 3KPQA 3OKNA 3HMWH 3TVMC 3V4UL 1OGTA 3NH7L 4PJAB 1UEYA 1DVFC 1AXIB 3EGSA 5EA0H 3FB7A 4LKXB 1IKFH 1CDGA 3WBDA 5LWYL 2DLHA 5HSFA 5D1ZD 2WBJD 3QDME 4U1JB 5MI0B 1NGXB 4ZYKA 3CFJA 5D2NA 3MXWL 1MAML 2V2TB 3VXMD 3ZSTA 1C5CL 3EW3B 1GGBL 1KTLA 1HN1A 1CLYH 4ZFFB 1ND0B 3HLAB 1VGKA 4GAGH 3LN5A 5E2TL 2EYTA 4I77L 4PGCA 1U93A 1IAII 2FGWH 2W92A 5HJ3A 1ZT7A 1IJ9A 2HVJA 4HBQA 1X4YA 3O6FA 4A2MA 2YPLE 1U8PA 3FO9B 4JRXA 5SV4A 1DEDA 4ZXBA 1ES0B 5I1GL 1S7UB 4DN4L 3JVGC 4WI8A 3QIWC 1QSFA 4AT6A 4R3SA 2YRPA 1QFWM 2NY2B 2DQIH 4IDLA 4OKVB 4WUKL 5EZOH 1EO5A 1I1YB 3MNVA 3TJEH 3QYCA 4JO4H 1VFUA 2X1XR 3OKOA 3L95B 5IVOA 5HYSG 3DXAA 2DQHH 4Q9CA 4Z78B 4J3XA 5DC4B 1A9EB 3HFMH 1T83C 4OUUB 5HHVL 1UADC 3QIUC 1K9TA 2PTTB 5LGHL 3W39A 4XP1L 4HJ0C 4RAUA 3WFCL 2P5EA 5HI5D 1N6VA 2ZUUA 4KUZL 3UPRA 4F3FA 1EIBA 5F9OL 2PNDA 3VMOA 1ZGLB 1BD2E 2VL4A 5F9WB 3U4EA 3PHQA 4FQLH 1T5XB 4IMLB 4LHUA 4QRTB 1Q9OB 2YPKA 3FO1B 1FBIL 2VERN 3WHXA 5T1LB 2CIKA 4KKLD 1I1FA 1RJCA 3WHXB 5FUZL 4FG6C 1A3RL 1LD9B 3PQYE 4LBEA 3TP4A 1I9RL 2NY6B 4U2ZA 4W68A 1EJ6A 4WFFE 1KACB 4J3WA 3MLVH 4UV4L 4EN3A 1I85A 5EU3A 5EO0A 3IJHA 5LAXA 3RDTA 1CLOH 3LVEA 1VKXA 5FYLD 3LMJL 2FX8L 4XP5H 4F7MA 1C7SA 5I75C 5KW9H 2ZP0T 2DJSA 1VCAA 4OJFL 3W39B 3V52L 1RMFH 1URLA 2GEEA 3RWEB 3J7HA 5GS0L 4P0DA 3MLZL 2PO6C 3U82B 4K8RH 4JFDE 3B6SB 4HPOH 4WHTA 2V5TA 5I1LB 3SY0A 5J12B 4PJAF 1DVFD 3JWDC 1EEYA 5I1IL 3DX7B 5HPMB 1JYXA 1FG9C 2F5AL 1UXSB 3MLTB 3V5DB 3O0RH 1R0AL 1ED3A 4J2XA 4ZAKC 2QHRH 4HWBH 5E94B 5HVGB 5ETUA 5IVXE 4QRPE 1CDJA 2ARWA 2RJMA 5IOPA 4Z6AT 4M00A 4JQXA 3KGRA 5GGQL 2Z92A 5FCUL 4WU5A 4CU7A 4PB9L 4NZUH 3DARA 4PJBE 1WZMA 3O4LD 4HUNB 2VXQH 3MXVL 1BJ8A 5BCAA 3U4BH 3GMRB 1HNFA 4L8DA 4JFFD 1CBVH 3PDOB 5H35A 5JIHA 1QEWA 5IWLC 4HBCH 3QIWD 2COQA 4XTRC 1ND0A 5I9QC 2C1OA 2P44B 2VDOH 2WUCL 4Y4HA 4CKVX 3S88L 3QFDA 5F1SA 3ZDZE 4AYFA 1MFEL 4ZTPH 3UJJL 3TCLB 5MHSD 4PY7A 4ZS7H 3D2UB 4D8PB 3DYMA 5B39A 2AKRA 4G3YL 2BOBA 2UZIL 2FX9L 4BSWB 4QGYA 1G6RH 3MJGX 1MAKA 1WBYA 3M17A 4L1DA 1EVUA 3WDJA 5EBLA 3PP3H 3QI9D 2VDNH 3NCJL 2H3NA 3GJFA 4POYA 4PLKD 2R0ZL 2VYRE 2Z9TA 2HT3D 4HXAH 4CADA 3QB7C 4JJ5B 5TE4L 1CICA 1FL6B 3ARFB 1KN4H 2H26B 3CCHA 3RY5A 4PJFE 3EOAA 5E8DH 1I7UA 4I13B 4QXUH 2NXZC 3C6LD 3V4PH 4OCSL 5D71L 5BMFL 4FTVA 3VI3F 2DN7A 1DUZB 1LWRA 2VLRD 3R0NA 1FNAA 3FN9A 1H15B 3NIGE 3HI1B 4PY8J 5C6PB 3LHPL 4YPGA 4YC2B 2B20A 3R1GL 3NAAH 1KENH 3AXLA 1TIUA 4ZS6C 1DE4A 4U7KA 2DQEL 2H9GA 2JJTC 1CBVL 3UMTA 4KZEH 4X6EB 5IUSA 1TFHA 3VFWB 3VXTA 1F3RB 1MHCA 1Q9KB 5T1DH 4NFCA 4OGAC 1BECA 1F45A 5IHLB 5CSZB 1YEHL 4O51B 4JCLA 1MWAB 5IFHL 4LLQA 4MCYA 3T8XB 2XXCB 3V5HA 1HWGB 2CLRA 4IHOB 3QEQB 4GO6B 4JFEB 3NN8B 4DUVA 4JZNA 5EOTB 4WHCA 4OFYA 5E4IA 5HGDA 3MO1B 3NA4A 3MYZA 4WFHE 1JV5B 4HS6A 4UZGA 5E8PA 1DANU 1XIWB 3Q48A 1ZGLP 3GIZH 1Q94A 1F90H 3V0WL 4OZHE 5SWZD 3GSXB 1JZ4A 4P46B 1OSPL 1HHIB 1KIPB 4HDIB 4PRPE 3RWCB 4BYHA 5JUEH 3WKML 4Y19A 4XX1E 4N1HB 1BLNB 2PF6A 2XFXA 5BVPL 4O00A 3FQUA 2QBWA 4OB5H 3LEVL 1J12A 4XP6L 4XGZA 4PRBB 4NO2B 1JFQL 2UWEB 4NWUH 4OZGE 4LL9A 3BISA 2Q7NA 1U8MA 2V2WA 3F6IA 2IADB 5IW6B 1BIIA 1F4XH 3VJ6B 3RI5F 3VXPB 2BJML 4O4YL 2OTWA 2UV3A 4X5LA 1VFBB 2WM0A 4LVNC 4J6RL 4QTIL 3WNPA 2VZVA 2V7HB 4NO0B 2AJXL 4PJ8B 5D72L 5EC2A 5I73C 3L5WA 4L5FH 3RY6C 5E99L 3IS0X 3IDXH 4YWGH 1MI5E 1VGEL 4QYOA 1T7VA 4GRWF 4X6CB 1AGCA 1BJMA 1U8NA 5JHDA 4M7KL 5E5MB 4G8IB 3DVGB 4KKCC 4WVRA 4JN2B 7CGTA 4QRSB 1Q9WB 3MNZB 3CSYA 2XA8L 5DJXA 3P11L 5DZLA 3MRQB 1F11A 2NY3C 4MNHA 2F5BH 1FIGL 1FJ1B 5GZNC 4W4NA 3D0VA 2FJHB 1QLFB 5ID1A 5F1OB 8CGTA 4U1HB 5BV7L 3BQUC 5J11B 1S5HB 1A4JA 1OAUH 3KPMA 4JFZL 4ODXB 4KZDL 4NKMB 3U6RB 2PTVA 3JWDL 3IVKA 3TIEB 4IMKC 2DQHL 5GS1C 3QFJD 1W0VA 3IDNB 4XH2A 4OZHB 2NY4C 1ADQL 4NQCB 4UBDC 1JHKH 2IWGA 3MV9B 2FGZA 3QEQE 5BVJA 1B4RA 5CHNB 3I6LD 3QXDA 1Z0MA 4I4WB 4AZ8A 1IGFL 3FMGL 3N9GL 2ZWLT 4N68A 2YWYA 2CXKA 3WFDH 5JQ6L 1TDQA 2CD0A 4PJ9A 3ZL4H 3B6SA 1S7QA 3DROA 2NY1C 4NBZB 2D4DA 5IR1A 5KVEL 3VWJC 4BK4A 5JW3L 1ZWIB 3KPPA 1T80A 3OAUL 3TH4T 5H94B 3UJIH 4ODXA 3I6LE 3QUXB 5E1AA 3WIHL 5JOEA 2HKHH 1T0PB 1HHKA 4MNQE 3BPLB 3TZVC 1QYGL 4NDMB 4I3SL 5J7CC 1A7PL 1EFXA 5GS0C 1WK0A 1GGBH 2GQHA 3MRMB 4P9HL 2PYEA 2MHAB 2YPLA 1DQJB 2P49B 4WI4A 4HPYH 3IJSB 1VADA 1TZHB 2PO6A 4CVWA 1M7IA 3BP5B 1OF2B 2Y07H 4PJ5E 3GNML 2CIKB 1RAMA 3U1SL 3TM6A 2DKMA 4PJFA 5AZEH 1SJHB 1MRFH 3EYSL 3NACL 3N1GC 1D5ZB 3L5WB 4F7PA 1ZHNB 1HH6B 4FA8A 1CN4A 4PREA 1UACL 3IFLL 4FQQA 2AJ3A 2Z93B 2DWEB 5IR1B 3QDMA 2VE6B 4Y16D 5ACLA 2P5EB 5JA9A 3G6JF 5BZDB 3FONB 4I3RL 1V7NH 1EAPA 1XGPA 3O8XB 1KNOA 4KJYB 4Q97A 3AROA 1YC7A 3ZTJG 3BIAX 2CRYA 5MEPB 2JCCE 4LGPB 3MRQA 1Z9LA 5KVGL 3F7VB 2YK1H 5T3XD 1KIQA 1GPOH 3MBEB 4XBGA 5CJXC 5JQ6H 1J0ZA 2BNUA 4HH9A 2H2PC 4ODBD 2ICES 2XTJD 4LCCC 1UM4H 1DDHB 3U9UB 2VZ3A 1KELL 4HS8H 5JXEA 4J3SA 3VMNA 3ZKNC 1CU4H 1DSFL 2DYPD 5EPMA 5C6WH 2VR9A 4OLZH 1FNSH 3G5ZB 3MO1A 3RU8H 1NC2A 4K7PL 2DTSA 3ARUA 2Z31D 1ZLWK 2XA8H 1FNGA 1QFWI 2HTLD 4L3AA 1F8TH 2W0KA 2Q7YB 4DVBA 1B6UA 3LIZL 3BUYA 1HKFA 4B7IA 5HJ3B 3G6JE 5AYUL 3U36B 1INEL 2BDNL 4UBDD 1DE4B 1G7IA 4IEFB 1DQDH 3DRQA 1FQ9C 5AD0A 1A47A 1VFBA 2RCSL 4XBPB 2DQDL 2QQLL 4U1KA 2AJSH 3DMMB 1ROWA 5C2UB 1MFEH 1K2DB 3VJ6A 4P2RA 3GMNB 4PJ8D 1L7IH 1EBPA 4LLUB 3WFHA 2DL2A 3S34H 4S1RH 3OHXA 4DGYL 4N90E 3EIFA 4JFFB 1FL3A 2BJMH 4IHOA 3P77B 4PG9A 5DO2D 3GRWL 3D69A 1DN2A 3QDAA 4PRIB 1HHIA 1KIPA 5KG9B 4R96B 3GSXA 4HWBL 1XAUA 1AP2B 3E8UL 4N0UB 2XWBA 1AQKH 3VXTB 2I60H 4JFHD 4M6MH 4Y4KB 3QP3A 3BKJH 3BP4A 3W82A 3TC9A 4TSCL 4RFEB 1JNLH 1MH5B 4H26A 4M02A 4DAGH 2UVEA 5CJ8A 5CCKL 4GUPB 1WAAF 3SE9H 4Z7VB 4ZMAT 3G6JA 5EWIH 1V3LA 2AEQL 3VRIB 1FZOA 3NTCL 4G6MH 4JFPA 5IEHA 5F8QC 1M05B 5EN2B 4V1DD 4QGTA 4GG8A 3BUTA 4KZEL 1SJXA 3ARED 3P77A 5I8EA 1QVOB 5DD0H 1BP3B 3CUPB 4X8XA 3LZFH 3P73B 4LLYB 1A3QA 4G8EB 1AXSB 3MUJA 4I3RH 4P2RE 1H15A 3VG9C 1NCUA 5C92A 4L3CB 1SJEB 3GSNL 1FBIH 5JLZB 4JM2A 5FUCE 4GG6B 2YD3A 2BOBB 5J1AB 3TIDA 4GKNB 4JFOA 1J8HB 1EV2E 3GKWL 3NCCB 4NZTL 5GGRB 5HHOD 2QL1A 4JFFE 2DYPB 5MP6H 5KVFH 5KVEH 2XKUA 4CVXA 1CF8L 4PJXE 1UH2A 3UROR 4N0RA 1EXUB 4HK3J 5D71H 5EBLB 3SPVA 1PAMA 4NQEB 4K94C 4I18A 4BH7A 2F54A 2Z35B 1IILE 1U91B 1NEZG 4NHCH 3MRCB 1RPQA 4H5SA 4HW6A 3JUZA 3DUHA 2NY1B 5D2NC 4Q58C 2D31B 1GGTA 2AXFA 5D7JD 1DEEB 2HTKD 4PV8A 2I9LB 3BO8A 3F6LA 1P7QA 4XHJD 4K3JL 1MEXL 3GMMA 3TPKA 1I8IB 3MUHL 2LU7A 1NSNH 1D6VH 3H9HA 5TH2A 5CBEB 5F7KC 3GB7A 4XNMA 5I1CH 1RUPH 3EO0B 4OZGF 4NCDA 1E6OL 3Q1SH 3D0LA 3P11H 4XPTH 4MA8H 1FLRL 3QUYB 3QIBD 5D5MA 5F6IC 5IFAH 1IFHH 3HCVA 3MRDB 2DM4A 1XEDA 1KXQE 1YNKL 2E7MA 3D39E 2B4CC 3SO5A 4HCRA 1A0QH 4XC3H 1EHLH 5EOCL 5EO9A 5HYQA 3CVHA 4PRPB 5HD8D 3E6FA 1IC1A 1T20B 3QUZC 1OTTC 1BOGB 1C08B 1NCNA 4P4RA 3FQNB 1IC5L 1F2QA 3RDTB 3VFTB 1ZHNA 1JGDB 3JV5A 2HMID 5CJOL 2D7TL 4IIQA 1IM3B 3RAJL 1D5ZA 3BRFA 1XR9B 1BWWA 1WAAE 1MRDH 5AG8A 4GAJH 3STZA 2R4SH 1I7ZA 3D48R 3KYOB 3RWEA 4EQ2A 1MCOH 4J1UA 4NQEE 1QR1A 1RULL 4X4ZA 3QXWA 2JELL 1DVFB 4PV9A 3MJ8B 1ZT4A 3VXRA 1O0VA 2JKXA 1MQ8A 5F70A 3SDDC 1MLBA 4YX2H 4OGXH 4ZO9A 4ZSOE 1ZOXA 3N85L 4BELD 1FHGA 2NMSA 4LLDA 4OIAA 2A6IB 2ITDA 25C8L 3U4AA 3WLBB 2PUQT 3JSSA 5HYSA 3ARXA 3CSPA 3SQOH 5GRVL 5BRZB 4Y89A 5I1KH 2DQGH 4CVUA 1XR9A 4JVWA 3WD5H 1ZLUH 1IM3A 3MRKB 2D2OA 1R6VA 4ZFFA 3UZEA 5L8LB 1A1OA 5JHLL 3QQ4A 1HYRC 4JGUA 3GSOB 2R4RH 3GSUA 3DHMA 2E7LA 3V0AC 4POZD 2YPLD 4XWOC 1F3JA 4X8JA 4ZOEA 4JFOB 4RFNB 5IFJA 4RAUB 1E4XH 4PP1C 5B21A 2DQFA 4RGNE 3RDTD 5DUPL 1R24A 3ZTNH 1TNMA 3I50L 5GJSH 4NKMA 1LEGB 3U6RA 5KSAA 4X80H 5TPWL 5DWUH 3FO9A 4JRXB 3ETBF 1BD2B 1QLFA 3QDJE 5HTSA 2M1KA 3BGMA 5I1AA 1YPZF 3DBXB 1NLBH 3W2DH 4K3DL 1UA6H 4OCXL 5LBSH 1NDMA 4HK3N 4JQVA 2WBWB 1UM6H 1WZKA 1CGTA 2C9AA 3OL2A 2UZXB 4L4VD 4GW1B 4IJ3B 4APQA 1JGVH 3T4AB 3NZ8B 2DI8A 2QADC 1K4CA 1DEEA 2XOTA 3REWB 3G5VA 4YDIH 1BPVA 3MOAL 1EBAA 2CRMA 1S8DB 2D3VA 3P73A 2VLJE 3HE7C 3JV4B 3FQRA 5F7LB 5DHYA 1BM3H 4LPTA 4QXUL 1FL5A 1C5DA 3UDWA 5GRZA 2QSVA 1XF4A 4P2QB 1INEH 1JZ3A 5BS0E 1AGDB 4NKIH 5IBLD 1A21A 2IFFH 1SJVA 2WQ8A 3CDGA 3LN5B 1TZGL 5F9OH 4MAYD 4R8WL 5J6GB 1LE9B 5B22A 1P84K 5HD8C 1QSEE 1CD1B 3VXUB 1YNTA 2FEDC 1AD0B 4JQIL 1J7VR 2CRIA 3PQYD 4ODSH 5D1ZB 1WSST 2XZQL 5CBAA 4QCIA 3O2WL 1NGXA 3QT2A 1KB5H 4ONHA 4KTDH 4RFEA 1DBKL 3IFNL 3S97C 1PBYA 3IFPA 1NUFA 3LRSB 1AE6L 5I19H 2BVTA 3I02A 1Y0LA 1FV1A 2VQTA 4ZPTA 5DMGD 4Z7UA 2DLFL 1B2WH 1T1XA 2MNUA 3C2AH 4JFEE 5J12C 3MJ9H 5FYJU 3SDDD 1KJ3H 2F9BT 4P4KD 3ZE1F 3D9AL 2I07A 2EE9A 3QNYB 4BZ2H 5D1XB 3ZHLA 4XVUC 1J0JA 2VIRA 4QHKJ 3UTTE 5F21B 1CZ8L 3EJZC 1R3LA 3RIFK 2E7BA 4NKOA 4O2FA 3CDYA 3EDEA 3L5IA 2EDRA 1PEZA 2QSCH 5F1NA 2HLFC 4UIKL 5AAMA 3IT8D 4KQ3L 4S2SB 3OKMB 3P0YH 1HNGA 3UX9B 5HDQL 5GGVH 1U8KB 3SDCC 1DZBA 1P4BL 3QDJD 4POZC 4LLAA 1YYMH 4H25B 1RJYA 4GT7A 3KPLA 4YO0A 1INQA 4HXBH 5DTFB 3BAEH 1BZ9B 4NCC1 3QNXB 3S36X 5C0JB 4W6WB 2LAGB 5D7SL 5JW4N 3FB5A 3KVQA 1MJ8L 3TPUB 2KL6A 5T3ZD 4JRYE 2JJVA 2VDPL 4MDJB 4UUJA 5IBTL 3DV6B 3VH8G 4PJIA 1G7PB 3O11A 3UJTL 3RPIB 1C16B 1CIDA 4HX1A 1GZPB 3GKZA 3WIIH 1JGLH 1UCTA 2IMMA 1W8OA 3BQUA 2K9UA 4WWKA 4D0DB 3SOBH 5BS0D 2UUDK 1X6LA 3L3IA 5HGGS 4MA1B 3U36A 2ADIB 5DS8B 4D8PA 5C07A 1PQZB 4E41B 4DFIA 2DQJH 4NNYA 5D70H 4FFYL 1D9KA 3L1OL 1GCFA 1HILB 1YEGH 4WW2C 1ONQA 1OW0A 1IEBB 5HHXH 5DQ9A 4CN1A 4J7RA 1KCLA 3D85D 3G5ZA 1Q0YL 2BXYA 4PREB 4HFUL 3L7FB 4WUUB 5HI3D 5EH1A 3QO0A 3RUGF 4EBQH 1U95B 3JV6A 2NY7L 2Y36L 3PGFL 2OBGA 4Z0BL 2FEDD 5DJYB 1K4DB 4NWTL 3WUZA 5D6DC 5IF0A 4YHIB 1S7QB 5F96L 3NFPA 3QUMA 4FXKA 4FQCH 3ULVC 5C7XH 3MV9D 1T2JA 2Q3AA 3MBEA 1MFNA 1EH9A 4NNXA 3BDXA 1OPGL 4XWGH 2XN9B 3Q2CA 2X4UB 1JNHB 3KLSA 3RWDB 1XF3B 5FGBC 2GFBB 1E28A 1I4FB 1KFAH 5D7JA 5IHZA 5JHDD 1JWSA 5BXFB 2EDTA 1MRCH 2V7NB 4NJAH 3BDBA 1QQDA 1EEQA 4RMQA 5MEQB 2BSSA 2CLZA 4RWYL 5EBMB 3B9KB 3RUGE 3UXFA 5IESL 3F12B 4KV5E 3SDAA 4ZUSA 3TO4B 4NQTA 1CFVL 35C8H 4DVRL 5JTWA 4UU9A 4MHHI 1DQQA 4B0MM 2WQRA 2HN7A 3LD8B 4ODWA 1HYSD 4YLQT 1ZVYA 2DF3A 3CMGA 4JGMA 4XCYB 4N8CH 3QUKB 3CLFL 3AUVA 2ZOKA 3R0MA 5KSUB 1SEBB 2GJ6D 3GUTA 4JRYD 4PJHF 1WC7B 1FZKB 4LCWB 5KVFL 3L3GA 3SDCD 5EA0L 4KGJA 3TYFB 3TIEA 3F7QA 4OD3H 5DMJB 3S4SG 1A2YA 3KPMB 3U4EB 2XQYK 1JE6A 3LKNA 4N90D 4FHBD 4PBXA 1ZLSH 1QOKA 3TVMB 1MPAL 4RBPK 3HMXL 4GKOA 2GKIA 3MX0A 1R5WA 4PTUA 2CDFA 1R3KB 3TN0A 3S98A 5A1AA 4UU9B 25C8H 1NC4D 3O9WD 1RK1B 2PTTA 4PJFF 4N0YL 1CR9L 5D7LA 4KJWD 2VC2L 3IKCA 1YQVH 4Z7NE 4EI5D 3BDYL 3O6ML 3T1FA 4UV4H 4ELMF 3ZTNL 1F97A 2R2BB 3GGWB 5DJ0B 5I30H 3CFCH 4X5XB 1CTOA 3BQUB 5DJ6B 4XP9L 1CLZL 2EKSA 3MCLH 3H3PH 3N0PB 4WW1B 4MD5B 1PX4A 4ZUUB 4FFVD 1Q94B 4HIEA 4S1RL 4HWZA 4FNLL 4R3SB 3LN9A 4U1GC 4MSWA 4K7PX 3NIFF 1JV5A 4MNHB 4Z5RB 4PRBA 4QHMA 5FM4A 6FABH 4ZPVA 4N8CL 2EDDA 2Q6WA 4OZFG 1G7QB 3HR6A 4JFEA 3LKOA 2WWKT 5ACMA 5HI3C 1Z6JT 3H9ZA 4G80A 3RWCA 4YFEA 3KYNA 1EZVX 3KPOB 2X4QA 4I5BA 1Q72L 3ZDXF 1D5MA 3TBTA 1CL7L 4KDTC 3KLHC 1KTLB 1WFTA 3QIUA 5IB4A 3RZCD 1ZHKB 4R4BB 2XZCL 5E70A 3P4NB 3VGAC 4L4TA 2Q8BH 5DC9B 4AENA 4CMMA 5DGRA 1E27A 2JELH 3BH8A 4MWFA 4RGMB 4M3KB 3RWIA 4X7DC 2B2XL 4BSVA 4E41A 1UB6A 2MOVA 3O6FC 2J5LC 5EOCJ 3QHFL 1CYGA 1T03L 4GW4A 4ZODA 4WWKB 1DBML 4BFBD 1Y18A 2R8SH 4NN5C 4KI5E 4D3CH 1NC2D 2C7UB 5I75B 1KIRA 2V5RA 1I9JL 2DM2A 5FGSA 3T4YB 3QIWA 3QIUD 3RZCA 3VXQA 1NGPH 4L4TD 4NUGL 1T0NA 4DZBB 4BFEA 5AG9A 2O5XL 4X6FA 3MCLL 1SVZA 2JK5B 1XT5A 3KPNB 5HI5C 5DHVB 3TBWB 5EOCH 1FAKT 4JDZA 2A73B 5HVWA 2A77H 1WEJH 2AV1B 4KAQL 4NOFA 1JTTA 3T3ME 1NEZA 4FQJL 5DJAA 3QDGD 2G5BB 2IPTH 1INQB 2F53B 5E03A 2JIXB 3PDGA 3RWHB 1IGTA 4WV1C 1KPUB 3NFNA 3DRTB 3D3VE 1LNUA 5ENWB 2XWJB 1B0GA 2HH0L 1LE9A 4QT5A 5ACZB 5FB8A 4FZ8L 1T89A 4L4VB 4NGHL 5I76A 1JGUH 1YEJH 5T5FH 1OT1A 3MR9A 3LQMA 4NRXA 1LP9A 4HKJB 2JIXD 4K3DH 4LCWD 4LHJB 4JM4H 3U7AA 3ZKXC 4NC1E 3C9NA 4DWHA 4KJWC 2PO6D 2XWTA 3M1BA 4NN7C 5EU7C 4U6YB 1MFCH 4RIRA 2DB8A 4Y5VB 1FE8H 4IOIA 4F58H 4XVSL 4EI5C 4OZ4B 1R5VB 5SV3A 3UTSA 3MV7E 5CSBA 4DGVH 2DQGL 1QSVA 1DQTA 1UQSB 2YN5A 4HIHA 4OCWL 5IKCB 2YN3A 3TBVA 2IANE 1A9BA 4J8RA 5D93B 5F1IA 5B8CC 3L3DB 1XGQA 5DRXB 1CQKA 5DI8A 5C0CE 4EIGB 1BX2B 5GGVL 1QLEL 3HE6B 4AJ0A 3C8DA 2LVEA 4JZJA 4PJEE 4XPGL 1KYOJ 4WHTB 3GSRA 4TRPL 5D9SA 3F58H 2XTJB 4LIQL 5GSRB 1LO2H 4NO5A 4PG2A 2FB4H 4OGZA 3PIQA 1MNUH 5GIRB 2ICEB 1W0YT 3C08L 1HHHB 3TJHD 3SGJA 3NA9L 3MLTA 9CGTA 1NMBH 1ADQH 4LLWA 3RVXD 4N1CA 3AREB 2UYLB 4XTRD 1MLCA 4GSDL 4FQIL 5CIPH 1YJDC 4XNQA 3IRPX 5TDPA 4XPFL 5J56B 4M1DL 4JO1L 1KCUL 1J5OL 1I1FB 1IGFH 3ESUF 5DD5L 1OQXA 5T3ZL 1A7OL 1ZA6B 4QTHA 3K4DA 3T4AA 1A7QH 5CGYC 3UP1A 3I75A 4Q6IC 1IAOB 4F8QA 5F96H 2QQKH 5JOFB 2MTPA 1I9IL 1XGUA 2A83A 2C26A 2ERJB 3BGMB 3QAZB 4TUKH 3IDJA 1H3PL 2Q87A 2BSRB 3O3EB 4YC2C 1NAML 1HQ4A 1ORSA 1FFNB 3WL9B 5F3HB 4IDJH 2F74B 3C6LC 3O2DH 4OF7A 1RIUL 1XIWC 4M1CC 3O2VH 1LEIB 1OB1A 3CK0L 2GK2A 3IFOA 2VAAB 3DVIA 1ZVSA 5FYKE 5GISH 2V9QA 1JPFB 1EMTH 1EUUA 3HG1E 1F3DJ 1N5AA 3C5JB 1YN7A 1FNEB 1T20A 4NBXB 3FRPG 3SGEH 1LEIA 3UJJH 4RX4A 1N8ZA 2HP4A 4F7MB 4DKDC 4FS0A 4KDVA 3S88H 4TUOB 1FDLH 1RZ7L 2NX5B 2XIDA 4HGWA 3V7MA 1PEWA 5FO9A 3ARQA 3SBWA 3IDUA 1N7ML 5C09D 1HKLH 2ATPA 1IRAY 4JO2L 3ARYA 5IMKA 2HT2C 3OXSB 1J10A 1XGUB 5KOVC 1EHAA 5C0EA 2YC1B 2NW2A 3S35X 3MRGB 5IP4A 3NABL 4YE4H 1I3UA 1TTFA 3ARPA 1N5YL 3GI9L 3LEXA 1EDQA 4D0CA 3QZWB 1QNZH 1OWWA 4XMLL 4WU7B 3RZWA 2R56L 1FNEA 2X9XA 1OSPH 1GIGL 1N6QL 3C5JA 2YC1A 3H9YA 1ERNA 3LPFA 5C2BH 4G8GA 1RI8A 2FZ3B 4X4ME 3B9KD 3CFJB 5D2NB 4R2GC 1G9ML 1EO8H 4G7YL 5KZCD 3D39B 4OFPA 2P46B 4OCWH 1YNLL 1HEZB 4OIIL 2YUXA 3FFDB 3LKPA 4HGWB 1QFHA 2HVJB 4MQXD 3KAAA 4ALAH 2IJ0C 3GIVA 1FNFA 5E7FA 4PRDB 1BFTA 1UT9A 4XCFL 2W65A 2X89A 4PJBA 4Y19D 3G6DL 4CVZA 3B5TA 1NAMB 5JOFA 1Q1JH 2NY4B 3T0WA 5INCB 4PGZA 4HF5H 3T77B 4G9DB 3TIDB 1WVZA 3FRUB 3KPRA 3JTTA 3SKJH 3EO0A 3NIFE 3DLQR 1TLKA 4HCRL 5C0IB 4PLJD 3KR3H 1FFNA 3VCLA 3T3MF 2BSRA 1WAAA 2NX5E 3SGDH 4XAWL 4PBWD 1BFVH 2BOCA 1QVOA 2ZCKH 1PGRB 2ESVA 1OWRM 4EIZC 2EC8A 2FJGA 3B2VL 5D1QB 3FAXA 1R3HB 3BRGC 4PRAA 4WTZA 3CLFH 2ZJSL 1WGOA 2Q76B 3QRFM 3WLWC 4IRZL 5GZND 1EFQA 4KZDH 3FZUC 2BY0A 1U8HB 3IYLW 4WDIA 3Q0HA 5FEBA 2J8UB 5K9KB 1OW0C 3V6FA 1B2WL 5T3XE 4I18B 2D7MA 2Z91B 1P7QD 1F2XK 2FR4B 5TE4H 5TGBB 15C8H 3F65A 4Y4FC 4U1SB 5FB8B 2DI9A 3T2NL 3WMSA 3QXAB 2G75B 2DYPA 2BNRD 3EGSB 5SWZB 3ZKXB 3JVGA 3O2DL 1X3DA 4KKLC 4WJ5A 5CJQH 5GIRA 4MJ5A 3UTTD 1MCDA 5JNYA 1NPUA 2ICWB 4FG6D 4PTTB 3AC0A 5J06A 4E42B 3H0TA 1P6FA 2VH5L 1KJ2L 5MEOA 3RP1A 3OBAA 2WUCH 4JDTH 4LSTH 3DSFL 2APWA 3M1BB 4M9OA 1JRHI 4GRMA 3HZKA 5D2NE 5I8EB 1T0NB 5A16A 2Y25A 3H3PL 4J4PC 4P2RB 4AEIL 4M7KH 1QO3B 5T1MA 3GZKA 1RUAL 3WS6A 1V05A 1F6LL 1X5HA 3BXNB 3OB0K 5C70A 4UDTA 1IZKA 3RNKB 1E4XL 2ORBH 4I0PA 1KJMB 4U6XA 1PG7X 3C2SA 2LU4A 4LRIA 2XWTB 3O4LE 5DZNA 2VXSH 4PJ7E 3MV8E 1BWMA 4ODTH 4KI5C 5J8OA 1AC6A 3AS0A 4YGAB 4RFNC 4PJEB 2EKJA 2Y6SC 4XP5L 1II4E 4YDJA 3NBNA 3BP4B 1XF5A 1YEJL 4ZQKA 2CIIA 1YPZA 4Y16C 3DI3B 4EKXA 3AU1A 5E4EB 4KK6D 5DHVA 1WF5A 1FVDA 3UAJD 3VWKC 2JK5A 4LCUB 3HC4L 2Z8RA 4D2NA 1IEAB 2G60L 3QG7L 5CP3A 1LILA 4U1NB 4P59H 2FX7L 4LASL 2JIXA 4QNPF 1KG0A 5A2JH 3FQXB 5IW1A 4H88H 4MJIB 1T1ZB 3OAZH 4GKSB 5HDBE 1V7ML 1WIOA 3EFDL 3FTGA 3TWCL 4OFVA 3MTRA 5KVDL 4XBEL 1A7PH 5M94B 3T3PE 4XP4L 3JTTB 3AGVA 3DX9B 4JN1H 4KPHL 3WFCH 1J0IA 4NN6B 4NUGH 3VRJB 2R23B 2VUYA 5F7NC 5A43C 1YEEL 4OCRH 4X5XA 1SBSH 3L3HA 1XGPB 4HGKC 4PGJA 3QIWB 2WWKO 3KLAA 4EJ1C 3GSVA 3IF1B 3UTPD 3GMOB 2X4QB 1Z9OA 4U1LB 2FATL 4JKPH 4WEMB 3FZUD 2AJUH 5F7WC 1RK1A 2PXYA 4UTBL 5E6ID 3LKOB 1J88A 3GHEL 5IJKA 4X0KA 3KDMB 1G7JB 4PJFB 1DBJH 3MREA 2FZ3A 1A64A 2ITCB 3J8F7 3BZEA 2V2XA 5DHVH 2EEDA 4EXPX 4LP4A 3C5SA 3KPTA 1IC4L 5IMOA 4I5BB 2FECL 1RUQL 1UWXK 2DI7A 3MRJB 5ICZA 3CFBA 1RFDL 4R26H 1IVLA 1S7VA 4M6AA 3LB6D 2P8MB 1AQDA 3T2QA 3PWNB 2R0ZH 4HIJA 4XCYA 1ZWIA 1RJZB 1JIBA 3FOMB 3WIFA 3O3BA 4F7EB 3VWJB 2HJFB 4BQCA 1HCVA 2CDGA 3B3IA 1EAPB 5FOBA 4LGSB 4PRIE 4JN1L 2D7QA 5CILH 5IVNA 2EH8L 4PTUB 5E99H 5FA3A 1MREL 3VXUD 5FF6A 4KK8D 4OCRL 5J1TC 3TVMA 1FFPB 1CG9B 3BKYL 3BJLA 4K7PH 1KLUA 2BFVH 3G5YA 3MCKB 3VDAA 1BVLB 2YXFA 5DRNA 3QCTL 2BRQA 3VFMA 5FA3B 2BNQD 3MRJA 1NJ9A 4LGRB 2BVPA 4P2QD 4OZFB 1I1AB 2A1WH 4ODHL 4QNPE 3P9LB 3EDJA 5HHQA 3C5ZB 4U1HA 1KPRB 3OB0H 3TESA 5T33H 5TQ0H 1TVBB 4M8QB 4KI5F 3O3BB 4YHIA 5IBTH 2YWZA 3D85B 4L3ED 1WV7T 3UAJC 3VWKD 4NDMA 2BHZA 2QKIB 1ZK9A 2OZ4H 5C2BL 1ZA3A 43C9B 1U3HB 5LVEA 3CX5J 2VN4A 1HXMA 4HWEH 3TT3H 3QXTA 3CJJA 4YBLB 4AEHH 2DLIA 2AAVA 5I1EL 5F97E 2IALB 4GMTH 2XPGB 3CFIC 4MQTB 3SGJC 4JR9L 4M61A 1BVLA 2BSSB 5DRNB 3G5YB 1T66C 2P5WD 3RIFF 3R8BB 2GITA 4HT1H 3FRPA 4TTDD 1N59B 3AREA 2IPKA 2HN7B 5DYOA 3NCEB 2CKNA 1FG2A 1U6AL 4NT6A 3P4OA 2APBA 4ENED 2EDLA 3RWFB 4G8FB 4AY0A 2G2RB 1XH3B 3X13B 3WDIA 3NCBB 4GMSL 2B4CH 1H0DA 4Z7VF 4MAUH 1G7PA 4X4YB 1NGWA 2VITA 2GCYA 3QEQD 2FJHA 5FYJL 2P8MA 1JWSB 4AH2A 4ELMB 2VSCA 4P46A 2W59A 4V2BA 3C60D 4ONFH 1JNHA 2E3VA 1QA9B 1S9WA 2HTKC 2LQRA 1AGBB 4OM0L 3U83A 5DRWB 4L8CB 5E8PB 3K8MA 3M45A 5D96C 4FFZL 3UTSB 1YEKL 4UQ3B 5IT2L 2HRPL 5AWNH 4Q74A 5BRZE 5DS8A 3QEQA 3QUZB 2CK0H 5EUKB 5ALBH 4KK5D 1EPFA 3T2OA 2ZG1A 4Q9BA 3GM0A 4DQOH 5HYJD 2XG5A 4XVTH 2ZZUT 3GI8H 2MKWA 1QO3A 3DURA 4K9EL 1AGEB 3ILQC 5I15L 2RB8A 4HWBA 7FABL 4WNQB 2IH1B 4AIZB 3UBXG 4XT1C 1LP9E 1ZSDB 2IG2L 3AM8A 2QQKL 2XWJA 4W81A 3RVUC 1OTTD 2NXYB 4PJHA 5GS0D 5C0CA 1JZ7A 3D3VA 2ADIA 4KU1A 1DQLH 3FT2A 2IANA 3P40A 5DURB 4NKIL 1Q9LA 2GY5A 4PJ7B 5CJQL 5HVHB 1G7MA 4JAMB 2W0FB 4NZDA 2IAMB 4XCNA 3EO1B 2BK8A 4RRPG 4YXHH 3OKMA 1DBAH 4HEME 3BGAA 1H5BA 1ADQA 4JJ5A 1TITA 4HS6B 1TPXC 4Y4KD 5DEGB 1S9XB 2IH3B 4F57H 4ORZC 2IH1A 1D5IL 1HZHL 5C0JA 4YGVB 3GHEH 5DUML 3RWGA 1KCRH 4FN0A 4X4XA 4GAFB 4J3TA 4GW4B 5FHAH 3SKNB 2ICWA 3SO3B 3DV4B 5IQ7H 2Q3ZA 2AABH 4GXUN 2BZDA 4F9PC 1VA9A 1OM3H 1M4KA 1JI1A 1RHHB 1A4KA 4CN6A 1BZQK 1NCCH 2C3VA 4JY4B 5B38A 1BQHG 3GSWB 1J1OL 5DA4A 4JPIA 5BV7B 4NQED 2YK1L 5DMKB 5C09E 5GRUL 4HUXB 2W60A 1QA9A 4NKOB 5HGHB 3HRPA 5K9QI 2VXTL 2X05A 2I26N 3UC0L 3HI5L 3MYJA 4UT6L 4PP1D 4RWHA 3HAEH 2WNGA 4OKDA 1FDLL 4GRMB 1YC8A 5JOPE 2F5AH 3BZDA 1CFQA 1DN0A 3RVVC 2X9YA 4Q9RL 4F15B 1Z9MA 5D7LD 4IJ3C 2EDKA 1YMME 5DJZA 1FVEB 1EHXA 2MCPH 3HZMB 2I5YH 1EO8L 4G7YH 3VFOB 4BFIA 2VZTA 3EYFB 3BWAA 3W9EA 5DRZA 1JNLL 2VLKB 3VCLB 1IAMA 4NT6B 1CL7I 2I25N 1AGDA 2X1OA 3M17B 4O2EA 4ZD3L 4JZOB 2G75A 4YHYB 1W2KT 5CINL 3KPRB 4K71C 5B39B 2NZ9D 4OT1H 3UTTB 5CBAB 1NFDF 3O81A 5IWLA 3W11C 4I0KA 5KANG 1QD0A 1MFAH 4OZHF 5TE7L 2X4SB 1IFHL 5BQ7A 3FN3A 5IB2A 1NCAL 5IBLC 3QUYC 4X6DF 3OTTA 2CK0L 2NTFB 1YEIL 1OAZH 4LQFH 1NDGA 2RFXA 2VXVH 4MAYC 5FO8A 1IQWH 5DO2C 2EDQA 2FHFA 1HE7A 4LBEB 1WFOA 3ULSA 3UYRL 4OUOA 5FO9B 5C09B 5DT1L 5CUSH 2AJYL 2O5YL 2BVPB 2HFGL 4B7LA 2YRZA 3L3GB 4O58H 3VXRB 1F4WH 3SE8L 2NCMA 2Q8AH 1RUQH 2A0LD 2OL3A 4NZRL 1QR1B 3QUKA 4X9GA 1I7ZB 2EIBA 5K9QG 2ATKA 4ZNEE 3O41B 4LRIC 4N8VG 5EU6D 3C6SB 1B4JL 1O5DT 2IQ9L 3OXSA 4LCIL 1ETZB 1T5WA 3TJEL 2A6KB 3T2NH 4P5KB 5CEYB 4IRZH 3ZYOA 4WFHD 2F74A 4LU5H 2OJZL 3WIFB 1R5IB 1XGYL 5FGCE 3QIBB 3WFBH 1M7DA 3EKCA 3ET9F 2B5IC 1TJIH 5L88H 2JJSA 3E6FB 2Q1EA 5HYQB 2SEBA 1CD8A 1CXFA 2OI9C 3KXFE 3NFSH 4R97C 1VACB 3OZ9H 3P9WB 4IRSC 5EDXA 1MCRA 5DVOA 4N0FB 4CNIA 5GZOC 3FAWA 8FABB 5D6CB 4XAWH 1OP3H 2R1WA 5CSGA 4PJXA 5DVLA 1MIML 4OJFH 4BQ9A 4LHUB 4YXLL 2G5RA 3PHQB 4RBPH 4WFED 1I8LA 1KCSH 4DW2H 1KEML 4X9HA 2WLYA 3OQ3B 5I6XC 1X6NA 4U1LA 4FP8L 4BK5A 4QLRA 1ZT4B 3IF1A 3WXVH 2WIMA 5EBGA 3PWPD 4XNZC 1C5BH 2PXYC 4X80L 1I3GL 2P1YA 5HHOB 3ILPA 1RK0B 2DIAA 4MYWB 1FO0A 2WWMD 4N9GA 3VWKA 3P0YL 5C8JB 2MKLC 4TYUA 2AQ2A 4OLUL 2EDXA 4EUPH 2W1NA 1XGQB 2FIKB 4JFQB 4MGXA 5DSCA 1BVKA 3FQXA 5IW1B 3RX8A 5TH2B 4M62H 3TBVB 5IHBA 1VERA 3W11D 1GIGH 2DQTL 2E9IA 3PWPA 4MXWH 3ISWA 3X3FL 2J88L 5HHVH 2A83B 3DI2B 2RIKA 4MDJA 4D3CL 5ESAA 3S9DB 3QUYD 3TO4C 3GSQA 5J9PA 3GSRB 1H3TA 2APXA 5ISZE 3S5LB 1NGPL 5C07D 2FD6L 5IK3A 2J2ZA 4WUUE 3GMLA 4JHBA 4MJ6B 5FECB 5IT2H 3ZMRA 4J3OC 2Y7QA 4GXVL 3MYJB 3WCYA 5C9KA 3CXHK 1WTGT 4C59B 5JW4R 5ALBL 4OM1H 5H37G 1ZANL 1IT9L 4MX7B 2F53E 1LO4H 3RJDA 4U33A 4JPWH 2R1YA 5EU4B 5AYUH 2V17H 4JY5H 3ULVD 5IVZB 5I8KH 4DN4H 4ODHH 2A0LC 4C4KT 1MHHA 1MHPH 2HFGH 4P23A 1CD0A 3WO4B 4ZG1A 3MRCA 1DBJL 2LE9A 1TVHA 1GXEA 3HAEG 1JWUA 3U2SB 1U3JA 3RWGB 4U05A 4OI8A 2AJZA 3ARBB 4Z9KB 4LAQL 5ERWA 1SJEA 5D1XA 4NRXB 1GHFH 1AXTL 4X7SH 4PGDB 5ESVA 2P8LA 1T1WA 1LVEA 3OJMB 1K5NB 5F89B 4YAQA 5JR1L 1CLCA 1UYWH 2FCBA 1A7NL 2FECI 4KRPB 4QKXB 1FNHA 1UKSA 3CFEA 5IEHB 5DJCB 2AJXH 3L3KB 4L5FL 1Y6KR 3FB6A 4KTEL 3ZYIA 3MACH 1ZHLB 1NEZB 3S35H 2XKSA 1RVFH 2HKFH 1UB6B 5E2UH 4G6FD 4JDZB 4U6VH 5I30L 2P45B 4FQPA 3LSOB 4KWUA 1LO0L 1LQSR 4P59L 4AENB 1KCVL 1GOFA 1CT8B 3MRRB 3MXVH 1A6UL 2NY0D 5T5NF 4LASH 4OGXL 2UY6A 1NMCC 3FOLA 4XCFH 3JXAA 1BREA 1RZFH 3HS0A 3T2PA 4N0UA 1KB9J 1CFTA 1AP2A 2VDPH 4L4VA 4R6UA 5KVMC 3A6OA 4Q6YA 4HMCA 4ZTOH 1U8IB 3O4LA 4MNGA 1QSFD 2FB4L 1XF4B 3QDGA 4CDGC 3V0WH 3NFNB 4KVNH 5JUEL 2Q6WB 5TQ0L 3U46B 5T33L 3SKMB 4OQTH 2ENYA 1D5XA 1REIA 2WLZA 4NIKB 2XYCA 3UO1H 5C0IA 1T6WA 3LEVH 4XP6H 3CNKA 4L3EE 2XY2A 1K2DA 2QSTA 4WHDA 4EN3C 3TBTB 4PGBB 5EC1A 4KFZC 3FFCE 3F7YA 3EYVA 5E2VL 5I8CB 5C6TH 3L3OA 5TE6L 4GRWE 1NGWB 2VITB 4NN5B 1EGJA 5K33A 5KSBF 1WICA 1LO5A 3MRLA 5GGUA 3ZE0F 3NCYP 2BVEA 3KJ4B 3P2TA 3IKCB 2EE2A 3FFDA 3BW9B 3LKPB 5KANI 2XN9E 4QOKA 3O8XA 4JPKH 5FIEA 1HK6A 3CMOL 1U92B 2NY2D 2IQ9H 4YXHL 2A9ML 4WW1A 1U8LB 1KBGH 3A6CL 4X8JB 1OP3K 3G5XB 1J1XL 4EEEA 1TQCC 4ELKA 5C7XL 3RBSA 1ZHBB 1ZLSL 3ESVF 5DVMA 2J7LA 2GITB 5JPMB 1DLHA 1S7XA 2H45A 3KYKL 4AG4L 3OGOE 2GY7B 1X7QA 2HVKB 2A1WL 4K3EL 1WEJL 3SKOA 1KEGL 1NGYB 1P7KB 3UYRH 3FQTA 2IQAB 3DYOA 2UUDH 2PW2A 2IFFL 2X40A 3DX6A 1TZGH 5DDHA 3OZ9L 4WRLA 5SWSA 4QF1B 1NC2B 3FT3B 2NY0B 2D7PA 5IFAL 2FX9H 3WNNA 2FATH 3QSKB 4PV9B 4FFYH 1DVFA 2Z31B 2AI0H 4G3YH 4MXQD 3MA7B 4HG4K 1A7QL 2AJ3B 1VSCA 1HXYA 5C6TL 2Q8BL 4LHUG 1MELA 4PRNA 3RNQB 2FHBA 3FQWA 3MODH 1RZIA 2LTQC 5CP3H 4D0BA 3BPCB 5IB5B 1JHTA 5D72H 3H9SA 2GFBA 3DYPA 3VGBA 1ORSB 3WL9A 3DX8A 5HYJE 1C08A 2WK2A 3Q6FA 3G08A 1MJJB 3BIBX 3PV7A 3ULUH 4GQ9L 4LVEA 4PRPA 2PCPB 3SDAB 4JQXC 4R0LA 4EI5B 2E7LC 5EU6A 1W72A 4HC1L 1LK2A 4FQQB 4PJGF 3DO7A 3WUWB 3OJDA 1MF2H 3PWNA 2Z31A 5DMYA 4X98A 3TNMB 1INDL 2XKNA 4Y4HD 1ITBB 1Q0YH 1L9NA 2FEEI 5FUOH 3B9AA 3TVMD 1K3ZA 2XN9A 1TTGA 3QQ3A 2P5WB 32C2B 2ARJB 3MUGA 1NGQH 1F6AA 4DCQB 4UAOC 3UTPE 5FK9B 4RX4D 2OTUA 1F42A 1J1PH 4PBVC 2QEJA 2DMCA 3ZYJA 4NNYB 1WFNA 2ADFL 3MLZH 5DHXB 5C07B 4WFGD 5CIPB 1YEDA 1X7QB 2E27L 2DIJA 4PJ8A 4NO0A 2Z35A 2BY1A 1W72B 3NGBC 2YKLL 4O5LH 1PKOA 2PCPA 4C57C 2GK0B 2FSEB 1XCTA 1LMKA 3VG9B 4MZ3A 4X6CF 4Z18A 5FDWB 5D2LF 4CW1A 2DLTA 1WBXA 5HYFA 3QH3B 3TCXA 3OSKA 2X4UA 2EIZB 3FQUB 2B39A 4XCEB 4TSCH 2ZCLL 5JW4Q 1BZ9A 4OV5B 4OCSH 3OXRB 5CZXC 3WJLC 4NRZB 1ZS8B 2RHEA 1L6XA 1JZ2A 1GZPA 4MXVE 2FHCA 1UZ6E 4QRPB 5B39G 4Z7QE 4JHWH 1UXWB 1PLGH 5EC1B 3MRHB 3CFDA 12E8H 4U6YA 4PJBF 3PHOA 4KHXL 2J5LB 4L1HA 1XIWA 4OM1L 2V7HA 3S8WA 1F5WA 4XVJH 3ULUF 1HH9B 2XA3A 1D5XB 3DSFH 3VFVB 4OI7A 4PS4H 1LP9F 2F54E 1IEBA 4K3HA 5DDHB 3ME0A 5IJVB 3BD5A 2CLRB 2HFFA 3K2MC 5EB9A 1MY7A 2MPAH 4ZFOB 4KRMB 3MGAA 5MERB 3KR3L 1A7BA 5JHDB 4Z7VA 2EDEA 1A6ZB 3QNYA 4LPXA 5KS9E 3SE4A 1BFVL 4LMQI 4LAQH 3SGKC 1RIHL 1AC0A 4QRRA 5I8KL 3AB0B 2H9GB 5GGVY 1KCUH 2DWDB 1Z0NA 4W4OC 3AXLB 4OM0H 3C08H 4Q6IA 1LO4L 3ROOA 3HG1B 3NA9H 4XPAL 3ZDYF 3TV3H 1QSZA 1V7NL 5E8NB 3TT1H 4ZS7L 4K3GA 3WKNA 5IVXA 3QULA 5E0QA 3SE3C 4ONOA 3GMQA 5TDNA 4NO2A 4FABL 5AZ2H 3MOQA 4LLUA 3U7YH 3ARZA 1FL6A 4E42A 3KPLB 3MLYH 4CADB 3SCMB 2J8UF 4YBLC 1GL4B 1PY4A 5GGTL 1CGUA 3CU1A 3CVHH 4NQVA 1ZMYA 3UTSE 4BSVB 4M4PA 3N1FC 3ROOB 2ADJA 4P2QA 1CDIA 2N1KA 3U2SA 4KVCL 2FDBP 3E0GA 3CXDL 1XF2B 2Y5TA 4U1SA 5FYJE 4QRRB 4NSKA 3LKRB 4JFED 4EOWH 4I1NB 4ELME 1IGMH 1ODAA 3LS5L 3MFFB 4ZAKD 1XFPA 5B8CB 4R2GD 2WUBL 3BUYB 4H20H 4QHLA 3NMEA 5GRJH 1RZJH 1TCRB 2VO5A 2DQEH 4QHMB 2KUTA 4X6EA 5CZVL 2YD4A 1B0WA 2C1PB 1WQVT 4MJ6A 5FECA 1R3JB 1G1CA 5EPMB 4ZTOL 3JV4A 4ZPTB 1ZEAL 1JNNL 4QHKI 3AVEA 3QG6B 4PJDA 3TN0C 1P9MA 1JK8B 2D7TH 4IRSA 3TT1L 4WW2B 5I16B 3LRHA 2FO1A 4XXDB 4XB8A 4UDUB 1NAKL 1AQKL 3RZCC 4TSAL 4KAQH 4MZ2A 3D39D 4AK1A 1QBBA 4LSPH 3GIZL 1CD1A 2DLGA 4OFDA 5I71C 1OAQL 2W65B 5D7LB 5GHWL 1KNOB 4KJYA 2XXMB 4X7SL 1TJIL 5L88L 4YE4L 4PJEF 1P2CA 2VLKD 4HAFA 3HPLB 4YHPA 3FONA 4ZNEA 3MV11 1RZJC 5L2JB 2ZUTA 1BFSA 3IXTA 4OF6A 4HG4J 1BZ7B 1AFVL 3SDYL 4J3VA 2NY5H 5DR5L 3X17A 5GJTH 2DQCH 5ITFA 1MI5D 3V0VB 3ZO0A 5EO0B 2R2EA 1BGXL 1F13A 2BY2A 3R1GH 3LS4H 5I8OH 4HS3B 5ADOH 4BZYA 2FBJH 5HYSB 1CTNA 1E4KC 4HKZA 2V5YA 4G5ZH 3LCYA 4JHZA 5C71A 2C5DC 2PYEE 1Z3GH 4PD4K 2RCSH 3T0EB 1HHKB 3PE9A 4X98B 5IMMB 4DKEL 2X44D 4RAVA 2APFA 4DKFL 1CVSC 5ESAB 4DOHE 2HRLA 2D7NA 5CEXB 1U3HD 4H1LA 1D6EB 4JFYB 4BUHA 1PZ5B 1SHMA 2VXVL 2GSIB 1MJJA 5SWSD 2VWEE 3SDXF 3W0WA 3MLPA 2E27H 5D5MB 1XF3A 2O26U 4MB4A 1ZVSB 4P5KA 5KVGH 4NNPH 4DEPC 4OZIF 3DXAB 4Q0XH 1KTDA 4YZFF 2EYRB 2ICCA 5I1LA 4NQCA 3OKOB 1W8NA 3VWKB 2A6DA 4KMTH 3F5WB 5HHOA 2LAAA 4KI5D 1WITA 1CU4L 1QFPA 2JJWA 3ES6A 4WO4A 4EUPG 4HUUA 2MSPA 2I27N 3GHBL 1JPTL 1JF6A 5CZKA 3RUGA 5BJTA 4WUUA 1UJTA 4OGYH 2VLLB 4OLWH 3RY6A 4JM4L 2H32B 4TN9A 5EWIL 5GS1A 1NBYB 3OKYA 4NHCL 4K9EC 2X4NB 4HKBA 4A6YH 1PKQA 3BAEL 4WO4B 3CSYB 1B0RA 1RUMH 3MLUH 4L9DA 1T89C 5FFLA 4ALAL 4JKPL 5DQJB 3H2WA 3OKEB 2QR0B 3STZB 4DTGH 2AEQH 3H9HB 5CBEA 3DSNA 1MCQA 2DKUA 3QZWG 5CEZL 2YPKB 2EYRA 2W9LA 1A6TA 5IB3B 1X5KA 3HLAA 4HJGA 5EC2B 1BQLH 1SM3L 3L95A 2W9EL 2AQ3A 2YD6A 2AK1H 3H8NA 4KVNL 3DPBA 1UZ8A 3LH2H 4Z76A 4TNVF 2SEBB 1UM5L 3BKMH 4JG1L 4F8TA 3ARBC 4LRNH 5T3ZE 3P0VH 1PZUB 3BZ4B 4GKZB 1U9KA 4JM2B 4IBLT 1TXKA 2XV6B 1JK8A 3V6OA 5TF0A 4KY1L 1G9EA 2XG4A 1P2CB 4YHPB 3MRLB 3EYFA 3R4DA 1WTLA 3FB5B 4XNUL 5EU7E 3VGAB 4A6YA 2VDML 4U4BA 3H7BB 1V3JA 4NM8H 3B9DA 3MACL 1M05A 1I1YA 3ARTA 2VDLH 2R2HB 1CFQB 3RGHA 1DBBL 1B4JH 1FGVL 4XNXH 4RFOL 4EVNB 5JW4M 3NIGF 3SBWC 4U6HA 2QTEA 4URTB 4BFGA 4X99A 2XZAL 1AXSA 3K1DA 5JR1H 4PD4J 4YHML 1DFBL 1IGJB 1C12A 3LB6C 2C3XA 1L7TL 1R3JA 5I9QB 4JRYA 1CXEA 4W6YB 4YDLC 1SY6L 1FPTH 2NY1D 3T0BA 4NQVB 1DL7L 1U93B 1U3HC 1B0GB 2VR4A 4P5TC 4X4XB 1LNUB 3DRTA 4P2OD 5EUOB 4M6OH 3MRRA 4YHLL 5JDJA 2HG5B 5AWNL 3ULVH 2DMKA 5I1HH 5E2WL 4XC1L 3SOBL 4MA8L 4R97B 3DUSA 4TNVK 4WWID 5E08H 4UV7L 4HUWA 1XF2A 4D94A 4N5UA 1CXKA 5C0ND 2KBGA 4GLRI 4IS6B 2XQYG 4Y0GA 5T1KB 5FYLL 3V9FA 5LXGH 1YA5A 4YHOH 5CD3B 2WMPA 4BM7A 5D1ZA 4U1KB 4XBPA 2OJEB 3M8OL 4GBXD 3B9KC 4PJGA 3S37L 1I8KA 3VXUA 4DZBA 4B53A 1VB9A 1CICB 3JWOH 1D3CA 1I8KB 2YZ8A 3RZCB 3UZVB 2VKXA 3X11B 1I3GH 3OHXB 3KPRD 1YMMB 4MQXC 3OG4B 1QRNB 1FYTD 2I5YL 2Y06H 4GRLD 3GJEB 3QHZL 1TVHB 4HUWB 2Y72A 5J13B 3WO3B 1MCFA 1J8HD 3HG1A 1S8DA 4FQLL 4CMMB 5HYIA 1G9NL 4KXZI 4OD1H 2E9JA 1T66D 1FZMB 4DTGL 2CMRL 1RUKH 3PHOB 4Y4KA 2XTJC 1U6AH 1YZZA 5IB3A 4IOFD 1QYGH 5F9DC 2R2HA 4KVCH 1ZTXH 5E9DE 1DDHA 4NN6C 3U9UA 5IFHH 4G80B 4D9RD 3ARBD 2ZSVB 1G7QA 1IGJA 3VFVA 4ZAKA 3MJ9L 5EZIH 4F37K 3ULVE 1U8OA 3OWEA 4JG0L 1QHOA 5DFVC 3TT3L 3WLWD 4BZ1H 2Z31C 3I6GB 3D9AH 4LEOB 2X4PB 1XCTB 1NC4B 3O9WB 5FUZH 1WUNT 1UXWA 4NNPL 4S10A 2P5ED 2CUIA 2DWEA 4TNWK 4Q6IB 1E4WH 5I19L 4Y4FD 1G7IB 1UXSA 2LTQB 3I84A 4K8RD 5HPMA 5DJ0A 2W91A 3INUL 2EIDA 1CGVA 5E8DL 1EEYB 3VFGH 1S3KL 5C0CB 3V4PL 1WBXB 2J6EA 1S9YA 3ILPB 2HFFB 4PJ8C 1IC5H 5TDOA 4NWTH 1N5YH 3DETD 1PZ5A 3TNNA 5CEXA 3IGAA 1HH9A 2EECA 1H8SA 4OZIB 3VW3L 1G7LB 5EOQH 5MENA 3V6ZB 1F4YL 1YQ2A 4P5TD 1MAMH 4J4PD 5EU6E 3KPPB 2NXYD 4OLVH 3VFRB 3KYOA 3Q1SL 3F5WA 1M6OB 4LCWA 1KBGL 1TPXB 3A6CH 4FFZH 4EI5A 3HR5B 4NRZA 3HNTH 3T0AA 2APTA 1WBZB 4JHWL 4GRWH 3CH1A 2YPLB 1PSKL 1RSFA 5HI4D 3HUJF 2FBJL 4OZFA 5GS1B 2EH7H 1JHLL 5AYQA 1VPOL 5I74B 1QPPA 3GMPB 2VLLA 4DK6A 3CD4A 4M03A 3K46A 3ORJA 4X9BA 1KOAA 2MFNA 4YFDB 4PS4L 3ZE1E 5DMIL 1NMCB 1AI1L 2VL5B 2VISB 1KT2B 5L2JA 3ARDA 4WI6A 1WLHA 2KH2B 4Y2DD 4K2UH 4KK6C 1HH6A 5F8RC 3BX7C 2CUMA 2A2QT 3T04D 1R0AH 1YEDB 4XAKD 3VXSE 2V7NA 5L7XH 4X7TA 2HJFA 3T09A 1IGYB 3PUCA 1BOYA 4R2GB 2IPKB 3VGFA 5BVJB 5FKAA 1P9MC 4BQ8A 1IARB 2RQ8A 4G9FE 3VI3E 2UVFA 3L5XH 43CAA 4TOYH 3NABH 1YDPA 2DRUA 4FXKB 3F7PC 5HGAB 3S3SA 4H1LB 4A6YL 4XXDA 4Y2DA 2VLME 4PV8B 3BZFA 2KQMA 1CZ8H 3VXSD 4LKCB 4X6CA 1ZXQA 4HD9A 4MCZA 4RAVB 4QYOB 4XP4H 4H5SB 3UJIL 4QEGA 2X4TA 4YDKL 1YN6A 5I2IB 2V5MA 5LBSL 3RVVD 3HHRB 1OP5H 3B8SA 3RHWK 1JWMA 3D85A 4FQHA 4NQEA 1U8LA 2OTWB 1G7JA 5TDOB 3IAPA 4YX2L 4I3GA 4QHLB 2X4SA 2VLJD 3MROB 1GVIA 4LFHD 3MZGB 4RDQG 1RZJL 1E6JL 1BZ7A 3KYAA 3MV9A 3O2WH 2AW2A 2BC4B 5SX4I 2VQUA 4N8VA 5L9DL 1IKNA 1RZGA 3Q3GA 2VR5A 3P4LA 1GZQB 1P4IL 4D9QE 2VDRL 4ZO6A 2BFVL 4Y2OA 1FO0L 3UBXI 4G8EA 3ARGD 4DKEH 4PJIB 5CD5D 1AY1L 3MV7B 1S5HA 1YNKH 3HZMA 1FVEA 3L7EA 4JHAL 4P3CH 2AI0L 1KG0B 1OGAD 1LDPL 2UWEA 3QIBC 3VXMA 1RJZA 3FOMA 1N6UA 4OSUL 1G6RL 4G6KL 2GTZB 1CDYA 1BVZA 1I7TB 3WE6B 1G1YA 2NXYC 1QKZL 4IRSB 4U1MB 5A40E 1CGSL 1C8PA 1J8KA 4HV8B 1P7HL 2R29L 4V1DA 1K3IA 4JO4L 4JPIB 4OLVL 3RGVC 1HI6A 1OCWH 2NX5D 1ZHBA 3ZDZF 3HPJA 3T65A 2B5IB 3LHPH 2GAZB 2IF7A 3E6HB 1JZ6A 5E56A 4FQCL 3W9DB 3PJSB 1CK0H 5LQBH 4R96A 3CK0H 3I85A 4YUEH 5FCUH 1FPTL 4UDTB 1KB5L 3RKPA 1BFOA 5HDLA 1Q9KA 2QADB 1Y6MR 3QCVL 1T2QL 3T0VA 1LO2L 5TF1L 2VZOA 4KPHH 3UZQA 1BBJA 2UWEF 2XFXB 1G9MC 4Z95H 2H32H 1IAKB 5ESVB 4H8WL 2EDBA 1NKRA 3HI1A 4PGBA 4ZTPL 3GBNL 4X7EC 2E6PA 4IS6A 3IFPB 5GZOD 4ONFL 4TTGA 3DGGB 2VDQL 4JCMA 3WN5A 4PTTA 4KMQA 4S11A 4YPJA 4PRPD 1I7UB 1X5YA 2F58H 4XWOD 2A9NH 3QDHA 3C09C 5EUOA 1ZEAH 2E5EA 3OAYH 4KY1H 4LNRA 5DWUL 2CH8A 4AIZA 3S37H 1NUDA 2GK0A 3PDOA 1HHJB 5SWQB 1I3RB 5LCVL 4Z7WF 1F4XL 1MCBA 4LARL 1ZTXL 1ZT1A 1CT8A 3WEXA 5DHYB 3JWNC 1QBLL 4LPCA 4NQDE 3OPZL 4HXBL 3C60C 2WWMC 2AK4A 4PPTA 4U6XB 2AEPL 3S4SB 4UI2A 5JORA 3NZ8A 4HJJH 2JTDA 4GW1A 1KB9K 4APQB 4EVNA 4MLSA 3WDHA 1YDPB 1AGBA 4Y8AA 2EYSA 3LQZA 1Q0XL 5EUOE 1HDMA 4IRJA 3SQOL 3H3KA 3IU3B 1JUFB 3HE7D 2CO6B 3IKKA 2H26A 2NY6C 3T0EC 1XGRB 5CS7A 4MD4B 4HLZH 4PRHD 3EOBA 2CPCA 3BDYH 4KK5C 1YEHH 3GJFB 1OM3L 2ZKHH 4UTAH 2FSEA 5BZDA 4RMTA 1FO0B 3MRNA 3BKCL 4P23C 2VE6A 2AJZB 3ARBA 4M5YH 2DDQL 3BZ4A 4GKZA 5J89A 2XRAH 4K9EH 1FRGL 2DQFB 1GHFL 1JHLH 4K7FB 4ZXBD 2B7DT 5CIPA 4O58L 3MV8A 1BVKB 4QRRE 3QH3A 4ZOBA 3GMPA 4J3UA 3ZKQD 4YHNB 1AI1H 4NZRH 3QFDB 4JRWA 3CH1B 3HZYB 3VXME 2VDMH 4Y1AE 5GGSB 5IMLA 2R29H 3BPOC 4XZUA 3FN0H 3MNWA 2D7OA 5DMGC 1FC2D 1EFXB 3MCG1 4QRTA 4X9FA 1Q72H 4LLDB 4EQ3A 5IM7A 2Q76A 4BH8A 5HHMD 4PRAB 3IAGC 4P4KC 4MA1C 1LK2B 5D1QA 5L0QC 3IGAB 5LAXB 3LDBC 1QFOA 3PNWA 4WO4C 2FJGB 4LLVB 4MNQD 1KN4L 1CGWA 1KPRA 4WWKC 3VW3H 4F9LA 3CU7A 3TA3D 3U9PL 4JKMA 1X5FA 1QZ1A 3AS2A 3NCMA 5T1LA 1U0QA 5CHNA 2R8SL 5IEKB 4P5TA 1YY8A 4ZDHB 2DQCL 3LH2L 5D2LB 4UNUA 2BVQB 1S7XB 3RNQA 3WJJA 1QP1A 2ENSA 4R4ND 1KJ2B 1JVKA 1HXYB 4MNQA 3IJYB 4FXGB 4CVZB 4YXKL 2VWEC 2DDQH 1OPGH 3MNVB 4PFEA 5JXED 4OF5A 1GAFL 2Y9RT 3CSBA 5EO9B 5FOBB 4U3HA 3DMMD 5ITBH 3Q6FB 3B2UD 1M7DB 4FMFA 1OY3B 2CDGB 4AL8H 1YEFH 1IGCL 3MLVL 4D9LH 1WCBB 2VRAA 4XB7A 4ACPA 1A9EA 2HJLA 5CEYA 4E0RA 4AIXA 4RCAA 5BVPH 1CF8H 1QLRB 3HN3A 2P48B 1TJGH 1WBZA 1P4IH 4G6JL 4FFWD 3HR5A 4O2CA 5IJKC 4WFGE 3CX5K 2NXZB 1X5ZA 2R1XA 1CFBA 1JZ8A 1Q9OA 2EYTB 3KS0H 8FABA 4OLYL 4CAGA 5KSAC 2FL5B 4X5WB 3I9GH 3TBYA 4M5ZL 3RA7H 3L5XL 4XVSH 5C08B 4JE4B 1MCCA 4RGNB 3S3PA 3TNNB 1ES0A 2NY6D 2OX5A 1U91A 2VZSA 2RFXB 2UYLA 3VD5A 3FQTB 5IROC 3VXNA 5LG1A 5DC0A 3EYOA 3QISA 1YMMA 3RVWD 2ZCHH 1IAIH 2D9CA 2OXGA 1BBDL 3K4ZA 1RZ7H 4U6VL 1JF1B 2AJSL 4P5MB 1IC7L 1VESA 1BLNA 4HUMB 4MA7L 1K8DB 4ZSOA 3QCUL 3F7YB 1R3IH 4F57L 2C3WA 4WIQA 5E9DD 4UDUA 1EO7A 3U7WL 1ZE3C 3NFSL 2X10A 2BNRB 1MWAH 5FKPA 4WW2A 1OGTB 2VXSL 3OJVC 2Q8AL 3DUSB 3RY4A 5DRZB 3ARGB 5CJOH 5JMOC 5JIPA 4XMPH 4BFIB 5BS0B 4CJ1A 4MCYB 2A77L 3UTZB 4PGDA 3VH8B 3LKQA 1XCQA 2H6PB 1IGIH 3WJJC 1MJUL 4DQOL 1CFTB 4NJ9H 4WTWA 1AJ7L 3BSZL 2VNCA 4Y19E 5T3XH 1MHCB 2VQ1A 3FHAA 3VRIA 4GXUM 3GRWH 1C1EL 2R2CA 1XF5B 1CFNB 1MI5A 1S7RA 1GOGA 3LQAC 2ADGA 4L3EA 4ERSL 5MENE 1C12B 5IGXL 3LSOA 4NSKB 1EHNA 2YMXL 5C9JB 5GS2H 3IDXL 4YWGL 4U1IB 4U3XA 1S3KH 1BMGA 2VDLL 3CMOH 5I73B 2VN7A 1V5JA 1KTRL 2R15A 4MB5A 4RQQB 4YQXH 5F7EL 3TFKD 4XNXL 5E8EA 1KPUA 4QOKE 5I18H 1IBGH 4RGOL 5FGCB 4I2XA 2D03L 2NR6D 3DVNA 3H7BA 3OR6A 3BP7A 2Y7QB 5IIEA 5I1JL 5ILTH 1QSED 1YUHB 4OCMC 3X3FH 4UAOB 4LEXH 3X3GL 4LHQB 5T1KA 4PJ9D 4OLEA 4U7SA 3SKUD 3O9WC 4Z8FL 1UC6A 4TVPH 4GAYB 2PXYD 4WI5A 1M1SA 3EYUH 1OD7A 4FFWC 4ETQA 4J8RB 5HHOE 4YIQA 3GBNH 4JAMA 2CLVA 3SKJL 1CLZH 5F9AC 1QLEH 4P23B 2ZCKL 2FJFB 1Y6NR 5DXWA 1MIMH 4F15C 4LRNL 3PGDB 1RU9L 1X4ZA 2W38A 4U1IA 1YECL 4KJQC 3HE6D 4GMTL 4WUUD 2VLRB 3PWVB 5D7KD 4FFVC 3THML 4R4BA 1JCKA 3QJHB 3BN3B 5ANMB 4WCYH 4YGVA 1I1RA 3Q5OA 4RMRA 4HKBB 1E4XI 5D7IA 4TUJA 3S5LA 1UCBH 2Z4QB 2Z92B 1FNLA 3T08A 3MSPA 3RTQC 3KJ4C 1RVFL 4WY7H 5KN5A 1H5BB 5IOPB 3B5HA 3Q6GH 4FQ2L 4LSVL 3PL6D 5CCKH 4UOW0 5CWSA 4UQ3A 4ISVA 1KLFA 5LGJA 2OTPA 4L4JA 3HAEA 1TQCB 3KLHD 2A6DB 4Y5XB 1GGYA 1OAYL 2P7TB 3CLEH 1UWGL 3S36L 3ELAT 3D18A 5C0CD 2J6EL 5GS2D 5GISL 1PFCA 4OFKA 3O3AB 3W5MA 1WT5C 1NAMA 4PRID 1N59A 3O6FD 4NN7B 4NFBA 4HQQL 2F19L 4QY8A 5DJ6A 5FYKH 4OFIA 4XVJL 5D6DA 3QCVH 3OV6A 1MCNA 3FO2A 3JUYA 4YBQC 3BGFC 2WIIB 1FFOA 4QRUB 2G2RA 2X1QA 4M7ZC 3BN9D 4MLIA 5F7DA 5L2KE 1YEIH 3QDJB 5FGBA 1VPOH 5BZWB 4HJGB 1BQSA 2B0SH 3O45B 1OAXH 1AXTH 1RJLA 4S1QL 5D1QC 5C0DB 2YS4A 1E4JA 1EEZA 4C58B 1KLGA 2BSTA 4A2LA 5MHSE 5DRWA 5B3JE 1PLGL 3HTLX 2DL9A 4YHKL 5DUBA 3C5ZA 2JB6A 1FH5H 3RWJA 3MRMA 3B83A 1AH1A 1H3PH 5FHBL 2RBLA 1T7WA 4MA3A 4AEEA 3HMXA 1WIUA 2WINB 2NR6C 1IM9A 2EIEA 3RUGB 5EZLA 4G7VH 4I9WD 1CXLA 3LAFA 1K6QL 2ATPB 5FO8B 3WUWA 1BAFL 4M7LH 5HXMA 3DO7B 2HJLB 1F8TL 1UKTA 4PJXB 2R1WB 2GT9A 2IGFH 2PYFA 3LIZH 2R69H 3AFLA 4PJ9B 4FRWA 4GAGL 2V9RA 3VFPB 4XBEH 3RIAK 2GTWA 5EIIA 1WZ1L 4YFLF 3C6LB 3MJ7B 1UZ6F 5DFTA 3VWJA 5A2LH 1IAIM 3QPQC 5L9DH 3O41A 1OL0A 4WI2A 2APVA 4B5EA 4JFDA 4ODVH 1DLFH 2GSIA 3EYUL 3MRPA 4CMHB 1I75A 3FQWB 5LKNA 5MEQA 4M61B 3MXWH 1KYOK 3DUUB 4JFYA 4QWWC 5D8JH 4EN3D 2KKQA 1JI2A 5CKGA 2IBGA 1JYNA 1B3JA 2N56A 3KPSE 1A6AB 4M6NH 2D4FA 4JKKA 2OK0L 3ULSB 1IKNC 1UG9A 2HWZH 5I1EH 1JPSH 1NCBH 1PG7L 3CH8A 4RMUA 3O3DB 3K7UA 1FZJA 3W0WD 1ZT7B 1D7FA 3NGBB 3RTQD 1HHGB 1MJ7L 1B6DA 3KXFD 1QHPA 2A9NL 4M1GH 5L6YL 3P9LA 2CSPA 4I0PC 2NY2C 1S7VB 3BEWB 1KGCE 3ULUL 1GRWA 3EOYG 4PJ5D 3KLAB 2Q86A 5H2BB 3UTTA 1HSAA 2IAND 4GAJL 5FDYA 1DLHB 4XPHL 5DMKA 1NMAH 4AEHL 5HY9B 2N4IA 1YYML 4X7CC 1NDGB 5L8JB 1A4KB 3LEYL 2YPVL 2NTFA 1MIEL 4HK0A 3QEHA 5D5MF 5L2KD 1KV3A 4ZO8A 4UT9H 3HI6H 2VH5H 1NCWL 5D7LE 1U58B 3BIKA 5ILTL 4PP2B 5C0FB 2GIYA 1T1ZA 3DXAE 1G6RA 4GW5B 5ECJE 5C0AE 5CEZE 1HINH 3BN9C 3SDDA 4JZJB 4RWYH 4UUJB 2OYPA 1S9XA 1F00I 2DLFH 3PGCB 5D7JB 1H3VA 5GSVA 1OLZA 1EEUA 2WAHA 2WSKA 4C56D 2VLKA 4NNXB 5EZOL 3LS4L 1UJ3B 3AB0C 4PJ7A 2OQJB 5HHME 1GGIH 4X6BA 4XNYH 3WNKA 4TQEH 2YOCA 2EE3A 4FQXB 3MGTB 4X0KB 2WBJB 4HHAA 4RA3A 2G9HA 3SJVD 1S9VA 4NC1C 4X6DB 3QQ9C 5HGBB 3V5HB 4U1GB 1P5VA 4DN3H 3EJYD 5F1NB 2XN9D 4RGMC 4G9FD 3NPSC 1AJ7H 4ORGB 3LKSB 2J12B 2WZPD 4HUXA 4ORGA 2DJ4A 4UT7H 1DR9A 1UH4A 3FOLB 4PJDE 3RA7L 1RFDH 4R26L 3BFOA 2FEEL 3TYGH 2XZAH 2VIRB 1RIVL 4LNRB 5B38B 2HT2D 3VU2A 5I15H 3CXHJ 2M26A 1GGCH 5DJ8B 3SJVA 3VDCA 2NLJA 5IVXF 4YJZL 1KJMA 2WV3A 2DBJA 4LAJH 3MLXH 4C55A 1FVCB 3CPLB 3FN0L 3QWRA 4KHXH 3WS3B 3MLWH 2B8OT 1VGEH 4Y5YC 3HC4H 5KVDH 2X4RB 1PW3A 3D3VB 1IKFL 1GC1H 4KK9C 2EIZA 3RPIA 4PJAE 3WHE1 5EZJA 1QBLH 3GMQB 5TDNB 4LSVH 4ELMA 1IAKA 1K5NA 5F89A 1T1WB 2EEAA 2GCYB 3BPNB 1PD6A 4PB9H 1SQ2N 4QCIB 4XCNB 3TPUA 3GM8A 4MHHG 3V52H 4H0IA 5GS3A 3BI9X 3O4OB 1GJIA 3ALWA 1I9RH 4ONGH 2DWDA 4FZEL 1CLOL 3VRLF 4G8FA 5GGSY 3PJSA 1F02I 3W5NA 2NLJB 3R06A 5DUPH 2RR3A 5E8EB 5SX4H 3VXSA 5JHLH 1JN6B 3RNKA 2EE6A 5CZXD 3BXNA 1OLLA 2ARJA 1HSAB 3QHTC 4PLJC 2G60H 2LABA 3QG7H 4OLYH 4ZUWB 3DO3A 4WV1B 1UB5B 2Y06L 2Z91A 2QQQA 4HT1L 2YEZB 1A5FH 2O5ZH 2GTZA 1XGTB 4OI9A 3V4UH 3EHBC 2R69L 2WBJA 1XCQB 1AO7A 4UINL 3EBAA 4ZFZA 3CC5A 4WEBH 3VGEA 3V4VH 2ESVB 1FH5L 3FCTA 5KS9A 1V3KA 3WNMA 5J6HB 3K8KA 3RWFA 5IROA 1WJ3A 1AGFA 4Z7WA 3CXDH 1GOHA 3RL1B 1FSKC 2A38A 1A22B 2DOCA 2BNQA 3SN6N 5I18L 3VFMB 5ICYB 3Q3GB 1RZGB 1HEZA 4DFHA 4R9HA 3QXAA 2KZ1B 5GGTH 5I1HL 3MCKA 2JJUA 5CLWA 2R2BA 3QEGH 4D9RE 4UV7H 1FAIH 5GGRY 3U1SH 5D93C 1MQKH 4K3JH 2XPGA 3MFGB 5D7IE 4KDTA 1G6RB 4GW5A 4JPWL 3U9PH 3QQ9D 4JFZH 3JTSA 5ISZD 3C6LA 5KAQF 4NYLB 4HAGA 5D96B 2QKIA 5F88A 2F19H 3S3JA 1EX0A 3HUJB 4MDIA 5DK2B 3PXHA 5DJDB 4UNVA 1L9MA 5C0RL 3LPWA 1L6ZA 3LPGA 1JJUA 35C8L 4DVRH 3VFGL 2BOCB 3IDIA 1A0QL 2FLBT 4OQ1A 4P2OC 4XC3L 5H8DA 3MV8D 2ED8A 2VDNL 1A6AA 1B9ZA 4TUOA 4KRNA 4CN4A 1NJ9B 1NGYA 1ZKAA 1T04B 1GPOL 3WFDL 3QAZC 5D6CA 3MRBA 4NZTH 2XKNB 1J18A 3M07A 3TNMA 5DT1H 1T2XA 1A1MA 3DOSA 2WP3T 1DUYB 1HHGA 43CAB 2R1XB 4KK9D 3L9RB 3VG0L 1IC4H 3OF6D 5MEND 4ODUA 3BMWA 2Y6SD 3O45A 1JP5A 1T4KA 2WUBH 4H20L 1P1ZA 4F7EA 2ZUXA 2OP4H 5F3HA 2IAMC 4HH8A 2Y36H 4Z0BH 2JLLA 4Q7DA 3O3EA 3NCYS 4D0BB 1C7TA 3GSVB 2VL5A 3UPCA 4ODUB 3U30B 1QQDB 3WSQL 1KC5L 3C6SA 3F58L 5FF6B 3GSUB 3EYVB 3TN0D 3EUUA 3P9MA 4QOKD 2BNQE 4F80A 4POUB 5ICXA 1YEEH 3QO1A 1T04A 2BXZA 3N1QC 1ACZA 2V2XB 3CIQA 4MJIA 3BZEB 4F2MA 5HYJA 2R4RL 4EUPA 3MREB 1CXHA 5JA8B 1RUAH 2YD7A 5C1MB 5I1DA 3BO8B 3U79A 4C4KO 1UJ3C 1KB5B 2EDFA 5KW9L 1P5UA 1AO7E 1MFDH 3QDJA 1AQDB 2BCKB 1S7TB 3LY6A 4G5ZL 5KSVA 1MFBL 3FO0L 1FFOB 4KRLB 1YEFL 4BJLA 4NBYB 4XPAH 5LXGL 2HVKA 2OJZH 2IBZX 1N6QH 3QUML 3D5OF 1KLGB 5FA4A 2P5WE 3KNBA 3O3AA 5L0QB 3LDBB 4JFXA 4LVHC 4CRPA 2R4SL 1OGAB 3L3IB 3PGDA 3LN4A 5D7KE 3PWLA 4HIIA 7FABH 2XQBH 5F1IB 4P4RB 5JOPD 1NANH 5IKCA 3BWAB 1UQSA 4HIHB 3W9EB 5J1AA 4R4FH 4LU5L 4ZFOL