3O6LL

Anti-tat hiv 11h6h1 fab' complexed with a 15-mer tat peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSGQSLLYSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 11H6H1 Fab' light chain
total genus 55
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6lL01
2X40A 1U8OB 7CGTA 3QCVH 3D18B 4GRMA 1MFBL 1GVIA 3FT2B 3QQ4B 5FHBL 1AC6A 3K1KC 3KLDA 4JZOB 1MNUL 2AK1H 3V4VL 4KI1A 4LVEA 1Z5LB 2UUDH 3AFLA 4MLSA 5C0FB 1KN2H 4BUGA 1Z3GL 4LRNL 4AIOA 1X5ZA 3QDGB 2H26A 5D1ZD 3DXAE 5TDNA 3QFJD 4RX4D 1EEZB 1F4YL 3O6FA 1CWVA 4ZQKB 4HHAB 4LSTH 1NUDA 1EUUA 3SY0A 5ETUB 5F9DC 4NM8L 1IGFH 4JHAH 4G6FB 2V5RA 2BK8A 2A83A 4KKLD 1ZHNB 5H94B 3BWAB 5HXMA 3MRDB 4QHNB 5F88A 3DIFB 5D6CA 3NIFF 2O93L 1YEHL 4K2UH 1XR9A 5SWQA 3TO4A 1U36A 5C0DB 1I9JH 2D7OA 5BS0B 5SX5H 1MCDA 2D7MA 3NH7L 2XWJA 3ARFA 4LU5H 2BRQA 3R06A 2JCCA 5F97E 1EGJL 4JFQA 5CBAB 2VZUA 2ADFH 4KPHH 5IT2L 3RTQC 3WLBB 1S7VB 1TZHB 5DJ8A 1G7PA 1IM3B 4KRNA 2BY2A 2DTSA 2MSPA 4OZFH 1D6EB 4JPVH 3S96A 1OGAD 2NZ9C 2WQRA 5E94A 1A3RL 2Q20A 4LSQH 3RWCA 3LS5L 4LDLB 3VFNB 2VDML 3MRMB 1PQZB 1A1MB 5E2TL 5CILH 3GMPA 1GPOL 4OCMC 3OPZL 3VWKB 1JPST 2ED9A 3FO1A 4KGJA 4OF6A 5DFWH 3RNQB 3WL9A 5B4MD 5FV2A 1I9JL 1RZJC 3KYNA 3OV6A 2J8UB 2EXYC 1VCAA 3GEWB 4DQOH 5AD0B 2IWGA 2AV1B 1AGEA 4UBDC 4DGYH 1JL8A 2UZXB 5DJYB 3QDGD 2ZZUT 4JM2B 3CMOH 4OGZA 1DBKL 3DGGA 3OZ9H 4P2QD 3WHE0 3FCTB 4JCLA 4N8VB 5FO8A 5LWYH 2DKSA 4LFHG 3PHOB 1OP3K 1U3HB 5IHUH 5CAYB 1A7PL 3NIDF 4OJFL 1TQBC 5AZ2L 1A22B 2Z92A 4Z7OF 4XVJL 2FGZA 5D70H 1RZJL 1F3JB 2HT2C 1EXUB 2H45A 5BJTA 5C6WH 4P99A 3VMNA 4AJ0A 1SYVA 1KNOA 1DLHA 2Z8WC 3EAKA 3SCMC 2AKRA 5F6IB 2RQ8A 4RX4A 3OR7B 5BW7A 3BVNA 5MEQB 5IJKA 4P46C 3V6ZB 3P0GB 5DJDA 3CC5A 4LCIH 1H3GA 1DVFC 3TWCL 2D0FA 2HKFL 1A6PA 1MCJA 4YDIL 7FABL 4KROC 4UT7H 3TGXA 4YHOL 1PZ5A 4HWEH 2DI9A 3QIBB 1IC5H 5FYKE 4RBPH 5SWZB 2WBJD 5C7XL 3N0PB 3BIKA 3O45B 4ZDHB 2I27N 3C6LA 1G1CA 1QSED 5DJCA 1S7QA 4XMPL 1OL0A 1T03L 3S3PA 5GS1A 3OG4B 3VWKD 1JGLH 2LFGA 5I1JL 4JFDE 4JDZB 1HIML 1IAIM 1GZPB 4DFIA 3D2UB 1T4KB 1KV3A 3TPKA 4HJGA 4RSVA 1RHHA 3LQAH 1MNUH 2GQHA 2V5YA 3MRGB 4MDJB 4NQEA 1I3VA 1CLCA 4NT6A 1IAIH 4LFHD 1ULVA 1LP9A 4PJ5D 1REIA 2R0ZH 3FQWB 32C2A 3RU8L 4XVUC 1F58H 3PP4H 4ODHH 1I8LC 3IKCA 3V6BR 2A9ML 4O2EA 1MOEA 3V79C 5E99L 1BP3B 4PG9B 3FQNB 5HHOB 4YNYB 1G7LA 1CFQB 1SJHB 5EWIH 3WIHA 3WNLA 3HRZB 3UYPA 5IV2A 4PJFF 1OW0A 4JHAL 1EBPA 3SE3A 4X6DB 4PTTB 4OM0L 2Y9RT 1CK0H 4WWKB 4OT1L 4PRPE 3BUYB 4Y8DC 4FNLH 1YEKL 1T03H 2UYLB 4K3JL 5DJZB 3LPGA 3VXUA 1JGLL 2ICWJ 4JM2F 4XT1C 1MF2L 1A2YB 1DUZA 1RUPL 5E1AA 3D85A 2VE6B 4TPRH 1WICA 1V8HA 1QO3A 1T22A 2AJSH 4CN1A 4E9LA 5T3ZE 3BEWA 2Q3AA 2F19H 1E4XL 3VFGH 4JRXD 4CVZB 3TNMB 4Y4HB 3DSFH 1MCOH 5I1GH 3EFFA 3OX8B 4X5XB 4NWUL 4ZSOE 4BSVB 1G9MH 2A6IB 1IGJA 4Y4FD 4M8QB 4IRZL 1LE5A 1EHXA 3V0WH 1TVHB 4JO1H 4V1DE 3BEVB 3RWGB 1QLEH 2VAJA 2ENSA 1EJOL 1GGUA 3FOLB 1D5MA 1EHNA 1D5BB 3RTQA 3U7WL 3QG6B 5C09B 3UJJH 4YDJA 5AUMA 1ZT1A 3BAEH 5EUOE 3BEWB 1G6VK 1CLYL 3OAYK 2HLAB 2HFTA 5IR1A 3V5HB 4U1GB 1OGAE 2VL4A 4JDTL 5H2BB 4FOMA 2FNBA 3GNMH 2Q86A 3CLEL 3F7PC 3KPOB 2GAZA 5E2TH 4QOKB 4AENA 4KKCD 2YD8A 3HE7D 4EIGB 4WO4B 1I3UA 1X6LA 4U1IA 5BV7C 5EIVA 2EYRB 2XN9B 4NDMB 4WDIB 3RBGA 3VXSA 2ADIB 3LPWA 4NHCH 4R4NC 1N8ZA 3PHQA 5DVLA 1LK3L 2VLKB 3NMEA 2IQ9L 2Y6SC 4YEFA 2ICWA 2HJFB 3N1QC 3ULVF 4MDJA 4NQEB 1JYXA 2UWEB 1ND0B 5IROC 1LP9B 4DWHA 1X9QA 2XFXA 4GSDH 2ZP0T 2Z4QA 4G8GA 4D0BB 2HTKD 1KCLA 5FK9A 4MQXD 4Z0XB 5FA3A 3E0GA 2EDKA 4HKZB 4ENEC 5DD0H 1DLFL 2X44D 3T4YA 5FUCE 3S36L 1JTOA 3U30C 1YEFL 1HHKB 4K9EH 3PWVA 4XCYA 5D7JC 4OLUH 3MPCA 5I8EB 1CL7H 5IB1B 5E5RB 3ARUA 3V95A 2VDLH 4FQJL 5F6HJ 4Y4KA 4WENB 2J12B 1MI5E 4CMHC 1P1ZA 1P6FA 1TITA 1A6TA 1D7FA 1IQWL 1QLFA 1N5YL 4Z9KB 2JLLA 3MGOA 1FFRA 2UWEA 5DJYA 2C1OA 3PQYD 4FQQB 1S7SB 5CIPB 5E95B 3P0VH 4KK5D 1TPXC 1MUJB 3WIIL 3P4LA 1S9KC 4C54A 3ZO0A 1K4DB 4YHMH 4NM8H 1YPZF 4GG8B 2OBGA 3MRBB 2VLJD 5EBLB 4G80A 4M7ZB 3W9EA 3B8SA 2R23A 3GBLA 5KS9E 4U6XA 1A6UL 1JGVL 3L7EB 3W81A 4PJEB 5HDLA 5A16A 5JLZA 1OTUC 3ARGD 5HHNA 4HIEA 1ZLSL 2WUBL 2VWEE 3T2QA 2J6EL 3EO1A 4U1HB 1VSCA 3CXDH 5HYQB 2MNUA 2NW2B 4WFGD 1T83C 3I9GH 3JV5A 3KYAA 4R4ND 4QHUA 1OSPL 4HZLB 4O58H 3QPXH 3PV6B 3L1OL 3DX6B 4KK6D 3WL9B 1MH5B 1XF4A 3W5NA 3BYYA 4FTVB 3FL7A 1YEJL 2BSTB 4JPIA 4U1LA 4J3TA 1UH4A 1VACA 4HS6A 5FDWA 3GMMB 1PDKA 5CGYD 3PWPA 4JREB 3WIIH 4OV5A 2OZ4H 5ENWA 3P9MA 1KULA 2WLZA 5D5MA 3OKOA 5DJAA 4HZLA 2VDRH 4XP4L 3EDJA 3IFLL 3P4NA 2IF7A 4ZAKB 4C58B 2XWTB 4ZFGH 1MLCA 3MJ6A 4NO5B 3FQTB 2J3SA 3MRKA 2R56H 3DRTA 1HWHB 5CBAA 1N64H 1YEGL 4MJ6A 3EGSA 4MJ2A 3Q1SH 3MLWL 2C26A 4G5ZH 1DUYA 1VGEL 2E27H 4AMKL 4XWGL 2WMPA 4JHWH 5JNYB 5T1DH 4YHKL 4OCLC 3HZMA 3O11A 3GMOA 4APQD 3UPAA 1CFNA 3OXRA 3BZFA 3C2SA 4QT5A 3QDMD 1F4HA 1CQKA 2GCYB 1FJ1B 2VXSH 4YX2H 4MAYD 3CUPB 1CR9H 1MRFH 4OZFB 5I1IL 3BO8B 3VXQB 4NHCL 2FBJL 4CU8A 3MRGA 2E5EA 5DVMA 5ELIA 1S7TA 2CXKA 2FX8H 1JNHA 5HD8D 2F5AH 3OKNA 3REVA 1EEYB 1BBJA 3IU4L 2WANA 4LSPL 5FYKU 4OZIA 1MHCA 1NBZA 3EFFB 3OX8A 2R4SH 4NKMA 4P23A 5IG7A 4GAYA 3MCKA 5DS8B 4P59H 4XVTL 4FXGB 4IRSA 5E4IA 5D8JL 3WLWC 3RWDB 1UA6H 3F7YA 3OSKA 3MJ9H 4X4YB 1NFDB 1N0XH 3RP1A 4JFHE 2OI9C 1LGVA 3VGEA 2H2PC 5DA0B 1CL7L 2BMKA 1CD8A 4PRHA 2H8PA 2VDLL 5MEPB 1H3UA 4KK8C 4P5KB 4L8DA 5KAQG 1E4XI 2VC2H 4YDKH 5L2KD 3P9MB 3BVNB 3BUYA 4W6YB 1T0NA 5HHPA 3TA3A 1QHPA 1JHKH 3JBG7 4WUUE 1BBJB 4U2ZA 3ZMRA 3FO9A 1CDJA 4D0DB 1KENL 2APFA 1D9KC 1BQUA 4F7MB 1L0YA 1AGCA 5K9OB 4NFCA 4FQPA 4KQ3L 1MQ8A 1NMBL 4P3CH 3EKCA 1M7DB 3NA4A 5KVDL 1YNLH 4NFDA 4K2UL 2XTJB 3MJ9L 3RPIA 2QV2A 3MYZA 4JY4B 1NSNH 3PGFL 1TENA 1CIDA 4Y4HC 3VW3L 2VDNH 2GTWB 1L6ZA 2I07A 3RY6A 1YNTA 3WDHA 3D25B 3B6SB 1RURH 1T83A 2D7NA 1NL0L 2O61B 5DMIH 1QSEA 4HJJL 5CWSB 1XGRB 2ZOKB 4JKPL 4P2RD 3PQYA 2DQUL 2OK0L 2Z8SA 3GHEH 1WCQA 1CTNA 5DHXB 3LMJH 3A6CH 3MA9H 4OFYD 4YWGL 4KZEL 3I84A 3RWCB 2DQEH 3MRQB 4PUBL 4KDTC 1S9WB 2WBJB 1UEMA 2LE9A 4MZ3A 3VXRD 1GAFH 1A6TB 2CD0A 3BFOA 4FG6C 4KGLA 3VRIA 3BXNA 1OP9A 4J6RL 4ZUVA 3S5LG 2DLGA 3EUUA 4L4JA 2Y07H 2BVTA 1J1OL 4JG0H 1A7RL 5DK0A 3ZSTA 4I5BB 4WFED 2DWDA 4JO3L 1URLA 3DYMA 3ULVH 3RDTA 2BSRB 3I50L 3DECA 4FQXB 4XMKL 5EFIA 2BNUA 4CDGC 4LLWA 2P5WE 2Y36H 2NZ9D 3RI5K 3SGDI 4D9RD 5I1EH 4O4YH 4KV5E 4H1LG 5ICXB 5EU7E 5FB8B 2F53A 3EBAA 4EXKA 4XAKD 1QRNE 1NCDH 2A83B 1JMXA 4DVRH 4HXAH 3WNMA 3TJHC 2OLDA 3L3IA 1FE8L 4HC1L 1W0WB 1Q72H 5E2VL 5IW3A 1SEQH 3G04B 4L5FL 2XZZA 4MA1B 3HHRB 4S1SH 1UZ6E 5E6IA 5M95B 4K3EL 4DOHB 1JNJA 4M6NH 4ZD3H 1XGPB 3BKML 3D0LA 3HNVH 4YHLL 2BFVH 3C09B 1X5LA 3RVXD 2ORBH 2CPCA 2D0HA 1OP5H 2JJWA 1NFIA 3RL1A 5CZVH 2A2QT 1KJVB 1OF2B 1HILA 3S5LB 3GMRB 5DUBA 2XY1A 4JHZA 1G7IB 3QWOB 2P45B 3SOBL 3LQZA 4W4NA 4FQQA 3WJJA 4GG6F 1ZGLM 4G8EA 2CKBB 2W65A 4OKVA 5I8CA 4N0CD 3LZFH 4HXAL 1LDPL 1FDLL 4YFDB 2A38A 2DYPB 1ND0A 5I1IH 2A6JB 3AAZB 1TVDA 3LQMA 2XPGA 5GRJH 3PGDA 1CGVA 4U6TA 1RFDH 2JJTC 5DD6A 5EBMB 5JPNA 1C16A 3Q5YA 1UZ8B 4GAJL 4D9QE 2Y1VA 1V7NL 2A6IA 4WW2A 5FFLA 3D0VB 2YD6A 2YRPA 4F58H 3W9DB 4X83A 1FG2B 1VGKA 2B7DT 2Z4QB 3T0DA 3LS4L 4M7LL 2AJVL 8CGTA 4L8DB 1TJGL 2ZCLH 3B5HA 4L9LA 5C3TA 1QSFE 4LEOA 2QQLH 3TFKD 4WV1B 1ZT1B 2CSPA 4PS4H 3P9LA 5T1LB 1N0XL 3WKML 4PRDA 1S9WA 4HKXB 4Q0XL 2IAMA 2DWEA 5C07E 3V5HA 1MCRA 4OCSL 1UVQB 4OBSA 5IFJA 3IFNH 4DKFH 3HG1E 1CYGA 3WUWB 4G6FD 2AJUH 4PJAF 1HE7A 5GRVL 1I9IL 5J7CC 3FB8A 4KVCH 3ECBA 1YECL 3PL6D 5LAXB 1IFHL 1TXKA 2DWDB 4XPGL 1KLUB 5TE7H 5CMAB 1OM3H 1A9BB 3SDXE 3EDFA 4Y4KC 5K9JH 5I1AA 3BPCA 1YEDB 3OJDA 4DGIH 5DHVH 1HINL 4MDIB 3LH2H 3MA7A 5GGVY 5H2BA 2HAZA 1A3RH 4LSQL 2NY1D 3FFCA 4U1KB 3V52H 4JLRA 1IM3A 1T7XA 2RJMA 4OI8A 4P3CL 2VQ1B 4Y5YB 1YNLL 1PX3A 3KNBA 4M93B 2QKIB 4DEPC 1DVFA 4MJ5B 4QHLA 2BOBA 2XRAL 1KCVH 3BEVA 3RWGA 5FCSH 2ENYA 2AQ2A 3VRLE 3QDHA 5DWUL 2B1HL 4BSVA 1Z0NA 3G5XA 4LL9A 4D0CB 4QXWA 1FAKT 1OWRM 5JXAH 1C5CH 3OKNB 3UPRA 4HAFA 4YPGA 5GS1C 1XFPA 3HC4H 5E6YA 5IEHB 3RGVC 4LCWB 2NY7H 2X4PB 5EOQH 3K2MC 4OCYL 5FHAL 4ZAKD 4HG4K 5IQ9A 3IS0X 5CCKH 4Y19A 1M05B 1G1YA 3OKEB 3DROA 1FVCB 4MS8D 3AU1B 5TDOB 1H3XA 4YQXL 1H15A 1QEWB 3TBVB 3VCLA 4OF8A 3EYSH 5D72H 4YHZL 1Z9MA 4KVNH 3NCEB 4GKSB 4NN5C 4ZODA 4PV9A 3SGJA 1T0MA 3ZL4H 4OGAD 3WCYA 2VXUL 1KN4H 4XH2A 3N1MC 5LGJB 2K9UA 2FJGA 3QISA 1BWWA 1BD2B 3EOBB 4KKAD 1OSZA 3TJEH 3SKMB 4NJAL 4TRPH 1I8MB 1AXIB 3SQBA 1NCDL 4MQTB 3REWA 1KPUA 3AREA 3S96B 4I4WB 1I1CA 3WXVL 3QULB 3BW9A 1WBYA 4OCNC 4LKXA 1FRGH 2HWZH 3VXMD 4OZ4B 4JDZA 4YLQT 3K80A 4PJHB 4LEXL 3DXAD 3NVQA 3MFFB 4W68A 2AI0L 3HNTH 3NFPB 1WC7A 4BK4A 3UTPE 2YA0A 5SWSE 2ZUUA 3NACL 3K81A 4M1DL 3V8OA 2HT3C 2YBRA 5D2LA 3B6SA 2R2HA 1PSKL 2ADJA 3P4MA 2DQDH 3KLSA 4M6OH 4PY7A 4TULL 4E5XA 3X14A 5AWNL 1P4IL 2IH1B 3MCLL 3WHE1 2YPLE 4X7DC 2Q76A 4XX1E 4ZAKA 1JFQH 3BSZH 3QFJB 5GGQH 1QLFB 5ALCL 3R0NA 2CR3A 5BO1H 1MVFA 4WWKC 1BZQK 3W0WB 5BZDA 2VKXA 5JLZB 3DYPA 1P2CA 4Z77A 1FZKB 2XA3A 4LSSL 5C0RL 4O5LH 2R2BB 1FVDA 1Q9LB 1K4DA 1F90L 3QIWB 1FYHB 4NWTH 3TA3B 1PGRB 4M03A 2OTWB 4ODWA 4X80H 5J1AA 5FUZH 2GKIA 1EVTC 3PHOA 1MJ8H 3O6FD 2BC4B 4JO4H 4I0PC 4EDWH 1K5NB 3NTCL 2J8UF 4G8GB 1VFAA 1MQKH 3QFJA 3FJTA 2XKNA 2YN5A 4NN7C 3PDOB 4R9HA 4HFWB 5BVPH 2Z31C 1A21A 2FR4B 2H2PD 1YA5A 5DJ8B 5I71C 1N2RA 3I6GA 5DR5L 4PB0H 3ZHKA 3TN0C 1A6WH 4Q9RH 5AWNH 3STLA 1KG0B 3R1GL 2RR3A 3MJ8A 4KAQH 1UGNA 3PWVB 1RUQH 2COQA 4XCYB 4RBPK 1PY9A 5T1KB 1OGAA 5JA9A 4PP2A 3V9FA 2AW2A 3EOTH 2MQ0A 1WFOA 3Q6FB 4QCIB 4JFHD 1ZT4A 3GMPB 1NEZG 3IDYC 1Z0MA 4AT6A 1KPRB 1YNKL 3HC3H 5DVOA 1A6AA 5JZ7D 1MCFA 4YUEL 5KSUB 5CIPA 1AKJD 4UUJA 3GIZL 3L3DB 3DUUA 4P46B 1ADQA 4P5TB 2BNQD 1CCZA 1QBLL 4U3XA 5BOPA 2VZSA 1ZVSB 3BMWA 3BHBB 1FO0A 4JFFA 4JN1L 1KJMA 3VU2A 3WYRA 2XN9A 2ESVB 4X7SH 2N7AA 3SQOL 3O6FB 3SDXF 5GGSA 5CEXA 5F71A 3MFFA 2EDYA 4O2FB 4RGNE 2CMRH 1RZ8B 2VAAB 2VITA 4L3AA 4WHTA 1RJYB 12E8L 5EC1B 3HZYB 4GSDL 2B4CL 3P4OA 3QO1A 5TJWK 5HVGB 3M8OH 2OTUA 1J86A 1RULL 3GSVB 5GRZA 1T89C 3F12A 3RIFK 5KVMC 1CXEA 3VRLF 2D03L 3WLWD 4DCQB 1NLDH 4X5WB 3ZDYE 1XMWA 1Y18A 3HB3C 2JK5B 1NFDE 2DKMA 1N5AA 3C5SB 5IW6A 4YQXH 4X99B 4QRTA 3AM8A 4DUXA 3D18A 4GRMB 2RGSA 2CXGA 2HRPH 2C4XA 3IAQA 4UIMA 4NQDA 3RUGF 1ZKAA 3FFDA 1MEXL 1TQCB 3RWIB 4WU7B 1KB9J 3VDAA 1YC7A 2X4PA 3J7HA 4N9GB 3JV4B 5FA4B 4MX7B 4EDXA 1NFDF 3QDJA 4UBDD 4U7SA 1FRGL 3ZDYF 3OXSB 4L3EB 4Z7UA 1CFTB 4PJDE 4QWWC 2FJHA 1MFBH 3PL6C 2HLFD 3MSPA 5D9SB 2FHCA 1T0NB 2CKNA 3Q5TA 5T5FH 4P4KD 2YPVH 4NO3B 3H6JA 4JRYA 2FX7H 4WU7A 3OAZK 1CGYA 1FYTE 5SV4A 2DQDL 2C3XA 1VESA 5F7MC 1R3LA 3C5ZB 3F6IA 5LBSH 2GI7A 1NGWB 1WEJL 5E1HB 3DO7A 1C5BL 5IK3B 1PG7X 5HHME 4MVBC 4EI6A 5DJ6A 3LRHA 2ICCA 1GZPA 4UDUA 4ZXBC 3MLWH 3VXRB 2H3NA 5KN5A 3DUHA 2IGFL 1DEEB 4BZYA 2AXHA 2ZPKH 4K7PL 1AO7D 1IC1A 15C8H 1AGFB 2F8OA 5D7KD 2NLJA 3BQUD 5JW3H 4OLWH 4RQQB 4YFEA 3VXRE 3V5KB 1K2DA 3GMLA 5MERB 5JIPA 1S5IL 1HQRB 4H1LH 2EYSA 4RGOL 4ONHB 1NBVH 4JANB 4NZTL 4RNRA 3ZT5A 5EOCL 4H26A 3OKKA 4XPAH 1AGEB 4LHUG 2ITDA 5FYJH 1U8IA 3FTGA 4JRYD 4TUOB 5L88L 3QXDA 4ORGB 3K4ZA 4MLIA 3SDAC 5JR1H 5A16B 5HHOA 5T5NF 3HE6B 2YD2A 3VGHA 5BOZG 2C4FU 4Z7QF 2PCPA 5ITFA 4QOKA 3SDDA 3IKCB 3MV01 1U3HA 4F15B 2IPUG 3LKQB 4OJFH 3ABZA 1HHJB 1HYSD 3QRGL 2F53E 4L5FH 5FCUL 4OCRH 2RCSL 1F2QA 1WBZB 3VGBA 3T4AB 3H9SB 4LLQA 5HI4C 1GZQA 3KPPB 3NPSB 4DGYL 1NLBL 1ZHKA 3QEQA 1MRDL 1PG7H 1NBQA 1JVKA 1HZHH 3PDOA 5J4MA 3BESR 5FYKD 3TJEL 4OZIF 3KYOA 4N9OB 3GMRA 4NO0D 4Y1AD 3TC9A 2W92A 1UYWH 1JGVH 3GSQB 4L3CB 2QSTA 2HN7B 3X13A 3ZHLA 2G60H 4XCEA 4ZTOH 3BP5A 3RZCC 1FZKA 5DQJA 2HTKC 4UU9B 1XGQA 1WWCA 5FYJD 4WFFD 1HSBA 4K94L 4FFZH 3M1BB 2FEDC 4PPTA 1KFAH 5ISZE 1M7XA 1T1WB 4MA1C 3T77B 5EZLA 5DRWA 1KJ2A 4XPFL 2QQNH 1D3CA 4OZFG 2J5LB 3GMQA 3G6AB 4QNPE 5BS0A 2HG5B 2PYEB 1AGCB 2BVEA 2IG2L 4BZ2L 4CADA 5IB2A 4PLKD 1J0IA 1UQSB 3MV8A 5GGQL 1RD6A 3PP4L 4G9FE 1F58L 5C0BA 3MRCB 1QYGH 3QQ3B 2Z31A 4GW1A 2VKWA 2DIAA 3BKCH 1X5AA 1NSNL 3OKLA 4APQB 1FFOB 3OGCA 1KJ3H 4F2MB 3CSYB 3ILPA 4DJMA 4NFBA 3UX9B 5KS9B 1A6VH 3H8NA 1KTRL 1DANU 3DBXA 4KVCL 3CFJB 1YEKH 3LN4B 3SJVD 3KXFA 1NAMH 5I1DA 2CKBH 5FYKL 2NCMA 4LLDA 4J3UA 3L9RA 2YR3A 1A3QA 2D31B 2EYTA 3MCKB 3MRLA 5AAMA 1IKFL 5E2JA 1AFVL 5D6CB 1EFXB 2HJLB 2VMFA 3GIVB 3EJJX 5SWZA 2OP4H 2XWBA 3EJZD 4JQXC 5ACZA 1WK0A 4ZPTA 5E0QA 1QTYT 5T1KD 1XCQA 4ZFZB 1CE1L 1NCCL 2Z35B 1RI8A 4KI5E 3SKMA 1KSRA 1DVFD 2L4OA 3O3DB 3I50H 2OYPA 5ALBL 3LEYH 5FM4A 2NR6C 2WIIA 4PLOB 2Y36L 3P0YH 4PV8A 5D96B 5F9OH 1DBAL 3CDGA 1CVSC 5CSGA 4Y2DB 1R24B 1IEHA 5KOVC 5FYKH 1INQB 3MACH 4JO2H 2FB4L 1YEJH 5EUOF 3H0TB 2OMNA 3WIFA 2Y23A 1RU9L 3H9SE 4HIHA 3MLZH 3HE6D 4RRPG 3UJTL 1TTUA 3T8XB 1VFOA 2WWMD 4DEPB 3L6FA 5KVEH 4LHUA 9CGTA 2HJKB 5I1CL 1A1NA 4UV7H 2MQCA 4LCWA 3WKNA 3KGRA 1SY6A 1HCFX 2ORBL 1J18A 2EH7L 3ZKMD 2MWCA 2CLVB 4NP4L 4Z0BL 4WFHE 5DYOB 4ODTH 1RULH 2C7UB 3C87A 4NRZA 4ZOAA 2A9NH 4UT7L 2YD9A 4KUZH 1EEYA 1T21B 5ESQB 2B0SL 4N0UB 4JJ5A 4TRPL 5JPMB 3ZYOA 3GSXB 2QLVB 2BVQA 4G9DA 3K4DA 4Y16B 4YXKH 5I17B 1SBSH 4MXWL 4GXUM 3TIEA 3TT1L 4JPIB 4U1LB 3I75B 2EDNA 2F74B 2EIZB 3QH3A 2CJUH 4YHPB 3MBXL 2IQ9H 5HYEA 1FVEA 3GGWA 4UOW0 2KH2B 2D7TH 4I13B 2FR4A 3HI1B 1D5IL 2NNAA 4HT1L 4O2CA 4OLZH 2X4RA 4EN3C 1CQYA 5DRZB 2FX9H 2V2XB 4R7NA 4GAGL 5A2IH 3LCYA 2DQUH 1WT5A 1RZGB 1KELL 2VB5A 4RFNB 2I5YL 5KANG 6CGTA 4EBQL 4LP4A 3RWJA 1CGXA 4XZUA 1WWAX 1MUJA 4Z5RB 3DRTB 4OSUH 3L3GB 1HCVA 4RGMB 4PUBH 3C5JA 5E4EC 1HKFA 2Q8BL 3C60D 5DRWB 3ROOA 5DFTA 1GC1H 3SGKC 4P59L 4XVTH 3W0WA 1WIUA 2JCCF 3A6BL 4I48A 3V5DB 4QTHB 2X1OA 1XZ0B 5J57B 3KR3L 4OZHB 4KQ4H 2QJDA 2ZOLB 4GG6A 1ZLSH 5FGRA 4U1HA 4QRPB 1KCVL 3OB0H 5F1OB 4PJ8A 2BHYA 5F8RC 1T2QH 3F5WB 3LIZH 1LE9A 2DIJA 2GT9B 5L6YH 4YBLB 4RAUB 3ZLQC 2BNRB 3B9AA 1UZ8A 2P44B 4EDWL 1FV1B 5I8EA 2VZ3A 5ERWA 4JPWL 1OLLA 1NAKH 3WN5C 2VLRA 1MH5A 1OLZA 3FT2A 5GSVA 3MRMA 1TCRB 4Q9RL 5CJXC 3LKNB 4WY7L 5GZND 1W0VB 3MGOB 3ULUE 1U93B 5B39A 1S8DA 2VR4A 4U33A 3SCMB 4G6KL 5D1QD 3EZ8A 2VLKA 3LB6C 1CGSL 4MD0B 1CGWA 1IQDA 1X4XA 4R8WH 2V5MA 2NY1B 5J11B 3RL2A 5EU7C 1NBVL 4QEGA 2VLLA 2R29L 2G9HA 4YO0B 5E00A 2OL3B 1U3HC 1G0DA 1NGPL 2AQ3A 2CLRA 2BSED 5C0GA 3QP3A 3TBTA 3D87B 1I4FA 5BXFB 1IM9D 1IAOB 3SKOA 3TH3T 4FFYH 4WWKD 3WFDH 1CU4L 1YJDH 1Q9OB 1XGUA 4FFWD 3QIUC 3RI5F 2VDKL 1N6QH 3GB7A 4PGEB 4PJXE 3CLFL 4S1QL 4KHTH 4XP4H 4UV4L 3WDJA 3H3BC 5CKGA 2XN9E 5J1TC 1WT5C 3ARBA 1L7TH 2AEQL 3P0YL 3A67L 5DEFB 5CLWA 4ELME 4MJIA 4HUKB 3MRRA 2AXFA 5DJ2A 4OD1L 2LAAA 3QXAA 4QOKE 5I76B 1YYLL 1VFUA 3O8XD 1FNGA 2NW3A 3HAEA 1PQZA 2QSQA 4KDVA 4R7DB 1BF2A 1LO4L 1MCWM 1YNTB 1J05A 4L4VE 3GJEB 4WUUD 4ZXBA 4R97B 2AJ3B 4OZGE 3DLQR 4KU1A 1PD6A 2OSLB 3BSZL 4CVXA 4NQEE 2AI0H 5IESL 2BX5A 1BLNA 1X5IA 3I3EA 5FV1L 4IHOA 1KN2L 3K46A 4YBQC 3TBWA 4RAVB 3BE1H 1J1XH 3OAYH 1U8PA 1G7QB 4OGXH 4DUVA 3KPRA 1IJ9A 3IGAA 1X7QA 3T2NH 3NPZB 4OFDA 4ZPVB 3WEXA 2NW3B 3HPJB 5LQBL 2EXYD 1AXTL 4IRSD 4PJHE 4QY8A 2MCPL 3RVVD 4EXPX 2XACC 1P69B 3ZDZE 4D9RE 1U6AH 1MEXH 3DIFA 4EIZC 3RX8A 4C59B 4X6FB 3WS3A 1JWMB 4Z7WA 3T08A 1N26A 3QZWA 4BFGA 2EE9A 3ZTNH 4WEMB 4QF1B 4MAYC 4KK8D 3D3VE 3SJVB 2BSSA 3D5OF 2OI9B 4LRIC 2VR5A 5JXEA 3B2VH 5DJZA 5DT1L 3VXUB 4G7VL 5J12B 1GYAA 3PXJA 4HUUA 3OAZH 4F7TA 5INDB 4UOJA 1FL3A 4O58L 4FQ2H 5DJCB 4QRPE 4PJGA 4QTIL 1B0RA 3CXHK 5E00B 2AABH 4KTDH 4G42A 4EUPG 1DL7H 4JZJC 3EW3B 2J4WH 3UC0H 3MROA 3RFZC 5KS9F 3ARTA 5IFAH 3UTQA 1PZ5B 1W72H 4RMRA 4NQSA 4PJIE 3U82B 2AXGA 2W65B 3HC0A 4HX1B 5A3IC 3SQOH 5D2NE 4LPVA 1CXLA 4BSJA 5B8CB 5I0DA 4MMZC 3U4EB 2IQAA 5GSVB 5C0CB 3U36A 4MJ4A 2JIXB 4ZUSB 3SKUD 1DBAH 1NCNA 4LBEB 3MOBH 3RJDA 1QBLH 3BPOC 4Y4FB 1JNNH 3DETD 5SWZE 5F8QC 5GIRB 5TE4L 5JOFA 2P47B 5HVFB 1KB5H 4GUPB 1EXUA 3P73A 3MRNA 4NSKA 1EMTL 2HKFH 7FABH 3N1FC 1K4CA 2G75B 4JHWL 4JFZL 4FFVC 1KJ2L 2D2OA 3SGKA 3S98A 5L88H 1CD0A 4FQ1H 5KSBA 5GGRA 4D94A 1QRNB 3QIUD 3GSOB 1I3RA 1MCNA 2CDGB 3VFWA 1SM3L 4JFXA 2PUQT 3H9SD 1L9MA 3V4VH 1HWGB 3ARVA 1I3GH 3PWJA 1ZANH 1S7QB 5J11C 4NN6C 5FCUH 3H42H 4ISVA 4AL8H 3Q6FA 4YAQB 5JMRA 3G6JE 1LO3L 1BZ7B 1C7SA 4UQ2B 4JB9L 4ODSL 4LOUC 1QACA 3PIQA 5T1KA 5EN2A 4D9QD 3P30H 3ARWA 4J2XA 2VUOA 1S5HA 5E9DA 4Y5XB 2AV7A 4PJ9C 3QI9A 4M3KB 3MLXL 2JIXD 5EBWB 3VXNA 2EH8L 3QG7L 3VFTB 3MBEC 2ID5A 1AO7B 2ZUVA 5E03A 4LLVA 3KYKH 1SBBA 3G08B 1KCSL 3ARZA 4P9HH 5L2JA 1SY6H 4BFIA 3VXOA 2YD4A 4QKXB 2NXYB 4HDIA 3PWPB 4OD2A 5HY9B 1SYVB 2CO6B 3LZFL 4U3HA 1Q38A 3SGEI 1DFBH 5HGBA 1VADB 2LVCA 1EJ6A 4X80L 3CX2A 2IPKB 3K74B 1IM9A 4KTEL 2IH3B 2R1XA 1X5FA 1NC4B 3OHXB 1EUTA 3D25A 1YMHB 2WW8A 4N0CC 3RVVC 5IMLA 4ODHL 1D6EA 5AZEL 5HYFA 4MNQB 4YHNB 5C08A 5D7IF 3VWJA 4JREC 4U6HB 2FATH 4FQXD 5KG9B 1U8MB 1YUHA 1BOGA 1MSPA 2Y06L 1BFOA 5IB4B 4LIQH 1R3HB 3QHTC 1OGTB 3GZKA 4OB5L 3PUCA 5JIKA 3LN5B 4CJ0A 3JV0A 4HLZG 1PG7W 3K3QA 3JWOH 2VN4A 4BQCA 3JWDC 1QQDA 3X3GL 1MI5B 3C9NB 4XCNA 2Y25A 1I1YA 3CSPA 4HC1A 1MJJA 1S7UB 5JUEL 1J0ZA 4HJJH 1MWAB 1E4XH 3TZVA 1RZKH 4XP5L 2DICA 1XR8B 1KTKE 4FXKB 1U41A 4K8RL 4ZQKA 5EZJB 3CFDB 3A6CL 3WO4C 3FKUS 4P3DB 2FJGB 1T04A 1T6VN 1AR1C 3LKSA 4KJWD 5HDQL 4M8VA 3ARDB 1S3KL 1LP9F 3MLRL 5F9JA 1GAFL 1BJ1H 4ZYKB 4NKMB 4P4RA 3TO4B 5SWQB 3S4SB 3TH2T 4TUJA 4NQTA 4KJQC 1YPZB 3N9GH 5C8JB 4KMTL 1WJ3A 1UJ3A 2N56A 4OKDA 3ZYIA 3B9KC 3LPFA 4XBPA 4HUWB 1UM6L 2X09A 1S9XB 3CFDA 4UNUA 2ZKHH 4EOWH 4E41B 5IT2H 5I1EL 1MCLA 5EIIA 4LCUB 1XR8A 3LN9A 3QFDB 4QF1A 2X1XR 3PHQB 3CFKA 3BP4B 5D1XD 2IADB 1GGBH 2F53D 5CJ8A 3DMMB 5HJ3A 4YPGB 4ESKA 4RGNC 4ZG1A 4JFEB 4S10A 5DR5H 3OXRB 4XB7A 3WN5A 4BUHA 4N8PA 1DQTA 1XGTA 4S1QH 1U8LB 5FF6B 1XH3B 4F3FA 3GSWB 1I1AD 1T2XA 3PWLB 1TVHA 2ZSVA 2F15A 4F7EB 1AE6L 4PY8J 2YN3A 2DQTL 1SEBA 1VKXA 1GGYA 1JGDB 4JFDB 1ZANL 5KG9A 1YNKH 2HVKA 2R0ZL 3CZFB 2EDJA 1P4LA 4BH7B 2GJZA 3TBSA 2HH0L 4YHNA 4PGDB 1IGIL 2BOCB 3BN9C 4L8BA 3QUYB 5FO7A 3VXTA 3HMWL 3U7YH 2LQRA 1UEYA 2HVJA 4RIRB 4DOHE 5D2NC 2P7TA 5C0EA 5LWYL 3CVHH 4PYHA 1DQLL 2CR6A 4XXDA 4M6AA 5FM5M 4LVNC 3U0TB 1IGML 4BKLB 5EA0L 2WM0A 3I02A 4ONFH 3BKCL 1QSVA 2E9BA 4WI8A 2W59A 4P2OD 4WTXA 4LSUL 2EEAA 1FLRL 1RJLA 5D4QA 4LASL 4Z78A 4LVHB 3W39A 2PTVA 2MHAB 4PRBB 4LNRB 3W0WE 2A77H 4GKZB 3UAJC 5EDXA 4N68A 3LV3A 4F33B 2W0FB 2Z91A 4OTXL 5DC9B 3QO0A 5D7SH 1JK8B 5EZOL 3IDXH 1I8KA 3DV4B 3LKOA 2EDLA 3VWJC 5E2WL 4UINL 3TA3D 5FM8A 4ONOA 4X98B 3O4LA 2A74B 1I9EA 2R69L 3AXLB 4Q58C 2XPGB 43C9B 5E8OB 2DDQL 2XG5A 3QIBC 4RZCA 2CK2A 3I2CL 5C0RH 4H26B 4KRPC 3MLPA 4O02L 4OZHF 1DQQB 5K9JL 1P7KB 2C1PA 4HPYL 5CS7A 5EU3B 5I73B 4MCZA 1F4XL 1UG9A 5IVZA 1G7HB 1UCBH 2YSSA 2VDOH 1OW0C 3MLSH 1MY7A 1AGDA 2KPNA 4WI9A 1NCBH 1H3WM 3H7LA 4CNIA 4NGHH 3D85D 3BX7C 3MFGB 4XMLH 3HI5L 3RUGB 5ID0B 5HHQB 1A6WL 4ETYA 2KKQA 4KJWC 1QRKA 3QRGH 4PRPD 5IB5A 3ZTJH 3X17A 4RAHA 4R90H 4HAGA 1RZIB 4BQ9A 1BJ8A 1T6WA 1A4KB 5F9AC 2DQJH 4WTZG 1PAMA 3D39A 1NGZB 3QDMA 5IVXB 4PREA 3MACL 1UKQA 5EU3A 4JQXA 1ONQA 4OBRA 5I74B 1D6VL 1HXMA 4FP8L 1FGVH 1Q9KA 1F11B 3G5VB 2ADGA 4Z5RA 2A9NL 3FQRA 3UJTH 1C5BH 3M17B 4XB8A 4HWZA 2F58H 2WNGA 1G6RB 2YD5A 1ZHBA 1P5VA 2X9YA 5FIEA 4C4KT 2VDKH 1JGEA 1N6QL 2XNAB 1PYWA 3HI5H 1Q72L 5E2VH 3VFOB 3STZB 4GKZA 3K8KA 5IBUB 2VISA 3JVGC 2X4NA 1XF3B 4YK4B 4WHYH 1LO3H 4UAOC 2WINB 2IBZY 2GITB 1ZA6A 2WBJA 4Z78B 4PJXA 4KMQA 4XP6L 3CIQA 3MLYH 4U1JB 5TE6H 5F3BA 1HHGA 2HLAA 3JUYA 3T0VA 4QXTB 1LO0H 2EE2A 4O9HH 2ERJC 5EB9A 5HHXL 5B3NA 3IDIB 3UROR 4JN1H 5D93B 3STBA 4HLJA 4QRPD 3DO3A 1FN4A 4ZXBB 5AZ2H 5HI5D 1DP0A 1UCTA 1FFNA 4YHOH 4L4VD 4A2MA 1ZVYA 3DWTA 4MQXC 4OFKA 4POZD 5EPMB 3FONB 4JFFE 4F57H 2M8XA 2PF6A 1MHHA 3EHBC 4FG6D 4HXBL 3VE0B 1U2HA 3CNKA 1ZHNA 5DUML 1LK3H 3PWPE 4ZOBA 3MYJB 5C0IA 3BGMB 5I9QC 5MEOA 4XBGA 3BP6B 4OIBA 1AHWB 2BDNH 4LCWD 3VFRB 3ARXA 4M6ML 2HH0H 4ELMB 4F7MA 5CEZH 5IKCB 3TZVB 3VH8A 3ARFB 5TFSH 1NGXB 5DA4A 1KEGH 2OJEB 1N0LA 5I6XC 3ULSA 3QDGA 4NUGH 3NGBB 1IGFL 3NCYP 1GXEA 1E6JL 4LLMB 1GHFH 4MA8H 1DQLH 5HBBA 2DM4A 1NAKL 3KPQB 1EO8L 4LSRL 1NH6A 1OTSC 4HGMA 4OM1H 5MEND 4HKBA 4KI5C 1MFEL 1QSEE 2XKUA 2QQQA 2JKXA 2PN5A 4KC3B 2NX5D 1F00I 4L8SB 4HUNB 1F45A 5C0AA 1T04B 4ZTOL 5D6DC 1U8QB 1MIML 3O9WC 1QD0A 2XZAL 3TJHD 5C0IB 3WE6A 1BX2A 3ARGA 3UYOD 4LNVA 1CICD 1CD9B 4IRJC 5GHWL 3V6OE 3ULUD 3DX9A 3MV11 5IMLB 1JYNA 5JHDA 1ES0A 3C8DA 2PYFB 1N7MH 3CCHA 4GMSL 4X5LA 2W1NA 3ESVF 4AT6B 4JPVL 4FQLH 2H1PL 2XY2A 1ZLUK 4KAQL 3D48R 1QFWM 3BPNB 2EC9U 3UBXA 3VFGL 5HVHB 4FN0A 4PJCF 3WSQH 3RIFF 3BDYH 3ES6A 1NBYA 3MLRH 5FM5O 1D5XB 5TF1H 2ICEA 4RDQG 2JELL 4P2RA 1MJUL 2CLZB 4FMFA 4JO1L 4JDVB 1MVUB 1U92B 4PJDB 5HI3C 2X9WA 4M6NL 4ZD3L 3VXMB 2X4SA 3UP1A 3VXSD 2BHZA 3PWNB 5MEQA 2OTWA 2SEBA 5L2KB 3D2UD 2IAMC 1JUFB 3RHWK 4JDTH 1T66C 1FE8H 4CADB 1V3JA 2PW2A 4XPTL 1VADA 1ORQA 4IRZH 4I18C 2XKSA 4Y2DD 3BZEB 3ARSA 4ODVL 4NNYB 5D1QA 1H8SA 4OQ1A 2P1YA 1SVZA 1FFPA 2KZ1B 1SJEB 3KXFE 3Q6GL 4D3CH 1BVKB 1EDQA 3O6LL 5F72S 2RB8A 3FQTA 3NZHH 1TETH 1JRHI 3G6DL 4ALAH 1KIUA 3IJSA 2AERT 4OZHA 3T1FB 1NAMA 3P9WB 1BECA 4U1MA 3FT4A 2X4SB 3O4OC 1IC7L 1EO7A 2V7HA 5D7KE 5GGTL 4X6CF 5C08B 2FYYA 5F44A 2NQCA 1TJIL 4PJAB 1HOCA 3SEPA 4R4BB 3MO1B 5ALBH 3U83A 2CRIA 5E8PB 5D7JD 3ULUL 1ORQB 4MQSB 2IANE 4CVUA 5J3HC 2CUHA 3G6JA 4NBZB 1NCAH 5GS0H 5DI8B 1TZGH 4WJ5A 4ISVB 5BZWA 1IL1B 5ESQA 4JRXA 4P5MB 4DGVH 3BKJL 2J8HA 1KT2A 4PJHA 3TM6A 3MODH 3OKYA 3RGVA 5F96H 3AREC 3U0WL 1KCKA 3QA3A 1SY6L 5KVGL 2F5BL 3TVMC 4HCRH 1HOCB 3X3FL 5I1JH 4NQSB 2V2WA 3BQUB 3O6KL 3VXNB 3HNTL 3E1F1 2V7HB 3UAJD 3AC0A 4NP4H 3CD4A 5DI8A 1T1XA 4WW2F 5DDHA 1AIFA 4OZHE 2LTQC 1C5DB 3LKPB 2ITDB 5JHLH 4WO4C 1QSFB 5TF0A 3IDXL 2CGRH 1E28A 2J2ZA 3DGCR 4JFPA 1JHLH 4DKAA 3O2VL 2CLVA 1FFQA 1UACH 1Z2KA 3BWAA 1AKJB 4FABL 4ACPA 1JZ4A 4MXQD 2H9GB 2BVUA 4C56D 5F7KC 1YECH 4FQCH 4LHUB 3Q5OA 3FFCE 5CGTA 4L4TB 1D9KD 5KVFH 4JDVA 4KK9C 1JPFA 3TYFA 4P4KB 4KI5D 5DJ0A 4LSDA 1DCLA 3CFBB 4I2XB 3HG1B 4YHYB 1MREH 1KB5A 3PWUB 3DTXA 4NUGL 1L7IH 5HGHB 1MQKL 1KELH 1E6JH 1E4JA 5EC2B 1YJDL 1DSFH 2NXYD 3HC0B 1VB9A 3DUSA 2EDXA 1E6OL 5D5ME 5FYJU 3ZT7A 3P77A 1U9KA 5F70A 5JIIA 3C2AL 1BLNB 1U91A 4Y5VC 5CILL 5DWUH 2B1HH 3QXWA 5C0JB 5J6GA 4OI7A 3GIVA 4WGWB 1MFCL 4U1KA 2ADIA 1JNNL 1B9ZA 5TQ2H 3EYSL 4YHZH 4K7PX 4PJCE 1J05B 1QOKA 3WHXA 3MRPB 1IEBA 5J6HB 1FL3B 1XF3A 4S0TD 2GSGB 5D1ZB 2NY7L 4V1DD 1FGVL 4JFZH 3W0WD 4GMSH 2XYCA 3BP7B 4PGCA 5FOBB 3OQ3B 4PRHE 5FYJL 2AEPH 3WNOA 5IB2B 5EUKB 1DN0A 4G8IA 3DMMA 5HJ3B 2F58L 4NKOB 4HUVA 3DBXB 5IESH 4G5ZL 4L9LC 2MHAA 5DMKB 4YDJB 1U91B 2NY6C 4XAKE 2FZ3B 3QDMB 3AS2A 1E4WL 1LO2L 3OKMB 5EO1A 4WW2C 3DETC 1RZIA 5AG9A 4MHHI 1OVZA 5KSVA 2VQUA 3M17A 3QEUB 1NGXA 1KC5H 3D39E 4XWGH 2VABA 1VEPA 2DQCL 3O8XA 1HNGA 5FO7B 4UTAH 3SKJL 5T33L 2WLYA 3WUZA 1BD2D 2GJZB 2AK1L 1G7JB 3MLUL 3MUHL 4CVXB 1CZ8L 3ROLA 4PD4J 5IVZB 4MJIE 1KACB 5F96L 2QR0A 3RIAF 2VITB 1IC4L 2DQIL 2FRGP 3S7GA 3GK8L 4Y5XC 1YMME 3JWOL 4LQ1A 4OIAA 4UNVA 1CFQA 3PWUA 1IBGH 4PJ7E 4YC2C 5C9KA 5KAQF 3T0BA 1QP1A 1CE6A 1U8MA 1YUHB 1SBSL 4MXWH 3JZ7A 1RK1B 2VN7A 1XGUB 4YZFF 5D7SL 4M43L 4XHQA 5J06A 5DHYA 1LK2A 2DM3A 3CH8A 4JG1H 5CD5C 1C5DA 1LDPH 4PJBF 1RHFA 2R69H 3A6BH 3ZE1F 3K2UH 4LK4A 3ZE1E 4DN4L 2WV3A 2DM7A 4KZDH 3KLAA 4Z7OE 5ERWB 3C6LB 3U7AA 4PJ7B 5I8KL 2YUVA 5GHWH 5I1LB 2AAVA 4EBQH 1RY7B 1R5IA 2GT9A 2PR4H 5HI3D 1T20B 3QNYA 5IP4A 5EZJA 1UH2A 2YK1L 4RIRA 4NQXB 2WUCL 3GRWL 4GLRI 1RSFA 1E4KC 1C12B 2WBWB 1C08A 2VERN 3KR3H 2VZOA 4V2CB 2XTLA 3KDMB 2GIYA 4HPOL 4KKAC 1UWEH 3PGFH 1FLTX 4PYGA 4TTDC 3TEUA 3EYFB 2YPKB 4N0YL 1SJEA 4NRYA 1A7NL 3UJIH 2UUDK 4F7CB 2WBKA 5LCVL 1A7OH 2VXUH 1EAPB 2ZUWA 3PABA 4KUCD 1AI1H 1BFTA 1E0OB 5C07A 3GJFA 4K55A 3IRZA 2YMXL 2PO6C 2XICA 3NFSH 8FABA 2K3TA 4YXHL 5B22A 2E6JA 1L9NA 5FAAA 1K6QH 1F3RB 2AJYL 3OJMB 1S7WA 1TDQA 4ZO9A 4XTRC 4RISL 1D9KA 3C5JB 3SJVA 3C2AH 1A5FL 3O41B 2ZSWA 2VRAA 1I7RA 5IFAL 1AHWC 4C56B 5IHBA 4CMMB 4H5SB 4BSWB 3QZWB 4K7PY 2J8UA 5ACLA 3UTSB 3JTTB 3SE4C 1A47A 4O51B 4MAYB 3GSXA 1G84A 2IJ0C 2EDFA 5GJTL 1U58A 3TWCH 2EKJA 3ZYJA 5TPWL 3VXTB 3H2WA 3IU4H 4XNMB 1NMAH 3U7YL 4J8RA 4E0RA 2AS5M 3L5HA 4C83B 3AB0C 3QYCA 2IAND 4PRPA 1MJ7H 4N1HB 4PJBB 4D8PA 1J7VR 5E6ID 4M61A 4GKNB 4M48H 5IF0B 4P3WA 4S1SL 3Q48A 1BVKA 2BHUA 4IOIA 4UAOB 1MWAA 4BKLA 1R3IL 1U2CA 4TUJB 1G7MA 1K8DA 1NUGA 1MJ8L 5D72L 4QYOB 3PGCB 5GJTH 5GRJL 4WTZA 5FXCH 1JWUA 2R4RL 3BN9D 4O02H 5EIQA 5EO9A 3BKYL 4Y2OA 1P9MA 5GZNC 1CIUA 1HN1A 2PYED 5DEGB 4PLJD 1CFVL 5CUSL 5MEOB 2DL9A 1R6VA 3O2WL 5BVJA 3LEXA 3C60A 2Q3ZA 1A64A 4JZNA 3GUTB 5EUOA 1OAXL 5T1LD 1INQA 1O7SA 4D9LH 3ET9F 1AXSA 4I3RL 3MRCA 3N9GL 1FNFA 3A0OA 2KBGA 3K1DA 4HKJA 4K3DH 4QGTA 2ZPKL 5TGBB 4CW1B 4X7TB 3LQAC 4LLMA 15C8L 1FYTB 1A1OB 3RDTD 4HK0A 1FQ9C 2PTTB 4M7KL 2XQBL 1CLOH 1LMKA 3JV6B 3AM8C 1ZEAL 25C8H 1C1EH 4LMQE 2CKBL 1JPGB 1OAKL 5FYJE 4NZTH 3C6LC 3DRQA 3EYQD 5F3BB 1U8NA 3WNKA 5IHUL 1D6VH 5DD3L 3VI4F 5DQDH 3P4NB 4NC1E 3MCLH 1ZLUH 3BGAA 3KXFD 2HKHH 1A3LH 1JGUH 4JN2B 3O2WH 4V1DB 4OGYL 2EXWC 5D5MB 3FONA 1ZSDA 4UZGA 1ES0B 5CD3A 12E8H 3OG6B 1S5IH 1IFHH 4OB5H 1DZBA 1V3KA 2W91A 1A7RH 1U58B 5IJKC 3M45A 1P5UA 3EOYG 2BRRH 1OT2A 2ZCKL 4P4KA 1Q0XL 4M7KH 5E70A 3V8CA 4LQFL 4H0IA 3MJGX 4N8CH 4BK5A 4XWOD 1AHWA 1FL6A 2RAMA 3QSKB 2FEDD 3MOAL 4XCFL 1G9NH 4ELKA 3H9HB 3DV6A 4PRHD 1FZOA 3VFOA 4NO0B 3KHQA 3PGCA 2X4NB 3S35L 2J88H 3W2DH 5ISZA 2XNAA 5D1XA 2CDEA 1FZMB 3G5YA 1DQDH 1OGTA 5JPNB 1N4XH 5IW1B 4MNHB 2ATPB 3FB6A 3BDBA 4CNIB 3KPNA 4OQTL 1QBMH 3M1BA 3UXFA 2YEZA 2OM5A 5D2NB 3EDKA 4N0RA 3HLAB 1BGXL 4PREB 1KJ2H 5TPWH 3HCVB 1S5HB 2YA1A 1FBIH 2OXHA 2X70A 3QXVA 1NMAL 1DBKH 3QJHB 1LD9A 1Z9LA 5I75C 1OF2A 3VGAB 1KTLB 5DUPL 4P2QE 4G9DB 1KYOJ 5ITFB 2VUYA 4XVJH 1RMFL 1A14L 4QNPF 4X4XA 1G6RA 3U79A 2Y72A 5C6PB 2AP2A 1D5ZA 2H2SC 3RA7H 4CN4A 1CDBA 4MJID 4B50A 5D7IB 4U1NB 2FSEA 3EYOB 4JQIL 1KN4L 1LK2B 5GISH 4U31A 3PQYE 5F7NC 3RNKA 3WXWL 2GJ6E 4TUKL 5BV7H 5K9QI 5E5UB 1I3RB 1V7ML 1ERNA 3MLXH 5GGUB 2NYYC 1MJ7L 1HQ4B 1FZJB 2AJVH 4LKCB 1QFUH 4XBEL 1R0AH 5SWSD 4L8CA 1INDH 3C60C 2F8XC 5F1IA 3KYMA 2ATKB 2GY7B 1FFPB 4IOSD 4NDMA 4WDIA 3VXSB 1AP2A 1B0RB 3PHSA 4OF5A 5IB3B 1IC5L 3BH9A 2OR7A 4HW6A 1T1XB 1DEEA 4AENB 1QR4A 4KK6C 3UO1H 4NC0B 4MMXC 1ONQB 5LXGL 3MUGA 1I7TA 3QUKA 4ZTPH 3Q2CA 4ZPVA 2NY2C 4MNGA 4W81A 5E9DD 4DAGH 4PD4K 4LU5L 3LD8B 3BP6A 2EYSB 3QAZC 1P7KA 2C1PB 1XIWB 5D96C 2R2EB 3RKDD 4F7PB 1JWMA 4Z7WB 4JRXE 1UWGL 1FYTD 3E2HB 3ZYZA 5IM7B 4CU6A 1E6OH 2ZOKA 4AMKH 3KPSA 4FTVD 2VZ1A 2CDEB 4FQHB 5D1XB 4ZUUA 1KLUA 5E2UH 2ITCB 4R0LB 5ADPH 3ZE0F 4NWTL 4XNYH 3I6KA 3VI4E 4YFLI 5C1MB 3HUJB 4N9GA 3QNXB 1JWSB 1XZ0A 3O3AB 3CU7A 1ZT7A 4Y5VB 3IVKB 3RZCD 5BVPL 4XTRD 2ESVD 5KS9A 3ROOB 5DO2D 3QUXB 4U6YB 1BAFH 1UM6H 5F7FA 3UYRL 3BRFA 5EBGA 3QEHA 4NOFA 4O4YL 2GHWB 1P7QD 2PW2B 3ILQC 1X5HA 3B4NA 4OGYH 3U4AA 1CU4H 3WJJC 1T7WA 2UWEE 1I7ZA 1IEBB 3MRJB 1XCTA 1J8HA 4XMLL 4WW1A 4YNYA 4N8VG 5I15L 1R3KA 2R1WB 1UC6A 4PG9A 1UVQA 4Y88A 2H8PB 5E5MA 2FZ3A 5HYSA 1M1SA 1ROWA 2BSSB 4HGWA 3E8UH 2XXCB 3MTRA 1WZ1L 3GKZA 2PXYA 4G8GD 3SCMA 1ZT7B 4Y5VA 5J9PB 3QQ9D 4GFTB 1GJIA 4TSAH 2AJ3A 2AXJA 1KC5L 3D1MC 4LSRH 2HRLA 1P53A 3EIFA 1SYSA 3IDMB 3MODL 4R3SB 3DTXB 1MLBB 1YPZA 4P2OB 3MBXH 4WWID 1C16B 5EU4B 3V6OA 4PJEE 1YMMA 2IMNA 1G7QA 3CXDL 3QI9C 2B8OT 4EVNB 4RMWA 1ZMYA 4JRWA 4K8RD 3GSVA 4R2GD 1MHPL 1A14H 3ARFD 4GXVH 4NZUH 5GSRA 1JP5A 5FYLE 3HNSL 2VTFA 3DI3B 1I1YB 2FEEI 1AC0A 5AZEH 1LWRA 2GJ6D 3BGFC 5JMOC 3O4OB 4L3ED 5JW5A 1OY3B 4P2RE 1QBBA 5HHVH 2Q8BH 2VLJE 5JXED 1F8TL 3WBDA 2AKRB 4N5UA 3QJFA 4JPWH 1WV7T 2A74A 3GHEL 4JFEA 5HTSA 5J56B 5ESAA 4FQCL 1ZK9A 1I8KB 3DV4A 4XPHL 5JIHA 1NGQH 1MJUH 2AK4D 4OCSH 3ULVE 3D3VA 4MWFA 3CX5J 3NH7H 3TV3L 4DZBA 4ZFGL 2Z35A 2FL5A 1WZMA 4PFEA 4JJHA 5E6ZA 4FFZL 4U6VL 1IAII 2HFFA 5C71A 2QEJA 4WNQB 3RTQD 4TQEH 4YGAB 5GJSL 1IEAB 3LDBC 1IGCH 5HGHA 2H2SD 3RWJB 1NGPH 2YUXA 5EU5B 3OF6D 2VSCA 4Z7WF 4TTDD 4Z7VA 4M5YH 2Y4SA 4BQBA 4OIIH 5IQ7H 1FO0H 4NQCB 3IAGC 4FTVE 1I1FA 3I6GB 3KXFB 5I1CH 2NY4D 2XQYG 5E8PA 4MB4A 4R2GB 3RVWD 2H9GA 5MP6L 4IRJB 1L0QA 3RPIB 4YUEH 2XKNB 5LCVH 4KJPC 5F6IC 3MUJA 5KJRH 2OX5A 3MREB 5FKAA 3ARFC 4YDLB 4P57A 4WU5A 4U6XB 4NQED 1FNLA 3TO4C 3RVXC 4LRIA 1G9ML 3SDAD 2YKLH 4XC3L 2BNQB 2VLKD 4IRSC 4JFXB 4NOBA 4XPAL 2I07B 2NY6B 3DX7A 3S37L 3X3FH 5BQ7B 4JY4A 2FH6A 4PP1C 5ACMA 5BZDB 1ZV5A 3AU1A 5I6XB 3QDME 3VD9A 5SWSA 5SX4H 5JDSB 1D5IH 2OP4L 5DVNA 5FUOL 3T0EE 2MJWA 4OLZL 1NAMB 1JPSH 1TTFA 2NY0C 2IH1A 2C3VB 5I30L 1CFSA 1NFKA 4UU9A 1FCCA 3AY4C 1T1ZB 1QFOA 3U0PA 3D69A 1G9MC 3OGOE 2A6DB 4XH2B 1JJUA 4K3HA 1WZ1H 4R97C 2MPAL 1I1AC 2JIXA 1H3TA 2ILLA 2YD1A 3V6FB 1U6AL 4HF5L 5T33H 4XNQB 4YXLL 3NFPA 4OZIB 5IMMA 5EOCJ 5DSCB 1C12A 3REVB 4PJGF 5F89B 3BE1L 4XMPH 4DCQA 4HMCA 4MS8C 2ZJSL 1RFDL 1ADQL 5J89A 2XZCL 4RA3A 1HH9A 3GKWL 2YPLD 3WD5L 1FIGH 5SX5K 4F37F 2HVKB 1GL4B 5I17A 3FN9A 4UI2A 3NAAH 2EXWD 2B2XH 2B1AH 5IBUG 3TT3H 4X6CB 1OD7A 3MA9L 5HPOA 3UTSD 5DXWA 1ZWIA 1OHQA 1AD0B 1CFVH 4JKKA 1Y6NR 3VDCA 1F13A 1YJDC 2YK1H 3EGSB 4KUCF 1RPQA 1LNUA 4G6JL 1H8NA 3CUPA 3NCJL 2ZWLT 3MBEB 2AXGB 3O0RH 4BZ1L 4J6RH 1TMCB 1OAXH 3KWWB 3R4DA 4Y19B 5C09E 1KJ2B 3RWHB 3O2DA 2Y07L 4NQDB 4P46A 5C0AB 2G5BA 1D5MB 3IXTA 1JZ6A 3MV8E 3SPVB 2NXZC 5DK3A 4X9GA 2P8MB 5EG6C 4ZUSA 1H3PH 3LRSB 5IOPA 5FOJA 1LEGA 1WWWX 4P9MH 2NY3D 5F7WC 4HIJA 3IDMA 2VDPL 1F4AA 1R24A 1MCOL 3P11L 2AJXL 5DD6B 1EFQA 5EBMA 5DQ9B 3FO0L 2I60L 2VNCA 3MJ8B 2XRAH 5TDPB 2HFGH 3FFCB 5E2UL 1GC1L 1DN2A 2P49B 4MB5A 2OQJA 3ARQA 2J6EA 4IDJH 1RZ7H 3VD5A 1ETZB 5KVDH 1TPXB 5E5MB 1P6AB 2QHLA 5I1AB 2NXYC 3BJLA 4YEEA 1EIBA 4LF3A 5IJVA 5KSAB 5TE4H 3C9NA 4XCNB 3W9DA 2JB5H 3JVGA 2W9DH 2DQHH 3BT2L 5FHAH 5CMAA 1EA9C 5GGSB 4CMHB 1IGTB 3KPMA 5BRZA 1DBJL 3PJSA 5F1NB 3TO4D 4NBXB 4CAGA 2ARJA 3P9LB 5T1LA 3JV4A 1F6LL 3QQ9C 4XVUD 1A7PH 32C2B 3OKKB 3MZGB 1UWXH 3TCLA 3TN0A 2ED7A 1TNNA 3CDFA 4PP1D 5LJYH 1GGCL 2M2DA 4RFEA 3GHBL 4HEPG 4PJIF 3TBTB 3B83A 5C0GB 4AEEA 2ITCA 2CIKB 3QNZA 3OAUL 1A4KA 3QWOA 5LKNA 5D2LB 1XGQB 4RQQA 1X7QB 4JEGB 4P4RB 4LBEA 4N1EA 5GGRY 3C5SA 2A0LD 1XGYH 2ICWI 5A43C 3FT3B 4XMKH 3OBAA 3MRHB 3UTTE 2YPKA 4YHKH 4LCYB 2IANB 4LVNB 1FBIL 2E9WA 5C2BL 3GSUA 4S1DC 4GH7B 4PJ8B 3MGTA 4K23H 5DHVB 1GGIL 1UXWB 4MCZB 4F9LC 1ZLVH 3F7VB 3LKNA 3KPPA 4I3GA 3TNNA 4PGEA 2YD7A 3QEQB 3DUSB 3N1PC 3MRQA 4LVHC 5KSAD 2XV6B 1CD1A 5DUMH 5C0BD 2EDRA 3MV9E 3VFVA 2LU4A 3DX8A 4P2CG 1N8ZB 2RBLA 2XZCH 1NKRA 3B9KD 4L3CA 1RJZB 2WK2A 1X5YA 1CXFA 3VA6A 4JGMA 1J88A 2FLBT 2D9QB 4TNWK 3TESA 2JCCE 3SDCC 1RIUH 2WUCH 3GRWH 4L3EE 1FZJA 4LKCA 3LKOB 2XFXB 2NY0D 2MOVA 1WCBB 1DE4B 3FHQA 3HI1A 1Q9OA 2FO1A 3G04A 2APBA 5DF0A 2M1KA 3DMMC 5FECA 4Y16D 4XPHH 2DAVA 1KCUH 3TN0D 2J6EH 1JHLL 1ACZA 3GJFK 4XCCH 4QHMA 3KVQA 1FP5A 1JZ5A 1H9VA 1DBBL 3DHJA 1FIGL 3HE7C 3FO1B 3QAZB 1RJLB 2Y5TA 1UKSA 3WFEH 1BPVA 3S34H 2D4DA 4NZJA 5D7LB 1XF5B 3DVGA 3E6HA 4QRTB 4POYA 3IT8D 3NCYS 4Z18A 3U2SB 3TFKC 4F33A 2VDOL 3MLSL 5I9QB 4LDEB 5JA8B 1N2RB 2X1PA 5IR1B 3VRIB 2ZOLA 4QGYA 5H35B 4NWUH 5DGQA 5FGCB 4P9HC 3FQUA 4PJ8D 5DZLA 4N90E 3DURA 2R15A 4ODWB 4C56E 2OL3H 3R06B 3S3JA 1KCUL 1WZLA 3J8F7 4U7MA 3L3GA 5DD1H 2NY5H 3I02B 5HDOA 4X99A 2X4UA 3WIHL 5CINL 1FVDB 2R0WL 4TOYH 3BZEA 5L0QB 5FYLD 4PJGB 4PRIB 3QDAA 2AK4A 5ESVB 1O5DT 4M1CD 4WVRA 3CFEB 1G9NL 3ILQD 3OF6A 3F58H 3EYUL 4NQCE 3KPRE 2EH8H 3QG7H 4Z7UB 3T1WA 4J4PC 1T22B 2YZ1A 2ESVE 2YKLL 3KYKL 4XC3H 2QBWA 3L3HB 2D03H 3SDDD 2X4QA 2DQEL 3X14B 3T0EA 5IMKA 3CDYA 2O5YL 4EQ2A 2WZPD 1JBJA 3QUZC 2JJSA 3WFDL 5DUPH 3CAFA 4NKOA 2PO6D 4Z7VE 4HUVB 3FN0H 2EEBA 3TIEB 4KKNA 3VI3E 4I9WD 3O81A 5CP7A 3S37X 1Q9WB 5EOTA 2Q8AH 3SGDH 5F3HA 2EIBA 5DK2A 5F9JB 4P5KA 1RVFH 2A6KB 4EN3A 2W60B 3U4BH 3SN6N 4PJDA 1WBYB 1HZHL 1DBJH 5DRNB 2WWKT 5T3XL 5INCB 5CZXD 1V7MH 3QFDA 3CU1A 3VGFA 1IT9L 1UM5H 3F7YB 1BX2B 1JI1A 1Y6MR 3RBSA 3TT1H 2NY3B 1TVBB 4M62H 4NCC1 4ONFL 4OZGB 2MFNA 4JFYA 4JJ5B 3GHBH 3ISWA 1YQ2A 1S78D 3JWNC 3P4OB 1SM3H 2YRLA 1I75A 4NRZB 1DEDA 5A40E 4Q2ZB 4HT1H 3QDJD 3GSWA 1N5AB 3PNWA 1F97A 3B3IB 5E08H 4NUJA 5JQ6L 1J1XL 1OB1B 1UJ3C 1FCGA 3QIBA 3VGAC 3D0LB 2DJ4A 1QFWL 3X11B 4X4ME 2CH8A 4HK3N 1ZVSA 3ZDXE 4ZOEA 4QHKJ 1CFBA 3CXHJ 3MV7A 4PRDB 4NQDD 5E99H 3SE3C 3HZKB 4ELMA 4MQ7B 3R1GH 4WV1A 4UUJB 5DJDB 1AY1L 2I9TA 4R26H 3VFPA 5CKAA 4YBLC 2VXQL 3H0TA 3UO1L 3FRPA 4FNLL 5FB8A 4PJ7F 5C8JA 3KPQA 2A73A 1RZ8A 5F7EL 3OKLB 1T3FB 4PS4L 3WKMH 5IEKB 4HEME 2R2BA 3TV3H 5FHBH 5I1HH 2OTPA 5L9DH 4GOSA 2VDQL 3HTLX 4MJ5A 5C0AE 1KJMB 1WEJH 2J8UE 1Z3GH 4W6WB 5JQ6H 4FQXC 5FO8B 1KTDA 2DQJL 1M6OA 3ARBC 2CIIA 4G43A 1SHMA 3AMKA 3WFEL 5HSFA 4ZPTB 2AABL 2XWTA 4KTDL 3U1SL 3QI9B 2XT1B 4J23A 3GBNH 1EZVX 3UYRH 1P4IH 5FGSA 2DTML 3MRLB 1AY1H 1G7IA 1G0YR 1ZLWK 1XF5A 3DVGB 3PIQB 4OV5B 1AR2A 4R6UA 1HHJA 2JJVA 5ENWB 2VLRD 3UJJL 1IE5A 1RZ7L 4HWBA 3WFBL 2WSKA 4LARL 2FECI 5EU5A 1JMZA 2DQGL 4ODUB 3S34L 5TH2A 5FA3B 2E6QA 3G6AA 4FTVA 1U3YA 1EGJH 1H15B 3ZT6A 1JIBA 2GYSA 2XXMB 2X1WL 4RNRB 4QHUB 3CFCH 4MNQA 3HR5A 4YHIA 1CDUA 3U6RB 3P2TA 2YWZA 3RY5A 2YMXH 2ZG1A 4K8RH 4PJFA 2C3WA 4TSBH 4IOFD 4S1RL 2ADJB 3P4MB 3OJVC 4HIHB 2XWJB 1UQSA 4A6YH 1FORL 3GBMH 3X11A 1A3LL 4NNYA 4PJ5A 5IB5B 3QIWD 3G6DH 1BZ9B 4OLUL 2HTLD 2CQVA 5ID0A 1Q9KB 3G5VA 5TE6L 4UQ3A 3OPZH 4LARH 4OZ4A 5E8EB 3VFPB 1NC2A 1BF8A 4PIRF 1B4JH 4M1GL 2QSVA 1WFTA 1XIWC 1KPUB 1OCWH 1BQSA 2ARJQ 5C07D 4Y4HD 4TSCH 2MPAH 4ONHA 2FLRT 1OAZL 1OQOA 2P46B 2EKSB 1R5VB 4OFPA 5T3XH 5ACZB 1UM4L 2VLRB 3NIDE 4D2NA 4FFWC 3WFHA 43C9A 1NFIB 1BZ7A 5T5FL 1WC7B 3NABH 1YN6A 5TDOA 1IGJB 4HS3B 1FG9C 3GSOA 3ECBB 4OUOA 2FECL 3RY4A 3IFOA 3P0VL 5FA4A 1F4XH 1VHPA 1I1AB 3U9PL 5GRWA 3BO8A 4CGTA 3ARGB 4HH8A 2CUMA 3AB0B 1UWGH 2BVOA 3FFDB 3QEGH 4H0HB 3ZDZF 1WBXA 2AJZB 4G8FA 2NY0B 3T8XA 2F54B 4M62L 4M3JA 1N7ML 1NANH 5MI0B 1X3DA 3FO9B 2GJ6B 3HMWH 2BNUB 2WAHA 3RX7A 1J8HB 4MYWB 1FNHA 5KTEL 1OD9A 5BO1L 4PJFE 3SDXA 1I85C 4MX7A 2AJUL 4N5EC 3OXSA 4L3EA 2YPLA 3WS6A 4HX1A 5IK3A 3CDGB 1J8HE 5IQ9B 1FLRH 2MQ3A 3W39B 3HUJF 1EZVY 2IPTH 3BGMA 3EJZC 3QG6A 4WUKL 2V2TA 3DSNA 4OTXH 3FO0H 4H25A 3WDIA 5DD3H 4PJ9A 1LEGB 5DJ2B 4WFFE 4WEUD 1A7QH 1QFWI 3HN3A 5I76A 3WO3B 3PGDB 3HRPA 4F37K 1OAQH 5C6TH 1NC2D 2NXZD 2DWEB 1CF8H 4ODBD 1YEIH 2VE6A 5GS0D 3TPUB 3WUWA 3VGDA 5C0CD 1FO0B 1PKOA 3WUWG 2B4CC 4I18B 5K9OA 2DQHL 4G8IB 1DN0B 2FX8L 1W0WA 1YQVL 3BMVA 4HBCH 5GRXG 4HS3A 3T04D 5HGAA 1NPUA 1FC1A 3BJ91 5HDQH 2DLIA 1VA9A 4WI6A 2VXSL 3BH9B 4HZAA 5MENE 4WEBL 4QRUA 4RMVA 3KYMB 1Y18B 4GQ9L 3T2OA 3OKDB 1FORH 3GMQB 2VXVL 4Z0BH 3W2DL 5FUCC 4M4PA 1Z9OA 1FSKC 5I19H 1DQDL 3TLRA 3FCTA 4N8VA 1BIIB 5CZKA 3IB4A 3K4AA 1U93A 3NOIA 3D39B 5IVXA 4JM2A 4ZO6A 4HIIA 4EI5A 2F53B 3BIAX 1ZS8A 5DTFB 1CVRA 2XZQH 1YEEL 1BAFL 4RGMC 3SE9L 4FA8A 5IW6B 4XNQA 2IANA 3ARRA 3CFIC 5L8KB 5T3ZH 5JW4N 2VLLB 3FAWA 4G9FB 3NBNA 1HKLH 1AD9B 3O6KH 2H3NB 3IRPX 1T66D 1RZKC 5B38A 4Z77B 1IKNC 1TTGA 4QRPA 1BFOB 2EC8A 4HFWA 4MAUH 5ECJE 3WJLA 3L1OH 1CN4A 4LLYB 2R8SH 2NW2A 1UXWA 3IDJA 5I2IA 4X0KB 5I18H 1G7PB 1PSKH 5GS3A 3T0WA 1OT1A 1CXKA 3ULUF 3K8LA 2FCBA 1A6AB 5CBEA 4JQVA 5BV7L 3QUML 1NC4A 3OHXA 2ARJB 2EYRA 4KQ3H 5IUSA 1UYWL 1KYOK 1NCWL 1RZGA 5TF1L 1QLRA 5CEYB 2AJXH 2DBLH 5DMGC 1CDIA 4PJ5B 1XGPA 5DVKA 5HHOD 5C0DA 5JO5B 5CD5D 4JFFB 5F7EH 2YUZA 2N7BA 4DUWA 3MREA 4BJLA 1I9RH 4OF7A 3MRDA 4LSUH 3VW3H 1WIOA 2F8VA 5HI4D 5I2IB 5KTEH 4POUB 2V5TA 5BRZE 4ETQA 1U8JA 4YBHA 4J4PD 3RGVD 5DLMH 3V0VA 3B9KA 2LU7A 3QRFM 4MQ7A 4PG2A 5DFVD 5L7XL 2BJML 3MOQA 3PP3K 2R29H 3PE9A 3V4PL 3PV7A 4Z6AT 4QRRB 3SE8H 5IMOA 4BZ2H 3U9UA 4Z76A 2GTWA 3QPQC 2RHEA 4UDUB 5KN5B 1A6UH 3HUJE 3VXME 2BY1A 4KKCC 4PTUB 4HIIB 1EPFA 1IC7H 4G9FD 1MFEH 2C4FT 5E94B 1VPOL 3QHZH 2F54E 3QULA 4W6XB 3L5WA 2Y7QA 4KHXL 4S2SA 3RWHA 4H0GA 3EO1B 2IPUK 4OZFA 2NTSP 3BWUC 3IF1B 2IEPA 2X42A 1YEIL 3DJ9A 2H26B 2QHRL 1C5CL 2PCPB 4QXUL 1VFBA 4JFOA 3VRJB 5MENB 2UZIL 4NZRL 3LEVH 5EBLA 1G0XA 1NUNB 3RVUC 1JRHL 1K6QL 1OQXA 4TSBL 3MV9B 1U8IB 4PJHF 3SE8L 3VCLB 3U0WH 3S35H 3L7FA 1FNEA 2DLEA 1T5XB 1F42A 4PRHB 1U8KB 4HV8A 1OARL 3TF7C 2DL2A 3KNBB 4JR9H 3BHBA 5IBLD 4RDQF 2JELH 1MCQA 2HJKA 3MXWH 4NO5A 3UTQB 5CGMA 1DQJB 2APTA 2DM2A 1Q1JL 4OCRL 4JLRB 2VXTH 3BQUC 4LVOB 4MA3B 2JE8A 3MROB 1OCWL 4ZNCD 5J13C 5FYLH 4HSQA 3B5GA 1BGXH 2D7QA 3QXUA 3SO3B 5B4MC 4ZFOA 4P2OA 1DUYB 4L4VB 5CHNA 4OSUL 5HHPB 4KFZC 4IIQC 4WUUB 1MCKA 4D0CA 2BOBB 5DYOA 3IFPA 1AGBA 1YEEH 2NZIA 3VGGA 1BREA 1H5BB 3T0AA 5I15H 4JFYB 3NABL 4OZGA 3Q6GH 3S36H 3IDYB 2RCSH 3DROB 3IDNA 3NZHL 2IAMB 4J3SA 4XNZB 3DX6A 4LAQH 4Q9BA 5DO2C 4MCYB 1AXTH 5FGBC 3MA7B 1S9YB 3DXAB 3DYOA 2XWBB 1CR9L 1JPSL 3U9PH 5CJQH 2QQKH 4GT7A 5DMIL 5DS8A 4TSAL 4NYLA 1WITA 3NPSC 5FKPB 2DIBA 2EDEA 3FB7B 1TJIH 1DANT 1RJYA 1OPGH 3H3PH 5C0BB 3SO5A 1B6UA 1UB5A 4ODTL 4PJIA 2Z31B 1FNSH 4QRRA 5HGAB 1EV2E 3DVNB 3LN5A 1JNHB 1WAAA 2PR4L 1CXHA 1IGYA 2X9XA 3MV8B 4YHML 3QUMH 3TBYA 2MKLC 1QNZH 4XCCL 4FS0A 1BOGB 5JOPD 3BH8A 5GGSY 4CJ1A 3JWDL 5HHOE 1KIPA 1Z9SA 2W07A 2ZSWB 3O41A 1Q8MA 5AUMB 4OD3L 1KIQB 2J1KA 2CKBA 4Y19D 4ZFFB 2Y7QB 3L5WB 2FX7L 1EFXA 2HJLA 1PKQA 3D0VA 2R2HB 4TPRL 1SMOA 5JO5A 3CVHB 1FG2A 3L3KB 2EYTB 5HPMB 4GRLB 3IYLW 3VRJA 3VG9C 4ZO8A 1X5KA 4XRCB 4XXCA 2CDFA 5FDYA 1NCBL 2PTUA 3AVEA 3DARA 3FQUB 1ZA3A 2YZ8A 4MVBD 5EOQL 4AYFA 1B0GB 2Z93B 5I8CB 5IFJB 2BNRD 5E6IB 3QFJE 2VH5L 1A8JH 5BMFH 3D85B 1H5BC 2WINA 3I9GL 1U8HB 4L9LB 4YZFE 1JHTB 5C70A 2D4FA 1FFOA 3V6ZA 2BVPA 4X6BA 1OSPH 1I1FB 3T3ME 3STZA 2BC4A 3BP5B 4KKBC 1CE1H 5HHMB 4NBYB 3H42L 1HK6A 3SKOB 4BQ8A 2E7HA 3X13B 4G6MH 3S3SA 4F8QA 4U49A 1SJHA 2EO1A 1F3JA 2MMXA 4J3XA 2OL3A 4EKXA 4PV9B 3KLAB 1BQHB 3P30L 1WTLA 4LPUA 3QCTH 4D0BA 3MLTB 4QRRD 2UZIH 3TO2A 2Q86B 3DGGB 5DURB 1I3GL 2Q7NA 1R5WB 2Q8AL 1P1ZB 4OKVB 4I77H 5GZOC 3MC0A 1YYML 3MXVH 1AH1A 5IEHA 3CK0H 1OARH 4WW2B 1MAJA 5D1ZC 3TCXA 1AD9A 2GUOA 4IDJL 3U4BL 2E3VA 4GUPA 4Y4KB 1KLGA 3T0XA 1LO0L 1QBML 2DLHA 3THMH 3G5ZA 3GSQA 1XF2B 2GAZB 1YMMB 4DW2L 1JPTH 2A6JA 4JPKH 1JN6A 1ZE3C 3BT2H 3OMZA 2IQAB 3HFML 5C0CA 4FRWA 1ZLVK 3ZTJG 3ULUH 5DD0L 4CN6A 4KXZH 1UH3A 2EEDA 3NIGE 3TNMA 5D93C 3PDDA 3IFNL 4M7JL 3F7VA 4OCWL 1FNAA 2NLJB 1W72B 1BD2A 3EOBA 3O6FC 4M1DH 2DD8L 5D8JH 4GXVL 3G5ZB 1ODAA 1XF2A 1XGRA 3PJSB 5F1NA 3HNSH 4H1LA 1OOAA 5I66B 2PXYD 1SQ2N 3VI3F 5D9SA 1F4YH 1KLGB 4BH8B 2MTPA 3T3PE 3HNVL 3RDTB 4GRLA 1LEKB 5D5MF 1J8KA 3QDJB 1BHGA 4EI5B 4DTGH 1F8TH 3LV3B 1FL6B 2IBBA 4OM1L 2UY6A 3H3KA 5ILTL 1K3IA 4PB0L 3TH4T 2ZCHL 1MELA 4HCRL 3O4LD 3HE7B 4LAQL 4ZUTB 5L9DL 3MLUH 4R2GC 4OT1H 3EO0A 3EHBD 1VGKB 2NY5C 4FXGA 4ZMAT 3INUH 5ITBL 1I7ZB 1C1EL 4X6DA 3O3UN 1RZKL 3ZZ1A 3HC3L 2WIMA 1IVLA 2IMMA 3EYUH 4EI6B 5EH1A 1B6DA 4RCAA 2JK5A 2ZCKH 5K59F 1CLZL 3MNVB 2FDBP 4MNGE 5CSZB 1ZOXA 3EOAA 3C5ZA 2D3VA 4I4WA 3RWIA 5IHZA 2VR9A 3JWDH 1QUNA 1FJ1A 2IGFH 4LLUA 4I0PD 4NO3A 4Y16A 4PJEF 2FEEL 2G2RA 1N6VA 4YE4L 2W60A 3G9VA 1CBVL 3IKKA 4D0DA 4IEFB 1HI6B 2VZTA 1HILB 3S5LA 3S97C 4G6AC 1A9BA 3C08H 3INUL 3O45A 5ITBH 4MA3A 4PTTA 4PJ8C 4IBLT 3FB8B 1CICC 4IRJD 3SBWA 1GOGA 4YR6B 4HJ0D 5GGVH 3HI6H 4M7ZC 5K9KB 1S7TB 4NQVB 2CRYA 1B4RA 1RZFL 5MEPA 1H3VA 2F54A 3WXVH 3FZUD 2K7PA 1A0QL 3L6FB 4WY7H 3SDAA 3UTTD 2NR6D 3GO1L 1DE4A 1AO7E 4NN7B 2GCYA 3V7AG 5IVNA 1CFNB 2E6PA 2FD6H 2I9LA 1VFMA 5E08L 4LPWA 4JKWA 3UMTA 4UV4H 4ZYKA 1G7MB 3M8OL 5BJTB 4GMTL 2HYMA 1PEWA 1G7LB 3ALXA 2XG4A 4BH8A 4XNXH 5J8OA 5MENA 3RWFB 5F7DA 4CBPA 5GZOD 1FHGA 2B5IB 2EKSA 3T3MF 3ZDXF 4HMDA 1HH9B 1JPTL 3HC4L 4PGBA 4FXKA 3PWPD 1R0AL 43CAB 4OCYH 4N0UE 5H37H 3HZYA 3MGTB 5HYQA 4P23B 5IG7B 3ZKNC 4X6EB 4RISH 5BQ7A 3OR7A 1MHCB 4FQ1L 5J0BA 1GGIH 2VAAA 1TCRA 2G60L 3QUZB 4L9DA 4MB3A 4NKIL 4P5MA 3A67H 5GISL 1KJVA 2VDQH 1CZ8H 2ATPA 3RVUD 2VC2L 4PP2B 4P49A 2WWKO 1CLOL 4YDKL 1QSEB 2DD8H 3G5YB 5JHDE 2FHFA 1DQJA 2Q7YA 4YDVA 3B9KB 5IHLB 3MNZA 5KSBE 4K07A 2R1YA 4R4BA 4JVWA 2OR8A 1N6UA 1QSFD 5HVHC 5EZLB 1RUAL 3HPLB 2IPTL 4ZOCA 3VXUE 5L0QC 2H6PB 3VXPA 1JGUL 4LLYA 4JM4H 4BM7A 5E8EA 1NEUA 4U1GC 4H8WC 1S3KH 1MWAL 1KBGH 4J12A 5JNYA 1P9MC 4N5ED 3D3VB 4MWFB 1KPRA 4Q9QH 2W0LA 4R96B 5E8NB 2BNQA 2HT2D 2BY0A 4FQXA 1RUKL 4XVSL 5C6TL 1U3ZA 4ERSL 2Z92B 5F88B 1NEZB 3S4SG 5KSAA 2C1OB 4GW4A 3K2UL 4PJFB 3MV7D 3GIZH 2DYPA 3QQ4A 4KZDL 4O2CB 4HWBH 4GLRH 3D9AH 1VEMA 4LKXB 5GJSH 4DVBA 2CIIB 4G43B 3HPLA 1LEIA 1I8MA 4ETQB 4P2RB 3V0WL 4NKQB 4KZEH 4Z7NE 4H88L 2VL5A 3RVTC 5TDNB 3D39D 3KYNB 5INCA 4TNWF 5DT1H 5DUBB 4I1NB 1NBYB 4IRSB 3GMMA 5B38B 2BY3A 3W5MA 4Y1AE 3U7WH 1I9IH 3PXHA 4J3OC 3SDDB 4Q9QL 4FQ2L 5CWSA 1IZKA 4RGOH 1P2CB 4Q6IC 1FPTL 4Y8AA 3T4YB 2DLFH 2GUOB 4PLKC 5F93C 4FZEH 2P8MA 3N50A 3UJIL 5ANMA 2BP3A 1ZHKB 3X3GH 2AEWA 4KY1H 5CINH 4OFVA 5GRVK 5CSBA 4JO4L 3LEXB 3C60B 3T4AA 5D2LF 4PR5B 4XP5H 1C7TA 3EO9L 1L6XA 1M7DA 1FIEA 2HMIC 2W9LA 2EZ0D 5ISZD 4KDTA 4HHAA 4I9WE 3CVIL 3MV7B 2O26U 1P7HL 4X7TA 4D3CL 1OP3H 5T3ZL 3G5XB 35C8L 5K9KA 4JRYE 4X4ZA 3UZVB 5EU4A 4X6CA 1EHAA 4QRQB 4YDLC 1KXQE 4LHJB 1T3FA 4PJ9B 1UB5B 3WFCH 4OZIE 3MJ9A 3VMPA 5LGHL 4YHLH 4LF3B 5F7LB 2L7UA 3MXWL 1AI1L 2ZNXA 1ZS8B 5DTFA 1TIUA 1S7RB 1N5YH 2R8SL 5F1SA 3TNNB 2AVGA 3TPUA 5GRYA 3I3DA 2MKWA 4YFLF 3DURB 3TIDA 5BRZD 4MGXA 1A0QH 4XI5C 2ICWB 1NQBA 5EZOH 3VG9B 1XCQB 1DUZB 5E1AB 2NY2D 3OKOB 1ZLWH 3BPCB 3QEUA 4KI5F 3VD7A 4F57L 1CK0L 4HK3J 2FD6L 3CH1A 1NBZB 4P23D 5LAXA 4HUMB 5DJ6B 3L3KA 5HPMA 1LE5B 4L4VA 3EO0B 4GRWE 4ODSH 4EUPH 3BGFB 1FVCA 5F7YC 3HE7A 2QKIA 2