1GS6X

Crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGASGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X02
3X1NA 4WTQA 3NJFA 1HFUA 1DZ0A 4A2GA 4F2EA 5B7MA 5B7FA 2HRGA 4DPAX 4HHWA 3AZUA 2YQBA 1AACA 2FNWA 2BZCA 1DYZA 2VN3A 1KCWA 1J5DA 4KO5A 1PLAA 3CDZA 4UF7C 2IH9A 3X1FA 1W6LA 2YXVA 3DTUB 1WA0X 3JTBA 3AG1B 2YAFA 1FFTB 5ANHA 4BK5C 4YVNA 4YSUA 5D4HA 3FQ2A 1MG3C 2PPAA 1IBYA 5F7BA 3KW7A 2XXFA 3SQRA 2BP0A 3S3DB 1JZJA 1L9OA 2CCWA 1RZQA 2VM4A 4YSTA 4BXVA 1R1CA 2YXWA 1V54B 2AFNA 2PP8A 3T6ZA 5B1KA 1NDTA 4BDVA 4YSRA 3ABGA 5I28A 1GS6X 3AY2A 5EHFA 1OE3A 2XVBA 2LLNA 2BWDA 1AOZA 3NJIA 4G70B 1IKOP 1TU2A 3PAUA 1MZYA 3T71A 1KDJA 2JFCA 3GXUB 3IN2A 4PCYA 2GC7C 1AAJA 4DP1X 2PPEA 1PAZA 2FQGA 1GS8A 5I6MA 3CZUB 2PPFA 2XV2A 2HX9A 2BW5A 3H4HA 1A4CA 1KDIA 2YAQA 2Y69B 2XUWA 2XXGA 2RACA 4G7QB 2H3XC 4KOBA 2IWFA 4AKPA 4YSEA 4NAJA 4GYBA 3PAZA 1JZIA 1ZPUA 3FQ1A 4HCGA 1SDDA 2JXMA 3TBBA 2VM3A 2YAHA 4JHVA 4F7KA 1SHXA 4ZK8A 2IDSA 4E9TA 1N68A 2QDWA 3AG4B 5F7AA 3HEIB 4E9QA 3ZBMA 1NIBA 2H5UA 4DP2X 2XX0A 7PCYA 1GR7A 2EIKB 3T6WA 5A7EA 4YSCA 2IWEA 3N2JA 2W8CA 3UAAA 1M56B 1TEFA 1F56A 1A3ZA 1RKRA 3SBPA 2IDQA 2XYBA 2MRYA 4KOCA 3UAEA 1URIA 4EF3A 4GY4A 1GYCA 2FQFA 1W6WA 3FPYA 3OMAB 1AZUA 3AG2B 1ILSA 2R7EB 3V9EA 1SNRA 2TSAA 2YAOA 1A4BA 2HX7A 5E9NA 3CVBA 3EH3B 1ASOA 1JXDA 2MTAA 2BWIA 4E9XA 4M4RB 1KBWA 2AZAA 3X1BA 1EHKB 1AANA 1PY0A 2ZONA 4AKOA 2DY2A 1AR1B 8PAZA 3H56A 4GP4B 1VLXA 2DYSB 1N70A 4YSOA 4DP5X 3FU7B 2J5WA 3D12B 2UXTA 4A66A 5B7EA 1SFDA 3PPSA 1OE2A 4A68A 1WAEA 3NJLA 3OMIB 1TEGA 1L9TA 3FU9A 3PLYA 4GXFA 2BO0A 2VW7A 1AZNA 3S3BB 1J9QA 1T5KA 5I6PA 1NWPA 1HAWA 1ZDSA 3EH5B 3NJMA 2CBPA 2CJ3A 3PCYA 4BWTA 1NPNA 1AIZA 2N0MA 1CURA 2XU9A 1XMEB 3U25A 4Q8BA 3BQVA 2XV3A 5D4JA 1BYPA 1GY1A 4A2FA 2XLLA 3AG3B 1YLBB 1SF3A 2FWLB 1PMYA 4WKXA 1ASQA 2BP8A 2FT7A 2EINB 2I85A 1PLCA 3ZIYA 5B1BB 1JZGA 4G72B 4DP4X 3IEAA 2OCCB 3NJGA 2VW4A 1KCBA 1IC0A 3NSDA 2FQDA 5LDUA 4GP5B 1ZV2A 5TK2A 1NIFA 3X1EA 2XX1A 4BWUA 5B1JA 4HCFA 1A4AA 3ABLB 4HHGA 1GS7A 2UX7A 2CUAA 3ASOB 2PPDA 1BQRA 4A2DA 1NTDA 4AI7A 4G7SB 2DV6A 4DP8X 3CVDA 1PNCA 3MBWB 4PAZA 1QLEB 4F2FA 4HALA 3WNJA 4AX3A 2FJSA 2A3TA 2PP9A 2B3IA 4M3HA 2WSDA 3NP4A 1J9SA 3FSWA 2QPEB 1M9WA 4CSPA 2P80D 1BXAA 2VSKB 1OCZB 3WIAA 1BQKA 5I6OA 1GW0A 3OQRA 1NIAA 2ZWNA 3FYEB 2HXAA 3QJVB 4KNUA 1OCCB 5PCYA 1IBZA 3NJJA 2FTAA 1CYWA 2TSBA 2YARA 3ERXA 2WO3B 1EZLA 4N8UA 2HRHA 3IE9A 1A8ZA 4AZUA 1A65A 2W88A 3FSVA 2E86A 4DP0X 6PCYA 2IAAC 1ID2A 2CALA 1JERA 1ZIAA 1KV7A 3NJNA 1B3IA 2FQEA 2PCYA 3ZX1A 1JXFA 1I53A 1OCRB 4UAHA 1AZCA 2QPDB 2GSMB 1OCOB 3T6XA 4HZ1A 1ZDQA 2X88A 1SFHA 1PZCA 3SBQA 2GI0A 3S8GB 1AS6A 4KO9A 1PCSA 2IDFA 4G7RB 4ENZA 1SF5A 2B08A 3C75A 2WO2B 1L9PA 1L9QA 4DP7X 1MG2C 1SJMA 5B3SB 1XB6A 2YAPA 3CDZB 1RCYA 3QJQB 2CAKA 3ASNB 3X2QB 1V55B 3QJTB 4W1TA 3T9WA 2I7OA 2FT6A 4YVUA 3SBRA 5I6NA 4L0PB 3PXLA 1E30A 3QJSB 1J9RA 3T6VA 1UATA 5IY5B 2BP0B 1W8EA 3G5WA 3EHBB 1ET7A 2HZHA 4KO6A 4E9YA 5B1JC 4HCIA 1AG0A 3OD3A 3HB3B 4BDVB 2PCFA 1V10A 3N55A 3UACA 1PF3A 2AVFA 1NINA 1JVLA 2BZ7A 2VSMB 1KYAA 4Q89A 1CYXA 3ZDWA 4W9ZA 1BYOA 1X9UA 1CUOA 2GC4C 3UGEA 2OV0A 3WG7B 1ET5A 3FT0A 3DKHA 3TBCA 1HAUA 3H4FA 2NRDA 3IBOA 2FT8A 5AKRA 2AANA 2X87A 1ILUA 2XWZA 3V9CA 4BXSV 2DWTA 4JHUA 1GY2A 5AFAA 4RH4A 1JXGA 4QKTA 3PAVA 2UXVA 1E67A 3JT2A 3FQYA 1NICA 3FYIB 4YSSA 4JKNA 4KNTA 2GB2A 9PCYA 1ASPA 1OV8A 2OJ1A 1E5ZA 3AW5A 2QT6A 2Y1AA 5I5JA 1AZRA 3QPKA 2IWKA 5I26A 1SDDB 3CG8A 1PZAA 2R7EA 3L45A 1FWXA 2EILB 2P80A 2PP7A 4HAKA 3RYMA 3TA4D 3UADA 2YAEA 4YSPA 3FPXA 3FU8A 4CSZA 2PLTA 1J9TA 1NPJA 2UXGA 3FSAA 3NSFA 4DP9X 2HLEB 1ET8A 2YAMA 4K9JA 4TXVB 1J5CA 4KNSA 4X4KA 1RZPA 4A67A 1JVOA 1NWOA 3FU7A 2QDVA 3NP3A 3ABMB 5AZUA 4FAAB 4HIPA 5I5IA 4P5RA 2BHFA 1BXVA 4GP8B 2EIJB 2J55A 2UXFA 2AZUA 1KBVA 3BVDB 1JOIA 2I7SA 1PLBA 1IUZA 3GYRA 1ADWA 1GSKA 2BW4A 2UX6A 1L9SA 1AZBA 1PZBA 1X9RA 5I5MA 3WNIA 1AQ8A 3EH4B 1ETJA 4E9RA 3FS9A 1AS8A 1PNDA 4N4YB 1WA1X 4E9SA 1WS7A 3OMNB 4YSQA 3EF4A 2IDUA 3DIVA 3WKPA 4YSDA 1OOWA 2Q5BA 3MX0B 4YL4A 3X1GA 4YSAA 3NYKA 2XV0A 3TU6A 2J56A 4UANA 2DWSA 2J57A 4AKQA 5I6LA 7PAZA 3WI9A 2EIMB 3QJRB 3OM3B 4DP6X 3QQXA 3NSCA 3UABA 2IH8A 1TKWA 2HX8A 1E5YA 1OE1A 5D4IA 1AS7A 4A2EA 1NZRA 5FC9A 1L9RA 1OF0A 1QNIA 2VW6A 4MFHA 1XB3A 3QJUB 4A2HA 2Q9OA 4FA7B 3FSZA 1AG6A 1XB8A 1JZFA 1SHWA 2IDTA 4G71B 5TK4A 4E9WA 3TASA 4E9VA 3S8FB 3IN0A 1MDAA 3KW8A 4QLWA 1M57B 3CVCA 1QHQA 1JZEA 1NIDA 4P5SA 2H47C 3NT0A 1WS8A 1JZHA 2JKWA 4NERA 2GBAA 1ZIBA 2BP8B 4NB7A 3ABKB 2ZXWB 3GDCA 5B1AB 2GIMA 5PAZA 3NJKA 1MZZA 4BWWA 3S3CB 1WA2X 4KO7A 2GHZA 4DPCX 3NJHA 1CC3A 5I6KA 1NIEA 1KGYE 2PPCA 2VMJA 2ZOOA 6PAZA 1BXUA 1BQ5A 4DPBX 1E65A 1FA4A 1BAWA 1BEXA 2DYRB 3NSYA 3WKQA
chains in the Genus database with same CATH superfamily
2BSTA 4G8EA 3VXQA 5CN3A 1DLFL 3QR2A 2OSWA 5E5RB 4AL8H 3CBJB 2B59A 4KY1H 1DZ0A 1DBKL 3DVNA 4TYUA 3WUWG 4BFGA 4MSWA 5A2CA 1EGJA 5HVHC 3UL4A 3SDAC 1E5CA 2HRGA 2M83A 1S7VA 5D7LD 3GBNH 5BS0E 4MMZB 4QJ3B 1UUSA 4GIOA 4KO5A 1PLAA 3CDZA 3DUHA 5HJBA 4QAMB 1NEZB 2EQDA 3DHPA 2P7TB 2RFXA 3D2UD 4IGBC 4NP4L 2YJLA 3DK0A 3V5HB 1A3LH 1GMIA 4HC1H 4YN3A 5G4NA 3UTSD 3H3KA 4OUOA 5F1OB 5CXPA 2WNGA 3K0WA 2Y7QB 4LLVA 4AC2A 3QNZB 4J4PC 4H0LC 4KUCF 1A7OL 3TBYA 3ZZSA 2Y36H 1JN6A 3PHSA 4YSTA 5BS0B 5SX4H 2YXWA 4XBGA 1NDTA 5D8JH 1P7BA 3GSVB 2CD0A 1GS6X 2WKLA 1YMHA 2E8YA 5INDB 4HKJA 4G70B 4HS6A 4QOKE 2XKUA 2XQ0A 3W0WA 3HUJA 1N6UA 4ODXB 3ZR6A 1MZYA 2RQEA 4NKMA 2D7NA 2ITEA 3ECUA 5SX5K 3TBVB 3O4LA 5CFHA 5C0DA 4LVOC 4LCCC 3RUGB 4R90L 4NI3A 1HHJA 1ZWIA 1MNNA 1SBSH 2GSIA 2A83B 1WFTA 1KDIA 1BOGA 2CKBH 2OP4H 3HCVB 1GZHA 5D5MA 4L1HA 3RWEB 1PLGL 1W91A 1YNKH 4JO4L 4K5OA 3ZN6A 5EOCL 4RMSA 2BK8A 4ICXA 5KN5B 3SDCA 4QOKB 3TVMA 4AKPA 4JRLA 2GJRA 1NCAH 3B3BA 3I9GL 2NZ9C 3N04A 5JW5A 4FABH 2NY2C 4NQSA 1IIKA 3A24A 1L6XA 1YN7A 4HLEA 4YPGA 3CX2A 5SV4A 3NIDE 3SE8L 1NJ9A 1GSMA 4Z7VB 3LNIA 1OSPL 1G7IB 3NABH 1BMWA 1PX4A 1F13A 1IGCL 5F7AA 2A74A 3MO1A 4FMVA 4JFXA 3CZEA 3WXWL 3Q8EA 4IRZH 3O3DB 3PDOA 4JR9H 4GO6B 2J8UE 1JXJA 2W1NA 3IXAA 3GRWH 4W9FC 4A6YL 5J3HD 2C7UA 2OMVA 2W8CA 3CZKA 1XHHA 4X6CE 3RILA 3WDHA 4BFIA 1BIIB 3PGDB 1CLOL 3NIDB 3PAYA 4BGDA 4XNUL 2W80C 2XYBA 4D94A 3VNZA 3GKWL 5DRZB 1QBMH 1T0MA 1LO3L 2KLSA 3MJ9L 5EF3A 1TJGL 2DMCA 3OKNB 4W9IC 3BH8A 3OMAB 5BS0D 3GMRB 4PTUA 3NCEB 4RBPH 3OR6A 3VGAC 2R7EB 1J8HB 3V9EA 1N12A 1WZ1L 1QRKA 1JDDA 4CC4A 1KEML 4X6CB 5EG6C 2VDKB 1MFBL 5FS5A 2BWIA 2UZXA 2BVTA 4RWHA 4NO2A 4GMTL 2Y1ZA 3GBDA 2XV6B 1AR1B 3KS0J 3NPSB 4QXUH 1U36A 2EVJA 2FYYA 3IKCA 4WCYH 4TSBH 3F7YB 3PPSA 2AABH 4TUKH 3FN9A 2F08A 3ZT7A 2DQUL 4GXFA 1IKNA 1A02N 3ZDYF 2AMGA 4OZGF 2ZOTA 3JWDH 3D1MC 4RSVA 1RUMH 2JLLA 5ICXB 4QOKD 4BWTA 4PRBB 4E5XG 3U9PH 5JPMA 2MPVA 4OW6A 1S8DA 4AYGA 4KY2A 1AIZA 2EUXA 2XVKA 5E8OB 1CURA 1MPAH 1YY8B 5C0GB 1G7PB 4U31A 4X5WB 2B4CH 2WKGA 4HH9B 2WYZA 1M53A 2E7LC 3MKGA 1Z5YD 1OF2B 2FLBT 3N85L 4N2MA 2NZIA 1JZGA 4NPYB 3LQZA 4AUUA 4KHTH 2NLJA 5FO2A 4KZEL 5SX5H 4M7LT 1JS4A 1KCBA 2R15A 3K72A 4I48B 3U7YL 1KPVB 2OSXA 4EDWL 3F65A 1S9YA 3K3QA 1NGYA 4JDEB 5HVWA 4HMCA 4JPVL 4MA7L 3VXRE 1PKQE 2WVVB 2CUAA 1HKLH 3QI9C 1MCIA 1Z9SA 4NFCA 1Y6NR 4TLKA 3ZLQC 4ANUA 5CZXD 4FA8A 3BP4A 2Q7YB 3UZEA 1UHVA 4AYFB 4DEPC 4L0ZA 4X5RA 1SYVA 1N6VA 3QUMA 4IIQB 1EXHA 2JCCE 2UY7B 4MRBA 1ETZA 2EYTA 3MBEB 1J9SA 1TJHL 3FSWA 4IU2B 2Z91B 3CLEL 3ME0B 3EYQC 3SCMC 3CSPA 4DH2A 4MBOA 2WIIA 4PCSA 12E8L 4HWEL 5DHDA 3VXRB 4CC1A 1PKQB 3G5VB 2HXAA 4PJBE 5DD6B 1RULH 2XWCA 4RGNC 5ABDE 2X05A 4XI5C 3TF7C 5K1NA 1WWBX 1YECH 2XCMC 4ONFH 3SBWA 1HKFA 3NJJA 4JDZB 1H0DA 5D1XE 3JWNG 4W93A 3ERXA 2QR0A 2WTRB 5L2KA 1NC4B 4G9DB 2XWBB 1GZPB 1T2XA 3FCUB 3KLAA 2JCCB 3DX7A 5IB4A 2ZX9A 4AZUA 3V0AC 3NEOA 1ORQA 3U6RA 1PDKB 3QUGA 4JRYE 2VN6A 4A55A 2W60B 4OZHE 1NQBA 2YEVB 3EIFA 3GLZA 3GSQA 4JMNA 5TF1L 4ENEC 4QRUA 3S88H 6FABL 2J2ZA 4I5BA 1TQVA 4UV7L 4G7VH 4PJBB 2G4GA 4A04A 4NJ9H 4CW1B 4ICWA 1TLMA 2J1WA 1T0OA 2Z4QA 4G7YL 4K9EH 3T6XA 1KELH 1I7ZA 4XNXH 5D1XB 1B0RA 2LVEA 3FB8A 5JR1L 3S8GB 1PZSA 1XR8A 1XZWA 2HFFA 4EQ3A 4KO9A 3NCFB 4PJ6A 4HS8H 3HZVA 5DVNA 2CBTA 2NPLX 3LSOB 4G6KH 5KYWB 4OZHB 2IQAA 4P2RA 4XGZA 4X99A 1IEHA 1B4TA 3SPVB 1I3GH 3LCYA 1JAEA 3GB7A 1UB6A 4Z18A 3A21A 3AMLA 5EOTB 3KYMB 5E2VL 1F11B 4N2BA 4FKKA 3ZE0F 3LKNB 1WCQA 1DVYA 1NAMA 4H1LH 3ZYOA 2WUCH 4H26B 4AMXA 5H94A 3FU6A 3LMJH 4BRJA 3MV7E 1BG9A 1S3KH 2NUTB 1OZTG 4XHJD 1R34A 1XFPA 4O4YL 4AK2A 3SO3C 5DD3H 1XGZA 3P9LB 3C09C 4ZUTA 2ICWI 1NEPA 2OW6A 1KB9J 2H1PH 1WBZB 1CFTB 1PJWA 1XBDA 4FQPA 3C8KB 3FT0A 1KLUB 3KGSA 3VXRD 43CAA 4LL4A 5IM7B 4GO9A 4RQQB 1T03L 2FL5A 3ARGD 4K7FA 1UVQA 2E4TA 4QXGH 5I1EL 4XN4A 5AFAA 1GA2A 1MFDH 1YMME 2ZCHL 3MV7B 3FQYA 1NICA 5MI0B 1NC4D 3CZFB 4YSSA 4EE2A 3MRLA 2O5XL 3KPMB 3O3AB 5DJXB 1EQWA 3UO1H 2QT6A 4XVTH 2BDNL 1N6QH 2WSKA 5I1DB 1ZOXA 4X9GA 5HJ3B 1DLHB 2IWKA 4PWEA 2BX5A 2CDFB 2CK2A 3W9DA 2I25N 2RTTA 4LEEA 5C7ZA 4Y4FB 2DAVA 1QWNA 1ZTMA 3U4KA 4YSPA 1V3JA 3P2DA 3U36A 3VCLA 2J4WL 3HBZA 1I3RA 3ZMRA 3NFNB 4NQVA 1YMMB 2UXGA 4C8XA 4QRPE 4EN3C 1I1AC 5HDWA 3ULVH 5F7EH 2IC2A 5T1KA 2GHWB 1MKFA 3D34A 2VC2B 2YGPA 2I60L 1GCFA 3ZQ9A 4JRYD 4Z7NE 1WUNT 1EJ8A 2HJKA 2FHBA 2ZAHA 3PHOB 4G42A 3HE7B 1INEL 2XWEA 1W0WA 3HAEB 3E1F1 1AO7A 2IWGA 1DUZA 1V05A 1A5FH 1YO4A 3SZ6A 2R1WA 3RGVD 3QDMB 5CGMA 3A4AA 1WAAF 3SGDH 1M6OA 2IPTH 2HMIC 3CFKA 3O11B 3RTQA 3R19A 1AQ8A 4QRPB 3OF6A 5FF6A 3LHPH 2TRYA 1BREA 2IPUG 2VR4A 2LU4A 2Y7NA 1JCVA 2OMXB 1FCCA 5EH1A 5GGSY 5JO5B 2F1AA 1G9HA 3LKRA 3VFGL 4HSAC 4Z7NB 5E6IA 3OZKA 3RDTD 1Z5HA 2Q5BA 2EDYA 3BFWA 2OK0L 4UIMA 4WLCA 1TCRA 3NYKA 1JHTB 3FQRA 4EUPA 5L6YH 4XRCB 4U6YA 4L3EA 5B38A 1IM9D 3DX9A 2ZX5A 1GKEA 5EMYA 5K9QI 1SM3L 3BVTA 3FOLB 4I4WA 2DKMA 2DM4A 2F5BL 4G1EB 5A2LH 4KDWA 1QMUA 1Z9NA 1OCWL 1TZGL 4AG4L 3IXTA 1P4LB 1E9QB 1XGRA 3QUXC 5I8CB 4LEBA 3MV7D 5E1QA 4NO3B 4IDLA 1T5WA 3HJEA 3V5KA 3KH3A 3ISWA 5CHNA 4UB0H 2CHXA 1M2VA 1VFUA 5D2LA 1GOHA 4UTAH 3QIUD 5BJTA 4UZGA 5FWQA 3C08H 1J5HA 2IAMC 4L5FH 3NZUA 2ARJB 1ECZA 5DJCB 3J7HA 3QPQC 1YJDL 3L4ZA 3HR5A 4B95C 1WFOA 2KQMA 1QEWB 4OD3H 4UZUA 2FRGP 1E8WA 4G2AA 4PCKA 2HAZA 1R5WB 2E6PA 4QRTB 5EO1A 4HULB 5LAPA 3L4TA 3STLA 5KG9A 4JVPA 4PREA 4WK0B 4RA0C 5E1HB 4KMLB 3TZVC 5MEPA 1IC4L 1SN2A 2BERA 3MDJA 3RVXC 4N2NA 3R1GH 4I0CC 1B4JH 2Y5EA 4HP5A 3U48A 1OW0C 4LLQB 5DC4B 3RBGA 3AWGA 4HH8A 2G3MA 3L6FB 2DWEA 4FQCL 4DUWA 3WD5H 4QEGA 2X4SB 1FLRH 3TX4A 2DL2A 3X1NA 4Y16C 2AJSL 2D7OA 1TNMA 1A4KA 4TTDD 7FABL 1DBJL 5AD0A 3L08A 1A6WL 1WFUA 3JTTA 2APTA 1MSPA 1U8CA 1W0VA 3HIZA 2B5IC 5JORA 2FX9H 4L1DA 3UZQB 3MXWH 1CQYA 4HUXA 4MA8L 5K33A 4FZEH 3VDCA 1CFNA 4IHOA 5I0XA 2V8MA 4PJAA 4JFPA 2IH9A 1J1PL 1RZ8B 1QNZH 2F18A 3NMEA 3WUWA 5IMLB 1VEMA 4F58H 3WBDA 3BRDA 1W72B 2BOCB 3OJDA 3OQ3B 5A3IC 1G1YA 1KJ2A 5D4HA 1SZNA 1MG3C 1OSEA 1RP8A 4QCIB 2WLHA 2G60L 1E28A 4L8BB 1RUQH 2V7HB 1N67A 2EIZA 3DTXB 3GMQB 4WNQB 2KT6A 4XP5H 2Y9RT 5E8NB 4DCQB 3PE9A 1YPZB 5ACLA 4HV8A 1I8MA 1KIPA 1GHFH 3VTMA 4FFVD 2R9HD 5H35A 4HGWA 4N8VA 2WGXA 1OAUL 3T6QC 5HHQB 4NFDA 4CBZA 1MHEA 3BPOC 1BZQK 2WXHA 1BJMA 1TTAA 5JA9A 1MRCL 1CD8A 4OF7A 3SDDC 4I85A 5EEVA 3LD8B 1KLFA 2D3VA 2VDKL 1F3JA 3QEUA 1GS8A 5DK3A 4ZXBC 3EYSH 2F8VA 4D0CA 3I74A 4YHLH 5HHPA 5KJ4A 1WBYB 3Q7JA 4MDRA 1JPST 5BQ7B 3SGJC 3P0VH 4LVOB 5CD3B 1DEDA 3FUDA 1G9NH 1UG9A 4LF3A 4RGOL 3ZTDC 2P3YA 2RBLA 4NRXA 5BRQA 5SWQA 1AIFB 1FGNH 3O8XA 5F7KC 2IWFA 2FB4L 4BSVB 4PTTA 2PO6B 3BQUB 4BHUI 2Q10A 3MCYA 1P5UA 3PV7A 4Q2ZA 4M6NH 4P5TC 2PCFB 5T33L 1W9XA 4WHYH 5JMRA 1Q9WB 2H0JA 2Z31A 3DVIA 4HUWA 1PFCA 1MJUH 4N1HB 7PCYA 2A6JB 4XCFH 4PW3A 1GR7A 3O2VH 4YLCA 4WI2A 5A7EA 3JBG7 5EU6A 2GTWA 4E41E 5I23A 3SDAD 3TJHC 4XP4L 2DBJA 4UUJA 1DVFA 2A0LC 1ZSHA 1EEYA 5DD0H 2WVSA 4PJIE 1YNLL 1OOAA 3O6ML 2VKWA 4W6XB 1WIPA 3RIKA 3KPNB 4LDEB 4P4KC 2ZSWB 3MODL 5LAXA 4ZOEA 3ZTCC 1ZA3A 3QJOA 4UM9D 3VFMA 5I1HH 4NUPA 3N44F 4HKBB 5J11C 1W6WA 3ZHFA 4F7PA 2VDQH 4S2SB 4TQHA 3DJ9A 2K7PA 3SE3A 5JPNC 4E41B 1QZNA 4AT6B 2E27L 3D7PA 4BFKA 4J4PD 4AV5A 5IHUL 5DK2A 2JK5B 2R69L 2CLZA 1XSIA 3GS4A 3LS4H 4GAFB 1V7NL 3MX0A 2CRYA 4PJIB 4UQIM 2OW7A 5GS2D 4P3CH 1MUJA 2PXYC 3VGAB 3KPQB 4UIKH 4K07A 1C7TA 3CDFA 4LBEA 2JQZA 2BY3A 3H56A 5I0DA 3P4MA 4QY8A 5EZPA 4Q4IA 1K4DB 4IK7A 5H2BB 3LAFA 4Z0BH 4UYPA 3TA3C 1J1XH 3LQAC 4X5QA 2QSVA 3VAEA 5IKCA 2MNJB 2P24A 2P8MB 1AFVL 2RCSH 4MA3A 1T1ZB 3FU3A 5AL8A 4DQOL 1RZGA 4K94H 3LHAA 2HN7A 2OTWA 2O6CA 2XKNA 4XCCH 2VE6B 3EH2A 4C56E 4GG6A 3SQOH 1NCDL 4P9HL 3ATEA 1JP5A 1MCHA 4MQTB 1KULA 5TGBB 4WSJA 4PRAB 1MDTA 3BQUD 1LDPL 4AQOA 3SPCA 3ULUC 1RQ5A 3CVHA 4KDTA 3BQVA 1KXHA 1D5BA 4CC0A 2NZ9D 4NNXA 8FABB 4EZLA 4OAWA 2NY2D 5FDYA 5DQ9B 1ASQA 4GW5B 1BOYA 3BISA 2I85A 4PBDA 1FQ9C 1SOSA 1ZS8A 2O5ZL 2XICA 1SEQH 3ARDC 5CJXC 4AK1A 3IEAA 1CDGA 1G0YR 1P0SE 2WQAA 5JDSB 1QLRA 1QQDB 3LDBC 2PW2A 1YYMH 3NSDA 2C1PB 2GTQA 4GNKB 2ZYIA 4JK0D 1R3HB 4KX9A 2NW3B 4GRLC 2P52A 4YO0A 4HCRH 4K8RL 2BSED 4LOFA 1ED3B 5TPWL 2UWEE 4JFDA 3L1FA 3CVDA 1IFHL 4S11A 1ZMYA 2WC7A 4UTCA 4HALA 3CFIC 4ORGA 5L88H 5LN4A 2A3TA 3GPSA 4QXTB 3KJ6H 4B9PA 1T6WA 4B0MB 4F7CB 1B2WL 4E41D 2G5UA 1MF2L 2ZPKH 3ECBA 3EBGA 2GK2A 4LGPB 4U1KA 1ZANL 3KLLA 3CU7A 5GZOC 1ZTXE 2WVUA 3FCSB 1SY6L 1M71A 4A7UA 3CLWA 2WLKA 3ARWA 4PJGF 1NIAA 3FYEB 4LSPL 5AW4B 4DF9A 3CGTA 2UWEB 1OCCB 2HTLC 1MIML 1NOFA 2AQQA 3AU1B 4URTB 4DGVH 1FO0A 1J18A 2H0PA 2ZICA 3MROA 1PZ5B 3VE0A 4IU3B 1A65A 1F6FB 2E86A 2O6FA 1G7MB 4L3CB 3IWUA 3IRPX 1SXSA 1Q0EA 1F0LA 3QGVA 4H8UA 1KB5A 3MV9A 1U8NB 1E4XL 3AUWB 3SKJH 2Z35A 2OL3L 4LLUA 2X3AA 5CUSH 3VFSB 3TFKD 5MEOB 4JMXA 4MBRA 1K8IA 2K9FB 4WW1A 5EEZA 2BC4B 3IU4L 5F7WC 4G82A 5CJQH 5CCJA 2GAZA 4S1RL 3WJLA 2UVFA 3ZIMA 1HSAB 1X5KA 3VG9C 4N2AA 4U6HA 1E43A 3B2VL 3C75A 1L0YA 4PLNC 1UOWA 3EZJB 4JKWA 4GSQA 4DP7X 1SJMA 1VZHA 4C56D 5TQ2L 3ASNB 2VC2L 5D7LA 5HJDA 4DN3L 2ENSA 3EUDA 5J12C 5EEWA 5I9QC 5I6NA 1P7KA 3SBRA 2YPVH 4APQB 3PXLA 3QJSB 1I8IB 1GAFL 1DDTA 1OPOA 1UATA 3C5ZC 3T4AB 3G5WA 2A9BA 5F7FA 1EK3A 1UJ3C 3HVNA 1PG7W 3OX8A 2AJZB 2OX5B 3D2UA 4Z3FA 3L4VA 4XPHH 3F3HA 3UTSA 4OFDA 2AI0H 3BZFA 3QBTB 4IBSA 2XA8L 4PRHE 1G9MC 1KYAA 2ITDA 2EIBA 1JNNL 4JPWH 3MGAA 4MD0B 5JQ6H 1MFAH 3MRKB 1NFDA 4XBEH 3WY4A 2IANA 1X9UA 3VFRA 1JUFA 1P1ZB 2UV3A 3BH4A 3T2LA 3KYKL 1QPPA 3SO3B 4YFEA 4ZMLA 1BBDH 4FXLA 4BFFA 4Y4KC 3LEVL 1T2QH 3DK2A 1G6RH 3GHBL 4ANKA 1O5PA 3EYQD 3SCMD 3JV4B 4BV1A 1HDMA 4QKTA 2PWDA 2D4FA 2EDQA 3QCTL 1XCTB 1MHHA 4K7PX 3P3TA 4XI5D 1AI1H 4HYTB 5KVFL 3VFVB 4R7DB 4X9YA 1A14L 4C55A 2DD8H 2Y1AA 3QO0A 4NAMA 2Y24A 3GGWB 4MNQA 4OZ4B 2JXMB 4PJFA 3GUTA 3CZNA 4HAKA 4EEEA 4DFIA 1SJHB 3UADA 1OXYA 3OL2A 4GKLA 1BVLA 5FK9A 3FU8A 2X2HA 3GWJA 5D1ZB 1IBGL 5CMAA 1DQJA 4LOUC 2H8PA 4ENED 4L4TE 2R4RL 2ZWLT 2YMXH 5EZLA 1J5CA 2X6BA 4MHHI 4KNSA 1WC7A 1MW3A 2Z34A 3OTTA 1WWWX 3ES6A 5SX4I 1A1MA 1QD0A 2KZWA 2JKNA 2QTVA 5C9JB 3IB4A 1EERB 4EN3B 3PWPE 3GSRA 4LMQI 4WUUA 2QVKA 4QF1A 1VEOA 3VTAA 5IHWA 4DVRL 3DA0A 1O6SB 4ZX5A 5EBWB 2BW4A 3NK3A 1MCRA 1U58B 4X6FB 4Z3IA 2R0ZL 1OY3B 2VERA 3E0GA 3T8MA 5DT1H 1IGIH 2QVIA 1KEGH 2YPLE 2X1WL 2IVFC 2VN5A 1BM3L 3PXJA 5E2UL 4L9DA 3W1ZA 2HPTA 2W0LA 3EOAA 2YEQA 3AROA 3I2CH 1BAFH 4PVMA 4WW2A 4GI9A 3PWPB 4EAEA 1YG9A 4PJ9B 4DWHA 4YL4A 4Y9BA 1JPEA 1D9KB 4GSDH 3WS6C 3OHXC 2K4AA 3V6OA 4BH8B 1NUFA 4PBWD 5I6LA 3EAKA 5FCUL 2E4FA 3WKMH 3QQXA 4FHKA 1YA5A 2IH8A 5HDBF 1IFRA 2YPLB 3HG5A 4Y0GA 3K8KA 5I16B 4WSKA 5EEXA 5LWYH 1K4CB 4HUMB 1W72L 5EV7A 3V4PH 4MFHA 4OY9A 4PRHD 1IQWL 5BO1H 1X7SA 1AG6A 2IDTA 1JZFA 3D69B 1SOKA 1U91A 2BINA 4OCYL 3HC2A 5AVZB 1D5IH 4LLDB 9CGTA 1LP9E 4K73A 2DQCH 3VSUA 2F7RA 4YDVB 4IBWA 1L0QA 2VAJA 1ZV9A 4HUCA 5HHOE 1BVZA 1FHGA 2BNUB 4J1UA 2ZG3A 3L5IA 4FHJA 3VI4A 2ODIA 2A6IA 3NCMA 1SLXA 4W81A 1ZIBA 3O6LH 1RUKH 1BFSA 3ABKB 2RQ8A 4JPQA 4RVBA 4UOW1 3ROOA 5F7YC 5B1AB 2E59A 4X6BA 2DLTA 2FEDC 1XGUB 2A9ML 4KMTL 2GHZA 3HI6L 2VISA 2NNXA 1BZEA 3FUKA 5F70A 2ZP8A 4EN3D 1I1AD 1LP9B 1AGFA 1TF4A 3DVGB 1WCBA 2AV7A 2HKHL 2X4RA 4KQ4L 4OLVL 4OZFH 5HHOB 3TZVB 1JFQH 5BW7A 1S78C 2YHGA 4M8QB 3RWGB 3K6SA 2DTML 2JELL 3HHRB 4JG1H 3AABA 4FFZL 4LSRH 4KJWC 2AJYH 1EJOH 4L4TD 3Q5YA 4ONGL 3I6KA 2BS8A 2QBWA 4ZS7L 3HOGA 5F9WC 3G6AA 2DWDB 3I6GB 4L23A 2HMID 5FOBB 1N3NA 4OM1H 3DC0A 3FTWA 3Q43A 2X6VA 5GGRB 2ROYA 3IETA 3P9MB 1XGYH 3N6YA 1D9KD 1EO8H 1WQVT 5BVPL 2B5IB 5I74C 4UOQA 1G7HB 4PHZA 2VMCA 2QQQA 1F58L 2NNAA 5FGRA 3TO2A 4PSPA 1YEGH 3VXTA 3S35L 2J8UA 3QAZB 1U30A 2B7DT 4JO1H 4PJCF 1AQHA 2PWGA 5T5FA 2ZUTA 4ZOAA 4WDIA 1HZHH 3FO1A 1HZLA 2YGQA 2NTFB 2YPLD 3GSNA 1TITA 1KBKA 3LKSA 5FCSH 1GYVA 1W2KT 4HUVB 4JZNA 4OKVA 2CCWA 4WTZA 1RFDH 1C1EL 1XR9A 4MMYA 3U30C 3VXNA 1JWMB 1WSST 3FUMA 3QUXD 4X4MA 3IGAA 1CL7L 3ESVF 3CX5J 3QFJE 3ISYA 2LLNA 2BWDA 1DFBL 4WKZB 1RUAH 2WQSA 4PBXA 2OZ4A 3VH8G 5LG1A 1QW9A 3PJSA 2B2XL 4PCYA 4CGTA 2PPEA 1CGTA 5DYFA 1P69B 1PAZA 3PGCB 3S98A 3MJGX 3CZUB 2PPFA 2XV2A 3BPOB 3CHQA 4A37A 4O2FB 1GJIA 1A4CA 2FJHA 4FTVE 3VGDA 2VERN 5EU3A 2IADA 4I9WE 1FZMA 3E8VA 1QLFB 1ZGLP 1RPUA 4PV9B 4N9GA 1TQCC 4HS3A 4XBPA 4ZXBB 3VQ1C 5IB5B 4RZCB 5D1QE 3QUML 1J86A 2DL9A 2XUWA 4FP8H 4KX7A 1MWOA 5D7EA 3HFML 5HHOD 3MRIB 3TZVD 4NAJA 1FPTL 1JZIA 3ATDA 1QVOB 3BKJL 3LEYL 1F8TH 4WGKA 3KJ4B 3EG9B 5BVJB 3H7LA 2EE2A 2DH3A 5CEYA 2B1HH 5E9DA 2Z92A 3WIIH 4FTVB 5I1CH 1BECA 4H0GA 3P2TA 3OWRA 2E6JA 4UQ3A 4UBDC 4W68A 2ADJA 5C6WH 3C60C 4CBPA 1M7IA 5D1QB 4F3FA 4E42B 1XGQB 3OPUA 3T6WA 3IMRA 15C8H 5C71A 3EYUL 1QFPA 4BGLA 2XJLA 1QFHA 2EXWD 2JB5L 3LVTA 1JWUA 3U7WL 5DHVH 1E27A 3ISRA 5IBTH 4HLZG 2DDQH 3KPTA 3BWAA 2HT2C 4X80L 5I73B 3VD2A 3I3EA 4BKLA 2JI1A 1G7JB 1YDPA 2CNZA 5B1CA 4DOHB 4E5XB 2QVTA 1FZKB 1CZ8H 2GFBB 1FIGL 3ARGA 3IDYC 5A3ID 4JM4H 2VDLB 4LSVL 5JOEA 1AZUA 2LQRA 5F7UA 4XCYB 1ILSA 2BCMA 2MOVA 4JFSA 1HHGA 4AITA 1XF5B 1YHPA 2KYIA 4Y5VC 1BLNB 3FCTB 4ODSL 1E6JL 5CP7B 5GISL 1NL0H 3M17A 1XAKA 1FP5A 2XWJA 5D71L 4P4RB 1XT5A 2AQTA 2X12A 1EHKB 2IF7A 4NC2B 1AANA 5C0BB 2DMKA 3QXAB 1CLZH 2VDOB 4LPUA 4I13B 2IH3B 3FU7B 5DJ0B 3LIZL 1NAML 1C5CL 3D5OF 5B7EA 3CDYA 5AAMC 4A68A 3MLYL 5FUOH 3G6JE 3OMIB 4ZXBD 1L0PA 1D5MA 1ZHLB 1T5XA 3QFJD 5DHXB 2EEFA 1MI5E 5I6PA 2WQRA 4NUGH 5E1AB 3JWNE 5EULV 4WJG3 3LNGA 4JRYA 4WNSA 1O7DE 3DRTB 2X0VA 3QXDB 3IMWA 4P2CG 4F7EB 2WQXA 2F0CA 2ZXEB 3Q48A 4JN1H 3EO9L 2NXYB 2X6AA 3CVIL 4K3DH 4N87A 4KJPC 1WLHA 3U25A 4N5EC 3RGVA 1ZTXL 3TNMA 2VUYA 4DZBA 3BVUA 5T1DL 4FTVD 1GY1A 3IJSB 2XLLA 2ROXA 2FECL 3PIQB 2UUDK 1H6FA 2GBVA 3G6JB 5LO7A 5F1IB 4B9CA 1FYTB 4H20L 3SPJA 4P5TD 2EEDA 5B1BB 4BCYA 4NT6B 3I02A 3CBRA 3NZ8B 1MI5B 2OPCA 2OCCB 3KCPB 3FJTA 4O02H 3RVVD 3HRPA 5HPMA 4XPTH 1NGPH 1ZEAH 1WGVA 1VPOH 2X6CA 3MXVH 5C3IA 3RDTA 3RURA 1ZGLM 2X9YA 5T5NF 2UZYA 1YN6B 4NQXB 4X8JA 3EJJX 5KS9E 4JQIL 3LX9A 3KLSA 4BUQA 3TJHD 4KVPA 3ZE1B 3FN0H 3HNTH 1IM9A 2A0LD 4PS4L 2HRPH 2LFGA 3KXFE 1MCWM 4CSTA 2EYSB 3L9RB 3RWCB 1MJ7L 5CWSA 1VAHA 1Q1JH 2WSDA 1FL3A 3NTCL 2W81C 3KGTA 1DSYA 1X5HA 3MGTB 1OP9A 2DIEA 5LLIC 4JUTA 4X6DF 4Q74A 3OVUB 3QUZC 4AVHA 3FB5A 1Q72L 2C4FU 5FYJH 3CMOL 3IRCA 3L4CA 3QIUA 5KS9B 4EI6A 3X12A 2MTPA 4WWKB 2FGWH 5GS1C 2EDTA 1GGCH 1HVXA 3TCLA 4BZ1H 1K6QL 3WU1A 3ROLA 3Q2CA 4E0RB 5FUZH 1CICB 4HJGA 3RVWC 3KXFB 3MV8A 2YARA 1EZLA 2PXYD 3ML9A 4GAGH 4EIZC 3BO8A 4NZFA 1B2YA 4F15B 2QJDA 1NMCB 3QYCA 2OSLA 2DYPA 1SDYA 3FQWB 4WJ5A 4X4XB 3E2HB 5FYLE 4MAYC 2PWEA 3MLZL 1TETH 3NJNA 3F12B 2O26U 5IJCC 3UOAB 2NXYD 3PRZA 4P0DA 5C0IA 3S3SA 3F6JA 2DI8A 1LO4L 2YD9A 1CD9B 1DUYA 1MCWW 1AGEA 1Q9LA 2YGNA 3AM8C 2DQTH 3UBXI 4G8FB 4LVEA 3GJEA 5LGJA 2K6YA 4OV6F 4AZ8B 1PCSA 3OKOA 4ABVA 4S10A 1FVEB 3ULUD 2A9DA 3VRIA 5B3SB 1RIUH 1FF5A 4URKA 2IH1B 1MI5D 5IJBC 3DX8A 4BRVA 5DR5H 4ODHH 5MP6H 3T9WA 2FT6A 5TDOA 4R26L 1DQTA 3ARDD 3B6SB 4LQFL 4A7QA 4F8QA 3EJQA 2A9NH 2HVKA 2AC0A 1YEDA 5J12B 1LEGB 1HIMH 4JJOA 4N2LA 1RV6X 2V3DA 1L5GB 3ARQA 1ZCRA 4GRLD 2L8AA 1FZOB 3GZQA 4HCIA 3OPZH 4XO5A 1HHHA 3ARTA 3C5ZB 3V0EA 3Q6GH 4JDTL 2CK0L 4KQ0A 1JGDB 1JGEB 3GMLB 5FXCH 1NCCL 4E68A 4NSKA 5FV2A 1AD0A 2Y6SC 4FFWD 4FNPA 3KPSE 2C26A 2GJ6D 2BNRA 2G9KA 1S7RB 4IKLA 2UUDH 2OR9H 4YHMH 3F2LA 3IBOA 3TBCA 1HJCA 1A6VL 2NY5C 4JHBA 1T2JA 3VX0A 1IX2A 5BOPA 1ILUA 1FORL 1NAKH 2XWZA 3SOBH 5EBMB 1LQBC 5GZOD 1JXGA 3IDXL 3ZOAA 1NCBL 5LCVL 3U0TA 1EFXB 2C34A 3VB8A 5CBAB 1TTFA 4ZYKB 3T0VA 4WHDA 5BNXD 2HTLD 3ZTJH 4KPHL 3B9EA 3DI3B 4NOBA 1CLCA 3FXIC 1WTLA 5MEQB 3UZVB 3GSUB 1C5BH 3SPGA 3L81A 4GUOA 4ADIA 4YHYC 3NK4A 2W9EL 5HYFA 2V2TB 1LO5A 2JMRA 5B8CA 4JEGB 4JANB 3NCYS 5E8DL 4JHAH 5FO9A 3UYPA 1J9TA 2V5MA 2HLEB 2A73A 4HJ0C 5FIEA 1MCSA 5GQBA 3P2BA 3U79A 2X09A 1X4YA 1OTUC 4IOFD 4U05A 4UNTA 4ODUA 4Y2LA 4YHIB 4IBVA 1GRWA 4HIHA 5FYLD 4K3JL 1VACB 4XVUC 4MZRA 2IEPA 4GS7C 2VXVL 5ETUA 1NGZA 4WHTB 3IVKB 1FCGA 3O2DH 2YQGA 4JVWA 4H1LG 2FO4A 1GYUA 4I18C 1I9IL 3SDAA 2F53A 3IJHA 1OD7A 3SGEI 1PZBA 4GXUN 2X1PA 1MREL 4N4YB 4GRMB 3ZE2E 3X3GL 2FJGA 2PWHA 4RRPG 2XZAH 1Q9OA 3C5ZD 2HJLB 5H8DA 3V55A 3OMNB 5GS0D 4AGMA 2YD5A 4UM9A 3U6XS 4IGBA 1KNOB 4H88H 5BUPA 3X1GA 3KG5A 4Z7QF 1GTNA 4P48A 4Y2OB 2EVFA 5DUBA 4OFIA 4W9KC 4J4PA 1X9QA 1KPRB 2EIMB 4OCWL 4ISVB 4TVPH 2DQFA 1U93B 1JJUA 2XWRA 1FNEA 3PP4L 4AQAB 2ZNWA 4GAYB 5CEZD 5DUPL 4FI7A 5C2BH 3DTDA 3MYJB 4LNRA 2OJZH 2D7TL 1TSRA 4N1CA 4Y4KD 2KC0A 5HHME 2YD6A 4PJEE 4J39A 3MRPA 4FA7B 2NR6C 4IEFB 4AEHH 3PFQA 1I1YB 1BM7A 3GF8A 1HYSC 5EZOL 3QQ3A 2LR4A 1MDAA 3D85D 3IN0A 3KPSD 3OJ2C 4IBQA 4LCCA 4L2YA 3K6DA 3UH8A 4XPAL 1U8MB 3LN5A 3T2OA 2JKWA 5DQJA 3O3EA 4YNYA 4ZFQA 2GBAA 2JIXD 3ZZQA 3IS1X 1O7SA 5FYKE 1PZUB 5HHMB 4YXHL 2MIZA 3GDCA 2WXLA 5JMOC 4PJEB 2DJMA 5PAZA 3I84A 3QCVL 2VWEC 1P84J 4FFYH 4AWJC 4LOUD 4TUOA 1SYSA 4F1SA 1LILA 2CXGA 1WEJH 2BS71 3FQ4A 5B4MD 3C6SA 3L7EA 1FV1B 3X13B 1MIEH 3P54A 4OCMC 1HWHB 3VXME 3DMMC 5B21A 2E7CA 2EH8H 1JV2B 1FA4A 3NRPA 4JO3H 3T04D 1L7TL 3MLTA 4O51B 3IFOB 5IVZB 4BE6A 4G6MH 2XPGA 4L48A 2C3VB 2YBRA 1QKZL 3NJFA 3RWFA 4KNQA 2FD6L 5DHYB 2OXGB 5AWNL 3HE6B 1AP2B 4MX7A 1OHQA 2XJKA 3QZNA 5DJAB 2BZCA 4M7JL 4K5NA 1DYZA 2CMRL 4X8XA 2Y07L 2JSFA 3VXMB 4DKFL 3P30L 1YYLL 5FHBL 4NCDA 3CFJA 5E6SB 1WISA 4IRJC 2OYLA 2BSBA 1RSYA 3JTBA 4J3VA 4R96B 2YAFA 2G2PA 4PGDA 5D7IF 1TVHA 4ZD3H 2MQCA 2ZQKA 5HDQL 2BVPB 4FNLH 4AIZB 3WFHA 3OMZA 4XZUB 1WFMA 3HC3H 3QFDA 1S6NA 3HNVH 4R97C 3NFPB 4X0KB 1R1CA 2YRPA 4BDVA 2IXQB 5EA0L 5ISZB 1U42A 4HK0B 1JHKH 2PCPA 5EOQL 4Y4HC 5EHFA 3P11L 5CJBA 3I85A 5DDHA 5LBSL 3SKMA 4RISH 4J2QA 2XG5B 3S96B 1QOKA 1ULVA 4LCYB 3BSHA 2W65B 3MNZA 1AXTH 4NWTL 3FF7A 4PU2A 3T0EE 4FI8A 4KH2A 2K8QA 4G6JL 3QNXA 3WLBB 3CUPB 4LBAA 2GK0B 1WHOA 3RWDB 4OLWL 1TPXC 3L2NA 3A6BL 1F4XL 3KLKA 2OKMA 2QV4A 2VDOL 2ESVE 3B2XA 1OP3K 2OR7A 5ICUA 3QA3A 2WCSA 1OGPA 1KGIA 3BHBB 1CBVH 4JY5L 5F1NA 2XSKA 3ETTA 4XAKD 3T0EB 3U83A 2E7LA 2V37A 2VTFA 2LT9A 2G4EA 4C56A 2NTSP 4LSSL 3TBBA 3IDNB 3CPLB 3MFGB 3OSKA 4YXLL 1MQKL 3NGBB 1S7UB 2JNZA 2HG0A 4XMPL 5CGYC 3U4BH 2CUIA 1S78D 1XTLA 1T1YA 2CHDA 1QATA 1N68A 3HE6D 4GAAA 4KJWD 2ESVB 2QL1A 5FWRA 5BZZA 4L37A 1T22B 3MU3A 1S7TB 1JPGB 1QSEE 1W80A 2F9BT 5KBNC 3N41B 3FTGA 5IUSA 1JZ4A 4DZ8A 3I6LE 3K71A 1K5NB 3QI9A 3VXMD 2AF2A 2YFOA 1JZ6A 3BJLA 2IWEA 1XF2A 2APWA 3QHZH 4AJYV 4JL2A 2WWKT 4CSSA 4HFWB 4O5LH 2EDDA 4BZ2H 3MRGB 1K8DB 1R3LA 1TO4A 4P57A 5G5DB 4R0LB 4DSYA 3VD1A 1ES0B 2H2PC 1OAZL 2OULB 3QARA 1M1XB 4KOCA 4OCLC 4RMRA 1D3CA 4FNUA 4CGUB 5D7SH 1UZ6F 4CNIB 3UTOA 1QRNA 4ZFFA 5MERA 3EW3B 4LLWB 3SCMA 1XIWA 3WTVA 5I6XB 1BLIA 2QLYA 3AG2B 1QSEB 4W9DC 2MCPL 2VLRE 3BZEA 4JQVC 4JFED 4BFNA 1SNRA 2Z93B 3IDYB 2RHEA 4U3SB 3EHBC 2PYEE 4UDTA 4Z7OE 1KZYA 2N59A 4M61A 2BOBA 1S7XB 3HI5L 2D9CA 3HB3C 4NJAL 2A4ZA 2OM5A 5C0JA 3ZHLA 3MUHL 5L9DL 1YEKL 1UZ8B 3WEXA 4CAGA 5DI8B 4XZ4A 4FF9A 5BZDA 3PWUA 2WHVA 5K9JL 4HIJB 1BQLL 1ORSB 1U8PB 1VLXA 2MJWA 3DLQR 3UTQB 1A0QL 1O5DT 4HPYH 3G5ZA 4PM1A 1C16A 1OE2A 2H0FA 2VLRB 4M5ZL 2OI9C 4ELMB 5I66B 3QUYC 2HG5A 1MCOL 4HHAB 4PLKC 2PYEB 4MDIB 4Z7OB 3VMOA 3IK2A 3OLGA 2IGFL 4PRNA 3ZHKA 3H55A 4QYOA 3UPRA 1BJ8A 4UQCA 5F96L 3II3A 4ONOA 3F04A 2PR4L 2N0MA 4BH7B 3ZDXE 3WTUA 3HG1E 3L3HA 5A2FA 3HMXH 2DKUA 4MJ6B 4ZAKC 1J10A 2XV3A 4HXAL 3D4YA 4G8GE 2CGRL 2EIEA 1CXEA 2ESVD 1S46A 2X38A 1OAQH 4MLSA 5HHNA 1RZKC 4RESB 3RNKA 4W9JC 4PGBB 4BQ8A 3MAWA 4LT7A 3EUUA 4FQ1L 3MLUL 4LP5A 4GP5B 3LS5H 1P6AB 4RWYL 3C60D 1CFVH 2WB7A 1TKWB 5GRJL 5IW1A 4PS3A 3MNWA 3KBEA 3ZDXB 1KFAH 2GJJA 1X7TA 3BAYA 3HG1B 5FYLL 1RJLB 5C0CA 5D93C 1G0XA 1OP3H 4KK9C 1T83C 3P3YA 3WTYA 2C4XA 4G8GB 1XD1A 1PNCA 1F90H 3FULA 4FHBD 2CHNA 4I77L 1DN2A 3CH8A 1F00I 2HT2D 1T1WB 3QWOA 1JNJA 1BZ8A 4N6RA 1QSED 2V2WB 2H6PA 4KZCA 4KMQA 1NOAA 4POZC 3DGGA 4HUKB 3I6LD 4PRHA 2XIBA 5IV2A 2C7FA 1TO5A 1ODAA 5D9SB 4XCEA 4Q6IB 5GS0L 3RWHB 2VR3A 4N2DA 3INUH 1IFGA 3ZTNL 1F2QA 3LKQB 4NDMA 1GYWA 2VN7A 1EGJH 5E8EA 5I8OL 5F21B 5LDSA 1JRHH 3ARXA 3PNWB 4NS0A 1SJXA 2YGVA 1XSJA 1MFEL 3BEVB 4UQ2A 3SKNA 1MCEA 3FH8A 5FKAA 3HPLB 3VXUA 3D25B 3EYVB 3RUGF 1TJMA 4TNWK 5J9PA 1YEIH 3MRFA 1N0LA 5IG7A 5JOFB 5DURB 2EDNA 3GHPA 3BUPA 5KOVC 2HJFA 2D31B 1PQZB 4XWOC 2PYED 1TFHA 4YHPA 1J05A 4Q4EA 5GGQH 4TQ8A 4GSXA 1XGTA 2L3BA 2F8IA 2R2HB 3VX1A 1I1AA 4ZFOA 2OFQA 4S1DC 1GW6A 2R29A 2NZ1A 1AGDA 3DXAD 1JNLL 1II4E 1CXIA 2B9AA 5J6SA 2X4PB 3ZL4L 2VXTL 5BOJA 4FOMA 4U1GC 4L4TA 4Z7VF 2OYPA 4ATWA 5GIRA 4G8IB 3OKYA 3RRQA 2QHRH 1LK2B 1L9QA 4N5ED 1U8JB 1XB6A 3MUGB 2I69A 2QMKA 3DDGA 4WGVB 1F5WA 1VADB 4B9JA 4IJ3B 1MOEA 2K8MA 3VM7A 4AENA 5C0FA 1ZK5A 1QFUH 4LHUG 4XPFH 3GM0A 2YN5A 1FG2B 2Y2WA 3QHFH 4RGMC 4R7XA 1E9OA 3HG1D 4FD0A 5DJDA 2JTDA 3OAUL 3T0BA 4YUEL 4JG0H 1E8YA 2HZHA 2JCWA 1G4RA 3NIDF 5EUKB 5F9DC 5LQBL 3PY9A 3QQ4A 2Q0ZX 1NCWL 4B9IA 1U3HB 2MOGA 2XQYG 4LK4A 3L3DA 2KHAA 5FGBC 3GMMB 3FQNA 1JPSL 4A1RA 4WI5A 1EHLL 4GUPB 4DN4L 1WZKA 3NAAH 5AYTA 3DROA 4G8AC 5BXFA 3QUXA 3U1QA 4PGEA 1JHLH 4X6CF 1HAUA 5K9OB 1NCIA 1MW2A 1QUNA 3JV6A 3QUZD 1TQWA 2COQA 5ILTH 3QPXH 1FL6A 3BDXA 1BQHB 2IAMA 4R4FL 3IJYB 1HXMA 1JDCA 1H6TA 3MRHA 2NX5A 3RVWD 4KK8D 4MWFB 2AEQH 2DI7A 5GGSA 2IFFH 3GI9L 5KZCB 3PABB 5I5JA 5E5MB 2CA4A 3GI8H 3QPKA 5GSVB 4ETQB 2XETA 3GIZH 4FTDA 1B6UA 1TJIH 3LEXB 1QHPA 3DX1A 4AQEB 3L45A 3MBXH 3FFOA 3DPBB 5FECA 4KGJA 1P4IL 2CKNA 2HKFH 4OFQA 4X98B 1KFGA 4MAYD 5LXGH 1DBBH 1E7UA 3EFFB 4F2ME 5KJRH 5C0AA 1HYRC 1OW0A 2QEJA 5DEGB 2CLVB 3MACL 4XVJL 3DX6B 3T0WA 5I1AA 4FADA 1XF3B 4PJ8C 1KG0B 3L8QA 4PJ5E 1JZ5A 4HIPA 1O6VA 2FX7H 4S1SH 3HLKA 1BXVA 5FA3A 3CFEA 2UXFA 4Y16A 3QUHA 2XT1B 1V7ML 2DQEH 3CN2A 4KI1A 4ABWA 3LKOB 2XIIA 43C9A 2WYHA 1UB5B 4GS7B 3WNIA 5I5MA 1KBGL 3N0PB 1ETJA 4E9RA 3UJTH 5BVPH 1TMCB 1MWAA 4YC2B 4H1LA 3V4VA 4YDLC 5FYKL 2Z4TA 1D7FA 5EZJB 2WAHA 2F54E 4WRLA 1UM4H 5JIKA 2W07B 4FKHA 4R4BA 3W38A 2N7SA 1WG3A 2DWSA 1T3FB 4CMMB 3LYRA 3B3IB 1U8KA 4TF4A 3OKLB 4RRPA 3G7TA 3SHSA 3WMSA 4K3EL 2I5YL 3CFDB 3W9EB 4OCXL 1OVZA 4PUBH 3S0PA 3DSFL 2Y6SD 4G5ZL 4WWNA 3QEGL 5HI5C 3BGFB 1TIUA 1UGKA 5D4IA 1C9SA 1JZDC 4A2EA 2HP4A 3MA9L 2WBXA 4FKEA 4HWUA 1N8ZB 5TE7H 3X11B 2AAAA 1NC2A 3BP5A 2Y1YA 3CDGA 4D9RE 5K39B 3T1WA 3MBWA 3EYFA 2F54B 1SHWA 2JCCF 4U33A 3ETBJ 3WL9A 2CBOA 1GGBL 3C87A 3SDDA 1ROCA 1IBDA 1NDMA 1GC1C 4LB8A 1S9WA 5C8JA 2BVOB 3TPUB 1FN4A 5ANME 1FE8H 4AV4A 1MH5A 3E6HA 2VWEE 4XC1H 5J1AB 4J3OH 3EJZC 3QFJA 2P8LA 1JZEA 5E08H 5KVGH 3L1EA 1OALA 4PJBF 4AQ1A 3NZHL 3SGJA 3ZTEA 1SLWA 3REWA 4JZJC 3LKPB 4F33B 3VGFA 5F89A 3TJPA 3SD2A 1EEZA 1CU4H 1R47A 2YLHA 5IW3A 4JW3A 1CE1L 1U92A 4QTHB 3NUKA 4HJ0D 4NX0A 5BUGA 4YXKH 5ANMB 4L8CA 4OZHF 2PPCA 4P5TA 3HG0A 1BXUA 1S5IH 32C2A 3MCLH 3S4SB 3PS6A 3CC5B 4NZRH 1U8HB 1ZE3H 1CVRA 3VQMA 1Y1UA 3VFTA 4XVUD 2GCYA 1OAYL 5AW8B 3TJEH 5EEUA 4N9OB 4L1BA 4Q7DA 4X9FA 2VT0A 5LGHH 3VH8B 3N50A 1QSZA 4LVNB 3FW6A 3IJ8A 1NLBH 4DVBB 2IBBA 4PJ5D 3MKKA 4M03A 5KSAB 3TM6A 3FUEA 5CD5D 5T3ZL 4MXVE 3QJFB 2CO7B 4P4KA 3AMKA 1A6ZA 4GB9A 2AV1B 2N0KA 3QEQE 2Y6TE 4M1DL 5T1LD 2ZD0A 3AU0A 1HI6A 1JPFA 3GLAA 3MOBH 4X83A 3OB0K 3E3QC 2VAAB 4YDIH 4YE4L 5EWIL 1MCLA 3UEQA 3O81A 2X53A 4WU5B 1HEHC 5JPNA 3SQRA 1N4XH 4ZQKB 1JZJA 2HB0A 1N9PA 4NPKA 5IQ7L 1CDCA 1DBAH 3T6ZA 3EO0A 3B1TA 3O3BA 1MHPH 1QSVA 2F54D 2PXYA 3FNKA 5IJVA 1NGWB 4CRPA 3N5AA 3OKKA 5BRZD 3GSOA 1WFJA 1RZJC 3HN8A 5DFTA 2VMDA 3S34L 5GRYA 3C2AH 3NJIA 4LMQE 5JHMA 3TA3A 3NRQA 1EX0A 4A38A 1HYSD 2EACA 3T71A 1KDJA 1THCA 3BWZA 1LL1A 3X3FH 1EHNA 3LV3A 1XV8A 1RAMA 1A7PH 4KTGA 2Q76B 2Z8SA 3AQXA 1XGPB 2DBLL 2VITA 2VXQH 2AXHA 4R6UA 2AXGA 4GMSH 3TN0C 3T08A 1S3RA 3BW9A 4D9RD 4JPKH 4HOWA 4OZFG 4ETYA 1KCUL 1TPXB 4JVUA 4Z7WE 1VFBB 2R2BA 3G04B 4XOBA 1CPUA 3TYFA 1CD1A 5I1GL 3K4AA 1FNSL 3N1QC 5TDNA 4KTDL 4MNHA 5I8EA 1F2XK 4CN1A 3B2PA 4D8PA 5DD1H 3TL5A 5CJXA 3ARDA 1SHXA 4Z7IA 1AKJA 3D2TA 4PY7B 2AXJA 2XZQL 5JHDE 4EBQL 4EN2A 4F9PC 4NKIH 2CKBB 3G5XA 1JYXA 4GRLA 5DRXB 3CNKA 2HUEA 2QQKL 4UM8A 1DCLA 5KSAD 4FQQB 4Z7NF 4Z7WB 4AEFA 2ZX6A 3RNQA 1YUHA 2X4NB 4KQ3H 3DJRA 3ZQWA 4FLQA 4F24A 4F57H 2DOCA 5C09A 2EVIA 5DZOA 2E74C 4S0SD 4YJZL 2DICA 1JFHA 3ALPA 4LOVA 5IOPB 5GSRB 2GJ6A 3FB6B 2ORBH 3GK8H 5GGTL 2MRYA 3OR7A 4IRJD 4U1NA 5ELIA 4EKXA 4NQCD 1GYCA 1QHOA 5JHDB 1J5OH 1HEZB 5FKPA 4K7PL 1I7RA 3ZKXB 1HL5A 1U3ZA 1CE6A 3QEQD 4NGHL 3U46B 1J0IA 2BSRA 4MJ2A 3KDMB 4XVSL 4KRPB 1KYUA 1F6LL 3NACH 5IVNA 2ICEB 1AHWB 4CMHB 4HAFA 3LQMA 5KANI 4UAOC 1PY0A 2EDKA 3O4OC 2GABA 2YQ3A 4I3RL 5KAQF 3U1SH 4JL1A 5EU4A 2R1YA 4WV1C 4IMKC 2IPKB 1T4KB 4RDBA 4OLXL 3MTRA 3EXJA 4A66A 2AERT 4NKDA 4EUPH 2O61B 2DQ6A 2OMWA 3OB0H 1PYWA 2DIBA 4ZZFA 1VKXB 1FDLL 1IBBA 3BLPX 2JKRM 4KJQC 3W39B 2I27N 1RHHA 2XC8A 2IBZY 4QGTA 1NPNA 3QG6B 3SN6N 3WJMA 4YGAB 1QO3A 2XA3A 3O0RH 3WGUB 4XH2A 1T21B 4Q8BA 3BAWA 3H3PL 4HIIA 5TE6H 4YDKL 3CSYA 4UT6A 4KXBA 3UJIL 1VCAA 3RI5K 2P4AB 3W56A 6TAAA 5I17B 3WN6A 3FO2A 2OS7A 1SEBB 3R4DA 4FMKA 5CGYD 4X9BA 4WQOA 1R75A 3RKDC 4DP4X 4HT1H 4F5CE 5BMFL 3RL1B 3ILEA 4Y2DC 2VDPB 5C07E 4MZ3A 3MUZ1 1UJ3A 5LDUA 3TT1L 3B9VA 4FA6A 2XX1A 3OG4B 1PW3A 3AJ7A 1SMAA 4P5MA 4GG8A 5AZEH 1UCTA 3V6FB 1NM9A 3WS3A 5EF2A 5AZ2L 3VXSD 4F9LC 3FQXA 4KKCC 1F41A 4YAQA 4HFUH 2N01B 3UMTA 4XMLL 4QO1B 4F2FA 5JHDD 1D6EA 5DUJA 3TF4A 5D93B 4M3HA 2AEIT 1CG9B 3SY6A 1QABA 3FT4A 3EDJA 4MGXA 4Y4KA 5C07B 3W81A 1YPZF 3MNVB 1TZ8A 4NYLA 4RFEA 5HHXH 3D09A 3RAJL 4KRPD 2XWTA 2WBJC 4WHCA 3FFDA 3PYCA 4TSCH 1GW0A 3VJ6B 2VQ1A 1KF9B 2WWMC 3D85A 4MAUL 2YK1H 3KPSA 1SVBA 1GIGL 3EHBD 5G4OA 1ZV5A 1DN0A 4HEME 3MRJA 1NEUA 5D4QA 2XRAH 4IOIA 4LP4A 4ERSH 5JLZA 2NY1C 1AQDB 1C12B 1ODUA 2JIXA 5CINH 3M8OH 4BUGA 4TL5A 3A5VA 5JHBA 1E6OH 4NO0D 3MLPA 3W11D 1NMBH 2EKSA 1IM3D 3B9KC 5AAPA 1KJ2H 4NNPH 3BUQA 1UACH 2CO3A 3BPLB 4JREC 1RZ7L 4AH2A 5A43C 2WBKA 3SKOB 3QUYD 3U0PB 1I53A 5C6TH 4ZSOE 2WNXA 4NHCL 4HDIA 1K5WA 1OCOB 2FATL 3LNEA 3NVQA 3WFEL 3SBQA 3WYRA 3LRKA 4NZJA 2C9RA 2YZ1A 2WKOA 4ZAKD 2V5TA 1IGJA 5CSBA 3LXUX 3R06A 4XNYH 5EU5A 3TC9A 1KBBA 4G80B 4ZUUA 1X7QA 1EBPA 1FFOA 5AW2B 1COBA 1UWGH 5I1KL 3W5NA 3CLFH 3DX4A 3VFWA 2Z9TA 1NLDL 4D9QE 2P46B 4ZPVB 4YWGH 1BSIA 4BFJA 3BVXA 3QQDB 4FYRA 1EHAA 4D3CL 4QI3A 4XOEA 3DIFB 4M48L 4ZFGH 3AQZA 4RGMB 3WS6A 3II2A 3OHXA 1JMZA 2QZ5A 1RK0A 3N55A 3FT2B 5JUEH 1AJ7L 1AY1L 2VSMB 2Y25A 4G43B 1KYOK 4WZ9A 4EJ1C 1RU9L 4LCWD 2F58L 5HGAA 4XHQA 2CIIB 2J6EA 4C59B 2P8PB 3EO1B 4OV5B 1HCZA 4POZD 4PJIF 1H5BB 2XQYA 3AT9A 1YNTA 3BZ4B 5IBUG 4DUXA 2JI3A 4BXSV 4DO6A 1Y7VA 3GBLA 1A6AA 2NY4B 1R24B 1AQKH 2ATPA 3K2IA 1K2DA 4M7LH 4Z76A 4LLYB 2YD1A 3BDYH 4NM8H 1VFMA 3VYOA 4LGSB 2F5AH 5I75B 3D3VE 2VL5B 1IKFL 4ZFZB 4QAWA 4ZUVB 5E5LA 1SDDB 3OKMA 3TP4A 4PGZA 1PFOA 3L95B 4LKXA 4JRFA 3QNYB 1RVFL 1TZIA 1F6AA 2AQNA 4XWOD 3T09A 3UGXA 5KW9H 1EV2E 1NGQL 2I9LA 4CSZA 3KD4A 3PQYE 1MLCB 3H9YA 4J8QA 5HVGB 1UCBH 1I1FA 3AB0C 4S1DD 2OJEB 3Q2NA 4XO8A 4M56A 5C08B 3BPNB 3SDXA 3V4UH 1JVOA 2D7QA 3ULVE 2DLHA 4JHWH 4ZNEA 2E46A 2IQ9L 3D3VB 5KANG 4ALAL 4QRQB 2Y7MA 3D0AA 4GQPH 3NCBB 1A4JB 3AQYA 1IUZA 3N42B 5A6IA 1ADWA 1C5DB 1E2ZA 3H7BA 4H8WH 3WHE1 5IIEA 1WTGT 3D33A 3PQYB 4FXKC 5DZNA 5EDXA 5B39G 2ICWA 3IDGB 3UP1A 3FS9A 4P2OC 5DZVA 3MJ8A 1CK0H 4LAQL 3WIHA 3U0WL 2F1BA 4H8QA 4L29B 5AW9B 3HKZA 4O9HL 1G43A 4I2XE 4FG0A 1DDHA 3BAKA 4NZTL 1RL1A 1HC1A 4JFEA 4WF7A 5KVEE 1B9KA 3CVHH 4YDJA 3L17A 5DEFB 2X4OA 1HQRB 1L3WA 2SEBB 4X7SL 1OAXL 4OJAA 1HHIB 4XNZC 2FZ3A 3ZTJG 2UY6A 5I76B 4RFOH 3QS2A 2UWEF 2CR6A 2NY4D 2DJUA 3WIFA 4N8CL 4PG2C 5DWUL 4ZRGA 3FRPG 3BPCB 4A2HA 1AKPA 1WBXA 2GT9B 3RU8H 5DMYA 5AYUH 5D2NA 5JHLL 4I2XB 3VXPA 1RXLA 4DHLA 4AL8L 4TMPA 5ACZB 4KY1L 3REVA 2Y4SA 5HYEA 4RIRB 4M4PA 1C8QA 1KTCA 2ADIB 3GMNB 2IOMA 3VWKC 2H9GB 3GBNL 4L5FE 2H47C 2HLAA 3R8BB 1EAPB 1P9MC 4YX2H 1A8JH 5CZKA 2DEXX 5ID1B 3OG6B 3F62A 4XE0A 5GJSH 3TCXA 5IW6A 5KSVB 1CVSC 1YEFH 3UBXB 1N5YH 1A3LL 3MNMA 4HC1L 3S3CB 3T4YA 5I0YA 2M26A 3D3VD 3I9IA 2QPSA 2WLNA 4LU5H 4XODA 5J89A 2WZPD 3E9TA 1NIEA 5EN2B 4OBRA 1I8AA 2WTPA 5JW3H 5HYQB 1I3VA 4LSDA 1KGWA 2WCGA 3Q9QA 1NCGA 2Y36L 3AXIA 4PJ8D 1V5JA 4Z78B 1BAWA 3RX9A 3SOTA 3P3RA 5D8JL 1AXSA 1CR9H 2PWFA 3PQYD 1FO0H 3KMDA 5DRNA 3C60A 4PJDE 3WEBA 3VI3A 1ZLWK 4JFYB 1E4XI 4N28A 5BCAA 3KPRD 1RMFH 1G87A 1RJYB 2Y72A 1KB5H 5B7MA 5DK0B 3ULVD 1T89A 3E3QE 1FNGA 2JI2A 4EVNA 1MW1A 1Z32X 3UJJH 1DE4A 1TVDA 2YRZA 4JO2H 4RDQF 5DEZA 1K85A 2EYRA 1KGCE 3EJRA 4PRIE 1SBSL 4H5SB 4MXQC 2OP4L 1FFPB 2CKBL 3FOMB 5T1MA 4ELKA 1BPVA 3BXNB 1YNKL 4ZX4A 4MYPA 2VZSA 3F7LA 2EDRA 3PU7A 4PJDB 4OUUB 4XMKH 2CIKB 3HHSA 3WMQA 4Z3HA 3WN5A 4Y5VA 2QSQA 2BP0A 4AEIH 2G0KA 1NCAL 4XX1E 3BVNB 5DQDH 4FABL 1QFWH 1JWSB 4LFHG 3S2CA 5HI5D 2VDMH 2HH0H 4PJ7E 4OLYH 3B83A 4Y5YC 3JWOH 1N2RB 2QMJA 3R18A 4TS6A 5E4IA 2ZCZA 3ZDZE 4PRIB 3S3JA 4BQCA 5F88B 1RIVH 1W8OA 1Y0LA 3NABL 5IBLC 3WO3B 3TPKA 1TU2A 5KYNA 2G5BB 4P5KB 1I9RH 4MB4A 2YEZB 3GXUB 3H0TB 4IRZL 1FNLA 4FJZA 4JR9L 1W16A 2ZXDA 2WCPA 4B9FA 5I6MA 4H8PA 3EJZD 2BW5A 3GRWL 3H4HA 2YA2A 4X9IA 3DXAA 1H8OA 4CJ0A 1JXKA 3QO1A 4PJ7B 4JB9H 5AW3B 3BH9A 1LE5B 3ZDZB 5I1LB 3L48A 3QRGH 1QBML 2ICCA 2X41A 4V1DE 4PP1D 1G7QB 4UT9A 3UPCA 5CGTA 3N3EA 1S7SB 1ZPUA 4AJVA 4TNVK 1NKRA 2H3KA 2OMZB 3K81A 1ZSDA 3L3OB 1A6TB 3CZGA 3TONA 2VDNH 4HKZA 3SY0B 4J28A 3JZYA 3HEIB 2LVCA 2NY3C 4HA1A 3R7QA 5ICYA 2VR5A 4QXUL 3MLRH 4TUJB 4V1DB 5EBGA 2G5RA 3KH4A 1YEJH 2V7NB 3KHQA 4NUJB 4ODBD 4WCYL 4HSCX 3T77A 4PJHE 3WEAA 2EH7H 4TSBL 3TT3H 2DW5A 2WINB 4X2UA 4NQEA 3UTTE 2AABL 4XN5A 3P73B 4TUKL 3F5WA 3U9UB 1M56B 5BZXA 4G1MB 1HEJC 4PN6A 1GZQB 3JWDL 2FSEA 2VABA 5CN2A 1RUML 4BSJA 1FFQA 4GINA 3U9PL 3X14A 3L7FA 2VNCA 1ETA1 2B0SH 5GRXG 1NFIA 3QUZA 2WLZA 2XFXA 3MLVH 1MPAL 4J3UA 2DLIA 2Q86A 3W5MA 5GS1A 2B4CL 3VD0A 3P3SA 5L4IA 1B6DA 2VKXA 1KGCD 3L9EA 2JQMA 2V3FA 4PJHB 2VIRB 4Q0XH 1ZLWH 1KYFA 3EGDB 3UTTB 4EKJA 5AVSB 5KYUB 3PNRB 1SN5A 4DUVA 1TZOA 1EIBA 4KXZI 5CFAA 2ZUXA 1A6PA 4KK6C 4XPGH 5F9OH 3O3UN 4KHTL 5ESVB 1MCNA 1T04A 3D39E 1H6UA 1RZIA 4J8RB 1BVKA 1DQQA 4P59H 2ZCLH 4R7NB 4MAYA 4BA0A 5FPIA 4WV1B 4MD4B 1HKLL 3GT6A 2XN0A 3ALWA 5F6HI 3L4WA 3GSWA 3DX0A 3TN0D 1LP9F 5E94B 3AM8A 3CZSA 3U4EB 5EC2A 5ESAB 7CGTA 5BV7H 2XTLA 4K71B 3V7MA 3D39B 1IGYA 4WFGE 4RFNB 2WXOA 2DQDH 3HBPA 3UX9B 4ZBJA 2ZKWA 4KRLB 4R3SA 1QR1B 3CIQA 5A2KH 1AGCA 1HHKB 1YLBB 2XTJC 3HHMA 5I2IA 3GSXB 4LLMA 3VFUB 3B8SA 1RULL 2EINB 3V6ZA 2R2EB 2A6KB 3ZVVA 1YECL 4ONFL 2E8ZA 4V1DD 4OZGA 1OGTA 1JF1A 2DJSA 2E9WA 3BYYA 3QYMA 3PUCA 1R3KB 5DJ8B 3HG4A 4Z5RA 1ESOA 4I3GA 4PB0H 5DMJB 5IF0B 4Z77A 4JPIA 3STZA 3O9WC 1CDUA 2WXJA 4WI0A 4ZO7A 3F7RA 3CZJA 4YIQA 2IJ0C 2A2QT 2KKQA 3ET9F 3KVQA 4OM0H 4Y1AD 4Y5XC 4ABQA 1IAOB 3S88L 3CFMA 4ZTPH 1FJ1B 1X4ZA 3RGHA 5KVDH 3VSTA 4TRPH 4G7VL 2I07A 1HX0A 3PL6C 3MR9A 4BKTC 1EZVY 3CAFA 4NJ9L 2B3IA 3HN5A 5EZIH 1P2CA 3JT0A 4K9EL 1KELL 1VSCA 1BFTA 4XNXL 2QPEB 1PGRB 1V8HA 4MMXB 5DVMA 5EO0B 5DJYA 2ZKHH 2B9BA 3POCA 4IS6A 5E00A 4HS8L 3UTTD 4KROB 4JAMB 5I6OA 4Z95H 4RLDA 4LO9A 3KWUA 4G6KL 1E7VA 3DURB 1KIQA 3I3DA 1NDGB 3GUFA 5IMOA 3VWJC 4F27A 1A1OB 4M7ZC 2NOYA 2EO1A 1XZ0A 4LHUB 5HI3C 1YZZA 1G5AA 1I3GL 3JQOB 1ZVNA 3LPPA 1UD5A 5F3HB 3LRHA 4OD2A 1A8ZA 4GBXB 1IL1B 1IJNA 4NENA 5HGBB 1LEKA 1UUNA 1LE9B 5I18H 2K7QA 1RPKA 2WUCL 3FCGA 4JFFE 5AOKA 2E0PA 3LMJL 2NY1B 4FG2A 5T5FH 4C58B 1S3KL 4N2CA 2FQEA 1QTPA 3GSNH 3PREA 5I1IH 3BEWB 3IFPA 4UDUB 3VRJB 2X4TA 3FONA 1Q94B 5DD3L 3D39D 5HXMA 1E4HA 1TQSA 3HI1B 4K5LA 2P45B 2AXFA 3WUZA 3ILPA 4JREB 1CL7I 5GRUH 5AKVA 2H1PL 3BUYA 3PV6B 4M5YH 5LNEA 5CEXB 3CJJA 2X1QA 4F2MA 5FOJA 1L9PA 3GRBA 4AW7A 1G7LA 3DOHA 4QXGL 4I18A 4NC1C 1QPXA 1ZGLB 2OZ4H 1CI3M 3AS2A 5K1JA 3M07A 1MFDL 3FU5A 2E3VA 2G2NA 4ZOBA 4PJ5A 3PJNA 1N7MH 2HVJB 4ZPTA 3RKDD 3RJOA 3HZMB 4YGVA 5IQ9B 3D18B 3T6VA 3UO1L 4XVTL 1DO6A 4KFMA 1QBBA 2NY7H 4KRNA 5T1LA 5GZNA 1VZGA 4XP1H 4JFQB 3ZW3A 4AIEA 2GSGB 4Z6AT 5EC1A 1WJ3A 5ID0A 4JN2A 4BQ6A 3BP7B 4NIKB 4KKCD 4J23A 4BA8A 2C3WA 5E7FA 1CYXA 2JQAA 3AWFA 5E24E 5EO9B 3ULVL 5F7EL 3AXLA 3BGMB 4HUUB 4D7BA 1HU8A 4KROD 1BD2E 4Z0XB 3WG7B 3WE6A 5BRZA 1NM4A 2QTEA 3OGCB 2D3JA 5E99H 4JRXD 2NR6A 3V9CA 4MMZC 2WBJD 1IGTB 2BRQA 2CG9X 4LHUD 1F42A 3PAVA 1A5FL 1JV5A 1TENA 4I0PB 2CO6B 5JW4Q 4LASH 4B3EA 2IPTL 5K9KA 3QJHA 3D06A 3FSOA 3LZLA 2GITA 5E6YA 4B50A 2NXZB 5C3LD 3WTXA 3LHPL 4X6DE 5EB9A 3ZR5A 5GGUB 1R5VB 4WEMB 4JKMA 4XN2A 1BD2B 2NY1D 1R0AH 3HPJB 5L2JA 4DK6A 1MFVA 3NDZE 5E5UB 3K6FA 4YR6B 1JZ7A 1G6RB 1WH0A 5L6YL 5C7XH 5KSBE 1YJDC 3ARBA 4TXVB 1ZHNA 1FAIH 5ERWA 3DMMA 2UYLB 2WP3T 4AY0A 3CWGA 3ECWA 2EDFA 4FAAB 3G6JF 2IIJA 5F0LB 1AMXA 1FFNB 4JFFD 4WFFE 1D2PA 25C8H 3DUSA 1Z5LB 3N1PC 1DJZA 1ROWA 4NO5A 4UB0L 4H40A 4F20A 1GSKA 3IS0X 2Y23A 4UTAL 1DL7H 3TYGH 3BP6B 3DOIA 3C08L 3IM1A 5AW7B 1MCKA 5IHZB 5KSBB 3CQFA 4L5FL 2ENJA 3L4UA 3CSGA 1WA1X 5AL0A 2YJQA 5L8LB 2MKWA 4IRJA 4QUOA 1A47A 3DIVA 4OD3L 1NKOA 5CU5A 4NQCA 5CBEA 4UTBA 3CD4A 2CJTA 5D6CB 3RZCC 2HPOA 5TFSH 4FZ8H 2YRBA 3EOBB 1KJMA 3MLXH 4PI0A 3T2NH 4P23B 4W4OC 3FB7B 2P5WE 3QEQA 4GT7A 4QHNB 3OM3B 4L8SA 1WAAA 4RAVB 5KS9F 5E1GA 3R1GL 1B4JL 1M3JA 3P4OA 1B0GA 2EEAA 4GKOA 4Y4HA 4MJHA 4DKAA 1NZRA 4FQXB 4EI5A 3DV4B 4I0PD 3WD5L 3ECQA 5AOZA 1FLRL 4ZODA 2QKIB 3O6FB 2A6DA 4OQTH 1TYRA 4DTGH 4YMPA 2NXZD 1KCSH 3M1CA 2QGBA 3P3UA 1BZ9A 2ZYSA 3IMTA 1BZ7A 3LH2H 1E90A 2VLJE 5KTEH 1BD2D 3EOYG 3RWJB 1REIA 1MVUB 2P5WB 5HHVH 2FX9L 4X7DC 4JBSA 3MXWL 2I32A 3FRPA 1ZLDA 3LRLA 1Q9KB 4PB9H 2F7IA 2EDXA 4FZEL 1DJXA 3IU3A 4NERA 4OJFH 4HWZB 4JM2C 1QNZL 4QR7A 3ETSA 1PIFA 1TR7A 4F58L 1S5HA 4MNGE 3IF1B 7TAAA 2EC9U 3HZKA 3V4PB 4ADJA 4BBWA 1QTYT 2WN2A 3NJHA 1P7HL 1KLGA 3DO4A 4I9XA 1AR1C 4LKCB 3NPSC 1RUQL 3OKDA 4QRSA 2JKLA 3BIAX 4XP5L 3QH3B 5JA8B 4N0UE 1V3KA 2AK4A 1LK3H 1MAKA 3DHMA 3OXSB 2DYRB 1GHFL 2VQTA 4U7KA 4N0YH 2X4UB 2X7LA 1Y6KR 3W57A 4MNGB 3VXSA 3MN8A 1J8KA 4BYHA 3AZUA 3QR0A 1CLVA 3DSNB 3KYOA 2FE0A 4OGQC 2FNWA 4WFFD 3IAPA 2VN3A 3MRQA 4QHLA 4B53A 3VFPB 1A9EB 1OWWA 2J88H 3EYSL 4HBCH 3WHXA 4TTGA 2E9BA 3TH3T 5MENA 3RY6C 4OI9A 4YHLL 1PSKH 4L3AA 4MCYA 4N0UB 1SQ2N 2C9UA 3K2UH 2DRUA 5DS8B 4OZFB 4P23D 3ZL1A 1WA0X 3ZKMC 5D1ZI 1NBYB 1WITA 3P0VL 2XNAA 1JYWA 1G9NL 2V4LA 3LN4B 3Q3GB 1FGNL 1JGIA 4ZMTA 4FXGC 1ZHKB 3KNBB 1WWAX 3F7VB 3GTVA 4FQXD 4LCUA 1TZHB 3WFZA 1U8QA 2DQGL 3EYOB 2XZZA 1V54B 3G9VA 3ULAB 4M6NL 1FG9C 1Z0NA 5INCB 4BCZA 4O2CA 2D9QB 3F00A 3AY2A 1L9NA 5F8QC 5G4MA 3FAWA 3UAJD 2CGYA 2BVEA 2AQPA 3FUFA 4UZSA 2P5WD 1MJUL 1PY9A 4Y5YB 2GUYA 4NO0A 4PG9A 4X4YB 4XCFL 1IM3A 1QSFE 5IT2H 2KI6A 1ZA6A 3A67H 3O2VL 3IGFA 4IIQC 3QIWB 4C47A 2ZXQA 4OGYH 3MBEC 2FIKB 3QUYA 4HX1A 3RPBA 3KLHC 2EVGA 5L7XH 4M6OH 2FWOA 3UC0H 2FR4B 2APSA 5DMIH 5DD0L 3TV3H 5DGRA 4MB5A 1KTLB 1CT8B 4D0DA 4BFBD 5CM1A 1RK1A 3WFCH 4OZIE 1SGKA 1ZVHA 3A4FA 1NCNA 4ZAKA 2VLJD 1JTOA 3ATFA 3H9HB 1SPDA 2WVTA 1YAZA 5TE4H 4BSWA 5I1HL 3SDYH 3WAJA 1AC0A 5SWSE 3CFCH 1RJCA 3UO8B 1ACYH 2VDQL 3FQ1A 1QSFB 1FL5A 1U2HA 3G9AB 4ZUSA 5IWLC 4P9HC 5F3BB 3WENA 3GRGA 3LS4L 4F7KA 2WM0A 3HLAA 3Q2VA 4ZK8A 2JB6A 4BZYA 4P3CL 3TT1H 5ESQB 2BPBA 1CLYH 4UIKL 4OZIB 3PWLA 4NN5B 3NQIA 2GJZA 2HFEB 1P5VA 1BBJB 2EECA 1ZT7A 2J1KA 2WXMA 3QWNA 4UT7H 1X9LA 3MFFA 4XXDA 3V4LA 3PWNB 4Z0BL 1J1XL 1T83A 5D1XC 5SWSB 4F5CA 3JZ7A 1UYWH 3CIAA 4LCWA 3UAAA 5LKNA 3QEHA 2RCSL 1JK8A 3QUKB 3ILQC 4FQHA 1Y18A 4K94L 1OWRM 5D7JC 3C6LA 3PWJB 4XCCL 4K8RC 3SQOL 3GS7A 3BAEH 3RAJH 3KLDA 3V2AR 4EF3A 1FYHB 5SWZB 4ZZKA 4GQZA 3B2DC 1P7QA 2OTUA 3JTSA 3LRGA 4Y9EA 5AEAA 3CSTA 3DJSA 4G3YH 2F19H 3ZT5A 3H9SB 3L3JB 1CF8H 1F4WH 1INDH 2EDBA 4G9FE 4KXDA 5T8IA 3OZ9H 4Z3TA 5A2BA 4E9XA 5F8RC 1HOCA 5IK3A 2XPYA 1BEYH 1VGEH 5BUAA 1SDAB 3KEHA 1SEQL 5DHVB 3CU1A 3RPIB 5HY9B 3PGFH 5ITFB 3QIWD 1I8KB 2DZEA 2K4WA 4QT5A 5AG8A 2QPFA 1YYML 2R1XA 2PTTB 3L3GB 5I82A 2XPZA 2UXTA 3LZFH 1BPLB 3APMA 3MRDA 4M3KB 4HCRL 1I7UB 4B5ZA 1GYAA 3B5TA 3LZOA 4FLOA 4PJEF 4XP9H 4APXA 5TDPB 1MELA 2CRIA 4KUZH 5DYOB 3EGXB 2Z3FA 1QASA 5L88L 1KTRL 2ZE0A 1HQ4A 3V0GA 2WZ6A 4ZUWB 3KJ6L 1ZVSA 5MI0C 3L3KB 1QSFD 4YQXH 1UZGA 5J6GA 3TO4B 4D0BA 4UNVA 2ZPKL 3TIDB 4ZSOA 3S36X 1BGXH 2NNCA 2ZOKB 3M6DA 5K59F 1Q0YH 1JGVH 1A9BB 1KJ3H 1HWWA 3LOWA 1IC1A 5CJOH 1UH2A 2FT7A 1FVDB 4TL4A 1PLCA 4Y4FC 3RFZA 1ZHBB 2CDEA 3LPFA 2H32B 5FA4A 2OXHB 2BVQB 1XF1A 2FWSA 2Q6WB 2Q8AH