1GS6X

Crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
b'QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGASGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X02
5D4HA 3PCYA 4DPBX 1JOIA 1JZIA 1NICA 2XXFA 1JZHA 2EIJB 1NPJA 3NJHA 1JVLA 2VW4A 2P80D 2ZOOA 1GR7A 4YSQA 2RACA 1ZV2A 4NAJA 4YSUA 6PCYA 4PCYA 4G7RB 2XV2A 1ZPUA 1OE3A 4HCFA 3X1EA 1L9PA 2BZCA 2PCFA 3HEIB 3EHBB 1WA0X 1PMYA 2PPFA 5A7EA 3ZDWA 2WO2B 2B08A 1NIBA 1XB3A 3AG1B 4BWWA 3ASNB 1SDDA 2GC7C 1BEXA 2HLEB 2VW6A 3AY2A 4KO5A 1JZEA 3JT2A 2J5WA 4DP7X 3V9CA 1PY0A 3S8FB 3PLYA 1ID2A 2HXAA 4G70B 3V9EA 1AS8A 1TEFA 1SJMA 3DTUB 1OF0A 3NP4A 1WA2X 3TU6A 2IAAC 1IBZA 2XXGA 2PP8A 4Q8BA 2HX9A 4YVUA 1AS6A 1PF3A 1GS7A 4N8UA 3PPSA 1MG3C 3TASA 1NINA 1PCSA 1KCWA 2XX0A 1BQ5A 1NDTA 1AZCA 4QKTA 3MX0B 3IEAA 1XB8A 1A3ZA 3X1NA 5B7EA 3NJKA 4DP2X 4JKNA 1AZRA 2QDWA 4G7QB 1BQRA 2IDUA 1ETJA 1ZIAA 2VM3A 2J56A 2XLLA 2GBAA 3S8GB 1IC0A 3BVDB 3FSAA 1J9TA 3X1GA 1W6LA 3NJFA 1M9WA 3WIAA 1JZGA 3NJMA 1PNDA 2I85A 2XV0A 1QNIA 2FNWA 4KNSA 1WS7A 3PXLA 2PPCA 2JXMA 4Q89A 4E9SA 2JFCA 2YXVA 1OV8A 2JKWA 3WNJA 3H56A 3AW5A 3TBBA 1GS8A 4BXSV 1NTDA 1QHQA 4P5RA 4G72B 5I6PA 5B7FA 2HRHA 3IE9A 3T6WA 4KO9A 2BP0B 1J5DA 1EHKB 1GS6X 1M57B 5I5IA 5B3SB 1AACA 1BXAA 5I6NA 4E9RA 4W9ZA 1NIEA 3GDCA 2YXWA 3FSVA 5I6LA 4FA7B 1DZ0A 1EZLA 1KDJA 1A65A 3NJGA 1A4AA 3NT0A 2IH9A 1GYCA 5LDUA 3KW7A 1ASQA 3G5WA 4A2DA 2UXGA 2FT7A 3D12B 3N55A 4ZK8A 2HRGA 4MFHA 1OCZB 1KBVA 4YSEA 4DP4X 4N4YB 1CC3A 1E5YA 1MZYA 4M4RB 2XVBA 1E67A 2YQBA 2BW5A 4AI7A 2XU9A 4WKXA 1A4BA 1JVOA 2PPEA 4G71B 2BP8A 3JTBA 3FPYA 3AG4B 3MBWB 1E65A 3X1BA 1L9OA 2BZ7A 1PNCA 3QJVB 1PZCA 7PCYA 3ABGA 3WI9A 3ABMB 2NRDA 2ZWNA 1OOWA 3OM3B 1JZFA 2YAHA 1KYAA 1J9RA 2Q5BA 2W88A 1HFUA 1QLEB 5B1JA 4E9TA 2GB2A 3X1FA 2TSAA 2AVFA 5EHFA 4DPAX 5ANHA 2YAMA 2FT6A 2WSDA 1TEGA 2BP8B 3ABLB 4EF3A 2AZAA 2QPEB 2AZUA 4A68A 1JXDA 1NWPA 1WA1X 1I53A 1NIAA 2IWKA 1CUOA 3ERXA 3FU8A 4F2FA 5B1AB 1AS7A 2PCYA 3QQXA 4X4KA 1BQKA 4BWTA 4E9YA 4YSAA 1IUZA 3FYIB 3CVCA 4HALA 1MG2C 4DP1X 4A66A 1J9SA 3L45A 1SF3A 2ZXWB 1SDDB 1ET7A 4E9VA 4GP5B 3CDZA 3SQRA 3NSDA 3PAVA 3NYKA 5F7AA 5I6KA 1ZDSA 5IY5B 1M56B 2VW7A 3DIVA 1W8EA 1XMEB 5E9NA 3NSCA 4DP0X 1T5KA 2UX6A 1BXVA 2A3TA 1OE2A 4GXFA 5I5MA 4RH4A 5FC9A 4DP8X 5I26A 3PAUA 2XX1A 2I7SA 2IDSA 1JERA 2PPAA 4NB7A 3T9WA 4YSOA 1VLXA 4CSZA 1RCYA 4YL4A 4JHVA 4HIPA 4YSRA 2H47C 1L9RA 2PLTA 2HZHA 2VSMB 2XV3A 3DKHA 3CZUB 1X9UA 1ILSA 1AZNA 1FWXA 4BDVA 3FQYA 2EINB 2LLNA 3PAZA 1OCRB 3NJIA 2H5UA 3KW8A 3QJQB 4HCGA 4A2GA 1V55B 2XUWA 2DY2A 1MZZA 4AKQA 5D4JA 1NWOA 4K9JA 4UANA 3RYMA 3ZBMA 8PAZA 2J57A 2YAEA 3CVBA 1AOZA 5TK2A 1YLBB 3GYRA 1GY2A 3S3CB 4F2EA 4L0PB 1MDAA 3OMAB 3T6VA 1OCCB 3QJSB 2GSMB 2DV6A 1RZQA 3QJUB 4BXVA 2FJSA 4E9WA 1AZBA 3T71A 4YSTA 3OMIB 1FFTB 2YAQA 4HZ1A 2EIKB 1SNRA 1KCBA 3BQVA 1SF5A 2GIMA 1L9TA 3ZX1A 2I7OA 3NP3A 1ZDQA 3WNIA 3U25A 2PP7A 2UXFA 3EH5B 4BWUA 2FQDA 2BWDA 1SFHA 1JZJA 2YARA 1PAZA 4NERA 2OJ1A 4KO7A 2QPDB 3UACA 1SFDA 1AG6A 2X88A 4DPCX 1IKOP 3N2JA 2FWLB 1KBWA 2E86A 3FU9A 1CYXA 4DP6X 1XB6A 2PP9A 4E9QA 4WTQA 2VN3A 3AZUA 2CBPA 1PZAA 1CYWA 4BK5C 2CCWA 3OMNB 3AG2B 2OV0A 1KDIA 3FSZA 2CAKA 3NJNA 3CG8A 2YAOA 4P5SA 2W8CA 3QJTB 2P80A 1PLBA 2EIMB 2R7EA 3TBCA 1GSKA 2IWEA 1PZBA 1RZPA 3FSWA 4A2FA 2DWTA 5AKRA 3UABA 3CVDA 2VSKB 1ASOA 2CUAA 2IDQA 3FS9A 4GYBA 5B1BB 3GXUB 4E9XA 2N0MA 1L9QA 3EF4A 4A2EA 1DYZA 1W6WA 4KNTA 4W1TA 1TU2A 4GP8B 3FT0A 4AKPA 1CURA 1ADWA 4YSDA 3UAAA 4GP4B 3H4HA 1JXFA 2MTAA 3NSFA 2R7EB 5B7MA 2TSBA 3IN2A 2X87A 7PAZA 2PPDA 1A8ZA 1L9SA 3FU7A 2DYRB 2FQEA 3NJJA 9PCYA 3OD3A 3ZIYA 3IN0A 4ENZA 2UXTA 5AFAA 1OCOB 1A4CA 2OCCB 4YSPA 4PAZA 4KNUA 1NZRA 1WAEA 1F56A 2UXVA 2BW4A 4HCIA 3OQRA 1BYPA 4AZUA 3NJLA 5I6MA 4QLWA 5I5JA 2BWIA 2H3XC 1KGYE 3IBOA 3UGEA 4FAAB 2IWFA 2BO0A 4HHWA 1ILUA 3FU7B 3CDZB 2Y1AA 3QJRB 1JXGA 1UATA 3FQ2A 4UAHA 1FA4A 3FYEB 2HX7A 1OE1A 3UAEA 1V54B 3AG3B 4G7SB 4AX3A 4AKOA 2CALA 1ZIBA 2J55A 1AAJA 3WKPA 3EH4B 2EILB 2Q9OA 3ASOB 2VM4A 4F7KA 2XWZA 4YSCA 3SBPA 2FTAA 1B3IA 2AFNA 3FQ1A 5PAZA 3SBRA 2BP0A 1R1CA 2IH8A 1NIDA 1KV7A 3WG7B 4BDVB 1AG0A 2AANA 2GC4C 2CJ3A 4DP5X 2B3IA 1RKRA 1AZUA 2QDVA 3SBQA 5I6OA 3UADA 5F7BA 1ET8A 3EH3B 4A67A 1PLAA 4TXVB 3T6ZA 1GW0A 4M3HA 1ASPA 4HAKA 2WO3B 1E30A 2FQFA 3QPKA 4YSSA 3H4FA 1V10A 2UX7A 2ZONA 4A2HA 1AANA 1N70A 3TA4D 2FQGA 1ET5A 1NIFA 2GI0A 5D4IA 5B1JC 1TKWA 1AQ8A 1SHXA 2XYBA 4KOBA 3ABKB 3X2QB 1HAUA 2VMJA 2DWSA 1BYOA 1N68A 5PCYA 4GY4A 1J9QA 1J5CA 1HAWA 1BXUA 4KO6A 3S3BB 5TK4A 3HB3B 1BAWA 3T6XA 1PLCA 5AZUA 1AIZA 5I28A 3C75A 4HHGA 1E5ZA 1SHWA 2YAFA 4CSPA 2GHZA 4UF7C 6PAZA 1URIA 1GY1A 2BHFA 3NSYA 1AR1B 2DYSB 1WS8A 4DP9X 2IDTA 2MRYA 4KOCA 1IBYA 2Y69B 5B1KA 4YVNA 3S3DB 3WKQA 2YAPA 3FPXA 1NPNA 1X9RA 4JHUA 2FT8A 2IDFA 2QT6A 2HX8A
chains in the Genus database with same CATH superfamily
3O6FD 3PCYA 5D1XC 3S5LG 1BVLB 5CCJA 1A8JH 3LNHA 4HV8A 1YECL 4JRXA 3FUIA 2J72A 4P2CG 1FNEA 3VWJD 4KTDL 1D7BA 4KVNH 3C60A 2RACA 3OXRA 4XZUB 5DJXB 4OLZL 4LPCA 3DI2B 4CVUA 2HJKB 3ZMEA 2JKNA 4XE0A 3RWCB 3KR3L 4LHUB 4YBQD 4AVKA 1KYOJ 4K7PY 3DGDA 3OJDA 4AYFB 1FPTL 4PJAF 4GINA 4PWIA 4WDIB 3ZO0A 4PJDF 3CV5A 1WIUA 4ZW7A 4NJAL 4FNPA 4LU5H 4M7KH 5DJ2A 3FFCA 3N43F 1NLDL 1AY1L 2C5DC 1P5VA 5DD1L 3BAIA 2F5AH 2WUCL 5CZVL 3Q6GL 5I8CB 4DEWA 5IBLC 4W6WB 1IARB 4B3EA 3BZEA 5D96B 3ECVA 1AKJA 3PLYA 4X6DF 1AXTL 2G75B 2QVFB 1HEZB 4RVBA 2AAAA 4M1DL 5AVSB 1JGUL 1I9JL 1FZJB 2WLMA 4LF3A 1YEFL 1INQB 1PZSA 5D7IF 1P1VA 2ZX6A 3OZ9H 3WEAA 3V10A 2J43A 3E8UH 3MNZA 1AS6A 2W92A 1WD8A 4PGDB 4TNVK 3D0LA 3O2VH 2AEPH 1CU4H 4L1LA 2EYTB 5CGYD 1TYJA 2LLGA 4GRMB 5GRXG 1NDTA 4QKTA 3RKDD 3MX0B 1EANA 4EZMA 4MVBD 5K9KB 1MLBA 2V37A 3OXSB 4L3CA 1ML0A 4Z95L 2DQDL 4JL2A 3NAAL 1Z3GH 4K3HA 4OD1L 1E9QA 3B7SA 3BYTA 1ZIAA 3IT8D 4OBSA 4XBGB 5EO1A 2DLGA 4NQEB 3AB0B 1NBCA 2Z4TA 3SY0B 4XAWH 4N6RB 1NGZB 2CPCA 1GGBL 2N1KA 2YD9A 4HJTA 3X1GA 4NNYA 4UM8B 1JZGA 2PF6A 2IG2H 2VKXA 1BWWA 3MRJA 3JWNH 1WS7A 3OKDA 3NFPA 1AGEA 1ECYA 2JXMA 4M1GH 4Q89A 5DRXA 4YDKL 2AMGA 5CR8A 5FUCE 1CFVL 1T2XA 3B9KA 2QQNL 4L05A 3B34A 4PD4J 1NANH 3BKMH 1H19A 1V3LA 2YEVB 1VENA 3AABA 4GO8A 4W9JC 5ILTL 2CDGB 5B1CA 3RIAK 5IROD 3UTSB 4E41D 3GHPA 3RVXD 5IJVA 3IDUA 2R69A 2NY2C 4OGZA 1BXAA 2GJRA 1F3DJ 5F89A 3C5ZD 3VNZA 1TTFA 1WFNA 3AREA 4Z7QF 1SY6H 4KBPA 5I15L 3P2DA 3D25A 4XBPA 2NY7H 3WDHA 5FYLE 2YD5A 3KW7A 1ASQA 2E6PA 1N0LA 2UXGA 3HHSA 4JFXB 3D12B 2PW2A 4OM1H 1VKXB 2NZ1A 3M7FB 4JM2C 5FV2A 3BH9A 1SN0A 3EZJB 3VB8A 1C16B 3QCUL 3NCBB 1FE8H 2F19H 4U49A 3WDJA 3KPPB 3F3HA 1ZGLB 1ADQA 1GAFL 2XU9A 5ELIA 1A4BA 3KJ4C 3B7UX 1UG9A 3NEXA 1FPTH 5K39B 1FI8C 1BZ8A 5HHMB 5HI4C 1A3LH 3B37A 5AKSA 1OKEA 3AG4B 2WKLA 1P1ZA 4NJAH 3VD1A 2N59A 3MA7B 1L9OA 4PJEE 1NLDH 4ZXBC 3TCLB 2XWRA 1PZCA 1X9QA 3QJVB 3TIEA 2JTDA 2Z65C 3BWUF 5DD1H 2WUCH 2XC8A 4TNGA 3U4BL 4DGIL 6TAAA 5AVYB 5TPWL 1HFUA 1F8TL 3VD3A 3A4EA 4RISL 3OTTA 4KZEL 4MD5A 1NGWB 1XAUA 2G3XA 3K1KC 3QIWB 3NCJL 5ITBH 4HKJA 1AXTH 2NTFB 3QR2A 4Z78A 5H4ZA 2WSDA 4HKBB 3DOHA 1JGUH 1NCAL 5J6GA 1HIML 2ID5A 3FTGA 4AYBA 3U7WH 1JXDA 4MNQA 4Y4KB 4AMWA 1W0WA 3CK0H 3D85A 3K0YA 4UIKH 3NCMA 3VRJB 4ZMLA 5DMKA 2AABL 4YHML 2KKQA 4QIRA 1E50A 1XEDA 2KDGA 2Q3ZA 1K8IA 4WWKA 1UCBL 2DYPA 2R39A 1KCKA 2XQYA 5DC4B 1KGIA 4RRPM 1EDQA 3THML 4JGUA 5E4OA 3QO0A 1BLIA 4P05A 1NC4B 2XKUA 3KWXA 3IXAA 3OLIA 1F58H 3PHQB 1TNMA 1LK2A 4ZO6A 1PQZB 2DQDH 2ED9A 3MRCA 3NAAH 4Z7UF 4OD1H 3ES6A 2PO6D 2C9VA 5EIQA 3VXMB 1SHSA 2SODB 5CMAA 5DK2A 3UFIA 5DA0B 3HMXA 4AVIA 3CDZA 4OR1A 3WN5A 4PGBB 3QEQD 3KBPA 2QZ5A 5F7AA 1M56B 4MNHA 2BS71 1I1AD 4OSUL 5HHOA 3TZVD 2OJZH 1C8QA 5C07E 2XTJE 4KQ0A 1OE2A 3KPLB 4MJIB 4XNYL 4PJIA 5DHEA 3U7YH 2J2ZA 4PJIE 1ORSA 5JPMC 3BVNA 2I7SA 2IDSA 4MD0A 3QHFH 4G9DB 2VDNL 3BP7B 1KB9K 1LK3H 4V2BA 2WBXA 2K70A 2W07B 4RGNB 3PWLA 3UYPA 4Y1SA 1W91A 3D9AH 1L7IH 4PJ9A 4YZWA 3SGEI 4FGMA 1OHQA 1U3HD 3NSXA 4XE5B 1BFTA 3VCLB 3TWCL 4Q4IA 5IQLA 4UOQA 3MLVH 1MPAL 2C4FT 4WUUE 2A83B 2IVFC 2FATH 4U2YA 1HILA 2R59A 3BUYA 1HXMB 5ESQB 3D2UA 4LAQL 4ONGH 1S7XB 1YQVH 4RX4A 2J8UF 5I15H 1S9WA 3EH1A 2ZKWA 1KFAL 1K8DA 5L2JB 5KANI 4HKXB 3VFTA 2OTUB 1IIIA 4P2OA 1VB9A 5FYKE 2J6WA 4F2EA 4ZD3L 3TFBA 4JCMA 4MQSB 2J1KA 2FWOA 3T6VA 4ZYKA 4D3CH 3BUBA 1NAKL 3UCQA 2B8OT 4YUEL 2D2CC 2AMUA 1Z7JA 1RUPL 5EZLB 2VWEC 2GVYA 2F53B 3BX7C 3CSGA 4YWGL 5FXCH 1A6ZA 2DS4A 3UBFA 2DLHA 1AZBA 5JW5A 5T1DH 3TNMB 2DJMA 3QI9D 1FFTB 2DJSA 1E4KC 1XEUA 1JI2A 4XPHL 2YUZA 1IFRA 1SF5A 2CRIA 1H15B 4E5XB 1CXIA 1ZDQA 4GNKB 1UD2A 2CMRH 3HZKA 1FZKA 3C6LA 4MAUL 4DGIH 1A6AA 5TPWH 4BWUA 4R5XA 4OCRL 5EUKA 2YGNA 1Z9PA 1CIDA 2EICA 4KZEH 1UFUA 3B3IB 3QWOB 1BAFL 3RIFF 1JF6A 4FTVB 4JPVH 4F8LA 3L9YA 3GSVA 2APFA 2X5PA 1CGTA 4UM9D 3MV7D 3H1ZA 4L8CA 3ULUF 3RURA 1BEYL 3QAZB 3RVVD 4DP6X 1FG2B 5BXFB 1SVZA 4OIAA 2R1WA 2E7LA 3K71A 3AZUA 3UX9B 4K9EL 1YAZA 1OD7A 4JLRB 3L4WA 3QUML 3B2MA 4Y5YC 5K93A 5J1AB 3GSNL 1CGWA 1KN2H 3S5LB 5E00A 4Q9RH 3Q8CA 4I13B 3UP6A 4PG2A 5C0GA 4MZRA 4A6YH 1TTCA 4BBWA 4B9JA 4X8JA 4LDOB 1J8HD 4QYOA 4WHCA 2DQJL 1TZAA 4RMWA 1A9BA 3X13B 4U1MA 1HCFX 4Z7VE 1KFGA 5EU7E 1EAPA 5DSCB 4GFXA 5CP7A 4F9LC 5SWQA 4B5ZA 3BCDA 7FABH 3ZYZA 1JVKA 2L0DA 3CU1A 3EF4A 3P9MA 1GGUA 1FORL 4XNYH 3ECBB 4HZLB 3FUDA 1XR8B 1G7JB 4W4OC 5EZOL 2CNZA 3QH3B 3VFWA 1VZGA 1I4FA 1A4KB 2O6FA 3ARYA 4LEBA 1JXFA 2WZPA 4KDTC 4F3FB 3GSOB 4PRDB 5EB9A 1F6FB 4FERA 2Y3NA 1A4CA 5F1IB 1F11A 2CRMA 1OW0C 5ALCL 2PWHA 1WO2A 4ZW3A 3DJRA 1HHKA 5EO0B 4X5WB 3NZ8A 4ZPTB 2CHZA 2CLRA 3DX4A 2WQRA 3NJLA 3O8XB 4AZUA 4QXGH 5HVHB 4RZCA 4GW4A 2WANA 3GB7A 1MAMH 2MCMA 2I9LA 4LAQH 4R4FH 4N2CA 4KXAA 4NRZB 5E1QA 4G43B 5CEXA 3G5YB 3IMTA 3HS0A 4FYRA 2CR3A 5F9JB 2XIDA 4LHJB 3NPZB 4WEUD 4DT2A 3FYEB 4CMMA 4E42A 1EQWA 3AT8A 3WO4C 3IKCA 3ZGHA 4OZ4B 1PJWA 3RY4A 5SV4A 3ETBF 4K3DH 3IBEA 2J8HA 1KY7A 5EORH 4LFHG 1KXTA 1E8YA 4XN2A 4LCYA 1PG7L 2WINA 2WBJA 2DL2A 3HRZC 4PRPA 4YUEH 1Q72H 1HYRC 4G8FB 2VM4A 4Y8DC 1S5HA 1JGIA 1RUPH 4JHBA 1E4HA 1PW3A 2XWZA 1KULA 3S3JA 3TO2B 3IDGA 1JHLH 2ZP9A 3BC9A 3SBRA 4IBZA 1FO0H 1R33A 4O5LH 5IB4B 4D7PA 3DMMA 3B2PA 2A6IB 2CU9A 3GPSA 4IK6A 5J6HA 2W9LA 4BKLB 2VDQL 2YA1A 2HG5B 4IHOA 4KDWA 1QUNB 2QSCL 5IOKA 4PIBA 4YEFA 3JWOL 4OCRH 2H9GB 1UM4H 5EU4B 4JZNB 3B5TA 3TV3H 1Q9WB 3MGTB 1SJHB 2P47B 3GINA 3HLAA 4DPRA 4HPYL 4I3SL 3SKNB 4J39A 1JTTA 1AQ8A 2J12B 2A2QT 4H8VA 1CDYA 2VMJA 4EDXA 1BYOA 3ZHFA 3GFUA 4QHNB 4K9EH 4Y1AA 1QX1A 2GI7A 3JV4A 1WT5A 3QUMH 2VLKB 4R7NA 1UQSB 4TOYL 3RNQA 1ZA3B 2EDWA 4X83A 3W2DL 4Z7OB 1UA6H 1FZOA 3F7KA 1JFQH 2YN5A 5DUBB 1T5WA 4JKLA 3AC0A 4AIOA 4NGHH 2IDTA 5F9WB 5ACMA 3F04A 5I1GH 3FH7A 3PG2A 5E1AA 4K7PL 3NABH 4R3SB 1EZUA 4S1QL 1GL4B 2ROYA 3P0YH 4NQUA 3WEOA 1FORH 3QPQD 1K72A 5D4HA 5FK9B 2EVFA 4NUJA 3VG0H 3VFPA 4G6FD 4CC1A 4PJGB 1VFBB 4PRNB 1NDGB 2EDEA 2LVEA 3KG5A 5E08L 4OZGB 3SBWA 1WRFA 3T1FA 5TE4L 2DOCA 2Z31B 4OVVA 1WTLA 4UV7L 4YSUA 4QHPA 2WXMA 3COOA 3OKYA 4FMFA 1L9PA 1NUNB 1KCVH 3VH8G 2CXKA 2F5BL 2J25A 4J7RA 5D1QA 4TV3A 3TLRA 3DA0A 2AJVL 4KJPD 1NIBA 2ATPA 2G0LA 2PXYB 4KKRA 3R18A 2G3ZA 4XBEH 3BZ4A 3NZHH 5A3IC 2D3NA 3RLSA 1U36A 3V0EA 5C8JB 1NCTA 4L9LA 1HDMA 4UILL 4G80A 5M94B 5KSAB 4K73A 1JGEA 1FZMA 3SDXE 4XZ4A 5T3ZE 1PG7H 2HFEA 3K6SB 1A7PH 1WA2X 1ZJBA 1AHWB 4Y4FA 3EADA 3NK4A 4QRPA 2VSCA 4U1LA 1XO8A 4MCZB 4QRPE 2BVOA 3AU1A 4F7PA 5L6YH 2V8LA 4JO1H 4L8SB 5F3BB 4N87A 3R1GL 4HIIA 4H0HB 3KGTA 3IJEB 2A9DA 3WAJA 5HGBA 4YX2H 1AZCA 3VWKA 1OAJA 4H26A 4PBVC 3VXPA 5FB8A 3RP1A 3TCTA 4TTDD 1E4JA 4FL4B 4XMWA 1CFMA 2NY5L 1E6JL 1JBJA 3EXJA 3QYNA 4H88L 3JWOH 1DSFL 2E9BA 1X4XA 4K0OA 1QTSA 4JPIB 4K71B 5IWLC 5GRZA 2XV6B 3BVDB 2AJ3A 4DIXA 3KLHD 4ADGA 4JDVB 3GZQA 3CFQA 3K72B 4OZIB 3EFFA 3C8DA 3OAYH 1TJMA 4HPYH 4IIZA 1CGVA 5BUGA 4MMXC 2CGYA 5GJTL 4WJG3 4UT6L 1QNIA 3VJ6A 1MJUL 1OPGL 1XVSA 3CSPA 3PQYB 4AQOA 4BGLA 4NJ9L 5M7QA 1BCIA 3RWGA 3RWJB 3ZT6A 2ZQKA 3ALPA 1NCHA 2DIEA 1MNUL 4OLYL 3SDCD 4AUUA 4DN4H 4H7VA 3U9PH 3RIAF 4K5LA 2V8MA 3X3FL 1OD9A 4TOYH 1ES0A 1WE5A 4A6YB 3EOTH 1GGCH 3G5ZA 4B0MB 5DFWH 5AYUL 2EH8H 1TYEB 3FK3A 2IBZX 1OAUH 5CNHA 1IEBB 3UTOA 1FUNA 3AS2A 5C3LD 4URKA 3EDFA 2WSPA 4JN2A 4X98A 1CFSA 5T1KD 3WTUA 1T1YA 4GUQA 5DLLA 2EXWD 1JZ4A 4XN5A 3BN3B 3ETBJ 3NT0A 3ALWA 4QGTA 4XWOD 1G7LB 4Y0GA 4I9WD 3OKOB 1GPOL 3LEYL 4MCYA 5LDUA 3LRKA 3SJVB 3GHEH 5INDB 4MX7A 4U1HB 1FYTA 2PW1A 1DEEA 1FYTE 4PV8B 2DJ4A 1N5AA 3O0RH 4RIRA 3T4AC 5J8OA 3WTYA 2BOBA 3MRKB 2EVHA 2CBMA 1E3XA 3KH4A 4OFYA 4X6EB 3HRPA 4OM0L 4MQXC 5JW4R 2ZSVA 4PS4L 2YD4A 2MOGA 4NO2B 5KYXA 2M83A 4FZEL 2XZZA 4J8RA 5EOTB 5JHMA 5TH2B 2Z7UA 5GS0L 3L7EA 2PWEA 5AD0B 1CD9B 3CFBB 1MCPH 4JQVA 5DTFB 5HHVL 1H3UA 1BMWA 1Z9MA 4HJGA 5BS0D 1OTUD 1AGDA 1YVLA 2ZWNA 4PJ6A 1P84J 4JK0D 1SJEB 1R24B 1S7TA 3L5XH 3DVNA 2BSDA 3HC4H 4PYGA 4LEOA 4NQSB 5EF1A 3CN2A 1IGFH 4LLVB 4L8BA 4LLWB 1N5YH 5F7UA 3QORB 2PR4H 1W2KT 3NCYS 3FQTB 1JWMB 1HKFA 4X9HA 3SE9L 2AJYL 5I6XC 3KGSA 5ESAA 3NTCL 2B4CC 2CDFA 2OMNA 3MTRA 5F6HJ 3WDIA 4EPSA 1CXLA 4XX5A 2H8PA 2Q6WA 3O4OC 5FYKU 1FO0B 3OSKA 1UWGH 3DPBB 1PZ5A 3E3QC 3QXAB 4NKMA 3I2CL 1AS7A 1ONQA 2DI9A 3VXRA 4P5KA 3WTVA 2X4RB 1NEZG 3VXRE 3GS0A 3GBNL 4KK6D 2XVKA 3BGFC 4XH2B 1AJ7L 1KJVB 1U2CA 2GSGB 1TCRB 4MLSA 2MPAH 2CSPA 4LO9A 3U0TA 2PTTA 1L0QA 3UBXG 3OKNA 3V4UL 1U0QA 4O2FB 3NCYP 5GGSY 3IF1A 5I1CL 5I6KA 1ZS8A 3DX8A 2R23B 1XMEB 4LCCB 1IKFH 3PL6C 1P4IL 2ZOTA 4HPOL 4GW5A 4X7DC 2DDQH 4TL4A 5GJTH 4GXFA 1U91A 1U6AL 2NT0A 2K1MA 5DS1A 4N6QA 4DP8X 4YDIL 1T0OA 3PAUA 1L3WA 3RFRA 3E6HA 4OLYH 1VACB 1K2DB 2ROXA 3LRSA 2YD2A 3QUMB 1S7UB 3X3FH 2K9FB 4KJWD 4Q52A 2H47C 3H42L 1DCLA 1TLKA 4BCZA 2FEDC 1LYQA 3WNNA 2EINB 2LLNA 2W65A 2WLLA 5FYLL 3PAZA 2G60H 4RSYA 4N2FA 1OANA 3QJQB 3T0EB 1Q9LB 2DD8H 1N2RB 3QSKB 4OGYH 1INDL 1N3NB 2F54B 3P73B 4MXWL 2P44B 1NCDH 5JPNA 4OI8A 3SY6A 2FJGB 3IJ7A 1XDTT 2FBOJ 3LEYH 5DJ8B 5KS9B 2R4RL 1BJ1J 5I23A 1BFVL 1I7ZB 4XOAA 2YEZA 2FSEA 2GFBB 5C09D 2EEAA 2JCCF 5KG9B 3OKKA 1QBAA 4CBPA 2NY1C 4FX5A 5TFSH 2GBVA 4J3WA 1UJ3C 3CZEA 3LS4L 3RGHA 5E5RB 2A38A 4HHAA 1HINH 1BP3B 4GS7B 1XHHA 4DKEH 4FZEH 3TN0A 2XJLA 3WIHL 3C60C 2B15A 1L6XA 4ZW8A 4DEPB 3S36X 5I16A 4NZFA 3TGXA 1O0VA 3QFJA 2X4NB 1Z5LB 2CM5A 4JGJA 4YPGB 4I0KA 5I75B 2WSKA 1EAJA 3GK8H 3K8LA 3EUDA 1YNTA 4L8DB 4QOKD 4LVHC 1EXUB 4H1LG 2Y7QB 2NMSA 4P4KB 3GO1L 5CZKA 3WO3B 5FO9B 3MXVL 4I0PA 5EF2A 3HE6B 4LCIL 3WS6C 2XXCB 1T20A 4FFZL 3CFTA 3SE9H 5HYFA 4XMZA 3EO1B 4JFFB 1NOAA 3G5XA 3G5VA 2P9RA 2AK4B 2X89A 1RV6X 4BJLA 5KSBB 2PYEB 3KVPA 2D7PA 3DOSA 3LVTA 3OKMB 2OMUA 4MZ3A 4ALAC 2CO6B 1C12A 4GIAA 4FLQA 1F4WH 4FEMA 5CSBA 5DWUL 3O3EB 4P5TD 1KDIA 3I2CH 1KLFB 1S3KH 2W5PA 4G9FD 4A55A 1UXSB 2F58L 5C0AA 2HT2C 3GBNH 3QO1A 4POZD 1AJ7H 1F45A 5ERWB 1NFDB 3C9NA 3UTTA 5JW4Q 2Z64C 3V4UH 3TO4D 1PG7W 1RI8A 1T4KA 3PXJA 5I1CH 4E68A 5DFAA 1GIGH 1HSBA 3MBEB 3S6CA 3QDAA 1D9KB 3RL1A 3HG1B 5IJDC 4GXVL 2WOBA 1T2QL 4YNYB 2M2DA 4P4RB 5D5MB 3IJSB 3FHAA 1F42A 5JTWA 1HOEA 4JO2H 5E2UL 3K0WA 1ZT7A 5IKCB 4DVRL 4K55A 2ZOLA 3U79A 3IN0A 2AGJH 3NJXA 1DUYA 3U46A 2FJFB 4HCRA 2I07B 4KMTH 4GQ9H 3B9KC 4D9QE 5FYLH 4Z7WF 1N6QH 5KSVA 1NAMA 5LDSA 1F4YL 2XQYG 1IAKB 1YCSA 2H3XC 5SX4I 5E70A 4EBQL 1DBKL 5AOZA 2P24B 4GT0A 1P7QB 1MCEA 1WP6A 2UYLB 4MXWH 4Y7MA 4UBDC 1ZHBB 3EGDA 3MRLB 3FW6A 5I9QB 4NQQA 3AVEA 3BN9C 1OE1A 5CP3H 3UAEA 1OSPH 2CO2A 1GKOA 1M2VB 2G2PA 3AREC 1LWHA 2A1WL 4XMPH 1I8IA 1J8RA 2BVTA 1MHPH 2ENJA 2ZCLL 4QRRB 4IDLA 2AW2A 4Y4HA 1A7QH 3B5GA 3VGBA 2G2RA 5KUMA 3UPRB 1XIWA 3MLSL 1R5WA 2V5MA 3QJHA 2QQLH 3U30C 1S7VA 5KAQG 3DV6A 4GI8A 3HR6A 3I74A 4C4KO 3WN6A 2AK1H 4XTRD 3U48A 1R1CA 1UACL 4PWFA 4EMZA 1TZIB 3ZE2F 4EN3B 1TJGL 2DL9A 4K5MA 3MNWB 1EHAA 5E2WH 4HP5A 1CXEA 1NLBH 2KLTA 3DHUA 5GSRA 1SYSB 4I18A 4F7CA 4ZW5A 4XX1E 3HI6H 2A74A 5TDPB 3T6ZA 1GJIA 1T21A 5CKGA 5JOFA 3ZU8A 3DETC 3M6DA 5EUOA 4X4YA 5I8KL 1D6VL 4GI9A 3QPKA 4LCUA 1LGVA 5KW9L 3AQDA 3G6JA 1FGVL 1L0XA 4ODBD 3OZKA 2R8SH 3TA4D 1A7NL 3U4EA 2DM2A 3I84A 2VUYA 1XCTA 3V6BR 3DX3A 2MQCA 35C8L 3BFWA 4H8WH 4GSDL 3CLFL 1G9EA 2BIMA 1JPTH 4FMVA 3CQFA 4MA8L 2VXVL 3D87B 3L17A 1H3VA 2DTSA 1IEAB 5AW8B 1MXDA 4JFOB 1SQ2N 3HNTH 3RI5F 1YY8A 4ANVA 2WNGA 4I9XA 2R56H 3G6AA 1C7SA 4XOEA 4ONFH 3GUTA 2ZXQA 1KEML 3LKNA 3NIFE 1AR1B 4WWKC 1U8LB 4Q0XL 3MHZA 4D0CA 5FO8A 1IBYA 3OAYK 1E2VA 3DYOA 4WSJA 5SWSB 5KJRH 2NSQA 2Z3FA 3QUXB 3TTYA 5IF0A 2EUVA 1KTKE 2IF7A 4XC3L 3AQZA 3KDPB 2QHLA 2X2HA 4ONHA 4IRJD 4P2RB 2KZBA 3PGFL 1QEWB 3APDA 1G7QB 2A73A 3QDGD 4RWHA 5A43C 1SMOA 1F4AA 1UADC 2WWNA 1ZGLP 1L9NA 4C56E 3TT1L 2UY6B 1EO8H 4CNIB 4PCYA 4PJBA 3D18B 4PJBE 1T3FB 1EJOL 5DMJB 3B7TA 4OCWH 3EG9B 4FJ6A 1X5FA 2B1AL 3BUQA 4S10A 4ETYA 4UDTA 1F4YH 1P4BH 1SXAA 4PGCB 4TSCH 4HV8B 3F7VA 3O4LE 5AAWA 5D93C 1SXSA 1LP9F 1FNEB 3D06A 2CLVB 2CCLA 1ND0B 3OXRB 2VW6A 5G2NA 5C2UB 2X6VA 1Q0XH 1M3JA 3SB3A 5FCUL 4AT6A 3OJDB 2OQJA 3K2UH 2GTZB 4MRCA 4Z18A 1MW0A 1P5VB 2VC2H 4WI4A 4ZQTA 3MLSH 4KY1H 2ADFH 2PP8A 3QWRA 3RTQA 1AP2B 4WV1C 4JY6A 1DJIA 1UZ6F 3DSNA 3NDYE 2K8QA 3BZEB 5KN5A 3IDYB 4PRIA 4D2NA 5AAMA 3ZKND 4PRIE 4WGWB 4E9LA 4HSAC 5E2VH 4S0HA 2VZ1A 2WWOA 3I50H 5J1SC 1GZQA 5E4EC 5B7EA 4LF3B 5CEZE 4TUOA 1EAOA 2CWRA 4R96A 1BFSA 4G7QB 3DJTA 3MRGB 1MCRA 2J56A 2VLLA 1E5AA 4X8CA 3MNZB 5F8RC 4IJ3C 1JK8B 1DVFC 2VLJD 1UA3A 5I8KH 3FSAA 5JW4M 4XMXA 3WIIL 4HAFA 3ECWA 3ULVL 1KTDA 3OR6A 1A7NH 4Q9CA 4JFUA 2JJTA 1AD0B 2FNWA 3M86A 4HIXH 2CGRL 5T1LD 3IGFA 4L3CB 1V05A 3VQLA 1MFNA 1FH2A 3HE7D 4CU8A 3CLFH 3FOMA 1E9QB 3F7QA 4MJ5A 3PHOA 2VXVH 3QIBB 2HRHA 3H9HB 5LGYA 3O2DL 2BP0B 5F7FA 4Y89A 2XWTB 1NSNL 2B20A 3LDBC 3N41B 3QEHA 4AIZA 1DQLL 3FOLB 4AV0A 1GA2A 1UWXH 3LQAC 3OKDB 4M48H 3EOBA 4CGTA 1MRFH 4WTXA 1U92A 5DRXB 4OGAD 2XPGA 1GGIL 5IHBA 4XPGH 4KRPC 3S37H 3C5JA 1TOXA 3ZTCC 5IQ7L 1SEBA 4IKKA 1D5MA 1NOFA 1T6WA 3B9EA 3Q43A 2A77L 4WU7A 4DF9A 2QGCA 4PLOB 1VESA 4MRBA 2E5EA 5K9JL 2FT7A 4KKPA 3B7YA 4PVLA 4QF1A 1KBVA 3BPLC 3F8UB 3P9LB 5I76A 2JQMA 2VR7A 2W38A 3TT1H 3L1GA 1KLGA 2QELA 3L2MA 5E6IB 2BJMH 2BW5A 4UINL 1A64A 4R4NC 3VRIA 5BVPH 1I9RL 3PDDA 4XBPB 5AVTB 3GRWH 1CI3M 3OZLA 1FL6A 2FAUA 4FNQA 3GSWB 4LHUD 3ARFA 4RGMB 1AGFA 3HPLA 1XCQB 1TR7A 3HHSB 2PW2B 7PCYA 3B6SB 3ABMB 2OYLA 3BKYL 1R0AH 1TG8A 2N7BA 2O5NA 2A5UA 2YQ3A 4JRYD 2D3JA 3U2IA 5JIDA 1JPSH 3FU6A 1M9SA 3CDCA 4M1CC 4MZIA 1JS4A 4OUUA 5JA8B 5EHFA 3JWDH 5IHUL 1IAIM 2GJ6D 4XVSH 1MIMH 3ZDYE 3ZGIA 4LPYA 2N01B 2QTEA 6FABH 4PJEB 1FAKT 3HS0C 3ARGD 2C3VB 2QTVA 3TIEB 4QAMB 2C9XA 2APVA 2BVQA 5IBUB 4JJOA 5DD5H 4GMTL 1I53A 3FTSA 2NNFA 1HCZA 1CUOA 3PNRB 4HXAH 1UHVA 1ZXKA 2R0LH 5F3HA 3GKWL 2PCYA 3HAEH 4YSAA 1ODAA 4HKJB 3QISA 5J57B 2OL3A 2VOTA 3LN5B 3CHPA 5J6GB 4XB7A 3FTGB 4I77L 5IEHA 3PY9A 4YHLH 3UTQB 4AH2A 1W0WB 2ICCA 1HOCA 3DMMC 4FYTA 1F97A 2JE8A 5IMLB 3KMDA 4R4BA 3N1PC 1FH5H 4NQED 4GBXB 4IBVA 5F1NA 2IQ9L 3ZDZF 1OT2A 2H3KA 3QUYB 1JHKH 3CN3A 5DJ0A 3QO0B 4UUJA 5I5MA 1JGVL 2VAAB 3TFKC 1ZT1A 1LK2B 3MRCB 4FADA 3ES6B 4CSZA 3LAFA 3WBDA 4WW2A 4H44C 4YLCA 1U93A 1I85C 3HNSL 2DMCA 4V1DA 4Z76A 5IT2H 1IO4C 3DUUB 4JHAH 2OJEA 4X5QA 3WN5B 4P5MA 5FYJE 3KYKL 1ZXQA 4YR6A 2IAMC 5CWSA 1ZE3H 5C07B 2XTJB 3FQYA 3UAJA 2Y07L 4FD0A 3MXWL 3FCSA 1I8MA 3T8VA 4PY8I 5L2KE 1WT5C 3IU4H 4HFUL 4PJIB 3ZE0E 4BK4A 4HCGA 2HUEA 5AZEH 1BZQK 1ORSB 4P2QA 1HQRA 2XUWA 3A4AA 3BVNB 4Y19A 1MWAA 4FQPA 1GGIH 3GSQA 4XVTL 3B2VH 4GSQA 1JL8A 3WMQA 4LIQL 4NN7C 4LKXA 5DJCA 3LQMA 4LLYA 3UYPB 2Z0BA 1OWRM 3PABA 3CVHA 8PAZA 4TTGA 4PJ9B 5K9JH 1AKPA 2EDNA 2UZPA 3H54A 1LO2H 4WUUB 2ZT9C 2K7PA 2ZUVA 3I9AA 4APQC 1HH6A 3QJSB 4JM4L 3DV4A 4DETA 4P3CH 4JNXA 1RUAL 1S9WB 4LT7A 5BZWA 4L2LA 3US9A 2HJFA 3JUZA 4YHYC 4QRAA 3SBWC 4RDQF 3OMIB 1WLHA 2X4PA 3ETSA 1SNRA 2EECA 3LZNA 4IKJA 4LL4A 2FWOB 1IBFA 2BSEA 3QQ3A 4ZYKB 5T3ZH 3MOBH 5K33A 2X6MA 2VL4A 4JFDD 2VZUA 4IMKA 3KPQB 4N28A 4O2CB 2FQDA 5HY9B 5D1QC 2BY3A 4M9OA 2AXWA 1LQBC 2BVEA 5JW5B 1A7RH 3RPKA 2P5EA 3ULVD 3QIWD 4HJ0C 5HJDA 5IQ9A 3B7RL 5DO2C 3MJWA 2VC2B 2NXYB 4JFYA 2WQXA 4L9LC 4W6XB 4LVOC 3U1SH 1CYXA 3W81A 3WEMA 3NIDE 3H3PL 4DO5A 1FZKB 2PP9A 3C6LB 4N5EC 3QCTL 2WTPA 1U8IB 2GEEA 2CBPA 3KLKA 3ET9F 4O2EA 1D5IL 1B6DA 5DC9B 4KQ3L 5HHPB 3ESVF 1GZPB 1ZT4A 4ZMTA 4F58L 2F08A 2B7DT 3GSVB 3FZUD 1A6PA 1U4FA 4UZGA 3T04D 2P80A 5KOVC 3GTTA 1NC4D 3ARBB 1VZIA 1OB0A 4L1SA 2UVEA 1IJ9A 2D2OA 4J1UA 2R1WB 3REWA 3L95B 5IMMA 5E99H 4Q9QL 1A6TB 3VXMD 1WSST 1O6SA 3G6DL 4UQ2A 2ZOKA 2AJZB 4AMKL 2IQ9H 4E9XA 4Y16A 1FSKB 3SYAA 3P02A 1W6WA 5ANMA 1TU2A 2R2EA 5LAPA 4UTCA 5ANME 1NM4A 4KQ4H 5CXPA 4MJID 3LB6C 3NSFA 4Z7VB 5FHAL 1HTYA 1EAPB 4C55A 1L9SA 5HYQB 2EO9A 3IFOB 2FWSA 3Q1EA 3MVSA 5JO5B 5D1XD 2ADIA 2DKUA 4BFRA 2MQGA 4RGND 2VR4A 3FB6B 5CLZA 5I1JH 2EAEA 2PTUA 3E7JA 3P9MB 2UY7A 4FFYA 2MH4A 3AAZA 2Y22A 4FQXC 5HGAA 5I1EH 1NOLA 4HJSA 2FH6A 2IQAB 1GHFL 3F65A 4HFUH 4HLZH 4PREB 3VFWB 4AG4L 1I4FB 4NCC1 2DIAA 2VXQL 4U1JB 2AEIT 3APFA 3RGVB 1BGXH 1HS6A 1UD8A 2EIDA 2OR9H 1F2QA 3QUHA 1CDJA 1RZFL 3WUWB 4OB5L 4PUBH 3IK2A 2BRRL 1V54B 1XV8A 1MFEH 2GBUA 2Y6SC 3B2XA 4JVUA 4AL8L 1A7OL 2QV2A 3NZ8B 2CLRB 1JD9A 1RERA 4QR7A 4HOXA 4RZCB 2EKSA 2WVVA 4GW4B 5IBLD 5I1LA 3GB7B 5SX4H 3TF4A 2MFNA 3RUGA 4M7JL 1TTGA 3ZYIA 4ZFQA 3U9WA 5CEXB 1UM6L 5IJBC 4D0DB 12E8L 2AFNA 1HX0A 2ATKA 2DTML 1QLEL 1NCIA 3O9WA 3POCA 4E42B 2E75C 2F53D 3SOBL 3IKCB 3KLSA 4GT7A 2AI0H 2FX7H 1E5UI 5TF0A 1KXTB 3GMNA 4Y5VB 5JORA 3RZCB 2QZQA 2ESVA 2ILLA 1IC7H 2WBJB 4NM8L 1L5GA 2ESVE 4RMQA 4XR8C 1M6OA 5INCB 4DFIA 3ARRA 3IDMA 1S5HB 3MFFA 4IBSA 2FYYA 3MA9L 4JQVC 3HA0A 8FABA 4YSSA 3IDGB 4QRSA 5CJOH 4F7MA 1AANA 4WI6A 1GYAA 1SEQL 2WWKO 3ZMRA 3KXFE 5JXAL 5TGBB 5D71L 5KYWA 2FQGA 4OAWA 3HIZA 3OR7A 4FTVD 1CICA 4LDCA 5H2BA 1WC7A 4PWHA 3X2QB 4ZZKA 4N0UE 3VFNA 1DJXA 4NO3B 4KHTL 5CCGE 1MHEB 5BCAA 3UJJH 5DMGC 2QADC 1RIVL 3Q2VA 4KQ3H 5TK4A 3HAEB 4N8CH 4KI5C 4F7TA 1PLCA 1X5GA 2YC1B 1QHOA 3D50A 4F58H 2Y6TE 5EIIB 2EC9T 1E5ZA 2E4FA 3U0PB 2GHZA 2RAMA 4JKPH 1OAQL 4BFKA 4G1EA 2YPKA 5DR5L 2BHFA 2X1QA 3L3HB 4EOWL 1NGXB 4IU3A 4F9PA 4ZUTA 5BO0D 3VXOA 3L3GA 2HJLB 1A3RH 4Q9QH 2JLLA 2B9AA 5D6DA 3V0GA 3WTSA 3Q0HA 1FVDA 2FT8A 1VCBC 2HPOA 4AMKH 2X44D 3RKPA 2PWDA 3LN4B 4NC1E 4AZ8B 2FE0A 3EFDH 4CVXB 3FQWB 1FZOB 5CZRA 2OZ4H 1T5WB 1PCXA 3RVWC 4OQTH 1NICA 4ZO7A 1S7SA 2YKLH 4IRZA 5F0LB 4R97B 2M8XA 1SBBA 2O5YL 2DN7A 1JUFB 3LRMA 4ZOAA 5E1AB 6PCYA 3CMOH 4I48A 1T6BX 3MBXH 1OGTA 1UWXK 5T33L 1TPXC 5IB2A 1T83A 4BELD 3FQXB 2E6JA 1L4IA 4D0BA 1IKNA 3D09A 1L9MA 1UD3A 1BVOA 5C6TH 1ZTXE 1SYVA 4YDLB 3VFPB 3OQ3B 3CPLA 4WO4A 1U21A 2B08A 1P9MA 4KTEL 1OAYL 2QMKA 3T1FB 2E9IA 4NNPL 1SDDA 2HP4A 1BEXA 4L29B 1MFBL 1H0DB 5HI4D 3IB4A 1E2ZA 4YHPB 4FQIL 4XP4H 4OB5H 5EG6C 3JV0A 4YMPA 3MRPB 4AL8H 1UB5A 4P0DA 5C0BA 3GLAA 1CD1A 4L4VD 4XHJC 5JPNC 5DT1H 4BK5A 2Z34A 2ATPB 2YRPA 2XXGA 2ZYSA 4M7JH 4YK4C 5HGHA 2JKRM 3BZ4B 2FGWH 1HXKA 4JHWH 3E0GA 5GJSL 4LNVA 2YGQA 12E8H 3DO7B 4PLKC 3ARQA 1MG3C 1G5AA 3LJ3A 1TZHA 2AERT 1HDMB 3QQ4B 4JKKA 1TTAA 4FXGC 1KCWA 3X14A 4G80B 3VFSA 5H35B 1RP9A 3HC3L 3SDXB 1CTOA 3RDTB 4FABH 4MSWA 3CFJB 1J0HA 2IPKA 3R06A 2XPZA 4Y4FB 3IAPA 3SDAA 2YPVA 3KPRA 4H5SA 4QRPB 3MA9H 4AGOA 2XLLA 3W57A 5EBMA 4F7PB 2R29A 5LGHH 4ADJA 5BQ7A 4GUPA 4QWWC 3MMEA 3NN8B 4HIIB 1U8JB 3NJFA 3V4VL 3QNYA 1O5PA 4PJCF 3VWKB 4QAWA 3HZVA 5AZ2L 2N0KA 4NYLA 2Q76A 4C59B 2CJTA 2EVIA 4GIPD 4KV5E 3D39A 4FZ8H 4YZFE 2JKWA 4MASA 5CJXA 2X4OB 5J11C 5EO9B 1U8KB 4MA3B 1D6EA 2F8IA 2O6CA 4P46C 1QHQA 3SDDB 1TIUA 2AJ3B 4G72B 4TQEL 1JV2B 1TQCC 2XN9E 4M4PA 1QR4A 3HTLX 4LBEA 2VLKD 2OAAA 5E2TL 3GHBL 2N56A 4AV5A 2R15A 2OFQA 2R1YA 1O7SA 4GQPH 4KJYA 3VJ6B 2VERN 5IR1A 2DQFA 4NSKA 3RWGB 4QTIH 5I6NA 4E9RA 3NPSB 3QZBA 1CLVA 2AKRB 4FJZA 4ZUWB 3OHXA 4XN8A 4DKDC 1JYVA 1E7VA 3BZFB 2IH1B 1HHHA 1BECA 1TSHA 1DZ0A 1KDJA 1QSEA 4JRFA 2EYSB 1MFAH 3G5ZB 2V4LA 5FGRA 3VW3L 1VHPA 2X3AA 2XBZA 1J10A 3PV6A 3TWYA 4YOKA 1QLRA 4G6KH 4S1SH 5LUMA 3V9FA 4HCRH 3DVIA 4ZG1A 2HRGA 5D6CA 2RBLA 3DX6B 4TVUA 4JN2B 1F90L 5FS5A 1SOSA 2P8MB 4HC1A 1T1YB 2BSRA 4WWID 3VGAC 4AI7A 4W9EC 5F71A 5HHQB 1QPKA 1BZOA 1QASA 3CXHK 1DSYA 3LRLA 4UZSA 5IHZB 2P7TA 3NCEB 2HYMA 1OGAE 3NFSH 5ICXB 2V17H 4MX7B 3OSVA 1FYTB 2PW1B 1G7PA 2BNUA 4Q9BA 1N5AB 2M26A 3TBWA 4N1EA 2F1EA 5K1NA 1H8OA 5FYJU 4PJXA 3UZQB 2O1AA 4Z77A 3OHMB 1J9RA 2KS0A 2ZSVB 3SO3C 5C7XL 2I32A 4K8RD 1B4LA 1A14H 1OK8A 5I66A 5CILH 4EEEA 1V3JA 4HOZA 1CE1L 2WKGA 4XPBH 2WIIA 3BP6B 1IM9B 4MGXA 2G30A 3L7EB 4LCWD 4TM9A 5KSUA 1ZS2A 2WOYA 5MEOA 1M71B 3L4UA 1DQJB 4ZMVA 5EEXA 2ZD0A 3KCPA 1KPRB 5CEZL 1BVNP 1INEH 4YHKL 1S7TB 3DVNB 5GJSH 1UUSA 5IQOA 1JMZA 3GSUA 2OMZB 4QLRA 1WAAA 4L8BB 4Y4HC 2FLMA 5DQ9B 1M2OA 3PGDA 2V9RA 3W82A 5JUEH 4Y88A 1NKGA 3F5WB 4N24A 4O58H 1KJ2A 4BH8A 3B3BA 3IDIA 4CSSA 5GPRA 2GY7B 3ZZSA 5FECA 1K3ZA 2P5WD 1MFCL 1EZSA 3CDGB 2ZXWB 2CDFB 4FQLL 4R2GB 3T65B 3RHWK 2R4SL 2IMMA 1XH0A 4FI7A 1QO3A 4I18C 1U2YA 4HF5H 3GI8H 4C83A 1PZ5B 4NKMB 2V3FA 4PJAE 2A74C 2UX6A 1ONQB 1OT4A 4R5VA 3VXRB 5AZ2H 4HWUA 1RUML 2HLFD 4TKWA 1LE5A 2B59A 5DUMH 2DMKA 5IJKA 1O6VA 2VQ1B 1W0VA 3V0WH 1VDGA 3ZKSD 3OKNB 1FN4B 2QQKL 4F27A 2EIEA 5FWRA 3IF1B 4X6DA 2VLME 2WTRA 1X4YA 3WXVL 1ZS8B 3DX8B 1X9UA 4X6DE 3L1OL 2NNXA 3NACL 3Q6FA 2GTWA 5HDLA 3UC0L 3ULAB 4ICXA 1DLFH 4YXLH 3AT0A 4X8GA 3TYGL 5HD8C 5JXEC 2A4EA 1DFBL 5JMOC 3GS7A 5EEZA 3KDMA 5D7IE 3CQQA 3WS3B 4CGUB 2DICA 3JUYA 3LRSB 4NP4H 1HU8A 3RY5A 3S4SA 4HUCA 4ZMNA 1U3NA 4PGJA 5KJ7E 1YRKA 1KPVB 3CU7A 1H3PL 3P2BA 5IVXA 3MKKA 1ETZA 4GXUN 2RTTA 4LLMA 3TBSB 3CVBA 4OIBA 4Z9KB 5FLVA 4ANWA 3SCMB 4LASL 4EN2A 1GY2A 4UQBA 2WLLB 3QEGH 3SJVD 2CBTA 4CADA 1TF4A 3OMAB 1OCCB 3WV0A 4GO6B 1ZHLA 1CXHA 3PREA 2EO1A 4NKDB 1JHTA 4ELMF 4EVNA 4N22A 1BM3H 4GSRA 1R34A 4P48A 1ODUA 1RJLB 3V6FA 3QDMD 4EI5B 4O02L 2O5ZL 1FIGL 3BEVB 2YBRA 2FSEB 1MREH 1JRHL 3I6LE 3OKKB 2X4QA 3WXWL 4AGQA 2VQTA 3SZ6A 3CX5J 4RFNC 1UYWL 5DRNA 3UDWA 2X70B 4HD9A 1WFTA 2QMJA 4C4KT 4Y2NA 1DO6A 4JGNA 2DQMA 4HISA 5CD3B 4F8OA 4P9HH 3S88H 3TBYB 3TN0B 1MCHA 5BRZE 1AR2A 1RIHH 3DXAD 1AG6A 4R0LA 1CDBA 2MQ0A 3V7AG 2WMPA 3KBEA 3QZWB 3N2JA 4P8QA 1YEGH 1J0IA 2LQRA 3CE1A 1PFOA 5CEZH 4KK9C 1YMMA 4JREB 2OI9B 1YNTB 4PJ7A 2NCEA 3GJEA 3GMLB 4AGNA 4Z7QE 3QJFA 3UGXA 4R90H 3UTPE 5FKPB 1MHCB 4JL1A 2H2PC 1S78D 2B4CL 1FL3B 2COQA 4I0PB 4AK1A 1Q38A 4PP1C 1TJIH 4AM0Q 2ODHA 4NQCD 2DLFL 2EIMB 3I9GL 1KXVC 1J0JA 1OWWA 3G5VB 3G5XB 1N7MH 5AAMC 3CCHA 1CGUA 4XCFH 4IYKA 2UWEF 2OMUB 1QI5A 2FVNA 4WKZA 3C09C 1PX8A 2HKAA 3VSVA 1DQTA 3PNWA 5HI3C 1NCUA 1II4E 4Y2DA 1QRND 4AE0A 5IQNA 2MCG1 2I24N 1QKZL 1RUMH 2ZSWA 4AKPA 1QACA 4EUPG 4OZFH 5JW3H 1T04B 3FT9A 3IRZA 3RVUC 1IB5A 1B3JA 2PPDA 3C9NB 2CRYA 1FNSL 1ACYL 1G9MH 2JJTC 3WLWC 5JQ6L 2Y5QA 1Q94A 1JZ2A 3L3DA 1A66A 3NACH 3UC0H 4KNUA 5E8PA 2RCSL 2H3NB 3TYGH 4IIQC 2EDXA 1U8OA 3HUJF 4LFHD 1DFBH 3HLKA 3MRRB 5CEYA 1JCVA 4ENED 3FBKA 1IGIL 1ZT7B 3T0ED 3PP3H 3A67L 1DANT 4X4MA 2ZOLB 5C9JA 1DQKA 4X4ME 4IRSB 3Q2NA 3O3BB 2F54D 1M7IB 3FQ4A 1DUYB 2NX5D 4NKIL 1CTNA 5AWNH 2VLRA 3U46B 2CKBH 4HEMA 4NZJA 4G3YL 1LO4L 4HEME 5KSVB 3BIBX 4JPKL 3U6RB 1F02I 1VCAA 2XACC 4S1DC 2FK9A 4Z7UE 4EQ3A 2GJPA 1PAMA 1WDAA 1NGPL 3PDOA 4L2YA 2IOIA 4ELKA 5IFAL 4GO9A 1YPZA 1S7QA 1YNLL 3TH2T 1YPZE 3JVGA 3GC3A 1QSFA 1QYGH 2K45A 2WXKA 2VDKL 4Q58C 5GGTA 1QSFE 4J8QA 2GSIA 1R5VA 4KAQL 1FIGH 2VL5A 4BDVB 4QHLA 2AANA 1EVUA 4X9IA 5C0NC 1WK0A 4FQHA 4W9HC 2BHZA 4UV4L 3K80A 1PLAA 4A67A 1FGNL 3ARFC 4OV5A 1XIWB 2BERA 1R5WB 1ASPA 1XF2A 2VDPL 4X7SH 3DV6B 3L3OA 3Q8FA 5DZPA 5E24E 4AQ1A 2C34A 1D5ZB 4YDNA 1EGJA 1P7KA 1NIFA 3S2AA 2XRAH 3EGSB 2XWCA 4M7LH 3D0VA 2Y7SA 4JAMA 2WP3T 5D7EA 5GSRB 5K5YA 3H7BA 3O6FC 3ABKB 2Q0ZX 4ZAKB 1MFDH 4AXWA 1QFUL 3OL2A 1BX2B 2ZXDA 2AK4D 3PDGA 4WFGD 4I88A 2PYED 2HFGH 3VWJC 3HG5A 5F0JB 2ZUQC 3AS0A 3T6XA 4DGYL 1XZ0A 4B27A 3S9DB 3U2SB 3P3TA 4MA1C 5GS1B 3P4MA 2ENSA 3FKUS 1IAMA 3QQDA 3SHSA 3E2HC 3U4EB 4ODXA 4YBQC 2F15A 1DL7L 1PKOA 1JDAA 4KFZC 1XCTB 4HUXA 4ALAL 1D5BB 4JUSA 3VXSD 2IO5A 2RD0A 3S3DB 5L7XH 1YNKL 1MAJA 4Q6IB 2EP6A 1CXFA 2EE6A 2E7CA 5FYJH 4OIIL 2WQ8A 2GIXA 3WLBA 5AYQA 4ZX6A 3L3IA 3QG7H 3HG1D 4YDJA 3NIFB 4F7EB 5DYOA 4NBYB 2F7IA 2PR9A 2XXFA 4OLVL 4PP2A 3NJHA 3N6YA 2IXQA 4YH6A 1F1DA 2E76C 3CH1B 3MLXL 4LL1A 1YYCA 3TVMB 3VD5A 4YSQA 4HIJA 4ZMZA 1MWAH 5E9AA 1RSYA 4DO4A 4GRWF 5DFTA 2IFGA 4JPQA 1W16A 4YE4L 4F1SA 1CT8B 1S9YA 1PEWA 2BZCA 3CHOA 2B39A 5EOQL 1USQA 3N85L 1PMYA 2ZZUT 5CGYC 5DUJA 2B5IB 5B4MD 5CBAB 3ULUE 2A73B 3VMNA 1CMOA 1NCCH 3F00A 1UKQA 3RKDC 3ASNB 4C56B 3A67H 2NY3B 4QHKJ 3UAJC 5GIRA 2F8XC 4N2DA 2YPLA 2A6JA 4PJBB 1P7QD 3GMMA 1Y7VA 3V0HA 4WFHD 4BSVA 1ID5I 4G70B 4WUKH 3FFOA 4NHUA 5KBKA 1SJMA 3DTUB 4UDTB 4TVPL 4CU6A 2OX5B 3FB8A 3O3AB 4JPKH 4JR9H 4MWFA 2CM6A 3DO4A 3O4LB 5TJWK 3LX9A 1N64L 3TU6A 3RB7A 1MJJB 5D55A 4CRPA 1TVBA 2R69L 5HYSB 5HPMA 4JFZH 4Q8BA 4OW6A 2CR6A 3II1A 3DHJA 5HSFA 3US1A 1YNLH 4EDWH 4G59C 1R4XA 2BVYA 2N7SA 4A37A 4YAQA 4P9ML 2XX0A 3GXDA 3GF8A 5EZJA 5FFOA 4ABUA 1XGTA 2OQJB 1KIQA 3IEAA 1G0XA 3STZB 3X1NA 2EUZA 5BO1L 3WSQL 5ISZE 2QVMA 1I3RA 4UV4H 4LVNB 1PEZA 5GS2H 2Q2LA 1FGNH 1NC2D 2XWJB 3N50A 5EU3B 4XI5D 2VDPH 3RTQB 3LEXB 3S8GB 3LKOB 4M7ZB 4KRMB 5KYYA 4ODHH 2IPUG 4PRIB 4NOFA 2HFFA 4JW3A 5HHNA 1E9OA 3KS0J 4IMKC 4JZJA 4J2QA 2BH0A 1O9ZA 4I85A 4HBCL 3WHXA 1GZQB 3OKEA 1T7WA 4TUOB 4GAYB 4GKZA 1QAWA 4ZX3A 3ZYOA 3K6IA 3PWNA 4YDVA 3NJVA 3N0PB 4XP6L 4NAMA 1NTDA 5T5FA 1RL1A 3IE9A 3ULVF 4KO9A 1EHKB 1VPOL 1KTDB 4ZMOA 5I5IA 2EKJA 5LWYL 3OR6B 5H8DA 3MV8A 1DL7H 2VCOA 2V2XB 4NUQA 3QXDB 4ALAH 5BV7C 3H9YA 3MJ7B 2D7MA 2XT1B 1BHGA 3BHBA 4KH2A 2BP5M 5JXEA 2EDLA 3D8MA 4PLJD 3FSVA 3IDJB 4MJ5B 3PE9A 1TETH 1W72L 2O72A 5I6LA 4G82A 1ZJAA 2J4WL 3BQUA 5AVXB 1NKRA 1CDGA 1Z9SA 3WJJA 4OIIH 2ITDB 1TZGL 3F83A 5FFLA 4OZFB 2W0PA 4YHNA 4ERSL 2PKDA 4AIZB 5GGQL 4PHZA 3VA2C 4BFGA 5GZOD 3SPIA 4FQCH 4ZO9A 1PYWB 4G5AA 1QP1A 1G4RA 1T0NB 1FDLL 1XMWA 1U92B 1YUKB 3MLXH 2XPGB 4X6CF 3LKRA 2WNKA 4JVWA 1MRCH 2E9WA 3C5JB 3HMXL 4YE4H 4DQOH 2Y2YA 5EOQH 4WU7B 3OX8A 4N0CC 3BEWB 3FPYA 3N85H 4MQ7A 3VXUA 1A4JA 4Y2OA 4NWTL 3K7UA 4U6YA 5E5MA 5I76B 3LVEA 3VFUB 4JRXD 4DGWC 4J3OH 1KLGB 3BVVA 4X9FA 5ICZB 4ORZC 1EJFA 3C60D 2CKBB 3BPNC 2PO6C 3VRIB 4ZPVA 3DOIA 3QUZA 4DPAX 1CTMA 1WHPA 3NH7L 3O6LH 4WEBL 4PJFA 3ZTNL 2NSXA 1MHHB 5KTEL 3RJDA 4KX7A 2AZUA 5FDYA 4PMEA 1BF8A 4HWBH 2DZEA 3NA9H 3FFCD 4FLRA 1RPQA 2YSSB 3HKZA 1P53A 3Q13A 4K2UH 3BDYL 5HJ3A 2D31A 1RJYB 1QUPA 3O0LA 4JDTL 3ZDYB 1DJWA 3D30A 1IUZA 3UG5A 1AKJD 3D08A 3VE0A 2AV7B 4CVZA 1XGZA 1SPDA 5F9AC 4RWYL 4M56A 2KI6A 2BVQB 3C8HA 3D05A 4N90E 2G5BB 4AEIL 1H8NA 1DVXA 1HCVA 4UI2A 4F2MA 3RDJA 4F2ME 2NY0C 3HBZA 3ZE1F 4QKXB 2HT2D 1LE9A 4U3HA 3NGBB 5ACZA 1P4UA 2IPTL 1O7VA 4TYUA 5D2NA 1G9NH 4OLUL 3Q7JA 2EEXA 1TJXA 4R8WH 4WFED 5TDOA 3ESMA 4XNBA 3ZL4L 2VH5H 3C5SB 5IEHB 2WZ6A 4DW2H 4M5YL 4AH2B 4U1KA 1LXMA 2E9GA 4NZUH 5GRVK 1AQDB 3L3JA 3RPIB 4NRXB 4HIPA 1WQVT 1PG7X 3LPPA 5L0QC 1VPOH 3EJYD 3GMPA 5DQJA 5CBEB 3LXBA 5MEND 3KPNA 5DJ0B 1CQKA 1QRKA 2YUVA 1Q9KA 1ZT1B 3LHPL 1TJHL 1CF8L 1HWWA 1J1OL 1W0YT 1XSJA 1HHIA 5DI8A 1FFOB 4NBZB 4HUUB 43CAA 4WW2B 4N8VA 1W72H 3WY4A 4Z76B 1WD9A 1BFOA 2Z7ZA 1KB9J 4X7CC 3B9KD 3TA3A 3ZY7A 1OSEA 3GSXA 1P2CB 4P5MB 2EH7H 2FR4B 2PCPA 1J5HA 4XNUH 3LQAL 4YR6B 3BO8B 4FLOA 5F96L 1X7QA 4P23B 2BIHA 1DDHA 4FQQB 1I8MB 3FCSB 5L2KB 4JFEE 3DX0A 2WLYA 3ZE0B 1C8PA 1RZ7H 1ZTXH 4UBDD 2DV6A 1HQRB 1A2YB 2HWZL 2RB8A 1MWAB 3GUFA 3EJZC 1J8SA 2H6PA 2QSTA 3BN9D 3O11B 4BXVA 1HESA 4MJHA 5DJCB 5J12C 3RVVC 4KXCA 3ARED 1PD0A 4LLYB 3WELA 1WCBA 3PABB 5A2AA 5F93C 1BBDH 3SPHA 4WK0B 4OZHF 4BGDA 4F37F 2Z35A 4WHYG 3PP3K 1JV5A 1XH2A 2AEOA 4ZMPA 1L9TA 5B8CA 1HH6B 5FDWB 3ZX1A 3QAQA 1NEPA 2VDOH 1T83C 3H8NA 2A6DA 4PSRA 2ZNWA 1BPVA 1ZPLA 3G04B 4PLNC 2HA1A 2WVUA 4JM2F 4DN3H 1X6LA 3BPCA 3PGCA 3KYNA 2A9NL 3MRBB 3ZTNH 1WUNT 4LRIA 2X88A 2X4PB 1BVLA 4GRLB 1KBWA 1KMGA 2ORBH 1F3JA 3GBEA 4XCCL 4XZUA 3JYCA 5IVOA 2VN3A 3BDYH 2YPVH 2HJKA 4BK5C 3RWCA 5FKAA 1YJDL 4JDTH 2R29H 2CAKA 4GAGL 1YYLL 3SDYH 2ARWA 2WXIA 4ACTA 4AYFA 3GIVA 2NR6A 4P5SA 2YQGA 3PF2A 2AQ2A 5IQ9B 2GQHA 1E3ZA 2Q7AA 5IW1A 2VIRB 4WEMB 3VG9B 4RWYH 1PLBA 3H55A 4I4WB 4U31A 4XMKH 4BZ1A 1TT6A 2AEQH 3NIDB 1FNGA 4TVSa 5GSVB 3U1QA 5CD5D 3OKLB 2VDPB 5LBSL 3R8BB 1K6QL 4KY2A 3QVAA 4MNQD 3K8MA 3G08B 3QA3A 3LEVH 1CL7I 2P5PA 5G4OA 2DW5A 1F3DH 3D85D 5C0CA 5C0CE 4PB0H 3SPVA 3MJ9L 2JJWA 3SDAC 1ZT4B 2YOCA 4WHYH 5IFJB 1PZUB 4WWKD 4HS6A 2OR8A 2DYPD 3N44B 3CFUA 1PSKH 1FZJA 2K4AA 5AG8A 2TSBA 4NN6B 2X87A 5DZ9A 1PLGH 4HIHB 2RQEA 4N5UA 1LWRA 5IMMB 5KVGL 4ODVH 5JLZB 2V2WB 5C2BH 4PGDA 1O6SB 1EEQA 2ZOKB 1SUHA 5DCCA 2EYTA 4Y16B 2LTQB 4LGSB 2UXVA 4GRMA 4QPEA 4UAOB 4XNZC 3WE6B 3RJQB 2ARJB 5CJXC 5ANMB 1OLZA 5HHOD 2R2EB 2QHRL 5IMKA 5K9KA 1KBPA 3OXSA 1CF8H 2DLEA 3X12A 3QNZB 1AD9B 3QG6B 5FUZL 3H9ZA 4XBGA 1UOWA 2O4EA 2JIXD 1RZKC 1T89C 2IANA 2ADIB 1NGZA 2IANE 3H9SE 3LQAH 2B0SL 5KVFE 4PJ9D 3AAZB 4F57L 4JFHE 5DEJA 3VQ2C 5DJAA 3IDNB 2YLHA 4UQCA 1RK1A 2EZ0C 3PHAA 1K3IA 1AAJA 2HWZH 4UT9L 3VVWA 2EDHA 2QGEA 1U33A 1FYHB 1RUKH 5J0BA 4WSKA 4RCAA 3MLTB 5AB2A 3D2UD 3UMNA 1CBVL 4H25A 2JJSA 4RX4D 4OF8A 4V11A 4PJ5A 4WWNA 3QZNA 1QTYT 1IX2A 1NCWH 4PJ5E 4N3UA 1HH9A 1U3ZA 5FYKD 4DP5X 4WCYL 3UTSA 2JK5B 4P2OD 2Q3XA 3LMJL 5IGXH 4G11A 4MS8C 4TXVB 3T2LA 4MAYB 2WUBL 3M8OH 1XWVA 1JNNL 2GJZB 5GRUH 1O7DC 2WBKA 2ATKB 2JQZA 4Z78B 2ZICA 2UX7A 3O9WB 1TCMA 1RAMA 2EVGA 5D2LF 3HS9A 1KYFA 4XAKE 5BZZA 2LAGB 2KDYA 3VXQB 1ET5A 4JFXA 1VKXA 1VGEH 3WJMB 1I1YA 1KJ2H 1CVRA 2XYBA 1FIEA 4X5XA 4CKQA 2ESVB 1IBBA 1J1PH 2NXYD 3QPQC 3BAJA 5JYLA 5FHBL 4XCCH 1M6OB 3SIKA 2BY2A 2AJXL 3MFFB 5DS8B 3HVDA 4JB9H 3OAUL 2P43B 3C6LD 4KPHH 1RH8A 4YHIB 2YIHA 5TE6H 3HG2A 1BBJB 1CN4A 1YJDH 2VMCA 3KWTA 1FRGL 1YYLH 1NL0H 4GAGH 5DWPA 5K39A 4BSJA 5AZUA 4F7MB 3KXFB 3QZLA 1SHWA 4HSCX 3EKCA 2IOOA 2JCCE 4OAWB 1QEXA 3OR7B 1W9XA 4P49A 4WNQB 1CICB 1GY1A 3QRGL 2DYSB 1FL5A 4N0UB 5E5UB 4AUJA 1KB5A 2J1ZA 3QHTC 3QPXH 5BOPA 9CGTA 4FNLL 1X9RA 5JOEA 3TJPA 3MLZH 3APMA 4F7TB 2H0JA 5EIVA 2P8LB 4WY7L 2CDEB 4HKBA 2BIQA 1IE4A 2C9AA 3RTLA 3TESA 4G1EB 3QXVA 1JZIA 1DJYA 2AQSA 1RLWA 1JZHA 2R83A 4N0RA 3TPKA 4BA8A 4KRPD 4IU3B 4WJ5B 4Y4KA 2W59A 3VRJA 3VXOB 3L3GB 2FJHA 1E4WL 1ZV2A 4DEUA 1ZPUA 1OE3A 3KLLA 1YG9A 1CDHA 2VXSH 5IJKC 1A6UH 4AEHL 3HEIB 4PQXA 1ZSDB 1WA0X 4PYHA 2PPFA 1N26A 4MJ6A 3T09A 3PHQA 4L9DA 5E0QA 1PQZA 1JNHB 4M62H 1S7SB 1W72B 2Z8SA 4R4ND 2GC7C 4H20H 4TTDC 1JPGB 2WZPD 5JHLL 5HDQH 2WN2A 1JZEA 5HXMA 4PGBA 4Z3TA 1OGTB 3E6FA 5F8QC 4DP7X 4R5TA 3V9CA 3LXAA 3QEUA 1BIHA 1GC1C 2XQBH 2B0SH 3SPCA 5IB2B 4FKEA 3FXIC 4JJHA 4TF4A 3KLHC 3L4ZA 4OCYL 4AJVA 4YQXL 4MJ4A 3V5DB 2QV4A 3NG5A 4WO4B 3V52H 1BOYA 2IAAC 5LQBH 1G1KA 4G9DA 4HGMA 3BP7A 3P11L 3DWTA 1SUJA 4OD2A 5D7JB 4DK5A 4MXVF 1BQ5A 3N5AA 4KRLB 4WWOA 1U41A 4HSQA 1UB5B 4OH2A 3WJLA 2VDOB 1Z0MA 2WXPA 2Q8BH 1GJWA 4OD3H 2NY4C 3VYPA 5ESQA 1HXMA 4FF9A 1ETJA 5HGHB 2X42A 2WBJD 4WGKA 2GIYA 2N4IA 4PRPD 4PV9B 3WEXB 5HYJA 2IFFH 5HYJE 4CC4C 2WZ5A 3PWPA 1TZHB 4YEEA 5L2JA 2VNCA 3PWPE 4HKXA 2F7QA 2AF2A 4Z7WE 1MCWM 1OQOA 2EXWC 4U3XA 2R9HC 2VO8A 4MSWB 2K9UA 4U1GC 4KROC 3DMMD 4AVJA 3TBTB 5FHBH 2JFCA 1UFGA 2YXVA 4FG4A 3ARDC 4H5SB 3CTTA 4PW9A 4F8TA 1MCNA 5J9PB 3OAUH 5EZLA 3QFDB 1A6VH 4GUPB 1EVTC 2AVGA 5ADPH 3MMEB 1SHMA 3SODB 3SE4C 5B3SB 1CK0L 3R4RA 3PJSB 5K59F 3HZMA 3F58L 1H15A 2DMGA 2B2XL 3FT4A 4E5XA 2H7WA 3CN0A 2SEBA 4LNRB 3FT2B 2YEQA 3IDXL 1D6EB 4QHMB 5FOBA 3RWIA 5JOPE 2XN9B 2NYKA 4KGJA 4Y1AD 3W0WA 3B3IA 3W0WE 3BCFA 3KYAA 4TRPH 3MKGA 2Q8AH 2R1YB 4J6RH 4KJYB 5IBTH 2DRUA 4AK2A 3P4OB 4MDJA 3S34H 1E4WH 4Y2DC 4HMEA 1T1XB 4PWEA 4ODSH 3OHXB 1HHHB 2BDNH 5J1AA 1Y18A 1BQHA 2YGPA 2CBQA 3WFDL 3T3PF 5DRWA 1PJ9A 4PW3A 4JKWA 3PV6B 1EEUA 3SQOL 3TH4T 3EJCA 1O9VA 1QLRB 1VRSA 3MBWB 2QKIA 4UB0L 3IVKB 5F88A 4QNPF 3D3VA 4OCSL 3X13A 3D3VE 1TENA 4D8OA 4KK6C 4WAFA 5DSCA 1UT2A 3WFBL 4K3GA 3WEBA 2UZYB 2XY2A 3VQMA 4Y5XA 1JFHA 3AY4A 4QRTA 3WKYA 2TSAA 4DH2A 2P7TB 2YAMA 3LTVA 5MI0B 1OGAB 5GGTH 5AYTA 3ABLB 3TT3L 5JNYB 2AZAA 4YQXH 1ZK9A 3ECBA 4C4UA 4L4TA 4HZLA 1G7JA 3CN1A 3QH3A 4L4TE 1A4KA 2BNUB 2JB5L 4F80A 1NCGA 5D1QD 4NUMA 3TBWB 4F3FA 4WU5B 3GSOA 4PRDA 1G7HA 2FZ3B 4PS3A 3V6OE 4UQ9A 4Z77B 1L7TL 3DSFH 4D94A 4PIRF 5DS2A 4HJ0D 5F1IA 4LSSH 4CAGA 5DO2D 1YC8A 2WB1A 2WIIB 4X5WA 4ZPTA 4TSAH 5KSUB 1UWFA 2R2HB 2X1PA 3O8XA 1CD8A 3JVGC 1SVCP 5LNEA 4FXKA 3B83A 1YEHH 2XA8H 4HW6A 3KCPB 1SY6A 1ZV5A 3WE1A 4R83A 2BM3A 4G43A 5F9JA 3GSUB 3FT1A 3NYKA 4J23A 2ZXAA 2MKWA 4OCXL 4NQXB 4DP0X 3CFCH 4OZ4A 1WBZB 4Z8FL 1KJ2B 4BH8B 4OJDH 2ITEA 1KPUB 3VWKD 3L3OC 1LP9E 3BYYA 2OLDA 1JDDA 1CQYA 4Z5RB 2ZAHA 4PD4K 2BS8A 1RUQL 3FB5A 5BOZG 2NQCA 3OC8A 1KF9B 1QO3B 2ZAGA 2KYIA 3CZUB 4PJAB 1DP0A 1N6UA 1FBIL 4TQIA 5IB4A 3C08H 2A6IA 3N43B 4RGOH 1VEPA 1BAGA 4K94C 4U6VL 3F58H 3FCTA 3CH8A 2J71A 1LE5B 2B59B 3SN6N 5F0MB 3RX9A 2MHAA 1QUNA 1W0VB 2H9GA 4BFNA 1NWOA 3IDXH 25C8H 4ZFOL 1UZ6E 4UANA 4XCYA 3BLBA 4X6DB 1Q9WA 3MGTA 3JXAA 5ENWA 1SJHA 2BFVH 4OT1L 4U0RC 3KLDA 1JP5A 2GTWB 3Q6FB 3UO8B 3NCWA 4LPXA 3HCVA 3UZVB 4G6MH 3WL9B 1Z9NA 4QGYA 4AENA 4OI9A 4WFFD 5D7IB 2EJ1A 4JVPA 3EGXA 2IGLA 3ULUH 1CPUA 3S4SB 1WWCA 2O30A 3L2LA 1E43A 4YFLF 1IGYA 1ESOA 2Y6SD 4KH9A 4U33A 3CZJA 1ZA3A 1SGKA 4M6NL 3WFDH 4LLMB 1S5IL 3LQZB 3GBML 3OPZL 4IOFC 5DUBA 3ZQ9A 5DD6A 1ZHLB 2BNQA 1FYTD 3QZPA 4QXWA 2BNQE 1AZZC 1JHTB 2PP7A 3VYOA 1E9PA 4OFYD 4R3SA 4GQZA 2W9DH 2J73A 3TO4C 2ZPKH 4OU3A 1OPOA 3HMWL 5FM4A 1THAA 1D2PA 1YY9C 2XWXA 3EYSL 3TT3H 1TVHB 1SLUA 5J4MA 5EN3A 3MV7E 3L4CA 1IVLA 2EDMA 1FLRL 2OK0L 1IKOP 1WHOA 4N26A 4PRNA 1NAML 1NDGA 4ZOCA 2XQ0A 3S35H 3ZL1A 3QNXA 4OZGA 4NBXB 4ISVB 1IC1A 4YHZL 2Z31A 1L7TH 2NUTB 2VJXA 4NWUL 1IFHL 4BQBA 4XWGL 4RQQB 5I82A 3CLEL 2Y3AA 1R19A 3EYOA 4HX1B 5BRZB 1J8HE 2XZCH 2XETA 3BE1H 3RE0A 2EDYA 4RFOH 1O5DT 3MRHA 1JIBA 3D69A 3WD5L 3EDDA 3TBCA 2PXYA 1GSKA 2LAAA 4XP9H 4L4JA 3W9EB 2HT4D 2D0HA 1C5BH 4NPJA 2ICWI 1IV8A 4KI5D 1NBVH 4Z7QB 3P0VH 2E7MA 3GJEB 4B3VA 4R2GD 5C8JA 3MREB 4OCXH 4X42A 4PS8A 5KSAA 2OSLB 3Q1SL 5G5DA 1ADWA 4YSDA 5T3XL 3K6SA 3VXRD 4YXHH 4OFDA 4HOWA 1AHWA 1MLCB 1SXNA 2J88H 4WTWA 1U4EA 2BNRA 5MEQA 1RUQH 1ULVA 2BNRE 4MCZA 3TPUA 1CL7H 1CR9H 3M7OA 1I9IH 4L8SA 5F3BA 5FEBA 2XG4A 1YN7A 2VZVA 1LDPL 3IJEA 3RVWD 1FBIH 2Z7YA 4W9DC 3ZW3A 3WCYA 2VE6A 1AXIB 1I7RB 2ZSWB 4JPSA 1Q0YL 4LKCA 3B2DC 1GKEA 1HJCA 4FAAB 4IBLT 2X3CA 4JPIA 1FQ9C 2KH2B 4L3EA 1JXGA 2AV1A 2IADA 1FA4A 1Q94B 4L3EE 1A1OB 2HX7A 3K72A 4EKJA 4OZIA 5F7LB 5E8PB 3NA4A 4JEGB 4N0FA 3NBNA 4HJIA 5D7KE 1AC0A 3PQYA 4PVBA 1MRDL 5C08A 3BQUC 1PDKB 2FGZA 5C08E 2NYZA 2D9QB 4X5PA 3WJJC 2FBJL 2QVIA 5JIQA 2XG5A 1SXCA 1IM3A 1ZGLA 1R3LB 3KYMB 3T5WA 2WCPA 3ZDZE 3N9GL 1A21A 2YK1L 3BKJL 1IEBA 5I71B 2DQIH 4LSQH 1RKRA 3SBQA 5J6SA 3ELQA 4Z7UB 3GMQB 1H9VA 5EMYA 5F7BA 1PPIA 1N4XL 4PLKD 1I1CA 2G3MA 2G4GA 1WISA 2X1WL 1XF1A 3PDOB 5E1IA 1QNZL 2XN2A 3DARA 1YPZB 5DJYB 2X9XA 1PD6A 3RX5A 1G7MB 1QSFB 3HS8A 4N8VG 1UWEH 3OKOA 4KU1A 1JI1A 2GSIB 2VL5B 5FW6A 3TN0D 2GI0A 5KWYC 4U1HA 4ZNEA 4U6XA 2J1WA 4IGBB 1XH3B 2IBGA 1NMCC 4H0LC 4IRJC 4TUKH 4XP5H 5DQDH 5F7HA 1U58B 1UT9A 1WV7T 3BP5A 3EYUH 2BX5A 3QFJD 4X6EA 1TTUA 4QWWD 5ESVB 5EC2A 4XN7A 3BT0A 4GMSL 5J1TC 1EV2E 2IBZY 3N0AA 4NO2A 4ZQKB 4XNQB 3ILQD 4EZKA 5EOTA 2Y7NA 5TH2A 4AQ1B 2W95A 4EO5A 5DTFA 2Y06L 1P7KB 3CFBA 5D7SL 1OSZB 3WD5H 3CHQA 3A6BH 1SDAB 2YMTA 4JAMB 4IOIB 5E9DA 4AXWB 3DO3A 1SJEA 1R24A 5E9DE 2X89D 1YEIL 3FPXA 4N1CA 4NQSA 1CVSC 4J28A 5C97A 4LLWA 3ZTJH 4F8PA 5MHSD 3QORA 3FTWA 4AJYV 3FO9B 3P4MB 3FQTA 3Q1SH 3QQDB 1JWMA 1U8QA 4KK5C 5C0AD 1BJ1H 1TXKA 1RIUH 2VUKA 1X5MA 3QRLA 4K3JL 2EIJB 4JRLA 5D72H 3CSTA 3L4XA 3LPFA 4JRWA 1E5CA 1J87A 3QJZA 2ZXGA 1RZ8B 1XGRA 3T8XA 5CJQL 1XSIA 1BDYA 5D2NC 4G7RB 2LOEA 4L1BA 2Z4QB 3UTTD 5L9DH 1FO0A 3W5NA 3DPBA 1EBPA 1H6FA 2HH0L 4HJJL 2PCFA 2A6KA 3EHBB 2JKLA 2PABA 4LHUG 3L3IB 2HKHL 4YDJB 2VQUA 4Z3HA 4I3RH 3DTXA 4HPHA 1G87A 4QRUA 4XP1L 4OLXH 4KHXH 4HIJB 4O2FA 3B1UA 1XGPB 4LCCA 4CN6A 1S9YB 3BUPA 3LD8B 4N86A 2ZCKL 5IK3A 1OF0A 4D9QD 3AMKA 4QJ4B 4YLQT 2Z8RA 4A63A 1C1EL 1OF2B 1K2DA 2FBJH 4G6AD 3JYBA 3QUMA 2ZJSH 2WYZA 1S7UA 1YEJL 4Y9GA 5J13C 4Z0BL 1YYML 3HE7C 4IKLA 1I3VA 1NMAL 1AI1H 2O5XL 2YK1H 4NOBA 2L8AA 1BLNA 2WXLA 5D1ZA 3MO1A 3FB8B 2FEJA 4MWFB 2YRZA 2CHNA 4UTBL 1RZJC 2YD0A 1Q9LA 3L9EA 1N4XH 1TVBB 2IDUA 5HPMB 1GOFA 1N3NA 4Y4HD 3VD4A 3P73A 2BP3A 1XIWD 2Y1YA 5B8CC 3HZYA 4XNXL 2FJGA 4KKLD 4WI7A 2ERJC 4KVCL 3NJMA 2JMRA 1I7ZA 1KIQB 3S97C 5ISZB 5T3XD 2H32H 2WM0A 1KBGH 1KNOB 3ESUF 4JX0A 5DYFA 4HDIB 4IBYA 4LRIC 1QTPA 3WFEH 1UT1A 3SE8L 4BXSV 1PU0A 3CBRA 4QJ5B 5KYYB 4JHZA 1AOHA 5BZDA 2HFFB 1GS6X 2PN5A 5HHNB 4JZJB 3VDBA 1B2YA 1FHNA 2X4NA 4TNFA 4YPGA 1DBJL 3OKEB 2X38A 4X0KB 2EXYC 5L88H 2NR6C 3CGTA 2NXZB 3HR5A 4L8DA 4JO4H 3CHRA 4QJ3B 3KPTA 1EXUA 5HD8D 4I9WE 4HT1L 3KYOB 2ZOWA 2G3NA 3VXNB 4P4KA 5JXED 2XKNA 4LLAA 5FO9A 4JO3H 4ORGA 2Z8WC 4NP9A 1MN4A 1IIKA 4J4PA 3HE6A 2P45B 4S2SA 3N55A 4NCC2 3A23A 3EO1A 5AW0B 4FKHA 1WBYA 4JFFA 1IT9H 5JDJA 4K3JH 5D96C 3IYLW 2CA3A 2XVBA 1T66C 3HJ0A 1DBAL 4K7FA 4LSUL 3SE3A 2CO6A 2VERA 5I1DB 3O3EA 2YFOA 1ICTA 3GZKA 4J2XA 1J0YA 5JIKA 2BP8A 5BS0A 1PD1A