1GS6X

Crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGASGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X02
1WA2X 3CVCA 3CZUB 2JXMA 3OM3B 5F7BA 2VMJA 3DIVA 3CG8A 2WSDA 3X1FA 1CYWA 1E30A 4KNTA 1CUOA 3H4FA 1GY1A 3FS9A 2QDWA 1JZHA 4RH4A 3GYRA 1OCZB 2XYBA 2YAPA 1MZZA 1GSKA 1KDJA 1PLAA 4E9VA 1NDTA 2R7EB 3SBRA 1JOIA 5I6OA 3PLYA 3U25A 2RACA 3FSZA 2GI0A 4FA7B 3T6VA 1CC3A 1AG0A 1KV7A 2FNWA 3IEAA 1XMEB 2HRHA 2VN3A 1B3IA 1PLBA 1WA0X 2LLNA 4HAKA 1HFUA 1W8EA 2BP8B 4AI7A 1ZDSA 4G7QB 3H4HA 5B7EA 1PZCA 1A4BA 1GS8A 1NINA 1WAEA 4KO5A 5AFAA 2AZUA 2DWSA 2J5WA 4P5SA 4BDVB 1IBYA 4YSCA 4EF3A 2UXFA 2VW6A 5IY5B 2DV6A 1ET7A 1L9PA 1AAJA 1KDIA 1NPNA 3ABLB 4Q89A 1IKOP 1V55B 1SFHA 4A2FA 3UADA 4BXVA 1PZBA 1L9SA 2B08A 2W88A 3CVDA 3NJKA 1OF0A 5I26A 3G5WA 1NIAA 1E5ZA 1BAWA 2XXGA 1OE1A 1JZIA 2YARA 1J5DA 1GYCA 3N55A 4UAHA 1RKRA 2GC7C 2YXVA 1W6WA 3SBQA 1GS7A 3FSAA 4DP6X 3PCYA 1HAUA 2BP0B 4YSAA 1F56A 2IDSA 3FU8A 1ET5A 1QNIA 1PF3A 2I7SA 3GDCA 3OMIB 2IH8A 4GY4A 4A2EA 4AKPA 2BW4A 2CUAA 6PCYA 4G7RB 4GP8B 1W6LA 4M3HA 5F7AA 5B1JA 1TU2A 4L0PB 3UAEA 3QPKA 3WNIA 1OV8A 3NJGA 2BW5A 4G72B 3UGEA 5I28A 5I6NA 4NAJA 2P80A 3X1NA 2IAAC 1OE3A 3NT0A 1J5CA 1MDAA 2PP7A 2ZOOA 5PCYA 1OCCB 2VW4A 3PAVA 1ID2A 2YAFA 1ZPUA 3OQRA 1CYXA 4ZK8A 2XU9A 1UATA 6PAZA 1BYOA 2B3IA 2HLEB 1PNCA 1VLXA 2DYSB 3PPSA 3FU9A 4GXFA 2XVBA 2IWFA 2FWLB 2P80D 2MTAA 2YAOA 4YL4A 3D12B 1SDDB 4QKTA 2A3TA 4F2EA 4NB7A 2IWEA 2OJ1A 1E5YA 3HEIB 1IBZA 4M4RB 4N4YB 2HXAA 4YSTA 1AACA 2BWIA 1E65A 3NJLA 2AZAA 2CALA 2DY2A 1JERA 3QJUB 5E9NA 3GXUB 1QLEB 4HZ1A 4DP2X 1FWXA 2TSBA 5PAZA 1TEGA 4BWUA 3KW8A 2PP9A 2PP8A 4YSRA 5EHFA 1XB3A 3AG1B 3AG4B 4TXVB 9PCYA 4DPCX 1JZJA 4BWWA 4A2DA 1SF5A 1WS7A 3WNJA 2J55A 1NIBA 1IC0A 4KOCA 1N68A 3T71A 2VM3A 1KGYE 2FQFA 2VSKB 4KOBA 4DPBX 4PAZA 1BYPA 4HCIA 5I6LA 3IN0A 3EH5B 3BVDB 1PZAA 1A3ZA 4HCGA 4E9XA 2H3XC 3JT2A 1KBVA 1GS6X 1A4AA 2IDUA 2QPEB 3OD3A 2QPDB 1PMYA 1OCOB 2UXVA 4GP4B 1AZCA 3DKHA 3MX0B 1BXAA 3FQYA 3FT0A 3X1GA 4QLWA 1WA1X 4UF7C 4DP0X 2JFCA 1ADWA 3ZX1A 1J9TA 3FPXA 1JVLA 3QJQB 3X1BA 3N2JA 3T6XA 1JVOA 3TBBA 4F7KA 1BQRA 1L9OA 3OMAB 4K9JA 2VW7A 4A67A 3NJHA 3PAUA 1PCSA 2MRYA 3KW7A 1N70A 2DYRB 2J57A 1ET8A 2HX9A 3FPYA 5D4HA 2FQEA 5D4IA 2EINB 1L9RA 2HX8A 1M9WA 1T5KA 7PCYA 3NP3A 4KO9A 2BHFA 1FA4A 1V10A 4YVUA 2PPEA 3V9EA 2PCFA 1ZIBA 2FT8A 3V9CA 3QJRB 2UXGA 2IH9A 1PNDA 3WIAA 3EH3B 3AW5A 4AKOA 2YAQA 4CSPA 4GYBA 1GR7A 2YQBA 2IWKA 1AZUA 2I85A 1EHKB 5I5JA 5B3SB 2FT6A 3AG3B 1BXVA 3S3DB 2IDFA 1SFDA 3ERXA 4N8UA 2GC4C 2XV0A 4DP4X 4DP7X 3T6WA 4YSEA 3NJJA 4KNUA 4ENZA 4YSDA 2HZHA 3TBCA 4YSQA 5B1AB 2X88A 3RYMA 4BDVA 1SHWA 1SJMA 3WKPA 1HAWA 2VM4A 2H5UA 3NJMA 1MG3C 4F2FA 3T6ZA 3TU6A 5B7MA 3T9WA 2TSAA 1X9RA 3DTUB 3L45A 3MBWB 2FTAA 3CDZA 3QQXA 3FU7B 5B1JC 5TK4A 4FAAB 3OMNB 1OCRB 1AIZA 2EIMB 3QJTB 5AZUA 4AX3A 1JXFA 5B1KA 3WI9A 2YAEA 1FFTB 3IN2A 3AY2A 1J9SA 3WG7B 4A68A 2IDQA 2YAHA 1KBWA 1NWPA 5FC9A 7PAZA 4E9QA 1MZYA 2GSMB 2NRDA 4BWTA 4YVNA 3EF4A 1JZGA 2FJSA 1RZPA 1NWOA 3FYEB 2E86A 2XLLA 1AR1B 3S8FB 3CVBA 2GHZA 2BP0A 1PLCA 1NIEA 2CAKA 3IE9A 4CSZA 5B1BB 2QT6A 3FU7A 2EIKB 4KO7A 4DP8X 3ZDWA 5AKRA 2HRGA 2XXFA 3EHBB 3AG2B 2BP8A 4DP9X 2YXWA 1JXDA 4YSPA 3SQRA 2FQDA 2CJ3A 3UAAA 1M56B 2HX7A 1AQ8A 2GB2A 3S3CB 4DP5X 1BQKA 3PAZA 4KNSA 1ETJA 4HIPA 1X9UA 1TEFA 5I6PA 4KO6A 1AZNA 1JZEA 2XX1A 1NZRA 3NJNA 1I53A 2PCYA 3QJSB 2JKWA 3H56A 4BK5C 4HHWA 2PPAA 4YSOA 1DYZA 2R7EA 5I6KA 1ZIAA 4HHGA 1CURA 1NPJA 5LDUA 4WTQA 2PPCA 2IDTA 4NERA 3S3BB 1SDDA 3X2QB 1L9TA 1SHXA 2AANA 2ZWNA 1EZLA 4HCFA 1BQ5A 4JHVA 4E9WA 1QHQA 3NJFA 2PPDA 1V54B 2Y69B 5I5MA 1OE2A 2GBAA 5I6MA 1XB8A 2I7OA 4G70B 4DP1X 3TASA 5A7EA 2PPFA 2X87A 1OOWA 3ABKB 1YLBB 1L9QA 4E9TA 4A66A 3SBPA 1AOZA 3FYIB 1KCWA 4G71B 4AKQA 3NJIA 3UACA 4BXSV 1BEXA 1M57B 4G7SB 1KYAA 2H47C 3WKQA 2BZ7A 2WO3B 2XV2A 2J56A 3NSDA 2XX0A 3NSFA 4E9YA 4A2GA 3FSWA 8PAZA 1PY0A 3ZBMA 1NICA 1RCYA 5D4JA 1TKWA 4P5RA 1ZV2A 3C75A 3ABGA 4WKXA 1SNRA 5I5IA 4YSSA 1SF3A 1XB6A 4W1TA 2ZONA 2VSMB 1ASOA 1AANA 4GP5B 4E9RA 1A8ZA 2CBPA 2DWTA 4E9SA 4X4KA 2WO2B 2AFNA 1WS8A 2XV3A 3JTBA 2GIMA 2XUWA 2YAMA 1GW0A 5TK2A 1NIDA 4AZUA 1BXUA 1E67A 2OCCB 1AS7A 3HB3B 4W9ZA 1NTDA 1RZQA 1AZBA 3CDZB 2BO0A 3EH4B 3UABA 2AVFA 2Q5BA 4A2HA 3NSYA 1AS8A 3NSCA 1J9RA 3S8GB 1NIFA 4YSUA 2EILB 4MFHA 5ANHA 1MG2C 2N0MA 3ASNB 1JZFA 3QJVB 3AZUA 3FSVA 1DZ0A 2QDVA 2XWZA 3ZIYA 1R1CA 4Q8BA 4JHUA 1AG6A 2BZCA 3NP4A 3FQ2A 1ZDQA 2ZXWB 4UANA 3ABMB 5B7FA 2Y1AA 2UX7A 1AZRA 4JKNA 2OV0A 2BWDA 2PLTA 2EIJB 2FQGA 3ASOB 4PCYA 3TA4D 2CCWA 1KCBA 1ASPA 4HALA 4DPAX 2UX6A 2W8CA 2Q9OA 1PAZA 1JXGA 1URIA 1A65A 1IUZA 1ILSA 2FT7A 3FQ1A 1ILUA 1J9QA 1AS6A 3IBOA 3NYKA 3X1EA 3BQVA 3PXLA 2UXTA 1GY2A 1ASQA 1A4CA
chains in the Genus database with same CATH superfamily
5IKCB 4I2XA 5GZOD 5IJBC 2G3ZA 2X0WA 4FFYL 3F62A 2CGRL 5D9SA 5C0DA 3U30C 5IVXB 2XA3A 2Y25A 3DMMC 4HKBB 4P5TA 2EICA 2CO3A 1DCEA 3EAKA 1PZ5A 1MFAL 4GO9A 3ZHNA 3SDAC 5JHLL 5KAQF 2XICA 2ZUYA 2Z1PA 1T0MB 1RVFH 3VXRB 6FABH 1BBJB 2F61A 1J0JA 4Q97A 3KMDA 3BLBA 4JDTL 1L9MA 3SGEI 1WEJH 1MJUH 5D96C 4KY1H 3US1A 3FUHA 5K9KB 5IHZB 4MS6A 2EKJA 3KPOA 3W9DB 3L4YA 5KG9A 3ARXA 2VN6A 4ONOA 5CO1A 3F12A 3G6AB 2CHDA 4W4OC 1BIIA 4Z3FA 1Z9NA 2F53E 3UTTB 3Q2CA 4LVHB 1EDQA 4DTGH 5BVJA 3K2KA 4YSCA 3O2VH 4FFTA 2DV6A 5GGUB 2HKFL 4AQ1B 1NPNA 3SO5A 2P24B 3QQ4A 4PP1C 2BHYA 4X8JB 4I9WD 4JPKH 4PJIF 3FDWA 4W9HC 1P4LB 1NL0L 5E2TH 2F5AH 4C58B 1GGCH 4N24A 4G9FB 1OGAB 3N43F 2HLFC 5CAYB 5K9OB 4NO0B 2EH8L 4BZ1H 1QFPA 3NGBB 1LEGA 2K4AA 4Y1AA 3DIDA 1HEHC 8CGTA 2X9WA 4TNWF 4DKDC 4PJIB 2VO8A 1XGPA 1HSAA 2OYLA 5IBLC 3QJFA 2A9ML 2YFOA 1I1AD 4EN2A 1CO1A 3C8KB 4AYDC 3I6GA 3ZIMA 5JW5B 1IGIL 1QBAA 4NO3A 1DDHB 4WNQB 2XWJA 5F71A 1IMHC 1KGIA 4GW5B 4M93C 1GZPA 5TF1H 4LMQE 1DBKH 5C07D 3FU0A 1BJ8A 4G3YH 2EQDA 2O61A 1WAPA 3BFQG 5I1LB 3L3KB 1FPTL 3B6SB 5FB8A 2GUOB 1U93B 1X3DA 5K39A 3P1VA 3UIYA 5EEVA 2JJTC 5EZPA 1QI3A 2A6IA 1J0YA 3ZZQA 3QWOA 1J8SA 3X17A 1HKFA 1KLUB 5GRUL 1J0HA 3DX3A 1TMQA 2DD8H 4JPWL 4PGDA 4NYLA 5JQ6L 4L3ED 3NCWA 3MV8D 1UATA 3Q3GB 2HLEB 4XO8A 2Q6WA 1K5NA 1LTXA 1OAZL 4PRAB 4UV7L 4C59B 3M07A 2E9WA 3HG0A 3P3YA 4WFGD 3NPSC 1A9BB 1JF5A 5IV2B 4KKBC 2XWCA 4BQCA 2IANA 4CILA 4H25A 4KZ0A 1F6LL 4QJ3B 4XP1H 4KVNH 3P73B 5AW8B 2NYKA 3B9DA 1F1GA 4PY8I 4M00A 2YD1A 3MNVB 4L8SB 2NY5L 1NGPL 4PB9L 5EUKA 3RX5A 5KJRL 4PJAB 3BKJH 3TNMA 1CFSA 2OTPA 4ABVA 5L8JB 4XP1L 4OT1L 2X40A 2DIJA 5KVGE 4BWUA 1NGZA 4K3GA 2PP9A 4RQQB 5LGJB 3PHOA 3FT2B 1FNHA 1UA6H 4I5BB 4R3SA 4K5OA 2WQWA 4OLVL 5ESVB 4UWQB 1VRSA 1A6TB 4MCMA 1JPGB 4LPVA 1RJYA 4FQJL 4NUGL 2V37A 3IF1B 2J20A 3KPPB 2CJSA 4WTWA 1NEZA 1OWWA 1R33A 5JQHC 1QPPA 3V4UL 3MV9A 5I15L 4GAGL 1J8HA 1H3WM 2ZUUA 2X4QA 3J27A 5K9JH 4K94L 1QTPA 4BCYA 4HS3B 5IK3B 4CDHA 4ONHB 1PY9A 5GIRB 1KTJA 4KVNL 4OF0A 4MCNA 4WJ5B 2CO6B 1T5WB 4UTBH 1RFDL 4UOW1 1EJOL 3KPQA 4MLIA 5C92A 1HH6B 4FGMA 3MLSL 3MRBB 3J07A 3D4ZA 2DDQH 4ZDHA 3MXWH 3VTTA 1EQWA 3LVEA 5L6YH 1DSFL 3C2AL 5JHDE 7TAAA 2R2CA 2EKSA 1S3RA 2C1PA 1HILA 1YQ2A 1I1YB 5MERB 1TO4A 3GSOA 4JKMA 4Y9BA 1AVAA 1EANA 3QO1A 2ICWJ 3RG1C 4H4NA 1UXWB 3L1OL 3RY6A 3PFUA 3PDDA 4A37A 3LQAH 4KO9A 1DDTA 1UJTA 4MD5A 5FDWA 4IJTA 4TSCH 2WJ7A 2PPEA 1X6NA 4RGND 4OZGB 1UXSA 3NACL 3U79A 3WEXB 3PXJA 1ZIBA 5IB5B 2HLAA 2IG2L 1GGYA 2IH9A 3OKNB 3A4DA 4OUUA 1EXHA 3O6MH 2D31B 3UJTH 1R9FA 2ZZUT 4HX1B 1JNLL 1TOXA 4BK5A 1W0WA 1XF4B 2ENQA 4WHCA 1Z32X 5IT2H 1CFNB 2OZ4H 1SFDA 3JWOH 4PLOB 2Y6TE 1I7TB 2CPCA 3ARYA 4DEPC 1SLWA 1YQVH 1HESA 5T1LA 3PHOB 2X9XA 2OTUB 4DTGL 3IDJA 3AGVA 1A6UH 5ESVA 3CC5B 2HT3C 4EBQL 3WU1A 3QWQB 1MG3C 3UTTD 1NEZB 1MCEA 2APSA 1SVBA 3HI1A 2CLVA 4QO1B 1HHHA 3T6ZA 4PG2C 1F58H 3WFCH 2A6JA 2WNWA 3CIQA 1N26A 1WFJA 3VNYA 1X4YA 4GKSB 4JRXD 1Q9KA 2C9XA 1MFDH 4KUZH 4C57C 2VDNH 1FCCA 1LEGB 4Y1AB 3L3OA 1IC7L 1L0YA 3QHZH 3TZVC 4UILL 5DK0B 4FZ8H 1NWOA 3UXFA 1N5AA 4PRHB 1RD6A 4M4RA 4TRPH 3U2SA 4ODWB 4AIZB 4P06A 2YXMA 3VAEA 3IE9A 1X5IA 2KYIA 1WZ1H 1CDHA 2AQNA 5DD5L 5TE4H 3UO1H 4OI9A 4C56D 5JR1H 5DRWB 3EJTA 4QRPE 2XWDA 3B6SA 3JYBA 1WEJL 5C9JB 1J88A 2BP8A 4L0ZA 5ESAA 1UC6A 3W0WE 2BIOA 4GRLC 2X6CA 2QTVA 4YXLL 9CGTA 3SGDI 3EBHA 1KLUA 3G6JA 1TVBA 4KDWA 2WZPD 1WZ1L 5DD5H 3FQ4A 3EO9L 3O9WA 3KLAA 2M26A 3QDHA 3KH3A 2XRAH 5DJAA 2BZDA 3ECBA 2WVVA 1MPAL 2G4GA 2DRUA 4P2AA 4Z7VF 1DBJH 2PCYA 1ZK5A 5IB4A 1W8NA 1UURA 2EYRB 4JN1H 4LHUA 2XBTA 2PPAA 5A1AA 2OBGA 1GCFA 4PFEA 1A6AA 2PW2A 2O6CA 1NCTA 3KPNA 4KI5F 4KBPA 4MNQE 4PJDF 1EAQA 4C4KO 4I18A 1KT2A 2JJSA 1R6VA 2CHZA 1HEJC 2I07A 3VFTB 1I1RA 3RVXC 1IL1A 1I7ZA 3CU7A 2ZKWA 2R0ZL 1MVUA 5D5ME 1GYUA 3FTGB 4EAEA 1BZOA 5F70A 2X4PA 4CU6A 1NFAA 5GRJH 4LNRB 2OL3L 1E40A 1ZT1B 4S0SD 2C34A 1EMTL 3D33A 1ZAGA 4JKPH 1T4KB 2D0HA 4KHXL 2ICWI 5EOCJ 4YHML 3M8OL 5EBMA 4TL4A 5DJZB 3C6SB 4TLTA 2F9BT 1LMKA 1IGMH 4E9TA 1DVUA 3MRHB 3ZO9A 4A66A 4GMTL 3TZVA 4Z3TA 3QG6A 1OP3K 3HE7B 1HXYA 3GBDA 4EN3C 1H8LA 4ZFOB 5J1AA 3TJEH 3V4VB 1F6AB 3BPLB 2NY2B 2YSTA 5FGRA 3QFDB 3GF8A 4MTMA 5D1ZC 2UWEB 4NBZB 1OCWL 4IBYA 5L7XH 3D3VD 3FK3A 3FO2A 5ESAB 1E3ZA 3WY4A 2VXQL 5DCCA 2X28A 3VXNB 1GJWA 4OGYH 3QIUB 5DD6A 4W93A 4X5XB 5D70H 4B9GA 3VSUA 1II4E 4LSVH 2CGZA 4M7ZC 3VXTB 4RMUA 3P11H 2W92A 2QADB 4PBWD 3O3AA 4PJEB 1ORQA 2QQNL 1K8IB 1TDQA 3JTBA 1CDCA 2W60A 1WDAA 4K5NA 1F02I 3QORA 1E67A 3ARWA 4ZOBA 3ZMNA 4CKQA 3UP6A 3HNVH 2AVFA 2PW2B 3VDBA 2CKBA 2JQMA 4XMVA 4YXHL 1JG9A 1G7LB 1JCVA 4UQCA 3WEXA 3PWPD 1JZFA 3FU5A 1Y1DA 3SB3A 1VFBA 3QDGD 2QSTA 4RESB 4DIXA 4D8PB 1MVUB 4O5LL 3SJVA 3IJSA 3UIZA 5HHOD 4N0RA 2NZ1A 4K7FB 4PJ8C 5AVVB 1CE1L 4TL5A 4MWFB 1Q9WA 2UZYB 1E5CA 3PWPA 1FORL 5I1KH 4OJEH 5D1QD 1TF4A 3D52A 1MWAH 3QPXL 5I8CA 3TBTA 3ZW3A 3RFZB 5K9QI 2LABA 4KV5F 4FQJH 5C7XH 4HPYH 2J71A 4MDJA 3U7YL 4JFEE 1ASPA 4H0IA 5C0CB 2H6PA 5EZIL 1E43A 3K6OA 4EXPX 1PAZA 1JXGA 2HKAA 4OB5L 3TVMC 2XIIA 3MUHL 3FCBA 1T7XA 4XN7A 5HYJB 1QHPA 3BKYH 4JKLA 4L37B 1GY2A 3JWNE 3ARBC 3FO9A 2ZWKA 4HOZA 2P5EA 4FERA 2UUDK 2CDEA 5CJOL 5JDSB 3V7AE 3L5JA 2COQA 4QTHA 4ZXBC 4PJFA 3CG8A 1E30A 3U0TA 1GHFH 1DJZA 2CUIA 2E9GA 4G1MB 1JZHA 4RH4A 5C07E 1UASA 1BVKA 1NQBA 4ODSL 5D93C 1KC5L 1RSFA 3P0VL 5LN4A 2XYBA 3FC8A 3GO1H 3QWRD 1KDJA 4U0RC 4X6CE 3BQUD 4JQIH 3BT2H 3FUJA 1JL8A 3WY1A 2QL1A 3CQFA 3GXIA 3GJEB 2X89A 4PJEA 1BZQK 2B1HH 2VT0A 5HGBA 3T6VA 5F9JA 2CRMA 4F1ZA 1AG0A 4N5UA 4YH6A 3CSBA 1ZOXA 1KPRB 3R7QA 2VN3A 3OAYK 3OKLB 3VU2A 3NGBC 5BV7B 4RMQA 3CFJB 2O5XH 5SWZD 5DS8A 1ZT4A 4X42A 3I9GL 3HAEB 4F7MA 3T1WA 4LCWB 2NNAA 5E6ID 5FM5O 4GI9A 5DJDA 1D3CA 5CGMA 4XX1E 4X4YA 3D08A 3SJVB 3I2CH 5LNEA 3RNQB 3L3JB 3W11C 1KBGL 2XN1A 3FFDA 3WO4C 4NX0A 5AUMA 4AJYV 4PJXF 1XCTA 4V1DA 3IJEB 3WOVA 2CIIB 4NRZB 4A2MA 2ADFH 2EXYC 3AAZB 3OZLA 4Q89A 2WB1A 3HS0A 3VXOA 4XP5L 5CBEA 4N87A 2ADGB 3UADA 1DR9A 3UFIA 1G7HA 1FFNA 4N22A 5B39A 3I75A 2OA9A 4I1PA 3S4SB 2R29H 4JFYA 4BFNA 4WO4C 5KVEL 3GBNL 5SX5K 1KT2B 3L16A 4WIQA 5I16B 2JH2A 4GSDH 4NP4L 2W94A 4JG0H 3KEDA 4YC2B 1G9MC 1WFTA 4DH2A 5LWYL 1Q38A 4ZS7H 1RKRA 4NFDA 1RUAL 2C4FT 1IKFH 2OL3B 3D3VA 1CD9B 3ARBA 5IW1A 2CBTA 3WTWA 2Y0SA 5DUJA 4BFOA 4DGVH 4I77L 1OSYA 5JDSA 5IBTL 5AVTB 2IAMD 2VO5A 4P9HH 4BGDA 3MUGB 4K7PL 4HEPG 4E0RA 3JWDH 2R9HC 1FUNA 3NPSB 2DWXA 3UTQA 3CZFA 5F7YC 2RBLA 1KG0B 4JO2H 3QA3B 3PPEA 1KTRL 1YN6A 1QZ1A 5T5FH 1WIOA 4AWJC 5CGYC 4GRWE 5G4MA 4ANVA 3QRGL 5KSAC 1QR1B 4AKPA 4JY5H 2FJUB 2OCFD 3DMMA 5F7AA 5J12C 3HG2A 1T6BX 1KFAL 3O41A 3QZWB 4L0PB 3WNIA 2IGLA 3D69B 4KQ0A 3N1MC 5I28A 5I0XA 1XXFC 2WXQA 4L9DA 5MP6L 4KNQA 4HF5H 4LPTA 5KTEH 3TEXA 4BCZA 1JD7A 1YY9D 1GTNA 4D0BA 3KWVA 1YPZA 2VNCA 4ZSOA 3D18A 4LHQB 5JW5A 5DJ8A 1ID2A 4AT6B 3T5WA 2XU9A 1GZPB 1XF2A 3JTTB 3UCRA 3GUFA 3ZL1A 3KE0A 4GXFA 3GGWA 5ITFA 3K46A 2X6UA 5JHLH 5LHDA 5LGYA 4CA4A 5CJ5A 5FB8B 4U3HA 2P28B 4KJWD 1DBML 4MCZB 4LPUA 3O11B 3WUWG 3KDMA 2ATKA 5IVZA 3HEIB 4RAUB 3MV7D 3KEHA 3QWOB 3IWUA 2DM2A 1UZGA 1JF6A 4UM9B 2F1BA 5BRZD 3HNVL 3KPSD 1XGRA 4PRDB 3GHEH 3RURA 2OSWA 1OP5H 2VLKB 4QHUA 2C3WA 3EG9B 4XNXH 2WBXA 3AS1A 3EFOA 3GMRB 4M7KH 5CFAA 1FL3B 3VRJA 3DA0A 5GS1C 4JFFD 3KGSA 4LKCA 1UWEL 2DN7A 2FL5A 2WC7A 4KVCL 3RTQA 1NUNB 3I02A 2WLYA 3BZDA 4Z95H 3ELAT 3QEQD 1JI1A 4NNYB 5AW5B 4OIFA 1XCWA 4NC0B 5L88H 1RIVL 1ZJAA 2EUZA 2XPZA 2VQTA 3MCLH 3LH2L 1N0LA 1EEQA 4O58L 15C8H 4JAMB 1EA9C 5D7EA 3CZFB 4U1JB 1QOKA 1XH3B 3KJ6L 1I3UA 4UTAA 3NIDE 4OJFL 2ADFL 1XTLA 1I75A 1UUSA 2QPEB 2H45A 2X0VA 5B22A 1LEIB 3FT0A 2J72A 1YPZF 1BV8A 1O9VA 3GSNB 2I27N 4IBQA 5KOMC 1CU4L 5E5LA 1OEZW 3QJQB 3HE6A 4TNVF 2AITA 3OMAB 4DN4L 4LL4A 3DECA 3QIUC 4MQTB 2WVUA 3VI4F 4BK4A 5F6IC 1PL3A 3SCMB 3DBSA 2ZE0A 4M7ZB 4RDQG 1CGUA 1BMGA 2R0WH 4HCRL 4QDGA 4Y1SA 2ZCHH 2JJSC 3MODL 4Y16D 3GS7A 3Q8AA 2FDBP 1HN1A 3DRQA 5DMIL 1GJUA 3F64A 3WXWH 3DUSA 4HDIB 1V3KA 4FG6D 4PJBA 4PP2A 1JYNA 1P69B 4UBDC 3DETC 3N04A 4P2RD 1A6VL 1E4XL 4JFFA 4EIGB 2APWA 2A9CA 2GHWB 4KRPC 5HGBB 1TTFA 1BSIA 2R83A 2VMFA 1QPKA 2OQJA 4JM0A 1TXKA 1T1YA 3L4CA 2P47B 5D6CB 3BD3A 3CBRA 1M42A 5BO1H 2YQBA 4PJEE 2IWKA 4M43L 3UBHA 4CN4A 2OYMA 5CLTA 4Z3IA 4M1CD 3DARA 4IU3B 5D7JB 4U1LB 1BF8A 5IIEA 4YC2C 1UENA 3BP7B 3MUY1 1RK0B 1UWGH 1WGOA 4PTUA 1C5DB 1DFBH 4NZUH 3BWAA 2B5IC 3FFCE 3RNQA 2EE2A 3WELA 2Z3FA 1BWWA 3LNGA 4BH8B 2VQ1B 3ESUF 1KCRL 4DK6A 5HHOE 1SHSA 5DQDH 1JHKL 4R4FL 3B2DC 3QNZB 3T9WA 3FONA 5DZJA 3VGHA 5HDWA 3NFSL 3GT6A 1KTCA 3G6DL 5B39B 3RUGE 1AO7B 1RUMH 4HUUB 1I4FB 1MY7A 1RZKC 5DEJA 2P7TB 5FHBL 1KCRH 3GI8H 5B1KA 3RWJA 5I1KL 1G6VK 4F7EB 4LKXA 2J2ZA 3MGOA 2AJXH 4L2YA 1XGQA 2E56A 3UBXB 3CSYB 2K9FB 3L1GA 4ONGH 1WQVT 1FFOB 3VW3L 5FYKH 4ZXBB 4EUPB 4F8OA 3WTXA 4FG4A 5FHAL 3OBAA 1XH2A 3EDEA 4PJ6A 3EF4A 2WYHA 4KTEH 4WWOA 2YHGA 3TBVB 1F11A 4GKZB 1NCDL 1SM3L 5CHNA 5DQJA 4CADA 1HCYA 3VG9C 5FX3A 1RUPH 2OZNA 3AFLA 3EFFB 4KO7A 4HDIA 4YUEH 1ZLUK 4ZUUB 2GQHA 1MCPL 4HWBA 5L0QC 1NAMH 5FO8B 4QHMA 4XWGL 2YXWA 5E2UL 2E7DA 2MNWA 4L3FA 2Q3XA 5A16B 3SQRA 1QYGL 3PNWB 2ZAIA 2B4CC 3RUGF 3CN0A 3NA9H 4LLYB 3GNML 4QOKA 4ZTOH 4AVHA 3UMTA 1F4YH 3TESA 1BQKA 4KNSA 3BH4A 1TZIA 1D7CA 4J6RH 5GJSL 5TDPB 1C5CH 5E8DL 5I6PA 2CPUA 1CIDA 3MDJA 4YXKL 5D7KD 1VGKB 4MJ2A 3RVVD 3D85B 4HIHA 3OHXB 4HAFA 2O4EA 2IXQB 2D3LA 2IAND 4QXVA 1IGFH 5F1NA 4LHJB 1FGNH 2WWKT 4ZUWB 1O9ZA 4R7VA 1RIHL 1WCQA 3QC5X 3S3BB 2QQLL 2NY3D 2EDOA 2IG2H 2WLLB 1UKTA 3AT0A 1HK6A 1P84K 2FWOA 1WWBX 3AREA 4ODXB 3TIDA 3Q1SL 4XCNB 1DLFL 2LU5A 4PM1A 5HGDA 4ZMZA 3QJFB 3LQAL 4PJEF 2PPDA 1EUTA 1FC1A 4Z3GA 1BBDH 2ZOLB 4KQ3H 5D55A 5ALBH 5I30H 3U7WL 2XKNB 3SZ6A 3FF7A 3MNZB 4BA0A 4HIJB 4EE2A 3JWNH 4PBXA 1ID5I 4IKLA 1YNLL 3NK3A 5KUMA 4LAQL 1F3JA 1OK0A 2OW7A 3ZHFA 4ZAKB 1YNKL 1MCHA 2NY1D 4YBLC 1PX4A 1BMZA 3O3DA 1TIUA 2XZCL 4XP6H 3RDTB 3V6FA 2P8MB 4YHNA 3VXSD 3HBPA 4EEEA 2A9DA 1MPAH 4NKQB 1OARH 4I0PB 3ZYOA 3ZBMA 5F89B 3B2MA 2NCMA 2ZSVB 4LL1A 2R0KH 3BD5A 3WMPA 4YJZL 3ROOA 2ZCLH 3R1GL 4M8QB 4LQFL 4XVUC 3FL7A 1XAKA 2EDEA 5GRZA 3NIDF 4JRYD 2BSRB 2HB0A 4ADGA 2OMUB 1A9BA 3M1CA 4MB1A 1T0NB 4J39A 1X9QA 3V6OA 5IMMA 2XI9A 3H55A 1OOAA 4B41A 2YC1B 3AXIA 4MJ6B 3T3PF 3FFCD 4AM0B 1DDHA 3CSPA 4G8GB 3LZPA 2LVCA 1LO0L 3H7BB 3QULA 4HF5L 5KTEL 1AY1L 2VDPL 4EJ1C 4ZMYA 1AS8A 3ULVD 4YSUA 1KXVA 3FO2B 1LQSR 4G1EB 4XODA 3FQTA 5JTWA 3W5NA 2C3HA 2LOEA 3NIFF 3NN8B 3P4OA 4K3EL 3FB7A 3IDNB 4D9RD 3LDBB 5I0VA 4MS8D 3D9AL 1M7IB 2K70A 4WFEE 1INQB 3SKJH 4K3DL 3WLBA 3RU8L 5DZLA 5ABAA 1PJWA 1EO8H 4N2EA 4N2FA 3KYOA 2IFFL 1J86A 5GZOC 1KENH 3P11L 3GKWL 1T2QL 1HC1A 1F45A 4KKLC 1QRKA 1CT8A 1NGXB 3QCVH 1O6TA 2EAEA 5DT1H 1L0XA 4PWJA 3QUZC 5H35A 5DD0L 5D2LA 2G0LA 3IBOA 3QUXD 5CSBA 4JKWA 2EVIA 1WBYA 4LCCB 1Y07A 3IAGC 1DBKL 1CIUA 3O3EA 5TDOA 5FA4B 1EV2E 4GFXA 5F9OH 1RZ7L 3PIQA 1FZJA 5MEOB 3OAYH 3BOVA 4Y5XB 1UB5B 3JUZA 3Q43A 1B0RB 4D2NA 4XBPA 5F88A 4KROC 2QSVA 1FVDB 4LBEB 5I74C 4AQ1C 5KS9B 5KWYC 2N1TE 3PWJA 4XB8A 1MHEA 3FUKA 3DX9A 4E9VA 4G9DA 1DE4A 4JY6A 3RPBA 5C0FB 2E74C 1UXSB 3PLYA 4HPOH 5IMMB 3Q5YA 3EYUL 2Q3AA 4Q0XL 4IIQA 4RRPM 2ZOWA 4XWOC 4BZ1L 4YR6A 1EAJA 4C56B 2YC1A 1GGTA 1ZPLA 3WD5H 1CLOH 5IGXH 4UMGA 5D5MA 3FBQA 3HG1D 1EJ8A 3LRHA 1B3IA 4IRSC 3AWGA 1T1XB 4JPKL 1DL7H 1NC2A 5CXPA 3U0TB 4AI7A 3QR1A 3C12A 1MAKA 1PZCA 3TM6A 2EIEA 1VFOA 3LHPH 4KO5A 1E4KC 2XWRA 4TVPH 1XD0A 2ADYA 2X42A 1E5UI 2W9DL 5E70A 2PYED 1ZLVH 3ZKXB 1IBYA 4ODSH 5BJTA 4CKVX 4FXGB 3LPGA 5IY5B 3F00A 2EKSB 3FQUB 1DBJL 3Q1EA 1HHHB 4DJMA 4RFNC 1LE5A 3QBTB 1J1PL 1MIML 2C7UB 2ZPKL 5F6HI 3UC0L 3ALXA 1R3LA 4WTZA 1V55B 2OULB 4Q74A 5J12B 2MIZA 3JV6B 4DGIH 5AB0A 5IVNA 3MJWA 3KLKA 5FDWB 1SJXA 1I31A 3CHQA 4Y4FD 5DWUL 4WTXA 5F1NB 2Y22A 3DJ9A 4XNBA 3ZTDC 1N3NA 4OZGA 1A4JA 2NNAB 4U6YA 1P7QA 1UVQA 4JQXA 1J5DA 2IWGA 1XEUA 3RZCB 4R2GD 4NZ8A 4X4YB 2J5LB 2D31A 4RMBA 1PZ2A 5I8KH 3NFNB 2V2XA 3PL6D 4FLRA 1N5YH 4JQVC 4PYHA 5IEHB 3ZDYF 5F44A 1IE5A 5AUMB 3GUTA 1AXSB 1TSHA 4DP6X 3EXLA 5C0IB 3R06B 5KJRH 1WK0A 2XG5A 2IDSA 2ADGA 2NYZA 1WE5A 2BSEA 1UZ6E 3F7KA 4JFQA 3S88H 1U8LA 3F6LA 4F9LC 4M62L 5E4EB 3S5LG 4L3AA 4R0LB 5IVXF 1QAWA 1MJ7H 3A3YB 3NJGA 1UCBH 3Q01A 4MJ4A 3KWXA 1CFTB 4CN1A 1WHPA 4MNQB 5DSCA 5EBWB 4QRSA 3ZR5A 5FV1L 4OZGE 2JCWA 1JPFB 1KXHA 3IXTA 3Q5TA 1B6UA 4KK6C 4H88H 2GW5A 2VDLB 2QQNH 4M7JH 4FKKA 3UTQB 4UZSA 4XNQA 3TO4C 1BYOA 1RZIB 5GRUH 4C55A 2VDLH 5KBLA 1F3DH 1AMYA 1UGNA 5CIPH 1OANA 2N0KA 3RL1B 4DVRH 2P80D 4QMEA 4RIRA 2HAZA 3ATFA 1EIBA 3WN5A 4PJ7E 1LXMA 2OXGB 1AR1D 4FL4C 4YSTA 1A66A 1HL8A 4XO3A 3JV6A 2EIZB 4D9LH 4Y2OA 1SY6A 2HFTA 1DQLL 3LXAA 5IMKB 3QDGB 1ODAA 1BMWA 1CFQB 1AGDA 5HHOB 1CICC 1JNHA 4DEUA 1M6OB 2NY7H 3N50A 1A4JB 1FP5A 1RIUL 1ML0A 2IMMA 4TQ8A 3HZYB 3NACH 4HKJB 4G80B 2NLJA 1RXLA 2AK1L 3T2NH 1KXQA 4BFJA 3FT1A 5FYJL 1RIUH 1U8KA 3ZGIA 3MRKB 1BOYA 3LQZA 1MCPH 3KYMA 1EAOA 1L7IL 4FQIH 1ZHNB 4YUEL 3RVUC 5FXCH 1GSMA 2ZAGA 1A6AB 1ZLEA 3RRQA 1QEWB 1KBVA 5ICUA 1LVEA 2R1WA 2E6QA 1SUJA 1IB5A 3SBWA 2FJFA 2VDMH 3VXNA 1T66D 4QLWA 2X1PA 1G84A 3K1DA 5E8OB 1E3XA 1YAZA 1SHMA 4ONFL 1WZMA 1U8NB 5KYNA 1L9OA 1HXKA 2NW2B 2EDQA 2YKLL 1ORQB 3PAUA 4AH2A 2AJSL 4QLRA 2WUBH 4MAYB 3QUYC 2JJVA 4MQ7A 4OCSL 2BH0A 4OFIA 1CGXA 43C9A 1F1AA 3U7AA 2VR5A 1QEXA 2YRPA 5IQOA 1ZE3C 2ICCA 3NFSH 2X89D 2F54E 1D5MB 2ADIB 1Q1PA 2ESVD 3CE1A 4DESA 7FABH 4NHUA 3TZVB 3KG5A 1P0SE 4YXLH 1Z3RA 1O5DT 3MLVL 1T03L 2BY1A 2WTRB 3N5AA 1XF5B 1HXYB 1WFOA 2D0GA 1VGEL 1LM8V 3O9WC 5A6LA 5EU5A 4MA3A 3EH3B 3Q2NA 4B27A 35C8L 1CE6A 4B9PA 1SGKA 2AK4A 4Y7MA 2UZYA 3VFGL 4ZMLA 2CRZA 2A9NH 1R19A 4N20A 5C0BA 4FLSA 2FECL 1MFVA 4NCDA 4JUSA 4TOYH 4OZIB 4GXVH 4QR7A 4XCYB 3VI4B 1E2VA 4U6TA 4DZ8B 2NNXA 4KH9A 5AL8A 2DQCL 1IJNA 2X88A 4BDVA 1UFUA 3GLEA 2PWGA 4L8DB 2X4OB 4EPSA 1ZLWK 3CDFA 1CXFA 4PIRF 1QLFA 4U7MA 2R0LH 2BVEA 5FUOH 1HTYA 5IMOA 4AYFA 4PHZA 4R96B 4FI7A 5B8CB 4OD2A 1HWWA 2ZCHL 3T8MA 4QGYA 4U4BA 1EDYA 1NKRA 1J1PH 1MIMH 5FO7B 3QJTB 3VQ2C 4WWID 3MU3A 1U30A 1XGTA 3IN2A 4FNTA 3RL2A 3V6OC 3VCLA 3DVFA 2IDQA 3IDGB 1NDGB 5INCB 2ICEA 3K2IA 2B1AL 4HBCH 3TGXA 1U41A 2H26A 5CCKH 5JIIA 1GCYA 4E9QA 4Y5XC 2NRDA 1B0GA 5LAPA 1PTZA 4YVNA 1R34A 2AS5M 4Y2DA 4Y4KC 4ISVB 3LN5B 3I6KB 4PIBA 3VXQA 1S9XA 3EADA 5EIQA 5HHQB 3RZCD 4MAYA 2A0LD 4N8VG 4DN3L 2OTWB 3QEUA 4XVTL 3D0VB 1U36A 2EYTB 3FU7A 3MUJA 2BIPA 4DKFL 5HHPA 4KI1A 4NQEB 5C6TH 5AOMA 3QFGA 4LSDA 3KCWA 4TQHA 2XFGB 3NCBB 5DLML 5FO9A 4K8RC 1CLOL 4DP9X 3IGLA 2P46B 1RIVH 4JFHD 4EN3B 4P0DA 4CDGC 1JXDA 3QUMH 2EDRA 4U1HA 5FK9B 3KZ8A 4M6AA 4FJYA 3IGFA 3BZ5A 5K1JA 1QSED 2VWEE 5IB3A 1CTMA 1AKJD 2IFFH 4U4IA 3G9VA 3D8MA 2CDEB 5E2TL 4WI6A 2J1WA 5J6SA 1ZWIA 4DN3H 2RIKA 1NANH 1P7HL 3TIEB 4LVNC 3VXOB 1DSFH 2FH8A 2ED8A 5TJWK 2CK2A 2Z31C 4NN7B 3MOAH 2BNQD 4NPYA 2R7EA 5DJCB 5CINL 4XHQA 4NERA 2WXFA 4Q9BA 3PQYD 4UOJA 4NKMA 4D9RE 5CMAA 4QOKE 2IC2A 3QZBA 2FZ3A 3NCMA 5A2LH 1TJGL 4F92B 1KPRA 4RDBA 4AYSA 4DAGL 4E9WA 2I24N 4JFXA 4DO6A 4QPEA 1RZGA 3B5GA 5E8NA 3CLWA 4M48L 3D6GA 1E7UA 4G70B 5HHOA 1MW1A 2HTKC 2K7PA 4F7MB 5C1MB 4UV4H 4NUGH 1DTUA 5A7EA 3GM8A 3QA3A 2GPZA 3M86A 2VLRB 3FFCA 4MQXD 2G2NA 1HL9A 3HE7D 4LIQL 5T33L 2Q7NA 3STBA 1QR1A 4L9LB 4XXDB 4OLWH 3EUDA 4XP4H 4BXSV 2CHNA 3FMGL 3TV3L 2Y1VA 5DHEA 4JY5L 1RJLA 4OV5B 3WKQA 5E8EB 3IJEA 2NQCA 4LXFA 2DBLL 3TIDB 1KEGH 1UB6B 4KJQC 4Z7OF 1CDBA 1E7VA 3EYOA 1G7HB 3GEFA 1NBVL 1D5IL 8PAZA 3QI9C 1Z5LB 4I89A 1NICA 1HHGA 3ABGA 2C9AA 4Y8DC 1SJEA 4S1DC 4FADA 1AGFB 1UA7A 4LZKA 2OMYB 4ZPTB 4WGWB 1SQ2N 1KV3A 3X3GL 1AANA 4OGAC 3ARBB 5IW1B 4E9SA 3GK8L 5HD8D 4JGMA 5DD3L 3KD4A 3NEOA 4FXTA 3U7WH 1V5JA 4X98B 2J44A 1SVCP 5J5EA 2CJTA 5BRPA 1U3JA 1MLBB 4LK4A 1BBDL 4R4BA 5T1KA 4UCFA 3LS4H 3SDYH 2Z92A 2FVNA 4GJTB 5IQNA 2Z31A 4TSBH 3NSCA 4FNQA 3SE4C 3BH8A 3HMXA 3NOIA 5C0CE 2D4FA 3DBXA 1LO3L 3RKPA 3VE0B 4QXTB 1DANU 2DWEA 3TT3H 3NZSA 4GKNB 4WW1A 1X9LA 5LG6A 1X5YA 3TC9A 4GMSL 2N3JA 4Q4IA 4C47A 3BSZL 3GBMH 1F3DJ 3D06A 2JKXA 3MBXH 1YNLH 3MGAA 4NZFA 1IRAY 1U42A 2GTWA 3ME0A 4WK4B 2DYPD 1F4HA 5D93B 1IC1A 3P3TA 1JGEB 1KIQB 3F8UB 4GFTB 1G94A 4GG8A 4ODBD 5TPWH 4XBEL 4YXKH 2Y1AA 3QK0A 3D0AA 1N0LB 5E6ZA 4H8UA 2FJHA 4HXBH 5GJSH 3HJEA 5EEYA 4G43A 4ZTOL 3VI3A 3C6LB 1DLFH 3CDYA 3RGHA 1TCRA 1ZT7A 1HXMA 2Q9OA 3Q8CA 1XV8A 1U8PB 1CTOA 1XGYH 3VH8B 3VI3E 1AH1A 2E9BA 3G04A 2CO4A 2JELH 3P2BA 2YRBA 4HJJH 3QDMB 3EOTL 1T7VA 1MLCA 4GBXD 1WFIA 5EV7A 2ZUXA 3LEVL 3S35L 3WS3B 5FAAA 2Q7AA 2AKRB 3P3RA 2UXTA 4G5AA 5GGRA 1RULL 2BXYA 3ELQA 1L4IA 2OMTA 2WZPA 3NIFB 2IMNA 3ECUA 3IPFA 3C60B 1K8DA 2E6JA 2XN0A 3CZUB 3IRZA 1QLEH 4GRLA 4TPRH 3KLHD 3RE0A 3ILEA 5EF3A 5AW9B 4XPHH 1G7PA 4PJ9C 3KPRB 2YSSB 2NSMA 4FXGC 1FBIH 3EO1A 1ND0B 2SEBA 2BNRB 2ZCKH 4GLRI 5F72S 3R4DA 1JOIA 3GTTA 4P99A 5FYKE 3KBHE 3TNNB 5I6OA 3ZQ9A 5DUMH 3PU7A 1R3HA 1SLVA 5A6IA 4HHAB 4MNGA 5LXGH 5MENB 1IO4C 1M3IA 4YZFF 4FA7B 5E2UH 4E41B 4FNLL 1RU9H 1T3FB 1WAAE 1XMEB 4LOEA 5HI4D 3QFJA 4KROD 4V33A 5AG9A 1J5IA 1ACYH 2X12A 3W2DL 3ETTA 3NZ8A 4JDTH 5MEOA 3CUPA 1V3LA 2EXWC 2K45A 4Q9RH 2BRRL 4G42A 3TH4T 1RVFL 5F88B 4QRRE 1OLZA 1NINA 3QQ3B 2XQBL 4NQTA 1HIMH 3L1EA 4XWOD 1DVSA 5DVLA 1JZ4A 2E7LC 2V2TB 3BWAB 3P9WB 1OTTC 3N41F 3CMOL 4ZS6C 4ODTH 5C07B 1OQXA 1MJ8H 2WLHA 4BFEA 2YD7A 3NRPA 5E4EC 1AKJA 3TV8A 5BW7A 1UM4L 1VADB 2NY3B 4IOIB 5AVXB 3AGWA 4UTAH 2ZYSA 1E5ZA 4NPYB 2VMDA 2DQUL 3N41B 5DJCA 1U93A 2VAAA 4KJYB 3H3BC 4PJGF 3JQOB 1DQJB 1WUNT 3PWUB 3VXMD 2OSXA 2E6PA 4KI5D 5GHWL 5K33A 1A7OL 4DOHB 4NJAH 2Z4QB 4PUBL 3UBXI 4XNDA 1XBRA 2WLZA 2Q8AH 2F19H 3S96A 1NBZB 4C4UA 2C3GA 3FQWA 1A6ZA 1K8DB 1MFEL 3ARQA 4W9GC 3BYTA 5DHXB 4X8JA 4CJ1A 4FEIA 3ZRSA 1MCJA 1ZS8A 2ZF9A 4YSAA 1F56A 1HKLH 1R3LB 3CLEL 3MRIB 4P8QA 5C0NC 4J8RA 4JM4H 2CBOA 4JFDA 1AIFA 1C08B 3LHPL 3QORC 4WU5B 3TJEL 1TTBA 5JUEH 3T65A 1IZJA 2HH0H 2EVFA 3BH9B 5AWNL 1N12A 3U48A 1U8IA 4Y5VA 4OU3A 4OGXH 5IROC 2Z64C 3RWCB 4LLYA 4TNWK 3M7FB 5FYLH 3QH3B 4OFVA 4PRPA 1XMWA 4UNUA 1MDAA 4X5PA 1OCCB 1QPXA 1D6EA 3RAJH 3NZ8B 3KXFA 4MKTA 1CYXA 2AV7B 5DF0A 1OL0A 5GS2D 3UZQA 2AJYH 5EO1A 4ERSL 5IEKA 4Z9KB 2J7LA 1IBDA 4XNZC 4P4KD 4P04A 3RZWA 3UTPD 2ZUQB 2OI9C 2MMXA 3CFDB 1FE8L 5GGVL 4IRJD 5C07A 4FQXC 4Z18A 1F4WH 3AREB 3ULAB 1DVQA 2Y06L 3MV9B 4PJFE 2Z34A 4MNQA 4UM9D 3FN9A 3ILPB 3ULUF 3Q6GH 2NQDA 2W0FB 5G4NA 1WLHA 1IAOA 3O6FC 1EO5A 1E9PB 2DY2A 2WLIA 1I7UB 3ESVF 3CSGA 3GMQB 3VWJB 2QHRL 4DP2X 1AHWC 4QXTA 1FWXA 4H1LB 2VAAB 4J3OF 5DD0H 5F3FA 5HI5D 1RPKA 3QCUH 3SE9L 3X3FL 2F15A 5AVSB 2NTFA 3IJHB 5A16A 2LE9A 3LKQA 3L95B 4N2HA 4KK9D 4ATWA 4TSAL 4Z3EA 4KKAC 4NKOB 1CCZA 2FX7L 3NTCL 2RQ8A 3ORJA 1KGYE 2NXZB 3VQ1C 1KIQA 4RGMB 5I17B 4M7LH 4GSRA 3APMA 3K8LA 4FTVE 1AR2A 4HUVA 5A2CA 1XCQA 3SOTA 1FAKT 2DLFH 4UQBA 4GAYA 3BVDB 4IKNA 5ETUB 2XTJD 4QYOA 5KW9H 2WM0A 3FO0L 3QDGA 2AXWA 4UQDA 2ZNWA 5DRXA 2IDUA 4URTB 4IKJA 1IEBB 3QUXB 1DBBL 4GP4B 4UOZA 4XB3A 5D7IB 1DQML 1L7TL 5MENE 3ZE1F 1WA1X 3ZLQC 4YDNA 1Q90A 1BXXA 1J9TA 3ZX1A 1NOFA 2NLJB 1AFVL 2AKRA 2OMUA 4N6QA 1JVOA 4A67A 1PCSA 3IS0X 3MRKA 2YLKA 3CZJA 1WD9A 2Q0ZX 2AEOA 4PV8A 4B9ZA 3B56A 1I7TA 3N9GH 1Q1JH 3OKEA 2HX8A 4I3SH 2MOVA 3N3EA 3WHXA 5GS3A 2FX7H 3NTCH 1I1AB 3WFCL 2X6AA 2AEWA 2QFRA 4WI0A 1RUAH 4ZTEA 5E5MB 1BG1A 4YVUA 1MAML 2ZAHA 3A5VA 2OJZL 2PO6C 4L4TD 4PJDB 5DLLA 1YY8A 4ADIA 2EE0A 1UYWH 3E8UL 3DUHA 4BQ6A 1AE6H 5HGGS 2RJMA 5KBPA 1U8NA 2CKBL 2HT3D 3JVFC 1T3FA 3P9MB 4KGLA 1IM3A 3TA3C 3UZEA 4BZ1A 1IVTA 1QSFA 1WCBA 4JM2F 2QQQA 2OMBA 2WNXA 2OX5B 2EC8A 2CSPA 3GSOB 3SZKC 1JHTA 2JLPA 3W56A 2PW1A 1MCFA 4G6JH 4JDZA 1R3IL 3NCYP 4UQ3B 4YBHA 3RTQD 3MRRA 4IBTA 1UXMA 2G75A 3QQNA 3AXLB 4X9IA 4HXAH 3WKPA 3SDCA 3S2CA 3DSNB 1I9IL 3DV4A 4ANKA 3H53A 1XGYL 1HDMA 3ARDB 5EU6D 2LHAA 4U2ZA 5KVEH 4GUCA 1JF1A 5I30L 1ADQL 4Y2DC 4Y4KA 2IJ0C 3BKML 3DTUB 3MBWB 1KGXA 5ETUA 4FNRA 1QO3B 4JFPB 3BMVA 5AZUA 1JXFA 5DRXB 1DJYA 4C56E 3OX8A 4QRPB 1QI5A 1FFTB 3AY2A 3V0JA 3SYCA 3HRPA 1A1MB 1F4AA 3BRFA 5FC9A 5E08H 2WZ5A 1WD8A 1B4RA 1RUKL 1MZYA 3I2CL 2A9AA 3EYVB 3JYCA 1EJOH 1RFDH 3TJHD 4AVKA 1HU8A 1S7TA 1DBAL 5EIIA 2GAZA 1RZPA 1O6SB 5G5DB 1ANUA 2E86A 3ALPA 5KVDH 1AHMA 2K6WA 5EEZA 5EIIG 1GXEA 4CSZA 4K3JL 4TUOA 3IPBA 3BUIA 3QB7C 2FRGP 3GZPA 2ITEA 1J5OL 1XIWA 3GS4A 1FIGH 1LWHA 5GS0L 5I15H 1QSVA 2XXFA 2PXYA 4FQLL 3V10A 3W3BA 4EI5B 1CT8B 2I07B 3RGVA 4YSPA 3FT3B 3L9BA 3FSOA 4HFWB 2Z4TA 2IBZY 3IKCA 1WC7A 1UWXK 1EZVY 1HHJB 4ISVA 3QEHB 1E0OB 4FXGA 4LCCA 1RUPL 3K2UL 1TVHB 1PJ9A 3H7LA 3H9SE 3QDJA 4PG9B 3JZ7A 4BFIB 2FATH 4UT6H 5HHQA 3PIQB 2FO8A 3NQIA 4GH7B 5A6MA 3PP3H 2BNQE 3MV01 2VWEC 1YEIH 2XIBA 2W9EL 3P77A 5KS9E 1VFMA 2A9NL 4FHKA 1X5AA 3S3SA 1FVDA 5KS9A 4GQPH 1YZZA 3L2LA 4XE5B 3AS3A 1G4RA 4RRPA 4OY9A 3TCXA 3L3IB 1SDDA 2WQ8A 5J1AB 4BKTC 5E99L 2AANA 1UFGA 4FTVB 1JGDB 2UZIH 3V4VH 2ENJA 3HI5H 3FCTB 4GQZA 1T03H 1DEEB 2O26U 3E9TA 3QZNA 1BQ5A 3P4NB 4D0CB 5IFJB 3BLPX 1J05B 2YK1H 2WBJC 2IPUG 3MOBH 4YDKL 1V54B 1DUYA 4DCQB 3U4KA 3CN1A 5KJ7E 1CG9A 1EXGA 3PGFH 3NFPB 1RY7B 3MV8B 4RMTA 1U91A 2X4SA 4KXAA 5D1ZI 3BHBB 2HJKA 1S78D 3GSUA 2X87A 1JV5A 3HPJB 1ZXKA 3BIKB 5BQ7B 3RLSA 3K0WA 3C09B 4RZCA 5IHHA 3UBFA 3KPSE 2NCEA 4J23A 4JN2B 4L5FE 3FQUA 5CIPA 4XN9A 4M6ML 4DOHE 5BUAA 4F57L 4E68A 2HTKD 4E9YA 4TUOB 2A6KB 1VZGA 3GHPA 2HN7B 1AXTH 1VIWA 3BDXA 3BP6A 4LDOB 4OQTL 4HJ0D 1NCBL 5F1SA 2G60H 3SQOH 4P23A 4QNPE 1DQQB 3MKGA 3IKCB 3BPCA 2VLJA 2IFGA 1U4EA 1BVLA 4OJYA 4Z7IA 5JW4N 2UY6B 4LCCC 2AJYL 4BFIA 4FXKB 1WS8A 3NZUA 4PRIA 4CW1B 4HKXA 1UWFA 4IGBB 5I23A 1IC4H 3WUWA 1KTLB 4JANA 2OSLB 2J3SA 3ZKNC 4OCMC 2OCCB 2XCMC 1NTDA 1HHKB 1XH1A 3CDZB 4XVTH 3K4ZA 1JK8A 2CLRA 3SDAD 1P5UA 1PKQA 4CNIB 5FOBA 5J7CC 1UD6A 3S8GB 1YJDL 2FEDC 1TKWB 1S5HB 2VERN 3BDBA 3UYOD 5A2JH 4NO5B 4ZW6A 4XMTA 1BVOA 4LFHD 2AQTA 1NC4A 2CO1A 3H42L 1PS3A 4RAVA 2A2QT 3BP4A 5K9QG 3BN9D 3FCTA 4JHUA 4L37A 1E3FA 1K6QL 1Y0LA 2QVFB 1HCZA 3IGUA 2NY0D 5L2KA 3AITA 3CVHH 1U8KB 1MHHA 4L4TE 3ZY7A 2BCKB 1QSZA 4KHXH 3AXHA 2BWDA 1IGCH 4PVBA 4R26H 5TQ2H 3WS6C 5TQ0H 1KCBA 4XMXA 3AROA 1U8QB 3RL1A 1G6RH 4LGPB 1A5FL 2DWEB 3EUUA 3SDCB 2FJFB 1TTGA 4NJ9L 2IQAA 4LPXA 3GJEA 3O6FA 1ETZA 1MJ7L 4G8GE 2GJ6E 4IRSB 4F9PC 2XYCA 4PP1D 2P8PB 5F9JB 5D2NC 4BH7B 3BQUC 2NSXA 5JR1L 5IJDC 1QA9A 1U92A 4OLEA 1XD1A 1JNNL 2PF6A 3PP3K 4MXWL 4Y2OB 2EDBA 4MRCA 1JNJA 1M7DB 1N10A 2JXMA 1TSRA 1CFQA 3TFBA 4XCEB 1CUOA 3H4FA 4V2BA 4HGMA 1IQDA 2F53D 5JOPD 2APVA 1JDAA 3GYRA 1OCZB 3QP3A 1D5MA 4FQXA 3L3DA 4HS8H 3VGAB 4GBXC 4BJLA 4W6XB 4FKHA 4YEFA 2Y7LA 4E5XG 3QDMA 1JAEA 2P3YA 2KDGA 4GO8A 3W2DH 1JS4A 4NC1E 4J3XA 2J43A 2R51A 5GGRB 4ZFOL 3RUGA 5IHBA 3KPRD 2DICA 1BGXH 4JB9L 3ZMRA 1E42A 3QIBB 4WSKA 4KMQA 2GJJA 4YBQC 4YPGB 2OK0H 4QTHB 4K15A 4Z77A 1TJGH 2ZPKH 2FUTA 4YWGH 4FDWA 4EI5A 5EZLA 1E8WA 3GINA 5DMKB 5I16A 3BP5B 4JJ5B 4LSTH 4O2FA 1J11A 4R7DA 1G9NH 5EO9B 4AGNA 3D3VB 5JA9A 4QHKJ 1QFUL 1A64A 1S9WB 2X1OA 3HC4L 4KROB 3PABA 4LGRB 4QHLB 3TL5A 5F7DB 4EI6A 1RP9A 1L5GB 1MHHB 5C9KA 2YPVL 3SO3B 1T83A 4HWZA 4AMKH 4IBWA 1NDMA 1NCNA 1YECH 4GAJH 3CVDA 2QADD 4YDLB 5JO5B 2AJVL 3G5WA 2WWMD 2ZXCA 5KVGL 1NIAA 2ZX7A 3UROR 5IHLB 2CDFA 1RPQA 4BV1A 2MQ0A 4LCWA 5GJTL 3WDIA 2R27A 4QAWA 2AK1H 1UJ3A 1N4XL 2CD0A 4NCC1 2P8PA 4FQ2H 3S6CA 1ZEAH 4PJBE 1U92B 1IZKA 3EJSA 2H1PL 3L1OH 4O9HH 1BFOB 2XQYG 1X5LA 1S7UA 3KYKH 1TQCB 3PCYA 3EBAA 4XBEH 1Y18B 3MFFB 1P6AB 4NDMA 1YY9C 3B9KB 3DGDA 2Y7QA 1AD9A 2ATAA 3E9UA 5C8JB 3Q6FB 4YHLL 3PGCA 2WP3O 3UJTL 1XO8A 1IFHL 3NIDB 5IZ7A 1B4JH 3T4AB 4M5ZH 2EADA 4OCRL 4U1HB 4QHNB 2CBMA 1WBZB 2FWUA 2XN9E 4X8XA 4JZJC 3MCYA 4HP5A 2BVOA 5DHVA 4NWUL 2DL9A 5AD0A 1AZZC 3K72B 5IB3B 1BF5A 1KXVC 3HE6C 2EIBA 2DIEA 2JWYA 2V5TA 4ZUVB 3QIBA 4QY8B 3T0BA 5BZXA 2ZOOA 4LLMB 4PVLA 3NIGE 3BKCH 2QV2A 2J5LC 3U36A 2GTZA 1UZ6F 4N2CA 5BVPL 1ZJBA 4WEBH 2BY3A 1F4XH 4MA1B 1OY3B 1KB3A 2NSQA 3X3GH 4EVNA 5C2BH 1Z9MA 5KANI 2ARWA 3S34L 3MLUH 4P5TD 1QNZH 2NR6D 4KK5C 2UY6A 2Z1KA 3EJJX 4JR9H 4NKMB 4CW1A 4HUXA 1IBZA 2KL6A 3MRDB 2C9VA 1VF5C 2WYIA 3MLRL 1OPGL 2YZ1A 2WNKA 5AW3B 1DQDH 1FSKB 5INDB 1AY1H 2EEAA 4U1JA 3ECVA 4JFXB 1VFAB 3E2HB 4BRVA 2ZKXA 4NWTL 1R4XA 5FECB 1EJFA 1SUHA 3K2UH 4R4NC 3UZQB 3CHRA 3ZHKA 4AIXA 1BA9A 5LG1A 3GSNA 3Q05A 3SD5A 3P3UA 5I8KL 5DR5H 3AG4B 3S4SG 2VSCA 4PJIA 5JZ7D 2HFEA 5F7UA 7FABL 1T0MA 2QFPA 4MCYB 4Y5YC 2H8PA 1ZRUA 2MCG1 1U95B 1ZANH 2XBDA 2P52A 2X0UA 3B7YA 3BAXA 3VWJD 2NY4B 5AVWB 4F8PA 5IG7B 4OT1H 4Z78A 4NWTH 3QT2A 4P2RB 2JKLA 3ILPA 2ZJSL 3TPUA 2X9ZA 3LXCA 5CBAA 5HYQA 1GTFA 3DHPA 4MDIA 3DUSB 2MQ3A 5DO2D 1E9PA 3IMVA 2VLKA 4OLXH 4QHUB 4XMKL 4J4PD 3VTMA 4QAMB 2GUOA 2QPDB 2UXVA 5C0GA 1OM3L 4N8CH 4OCRH 3DKHA 3QXWA 1INEH 3RY6C 3UH8A 1JYXA 3U6XA 1ADWA 2EJ1A 3LH8A 2DWDB 3A21A 2CGYA 5I1IH 5BVJB 4OFYD 4PMFA 4EOWL 1GMIA 3KWTA 2HMID 1A25A 1AJ7H 1YJDC 1A1OB 3NJHA 2MRYA 1YMMB 4GSQA 4N6RB 4BQBA 4L23A 4EIUA 2Z93A 1ET8A 3FPYA 2QGBA 5BVPH 5IVXA 3RX9A 4F7TA 5FYLD 3W5MA 1IAIM 5D4IA 1M1XA 1Q9LB 2OPCA 3NCEB 4JFED 3RKDC 4DO4A 2A9MH 1WUZA 3Q8BA 5CJQH 1NAMA 3QYNA 1KJ3L 4YNYA 1E6OH 3LPWA 4PW9A 3FTSA 3V9EA 3HN8A 2D8KA 1IBBA 2UXGA 1IM9D 1FO0B 2O5ZH 4FQHA 2B15A 3CH1B 2J1ZA 2VLJD 5C86A 5SX5H 5KYWA 4H2AA 1DQLH 3B2VL 4X9GA 4G6JL 5JDJA 1VZHA 1KN2H 2FT6A 2Z35B 1KJVB 1N67A 1AYRA 1S7XB 1NCHA 5L4IA 4YHPA 3RWHB 4FQQA 1RZ7H 3LRMA 1W80A 4CJ0A 4ZQTA 5DYOA 1UZ8B 4GRLD 3CPUA 3FCUB 3TBCA 1YYCA 4YSQA 2ZICA 4FF9A 1M71A 4B60A 1Q0EA 4LSTL 2GT9B 5FIEA 4UU9B 2ZTBA 4PRPE 2J6WA 4F2FA 3WS3A 3TF4A 2FO4A 4P2RA 2CO7A 3DI3B 3SDCC 4Q2ZB 2OZ4A 3RA7L 4AITA 5B1JC 1J8KA 2Z92B 4MDIB 2Q7YB 1AQHA 3N9GL 5L4MA 3HG4A 2ICEC 3OMNB 1G7JB 1GZQB 1WPCA 4PJ5E 3LRKA 2R0LL 2YJQA 4NQXB 4JFEA 1JHTB 1XCXA 1UCBL 2VZUA 3O6KL 4G8EA 2VITA 1OT4A 4PLKC 4YZFE 1KZQA 4R97C 4DQOL 2AJUL 2VGLM 7PAZA 1F90H 1JUFA 3U2IA 1IILE 4LQ1A 1KELH 5HJ3A 3VUAA 4QRRA 5JOFB 5I18H 32C2A 4M9PA 2FJSA 4UB0H 2R8SH 4RWHA 3WE6B 2AJXL 4I85A 4POYA 1HILB 5MERA 3S7GA 4UDTB 3UO8B 5AENA 5FHBH 2B14A 1JF1B 3CVBA 4BKLA 2I5YL 3EYSL 2AQ3A 5B1BB 2QT6A 2L7JA 4X7TA 3B8YA 5ESQA 1KB5H 3VI3B 3WO3B 2XWTA 5IESL 1WIPA 3LOWA 2VUKA 3EHBB 3CUPB 3WY2A 4ZO9A 4J1UB 4L9LC 4WW2B 4E5XB 2VISB 4EN3D 5JOPE 2WTPA 5IB5A 3L4WA 2FYVA 1QWHA 3AJ7A 3BESR 3UAAA 4HLZG 1NBYA 1SOSA 1ZV5A 1NCCH 3ETBF 4J3SA 4M1GL 3EYVA 3LXUX 4XCNA 4G82A 3TO4B 1S2EA 3VFSB 3HZVB 2B0SL 3PHQA 1Z3GH 4LLMA 4XPGH 2C3XA 3BX7C 1WGVA 1BVNP 1NZRA 1SEBB 3QXAB 3LZFH 1G7PB 4I2XE 3CXDL 1EGJL 3MRPA 3MRCA 4JG1H 4ZAKD 5BXFB 1TQUA 3OSVA 4S1SH 3UJJL 4TVPD 4MXWH 3EO1B 1UH2A 4PVMA 5HYSG 3BAIA 5I18L 2XBZA 3QCTH 3LRGA 1EEZA 4HS3A 5IK3A 4LASL 1ZGLP 4RAHA 1JGVL 4WJ5A 4D94A 1SHXA 4AW7A 2CRIA 1FC2D 1E4XH 1L6PA 1UOWA 2NX5D 3CX5J 1PAMA 1WFNA 2GEEA 1CICB 2CO7B 2QZQA 1OKEA 3QEHA 5KYYB 4ILDA 5TDPA 5F7LB 4FQIL 5D71L 4X5RA 4P2RE 3CFKA 3VFRB 2DWYA 4YPJA 5IFHH 1P7KA 1F58L 4NQXA 5E1AA 4QRRD 2VITB 1J1OH 1CLYL 1UXWA 3VB8A 5J6GB 3BZEA 3VXUE 4MD5B 2HCZX 1JUFB 1M2VB 3MXVH 2FEEL 3SBPA 1VKXA 2VERA 2EC9U 1A6UL 2YOCA 5CZXD 4Y4HA 2G5BA 2WXLA 43CAB 1NKOA 3FRUA 1YMME 4U6VH 1BEXA 2NY6C 4YHYC 3WNLA 2H3KA 1T04B 5C0BD 5I1DA 2PTVA 2WO3B 3SE3C 2AK4D 4X2UA 5HGDB 5H8DA 3KJ6H 2APXA 3WNOA 4A2GA 4Z5RB 3ZE1B 3FSWA 4JLRA 4R7LA 2GFBA 3DPBB 1CFNA 5K69A 4ZFFB 5GPRA 2L7QA 4IEFB 4OCXH 2LU3A 2NTSP 4K9EH 5DJXB 3O6ML 3GHBH 2YEVB 3GMLB 4WW2A 4NQVA 4KTYA 4Y89A 1G6RA 4JRXE 4JG5A 4YK4B 4XMWA 4JUTA 4H8PA 4QRTA 5EBLB 3SCMC 3ULVC 4XNMA 3UJIL 1LO2L 2D9CA 5JPNB 3ARBD 3IDNA 4PRHE 4E9RA 3UTZA 3CFDA 4KTDL 5HJGA 3LD8B 3EOBB 3CH8A 2A74C 2GIMA 3EJYD 1YUHA 1B0IA 3IMWA 5SV4A 1F2QA 2W1NA 2D03L 4Q14A 5HHNB 1EHLL 2OCJA 4PJ9B 3MRPB 5DK2A 3TOPA 1UM4H 1PZDA 3HB3D 2V8MA 3UABA 3SKOA 2YGPA 3VU1A 3BQUB 3MJ9L 4P49A 4OZIF 4N0UB 4L5FH 4IRZA 3PUUA 3SKMA 3QG7L 3LH9A 4WNJA 4WEUD 1SY6H 4P23B 5E95B 4DQAA 1IKNA 2CHWA 4NQUA 4Z0BH 3NP4A 4F1SA 4PRPB 2X4NA 1E50A 2X44D 3PV6B 3P40A 4FMKA 3FQNA 5K1VA 1ZT1A 4TS6A 2BXZA 1COBA 5CR8A 5IB2B 2ORBL 4BHUA 3WIIL 3H2PA 4G8GA 3NIFE 1A3LH 2VXUH 2BY0A 4KX9A 3CFNA 3KL3A 4BSWB 4XT1C 5DXWA 1MHEB 3DX9B 1HYSD 5HYJE 4N0FA 2QLVB 4G1EA 4WKZA 5HDOA 4UU9A 5ANMB 3K8KA 4FQPA 5EN2B 4KXDA 4O2EA 4HW6A 5GZNA 4CMMA 4L4TA 2A6JB 2FHBA 1OP9A 2AABH 3MREA 1ASQA 5D5MB 3U46A 5C08D 3A67H 3GXDA 4AEFA 1IAOB 4P46D 4HPHA 3SEPA 1O7DE 1GZQA 3GMQA 3VWJA 1NLBL 3WLWC 4K2UL 1UTDA 5GZND 2ZWZA 1GY1A 4HAGA 3IDMA 4IRSD 4JR9L 3QIUA 1ACZA 1CXKA 1QNZL 2BSSB 1TITA 2B3RA 3LEVH 3WKMH 5DA0B 2VB5A 3C6EA 4QUOA 3PP4H 3EJCA 1A22B 1JFQL 2OR8A 1KIRA 4JG0L 3UZVA 4UOQA 3P2TA 2R9HD 3LSOB 4OKVB 4HEPA 5H35B 4Z7NF 4F15B 1CC3A 1PG7L 4FEMA 2JCCF 3F5WA 2VXTH 4FFYA 1FIGL 5AB1A 3O4LB 4JGNA 3PNRB 3I50H 4X50A 1YMHB 4WSJA 5EMYA 2Q8BH 2AI0H 5KSAD 5AEAA 3TEYA 4AXWA 4ORGB 3RJQB 5IGXL 1HFUA 2BP8B 4KUCF 5E6RB 2W07A 3BEWA 4PEEA 5DJZA 5JPMB 3C60C 2KLTA 3EDKA 2J5WA 3MRHA 3AADB 3ATDA 1HINL 2GJPA 2NYYC 4GW4A 3WJJA 3D2TA 3FQRA 3U9PL 1Y6NR 4N68A 2X4NB 4RSVA 2KZ1B 3BD4A 3UC2A 4RSYA 4EF3A 4H8WH 1HVXA 5TF1L 1H3PL 1GVIA 3BZ4A 5DS2A 3VGDA 4GKOA 5E51A 2PCPB 3HBQA 2WVVB 2VXSH 4FJ6A 4QGTA 2XNAA 3MBWA 4P3DA 1N2RA 5E94B 3B2UD 3KYNB 1G1YA 3HIZA 4K71C 3L7FB 4WUUE 2D2OA 1HEZB 1OF0A 1OZTG 3VM5A 2DQFB 3K5RA 3GD1C 3RWFB 3O45A 4MNQD 1I8IA 2QTEA 4M3JA 4E41E 5AOJA 2V5MA 1K3ZA 3C5JA 5GSVA 1CGYA 2YARA 1OAQH 1A1MA 4KKCC 4AGLA 1SBBA 3CLFH 4EDXA 1CR9L 2Z7YA 3MV7B 1JTPA 2AXFB 4XHJC 3SYQA 4ELME 4LCUB 2VLJE 3LEYH 3U46B 1JPTL 4N8PA 1S9VA 3OTTA 1VERA 3MRQB 4EI6B 3KGTA 1GS7A 3CFKB 2IAMA 2X2IA 4AENB 5IROD 3R8QA 4JCWA 2QHLA 2BP0B 3KCPA 3E8VA 5E1AB 5JOEA 2PW1B 1OGSA 2PYEA 1RZIA 4JY4A 3FU8A 5JHDA 3GDCA 4F7CB 5AZ2L 1KEGL 2DBLH 4Y5VC 4DKEL 4JCLA 1VKXB 2PXYB 4MMZC 4YE0A 4L8SC 5JW3L 1TU2A 1DQMH 2Q3ZA 1FRGH 4P9HC 3DV4B 1L0PA 3ZSSA 1PBYA 3OQ3B 4U1NB 3MAWA 3GI8L 4J2QA 4H8VA 5EZIH 3GMPA 2OMWA 1YO4A 4K9EC 2FR4A 5C7XL 5CCJA 1FAIL 1OT1A 1V7NL 2EIZA 3OKLA 3ZZ1A 4GT0A 4LE8A 3LS5L 4M48H 1YSOA 4IEFA 3OX8B 1YG9A 4LMQI 4Z7WB 5LQBH 1SXZA 1G6RB 2FHFA 3VGBA 3RWDB 1Q72H 1PW3A 3KPTA 3AB0B 4M3KB 5MP6H 5HVGB 4TNGA 2WAQA 3L3JA 3MLZH 2YQGA 5HI5C 4MJJA 2I69A 1WTGT 5I66A 4G7VH 5E2WH 4G6ML 3IPEA 4KXCA 2EEXA 2X2JA 4KK8C 4DVBB 1SN2A 4OCLC 5AD0B 1CFTA 3FBKA 4Y16C 5AZ2H 2FO1A 3QORB 1ZHNA 2HWZH 4N0CC 1NEPA 1RK7A 4OIBA 3NJLA 2RAMA 3CN3A 3KYNA 1G7MB 1MCKA 4P3CH 3QJUB 1JERA 4H40A 5E9NA 3GXUB 4L4VA 3IXTB 2G9KA 2VJ8A 2C9UA 1PLGH 4LCYA 4PJHF 4XAWL 1C16B 4YDJB 4DKAA 4QF1B 2H3NA 3GSNH 4XC3L 3NVQA 1EZVX 4GG6B 3OKMA 3QNXB 1N8ZB 4H13C 4PRBA 4TNVK 3M7OA 5DUPH 5KUKA 1QUNB 3LJ3A 3TH3T 3T71A 3IMBA 4B9CA 3DX7A 2FQFA 1IAKA 3UG4A 2OFQA 3TXAA 5C6TL 1CWVA 2L4OA 4R8WL 1A7BA 3IFOB 1T22B 2PYEB 5D7LD 5EULV 2PWDA 4QTIL 5I74B 4E9XA 3CFJA 2FD6H 3K81A 2J73A 2DTML 2C4XA 2HH0L 4ZX4A 3MX0B 4IU2A 1FNEB 1BIHA 4OZHB 4HUMB 1E6JH 4Y19D 3D30A 2A1WL 4F3FA 1BWMA 3CQQA 3MA7B 4YDMA 4AG4H 5CP7B 3N42B 2FD6L 4AQEB 4DUVA 4KFZC 5C09D 2K78A 5I19H 2Q86B 1J1OL 3AM8A 4V1DB 4ERSH 1KJMB 1NAKH 3U1QA 3CBKB 1ZVSA 3OC8A 3VGFA 1I7RA 4ZYKB 2OSLA 2EINB 2I60L 4G83A 4UYPA 5HPOA 5J4MA 1EAPB 1FZKA 3PL6B 2F19L 4RGMC 3NQKA 1T7WA 5FOBB 4C8XA 5F9WB 1JP5A 2B1HL 1XWVA 4NQEE 2R2HB 2Y5TA 1DSYA 5LBSL 3CN4A 2XHNA 3FN0H 1E9OA 4ODVL 2CXGA 1O6VA 4FP8L 4OD2B 4Y9CA 12E8L 3SD2A 4H0GA 2FUQA 5I5JA 3GSRA 3ARFB 5B3SB 1GYVA 1BXVA 3FB6B 2WZ0A 2Z93B 3VM7A 4YHOH 1NLBH 5CKGA 3L81A 3AS2A 4CBPA 2YMXL 2ZG1A 5CJOH 4ODTL 5CD3A 1CK0L 3NJJA 4K23L 4MAUH 4ZJ9A 1QSFD 2EDLA 2VLJB 4GG6A 3PGDA 5JW4M 5E6IB 3FAWA 1DLHA 4PV9A 2VM4A 3D69A 4ICXA 4K5MA 1F2XK 1OAXL 4XVJH 5SV3A 3SQBB 4I1NB 1ACYL 4F5CA 3PGFL 3EO0A 1GMEA 4HPYL 4ZMTA 3FUEA 4JAMA 2XNAB 1HHKA 4HUNB 3CDZA 3T2PA 3FU7B 4YDKH 1D5BA 1WAAA 2YPVA 1ED3B 3RZCC 3SDXB 4FAAB 4NPJA 2D3JA 4FNLH 4FABL 5FO9B 5ADOL 1OAXH 4LOVA 1IGTB 2JIXD 4XVJL 3BDYL 3O45B 4XZUB 3RWFA 4OZIA 2KPWA 3DX6B 5JORA 1J9SA 5E99H 1MDTA 1JYWA 4YS4A 1KFAH 2YAHA 4OZ4B 1KBWA 3D87B 1BF2A 4FZEL 1S7WA 5DQ9B 4PJCF 2CIKB 2X4OA 4OF5A 3EKCA 3CVIL 1HZHL 5K59F 5EU7C 2F0CA 2BNQA 4RAUA 3DUUA 2R2BB 1L9NA 3PHAA 2BP0A 1A9EA 4PCSA 2FATL 3EJPA 4UT6L 5K9KA 1XZ0B 4PLKD 4BRJA 5KSUA 3APDA 1MCWM 3FH5A 2BCMA 2QKIA 4G5ZL 3PDGA 5FO7A 5I1GL 3RY4A 4NAQA 3RWEB 4FA6A 1TU2B 3QZMA 4GRWF 1N6UA 3ILDA 5BO0D 3THML 4XVSH 1E4WH 1KTDB 5J89A 4HEMA 3AQZA 5HVHC 4LLAA 2O1AA 2R39A 4LLWB 4NNYA 3SGKA 2ZCKL 4FFWC 2DQ6A 1DANT 1KJ2B 3NDYE 5D1ZB 1TEFA 4F33A 1FVEB 2X70A 1PG7X 4E42B 5C70A 3BW9B 2WKOA 4ELMB 1AMXA 1TQTA 4NN5C 1KTKE 4ACPA 5HJBA 4R6UA 5IT2L 1PX8A 3QEUB 1XGZA 3VVVA 4MMYA 3JVGA 5AAWC 4QT5A 3PGDB 2ARJQ 4MAYD 1E4HA 1RURL 1FFPB 2VDOB 5TFSL 3QE5A 2IPKA 5C97A 1BG9A 1L9TA 4OIIL 4PJHA 5AW4B 4HK0B 3TBYB 3DX0A 2ATKB 3HN3A 5DGQA 1U8JA 2BC4B 3HZMB 4WFED 2P5WE 2WZAA 4IYKA 4OJFH 1PD6A 4LLUB 3V0GA 4YHZL 1CLYH 3TP4A 1OW0C 3NJFA 4U1GB 1E4KA 2IPTL 1RZJH 3ZKMC 3EFOB 3QXAA 2Y2YA 1CXHA 3IDXL 4KJQD 4LCYB 5DD3H 4NDMB 3U1PA 3X13A 5ICZA 2QQKL 1D5RA 1OLLA 2CHXA 1P1ZB 4AYEC 3BUPA 1UKSA 3NCXA 2NXZC 3C08L 4OFPA 1AJ7L 3OKKB 5L6YL 4JQIL 2W0PA 3FYIB 4KXZI 1RERA 1BZ7A 3IWVA 4M03A 2K0RA 5FCUH 4L48A 1S7SB 3ULVH 1BAFL 4WVRA 3VDAA 3PABB 1KYAA 2PCXA 1E8XA 1OM3H 3DUUB 4I8DA 1OB1A 4GS7B 2BIHA 4PR5A 5AQ0A 3U1SH 2UYLB 3RVTD 5K9JL 4FMFA 1AYOA 2AMUA 2HWZL 3ASWA 4JG1L 3LZFL 5IKCA 5JXED 4P23C 4ZUUA 4UINH 2B39A 4GKNA 4WW1B 4WY7L 2WXNA 1I9RL 2DI7A 5DHDA 3TEWA 1BP3B 1BFSA 5KBDA 5DD1H 1UD4A 3WIFB 4L9LA 4XXDA 2I9TB 1A8ZA 2AGJL 2GTWB 3ME0B 5LQBL 4XRCB 1JI2A 1GW6A 1RH8A 3HR5B 2XUWA 1MSPA 1Q1JL 1VGKA 1CGVA 3DX1A 1ZVSB 2XZQH 2MH4A 1AZBA 2NY0C 1KCKA 4G43B 1NGPH 4FHJA 2J8OA 1LDPL 3NSYA 3DNKA 1PDKA 1I4FA 4ZMQA 4Y2NA 1TCRB 1ZT7B 1HXMB 2EILB 3EF7A 4HIIB 1A6PA 2R8SL 2N0MA 3ASNB 3RQ3A 2Y5EA 3T8XB 3G04B 3KM2A 2BSTB 5ERWB 2WLLA 3FMGH 1YYLL 4KV5E 5EB9A 4W9LC 2WQAA 2QDVA 3C9NA 1YCSA 4XBMA 4YXHH 2A6DB 1WWAX 2B7DT 2DW5A 3O3UN 4UV7H 1SJVA 3UTZB 2J8UF 5CUSL 4DFHA 3BWUF 4JFTA 5BOZG 3JWDL 3GS0A 2JQAA 5AB9A 4X0KA 5HHNA 2XKNA 2DIAA 4MMZA 2CKNA 1XTMA 2PLTA 4XGZB 4CADB 5KVDE 5F1IA 1CZ8H 2EH7H 3ARDC 4KAQH 4NAMA 3QXDA 4BA8A 2WMPB 3IRCA 4LU5L 5E8PA 4E41D 1PYWB 4L8CA 1P4BL 1IAMA 5FO8A 4PY7A 5AALA 3BGMB 1YDPB 5GRYA 1FN4B 1YNTA 2YD8A 3FQ1A 5TGBA 5LN8A 3UPCA 1O7SA 4QOKB 1OK8A 4QXUL 1FPTH 3KWWA 5ES4B 2B59B 5LNDA 5EUKB 3I6GB 1TMCB 1YC8A 2FBRA 2OZ4L 3X1FA 3SE3A 3QUKB 5MI0B 3QO1B 2J2ZB 1UXLA 1XR9A 3MGOB 2X1QA 3V5DA 5B38A 4POUB 4ABQA 1FE8H 2Y36L 4BE6A 2P26A 1QRNE 3QAZC 2I25N 4NO2B 4JJHA 2EDHA 3K6SB 1D7FA 4NENB 4FG0A 1PZ3A 3WKNA 5C6PB 1FO0A 2W65B 4CVZA 2A6IB 1ZLUH 2JLLA 4EI5C 1WT5C 4R90L 5KVGH 3K4AA 3NDZE 4ANXA 4ZS6D 3U9UA 4DKFH 5L2KD 2B16A 4WRLA 5CEZD 3EDJA 3B7TA 4JDEA 4JRWA 2MKLC 2E0PA 3BMWA 3A4FA 4QXGL 3VXMB 5KVFE 4MSWA 4Z7QE 1IGYB 2QKSA 2J8HA 3RWEA 4WI8A 4P59H 4MJIA 3T0WA 5JW4Q 4YE4L 5JIKA 5E6UB 3NZHH 1Z66A 4TUKH 1JGVH 3KPQB 3MXWL 1OM9A 4DW2L 5MHSE 1M6UA 2ZG2A 4X6BB 5DZOA 3N0PB 3SGJC 4GXVL 4N8CL 1NFKA 3TVMD 2NZIA 3VSVA 2EDNA 3BW9A 4O4YL 4HMDA 4YWGL 3I9IA 1SQMA 1DUZA 2EIDA 1CFSB 5I26A 2QSQA 4NJAL 2XKSA 2VLLB 4AE0A 3BUDA 2YGOA 5FUOL 4ZOAA 2YPKA 1R3JA 1T80A 2YLHA 4Y5YA 4GSXA 2W07B 1OE1A 2IPKB 3GLDA 2P44B 1FDLH 1QBMH 3BH9A 2YD9A 2YXVA 3BN3B 5L8KB 3L3GB 3BPNB 2DQCH 1U8OA 2QVIA 1LK3L 4K7PY 1FZOA 2I9LA 3KXFB 1FZJB 2CK0L 1SPDA 4ZPVB 5IEKB 1B0RA 1OSPL 4XBPB 2GYSA 4KKCD 3OAUL 4L3EB 5EH1A 3PWJB 3QJXA 1I8IB 4MJID 1FSKC 3RY5A 3VXRA 3QPKA 4IIQB 1I8MB 3AWFA 4S2SA 5DC2A 3PWUA 4J5VA 3NN8A 4PR5B 4MA8L 4NAJA 2MNJB 1DVXA 4Q2ZA 3R7RA 4YHNB 1TVBB 2V6HA 4QNPF 5T3ZH 2V9TA 3H6AA 3CZEA 5PCYA 2WLIB 1EERB 1WAAF 2DQTH 2XXCB 1X5XA 1XDTT 1G9ML 2YAFA 5DGRA 2H4EA 5F89A 3RJDA 3D39B 2EXYD 4BYHA 1BIIB 3KYOB 3EYQD 5ELIA 4GQRA 4I0PD 5C0EB 4W81A 4JO1H 1D2PA 4IBUA 4OLYL 1BPVA 5T3ZD 2ENYA 2E7LA 4J3TA 2F2HA 3F6JA 1RJZB 2OYPA 1DQKA 2R23B 4R4ND 4WO4D 1E8ZA 2WVSA 4F37F 1PZSA 4XC1L 3T65B 4F2EA 4JRYB 4M4RB 3U2SB 4KK9C 5JZ7C 3FT9A 4TNEA 3EH1A 1GC1H 1P4LA 3O4OB 3QULB 4XCFH 4HZAA 4QIRA 1I85A 1QLEB 4TQPA 1SXSA 3ZHLA 4LBAA 4LF3B 1TEGA 3T4YB 2YRZA 2IQ9L 3ZKSD 1P7QD 1PSKL 1ZEAL 2XWBA 3ZDZF 4AYMC 4ZNCD 1MJJA 1MREL 1MW0A 1TETH 2I26N 5CGYD 4CRPA 9PCYA 4FC3E 3SBWC 4XMZA 4IRJA 1IC0A 2ENSA 1TR7A 2WINA 3U4EA 4F24A 3EOYG 3TT1L 2PWHA 3HI1B 5I1GH 3GXPA 1HZKA 5J06A 5DEFA 3ECBB 1JMZA 3RPIB 2YKKA 1RHHA 3AQXA 1JTTA 4HJ1A 4XCFL 2WXRA 3RGBA 4AMKL 1A3ZA 3I3BA 3REWA 4HUCA 1R75A 5AYUH 2SODB 5HHVL 2MTPA 1CD8A 3X1GA 2VLMD 3Q13A