1GS6X

Crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGASGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs6X02
2PPDA 3FU8A 5I5IA 1AG0A 1NICA 3T71A 3WKPA 2QPEB 3ZBMA 2XXGA 2X88A 3GYRA 2CUAA 1PMYA 3X1BA 3ABKB 3WNJA 4A67A 1JERA 1KYAA 2FQEA 2EIJB 1ZIBA 3QJQB 3NSDA 1JZIA 2EIMB 2DY2A 4G71B 8PAZA 2YXVA 3H4FA 4DP9X 2I7SA 3NSCA 5A7EA 4F2FA 1J5DA 2CBPA 3ZDWA 3CDZB 4W9ZA 3D12B 2XXFA 1OF0A 1B3IA 2HRHA 1PNCA 2GI0A 1J9RA 1ET8A 3PCYA 3NP4A 2Q9OA 1JVOA 2IWEA 3X1GA 1JVLA 2HLEB 1X9UA 3CG8A 2MRYA 1SJMA 1W8EA 4G7RB 3PXLA 3NP3A 1M57B 5I6NA 1NINA 2UXTA 1BXAA 1PZBA 4AKPA 2XLLA 3ABLB 3TASA 1ASOA 2A3TA 4DP2X 4A2FA 3CDZA 2MTAA 3CVDA 2DYRB 1PY0A 4L0PB 1ILUA 1RKRA 1EHKB 1T5KA 2E86A 4YSTA 4CSZA 1OCOB 3FSAA 1AS7A 1A4AA 1FWXA 1GY2A 3PLYA 4X4KA 3TBCA 1E5ZA 2H3XC 4UAHA 5IY5B 3EF4A 3FPYA 1A8ZA 2BW4A 4N4YB 4YVUA 1PLBA 2H47C 2W88A 5EHFA 4FA7B 4HIPA 1PF3A 3CZUB 2YAMA 1L9TA 4YSEA 1JZGA 5I26A 2YAPA 4A68A 3IN2A 1TEFA 4JHVA 1BQ5A 2VSKB 3IE9A 4FAAB 3EH4B 1XB8A 5B1JA 1EZLA 2XV0A 1AQ8A 4JKNA 3H4HA 1AZNA 4GXFA 2XYBA 4A2HA 2WO3B 3UAEA 4DP1X 3N55A 1CYWA 2FT8A 4P5RA 4YSSA 2XWZA 2JKWA 2BP8B 2X87A 1ID2A 2GSMB 5LDUA 3ASOB 4E9YA 3FYEB 3OMIB 2FJSA 2Y69B 4NB7A 4W1TA 3PAZA 2HX7A 7PAZA 4CSPA 3DIVA 3T6XA 1GS6X 4GP8B 5TK4A 2BZCA 4BWWA 2LLNA 4YSUA 5B7EA 2VMJA 1ET7A 1KV7A 1RZPA 1SDDB 2XV3A 2FNWA 3AG4B 2RACA 1YLBB 1E30A 4EF3A 3KW7A 2DWSA 2GC7C 4Q8BA 4PCYA 4E9VA 2CJ3A 5B7FA 3QJVB 1GW0A 3EH5B 4A2EA 1JZEA 3IEAA 3OMAB 4NAJA 3AG2B 4E9TA 1WS8A 5F7AA 4ENZA 3S8FB 3FT0A 4HCGA 2I7OA 1FFTB 4KNUA 4RH4A 2AVFA 1PLAA 3WG7B 1KCBA 2BP0A 2EINB 1SDDA 4DP6X 3G5WA 5I6KA 2J55A 3NJNA 2XV2A 3FU9A 3T9WA 3TBBA 2PCFA 2DV6A 2FT6A 2PP9A 2R7EB 1RCYA 4P5SA 3V9CA 3WI9A 4KO5A 2BO0A 4HHWA 1OCRB 1IUZA 3NJMA 4YVNA 3S8GB 3FQYA 1PAZA 1AANA 1AIZA 2FTAA 1KBVA 3QJUB 1SHXA 3ASNB 3JT2A 3QQXA 4WTQA 3FYIB 4GP4B 5I6PA 4BXVA 1HAUA 5I6LA 1BXVA 1IBYA 1XB3A 4BDVB 4YSQA 3S3BB 1NIDA 3OQRA 1NIEA 2IDQA 3WNIA 2H5UA 2HXAA 1AS6A 1OE1A 2R7EA 5B1JC 4BXSV 2TSBA 4KNTA 4A2GA 4E9QA 6PCYA 1CURA 1NZRA 1ZDQA 1OE3A 1JXGA 2Q5BA 1AACA 1V55B 3UADA 1NPNA 2OV0A 1MZYA 1ILSA 2ZXWB 3SBPA 3ABGA 2YAEA 5F7BA 2XX0A 1N70A 1AOZA 2YAFA 1SHWA 4N8UA 2IH8A 1TKWA 4JHUA 2Y1AA 1ZDSA 2IH9A 3QJTB 3T6WA 4QKTA 4KOCA 4BDVA 9PCYA 1BYPA 4AX3A 1KGYE 1PLCA 1OCCB 3BVDB 1J9TA 5B1BB 3FQ2A 2IDSA 4HALA 1NWOA 1ASPA 1JZFA 1SF5A 3MBWB 3QJRB 3T6ZA 1AZBA 4NERA 4KNSA 1DYZA 3FQ1A 1BYOA 4AKOA 2FQGA 3EH3B 2CAKA 1PZAA 1OE2A 5E9NA 2QDVA 1GSKA 1AR1B 1GR7A 1N68A 1WA0X 5I6MA 1J9SA 1XMEB 2P80A 3KW8A 4G70B 3DTUB 3AZUA 3X2QB 2UXFA 2YAQA 4UANA 4BWTA 1TU2A 5FC9A 1L9SA 3C75A 1QHQA 3L45A 3X1EA 4YSAA 1E67A 3FU7B 1TEGA 1NIFA 2CALA 4GYBA 4M3HA 2BP0B 3NSFA 1MDAA 3ABMB 2YQBA 5B1KA 1BXUA 3JTBA 4KOBA 1UATA 3FSZA 2UXVA 4E9RA 5AFAA 2ZOOA 4HZ1A 3AG1B 5PAZA 3H56A 1V54B 1W6WA 1BAWA 1OV8A 1AZRA 1GS7A 2VW7A 3U25A 4YSPA 1F56A 1URIA 1E65A 2AANA 3OM3B 3WIAA 2QPDB 3FU7A 2HX8A 3GDCA 3V9EA 2FQDA 1QLEB 1MZZA 4E9XA 1A4CA 2IWFA 4HCFA 2BHFA 1BQKA 2UX6A 2PPCA 4HHGA 1I53A 2VN3A 2TSAA 1KBWA 1ZIAA 3OD3A 4HAKA 1JZHA 1IBZA 3EHBB 2XU9A 4YSOA 3WKQA 2PP8A 1GS8A 3N2JA 3TA4D 1AZUA 2JFCA 4G72B 2QT6A 1ZPUA 3PPSA 2IWKA 3QPKA 5AZUA 4DP4X 1PCSA 1XB6A 1ETJA 3X1NA 3ZIYA 4DP7X 1AG6A 1WA1X 1J9QA 2FQFA 4GP5B 3NJKA 3UGEA 1GYCA 1JZJA 2UXGA 2AZAA 1A65A 3QJSB 1AAJA 3CVBA 3SBRA 1JOIA 2BW5A 4GY4A 4DP0X 2YAHA 2VW4A 3UACA 2ZONA 2GHZA 5ANHA 5I5MA 2B3IA 2BWDA 1PZCA 3ZX1A 4HCIA 5D4IA 4DP8X 5TK2A 3PAVA 3S3CB 4AZUA 1PNDA 1DZ0A 2VW6A 2GC4C 4A2DA 5PCYA 3OMNB 6PAZA 1NWPA 4DPCX 2PPEA 1FA4A 1OOWA 4K9JA 4F7KA 4YL4A 1BEXA 3FPXA 3NJJA 3PAUA 1NTDA 2N0MA 2HRGA 2VM3A 1E5YA 2I85A 4G7SB 1AZCA 4QLWA 1R1CA 3NYKA 3X1FA 1WA2X 2WSDA 2P80D 4DPAX 2GB2A 1NDTA 1KDJA 4KO6A 2IDFA 4BWUA 1CYXA 1JXDA 2CCWA 4TXVB 4DP5X 2PLTA 1SFDA 1SF3A 1J5CA 1ET5A 2J57A 2J56A 4PAZA 3ERXA 2BWIA 3HB3B 3UABA 2AFNA 1SNRA 1HAWA 1GY1A 3TU6A 2QDWA 1MG2C 1M56B 2PPFA 2IAAC 4DPBX 1ADWA 1BQRA 1A4BA 2XVBA 1WAEA 2HX9A 4MFHA 1IKOP 2FT7A 2OJ1A 3RYMA 3SBQA 4YSCA 2AZUA 2IDUA 4YSDA 5D4HA 3T6VA 5B1AB 3NJFA 2DYSB 3FSVA 4A66A 1W6LA 2YARA 4M4RB 3SQRA 1CC3A 2XUWA 5AKRA 2XX1A 2EILB 3NJGA 1M9WA 3NT0A 4AI7A 1IC0A 1WS7A 4Q89A 2DWTA 3AG3B 3NJHA 2UX7A 4G7QB 2VSMB 3DKHA 5D4JA 1NIAA 3UAAA 1KDIA 1ZV2A 3GXUB 4ZK8A 3HEIB 2YXWA 4UF7C 2VM4A 2W8CA 5I28A 2GIMA 1L9PA 3AY2A 1JXFA 3NSYA 5I5JA 3MX0B 3BQVA 5B3SB 4KO7A 1L9RA 2PCYA 1L9OA 7PCYA 3FS9A 5B7MA 1AS8A 2IDTA 2YAOA 3NJLA 1NPJA 2BZ7A 3S3DB 4E9WA 3IBOA 2GBAA 1ASQA 1OCZB 2FWLB 1KCWA 1X9RA 4YSRA 2PPAA 2HZHA 3FSWA 4WKXA 1NIBA 3AW5A 1QNIA 4E9SA 1L9QA 1A3ZA 1VLXA 1CUOA 2PP7A 2BP8A 3CVCA 4AKQA 2NRDA 2WO2B 2ZWNA 4F2EA 2OCCB 3NJIA 4KO9A 1RZQA 1SFHA 4BK5C 1HFUA 2J5WA 1MG3C 2JXMA 1V10A 2B08A 5I6OA 2EIKB 3IN0A
chains in the Genus database with same CATH superfamily
4BZ2A 3IGUA 5C0EA 1DVFD 4YNYA 4AC2A 3L17A 4PJBA 3N1FC 4JN1L 3NA9L 1SJEA 5L2KE 5DHXB 4G8EB 3P9WB 3FCTB 3MUZ1 1BFOA 1KBKA 4XP4H 3WCYA 4TPRH 1JERA 3OZ9L 1KYAA 4PYGA 2YSTA 5LAPA 3PWPB 5IBTL 5INDB 1EHLL 1QFWL 2WXFA 4ZMTA 1MFAL 4YIQA 5KYWA 1FL5A 8PAZA 3KBPA 1PX3A 3TN0D 4DEPB 3QS2A 1CGVA 1Z9OA 4NJAL 4AYDC 5KSBE 5LGKA 1H19A 3BZ5A 3DV6B 2V2WA 4N24A 2VRAA 3DARA 3VGGA 4W4NA 4YR6B 4IKIA 4C56D 3DO4A 5F6HJ 4QJ4B 4OZIA 4FFYH 1VRSA 4PJXE 1AY1H 3OZKA 3HPJB 1GIGL 2OM5A 1JK8B 3OL2A 3U2JA 2A9CA 3D52A 4XPBL 3J2PA 4AMKH 4O02L 3B43A 1E6JL 1TCMA 3KJ6L 4QHUB 4W6XB 5BS0B 1AO7D 5I6NA 3O3BA 1A6WH 1CVRA 2G60H 1J9CT 5HJDA 3DI2B 5HYJB 3VSUA 3ZDYF 5KOVC 3QQ3A 5H35B 4PTTB 1B2WH 1HHGB 2AXFB 3ZK0A 2ZIDA 1H3GA 2DYRB 3LRHA 4KJYA 1LD9B 2QBWA 1DLHB 1F90H 4QRUA 4N2IA 3QEHA 3ZN6A 1EHKB 3O6LL 4PJFE 4ZO6A 4HJ1A 2VL4A 1FWXA 3DGGA 2P8LA 4L1TA 1ZOXA 3CTTA 1O6SA 2DLGA 5EHFA 4XGZB 2YJLA 1SXNA 3TT1H 1BAFL 4P46D 4Q0XH 4YXLL 3A4AA 1JNLH 1UKTA 4LO9A 1L9TA 1V3LA 2FLRT 4NHUA 4TYUA 3RVVD 3TBYB 4E41A 5J56B 1A9EA 4J8RB 3WJJA 3RX8A 4NQED 3ARGB 5E8DL 3NZ8B 4ANWA 3GIVA 2Q10A 3I2CL 1KJMB 3GHEL 2A83A 2W9DL 3EYUH 2XNAB 3KLAB 3L1OH 3QCTH 1PY4A 1E0OB 1MJUL 1OB1B 2ROXA 4P2RA 4RFNB 4LKCB 2R2BB 5HHOB 5E8NA 4DP1X 2EVJA 3FT1A 3K81A 3OKMA 2HRPH 2FT8A 4X4XA 2X87A 1LO5A 2OMTA 3MLVH 1KWKA 4OCXH 1IEBA 3BSGA 1EAQA 3BUDA 1BZQK 2Y5EA 5ABDE 1MQKL 5CJ5A 1MAJA 4AL8C 5DJ8B 3F6JA 4IMKA 4XC3H 1QZNA 4CN1A 1W0VA 3GI9H 3P3YA 1U21A 5GS2D 3QIUA 2QVIA 3LH2L 4B5EA 3A21A 4HV8A 3X12B 5CILH 1EXGA 4YC2C 4HS3A 3WNKA 4AIOA 3D18A 4HWZA 3UZVA 3AG2B 3HBPA 2NY4D 1CI3M 3GHPA 3S8FB 3IM1A 3W9EB 5EO1B 4ZX3A 3AM8A 1XAKA 3BE1L 1T4WA 4PWHA 2GPZA 3ATEA 4KNUA 4JFWA 4MD5A 3FU6A 4XNZC 4LPYA 1E8YA 3IDYB 2Z1PA 1IGIH 4KI5C 4PWFA 1KXTA 2HKHH 2V33A 5HDQH 1XCQA 5EZOL 1ADQH 4DUVA 1FVCA 4MS6A 2F58H 2PCFA 5C0AB 1UT1A 2EDBA 2XIBA 1LMKA 5LB1A 4ALAH 4PRHE 5F93C 2XWCA 5DJZB 3QG7L 2WUBH 2VCOA 3RI5F 3W2DL 2YPKB 1KTCA 3ZTDC 2VXUH 1DL7H 3RKDC 3HHSA 2HFTA 2V2XB 4LKXA 3GSNH 1OIOA 4FL4C 2ARJQ 3WKMH 1KCVH 1SPDA 2WAHA 3VFUA 2B39A 4KK5D 3QQXA 5DJYB 3VGFA 4Z3FA 2DQCH 1Q38A 3NIGE 1C5DA 4XPTH 5KANI 1I3GH 5B22A 3NFPA 3OQRA 4RFOH 3WJJC 1WVZA 4MJ5A 1FFRA 3CXHK 4W9KC 1DQKA 4XRCB 3DHMA 3LEYH 1ZA6B 3D85D 2YWYA 4H8QA 4E9QA 3HJEA 4AQ1B 1UADC 1LO3L 1G4MA 1SMAA 1OQXA 3JVFC 5JHDD 1DLFL 4KZDH 3S37X 1INEL 1MW3A 2FJGA 4G9DA 4M56A 4PWJA 1MFUA 2F1BA 1UWGL 4UI2A 1YMHB 1F2XK 2UZPA 2DW5A 5C0BE 4G80B 2CBOA 5DLMH 2FSEA 3PQYD 2AI0L 3GSRB 2VT0A 1DQVA 3I9PA 3QISA 2HJKA 5CBEA 4FXGA 1IB5A 3WXVH 1OCCB 4NFCA 3LZFH 4DZ8A 1Z3GH 4X8GA 4DKEH 4IMKC 3LIZL 4X42A 1A1OB 5K69A 2QADC 3QIUC 3OR7B 1JGLL 3H9SB 1KBPA 1QUNB 1SY6A 5A2BA 3QFGA 2DYPB 1U2YA 3HNSH 4HZLA 3AGVA 1BX2A 2KMWA 2VH5L 3CXFA 4L05A 4XNYH 2EDLA 2HVKA 2IOOA 3ILEA 4KNSA 3CZNA 4P9ML 1T3FB 4RIRB 3AM8C 3MV11 2OMWA 5GIRA 1UD4A 2V9UA 4G8IB 3DBXA 3GSQA 4B53A 3EZ8A 3HBGA 4JDVB 5KS9F 1MI5D 4MDIA 5DZLA 4I3SH 3BAXA 3QDMB 3HHMA 2DQDH 2ZWYA 3LB6C 3MV8A 4OLVH 3FF7A 1MHPL 1OGAB 2P80A 2QTVA 2NY6B 4NP9A 4PGCA 3V4VA 1D5RA 5ITFA 4WWKB 4ZS7H 2P8MB 2VRKA 1UJTA 2PWGA 4EBQH 1FYHB 3OAZH 4LMQE 2RA1A 3GEFA 4X6FA 3RGBA 2BS71 1YC7A 3W37A 5MEQA 4Q9RH 5I17B 4AW7A 4ODHH 2BP0B 3IU3B 4M93C 3O2DH 3QFJB 3US1A 2YQBA 3FN0L 3IMUA 3IS1X 2FL5A 1CR9H 2FWOA 1ZJBA 4LEOB 4NUQA 5TGBB 3WFDH 3ZKXC 4HIHA 5D70L 3KYKL 4U7SA 5KVEH 3HI5H 3Q13A 2HCZX 3B7RL 4DW2L 1BAWA 4GKZA 5EORH 4Z7NE 2XPZA 4LSUH 2FO1A 5D96B 1BJ1H 2FATH 4P9HC 5F1NB 3CZJA 4URKA 3S96A 3BWUF 2R69H 5G2NA 3UC0L 3WY1A 3L9YA 4LLVB 5TQ0H 1BQHA 1ZRUA 3FN3A 4QJ3B 5AB1A 2BHFA 1WQVT 3TWCL 2I32A 1DEEB 5GXBB 1R5IA 3MGOA 4HHGA 4HLZH 5HJGA 2NY7H 2H6UA 1JAEA 3WO4B 3LKSA 1CDHA 2C3HA 1UQSB 2XU9A 3HUJA 2WLKA 4FXGC 5FR3A 3LNFA 3PV6A 3TA4D 3QC5X 5ADOL 1NM4A 4FQ1H 3TYGH 1JZ2A 3ULUD 4NKDA 4POUB 3O11B 4WUKH 3WHE0 1QFWI 5T5FH 2BNUB 3X1NA 2DLEA 25C8L 1WA1X 4JO1L 3WDIA 4YHML 3VFVB 1CFSA 1A4KB 3IE4A 4PWGA 1PFOA 3BH8A 4K7PY 2JTDA 4JFQB 5IHUL 2IDCA 3HS8A 3MFFB 3QUGA 5F7EL 1UM6H 4K3JL 4X83A 1VGEL 3VGAC 4OLZH 5I66B 3ULUH 4EI5B 1HQ4B 1S8DA 3DETC 3AREA 3WELA 2A9DA 3GT6A 2BWDA 1MCRA 4HYTB 3E2HB 2CR0A 1F3DH 4LL4A 2DI9A 2DBJA 3BT0A 2IAMA 3Q2LA 5KSBF 1J5OH 4UMSA 3BGAA 4NO0B 1PNDA 1DVFA 2Z91A 3S97C 2OZ4A 1YA5A 5DHYA 3FCGA 1FCGA 3WIFB 3WNNA 5CXPA 5DUJA 1T7YA 4K9JA 5C07D 3EYFA 2IJ0C 4PJXF 3MRRA 4FG6C 1KY7A 3UZEA 4D8PB 1FE8L 1UVQA 3DGCR 4HSCX 1WFIA 3VXSB 3FXIC 3MU3A 4A7GF 2OKMA 3T2QA 3NCBB 5BZDB 2GAZB 1R1CA 2MNJB 1EXUA 2A5UA 1INQB 1WA2X 3FOMA 1KXHA 4BELD 3TN0A 2L4OA 4FHBD 3W81A 2E6PA 1U42A 2BIMA 2NY1B 2YHGA 5SWZD 1H6UA 2XZAL 2CCWA 3BO8B 2WZAA 2Y5TB 2J57A 2J56A 1KCSL 3FULA 4HIJB 3F04A 5IQOA 3R1GH 2YJQA 4FTDA 1N6UA 3ZDZB 4C56A 3FCBA 3TYFA 4WIQA 2KPNA 4H25A 3HC4H 4PVNA 2PPFA 3VI3A 4PJFF 1JWMA 4PRIB 1HWHB 1S7TA 1U8HB 1S78C 1WAEA 2IOIA 5TTRA 1B2YA 1AO7A 4G42A 1G7PA 1YEFH 5KVFL 4U1LA 1P5VB 4U1JB 3V6BR 1R24B 5FCSH 3QORB 4BSWA 1CVSC 1KNOA 3NJFA 4BZ2L 1OOAA 4Z0BH 1XEDA 3HZYB 4HUUA 1MWAH 3TV8A 3T0ED 2ZCKL 1GPOL 3N0AA 5I0WA 4WK2B 3UBFA 1XH3A 3CZFA 3EJRA 4ZX4A 4I3RH 1AP2B 3GBMH 5HHMD 1AQDB 1R19A 3U2IA 3OJ2C 3L4CA 1IC0A 4HX1B 1C5BL 3QSKB 5F1IA 4F20A 3T5WA 1EZUA 4WDIB 5DD5H 1OM3L 2HT4C 4JMNA 3OVUB 3PGCA 4Z7WA 4UF7C 5T1KD 2K7PA 2PTTA 3AREC 4G9FD 1VZGA 3ES6B 4P46A 3MXWL 3SDCA 5AOJA 4WJ5B 3CJJA 3WLBA 3LTVA 1BCIA 1G1OA 3U30C 4C4UA 4JQIH 2KZ1B 3FAWA 1RURH 4TTDC 2P8PA 4NQEA 4QXUH 3K6DA 4HIEA 5L2KD 1EEQA 4PJ5E 5KYYA 4LLWB 4U33A 2K7QA 1DVFC 1AS8A 4QOKA 2BZ7A 4NOFA 3T1FA 3X11A 2PWDA 5EZIL 2CKBL 1DUYA 3MLYL 3HZ3A 3ZLQC 1A47A 3UO8B 4G7YL 1L9QA 3UZEC 3VFMB 4DGVH 2OPCA 1MCHA 4XMLL 3FU0A 1SBSH 1XGUB 3NJXA 5IQ7L 3DIDA 3PU7A 4TUOA 4MCZB 1JHLL 2VLMD 5GGTA 3TN0C 4Y5VB 4ZUVA 3E3QC 1V10A 3EOBB 3QZLA 4N1EA 4KTGA 2NYZA 3PWVB 1N59B 5CJQL 2AEIT 3KNBB 2XTJD 4TULH 1LK3H 2AEPL 3LZQA 1K5NB 1XF3B 1DQTA 1QSVA 1ZT4B 2VR9A 5KVDE 1SXSA 1ITBB 1YAZA 4GSXA 4UILL 1MVUB 1PLGH 4RGNB 4JPIA 1TLMA 1I7ZA 2ITDB 2ZKWA 1KBGH 1NOLA 2VXTH 5IB2B 3UTOA 2V5TA 4CN4A 5AVZB 1KTDA 1JZIA 3GMOB 5IROD 3NA4A 1NEZB 3S9DB 3CU1A 2Q2EB 2H32H 1YHPA 4FP8L 1J0KA 4HVBA 4XVTL 5A7EA 3VFPB 2OXHB 2X6CA 3NIGF 2OI9C 2SODB 1WWAX 1E90A 2N01B 3SPJA 5A2KH 1YNLL 1A6ZA 2I69A 3NA9H 4JN1H 3DUUA 3FCSA 2NNAA 1AD9A 3OXSB 4IEFB 3D3VB 2EKJA 5BRZE 3SDAA 3LZOA 1ZA3A 3B7YA 5LGJA 4PG9A 1DSWA 3NCCB 4HKJB 4S2SB 4OGAD 3JUYA 4ZD3L 2WSPA 3JV6A 3NP3A 2JI3A 3QNXB 2JIXB 5AW5B 1MFAH 1QABA 4P46C 3SDCC 2CK0H 2UZXA 3KPLB 4Z5RA 3RVVC 2FX7L 1XAUA 3PWPE 2MMXA 5TDPA 2WTRB 4BH8A 5CWSA 1P2CB 3P73B 5E6ZA 2EE2A 1PY0A 2AQ3A 3AMKA 3VDCA 4WHTB 3LS5L 1IBHA 5I0DA 5ITBL 3IDIB 2PWEA 3V0IA 4BE6A 2E86A 3VM7A 3RHWF 4M3KB 2QQLH 1D9KB 1MCCA 4N5ED 4ODTL 3WUWB 4DEUA 2CNYA 5JUEL 2WAQA 1VENA 1G87A 1YEEH 2JJTA 2V3EA 3HC3L 3MJ9A 2H47C 4NN5C 2WWKT 1E6JH 2NW3B 4HG4K 2VMFA 3HBQA 2FEDC 3D2TA 3H3PL 1P0SE 1AC0A 4C59B 2DQ6A 2OYPA 5I26A 3SPGA 1N8OE 3SKMA 5B3NA 1YY9D 2DQGL 2VSKB 1AGFB 2VKWA 3APMA 5BS0E 2AP2A 3PDOA 5B1JA 3NN8A 3W39A 5CINH 4RDQF 3C08L 5HYJE 4QTFA 4X5WB 1DQQB 1I9JL 2PR4L 2IALB 4HW6A 4A2HA 5EG6C 2PXYA 3O6LH 3SPVA 3TURA 3VWKB 4P5RA 4CRPA 2OAAA 2NY4C 2VDQB 3KPPA 1TEYA 2BP8B 4XH2A 4BYHA 5EIIA 3MRQB 3X17A 3KL0A 4X6BB 4PRAB 2KDYA 4V2BA 1A0QL 4WUUB 4C4KT 1X44A 3AFLA 4NB7A 1RZGB 4UV4L 4CC1A 2HX7A 2OSWA 3EKCA 1B90A 1MPAL 1XZ0A 2LLNA 3LRSA 4YLBA 2VMJA 4YFLF 4OZFB 5GGVY 4GW5B 2ATKA 1Q0EA 1U93A 3QYCA 4FQCH 4PH8A 2VDNL 4PRHD 5E8DH 4H44C 1U8KA 2GC7C 5IG7A 3DRTA 1G6RL 3VFSA 1H15A 2CJ3A 2H1PL 5D55A 4P9HL 1IKFH 2MIZA 1MJUH 3IEAA 4JDTL 4K2UH 2APSA 1AGBA 3ZGHA 3SDAC 4BIKA 3BAYA 3S36H 2CU9A 1E5AA 4D2NA 1IBBA 5HHOE 2CR6A 1AXSB 2Z92A 4X9BA 2XC8A 5IREA 4KK5C 4K4KA 3I74A 4GQQA 1TTUA 2EXYD 3OPUA 4H0LC 1MQKH 3T9WA 1D5XB 3IBEA 1OAJA 2MTPA 4YUEH 4P5SA 4X7EC 1JXKA 4LNRB 5FYLL 1OCRB 1OSZA 3LH2H 1IUZA 3QWRD 2BY0A 1D7DA 4PRBB 4PVLA 1MIEH 2NZIA 4XCEB 3ZKMC 4NZTL 4BZ1L 1ZTXL 3UAJD 4ZYKA 5CZVL 4ZSOA 2AJ3A 3BGFB 4KMTL 4BK8A 2J3SA 3HS0B 1CFBA 1XWVA 1AANA 3BKJL 4NT6B 5CD5D 3BE1H 1UA7A 4X5RA 1KBVA 2ADIB 2GSGB 1SHXA 3FYIB 2Y1ZA 3HFMH 3QO1A 2VABA 1BXVA 4U6XB 2ZOKB 5CJBA 5T3XD 3ZU8A 3W0WE 1TJGL 1W8OA 2W07A 1G7JA 4HFWB 2VDPL 3HC0A 5FO7A 5EZOH 1OXYA 2AERT 5B1JC 1S7UA 2XG5A 5FPIA 3IF1A 1OE3A 1JXGA 3KHOA 3QJHA 2D8KA 2ZXCA 2PXYC 2RAMA 1HCFX 4WFEE 4GKOA 2XY1A 2BK8A 2YAEA 3QG7H 3WY4A 1U8QB 2CO6A 4XVSL 2ZNWA 4EUPA 5KSVA 3EUDA 2CQVA 1ZDSA 1SHSA 2C9UA 3C6LB 4EOWL 3P0VL 5ID0B 5C08B 3SGJA 3QR1A 4NO3A 4HBCL 1L9NA 1XGZA 2JJSA 2WXPA 2D9QB 4IRZH 1HT6A 2A6IB 1MCOL 1TZHB 3D0VA 1JZFA 1SF5A 3ELQA 5I74C 3FQNB 3WE6A 3LPOA 5C6TL 3QZWG 3S3SA 1C7TA 1LO3H 3EXLA 1IGFL 4NERA 2F7QA 3DV4A 5BO0D 5C9JB 3BYYA 4BEIA 1JPTL 1DLFH 1ZANL 5KS9A 3JYBA 5IUSA 1INEH 4IRJD 2DMHA 4ABVA 4ACPA 5J4MA 1UWGH 1FZKB 3IJSB 2IFFH 3GMPA 5C07A 1IKNC 2XWDA 3NQKA 5JIKA 2EYTA 5TPWL 3WMQA 5FKPA 1S9WB 2H9GA 3SE3A 1F6LL 4DCQB 5ANME 2YR3A 3HZKB 2WLHA 5HTSA 1B4LA 4OCLC 5ABZA 5BJTB 4V1DE 3GZPA 4Z3HA 3BI9X 4J3BA 4POYA 2OJZH 3LIZH 3P40A 3MBWA 1JGLH 3MJ6A 1JPGB 3GSOA 2DKSA 3SD2A 2VH5H 3L45A 4Y2DD 4M8QB 3EJTA 3S2CA 1BIIB 3W56A 2BY2A 4XVUD 4C83B 3GLDA 1CDBA 1KGIA 2HVBA 2ZCZA 1B0IA 4P9MH 4KBPA 2QVFB 1Q90A 3S35L 2VR3A 3B7SA 4J3OD 5CCKH 1T21B 3MRGA 1KJ3H 3BUIA 2BCKB 5D71L 2VLKD 2G2PA 4ETYA 3MJ7B 1U41A 2VSDA 5HYEA 4U1NB 3RJOA 1RUKL 4LL9A 1ORQA 5JTWA 5JPNA 2YKLL 5AW6B 2J25A 1CE6B 5CIPH 1E9QB 3KE0A 3SYOA 2SEBA 4XNXL 4F2MA 1LXMA 3H56A 5DK2B 3VD3A 4J3OH 3MMEB 3T0EA 1OGAE 1GZPB 2N59A 1MHEA 4JM2A 4FADA 4J1UA 3OM3B 3DX6B 4ZTPL 5SWSA 2HX8A 3AITA 1JBJA 4BSVA 1MZZA 5E7FA 4JO8A 3U2SB 4UDUB 4OZHE 4ZDHA 5B21A 4EMZA 3BCDA 2QVMA 2VDOB 3CE1A 4LSPL 3AU1B 4TNWK 3FKUS 4M7ZB 3RWEB 4JRXB 3L4XA 1VB9A 4ENED 3ME0A 3MCKA 3FN0H 2JJSC 3IETB 4U1KB 3IJYA 4X8JB 1CTNA 5T1KA 5CEYB 4AVIA 1TG8A 5GGRA 2MPAL 3KYKH 2LT9A 1ZPUA 4FFWD 5K1VA 3CHOA 1JPSL 4M1DH 5L2KA 5T3ZL 2IBZY 2C7UB 5FXCH 4LCWD 1HHIB 1P7QB 2KT6A 3GI8L 4V33A 1CIUA 3O81A 4N90E 2W95A 2NYYC 2D0HA 1GYCA 3STLB 3UC0H 1T0NA 2IPKA 2Z35B 3CHQA 5FWQA 5LBSA 3T2OA 5K59E 1Z9PA 2KPWA 5F2FA 4ZFQA 2QHRH 4ZFOA 1BMZA 4DGYL 3SE3C 2QVTA 4MCYA 5DSCA 4Q52A 3E1ZA 4GY4A 2APBA 5F7NC 4PHXA 5DEJA 5AW1B 3QDJE 3MROB 2MCG1 4MWFB 5KSBA 4LPCA 3SZKC 3L5WB 4NNYA 4XI5D 2CBQA 3ARYA 5ADOH 1O6TA 4M29A 3WTVA 1B6UA 4XAKD 4DP8X 2OTPA 3LN4B 3CD4A 1KPUB 5MEPA 3STBA 4PPTA 2ZSWA 3BMVA 4PJXA 3SDDB 4ANUA 4YHMH 1A7NL 5BCAA 2ZOWA 4YDVA 2CMRL 4LXFA 1FA4A 2J5LB 4JFEB 1AHWB 4A7GA 1KIUA 5DT1L 2I9LB 2X3CA 3PAUA 4QUOA 5EC1B 2UZYA 5DS8B 5F7EH 3FTSA 5ICXB 3B6SA 4K3JH 1J11A 3V7AE 3CSTA 3T6QC 1VGEH 1U95B 2A74B 5JPNC 5I1HL 5IROA 4M8RA 3NYKA 3X1FA 5IEHA 1KDJA 3BWUC 5DURB 3Q6FA 4AEEA 3GUTA 3SSGA 1NCNA 1DO5A 3G08A 3D33A 4N1HB 5A2AA 4PJFA 3T0EC 1M05A 3T0BA 4JM2C 5AB9A 1S9VB 1U3HD 4EZJA 3V0FA 2VE6B 2BWIA 3ZIMA 4YGVA 4AEFA 4FD0A 5J0BA 1X5HA 3D05A 4QTHB 2Q76B 1REIA 4KX8A 4TL5A 1G4RA 1HEHC 1B4JL 5SX5K 2BX5A 1NFIA 4A6YA 1FE8H 2A6JB 2WXGA 3QUYD 1OVZA 1I7UA 4PJ5D 4IU2B 2CXGA 3BIKB 3G5XA 4NQCD 5FM4A 4FA8A 5D4HA 1T2QH 1BV8A 3T6VA 4UMGA 3VO0A 4G6ML 3VXSE 3TF4A 4UTBL 3ARFD 2G75A 2XZAH 6TAAA 2ZUWA 1CC3A 3QFDB 4U0QB 1JNNL 3HE6D 1FL3B 1J8KA 1FHGA 4FGMA 3WN5A 5F7KC 3OAYH 1JGIA 3V5KB 4XR8C 2UX7A 4ONOA 3WU1A 1WBYB 1TVBB 4JB9L 3C60C 3O8XA 3ZDZE 4LNVA 5GS0C 3BAEH 2QR0B 5EF2A 3BD5A 1UOVA 1L9PA 3TFKD 2HFFB 2ENQA 3D2UB 4GIAA 5KVFH 3T0WA 3B2DC 4FMVA 3DX1A 4BZ2H 3WTYA 1EFXB 1OB0A 1WFNA 1K8IA 3RVWD 4JY5L 5FO8A 5FDWB 4HPOH 2ZCKH 5L2JA 1BPLB 1P4LB 5D7KD 5D6CA 1NPJA 4ZW7A 3U4EB 2GUOB 4IJ3B 5AQ0A 2XVLA 5KZCB 4UQ2A 3EGXB 2OR9L 3JTSB 3OQ3B 3KL3A 1IO4C 1VADB 1C5BH 1QASA 1LMIA 4WKXA 5IIEA 4M4PA 5EIIG 2JLLA 3DI3B 2PP7A 4F2EA 5BXFB 4OKVB 1MSPA 1THCA 4GRLD 1E2VA 1SFHA 2D4DA 1H8LA 2BS8A 4LQFH 4AYFA 3CFUA 1X5KA 4X5XA 1TCRA 3MXWH 4AYSA 1Y6MR 1WZKA 3A4EA 5ELIA 3IPBA 4P3WA 2AJZB 4PRHA 5DD3L 5T1LB 5I5IA 1NICA 2EC8A 2EXWC 4N25A 2GTZB 5BRZD 1RY7B 3VG0L 3K6SB 3MRHB 1WH0A 4MS8C 3L3HB 3RVUD 1KB9K 4OZ4A 2CKBH 1JTTA 1U3YA 3AS1A 5CFAA 3MOQA 1WLHA 4PJDB 2MQCA 2EIJB 1MCWM 2F6AA 3JZ7A 1BWWA 4G7YH 1ZIBA 2F61A 4JS7A 1Q9WB 4NBXB 2XFGB 3K3QA 3HE7D 2WQSA 4G71B 4IHOB 4YDMA 2OMZA 1IC1A 2YK1L 1JHLH 4HOZA 3FMGL 4N2CA 3UTZA 2XKNB 4B7IA 1SBBA 4UU9B 5IMKB 1RZ8B 4FLHA 2NZ9D 3P0YL 5CJQH 2HRHA 2BOLA 2WD0A 1HHJA 3DXAD 3VXPA 2AEPH 1JVOA 1MCJA 3QWRA 4PMFA 2FHBA 3RWIB 5A7BA 3WN5C 5C7XH 1JZ3A 1IBGL 3UAJA 1HWGB 2XXCB 3QQDA 4FNSA 5TE4L 4Y7OC 3G3LA 4UILH 4XMZA 1UA6L 4KKCC 4N5EC 5IUCA 3O8XC 4G7RB 3H0TB 1TQWA 5DD1L 3I6LD 2NQCA 3F7RA 4OAWA 1MFEH 2ZYSA 3LEVH 4IOIB 3QWQB 3I6SA 4PIRF 1Q9OB 3CDZA 1YY9C 1XSJA 4PB0L 1O5PA 1EAPB 4IIQA 1LDPL 3STZA 4HCRL 1YNLH 1OCOB 4G1MA 2ADFL 5JORA 2X1OA 4QRQA 4YEFA 3UOAB 2OR8A 4O00A 3LV3A 3DO3A 2PMZA 3D3VE 1FGNL 4KU1A 3TH3T 2YAMA 2WCSA 2ICWA 1PYWA 3VI4B 2K3TA 3W38A 2VJ0A 2F54D 2FX7H 1CGSH 2HUHA 2A9AA 2WVSA 5HHQB 2DICA 2VN4A 2GJ6B 3BKML 3DX7B 4MNGE 2ZZUT 3T77A 1CK0L 1CBVL 3L7EA 1ZLSL 2AMUA 3HKZA 3IJ8A 4N8PA 3WNOA 5FUOL 2ITCA 1CLYL 4W93A 2YA2A 4FFZL 2ZP9A 4PI2A 2AAAA 2BSCA 4H26A 4JN2A 5FF6B 3TVMB 3IXTA 1RJZA 4PYHA 1ID2A 1BZ9A 3NDZE 4IRJA 4ODTH 1KB5L 1UB6A 3Q3GB 5JUEH 5LNGA 1WUNT 3HC3H 3GWJA 5DJDA 4D0BA 1HEZB 1RK1A 2ZUQC 3LH9A 2AQTA 4JQVA 5F71A 5TK4A 4DIXA 3OXRA 1NKRA 3H3PH 3GMLB 2EXYC 4F7EA 3NCXA 2DQGH 5EU6D 4ZAKB 1Q9KA 5E00B 1J05B 5IM7A 4QHLB 5BZXA 1PY9A 4NRXB 3C08H 4I0PB 3EH5B 1UD8A 4CVXB 3GMMA 3V0DA 4KHXL 4BK4A 5D2LB 3P4LA 1KC5L 4A7VA 5CMAA 3Q05A 3PP4L 4ZFZA 1N8ZA 3MA7A 4DKFL 5H94A 5E1AA 5C3LD 4Z3TA 3BKYL 3W0WD 5DZNA 3RWGB 4OZHF 4FQXD 3LNIA 2ZXAA 4UV4H 2VLKA 4B97A 3MCG1 3Q8BA 1MPAH 5I6KA 1JYWA 4WNJA 4WUUE 3SQBB 5FX3A 5CAYB 1LNUA 1MWOA 4WK4B 5IOPA 1OLLA 4IIQC 4UOQA 3AQZA 4KKBD 1G6RH 1YNTB 1S4IA 1JV5B 1EERB 3D39B 4K71B 3NCMA 3CHSA 2VN5A 3NJMA 4E5XA 3DTXB 4PBWD 4JDTH 5DGRA 1G7IA 3ZL2A 1F4WL 3TIEB 1YYCA 2Y2YA 1AIZA 3LOWA 2AGJH 2FLMA 2Z4QA 1TKWB 2K9FB 4AIZB 3G9VA 1D7CA 2BNQE 3QJUB 4L2YA 4X0NA 5K59F 3DMMB 4BXVA 3M86A 2BY1A 2EYSA 4AQEB 4YSQA 5BOPA 2IPTL 1ROCA 1A6VL 4HUVA 1WFUA 2X4NB 1T20B 4R2GB 2YSSB 2TSBA 3H55A 4KNTA 5HGDA 1FBIL 3GRWH 2EDXA 5FLUA 3EOAA 1V3KA 4ZUUA 4U6HB 2JCWA 5CN3A 2VR4A 3SBPA 4BZ1H 4NZTH 3W5MA 5DMGD 1OTTD 1S7SB 4EO5A 2ZWKA 4IRJC 1P5UB 2R2HA 4KMTH 1GGCL 1PZ5B 2OMXA 3ARDB 4O2FB 4C8XA 3N5AA 4D9RD 3BKJH 3MNDA 2IGTA 3DIFA 5EFIB 1I3RB 4G1EB 5D7IB 3SD5A 4Z77B 2VIRB 4LU5L 3F7VB 4QKTA 1A2YA 4JQVC 1IRAY 4V1DD 5MI0B 3U6RB 5DRXB 1VACA 2YEQA 1JNJA 2CSPA 4BV1A 3BZ4A 5C09B 4GAJL 5K1JA 1TJGH 2VR7A 4JFDB 4FG4A 2VDPH 1IM3D 4F33B 1VFOA 5AENA 5J12B 3I02A 4CADA 5IJKA 3GMNB 4J4PA 1YEHL 1XR9A 4KX9A 2H1LM 3H53A 4I8DA 3UPCA 5IMLA 4F27A 2WZ5A 4FEIA 1USQA 1JFQH 1CB4A 1O9ZA 1RIHL 2ADJB 2WB1A 4XVUC 3RPBA 4DKAA 4RGMC 1I8LA 2L7QA 5T33H 3HA0A 2UY6A 3EGSA 3W57A 4XVSH 4AKOA 2ZYIA 4ZG1A 2A73B 4F57L 4B95C 3QHFL 1FORL 4RNRB 1UASA 3P0VH 1GZQB 5F9JB 4HBCH 4YS4A 4WGWB 1AR1B 4RDBA 5E8OA 4UOJA 4Z76A 3DJTA 2DLTA 1VGKB 2X6VA 3ML8A 5C08E 1MCOH 2ICES 4G70B 2AJVL 2CIKA 3P11H 1KPVA 3ULSA 1CJYA 1E4KA 5DJ6B 4RAVB 1WWBX 1Z9MA 2QMKA 4EEEA 2WXJA 4GRWB 4UANA 4WTXA 3GLZA 4OGQC 1IGFH 4W68A 1JGUL 3C5SA 1JPTH 1TVHA 2QFPA 3FU7B 1ZE3C 5TFSL 4ES8A 4AC4A 3E6FA 3PS6A 3S5LA 4OSUL 1F02I 5GS0L 3BUQA 3ABMB 3BKCL 5TPWH 2AHIA 4PJ7E 3AGWA 4ENEC 3BVUA 1J8SA 4L4JA 2LU7A 1I1RA 3BESR 1ED3A 3ZDZF 4KMQA 5CLTA 5ECJE 4FX5A 1HXMA 2Q86A 3CZGA 3BUYB 3QHZL 4PJ5A 1BYNA 2YXMA 4YHPB 5D6DA 4H88L 2DTSA 5IGXL 4N90D 2DMGA 3ARFA 1A9BB 1E65A 2XQBL 3CV5A 4JZOA 4KRLB 4OF6A 4NO2B 3QG6A 4J23A 3HE6A 3CSYB 1SQ2N 5CR1A 1CF1A 4MXVE 2ENSA 1ES0A 3S34L 3QDJD 4YDJB 5IVNA 3S35H 1XMWA 2WVVA 3E0GA 1OHZA 1ZIAA 5F7FA 1A6UL 1JZHA 2BINA 5D71H 3QAZB 3BFWA 4KAQH 2YMXH 4Y4FB 2CPUA 1DQDL 5FCUL 5F44A 1RUKH 5BV7H 3I6GB 4IK7A 3MCLL 2YKLH 4Q6IB 5EZJA 4L29A 4N2LA 5I8KL 5IJKC 4XNXH 3T2PA 3MLPA 2YD3A 3IDGA 4J4PC 4WI9A 3HMWH 4XMTA 2FK9A 3C6EA 3WFEL 1MFVA 4P5KB 1AFVL 4HUXB 1U8IB 3KBEA 3SE6A 3R0NA 3EJJX 3ARZA 3L48A 1I8LC 1SOXA 4X4YA 2C9PA 2X40A 5DDHA 3CH1A 4B9FA 1G7MB 4QRPE 2C1OB 5I9QC 4DP0X 5I1LA 1TQCB 3A4FA 2AABL 1SVZA 3ZE2B 2CKNA 1A8JH 4Q6YA 5F7MC 5JXEA 2G9HB 2NDFA 2B1AL 3MRCB 1X5ZA 4HD5A 2Y2WA 1PZCA 2MPAH 5DJ2A 5KSUA 4HUWA 2DEYX 3VD5A 1E4KC 1J10A 4GFTB 1U8LB 1JPSH 5FYJD 1SLXA 4LVHB 4AZUA 5T3ZH 1Q0XL 2PR9A 3TCXA 1J8HB 2HRLA 2ICCA 3TBWB 3OMNB 3CBJB 5BRZA 3RWJA 2AV7B 4ZFFA 1G1KA 1OOWA 4ZS6D 4F7KA 3RZCD 3FCTA 4YL4A 3FBQA 3FUMA 1LWRA 3FPXA 1NUFA 1QX1A 3KLLA 3IMRA 4KZ0A 2QV2A 2X4SB 2YD4A 3ALWA 3KWWA 4G7VH 2ZYRA 3Q2CA 3HE7A 2HFEB 3K80A 4J39A 4OTXL 4DPAX 4OGZA 4Y1AB 1SJHA 2EYRB 5IQLA 5D6DC 3O0RL 2X42A 4NDMB 4TXVB 4NXSA 4KZEL 2XI9A 2A6DA 2DH2A 3ARFC 4M02A 1X9LA 1XGRB 4ZO9A 3SO5A 3DXAA 4JO5A 3HE6C 4PW4A 3TU6A 1E9OB 1L0YA 3NUKA 4YR6A 1KGCD 1FH5L 2CMRH 4L0ZA 2X4UA 2IAAC 1MCIA 4G6AD 4WEBH 3ZUNC 1UZ8B 1XTLA 3HPJA 4HS8L 2N3JA 2WBWB 3NCYP 3D07A 1NCTA 4J2XA 4JFEE 3MRMA 2HMID 3RYMA 4ODVL 2WM0A 4MSWB 5I1HH 1Q0YL 4JFHD 3TFKC 2CCLA 2AZUA 5BS0A 3DC0A 4GT7A 2Z31B 2YN5A 1RULL 4HJJL 5HYJA 3UROR 1KEGL 5H35A 1OP9A 4PTTA 1LEGA 2NYKA 3RVWC 3TPUB 4IBWA 2ITEA 5E9DB 1MUJB 1NUGA 5AKRA 1OAQL 1LD9A 1ONQB 3BQUB 4YZWA 1AH1A 1OPOA 4JFPB 2NY2B 4AI7A 3MUGB 2YWZA 5ICYA 3AG3B 2C9SA 3VFTB 2R0KL 1NGWA 3AJ7A 4IDJH 3S8WA 4DUWA 1B4JH 3W1ZA 5JXEC 2GTQA 5SX5H 4L37B 4XGZA 4Z78A 2DDQL 1JXFA 3PFUA 2J1ZA 1XHHA 1H5BB 5TF0A 5B39A 4MCMA 5DJXA 1MAKA 3DVGB 3OKKB 3TBYA 1PQZB 2PCPB 4UTBH 3L3DA 3T65B 1FI8C 4PV9A 3CFKB 4BA0A 5L4FA 4IGBB 1WBXB 2F08A 3SKJL 2R4SH 3F7YA 3KLAA 1JNNH 2VQ1A 5CNHA 1MELA 4AQAB 5HHOA 2AXGB 3RVUC 2OZNA 2PPAA 4K8RD 4UQIM 4Z3JA 4EIZC 3MLRL 4UNTA 3RWDB 2HTLD 2WXHA 3CVCA 4LPTA 1BP3B 4UQAA 1XF5A 4WI7A 3CFEA 3HE7C 5T1DL 2EJ1A 5A43C 4M43L 1V7NH 1YEGL 4HJIA 3VG9B 3D4GA 4DEPC 5AWNL 5EU6A 2NZ9C 5DJ8A 3TBSB 1TO5A 4JY5H 3ZBMA 4KXDA 1A22B 4QRTA 1FO0L 1UKSA 3GQFA 2NSQA 2OR9H 3IFOB 3ARBD 2WQWA 4I7ZC 4QHNB 3TF7C 1CG9B 1JTPA 4X6DE 2GCYB 4I87A 5EO1A 3SE8L 4ZUWB 3TNNB 3W0WA 1X7QB 1J7VR 4FQXA 5IB5A 2E9IA 4J3VA 2RMNA 1PW3A 4UTAA 3U7YL 3LHAA 3MNWB 2WOYA 1OW0A 3US0A 5MHSE 3UFIA 2XZCH 4ZPTA 5DD3H 3QQ9D 2XBDA 2IWEA 3K0YA 1YEJL 4Q7DA 1RZJC 5LBVA 5TE6H 5E8EA 4E5XG 2WWNA 3VG0H 3TLRA 3RY6A 1T4KA 2VXVL 12E8L 5DJZA 3BP7A 1W8EA 1IEHA 2E0PA 2YPKA 2R2EB 2JWYA 2GJPA 2V2XA 1BXAA 1C12B 4AUJA 4PJDE 3TXAA 3QCUL 3TASA 1QA9B 1KEML 4A2FA 4J8QA 1LL1A 3V5DB 3FMGH 2WSKA 1ESOA 3RNKB 3LVTA 3S98A 1INDL 1S9KC 1T22B 2C4FU 5BNXD 3P0YH 4AJ0A 4CUCA 3V5HB 4AQ1A 3FSAA 1MREL 1ZHLB 2LTQB 5HSFA 4RFNC 3QUKA 5GRJL 3FB8B 1IBGH 4NENB 5TE4H 1YRKA 1D5BA 5D5ME 3RUGB 4W6YB 1FNLA 5ANMA 5DD1H 4ZRGA 4AJWA 3EUUA 1FJ1A 1PF3A 1YMHA 3R06B 4HLEA 2P7TA 5EEXA 4V1DA 3GSRA 3OKDA 1IQWL 2P5EB 4OB5H 1L0PA 4IU3A 5DHVA 4N0YL 4PB0H 1QBMH 4JLRA 2FJFB 4NPKA 5AG9A 1CWVA 5DK3A 4FI7A 3NZUA 1A1OA 1LDPH 3OR7A 3TCLA 3LDBB 4HCRH 3X3FL 2DYPA 5IWLA 2WQXA 1ODUA 3ZO9A 2Y1VA 3CFQA 1T3FA 2YEZA 3GHBL 4UOZA 4W1TA 4WW2B 1L6XA 1NCAL 3O2WL 2APFA 3QPQD 4FQXC 4BKTC 1R3JA 1FGNH 1HYRC 4N0FA 4PU2A 2FUTA 1KV7A 2XV3A 4PJ7F 4MAYD 4ETQB 2ALWA 2B8OT 1OW0C 2CGZA 3BKMH 4X9FA 1CBVH 1CK0H 1OGAA 1AJ7L 2Y23A 3VI4E 1ZLSH 1GW0A 3CVIL 4KKBC 5FUOH 3UYOD 1A1NA 1CLYH 4E9LA 1EX0A 2GJ6E 3O3AB 32C2A 4FFZH 3RY6C 4WWKA 4OZHA 2P8MA 5GGSB 2I7OA 2BNQD 4JKLA 1GOGA 2WLLB 3S5LG 4RISL 1TR7A 3C5ZB 1KB5H 4WJG3 4YOKA 3D30A 4MXVF 4F5CA 3BP6B 1PLAA 2BP0A 2CDGA 1RUAH 2EINB 3A3YB 3JWDC 3NJNA 4OCSL 4LEOA 3GJFH 3VH8B 5D9SB 3BJ91 3V9CA 4N9GB 5KBMA 2BNRB 4WNQB 3KXFB 2RD0A 1YNKL 1EEYB 1EFQA 4AM0Q 4AQ1C 4HWNA 2X0WA 4PGEB 2ODHA 2WBJB 5C1MB 2OXGB 3N91A 2AXWA 5DMGC 4MGXA 1KC5H 3DO7A 3PP4H 4R7NB 2FTAA 3CH8A 3OTTA 4LLVA 3WLWD 4DKFH 3QDJA 5D2LE 5HHPA 2EVHA 3ASNB 1DEEA 3BKYH 4BDVB 3EFFB 3RWHB 3FL7A 3VFRB 3DSNB 2JH2A 2O5YH 1UQSA 3RIAF 3E1F1 3ETBF 6PCYA 1YPZB 1VERA 1LHZA 4PLJD 4XNQA 3L7FB 3UADA 3LHPH 5BQ7B 3O11A 4KQ3H 2ISDA 4ZMAT 2AQQA 4LBEB 3N40F 3RPIB 4ELME 5IWLC 2KQNA 3QA3A 1A4KA 3SKOB 2B77A 2YAFA 1F4WH 3D39E 4YXHL 2OTUA 3IAQA 4AEIL 1KIPA 4G43A 4XOEA 3RIKA 5DLLA 4J2QA 3MFFA 4NQDB 5GJTL 2Q8BH 2IPTH 1E28A 4EI5A 3SGEI 4HBQA 3NEEA 4LHJB 2BJML 4GIPD 5B1BB 1I85A 5GZND 1R47A 1EHNA 2OX5B 2RQ8A 1JVKA 3HAEA 4CNIA 2FZ3A 1FBIH 2NY6C 3KR3H 1OTUC 4JKPL 3P02A 2X1WL 2LE9A 4WWKC 4NO0A 3ZVVA 4AQOA 5EIQA 1O9VA 5JLZB 1BYOA 1SJVA 2FQGA 4MNHB 4R5VA 2OYMA 3OHXA 3N04A 3AWEA 2FECL 3FONA 4IKNA 4LU5H 4OI8A 4OU3A 4D9LH 4D8PA 4MYWB 3DJ9A 3QUZB 4U05A 4XB7A 5D7IE 4GAJH 5BZDA 5I6MA 2B9AA 4I1RA 3LAFA 2NXZD 3RVXC 1INQA 4JHAH 3TT3L 5EOTA 5C09E 1TNNA 3F7QA 1N0XL 4GI9A 3MGTB 3RGVD 3CMOL 1EPFA 2DI7A 5T5NF 2OSLA 4HIJA 5TDOB 1OAXH 1RIHH 3D09A 1KG0B 1EUTA 1NIFA 1IIIA 2R4RL 4GYBA 1DJSA 4MMZB 4F57H 1MH5A 3PGFL 3QHFH 4UIKL 3UCRA 5L0QB 5KAQF 4GQ9H 4HKXB 4XBGA 3T0XA 2TRHA 2COVD 1U8HA 2G3ZA 1AI1L 1JMXA 2IADB 2DMKA 2PKDA 4JANB 5D1ZI 2EP6A 3N1PC 3OKOB 3VSTA 4DTGL 3EBGA 1V54B 2AJVH 3AADB 1R24A 5CEXB 5FB8A 4LSDA 4TKWA 1JF1A 1YUHB 2DQJL 1FIEA 1JGUH 4QRPD 3B37A 3E6HA 1QLEB 1N12A 2CBTA 4PLKD 1FZMB 5EO0A 4KH2A 1VPOL 4AVHA 5EDSA 2IEPA 2NOYA 4HX1A 4B3VA 4OSUH 3EHBB 3BKCH 1LVEA 3BPNC 1GAFH 2EDEA 2EO9A 3MUHL 4OJFH 5IV2B 2R51A 4EI5C 3MLWH 4LPUA 1I85C 2QT6A 2WZ6A 3QHZH 1TT6A 2YPVA 3E2HC 2GIXA 3OJMB 4OGXL 1JUFB 4PRNB 4H88H 4QWWC 1DSYA 1UUNA 2IBBA 5CCHE 2ICWI 4LLYB 5IGXH 1TVDA 2XQBH 4DK6A 1P7QD 3U36B 4GXUN 3RL1A 3KPSE 5JO5B 2YUZA 1MHCA 3LNEA 4AENA 4KKZA 3TC9A 1EANA 3UYPA 5HBBA 1U8CB 3QULB 4C58B 1QFWM 2PYEE 3HNTL 2JQMA 3L4TA 5C0GB 4PQXA 5GRYA 2B9BA 2ZQKA 4LMQI 2N56A 3QUMH 1K4CB 4Y9FA 1A6UH 2YAHA 5M95B 2R39A 1JPFB 1PKQB 5DUBB 3A6OA 5ACZB 5FCUH 3NBNA 4X6DF 1DQDH 3BP4B 1G1CA 3B2UD 4AE0A 1MQ8A 3A67L 5GSRB 4MCZA 2W0KA 4AMWA 4GB9A 1CYGA 5I8KH 5TK2A 2EC9T 3DX9B 5LG6A 4BGLA 3QR0A 2W5PA 4JGJA 1E4HA 1T1ZB 1DZ0A 3LNGA 1N59A 2HPOA 1RZJL 3B34A 3K8KA 1AFVH 1NCCL 1QHPA 1Y6KR 1F18A 1R5VA 2ZUYA 2B14A 3CSPA 2BHZA 1NMBL 2NX5B 3GMQB 3KM2A 3NRPA 5ACMA 5J7CC 1C7SA 1YEKH 3ARBA 3WHXA 1SHMA 2CLRA 3I9GL 2ITDA 3F83A 4CILA 4QLWA 5JA8B 5IB2A 2HMIC 2X3BA 2B1AH 2VLLB 3GMOA 4NRZB 4GSUA 4JFVA 3SDYL 5DUPL 2ARJB 3L4UA 2I27N 2YXFA 2J43A 4PJDF 4QRRE 1J1PL 1RK0A 2OXHA 2ENYA 4F37F 1BZEA 1R3LB 2A77L 3FTYA 3QR2A 1RFDL 3QCVH 2MQ0A 4FFVD 1KTKE 3KPMA 4JY6B 4M9PA 3AAZA 2DQFB 2EDTA 3GJEB 5DVPA 4JRWA 1WTLA 2Z7ZA 3QZNA 4AW4A 3RJDA 2AJSH 2HVJA 5M7QA 3OXSA 1NMAL 3LKNB 4M7KL 1A4BA 1IAIM 2J6WA 3D3VA 4ZMYA 2Y7QB 3HMXL 4K5MA 1IKOP 5D5MF 4HKJA 1TTRA 1X6NA 3QNXA 2E6QA 2HFGH 2BFVL 4MNGA 1BVNT 4OTXH 5TF1L 4M5TA 1J5HA 1XSOA 3DRQA 1IZKA 3O0RH 2R0LL 1OD7A 1E27B 1T04B 1VFAA 4JFYA 4OF7A 4KZEH 1P2CA 4PJHF 2RJMA 1FPTH 4LOVA 4WHTA 1QLRA 2K8QA 3NJGA 2XG4B 1S7QB 3C5XA 2J12B 4K7FA 5E5RB 3VXNA 4HK3J 2P45B 2R56H 3SGEH 1FH5H 4H8HA 4HF5L 4K8RC 2M26A 4XBPB 1S7RB 4HISA 5BPPA 3S88L 2R1YA 2Z0BA 2HTLC 3II2A 4HS8H 4LP4A 5DRWB 1IVLA 2F7RA 1N5AB 2CIIA 3ARVA 3VFOA 4XNDA 4UTAL 4ODVH 1GYUA 4XNMA 4X5LA 5IQMA 1BMGA 3WTUA 2WIMA 1RULH 4HJJH 1B4TA 1AGFA 5C0EB 5KWYC 4YNYB 4JVPA 5GS3A 2P44B 2WCPA 4DOHB 3ORJA 2N7BA 1Z6JT 5AAMA 1OAQH 4XMWA 1BFOB 1E3FA 2ILLA 3EIFA 2VERA 5E51A 2YA0A 1NCIA 1DBJH 3ARBC 4Z3IA 5DZ9A 3WKYA 2BP8A 2NRDA 3FTZA 3MRQA 4YXKL 3ARTA 1MVYA 2EDNA 4X6BA 4QYOA 4OR1A 4YIQB 1K6QH 4GAFB 4WUUA 5KYWB 3JWDL 3CVHA 2DDQH 2IOMA 1HXYA 2XY2A 4MAYA 3LRMA 3U48A 1YAIA 2WO4A 3QQ9C 4P06A 2Y0SA 2RALA 2WNGA 2V9TA 4YC2B 3SKJH 5JMRA 4I88A 4XZUA 4UAOB 3F58L 1E2WA 2BNQA 1UH4A 2Y7OA 4LDLB 3MLRH 2KKQA 4M00A 4LSSL 5KUKA 2EDFA 1E7UA 2QLYA 4ZOEA 3O3BB 4KVCL 1UOLA 4XNZB 5D2LF 2I7SA 5T1DH 4M43H 1E4JA 3CN1A 1J5DA 3QNYA 1YEGH 3RBSA 3QQ3B 4RSYA 5EO9B 1LDSA 1ZKAA 1QI3A 2DS4A 4KJYB 5AWNH 1KB9J 4ODBD 2Y22A 1J9RA 4QRUB 2Q9OA 3P30L 3DGGB 1LEIA 1FO0H 4PRBA 4G8GB 2EAEA 4BRVA 5DEFA 5DZOA 4ELMF 3ULVL 1W72A 1O6SB 1WRFA 4FL4B 1EZSA 4DH2A 1DQJA 2RH0A 2VISA 4NT6A 3RL2A 3RTQD 2ADIA 3MI6A 4YK4C 1NKGA 2WP3T 3V6FA 5DMIL 2ZOKA 4YWGL 3QZMA 3GIVB 4JRFA 5AD0A 4LOEA 1ILUA 1G9NC 5AKVA 1N5YH 1YMMB 2VN6A 5AAMC 4F8QA 1BREA 1DJXA 1YEJH 5E8NB 3OGCA 3OKMB 4X4KA 3TBCA 4DWHA 2Z8WC 12E8H 1HYSD 2YEVB 1LO5B 2FR4A 1PLBA 3KEHA 5CO1A 6FABH 3V7AG 4HIPA 2P4AB 5HJ3A 3BDBA 1YYLL 5AAPA 1O7SA 3BMWA 3QPQC 3C6LA 2H6OA 5C08A 4ACTA 4JHVA 3V4PA 4R8WH 4ZW3A 5E95B 4MAYC 2VYRE 3VDAA 4ZI8A 5GZNA 1W0VB 4CKQA 5D7IF 1TZHA 2QADB 3QIUB 2F2HA 5C0CB 2ZUXA 4HV8B 3JYCA 4HS3B 3D18B 4HWZB 1KXQE 1MREH 5DJCA 3FO9A 3IT8D 1KLUA 2KH2B 5C9JA 3OX8B 3ASOB 3GBLA 4Q9CA 1AGDA 1SXAA 4PJ7A 1FZKA 3IJSA 4MD5B 3T6XA 1IT9H 4HGWA 2AK1L 3PWNA 4I3GA 3RUGE 5DO8A 3T0VA 1IQWH 3UBXB 1KXTB 4DCQA 3OSKA 2PUQT 2FUQA 2PCFB 1IAMA 5DQ9B 1QBBA 5IKCA 1XSKA 2G3XA 2GJRA 1DFBL 4RGOH 1JPGA 4WO4D 2G2RA 1E8WA 1FLTX 3FOLB 3HHSB 3I3EA 4LKXB 1U4FA 4NUGL 2VZTA 5DWUL 3R8BB 4RH4A 1MW2A 3GHBH 3VVVA 3VX0A 2EDMA 3VFUB 1K4DA 4M93B 3R4RA 3U6XS 3O2WH 2B16A 2R9HD 1SDDA 2BCKA 3WXWL 4APXA 4AYBA 3SB3A 3NFPB 3FU9A 4MJ5B 2DM2A 2NNXA 1W15A 4U1NA 1NCDL 5EN2A 4OI7A 3MAWA 2W60A 1LK2B 3JV4B 4R84A 3UEZA 2BXYA 3WI9A 4GXUM 2FD6H 5JNYB 1GHFL 2BO0A 2V7NA 4PLJC 4QXGL 3CVIH 1EMTL 2FJGB 3MMEA 4L1LA 1GZPA 1TTFA 1WZAA 2RCSL 3AT9A 4QRPA 3DX6A 4OCRL 4K55A 3MUJA 2E27L 4RISH 4PBXA 5C6WH 2FSEB 4UYPA 3NGBC 4UDUA 2WKGA 4WTQA 3N41B 3C6LC 2F15A 1BSIA 3BSZA 5L7XH 3LEXA 2HJKB 5CBEB 1OL0A 4FXGB 1BG1A 5FUCE 4TLKA 3IETA 4X8JA 4NQUA 4OCSH 4X0KA 4DZ8B 1BFSA 1YVLA 4A2GA 5GZNC 4KGLA 4OQTA 1M7IA 1PIFA 1YNKH 4Y16B 2AJXH 1BX2B 1ERNA 1NC2D 4N8CL 1N18A 3B3IA 4NQXA 1A21A 4CVZA 1HHIA 2BNRE 1P7QA 1UYWL 2XN2A 3KXFE 1KMGA 2VDLB 4WVRA 2GY5A 5I1IL 2OMWB 4WEEA 5L4IA 3DYMA 1F1GA 2G30A 3STLA 3DBXB 3GSQB 1N3NB 1YQVL 2Z35A 2A4EA 4MDIB 3VGAB 2M8XA 4RWHA 1PFCA 2E9WA 1Q8MA 2YD7A 3O6FD 3BH9A 3TO4D 1AMXA 4G6FD 5KG9A 4DO6A 3MROA 4F8LA 5C09D 4NCC2 3E80A 1NWOA 3CSFA 1MLBB 4PS8A 3V4VB 5FYKD 3P3TA 5ITFB 5TH2A 5F6IC 1RUPH 3LN4A 3GNML 1KPUA 3H2QA 1YPZE 2LR4A 3ILDA 4WGVB 4YHYB 5GS1A 1EO7A 1ZVNA 1UZ6E 4X6FB 3SDDA 3VQ2C 5MEQB 3EH3B 2XKSA 3HI1A 2P48B 4P2QE 5TQ2L 4JFEA 4AEIH 2FO4B 4EDWH 2DQMA 4OFQA 5AOZA 1OE2A 4MVBD 2J2ZB 3N42B 5DS8A 5KTEH 5ICXA 3GXTA 2X4PA 4X98A 3VCLB 5GJTH 4QAMB 3MOBL 2A74A 5LN4A 2VR6A 1XMEB 2OW7A 1NEZG 2BJMH 4NQDE 2X4TB 3KGTA 3MBED 3T0AA 3ZE0B 2D3VA 3T09A 2JJWA 3M1OA 4BWTA 4Z7AA 4LFHG 1DVQA 2KLTA 1LEKB 4JKPH 4H13C 1GCYA 3W82A 4K9EC 1WSST 3BWZA 2WZ0A 3WGVB 4C4KO 1HL5A 4R90L 1BQHB 4PLKC 2IAND 1QFHA 4QTHA 5C2UB 1JGDA 2Q76A 4XP6L 3MGOB 4XP1L 1ORSA 3LKSB 4JDEB 2RQEA 3APCA 4M7ZC 3HUJB 1UM4L 3GLAA 4NZFA 4XP9L 4LPWA 4K0OA 2ZOOA 1VAHA 4JFOA 4RZKA 4CU7A 1SXZA 1UEYA 3FO1A 4ELDA 3WSQH 3DYOA 1E40A 3UCQA 4D9QD 4IU2A 4MJ6A 1AQMA 1MNNA 4NKDB 3F65A 3TT3H 2J20A 1U0QA 4P57A 3NK4A 3KPSD 3DA0A 5EV7A 2Y25A 2LLLA 2IIJA 3WIAA 1N0XH 3GBNH 3CMOH 1XGQB 4DKTA 4TSAH 5FFLA 2PYED 2X3AA 1NGPL 4J7RA 2UX6A 5E5LA 1FL3A 2E76C 1X5YA 2R4RH 2XBZA 2WHVA 2WXQA 5F8QC 5GRUL 1IBZA 5DF0A 1WBYA 4JRYB 3WUWG 1TVBA 3WKQA 1ULVA 3AREB 1GS8A 1DJGA 2VDMB 1YG9A 3N2JA 1IL1B 3B2UC 2QR0A 4RAHA 1F0LA 4FQLL 2HFFA 2IWKA 5H37G 1TDQA 3WIHL 2IAMB 1PCSA 1PTZA 3BAJA 1FZOB 3MJ8A 3PUCA 1OPGL 3LKOA 1DVFB 2YQ3A 2Z91B 1EFXA 4GAAA 4K73A 3ZHNA 4ZMQA 5DHYB 2DQJH 5GS1C 5FDWA 5DO2D 3SDDC 2UXGA 4WY7L 3EYFB 4FQQB 3BVNB 5CJXA 4X6DA 3WEXA 5I8CA 5AYUL 1H3UA 2J5LC 4OF8A 3E8VA 2ED7A 2BW5A 3MRRB 1ETZA 2XXMB 4LLDB 2VM9A 4U1HA 3B9KD 1IJNA 1GGIL 3MKKA 4NIKB 3DUSA 4QRRD 4D0CB 3MV7D 4OKVA 5IP4A 1EXUB 2A74C 3PF2A 3TN0B 1VEPA 2DWDA 2XZQL 3TNMA 3VFWA 5IW3A 4OZFG 1WHPA 1SRDA 3REVB 3AB0B 1KYOK 2AJZA 4XT1C 4MZ3A 4FFVC 4JO3H 4CJ1A 3ZO0A 3TYFB 4C56B 4DPCX 2ZCLL 1ANUA 3VI3B 4BQCA 3CXDL 3NJJA 3OLGA 2B4CC 2N0MA 2CJSA 3GDBA 3HNTH 5GGUA 5DMKA 4KKAC 4PJDA 1JL8A 1MFNA 1JF5A 2CDFA 4YFEA 5BQDA 4PLNC 1AO7B 4G42B 1G7PB 4JJOA 3WDJA 3VA2C 1PZSA 4U1LB 4CN6A 4NN7C 4IHOA 3A67H 4QI3A 1MCSA 5I0YA 4BSWB 1KNOB 4B9KC 3D8MA 4HUUB 3VGEA 5IJVB 2NUTA 1J5CA 3L3JB 2WWOA 1CDYA 3CDGA 4NQTA 3T8MA 5IMKA 1RZ8A 5KJRL 2HB0A 3U1QA 2CJUL 4ZMZA 1QWHA 3CZFB 5CEZD 1CTOA 1FLRL 1A3LL 3A47A 5D5MA 4N0CD 3VFNB 1FNGB 1XV8A 1KLFA 2VDQL 3GK8L 5F1IB 3EJYD 3QC6X 2J44A 2DH3A 1VZHA 1G7QB 1I9EA 3F01A 3PGCB 2BSSA 3IPEA 3OB8A 5MP6L 3N9GL 2PTTB 3RTQA 2CK2A 3AVEA 4P46B 4XN9A 2E9BA 1M6OB 5FM5M 4HK3N 4PJHA 3WLBB 1WDAA 3G6JE 2VUOA 1EQWA 5ABAA 1MFCL 1O75A 1R46A 4N2DA 1KIQA 3MRJA 4N8VA 5DUPH 3SDYH 3HLKA 1J1PH 2FCBA 5KYYB 4HWUA 2VZUA 2A77H 1M1XB 4ECNA 1RFDH 3QDGE 1CE1L 4QRAA 3QO0B 4IJ3C 2DWTA 4G2AA 1QHOA 5CJXC 4KVNL 3OLDA 3VYNA 3QNFA 4BKLA 5T1MA 4M7KH 5BUAA 3EXJA 2BIHA 4NN5B 2VM4A 3HMXH 4GO6B 4F1ZA 4TUOB 3MR9A 4U2YA 2EIZA 1LO0L 2H2SD 2KDGA 5I5JA 3BIBX 3GM0A 5TF1H 4DAGL 1HHKA 1TZGL 1DVYA 3QJZA 4NZJA 3IDUA 4XVOA 3NCFB 4M62L 2R0LH 5LGYA 2GJ6A 3NJLA 43C9B 3VRLF 4MB4A 2G0KA 1BVZA 4WTZA 4FMKA 4IJTA 1CT8A 3S3JA 4ES9A 5EEUA 5ETUA 4OVUA 2WQAA 4L3CA 4LPVA 4LCUB 1BDYA 4UT9A 4Y5XA 2NY4B 4Z1PA 4E9SA 5FF6A 4HF5H 4N6RB 5LN8A 2BMKA 2DQUH 4N5UA 3GUFA 1CFMA 3A0OA 3BFOA 1KTDB 3OKNB 1RZQA 5D1XE 3Q3GA 4PMEA 4AOFA 3CPUA 4G5ZH 4RMBA 1IBFA 1HEZA 3FC8A 3MX0A 5BZZA 3M88A 4XX1G 2ZUTA 2FYYA 1DN0A 1FFOA 4MXWL 4Q4EA 4WCYH 4XO9A 5E2WL 4WW2F 2J1KA 4ZAKA 5E00A 4FQPA 5FA4B 1ZV9A 1A6ZB 1KJ2H 2BSEA 4QHLA 2ADGA 4NRXA 3BD3A 4ZX6A 1L6PA 2FBJL 3GKWL 2WYIA 1OT2A 4CVUA 4WO4A 2FQEA 1TYEB 4DOHE 1ZA3B 5D2LA 4N0UB 3PNRB 5LGJB 4KQ4L 3DDFA 4J6IA 2YIHA 3IGAB 3JV6B 3RVTC 3QP3A 4CMMA 3RTQC 1L7TL 1R75A 2XFXB 4M61A 4YXKH 3ZYIA 1WHOA 2UZXB 5CLXA 5C70A 4Z5RB 2KLSA 1NCUA 1T89A 4KK8D 1P6AB 1GYVA 2ZJSL 1YEIH 5TDPB 5CWSB 1EBAA 3D85B 3ISWA 4JO2H 4Z3GA 5BUGA 1PAMA 1PNCA 3FUDA 1QRNE 4ELMA 3X1GA 4X6EB 1GC1C 1X9UA 2E47A 1YNTA 3MDJA 5JHDB 5GHWL 3TEUA 2ICWJ 1HYSC 3VVWA 1NUNB 5J8OA 3QUHA 4NC0B 1I7TA 1M57B 5IB3A 1JDCA 1NINA 3PQYB 4LSSH 3BD4A 4ODUB 5ALBL 4WAFA 4KVCH 1W8NA 3S7GA 4WI4A 4AQEA 2MTAA 1DE4A 5IQ9A 1WZLA 2IV9A 2X4NA 3NN8B 1T20A 2KLRA 4JO4L 3W39B 4HH9B 3UPRA 4NP4L 5IHZA 4MA8L 4YSTA 5IW6A 4FXLA 3CN3A 3P30H 4U6HA 1NC2A 3ET9F 1T1XA 4Y5XC 7TAAA 1P4IL 4XH2B 1L0QA 2B5IC 1YPZF 1IJ9A 1JHKL 3ULVH 4O2FA 4G8GE 3ABZA 3LCYA 1MI5B 1JZGA 5D7IA 1IC5H 1WD9A 2B0SL 3FU3A 2W38A 3O6FA 4NPYB 5AOIA 3TO4A 3U6RA 3IE9A 5KVGL 3EH4B 4X99A 5IMOB 1U93B 4J3SA 2E3VA 2WQUA 2YGQA 5C09A 2H2PD 4TNVK 3VD0A 4JEGB 1U8KB 5IG7B 3DRTB 4ZAKC 1R4XA 3VFSB 1H15B 5I74B 4F33A 1U8OA 4FQ2L 1BVNP 3UAEA 3ARPA 3AS0A 3GMNA 1WEJL 2XA8L 3MN8A 4YSSA 1E9PA 1WAAE 1MEXH 4ODSH 4WO4C 1C8PA 2VZVA 5INCA 1CICD 3BXNA 1YMME 2ADJA 3H8NA 1DDHA 4P59H 4ZZKA 2VDOL 2W9EH 4CSPA 3UL4A 2PO6D 1YYLH 5B7EA 2R9HC 1FC2D 2WBXA 3F64A 3JWOC 1Z9LA 5F3HB 1T89C 1YLBB 1SYVB 2DWSA 4Y88A 3ZHLA 4Q8BA 3N6YA 4KRPD 3F3HA 1RJCA 3MBEA 2FGWH 3VTAA 1HC1A 2ZD0A 4A2EA 4Z23A 1HCZA 1FG9C 1X5XA 1WZ1H 2MOVA 4RAVA 2NY0D 4F7CA 1H6TA 1IGYA 4ZYKB 4ZSOB 2AJ3B 1F6FB 4PJIB 5C0CE 1MJ7L 2DLIA 2IANA 1LM8V 5CCJA 2WTOA 1WISA 3MUUA 4H40A 3QO1B 2VABB 3Q1SH 1OGTA 1AE6H 4PCKA 2AK1H 1ML0A 3DOSA 2W07B 1SN5A 4F9LA 3RAJH 3HC0B 3KWXA 5CGTA 4UQCA 1S7UB 1ZLWK 1OAKL 1E5BA 2XG5B 1EWHA 3BUYA 4R2GC 4XWGL 5KBPA 3IF1B 5IW1B 4M03A 4DPRA 3KPSA 5F6HI 1QVOA 3VACA 1DVZA 1DFBH 1DANU 3X13A 1A9BA 5AOLA 5HYSA 2JKSA 1SZNA 3ZKND 2PYEA 1I1FB 4BKSC 5FHAL 2CO6B 4NO2A 3W9DA 4R0LA 4EUPB 2VR8A 5KSVB 1CU4H 4NJ9L 4JG0H 4XO3A 2ZUSA 5I23A 4NUGH 5DWUH 5I6LA 3Q48A 2BPBA 4YDJA 4PD4K 4NO3B 4P5TD 5MI0C 4BQ9A 3TO4C 3ILQD 3WXWH 4HULB 1E4XL 4Y4FA 4RRPM 1NCDH 3D0VB 2BC4A 2IG2L 2YZ1A 3I6GA 4G59C 3WE6B 1GHFH 4HIIB 5J12C 3VNZA 1J86A 2ZXWB 1OGPA 3AC0A 2X10A 3DV4B 2A7BA 2VAAA 5KS9B 5I1GH 4P2QD 4Z0XA 4MJIE 5DZJA 2RCSH 4TQIA 1SHWA 1SUJA 1QOKA 2BOCB 3GMPB 4OCRH 5C07B 1SLWA 2ZUVA 4IRSD 2EYTB 4KOCA 5FKPB 2H9GB 1G7MA 5C0IA 4JPKH 1QSFD 4MVBC 4WHYG 5L6YL 4GUQA 2FLBT 1QUPA 3Q06A 4QRRA 3QXTA 2R29L 3MV7A 1VFBB 3V0JA 4HUNB 3MRCA 4BFGA 1W80A 3IGLA 1VCAA 3MBEC 3MBWB 1H0DA 2B20A 3QJRB 5SWZB 1I9RL 2APVA 3EJPA 3OSVA 4N8CH 4RFEA 4G83A 3J8F7 2ZAIA 1UYWH 2K6WA 3TBWA 4HQQL 1TJIH 3MXVL 5D2NB 3MRGB 1YQVH 2QDVA 1ORQB 2HG5A 2JE8A 5JPNB 2EEDA 1N68A 2V17L 4F9LC 1BMWA 1J9SA 4ZODA 2Z65C 4JCLA 4F2MB 1A7QL 4OGYL 2ZG1A 5JQHC 3G6JF 2VITB 1GRWA 3T0EB 4LSRL 1MHEB 1DBKL 4J1UB 1XCTA 3GNMH 2ICEB 1KYDA 5HI4D 4BSVB 4R0LC 5HHMB 1CGUA 2F8VA 3BEWB 3QE5A 3ZR6A 4KVPA 1MDAA 5D7SL 5DC0A 5CKAA 3EYVA 5TQ2H 3RWFA 3AS3A 2DTML 3QIBD 2XV6B 3ME0B 3MCKB 3IJYB 5T1KB 4G9FB 3QAZC 4Y4FC 7FABL 5GGRB 2P28B 4MSWA 4YBQD 2ZXDA 5DFAA 3VTMA 1HSBA 5ALCH 2VW7A 3U25A 5L2KB 4YSPA 1NA8A 4L3FA 2EZ0D 2AANA 1YJDL 1U36A 4B0MM 3GDCA 1QEXA 5DO2C 1T0NB 2L0DA 1ONQA 3BQUA 2GEQA 2H45A 4LSVL 1U33A 4PJ9D 4R7DA 4XP6H 2LU5A 4U31A 4ZFOB 3VFTA 2NNFA 5DSCB 5EULV 1E43A 3MQIA 4MNQE 3ROLA 4FYTA 3CFJB 1TQCC 1UM4H 4JX0A 3ZTJG 2FDBP 2QSTA 4NNYB 3FT2A 3VGHA 4WKZA 3ILPB 2NT1A 1XH2A 5IK3A 3ARQA 2YRPA 5AW8B 4ODXB 1RHHB 5MEPB 4GP5B 4U3CA 3Q44A 2ZSWB 2XTJB 4PJXB 2Y6SD 3CUPA 2H32B 3M8OH 1A66A 4ICXA 4WTZG 3CFKA 3PFQA 2BHYA 1EV2E 1WBXA 4X9IA 5HHNB 1NGPH 1KIUB 2APXA 2V37A 1YZZA 4LOUD 5I15L 4XMVA 1RD6A 3TH4T 2XT1B 4IHBA 5I5MA 2WY3B 4RWYL 3GF8A 3GEWB 1JYXA 4JRYE 3QWNA 3Q6FB 1KPRB 3GUTB 3VQLA 3L3GA 3G08B 5DEGA 3WIHH 4GEIA 2WXNA 4XCFL 1M05B 2GC4C 3EAKA 1GC1L 4FKKA 1OPGH 4A2DA 1FP5A 4F8NA 4YGVB 3FTVA 3S2AA 4TVSa 3PWUB 1ZV5A 4GRMB 4WY7H 2HRGA 1OSEA 4OUUA 5AYUH 1RUQL 5AZ2L 4A6YB 1QZ1A 2YQGA 5BOJA 1GGIH 3QRFM 1I7UB 1X7QA 4KO6A 1Y6NR 3G5XB 2NSMA 3ATFA 2IDFA 4YDIL 3T8XA 2XZQH 1UA3A 3SYAA 4U0RB 3MNWA 3QDGD 2QLVB 3F8UB 4EXKA 4P3CL 4OFKA 3ETTA 1GKEA 4FQHA 5JDSB 1HILA 4UT9L 4EPSA 3WN5B 4H1LA 4LHUD 3BQUC 4ZFGL 2ZCLH 2LOEA 2ZG3A 1T0OA 3CXDH 3C2SA 3B5TA 3O2VL 3IGKA 3L5XL 4YBHA 1WBZA 4MFHA 4DEWA 3BWSA 2R2EA 1TZIA 2H2SC 3FQ4A 4HZAA 5H37H 1OP3K 3IDNA 1K8IB 4NYLB 2Q7YA 5FO8B 1JN6A 2XUWA 5D6CB 1KXQA 2CJUH 1T22A 2D73A 5J1SC 2OSYA 3B9AA 1A3LH 2AEQL 4G7QB 8FABB 1UD6A 3TZVD 2VXSL 4ABUA 5D1XD 3GK8H 2OJEA 3GXUB 5IIEB 1WAAF 4WHDA 2X9WA 4Z8FL 5LXGL 4HJSA 3UJJL 2YN3A 2YXWA 1EA9C 4MAZA 3NPSC 5MP6H 4OLXL 3R7QA 3RUGA 5DJ0A 3JWOL 3N9GH 1CXKA 3EJZD 2EEBA 3R06A 4LL1A 3BZFB 1MCFA 1H9DA 1IM9D 2WLJA 1FSKC 4OZFH 2I9TA 1MFCH 2H3KA 3FS9A 3VG9C 4PRHB 3MYZA 4E9WA 3RDJA 3FJTA 3MTRA 1NQBA 2FJFA 3ZMEA 2ZP8A 2D7MA 3ROOB 2KBGA 4WSGA 4LPXA 3WAKA 1X9RA 3RA7L 4OZ4B 2XWTA 1NIBA 1X6LA 1ZS2A 3WOVA 4KVNH 3UMTA 1A3ZA 3BUBA 1CICA 1G0XA 4AKQA 1R6VA 3SPCA 3NIGB 1UXLA 1GGTA 2ZUQB 4X7TA 4UM8A 4WW2A 1I31A 2OMZB 1F45A 3ZW3A 1KFGA 1LO0H 3FPYA 4R97B 4XZ4A 2EIKB 3UTZB 1WZMA 1QRND 4KK8C 2WK2A 3IJ7A 1NM9A 5TE7L 5JW4N 1AG0A 5E8PA 4D7BA 5A6LA 4M62H 1HHJB 2B15A 4CDHA 3VXPB 2K70A 4IBSA 1OP4A 4DSYA 3QQDB 4POZD 3MACH 2YUXA 4M7LL 4D7PA 1G9MC 2FNBA 4OAWB 4H8WC 3B3BA 2JKNA 1VEOA 3VQ1C 4N2NA 1HIML 3CAFA 5CP3A 4LASH 3ZDWA 3CDZB 1OZTG 4PCSA 5CGYC 5SWQA 4YAQB 3C8HA 4DZBA 2O93L 5E2WH 4MXWH 4HHAB 4PB9L 3KGUA 3STZB 1VDGA 4KC3B 4WNQA 3KXFA 4NWTL 1G7LA 5I19L 2ZPKL 4ZOCA 4DT2A 1HJBC 2FBJH 4PGEA 3GKWH 2LTQC 3SQOH 5JORB 4G8GD 3TJPA 4BK5A 2OXGA 4QRQB 4CAGA 4L8SA 4KQ4H 4BHUI 3LV3B 2UXTA 4ORZC 5E6UB 5BW7A 1GJWA 1HHHA 4N0UE 3U46A 2JJVA 5JPMB 3KYNB 1KLGA 3CVDA 3VFRA 1U8PA 3QGVA 2QKSA 3L7EB 2H2PC 2VWEE 4L0PB 3KH4A 2K45A 3N41F 1RKRA 3V9FA 1YPZA 5K9OB 2C4XA 1AS7A 5EEWA 2GTWA 1O5DT 1GY2A 4HUMB 4H26B 2WLNA 2OTWA 1EGJA 1BLNA 5F0PB 1RJZB 4P2QA 4WFGD 2OL3H 3D6GA 4IRJB 4LBEA 3JTTB 4PS7A 4L2LA 3RPIA 1CICC 1UM5L 2VXQA 5E2TL 2V5MA 4R4BA 1DDTA 5JHDE 4OLUL 1AXTL 4D0BB 4IRSA 1RK1B 3IYLW 4WW2C 4KXCA 5ALBH 3OXRB 1J1XL 1P7KA 4F7EB 2R0WL 3PQYE 2WQ8A 1E50A 1EZLA 1Q9KB 3EOTH 4JKNA 5IM7B 4AV0A 2OX5A 4GXFA 4NP4H 5LCVA 4MA8H 5ES4B 3GMMB 2NY0C 4F58L 4Y2DB 1JDAA 4L5FE 2OMUB 4ZFZB 3GLEA 4RGMB 3EO0A 2FJSA 3MA7B 5H94B 5E1AB 1PU0A 2JV6A 4KNQA 4LAQL 5D7JD 5JLZA 3FRPA 3DNKA 4Z7OF 3VXQA 1EVTC 2DWEB 1KN2L 1HS6A 2VLKB 5FUCC 2BVTA 3LS4L 4MNHA 4YHOL 4W4OA 3RA7H 2J6EL 3KJ4C 2JK5A 2B0SH 5KVGH 4MAUL 2H3NA 3KVPA 5KN5B 1MI5E 2V4LA 4X80L 3JWNG 3C5JA 4ISVB 3B2VL 2N7AA 4FQ2H 5SX4I 2YD5A 2XA8H 3PAYA 4GUCA 3A22A 3EFOB 3ZKNC 4QO1B 5E4OA 2O5XH 2L7UA 4L8SC 4QRBA 2CE6A 3V10A 5BW7C 2Z8RA 2R0ZL 3LZRA 2QGDA 4MMZA 3QIBA 2ZWLT 3D08A 3H9YA 4HUVB 5FKAA 1GL4B 3ILQC 4ERSL 3CPLA 5I2IA 4XP5L 4HKXA 4K7PL 2HJLA 2XICA 1XTMA 1BZOA 4KUZL 2IBGA 5HGDB 4KO5A 2IADA 4WI8A 3M46A 5E1HB 3EOAB 1D7BA 5B4MD 4GH7B 3FDWA 4MJID 2F0CA 1NAMH 5I30H 5JHLL 2LU3A 4LCWB 4L4VD 5CEXA 4PJ8D 4MQXC 1MRFL 3IVKA 2AF2A 4R26L 1HH6A 5FV2A 2OMXB 3SEPA 1MJ7H 2KZWA 3KPQA 1M7XA 3DIFB 5EEYA 2MCPL 4IRSC 4PJ9A 4ZSOE 1A9VA 2WQVA 1A2YB 4PJIE 1WJ3A 3SOBL 2C34A 1NIDA 1Z32X 4OD1L 4F3FA 1GSMA 2AQPA 3VFGL 3BZ4B 4KXZI 1J1OH 1AS6A 2RBLA 1R3KB