1MY5A

Nf-kappab p65 subunit dimerization domain homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
b'TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappaB p65 (RelA) subunit
publication title Solvent exposed non-contacting amino acids play a critical role in NF-kappaB/I kappaB alpha complex formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 19
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1my5A00
4Z5RB 5HPOA 1T3FB 4QWWD 2H3NA 3HB3C 3Q5OA 2AEQL 1MIEH 2J8HA 4W70A 1OGAE 1OD9A 1IC7L 2GJ6E 4MXWH 3D5OF 4JEGB 1EBPA 3GSOB 4NRZB 4O58L 2IAMA 4RAVB 4NQDE 3W5MA 4U7MA 1F4AA 3U9PH 4DN3H 2NMSA 3SJVA 3TVMC 3P40A 2VAJA 2HJKA 4NN7B 3G9VA 3D0VA 4LCCB 2A1WL 4XNZC 4OZ4B 5GJTH 1TETL 2Z91B 5GZOD 3X11A 2XI9A 2AEPL 5DHYA 4OFVA 1U9KA 4X0KA 3Q3GB 3L9RB 3GGWA 4TULL 3LV3B 3UTPD 2HMID 4UDUB 1H3GA 4J4PD 4AH2B 3ZT5A 1KB5H 2W0LA 3MLXH 4UV4L 4JPKL 5F1IA 4BH8A 3TC9A 1NGZA 5DO2C 5IR1A 5HVHC 1L0XA 1ES0B 5FO8B 1HXMB 3BQUB 3V5KB 4YBQC 5I1EL 4U6HB 3CVHH 1VGKB 4G9FB 4RBPK 5E9DD 2MCPH 5FUZH 1NJ9A 4Y4KC 1ACZA 2DDQL 1DQTA 2E7LC 1EH9A 2DMBA 2EIEA 3LEVH 2CUMA 2LQRA 4K3JH 5IG7A 4HGWA 4R7NA 4N0CC 4GSDH 1KCRL 1SVZA 4LKXA 2ADJA 3DRQB 4HS6B 4JREC 1C7TA 1FYTD 5FGCE 2VABB 3HC4L 1OLZA 2WUCL 5C8JB 1FDLH 2JB5H 1TXKA 3UJTL 4X7TB 1JJUA 4PPTA 1REIA 3WKMH 3CFKB 5IJKA 4X6CA 1I1RA 4WFED 2FJHA 1AI1H 2VKWA 1WWCA 3ORJA 4YDLB 1AD0A 2ZCHH 4K7PY 4R2GC 1OSZA 4RBPH 3VW3H 4KRLB 5T1LA 2V2WB 3EYSH 4WUKL 5EZIL 3AXLB 3KWWB 4KXZH 4K23H 4D3CL 3MO1B 4JG0H 1N8ZA 5DD0L 1N59B 4NC1E 3DWTA 1CLCA 5AZ2L 4N5EC 1OOAA 4YEFA 4D2NA 1FVDB 1L9NA 1EHXA 3IFNH 1EDQA 3LB6D 2Z31B 4M6NH 4PP2A 2DQJH 4BQ8A 3ZDYE 5DUMH 2HT2C 4JY5L 1RUML 1I3GL 1N7MH 5AYUH 1G7LB 4MNQA 1BHGA 1X5ZA 3PWLB 5F70A 1ACYH 1IAKB 1M05B 1PG7X 5C0BA 3JWDC 4R8WH 1NCDH 3HUJB 3ME0A 3HC0B 1DQMH 1J8HE 5JIPA 5JXED 3ULUH 5CINH 2OM5A 3OKLA 2X7LB 3D85B 3MV8B 1JI2A 5BZDA 4QRQA 1EO8L 3WNMA 1CLZL 3AC0A 3TT3L 1A6UL 4GG6A 3BJLA 1AGDB 2YD1A 4Z7NF 4YHYC 2NY1C 3I9GH 1MCHA 4PS4H 2GJ6B 4PRHA 1EVUA 4NQCA 1KTDB 5C0AE 1I8LC 5I1GH 5C7XH 1NBVL 4NM8L 2NR6C 2Z8VC 3OKKA 3L7EB 4NQDB 1FORL 2FX8H 3TJHD 5F71A 3RIFF 1N6QL 3QUYA 3DURA 3F7PC 1NLBH 5JDSB 2PCPB 4GUPA 4UIMA 4UT9H 5GQBA 2X42A 5DEGA 2PR4H 3RWGA 1MFNA 3BQUD 5TQ2L 1HHGA 1B0GA 2E9BA 5IBUB 3SPVA 2DICA 3S5LG 4G9FD 1UWEL 4L29B 3KPMA 1I1YB 5BVPL 1UWGL 1CR9H 3V6OC 1DSFL 2BOCA 4WFHE 3OG6B 5F93C 1SY6L 2YSSA 4K94H 5IV2B 1IQWH 4HT1H 3QNXB 2CLZB 2HN7B 3QUKA 1EFXA 2ZG3A 4P46A 1RUPH 4WU7A 1YNKL 5FA4B 4P3CH 4WEBH 4R97B 4F33B 3AMLA 5C0ND 1XFPA 3MRNB 3P4NB 1BWMA 3PHQB 2FBJL 3I75A 1MCDA 4O9HL 5KSBF 2ZSVB 3QEHB 4LDEB 1A7NH 3GJFK 3EOYG 2YUZA 4RNRA 1MCOH 3Q5TA 3QA3B 1XR8A 2HFEB 4XX1E 4NCC1 1QFUH 2W9EH 4DGVH 4BUHA 1F97A 4TVPE 3LZFH 1DFBL 2J88L 2VLRD 4L4JA 4YXKL 4JVPA 2IF7A 3BIKB 1RUKL 4HUMB 4H1LH 4PFEA 5LWYH 2ZWLT 2EDXA 3L3IB 3E6FB 4U3HA 3Q6FB 5KAQF 4CU6A 1D6EA 5I74B 1G1CA 2VQTA 2D7OA 3P0VH 4K7FB 4XCEB 4JO2H 3RHWF 5DEZA 5EWIH 5FGCB 2VDNL 2DJSA 5JXAL 3IKCB 3R06B 2Z9TA 4U1JB 3LN9A 1MF2L 4NO3A 1DVFA 3GJFA 5IB2A 3A67H 3B5TA 4GRLC 4HC1A 1HWGB 3F7RA 1DUYA 5AUMA 3GJFH 3GSWA 3B6SA 5HHXL 3CFDA 3HMXA 5CIPH 3V8CA 4HC1H 2Z31D 2PW2A 2EXWC 2NY7L 3HMXH 4I2XA 4JFPB 4U2ZA 1TTFA 1WBXB 3EJJX 3M17B 5C92A 32C2A 4OZGE 2XPGB 3VE0B 4ONHB 2ERJC 5D6DA 4NQEA 1IGML 5FF6A 1YDPB 2H1PL 2WMPA 3UXFA 2NTFA 5I8EB 1DTUA 3MV8D 1S7UA 5L9DL 3P3YA 5K59E 1ZHNA 5BO1L 3MLZH 1WVZA 4CJ1A 2B8OT 5LGJA 2BSRB 4YHKL 3PP3K 4OBRA 1UB5A 4D8PB 3S3PA 3BEWB 2GJ6D 4GKZA 5GRJL 4WTXA 1FGVH 4WI8A 5GGTH 5KVGL 5GRUH 2WQRA 4NJ9L 3VU2A 1UENA 1BD2E 4NQDD 4KKBC 1S78D 5DGQA 1JYXA 1G9ML 2DL2A 4RGNC 1MFEL 4TVPL 1J8HB 2NY0C 2VLJA 4TSBH 4BZ1H 1X5GA 1OF2B 3K8KA 3JV5A 1BLNB 1KYOJ 1HXYB 1DQDL 5TE6H 5FUCC 5JW3L 4PGBA 2FJFA 3DPBA 3ZE1E 1FIGL 4P99A 5D1ZB 3EO1B 3FONB 1FZKB 3VDAA 1MJJB 3LD8C 4MX7B 4XC1L 1OARH 3MRBA 1BMGA 3RZWA 5GS1A 5D7SL 2QEJA 2VZ1A 2JLLA 2R56H 1H0DA 1MLBB 5E4EC 4FQQB 4HSQA 3CZFB 4L3EE 5E7FA 5I66A 2EH8L 3QXUA 4DQOL 3NN8B 3MCLL 4XHJD 1IE5A 4QRRA 3DI3B 5FKPB 1ZK9A 3BMWA 3O6LL 4NN5C 4R96A 4X4YA 4UAOB 1G6RA 1XF4A 4YAQA 2HVJB 4Q9RH 1FJ1B 4Y4FC 1YEFL 1S7SB 1T0NA 1G6RH 2P24B 3PL6B 4A6YL 5I1JH 1BJMA 2CR3A 3D39B 2P7TA 4U1GC 3BJ91 4OLVL 1A9EA 3FKUS 3QQ4A 4EI5D 5DQJA 1JHLL 1Q1JL 3VCLB 1WCBB 3L7FB 1A8JH 1XF3B 5DSCA 4DGYL 2EZ0C 1IAIL 2XQYG 5JOFA 1UH3A 3RVUD 3QEUB 1GGBL 2B5IB 4JFDE 3SDCD 5IM7A 1M71B 3GIVA 4L4TA 4KUCD 4O51B 2JJTC 4XWGL 3DGCR 3MLTA 3IDJA 2E27H 2NXZB 2QSTA 2XTJC 3KYOB 1R5IB 4TSCH 4WO4A 4HWEH 4QRSA 4UOJA 1B90A 1DDHA 5CBAB 2G2RB 5JOPE 2CKNA 3GHEL 4OUUB 4YO0A 4Z7WF 1G7HB 2R2EA 3DI2B 4PJ9B 5FM5O 1HDMA 2YPLE 1ZGLP 5D93C 1WAAE 1B0RA 1C5BL 3TO2A 5KSAC 3WXWL 3G04B 1QSEE 1T04A 4IMLB 4QYOA 4LVHB 5KG9B 4KI1A 2ARJQ 5D2NC 4MGXA 1MWAL 3FB5B 3TV3L 3HE6B 2GT9B 5D72L 3I3DA 4PV8A 4R0LB 1X4ZA 4DKEL 2OJZH 1WLHA 5GGVY 1N2RA 5EU7E 3IDMA 3HG1E 4QXTA 5EORL 1BAFL 5D2LA 4X6FA 2NZ9D 1EA9C 3B9KB 3O0RH 4NYLA 3BSZL 2YOCA 4OZGB 5T3XE 4J23A 3REVA 4PY8I 2H9GA 3BGAA 1N6VA 3MRRA 4XXDA 3L1OL 1RQ5A 1J8HD 4JM2D 1D6VL 3R1GH 5SX4H 1U3HD 3RWCA 1U2HA 1PKQE 5LVEA 2WIIA 4I9WE 4U1HB 4PIRF 5ANME 2BFVL 4YE4H 1M7IA 4UT6L 5D1ZD 5EU3A 5CEXB 5E9DA 3MOAL 1LO2L 4OGZA 3QXWA 4JE4B 4Z9KB 5C0AD 1XGPA 5FM8A 5IEKB 3VXNA 4EN3A 1W8NA 1QHPA 4GMSL 1INQB 3KNBB 3BPCA 1I9JH 3L3HB 1XIWB 4QXGL 2DLIA 3RDTC 2Q8BL 2DF3A 2X40A 4OZFA 4DUXA 2IPKA 1LEGB 4PD4J 5CZKA 2Y23A 1FFRA 4OZFH 4AL8L 1FYTA 1MCIA 4JZOB 5DZOA 4KKLD 5JHDE 1X5FA 3HZYA 4K3DL 3CFIC 1S3KL 5I8CB 1DBKL 3D39D 1RZKH 3QUMA 3IDXH 2MHAB 4HH8A 1HQ4A 2YK1H 4CADB 1HKLL 5SX5H 3BWUC 3A6CL 3LRSB 3QULA 1GGTA 3GMQA 1IGCL 3LS4H 4KUZH 2R0KL 1J11A 2FNBA 4NDMB 5LBSL 4LSVL 1RJLA 3ESUF 2ED7A 4XGZB 2E6PA 4MDJA 2Z35B 3FO1A 4XT1C 3I50H 2BJMH 1T21A 5LXGL 5F7EH 5HHQA 4NKMA 1OM3L 2HJFB 1XCQA 3TBWA 2NXZD 1KTKE 3F62A 1PJ9A 5TFSH 5DJ2A 5IUSA 1RPQA 2F5AL 4TVPD 4FFVC 1E4WL 1BFOA 4NBXB 4MB3A 1ZE3C 4APQC 1CLYH 1YN6A 3RU8L 1NC4B 4DCQB 5CP3A 3B2VL 3EDFA 4PV9B 4LLMB 3FT4B 4GMTH 4RAVA 1NUGA 3WJJA 1FFOB 3MGTA 1B6UA 1S7RA 4JFFE 5I9QB 3S96B 1TZIB 4MA3A 3HE6D 1BFTA 1LEKB 2ARJB 5JXEA 3A6BH 4PRAB 3F7QA 2DQEL 1MHCA 1YEJL 2E6JA 2V5RA 4LCCA 5DVKA 5CCKH 3MLSL 2CPCA 4C56E 4F9LA 5H94B 2BMKB 4NRXA 1CFNA 3OBAA 1BECA 3AUVA 3B9KD 1Q9OB 2R23B 1HQRA 2YPLB 3Q3GA 5T3ZD 1DQJA 3D0LA 1DR9A 3RFZC 3LV3A 4I5BB 2DQGL 1QSEB 3UTSE 3OV6A 4XPHH 4L1HA 3QWRD 1CS6A 1FFPA 1T89A 5B38G 1TPXB 2CRIA 1KNOA 1X5YA 2XQBL 5J3HC 3MRLA 3FOMB 1NANI 2OK0H 5FO8A 2X1OA 2X1PA 3V5KA 2CDGB 5GGUA 4U6HA 1X5LA 4PJHF 4XTRC 1VGKA 5D8JL 3EJZC 4G9FA 3HG1B 2HJLB 5FAAA 4Y1AE 4D9LH 5GS3A 3ROOA 2P5EE 4PP1C 5TE7L 5JPNB 3OPZH 4KVCH 1ZT1B 5DYOB 1BD2D 5FDYA 3TNMA 4ELKA 2P8PB 4N0RA 3LRGA 1N0LA 1CDJA 2N7BA 1X7QB 4J6RH 3KJ6H 4XNMB 3DRQA 3QUXC 4G8GA 3QBTB 3PDOB 1UZ8B 2VDKH 5CZVL 5A16A 3WMSA 3ARZA 1PKQB 4AEHH 5C8JA 3NTCH 4MNGE 1DEDA 2QSQA 4YR6A 1A14H 3SDYH 5ANMB 2R9HC 3BGFB 4IBLT 1M1SA 1QLRB 2ADGB 3U6RB 1F3DH 1ITCA 2VLRA 1CL7H 5FGBC 5FV2A 4QHKJ 4M1GL 2V2WA 5DWUH 3RUGB 4XCCH 1FN4B 4OD1L 3HNSH 3KWWA 3E0GA 3DUUA 1I1AD 5DVNA 4WTZG 4KK5C 2PTTA 1U8LB 1L7IL 3MO1A 1KTRL 3N1QC 4NC0B 1KJMB 3OZ9L 4LLDB 1N59A 4LRIA 5DQDL 1F90H 2A74A 5JHDB 5F6IC 1YZZA 2C7UA 2FH8A 4FXKB 3GDBA 3HS0B 1XR9B 5IVZB 4LVOC 5BOPA 2Z31A 5IOPB 4I4WB 4JPKH 5D7IE 1NC4D 2UVEA 2QQKL 4LDLB 4DZ8A 1RJYB 1G7LA 1XF5B 3PWLA 3F58H 1FNFA 3MCKB 1MUJA 2NY5L 3TEUA 3MUGB 2R0ZH 1IKNA 3FHQA 3DHJA 3HC0A 1MOEA 3OAZH 1ZGLB 5L6YL 2AERT 2FDBP 4OI9A 5EG6C 2BY2A 1AGCB 2X9YA 5KTEL 2X7LA 3MV8A 1K4DB 1MHPL 1EEUA 3ILPA 5FDWB 2IPUK 3OB8A 3SEPA 3WIIL 5JOPD 5KVEH 4RQQB 5EIQA 3HZKA 4AENB 1BQUA 4CVZB 2YPLD 2PTVA 2BK8A 3UTOA 1OGAA 4N68A 5HDOA 3IU4H 5D5MF 2GJ6A 3S37H 3GMNA 1KTDA 3ILQD 1QSED 3WSQL 4K55A 1A7RH 3L7EA 3T0BA 4X7SH 1JUFB 4JFFB 2AJYL 1U8PA 2PCPA 2ZPKL 4KPHL 5IMMB 3RP1A 1I7RB 1UVQB 1L7TL 2ZJSL 4NNXB 3WNLA 3BZDA 1S9KC 1TTUA 3WHE1 1D3CA 5J6HA 4W81A 5DJ6B 5EZIH 4C56B 3HG1D 3VGBA 5EIIB 5JPMA 5DRWB 4JRYB 4EZMA 2X4SB 1LD9B 5GS0D 2DTML 2UZXB 3MLUH 2R39A 5T3XD 5GGSY 3IS0X 4FQCH 4XVTH 3UTSB 5BW7A 1UM4L 5FA4A 3UBXG 2F53E 3MRNA 3P4NA 1I7UB 3PHQA 3LPGA 4X9IA 4GBXD 5IQ7H 4I9WD 1NBZA 3N1MC 5HSFA 3EFDL 2J8UB 4WNQB 1RUMH 1I3GH 3FT2B 4L3AA 3QA3A 3HNTL 2XZCL 4JHAL 1A02N 2OTWB 3MV9B 1CFVH 3GZKA 4OZIE 4X80L 4YC2C 4Y1AB 1JK8B 5CEZE 3FO9B 4EI5A 3GKWH 3MOBL 5E8PB 5HYIA 1S9YA 3WNPA 1H8NA 1IC5H 1CDGA 2V5MA 5ACZB 3M07A 3EGSB 1TJIH 2KPNA 4M62L 2D4FA 2VWEC 2SEBB 4ONFL 3TT3H 1A6UH 2HP4A 3LKPB 5D7LB 5DUPL 1MCWM 4DGIL 4IM8A 4U1JA 3NCBB 5JHDD 3SDCA 2AJVH 3H9ZA 2IADB 3DIFA 3DMMB 1RULH 1UXSB 3K2UL 3WS6C 4ZXBC 2FECI 4HW6A 1LMKA 1E4XL 4AM0B 1T7WA 4RMSA 3VE0A 2XPGA 3BP7A 1HSBB 3ARGB 1KOAA 3VGAB 2PKDA 4TSAL 1TTGA 4QHUB 4MD0B 3MYJB 1XGRB 3C87A 3PWVA 3UTQB 43C9B 3O2DH 3WO4B 3IDYC 3PGFH 3R4DA 1AJ7H 4XNQB 1FP5A 1SY6A 3SO3C 1FAKT 4LCIH 3QDGE 1DSFH 2BOBA 3OXSB 3S35X 4LHUG 1SY6H 5KSUB 4L1DA 2BP3A 5C3TA 3VGDA 3CD4A 4K3HA 2EC9U 1L4IA 4HUUB 3I6KB 5I1HL 2NW3B 4D8PA 4U33A 2GKIA 1B6DA 3I02B 3BEWA 1JRHL 3V4PL 1AP2A 3UTZB 1OPGL 1JHKL 4JKPL 2IH1B 5BS0B 4JFFD 1HH6B 2VXQL 1UJ3A 4I0PB 4JM2A 5J06A 1YEHL 5JZ7C 5D70H 2J88H 4LSRH 5CEZL 4PJBE 4YXKH 4PJDE 1U3HA 4ZNEE 4IEFB 4EIGB 4Y8DC 3D6GA 4C56D 5JMRA 4FFYH 3C60D 3QEGH 3VWKC 2XTLA 3C2AL 1FZKA 3FONA 1U8NA 1F4YL 5DVOA 3VFNB 3DETD 3SGDH 3TYFB 2VLME 2VZOA 4MS8D 2CDEB 2FGWH 5C0AA 3UTSD 3MPCA 4FQQA 5E6IC 1PZUB 4S1SL 2VTFA 1A47A 1KEGL 2PN5A 1OLLA 1WF5A 1JWSB 4Y19E 1KPVB 5FKPA 4PJ8A 1U2CA 4AK1A 2DB8A 2HVJA 1FJ1A 2X9WA 4ZAKB 4QOKE 2D31B 1P84J 3R0MA 3DX7B 4K8RC 3QG7L 4XMLH 2P24A 3VXRB 1U95B 1SYSB 3O4OB 5HDBE 4Y1AD 1RK0B 1IGMH 3GJEB 2VUOA 4RGMC 1WCBA 5EO9A 3ZO0A 2MFNA 3MACH 3L7FA 1S7WA 1BQHG 4N1CA 4QT5B 1NGPL 4P49A 1S7TB 4FQJL 2QHLA 2UV3A 3MLYL 1PSKH 1QSVA 5IHLB 4M4PA 3QNZA 5D7LD 3QEUA 2A9NH 2D03L 3MRKB 4O51A 3AS3A 2P5WE 3G5XA 4PJXF 3W9DB 1M7XA 4NJ9H 3TBSB 4OZIB 5CBAA 1OAXL 2AJXH 1JGDB 3IB4A 1WGOA 1L9MA 1MJUL 2VN7A 4P9HH 1WZMA 3G04A 1YEIL 4HIJA 2R2CA 1ADQA 4X98B 4YWGL 1ZLSL 5CGMA 5KZCB 4PGDA 4LSDA 5TDNB 1LE9B 1ADQH 4OGAC 4PJ7F 3FB5A 2CR6A 4JN2B 1VFAB 4D9RD 3K1DA 4R0LA 3BISA 4S1DC 4EI6B 2X70A 3PIQB 1YEKH 4M61B 3QDME 1FLRH 3QUZC 4L8BB 3BP6A 2Q6WB 3B9KA 3GSQB 1QPXA 3LHPH 4OB5L 4OZGA 2D7PA 2AJSH 4HKJA 5DA0B 2GTWB 5T3ZH 4Y2DB 4OGYL 5BZWB 5KVDL 1CWVA 1MI5E 2RR3A 4PG9B 4I0PD 3QISA 3BKMH 1VFBB 3GSUB 2ED8A 2C3GA 3B9VA 3NAAL 4NOFA 5F3BB 5ICYA 4RIRA 1G7IB 4LSQL 2ZUVA 3QDGB 1G1YA 3WUWB 3BGMA 4PRNA 4XVSL 4M48H 4I18B 1KJ2B 4YBLB 4DGYH 5AD0A 5IW3A 1I3VA 1IAIH 3H3BC 4HIEB 5FKAA 1I7ZB 4S0SD 3U7WL 1XGUB 3MR9A 3ZE0E 3DGGB 1EJOH 1F6FB 1INQA 1BD2A 3L3HA 4HJ0C 1JGEB 4XWGH 3AAZB 3LDBB 3V6BR 3RA7L 4Y16D 5IFAL 1LEGA 2IEPA 5LCVL 3SDDB 1FL3B 1HEZB 3RAJH 4HLJA 1SJEB 4PJBB 5A2LH 3GM8A 1YNTA 3VFMB 1AFVH 4JZOA 4PJDB 1LEIB 4ZAKD 4K3EH 1K3ZA 4LEXH 5JW4N 1NQBA 1PQZB 4N0FB 2NZIA 2ZUUA 3CSBA 1PAMA 4CADA 4HJGB 1MWAA 3LRSA 2B1HL 1WV7T 3O6ML 1FAIH 1F8TL 2RFXB 5HHPB 4M93B 2F58H 2BVOB 3FCTA 3OQ3B 4NSKB 5C0DB 4H8WL 5FYJU 3CUPA 4QNPF 4L3EA 4YHOH 1GOFA 2WP3T 1U8QA 4TPRL 1I1AA 2F53D 3UX9B 2AEIT 2W38A 2XKUA 4Y19B 5HTSA 2YBRB 2MQCA 1BAFH 1C5CL 4FQXB 2HJFA 2GFBA 1MFAL 4ZO6A 3WD5L 4QOKB 2YA0A 4LU5H 3TCLB 5EDXA 2V2TB 1S7VA 5CEZD 2YXMA 3L1OH 1SM3L 1D6VH 2VJXA 2YRPA 1MH5B 2EKJA 4ODUA 4DCQA 3JZ7A 3GK8L 4LAJH 1UKTA 5HYFA 3NGBB 1N26A 4MJ6A 4LLMA 2EEAA 5KW9L 4HWBH 2X4RA 2BFVH 2BSSB 3EIFA 2VRAA 2FB4L 2RJMA 1TZIA 1HHKB 3G6DH 3QB7C 1LEKA 3VFRA 4E42B 3T0EE 4JFDA 5E5UB 4O2CB 4PRAA 4L8CB 2UWEE 2IG2L 4M4RA 3LEYL 1Q38A 4LP4A 1JPFB 4IDLA 2Z4QB 4XP4L 1Z0NA 2YRZA 4OFIA 3WXVH 3WLWC 4WWKB 3GI8L 2BMKA 4POYA 5T33L 5GGQL 4A2LA 5IP4A 3DJ9A 2YPLA 2F54B 1WAAA 5EZLA 3S98A 4DTGL 4Y2DD 3HRPA 3VRLE 2K9UA 1DL7L 1QSEA 4K3DH 4JG1L 3SE4A 5HGHB 3BPNC 5FCSH 5ALBH 2GI7A 1I3RB 3GHBH 3QRGL 3TFKD 2RBLA 4OM1L 1YC7A 3S4SG 4GFTB 1HKLH 3UC0L 4JPVL 3BW9A 3QDGD 3FOMA 4I3SL 1YPZB 4D9QD 2PO6B 1NCAL 3RZCD 2F5BL 3BKYL 1QO3B 4BFBD 5JQ6L 2A0LC 2R0KH 4G5ZL 5DMGC 1A7BA 3OR6B 3BOVA 2HJLA 3HG1A 4RFEB 5LBSH 4U1NB 1HYSC 4X6DF 2WBWB 2AABH 4EIZC 2CMRH 3K4AA 3FFDB 5DYOA 4WEUD 1BBDH 5I18H 5C9KA 3PGDB 4ODVH 1OM3H 5CJQH 5GS0H 1BIIB 2P8PA 5DJ8B 2DIJA 1MI5B 1PG7L 1X7QA 5T3XH 3DX9B 4U1IB 4KQ4H 3HCVB 1KN4L 2F5AH 1E4WH 1NFKA 3PDOA 1P53A 3TIDA 1ED3B 4GBXA 3T2PA 3P30L 5FECA 3FN0L 3NCCB 3GBML 1RZ8B 4BJLA 3U0TA 1UH2A 3B2VH 3WDJA 3C09C 1DBML 4GS7C 4F15C 2IBBA 1RZ7L 5C0GA 1TDQA 3L5JA 1WZ1L 3UAJC 5HYSA 4JDZA 4KDVA 3G5YB 1UKQA 3MUHL 1KIQB 3H9HB 1KBGH 5CGYC 1MCFA 3QDHA 5C0JB 1VPOL 2LTQB 5DR5H 3G5VA 5FOBA 3MA7B 3CDCA 2FEDD 4Y19D 3CH8A 4I13B 4LLDA 1QBBA 2DBJA 3QWQB 4FQXD 5I73B 4QOKD 5CWSA 4F37F 5JHDA 1T83A 3FRPG 4FXKA 1WIUA 4LLQA 5DFVC 2AKRA 3SY0B 4CW1B 4I4WA 3E6HB 4QRUB 4X8XA 1QPPA 4G6FD 2AJ3B 1XF5A 4U3XA 3Q5YA 4PY7A 4PG2C 1QTYT 1U6AH 4XCFL 4I3RL 4JQIL 5J11B 1A7OL 1ZGLA 1BFVL 4OLUL 4NZJA 3V6ZB 5BJTB 1CFQA 4YHLL 1AGCA 1KLUB 4Z7OE 5FXCH 1S5HA 5I15L 1K4DA 4PJEE 4FRWA 7FABL 3KDMA 4WWKD 1GHFH 1E6OH 4RQQA 1GRWA 3QJHA 2VDRL 4TTDC 4YXLH 1S7XB 4IIQC 2XNAB 2AEWA 3SDAC 3VI4E 5HYQB 2F54D 1ZHLB 4K7PL 1D7FA 3AY4A 1A4KB 3LN4B 1IGFL 3CXHJ 5DMIL 2JKXA 4POZD 5CILH 5D1QC 3PHOA 5CJOH 4UBDC 1JUFA 4JFFA 4X9HA 4EOWH 2PO6D 3T77B 5IW1A 2RCSL 4NNXA 3M1BA 4S2SB 2C5DC 4A2MA 2Y5TB 2WLYA 4C56A 3TO4B 3QDMD 3FTGB 3BO8B 3C60A 3ARBC 5CJXC 2HKFL 4E41E 1SEQL 5IEHA 2X4SA 1KXQE 4KHXL 3WE6B 2XWTB 3OZ9H 3NIFF 1A6ZB 1JMXA 3GBNH 5IF0B 3QCUH 5B3JF 2E9JA 3UTSA 1MI5D 4R4FH 5A3ID 5F8RC 4NO0B 4MAUH 4RX4D 5TDPA 5HI5C 3FQNB 1T4KB 1ZV5A 2AQ2A 4PJIF 3G6JF 1CGYA 3P77A 3FT2A 1UM5L 4B41A 6FABL 1WFTA 2OTWA 1GPOL 1U8HB 2VC2H 4Y1AA 5B4MD 1JK8A 2NY5H 5F9OH 3KPSE 2YPVL 5DRNB 2P5EA 4PRPE 5CSBA 3VFGL 4MYWB 1ETZB 5L6YH 3TZVC 5ACZA 1MHPH 4MD5B 5BV7C 1CDHA 1P9MA 1GGCL 5C09A 3RIAK 1KN2H 1WICA 1YEDB 2AV7A 5KS9E 3K8LA 1A0QL 1NCUA 4MNGA 3FQRB 3J8F7 2EYTB 4BA8A 3NPSC 4KVNL 1GOHA 4LNRB 3U46A 4NZTH 5I1DA 3VG9C 3NCJH 4KI5C 2ZUYA 5EA0L 1BF2A 1JGVL 2PYEE 4C4KT 5C2UB 4LPXA 4IRJA 4AM0A 1MFDL 1IGYB 1L7TH 4NNPL 1JVKA 4P57B 1EEZB 4QHUA 5E8DH 1R5VA 1XGRA 3X17A 3VMNA 1F4WH 1OTTC 3TWCL 1AE6L 1QRNB 4Q97A 4XNQA 1YECL 3WBDA 3OJDB 4QGTA 3O11B 3OKEB 5KOMC 4M6AA 3OXSA 3WUZA 4DFHA 5KSUA 3EW3B 3MJGX 3BVNA 4K9EH 5MERA 2F74A 1XH3A 5EUKB 2R4RH 5KVFH 4HUUA 1UM4H 4JCLA 3I6KA 2NW3A 2R69H 3MCG1 3I02A 5D7IA 4Z0XB 5DK3A 1MNUL 1W0WB 4HZLB 3NACH 4E5XA 4PUBL 1BGXH 1X3DA 1OAUH 5I8KL 4URTB 1N5AA 2Y6SD 3FQXB 3PWNB 4P23C 2IH1A 2ARWA 4ODSH 3GB7B 3RGVB 3O3BB 5H37G 1PDKA 3I2CH 4I0PA 1QACA 5EUOB 4UQ2B 3T0ED 2FZ3A 3MV7E 3TNNB 4MAYD 1FH5L 3V52H 3SKUD 5FO9B 5IHUL 1CZ8H 2J4WH 1NSNH 2XZAH 2XRAL 4NWTL 3MRFB 3TO4D 2YUWA 4M62H 1BOYA 2VO5A 5CZXD 5GRXG 5CD5D 1OY3B 1KFAH 1HINL 4M6OL 4MA1C 2V5TA 3RWEB 1UB6A 1UCBL 2CDEA 3F7YB 1NCWL 4NO0D 3P4LA 2ITDB 3Q2CA 5HHOE 4P5TB 3O8XC 4Y16A 1RUQH 1Q72L 5C08E 4NQUA 5HDQH 2VDML 5D71L 5IGXH 5KBNC 3K3QA 1FO0B 1QFWM 3QO0A 4QTHB 1IGJB 3AU1B 3GJEA 3GSNB 4GO6B 3GMOB 3T04D 4PR5B 3TIEB 4AQOA 4HLZH 4E41B 1GGUA 5CBEA 4JPWL 4KMQA 3E2HC 3NZHH 4NC2B 2EEBA 1UC6A 3JSSA 1LK2B 4FQPA 2FHBA 2F53A 1RZFL 2PYFB 3ULVE 5I1HH 1IILE 5DJZA 3MRKA 2ICEB 3GSXA 2PXYD 4G6AD 2FIKB 5F7UA 3OHXA 1EO7A 3TBSA 4JKPH 4I48A 1TQBB 4H20L 2CKBL 4OZIA 3ELAT 3OMZA 2DLFL 1FCGA 3MROA 4U7KA 3KPSB 1BZ9A 4OLWH 1JGDA 4WHCA 3WS3B 1BVKB 4ZFGH 4LQFL 4MLIA 3RY5A 5CEZH 4XBPA 3QIBD 4KK6D 3WYRA 1GC1C 4Z7VF 3QIWC 3CLEH 1OCWL 4PLJC 3OAUH 3THMH 5TDNA 2D0HA 1LE9A 3W11C 3IJHB 1UKSA 3TBTA 5JDJA 2HLAB 2L0DA 5KS9B 2A6IB 4JN2A 4MQ7B 1VFAA 2VXTL 5DD6A 1YYLL 4Y5VA 5D7JC 1MHEA 1XZ0B 5FO7B 5GGRY 2VLKB 5IHZA 2WBJB 4Q9CA 4JM4H 2VDPH 4M61A 2BRQA 4Q2ZB 4Y4HC 4GRWF 1FYHB 2PYEB 4JZJA 2XFXA 2NY3B 2Q7NA 3GSQA 2HFFB 4GXVH 5SWZB 3GUTB 4YDKL 2R2BB 3B9EA 4F80A 3RGVD 4KMLB 5SWQA 4HUWB 4UTBH 1G7JB 4OT1H 3GSUA 4O2FB 2GSIB 2APVA 4GW1B 4K3GA 5A40E 1G7IA 2EO9A 3QDGA 3OKMA 2WUBH 5HGDB 2H32B 1R5WA 3WUWA 4R4BA 4I18A 1KJ2A 1T20B 2D7NA 2CGRH 3RZCA 1KJ2H 2N56A 1LO5B 4IRZH 3MLYH 2HT3D 4XPTH 2FIRT 4RA0C 4KTEL 5IB4A 2D03H 1NMAH 2ZOKA 2XZZA 4KI5F 2X41A 1ONQB 1ZT4A 5EZJA 4PTUB 5JUEH 4OCWH 3CFBB 3P0YL 1T5XA 4CU7A 3SCMD 5IROA 4LK4A 1FBIH 1FZOB 1FL3A 4ENED 1HEZA 1NEZA 3MV7B 1SJEA 4PJBA 1Z9LA 1U8IB 3VFMA 5IJVB 4PJDA 1UWXK 4HWNA 4ZNEA 3V4UH 1EXUB 3BPOC 4FG6D 4J1UB 1MJUH 3MXVL 1KB9K 3WFEL 2YN5A 3BP5A 1EAPB 4O2EA 4OSUH 1DQLH 4PY8J 2IGFL 4HJGA 3MRQB 1YY8A 4E41D 1MCPH 4XP6L 3MSPA 3T2QA 2EEDA 3LKSA 2RFXA 4G6KL 2DKUA 5HHPA 3DX8B 1CICB 4RMUA 3QDJB 3PV6A 4RFOL 4DZBB 2CD0A 4Z7NE 1T03L 4P5MA 1PGRB 4F7MA 4Y19A 5IKCA 2YBRA 2MKWA 3IFLH 5C08B 4FTVB 1VESA 4FQXA 4QOKA 5IMLB 3K81A 5HGBB 4TN9A 1UWXH 2XZQH 5HGAB 2V2TA 3KPSD 1OP3K 4PRPD 5MENA 4U6VL 1EZVX 3PABB 1MH5A 3FO0H 2HVKB 3CPLA 3NFSH 2QADB 3RJDA 4KK9C 2KL6A 3LKOB 5FHAL 1DE4B 1PY4A 2G5RA 3FFCB 3B9DA 4QXUH 1MAJA 5BQ7B 3SQOL 1U58A 4E42A 1HHKA 4G8FA 2XKSA 1MEXL 2P5WA 1JPFA 1KTLA 2VLKD 1NL0L 2WBJD 3LS5L 4OAWA 5DFTA 3T2OA 4HEME 4WWKA 3C5ZC 5CUSH 2PYED 2R1WA 4O02L 3S3JA 5IFAH 2NY3D 1XGQA 1CXKA 2B0SH 2CSPA 3EFFA 4NO5A 4CDHA 1TQCC 5DA4A 5HGHA 4KJWC 4KZEL 3N85L 4X6CF 1K5NA 4NN6C 1VEPA 4Y5YB 4H88H 2Q8AH 3DO7B 3O6MH 2PO6A 3WFBH 1NFDB 1G9NH 2D0GA 1JNNH 4YHNA 1LDPH 1QO3A 1P6FA 2LVEA 5FK9B 4U1SB 3OR6A 4RFEA 3QDMA 2VERN 2W60A 4PJCB 2EDEA 5DFWH 3OX8B 1HILA 5CMAA 1AR1C 4HFWA 3PHSA 5FA3B 4HK0A 3EO9H 2R29L 4LMQI 1YJDH 3EDDA 3HFMH 1MI5A 4XH2B 3HCVA 2NXYC 4RX4A 2CQVA 2BDNH 3MV7D 3S97C 4F3FB 2EECA 3QHZH 5KSVB 2HRPH 1RV6X 1TFHA 2AJUH 4WGVB 5F89A 4H25B 4L5FH 3GK8H 5C2BH 1MCCA 4RCAA 1QYGL 1V7ML 3T1FA 5GISL 3F8UB 4NNYA 4OCXL 1CTNA 1MSPA 4JO4H 2QJDA 3W9EA 4IDJL 3C6LC 2J6EL 3QH3A 2JJSA 4AIXA 1KIQA 1K8IA 5C0JA 1A7PH 3NA9L 4XP4H 3MA7A 5E70A 3VFWB 5C9JB 1EMTH 4NHCL 5K9JL 1MCBA 1CN4A 5C08D 4XPAL 4Z8FH 4WV1B 3OSKA 2YD8A 4DTGH 4FXGB 1IFHH 2XA8L 3CVIL 3KPPA 5D9SA 1TIUA 2ZKHH 1TZGH 3CMOL 1S9WB 4OM1H 4OTXL 4Y0GA 3E6HA 3IRPX 4JPVH 1J0JA 1AR2A 3O6FB 4LL9A 2QADD 1DLFL 2AJ3A 4QWWC 1JHTA 4YXHH 5MI0B 1AO7E 2AK1H 3BN9D 2QKIB 3FFCD 2I24N 4F9PA 1R3HB 1D5XA 5JQ6H 1EERB 3MLRL 3ULVD 3TPUB 3I6LE 3ARFC 1PLGH 3VXUB 3V6ZA 2BY1A 1OTUD 4YZFF 2JK5A 1OTSD 3CDFA 3LQAL 3UMTA 2CJUH 3RVVC 3PQYE 2ATPB 3DVNB 4HFUH 5ALCH 4NQTA 1DEEB 3RPKA 4XNYH 1FVCA 4LPTA 1PG7H 4YDIL 4PB0H 2G9HB 1G7PB 1KN4H 4L8SC 1S7XA 2XNAA 4NGHH 4G6JL 1TITA 1R3JB 4U6XB 1CVSC 1RU9L 1F5WA 2NQCA 1MJ7L 5ILTL 1K8DA 4FQHB 2B4CH 3EYFB 1QKZL 4FA8A 1WZ1H 1B4RA 3T0EA 4JRWA 4MAYA 2UWEA 5E2JA 4XPGL 1AKJB 4JKKA 4J4PC 4KXZI 5D6CA 4M8QB 2KZ1B 4YIQB 5I17A 3TO4A 1AQDB 3FTGA 1A6AA 1KC5H 3WIHL 5DJCB 1CQYA 1CE1H 3BIBX 2NY6B 1T66D 3WE6A 2XWTA 4KH2A 4Y8AA 3TVMB 1KLGA 3N1GC 3EYUH 2OJEB 2Q7YA 5LQBL 4Z7WE 1O0VA 1SJHB 2I25N 3VFOA 3FN9A 3FQNA 4F7PB 2V7NB 3U36B 5F7WC 3VXME 1G7MB 3QP3A 1Q9WB 1T2QL 3V6OE 2ZOLB 3L5IA 4ZFFA 3AREC 1CXIA 3TLRA 4KHTH 5TH2B 2NNAB 2ORBL 1Q94B 2C9AA 1RZKC 1JFQH 4R6UA 1O7VA 4NZUL 3O6KH 4LPYA 2ZUWA 4WCYL 1A7OH 1BFVH 2HYMA 5GHWH 4P48A 5DDHA 2FH6A 1TJHL 3LEXA 1UZ6F 4KQ3L 1INEL 4LOUD 4P9ML 4QRTB 1YEDA 5GIRB 3ZE2F 4HJJL 5B21A 3BH9B 3T1WA 3BYTA 4BSWA 3JWDL 4Y4KB 3SGEH 4WY7L 1ZLWK 3FQRA 4WW2A 2BCKB 1IEAB 1C16B 4DN4L 3QI9C 3X3GH 2EYTA 5ACLA 2PXYA 1JPGA 4KGLA 1RJCA 1FL5A 2EE2A 5ICZB 4AEIL 1P6AB 4M6ML 5F9WB 3UYRL 4QHNB 2CUHA 3O6FD 4HUVB 1XGYL 3VXOB 2OP4H 1IGYA 2IALA 4UIKL 3QIBA 1KCKA 4TTGA 4LSPH 1EEZA 4YHML 4JKLA 5IBLC 3HNVH 2M8XA 4WI6A 3VFUB 4W6WB 3VXUD 5B39B 1EHLL 3O11A 5HVFB 4JHBA 3HZVB 1ZSDA 4R2GB 4M7ZB 3L3KB 2QQNL 4MDIA 1ZLWH 1FV1A 3ZTNL 5DXWA 5CKAA 3KHQA 2AGJH 3NFPA 4NN7C 4HMDA 3UTTE 1YQ2A 4S1RH 5HBBA 3HE7D 4HZLA 3L5WB 4ZO9A 3V2AR 1H15B 1J05B 5T1MA 3ZKND 5ID1A 3PNWA 2CDFB 4LPVA 3FQXA 4GAYB 1AO7B 2CK2A 1UM5H 3GB7A 4I0KA 4P59H 4Q58C 3RGVA 5E08H 3O3BA 1GPOH 3U1SL 3U79A 1K2DB 3HB3D 2QHRL 1XF2B 2X4NA 4N0UE 5FO9A 4Q6IC 1AKJD 4TNVK 1UH4A 1RZJH 3K0WA 3RNQA 4PJEA 1IGTA 1LO3L 1FNSL 1N4XH 3U4EB 4WUUE 2HTLC 3CX5J 4Q9QL 2BNQE 2P1YA 3RX8A 4WW1A 1P69B 3EYOB 2C4XA 3BQUC 3LPFA 1D5BB 2D7QA 3QZWG 4WGWB 1RUAH 4G3YL 3RWEA 1O5DT 2R1YB 4F2MB 4Z0BL 3TVMD 1A0QH 4LASL 3STLB 5EBWA 1ND0B 1KCUL 2R0LL 5FUCE 3KYKH 3DUHA 3SCMA 1I85C 1JL8A 5EA0H 4BSVA 2C3VB 4UV7L 1JGVH 5GGSB 4CKVX 1JGLL 2B1AL 5SWSE 3V0WL 1FO0A 3R8QA 3AU1A 5EU6E 1BOGB 2AVGA 1FO0H 3GMOA 3MRMA 3O3DB 4H8WC 4QHMA 3FB6B 4XMKH 3BKCL 1A6WH 3RRQA 3TWCH 3GBLA 1YECH 3GIZL 4GH7B 5DO2D 5EZOL 5HHVH 3GSVA 4YDLC 1XF1A 5J7CC 4YBQD 1LK2A 4I77L 4JPIB 4LKCB 3V6FA 3J7HA 5DHXB 4Y4KD 1WFUA 4XNXH 2NW2B 2FIKA 5TDOA 4UQ3B 1YQVH 4U1KB 4HKXB 2W92A 4L8DB 1YN7B 5E99L 1MQKL 4N0CD 3KPSA 2FO4A 4PRPA 1MVUA 1RY7B 4WI2A 4LSTL 4PJFF 4UILH 1MQ8A 2WWMD 5E2WL 2FO1A 4UI2A 2ZCLL 2ZUSA 1CXHA 2XTJE 1C5DA 3CCHB 5CP7B 3MJ7B 1U3JA 4IRSA 2FR4A 2HLAA 5KS9A 4MQ7A 4Z95L 4ZUTB 4K07A 1IGIH 1JTPA 3HTLX 4R2GD 1IKNC 4MZ3A 3HN3A 3FL7A 1A22B 2WBJA 2OL3B 1SJVA 1NCWH 3G08B 1JPST 3DV4B 5ENWA 5L2KE 2PYEA 3IDNB 2DM4A 3MTRA 4QLRA 2HFFA 3GNML 4PREB 1HYRC 5D2NE 5IWLA 4WTWA 3GUTA 5BVJB 1AO7D 1YEEL 3X13A 2R2BA 3MBEA 1V3JA 1HK6A 4N5ED 4OM0L 3AS2A 3DOSA 3I6LD 2GSIA 1NAMB 4GW1A 4OLXL 1ZLUK 3KLHC 5JHLH 5HGDA 3O9WB 3GMRB 3PQYD 2Y25A 1S78C 5IFHL 3IT8D 2HT2D 3BE1L 5F7DA 1WFOA 4BFIA 1T20A 1EEYB 2G5BB 1MFBL 1D9KB 1E4XI 2ERJB 1FZJA 2CLVB 2YN3A 3BD5A 3LY6A 3BP4B 3UTTB 5JA9A 2QTEA 4PGEB 4N0YH 4K2UH 4UINL 4YQXH 1LO4L 1QVOB 4PTUA 3RJQB 4H0GA 3R0NA 4DJMA 4X83A 1H3PL 3S34L 2ZZUT 2VE6B 2OTUA 1FZOA 4HXBL 4GQ9H 4N0UB 1INDH 3VWJB 5IJVA 3ZHLA 4J1UA 2UUDK 1ZLUH 1J1OL 1BP3B 4R97C 2P4AB 5BMFL 4WUUB 3X12B 2BNQB 5MHSE 2NR6D 1JRHI 1YY9D 5INDB 1X4XA 4JFHE 3L3OA 4OIAA 5FEBA 1AHWC 1IL1B 3DX8A 2IAMB 3TT1H 4ISVA 1QSFE 3LAFA 5I1CH 3SJVB 4DZBA 5HHOA 4WDIB 2MPAH 4LCWE 5D5ME 1OAKL 1L0YA 3VXMD 2QSCL 2HJKB 1KENL 5C08A 4P4KA 5I74C 3D0VB 1N64L 4XPFL 5IMLA 3LQMA 5SWSB 4OKDA 3X11B 5EU6B 5DHYB 2MWCA 2Z92B 4MCZB 3PABA 1KJ3L 4ACPA 1HHJA 2AQ1A 2ED9A 3CZJA 4OV5B 4NN5B 1UM6H 4JQXC 3LKOA 4NFBA 4BH8B 4ZOBA 5F1IB 3PP4H 3BZEA 3DXAE 1NGZB 5IR1B 5BQ7A 5IW6B 1YMME 3FB8A 3NIDE 2VH5H 3ULVH 2A73A 3WEXB 4LLVA 4WEMB 4PYHA 4LIQH 3CK0H 1NJ9B 1QBLH 2EH7L 3C2SA 3WNKA 3P0YH 1DANU 3UJJH 2FECL 4R26H 4UB0H 2HRLA 5F9AC 5DD5H 3FMGH 1A1NA 4LKXB 3PWJB 4OJFH 2ADJB 5GGVH 5D96B 2XTJB 5DMKA 1NGWA 1GOGA 1JN6A 1CQKA 3K80A 4Z6AT 2EXWD 5FM5M 4FFZL 4Y88A 3DO7A 4ZNCD 1J86A 5E94B 5D93B 4CL7A 4IMKA 2WP3O 5FK9A 1D9KD 4U1SA 3HAEB 4I2XE 1JZ2A 1P4LB 1AD0B 2OQJA 3OX8A 3UTTD 2EDLA 5BCAA 1YEGH 5T1LB 1IT9H 3OKYA 5F7KC 5FA3A 5D2NB 1EBAA 4KDTA 5D1ZC 1MIMH 2X1WL 5C0CE 3STBA 1HCVA 1U8KA 4RMTA 5E8EB 3FT3A 2O61A 3L5XL 3QAZC 5I71C 1N8ZB 3TBYB 1LP9F 5GSRB 3VWJD 4LPCA 5KSVA 4XC3H 2O5XH 1OW0A 4FABL 3GEWB 4H25A 4WUUD 5JIKA 2BNQD 2VXVH 4Z7QF 3BRFA 4KKBD 5FHAH 35C8H 2HFTA 4UAOC 2XG5A 1WT5C 3HUJF 3PL6C 4X99B 2D2OA 2NY0D 3M8OL 2IAMD 4LSUH 4MNQB 5EBLA 4QO1A 1B2WL 1FIEA 1X6LA 3AFLA 5C0BB 3IDIA 2W0PA 3HC3H 2DQHH 3X3FL 5C9JA 1SBSL 2JE8A 4AIZB 3S9DB 3OKLB 2DQTH 4WV1A 3TA3C 2Y07L 1R3IH 5BZDB 3OTTA 5SWSD 3RIFK 4OCSH 1NMBL 5EU6D 4GG6B 4GQPH 4FXGA 2EDWA 1T0PB 3T4YA 2C4FT 3LH2H 4HGKC 2N4IA 1S9WA 1FNHA 4LLYA 5GRYA 4NQCB 3RX5A 3O6FA 4QXWA 1HHHB 2IPTL 5DLML 1ZANH 3OKKB 4Q9BA 5ELIA 2W9DH 1QSFB 4P9HC 2QKIA 2J3SA 3DURB 4PJ9C 1V8HA 4UIMB 1QFWH 3CXDL 3N1FC 4LCWB 3TPUA 5DEGB 1EIBA 4KROC 3T0DA 3OF6A 3SE3A 1B0GB 5C0RH 1R3KA 4RGOH 1U41A 1VCAA 2P43B 3SPVB 4OF0A 2W65B 3DVNA 4NKOA 3S36L 3U7YH 1UA6L 3HE6C 4BK5A 3LMJL 2BOCB 2G9HA 1W72L 3EZ8A 2YSSB 1J87A 2NYYC 1Q0XL 3B8YA 1KCLA 3CIQA 4C57C 2H2SD 4PBVC 3QUKB 4RMQA 1EFXB 3HE7A 2DBLH 1R3JA 4WHTA 2I60H 4WU7B 3BWAA 3H3PL 3ALWA 1YNLH 2B7DT 2XTJD 1CL7I 4S11A 1F6LL 4FHBD 5I1KH 2R8SH 1YMMB 2BY0A 2J6EA 1CK0H 4OGXH 4MNHB 4RNRB 1EX0A 1AKJA 1Q9KA 2APXA 4WJ5B 4APQB 2J6EH 4HWZB 4F8QA 4M8QA 4YIQA 5E2UH 3K8MA 5DD1L 3RHWK 3VXTB 1OP5K 1AQDA 2JCCE 3OJMB 3NA9H 2FLRT 5DJCA 4OFKA 2WANA 3KPTA 4NHCH 4OF7A 5K9JH 3HI6L 4CMHB 1IZKA 3TVMA 1D6EB 1NGQH 4YNYB 4KUCF 1I8MB 1SJHA 3F7VA 4M7LT 2FL5B 2LE9A 1LO0L 4F7PA 2V7NA 1NGXB 4F8TA 3V0AC 4NO3B 2EDHA 1B88A 1DVFB 1XIWC 4TYUA 3WFHB 1B0WA 5FCUL 3P4OA 2A38A 2HWZL 3QHFH 3GSWB 4ZUWB 3B6SB 2QQLL 5TH2A 2PW2B 4PJ7E 1JNHA 4R3SA 1A5FH 1CU4L 4I2XB 3RTQC 1RFDH 3DO3A 1OP5H 1MY7A 1M4KA 2OR7A 1HNFA 1MPAH 1RIVH 4XBEL 4UU9A 4NQEB 5C0BD 5FF6B 2AXFA 2NTFB 1CDIA 4G7VL 2Y36H 3BKJL 1J8KA 1JI1A 1S7UB 3P11L 1ZHNB 4Y4KA 3MLVL 2ZUQB 2E7LA 3STZB 2BCKA 1IEAA 5MEOB 2FSEB 3NBNA 1F3DJ 2XG4A 4TRPH 4XNUL 5LGJB 2V6HA 5MHSD 5ICZA 1E6JH 1HZHL 4ODBD 4CVUA 4GKSB 4JFHD 2VWEE 1MJ7H 4GKZB 3UJIH 5IB3B 4ZTOL 5ESAA 4DEPB 3QUXB 4HBQA 12E8L 3ALXA 4XPGH 1QSFD 2D7MA 2OZ4L 2D7TL 4LCWD 1ZT7B 2H26A 4CGTA 3VFUA 5B39A 2MQ3A 1D5MA 5L8JB 4F7CA 2FJFB 5E95B 4XAWL 4O5LH 1RMFH 4FMFA 2COQA 1ZA3A 2I26N 1CFSA 4LP5A 4YFLF 4BELD 1LE5B 1EVTC 5GS1B 3MRBB 5M95B 4WHYH 4YJZL 3L5WA 1H15A 3S35H 1ZS8A 2CDFA 4HS3A 1T2QH 4N5UA 5ITBH 1AO7A 2P44B 3M45A 1RHHA 5DEFA 3WN5B 4OZHF 3DXAD 5BXFB 2Z8WC 1A9BA 4NWUL 4QRRB 4KRPC 1YMMD 4FFVD 1J1XL 3O4LE 2ZCKH 2YRLA 1XF4B 4YAQB 1U0QA 4ZUVA 3MUJA 4APQD 1T1YA 4WCYH 4QNPE 3RWFA 3P73B 3QHTC 3PQYA 1TPXC 5HVWA 2GJZA 3U4EA 1VA9A 1A9EB 2BNRE 5T5FH 1F00I 3PWPA 1Q0YL 5EOTB 4KQ3H 4P9MH 4OZFG 1J0KA 1B4JH 3LQZA 1KCSL 4F2MA 5DSCB 3W0WE 1IC1A 4J12A 3JWDH 2VISB 5JOFB 3STLA 2YS4A 4FFWC 1ND0A 4P4RA 4DN4H 3SKJH 4KRMB 3QCTH 4WI9A 4DKFL 4C4KO 3GIVB 3VG0L 5EU5A 1EPFA 3JV0A 5GGSA 5TPWL 1XGYH 4WO4B 4GAJL 2BVEA 1DDHB 1I8LA 2JCCB 3PWUA 4P2RE 4YO0B 1I1FB 3O3DA 1HDMB 4EVNB 4DVRH 1H3UA 1EHLH 2ADFH 1BZQK 4FS0A 1RSFA 5J3HD 5EOCL 1T04B 4WI3A 4FZ8H 3NH7H 3T8XA 4Z7WA 1G0YR 1F3JA 4HQQH 3ZTNH 3DX6B 4XTRD 3DVGA 4JPIA 1UEYA 3E8UH 3VXMA 5I1AA 1DQQB 4ZUSB 3V6OA 3MRCA 4PP1D 1NUFA 2NW2A 2BC4A 2H41A 4OZGF 4L8DA 4U1KA 4QXTB 4QCIB 1YN7A 5AAMA 1F58L 4PJ7B 5D2LB 3SDXE 2W0FB 5GJSH 3ARDC 4NYLB 4JRXE 3U1SH 1CE6A 3QUXD 3ZSSA 1P4IH 2P48B 5MP6H 5FYJL 4UMGA 4NJAH 3REVB 2H9GB 2EYRA 3I6GA 3L95B 1CF8L 3HPJB 3MRRB 4JO3L 4Q0XL 4XXDB 5K59F 3ARVA 4ALAL 1D5IL 4G8GE 4Q9QH 2R9HD 3CCHA 4G9DA 3MJ7A 1BPVA 3RY4A 3H9SE 4YC2B 3FAWA 4YK4B 5EU3B 1WIOA 2OL3A 4LASH 1I8KA 2O5ZH 3G08A 1KCUH 2BVPB 3DV4A 2OL3H 3FZUC 4EDXA 1ORSA 1A3QA 3WFCH 2CXKA 3IDNA 2UYLA 3BUYA 3VXNB 4EN3B 4PREA 1JPSL 5HI4C 1RZGA 4LARH 5BVJA 3MV11 1MJ8L 3PJSA 3AROA 2B1AH 1EV2E 2IPKB 1VFOA 4GRLA 4KY1H 1WEJL 1Z3GL 5HVGB 3CAFA 3LN5B 4PJAE 1NAMH 4CAGA 4JDTL 3GMRA 2NCMA 1GCFA 3QUMB 3UO1H 1A3RH 3QWOA 3CH1B 5CEYA 1HQ4B 1T5WB 2G5BA 5A2KH 1DZBA 3C8HA 4ELMF 3S7GA 1KEML 3QULB 2A77L 4EBQL 4K8RL 1ZWIA 3SHSA 2BSTA 2OS7A 2CLVA 3H6JA 5F8QC 3BP4A 3UTTA 3DTXA 4PGEA 1OAZL 1RJLB 3F6LA 3SKNA 3BDXA 4MDJB 2CH8A 3H9YA 2L4OA 5GRWA 3PF2A 4TNWK 1A3LH 3CSYB 3NPZB 4N0UA 4NKMB 2DAVA 2DIAA 3WFZA 4WUUA 5E2WH 3X12A 2BNQA 5I19L 1BFOB 3ZSTA 1K9TA 2ZCLH 4R4ND 3VH8A 5INDA 1YN6B 2Y1VA 1QLEL 1IL1A 2X5PA 4Z95H 2I5YL 4OCYH 3MGTB 5IESH 1S7RB 2VMFA 1JMZA 3KGRA 4WDIA 3QT2A 4MA3B 5I1IH 4XMPH 3BUTA 2BVTA 1MHCB 3VWKB 1YYML 1CGSL 2JELH 5SWSA 3KJ4C 3T09A 1WAAF 2CK0H 1WK0A 4NRXB 1CFNB 1XAUA 2HTKC 3BT2L 4P2RB 1FFNB 3MXWH 5EU6A 4M7KL 2Z92A 3ARQA 1HQRB 4OM0H 3P4MB 4MCZA 1DQJB 1R6VA 3MZGB 5IT2L 2VR4A 3D0LB 3DMMC 2WQ8A 1F4XL 2DWDA 4OV5A 2F9BT 1QNZH 2V17H 3BE1H 1FFPB 2VDOH 4X4XA 4Y4FA 3LQAC 1KNOB 5IVNA 5C1MB 5IW6A 3MRLB 3NIFE 3ARGC 3KLAB 1RIHL 5E2VL 3VGAC 5B3JE 2E9IA 1FC1A 4CRPA 5GGUB 3WEXA 3WO4C 5DD3H 1XCTA 3BHBA 5HD8D 3FQUA 1AGFA 4PJIE 1WBZB 3G6JE 5L8LB 3ROOB 3V7MA 4K9EC 3SDXB 2YKLL 5J89A 5CHNA 4FQLL 1NCCL 4EN3D 4JRXB 2R2HA 2ZNXA 3DVFA 4HXBH 1VGEH 3QQ9C 3TNMB 4ELKB 2DQIH 4QF1B 4XCYA 3T0XA 3JV6B 5IBUG 3PWJA 2JJTA 4G8GB 2IPUG 5A16B 1MRFL 4J2XA 5HYEA 1RVFL 1BEYL 1J0ZA 2GEEA 3N1PC 1CT8B 1JGUH 4XP9L 3F5WB 4OQTA 4YR6B 5E94A 2FD6L 4MXQC 3T3MF 1J12A 4OQTH 3RUGF 3F12B 2GUOA 4MA7L 1MCQA 5KSAA 1KUMA 3HAEA 2VLRB 4M9PA 1P4LA 4JN1H 1Y0LA 5L2KA 5CSGA 1GIGH 3HAEH 4ETQA 1TZHB 2X4PB 1PVHA 1OGTA 4HCRL 1FCCA 5D2NA 1F2QA 5EOQL 3DUUB 4O4YL 2DQDL 1T6WA 4JAMA 2PTTB 1OVZA 2VDQL 5FUOL 2FX7H 5E8EA 3REWA 3MJ6A 3TBYA 5FYKE 1EHAA 5GSRA 4YPGB 2A74B 4PB9L 3WV0A 4UUJA 2OI9C 1KJ3H 4PJAB 1YUHA 1FGNL 4U49A 2C7UB 3CX5K 3DLQR 2BNRD 2O5YL 1VHPA 1FE8L 4ZAKC 4DZ8B 4HHAB 4JGJA 1NGYB 4X99A 3W0WD 5KN5A 2LAGB 5JZ7D 4EUPB 2HT4D 5ABDE 1IAIM 1JF1A 5AAWA 1C1EL 1MUJB 3O2WL 1NFIA 1UACL 4AIZA 4LSSH 5E0QA 1MVFA 5T1DL 2OX5A 3VWKD 3ZKMC 1ZTXL 2I9TB 4BZ2H 3ILPB 1I9RL 5DTFA 4RWYH 3D18A 4I1NB 5IIEA 1QA9A 4P2RD 3HZKB 4W4OC 4F57L 2G60L 5BOZG 5E6ID 5TQ0L 1OGAB 5D1XC 3RDTA 4NQSA 3GMNB 4ORZC 1CD8A 1HHHA 1QFPA 1WBYA 1L0QA 4FFZH 1ZEAL 1QSFA 1TNMA 1GGYA 3SE8L 4K8RD 1U8PB 4OFDA 3ULSB 4F7TA 1CXFA 4LCWA 5D5MA 3V0VB 4NZRL 3V9FA 4YFDB 2YUVA 5I6XB 1U92A 3HI5H 1CGUA 2YMXH 5E2TL 5ISZE 2DJ4A 3QXDB 5J6HB 5SV3A 2W65A 3RY6C 3V5HB 5JPMB 5AG8A 4LFHD 2G75A 1A7QH 3AGVA 3GRWL 4JRXD 4M43L 2P8MB 2DD8L 5FYKL 3KPRE 3HMWL 4Q7DA 4FABH 4QGYA 3ARWA 2J8UF 4G8GD 2YHGA 3KLSA 1WQVT 5HXMA 3DXAA 3KR3H 5JW5A 1NBZB 1AQKL 3C08L 1YMMA 1U93B 3QJFA 4Y2DC 1SMAA 2ESVE 2J5LB 4MNHA 1N0XL 3BDYH 2ID5A 3PUCA 4APQA 4WJ5A 4HWZA 3JWOL 4GW4B 3TBVB 4YDJA 1T7ZA 3VXTA 4PJIB 4K71B 3G6JB 4EI5B 1S9YB 2V2XA 4K7PX 2XWBB 4YBLC 5T1KA 1ZHBA 3V5DB 5DVMA 3OR7A 3K2MC 3MJ9L 2BY3A 4YNYA 1I8MA 4GG8B 4S1DD 5E1HB 2N7AA 2FL5A 3WKNA 5I30L 4HBCL 4DK3A 5EN2A 1AXIB 1NGXA 3QUZD 3SDCB 4M7LL 1HI6A 1K4CA 3WFHA 3DIFB 3LDBC 4FP8H 5TE4H 1J10A 4HG4K 4ZUWA 3SDDC 4AEEA 3GO1H 2IC2A 5I2IB 3S88L 4M5ZH 3CXDH 4XPBH 1P4BH 3BP7B 2BRRL 4RRPA 1MFCL 5TF1L 3PWVB 5JLZB 4M1DH 3RBSA 2FYYB 2P49B 3VRIA 3VXQA 4M7JL 5E8OA 5FHBL 5C0CA 4XX1G 1UXWA 1W72A 4M93C 3RVTD 3U0PA 3BDBA 3LMJH 2BOBB 4UNTA 2LU4A 2YD5A 5C71A 4DKDC 1Q0XH 3HPLB 4D0CB 3STZA 5MEOA 2FSEA 4RISH 2FEDC 1K6QH 4HIHB 3Q1SH 3H3PH 4HJ0D 1OGAD 1RI8A 2OTPA 4GKSA 3AMKA 3SBWC 5J57B 2C3XA 3U2SA 5IB3A 3EUUA 1AP2B 3QUXA 4NCDA 4FQIH 2R0WL 3SKOB 1NPUA 4MD4B 5LGKA 1UJ3B 4HK3J 1CDBA 5DD1H 1ZT7A 4JM2B 3C09B 3ZDZE 5TJWK 1U3HB 4KI5E 3N9GH 4LMQE 2EDNA 5JO5A 5FGBA 2GQHA 1H9VA 4OCRL 1CGTA 3S8WA 4RFNC 1U8NB 4XVJH 1LE5A 3WIFA 2YA1A 5LGHL 1KGCE 2Q86A 3VGHA 1DBBL 4KU1A 5CD3B 3ZYJA 3PP3H 2CIIB 5C0AB 4LEOA 1WC7B 2EDBA 1FRGH 1J1PL 5FCUH 1FG2A 4OIIH 3WN5A 5BXFA 1GAFH 2XXMB 4NBYB 1NAKH 4PJ8B 4X9FA 4L9LC 5F96L 2H2PD 5ISZB 3P73A 1UQSA 4ERSL 4XBEH 3G9AB 2UZIL 4CN1A 4F58H 4UTAH 4NKIL 1G9NC 5EOTA 1ZGLM 3T3PF 1OAQL 2B2XH 1B9ZA 2EDYA 5EO9B 3ARXA 3IDGA 4BM7A 1S7WB 1EGJL 3KPRB 2ICWI 1UGNA 3P11H 1GZQA 2VISA 3NABL 3QNZB 4NP4L 4BYHA 2VL5B 1YJDC 2IMNA 3VFPB 3EOTL 4MWFA 1RURL 1U8OA 3IJYB 4L3CB 3WLWD 4NUGL 3RKDC 1WJ3A 5BV7L 3G5XB 2ESVB 4ZTOH 2J7LA 4F7EA 1QG3A 4OLYL 4KWUA 2VNCA 12E8H 2OZ4A 2EE3A 2JCCA 4JO1L 2OZ4H 1I1FA 4XCNB 3SE9L 15C8H 4EVNA 1X5XA 4AMKH 1OP9A 1MCWW 3UEZA 1KELH 4HIJB 1DBAL 1IQDA 3HR6A 1MIEL 1NCBL 4PGDB 3NZ8A 3OB0K 4XAWH 5L88H 3DX6A 2A0LD 5FYKD 5HI3D 1J0HA 1I75A 2CLRA 4MXWL 2VZVA 3H7LA 5F7LB 5DC9B 1HYSD 2H6PB 1DQQA 2LTQC 2PW1B 3ARBB 2AAVA 1HSAA 4ZUSA 4NBZB 4OF5A 2X70B 2DQUH 4MSWB 3BH8B 3U9PL 1WTLA 3QPQC 4QCIA 2J8OA 3LVEA 4PJ7A 3JVGC 5I73C 3BP6B 2W0FA 4TUKH 3MA9H 4A6YB 4OLEA 4HKJB 2ITCA 3MRGA 4CVXB 2Q76B 3UBXI 5DQ9B 3HZMA 4Y7MA 3L95A 5GJTL 1OAYL 5C0EB 5JW4M 5K9OB 3HPJA 4FQ1L 4DFIA 3MLWH 6CGTA 4NUJA 3LIZH 5ICYB 4RIRB 2IBZY 3INUH 4JQVC 4AJ0A 4R9HA 1QLFA 4KV5F 3UAJD 3U30C 3BGMB 4PRNB 3UROR 5INCB 1I7TA 4KTDH 5F44A 3ZL4H 1KB5L 5AD0B 1RHFA 5J11C 3GSRB 3K4DA 3MLXL 3TZVB 5FKAB 5CGYD 2BVPA 2DKSA 3MR9B 5FYLE 2FATH 4N8VA 4MXVE 1AIFB 1BD2B 3TESA 4PJBF 3CVHL 3BPLC 5J13B 5FUZL 2MCPL 4PJ8D 3IRZA 3U0WL 3VGFA 3CC5B 3LEVL 3NPSB 1YNTB 3VG9B 4HIXH 4K3JL 4N9OB 3WS6A 4MLSA 4ZXBA 4HUXA 5ISZD 3LN5A 4YUEH 1LK3H 4GSDL 3IXTA 3CH1A 2FRGP 3EOAB 2DM2A 1T5WA 1TCMA 5I8OL 3QUMH 2HAZA 2L7JA 1MWAB 4WFHD 1JZ8A 4JFEE 4Z77B 3CNKA 2JB5L 3KPRD 5J1AA 1R24B 3FCTB 2P46B 1CBVH 3WKML 1GYAA 3CUPB 4L3EB 1U8QB 4BQBA 1I1AB 1AI1L 2IFFL 1ERNA 3BESR 4FQ2H 1S5IH 5HDBF 3VW3L 4ZFOL 3CSYA 2V9RA 2ESVD 3O4LA 2HFGH 2YEZA 3EYSL 2MOVA 2GFBB 5HYSG 1QR1A 2JB6B 2DN7A 3SDAD 4QTIH 4M1CC 4LLAA 4K23L 1S7VB 2BNRA 3HHRB 3GI9H 4JG0L 5D1QD 4P23B 4ALAH 1I1CA 4UBDD 4ODUB 3CSPA 2NLJA 1F6AB 1IBGL 4KJQC 4TNWF 4KKAC 4MJ6B 3W0WA 1VEMA 4GAGL 5CP3H 4C54A 2X4RB 3PV7A 4YX2L 3IFNL 1OSPH 3LCYA 1AGEA 4M6NL 3VFRB 1GC1L 4JFDB 4Z7UE 5HYJE 1N7ML 5AYUL 3ARBD 3VWKA 5FYLL 5EC1A 5DVLA 4OD3H 1ACYL 1MRCH 4R8WL 5AZEH 3UPAA 4L4VA 1VKXB 1DQML 1V7NH 2CO6B 2N1KA 1FFNA 4P2RA 3ULUL 1JP5A 5CINL 3QFJE 5E6IA 1QFHA 3P4MA 5HI5D 4WU5A 3V4VL 1CI5A 5EZLB 4G6AC 1Z3GH 4HS8H 4FZEL 5JR1H 3VI3E 1F45A 4OLZH 1A6TA 1YPZF 4J3VA 2WV3A 1EFQA 1A2YA 5E5RB 3BW9B 3I9GL 1KEMH 2IQAB 3ES6B 4OFPA 4PS4L 1Y18B 5A43C 3KLAA 4K8RH 1J5OH 4RA3A 5I1GL 5C7XL 2OLDA 3NCYS 4OKVA 2FX8L 3D2UB 3E2HB 2E7MA 3TZVD 2AK4E 5FGSA 4HV8B 1FPTL 3MRHB 1NLBL 1WBZA 2DLHA 2XY2A 4UT9L 4I3GA 2A2QT 2PR4L 3SDXA 4R7DB 3W2DL 4JRXA 2EDRA 2JIXB 3N0PB 2JTDA 3VFSB 2WWKO 4OI7A 3TN0C 1ITBB 4QF1A 5GGRA 3BZ4A 1XT5A 3JV6A 1MAMH 3ETBF 5C09E 2KZWA 1CR9L 2AEQH 1MCEA 1RAMA 5EPMA 5I19H 3U4AA 3EYVA 4KI5D 4LBEA 3TIDB 4ONOA 1QFOA 4K94L 4GBXB 1HCFX 3H9SA 1CT8A 1IQWL 5FECB 1IC7H 5JW4Q 3B43A 3F5WA 1BREA 1QLEH 3U0TB 1RUPL 4O58H 4EXKA 3VFVB 3F12A 3ZE2E 5C0GB 4P3CL 1CDUA 1RZJC 5HYSB 1KGCD 4F37K 4NO2B 4JDZB 1A7NL 1TZHA 2X4PA 1OTTD 3RI5F 2HG5A 1MCOL 1MLCA 4L3ED 4KRNA 1QFUL 2W9EL 3DROB 2A1WH 3G5VB 4DGVL 5FOBB 4XAKE 1TETH 3LKQA 2NX5E 3TM6A 4E0RA 3ZMRA 1RD6A 1P7HL 2WINB 2AEPH 4AT6B 4YPGA 5CWSB 3QUZA 5LWYL 4PJAA 3DHMA 4TULH 3E3QC 3CFCL 2AW2A 4P5TC 1F4XH 3P0VL 4LLQB 2AKRB 4P23D 4JO2L 1NBYB 5EWIL 1D5ZA 4UV4H 4JFEB 4GKNB 5DK0A 4HHAA 1NGYA 2DYPB 4EUPA 3FQWB 5L7XL 4P2OC 5I1EH 4EUPH 4PY7B 4JFDD 2DDQH 1CFQB 4JKMA 5IB5B 2EDOA 1S5HB 3VA2C 2I9TA 4P5KA 1LHZA 1NCCH 3ARPA 2VSCA 1QP1A 4JANB 3KDMB 2KUTA 3QXTA 1F2XK 3FRUA 1KCRH 3QJHB 1IARB 1FFQA 1KPUA 4U31A 3HC4H 3IYLW 2WUCH 4WI5A 4NKDA 3UJTH 1A1MA 3MLZL 5L2JB 3PHOB 4HUKB 2MCG1 3CJJA 4KC3B 2HLFC 5JNYA 3ULSA 2Q20A 3V0VA 4Z7UB 1FGVL 5GGTL 5HYJB 5IW1B 1HHIB 4X7CC 3M1BB 5GRUL 4HCRA 4MQXC 3QXDA 3D2UD 1KB9J 4Z78B 3IJSB 4WUKH 4NHUB 1E27A 3V5HA 4O4YH 1NC2D 3C60B 1KG0A 5CLTA 2XYCA 3T2NL 4TSBL 2VDQH 4D3CH 4KJPC 5IEHB 2VKXA 3T0VA 2JIXD 2P8MA 5FIEA 2GK2A 3H7BA 5DD0H 2F8XC 5TE6L 4XBGB 3SGKC 5L0QB 1TMCB 4V1DE 5AZ2H 1PEWA 3NA4A 5TDPB 4LHQB 3H3KA 3QIUC 3WLBA 1R0AL 3SGJC 5I0ZA 3P77B 3C6SA 1KF9B 1OARL 1U93A 4MB4A 3P9LA 4JY5H 3KVQA 3T65B 2R56L 3QQ3A 5DK2B 5H35B 3TBVA 3D69B 4GW4A 3VGEA 2AK4B 3OKOA 4MHHG 4XXCC 4PJIA 3G6JA 4UOW0 3O2WH 2P5EB 2GK0B 1H5BC 2Z8SA 4MVBC 5FYLD 2XWBA 3IVKA 3W11D 3V5DA 5I1JL 3U4BL 3U48A 5F1SA 1EO8H 1CLZH 5C09B 4GG8A 4EJ1C 2IQ9L 4ZUUB 3RWIB 2AV7B 2R15A 2G60H 4HLZG 3E1F1 4Y4HD 4PJFE 4MNGB 3CFEA 2XWJB 4OFYA 1NBVH 3U46B 5I1DB 4NM8H 1FORH 4O00A 1N6QH 5I2IA 4JFED 3EO0A 3F65A 4IRJB 5IK3B 4NZRH 2DYPD 5TQ2H 4NN6B 5EBMA 5K33A 2E27L 1BFSA 4TSCL 2NY2C 1GSMA 4HWEL 1R5VB 5JLZA 2FYYA 1UWEH 5HY9A 1EK3A 5BVPH 2NX5B 1UWGH 3RNKB 1CICC 3IU3A 1MCNA 3KYAA 4M43H 3BVNB 5FYKH 3RBGA 4N90E 3HPLA 4D0CA 5MERB 4FN0A 2YD9A 4ZPTB 2F74B 3MODL 4HIHA 1XH3B 1YNKH 4UDTA 5C6TL 1T22A 4WFEE 2XXCB 1E28B 5D7IB 4RMVA 2PF6A 2FBJH 3AB0C 4O9HH 3T4AB 5EUOF 1ORQB 4E5XB 1WUNT 2NXYB 3L5HA 1N5AB 2OJZL 1BBJA 4X6EA 3SKOA 4MD4A 3V7AE 4GXUN 3MNVB 1S7QA 1GJIA 1CDCA 1X5JA 1DFBH 2FZ3B 5HYJD 3O0RL 1HIML 2QADC 1RUKH 2QSVA 4KKNA 2BNUA 3CU1A 2Z93B 4YHIB 3BN9C 2GW5A 2E7BA 4MJ5B 5CSZA 3ULVC 1P2CB 1LQSR 2XKNB 1EUUA 3OKNA 3QFJD 1OTSC 2I07B 2RB8A 5I30H 2VDNH 5I16A 5JXAH 5CD3A 2FWOB 1UB6B 3KYNA 2CIIA 1MF2H 4M7LH 2CRZA 1WC7A 1F3RB 2AQ3A 4ZOEA 5IVXE 2YXFA 1GZPB 4YE4L 1I9EA 1IAOA 2FCBA 3WUWG 2V5YA 5LG1A 5HHXH 4Y16B 2EIZB 2ZNWA 3G5ZB 2NY7H 5C07E 5FGRA 1DLHA 5ISZA 1HNGA 5F9JA 1MFCH 1DN2A 2AK4D 3QO0B 4KKCC 1Z9MA 9CGTA 3WL9B 4KK9D 2P5ED 4IOFD 4Y5YC 1OQXA 5MENE 2H1PH 2LABA 5CBEB 1IZJA 3SGEI 4PRDA 4LHJB 5DUBB 2DQFB 4PG2A 1U3ZA 3KPRA 1J7VR 1NEZG 5L9DH 3I85A 3ARFB 1RZKL 3BXNB 4V1DB 4HK3N 3IDXL 4X5WA 5BO1H 5C09D 5JTWA 3KPOB 2YK1L 2FHFA 2VL5A 2F53B 2Q87A 1T66C 4YHKH 2BVYA 3VFPA 2CIKB 3IJYA 4L3CA 5DJZB 3C5ZD 3GSXB 3LS4L 5GRJH 3QR2A 2ESVA 5KVGH 4KUZL 3OHXB 4IIQA 5DJXB 3SDAA 4TUOA 4I48B 4D0BA 3I50L 2BJML 1G9MH 3C9NB 3MROB 3OAYK 1BZ9B 3L3JA 1TVBB 4IRJD 4XCNA 1MFEH 4TVPH 3QRFM 5D1QA 4KJWD 1IM3B 2VIRA 4XBPB 4U6YA 2NTSP 5TFSL 1DQDH 5JW3H 5KS9F 1G6VK 3BYYA 1JNJA 1RZIA 2NX5D 1FIGH 3FB7B 4KJYB 3TBTB 1CLYL 2VXSL 1J18A 1W0VA 2RHEA 4PJFB 5DD6B 4XC1H 2H6PA 2PW1A 4Y5VB 5E56A 4Z7VA 3ARBA 5CJXA 2E7HA 5D7SH 1MHEB 4GMTL 2EKSA 4WVRA 5IHZB 1EUTA 3BH8A 4MSWA 1AR1D 4LOUC 3DYOA 2EH8H 2UY7A 2NY4C 4DQOH 3MCLH 4JZJB 3A6BL 2XFXB 2X44D 4HX1B 2NXYD 3OAYH 3O6LH 3FQTA 4A6YA 3TP4A 2ATKA 4CVXA 2Q76A 1YEFH 5DQ9A 5CCKL 2DTSA 5C0EA 4A6YH 3KS0J 5SWQB 5K9OA 1SVCP 4ERSH 5DRXA 3VD4A 2UZIH 4OLVH 1I4FA 5MEPB 4NKIH 3TH4T 1JHLH 1Q1JH 2V7HB 2EXYD 3B2UC 1EGJA 3OKMB 1R5WB 4R4BB 5INCA 2YD4A 3ZKXB 1LVEA 2A6JA 4XPHL 3RZCB 3C6LD 3FO2B 3GSRA 5SV4A 4JFQB 3TZVA 1LP9E 4JFOB 1QSZA 5IB4B 4HAFA 1GGBH 1OT1A 3UDWC 2OK0L 2ZOKB 3EOTH 1ZT4B 5BV7H 1AIFA 5EZJB 3ESVF 1T5XB 1QR4A 3L3DA 3HUJE 2C1OB 1NEZB 3CC5A 3GHEH 3N50A 2GY7B 3OPZL 4KVCL 5HGGS 2DWEA 3D48R 3BP5B 4O2EB 4HMCA 1C5BH 2VZSA 3WXWH 5F3HB 3EOAA 4J6RL 2IMMA 3KJ6L 1YY8B 1E4KC 2VDKL 1NCBH 4JKWA 4Z77A 4AEHL 4TOYL 3LKSB 3NTCL 1MWAH 3TV3H 1R24A 1G0XA 3ARFD 4N1EA 4V1DD 5D72H 3NFNA 1A14L 3SDYL 5IVXB 5K9QG 4DKEH 1NCTA 3PV6B 2EE6A 4JB9L 3RVVD 4P5MB 5C0IA 2NY6C 4F7MB 5EORH 3DBXA 5IKCB 1CL7L 3FAXA 4OCNC 5C07B 5DWUL 4XCCL 4RAUB 2JB6A 5FV1L 3BSZH 1Z2KA 3HLAB 3HNSL 4P2YA 2AP2A 3OJVC 3KPLA 3JUYA 4LVNB 1OAYH 4MJIE 4PBXA 5MENB 4FQ1H 4P23A 1F90L 1F6AA 4ZO8A 1SMOA 3CPLB 4LPWA 1OB1A 1T1ZB 3ULVF 5ESQA 8CGTA 1KB5A 4G6FB 5AWNL 4Q6IB 4UT6H 1N6UA 4ODTL 1U58B 3FOLA 3MOAH 4G8FB 1LO2H 4WI7A 2P5WB 3QXVA 4DAGL 1KTLB 3CVHA 4OAWB 4GMSH 3F58L 1WIPA 4QXGH 2E6QA 2R0ZL 3MFFB 2ZG1A 2Q8BH 1VKXA 2X4UA 3RL2B 2R1WB 1XGQB 5KANG 3U0WH 4YGVB 4AL8H 3F6IA 3EFFB 4NO5B 3O8XA 2AV1B 1S3KH 2XACC 5DJDB 1DBKH 5F9WC 5KVEL 1NFDF 1K5NB 2WSKA 3H2WA 2W1NA 5I8OH 3ARED 1JTOA 2LU7A 3ES6A 2IQAA 3IU4L 3A6CH 5IMKA 1Y18A 3KPQA 3S37L 4LF3A 5F1NB 4PJCF 2OR8A 4N90D 2WWMC 1IGCH 5B3NA 3BEVA 1A7RL 4YHNB 3D2UA 4X7SL 2GTZB 4NRYA 4HV8A 4FNLL 3QDMB 4LSVH 3MRHA 2W60B 4CMMB 1IM9B 1NC2A 2IFFH 3RX7A 4ORGA 4ZFOA 4OF3A 4R7DA 2YD3A 1HILB 5CMAB 4HFWB 5LXGH 4M7ZC 2JIXA 4HK0B 3VFSA 5K9KA 2Q3AA 1UADC 4NPYA 4YFEA 2VN4A 3QI9D 4U05A 1DP0A 3JWOC 4RMRA 3MLUL 1FNGA 2WNGA 3RU8H 5I75B 4FQCL 5F89B 4XVTL 1VACB 2VB5A 1IBGH 3I3EA 3VFVA 4GAGH 3T1FB 4NNYB 1LP9B 4YX2H 3W9EB 3QIWA 5IBLD 3IF1A 3DECA 2VLMD 4NO2A 5IQ7L 1GC1H 2VUYA 2PNDA 3QH3B 3MRJB 5IQ9A 1K8IB 2DQEH 1YEJH 5FYLH 3WJLC 3QSKB 4S0TD 1BWWA 1QD0A 1CFVL 3DROA 3MJ8B 3TYGL 1BX2A 3MLSH 1SQ2N 1GGIL 3MBXL 4TQEL 5D7JA 1BQLL 3GKWL 2WINA 3MGOA 5C07D 4AT6A 4NQXA 5ID0A 1IC5L 4Y4HA 3VD7A 5JW4R 3V4VH 5E7BA 5KJRL 1TJIL 1JF5A 4FZEH 1R3LB 2DQGH 3KPPB 5D9SB 4NQVB 5MEND 4X6BB 1NBYA 2GCYA 3MGAA 4JFEA 1ULVA 4GKNA 2XQBH 2AJVL 2UVFA 2DYPA 2VZTA 3RVXD 1JHTB 1E4JA 3FQWA 5F72S 5A2JH 1RULL 3PE9A 5LAXA 1D5XB 1YY9C 5D8JH 2D0FA 1FPTH 5J1TC 3NOIA 3TH3T 2HTLD 3K7UA 2JK5B 5IB5A 2P5WD 4WIQA 5TE7H 3VMPA 3W2DH 4JANA 3QCVL 4OZHE 3BZFA 3O2DL 3D39E 1FVCB 2IANE 2EYSA 3PGFL 4MJIB 1AJ7L 2GY5A 4JLRB 2GJJA 3IETA 4LCIL 5CZVH 1SYVA 3P9MA 5L2JA 4KMTL 4Y5XC 3LKRB 3GMLA 2A6DB 1K8DB 2VLLA 3QNYB 3WHXA 3T0EB 3O3UN 1U91A 4Z7UA 4MAYB 2UWEB 5HYJA 1HHIA 1Q9LB 5D6CB 4M1GH 4XWOD 4P3WA 5I17B 4Z78A 1S9XA 3IJSA 4Z76A 2CXGA 4OD1H 3T0AA 1A6AB 4NHUA 1AHWB 1IM9D 1TLKA 1L7IH 5D70L 4LSRL 1OT2A 2A83B 3QFJA 4H1LA 1C7SA 5EH1A 5DQDH 4XBGA 4OQ1A 1KLGB 5E8NA 4RZCA 2Q7YB 3CFCH 4FFYL 4WI4A 3VFOB 3CDGB 3QEGL 4DUVA 2V9QA 1YA5A 3EJYC 4U1MA 1KXVC 4U2YA 1HH9B 2FGWL 3T65A 2BHUA 4ZFFB 3ECBB 3QO1A 5B8CC 4DW2L 2QQKH 5DK2A 2DJUA 4OF6A 2YD7A 3S36X 5DJ2B 5H35A 3D69A 5CIPA 2AK4A 5L7XH 3BD3A 3L3GA 2GK0A 3O9WC 4KGJA 4LNVA 5DDHB 5T3ZE 3IFOB 5KTEH 4H0IA 3D3VE 4XMLL 3QXAB 3LEXB 1D9KC 4LQ1A 4JFXA 3WIIH 4BFEA 1TVHA 2VAAB 4ZUUA 3RWIA 2JJWA 3MACL 4BSWB 1S8DB 3C5ZA 3TPKA 2XWJA 3D85D 4WW2B 1MCLA 7CGTA 2PXYB 1JPGB 43CAB 3WSQH 1FL5B 1QFWI 1A4JB 1KPRB 1PSKL 2VYRE 4Q74A 2X1XR 2VZUA 3VWJC 2A9NL 2AJYH 3WFDL 2ZPKH 1T0MB 4KPHH 4JFYB 5CKGA 5GGTA 3RVWC 3D9AL 5IK3A 3FN3A 3S5LB 2IALB 2XN9E 2ZJSH 4IJ3C 3QIBB 4X4ME 3KLHD 3RQ3A 3RKPA 3L6FB 4CN4A 1M7DA 5DJ0A 2AJXL 2NX5A 3RNKA 3T2NH 2IAMC 4P9HL 1MAKA 1EHNA 1U8MA 2DTMH 5IB1A 4MQTB 1ZSDB 3RWDA 5I0DA 4ZDHA 1IJ9A 4MDIB 2MKLC 1FV1B 4ZPTA 5ETUA 5GRVL 4MJID 1NUNB 1ADQL 5J1SC 3NFPB 4XB7A 1E28A 3O41A 4KK8C 1R0AH 3KAAA 3T4AA 5T1MB 1ORQA 5ID1B 2EDTA 3PNWB 3QAZB 5I71B 3EFDH 4RDQF 3KXFE 1YEKL 4ELME 2XV6B 3HNTH 2XZCH 4JHAH 5JQHC 4XP5L 1FLRL 2YWYA 2BX5A 3MNVA 4P2QE 1IMHC 4X80H 2QR0B 2X4NB 3MOBH 3T0WA 3WO3B 3LHPL 1FZMB 5HHNA 2AJSL 3RNQB 4PJEB 1IGTB 2Z93A 4G8IA 4YHIA 5T3ZL 5JIIA 4N9GA 4OZHB 4DWHA 4MJ5A 3C6LA 4WW1B 3U4BH 3BKML 2GYSA 4LGRB 1P2CA 2IANB 4ONFH 2XKNA 4LLWA 5DUPH 2I07A 2IQ9H 2FWOA 4HH9A 3TH2T 4DGIH 4M48L 1KIUA 2GAZA 1GZPA 5EBWB 3TA3B 4ZD3L 3SCMB 3K2UH 2EIZA 4BSVB 3G5ZA 4GRMB 2H2SC 4YPJA 1EJOL 1PZ5B 1E4XH 3C5SA 1OD7A 5D96C 4NIKB 4TSAH 4BKLB 4AYFA 3WL9A 3MRMB 2DQCL 3ZT6A 3DVIA 4BQCA 4QHMB 3VD9A 3RAJL 1KJVB 1KT2A 2X4OA 5IJKC 1AFVL 5DUBA 2DQFA 4K3EL 3Q48A 5L8KB 1AXSB 4LEXL 1KV3A 4WRLA 3ARFA 3BXNA 1BM3L 3GSVB 4KROB 4V1DA 3KPOA 2WZPD 2W9LA 1MELA 3BD4A 3MODH 3RWHB 3V6FB 1A6PA 2W91A 5C6TH 1ODAA 1YMHB 2CIKA 1FAIL 5FFLA 1TJGL 4MCYB 1JRHH 2F58L 2Z0BA 3V4PH 5TDOB 2ADIB 4L8SA 4YHOL 5DJXA 1OPGH 1JHKH 3AS0A 4H26A 4M5YL 4PRIE 2VXQH 5ITFB 3C9NA 3PGCB 2FO4B 1TVBA 4PRPB 3VXPA 1YEHH 5F7NC 1IM3A 5DRZB 1MVUB 1HIMH 5DI8B 1FSKC 4LU5L 3D3VB 1CDYA 4PJGF 4J4PA 1C5DB