1MY5A

Nf-kappab p65 subunit dimerization domain homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappaB p65 (RelA) subunit
publication title Solvent exposed non-contacting amino acids play a critical role in NF-kappaB/I kappaB alpha complex formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 19
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1my5A00
3S37X 1P53A 2ZUUA 1AI1H 4G8EB 4KJWD 2F54B 4XBGB 4XBEL 4QEGA 4YXHH 3O2WL 1PG7H 5KVFH 3U0WL 4G8FA 3LCYA 1ETZA 5ICYA 1UM5L 3M1BB 5CJBA 2R0LL 4MAYB 3RWJB 1MOEA 3K2UH 2ED9A 4U1HB 5DD6B 4X7TA 1HKFA 2E7HA 1KT2B 5LGJB 4MB4A 3K3QA 4CL7A 1N5YL 4F33B 3DSFH 1JUFA 2BSRB 3C5ZB 3OKMA 4OT1L 3SO3B 3U4EB 3GM0A 4MCZA 1NAKL 1XF1A 3NH7H 5TDPB 1NCWL 3AGVA 3L7FA 2Z9TA 1WICA 1UJTA 4CGTA 4QOKB 2VWEC 3LN5A 3CFDA 3WFBL 4OSUH 4X4XB 3FONB 4GBXB 2PR4L 2BNUA 3MCKB 5DD0H 3BZ4B 1A02N 2DQEH 4OLYL 5B21A 1G7JB 3P4OA 1LEIA 4MAYC 4JZNB 4ZS7H 1K6QH 4YE4H 3QDMD 2J6EA 1PSKH 2JJWA 3GK8H 3WV0A 1GC1L 1Z9SA 3LEXA 4N0UB 5CEYA 4PRBA 1IBGH 5HY9A 4HUUA 1GOGA 3C8KA 3D0VB 1IC5H 4POZD 3MRCA 5I15L 1S7RA 2C3XA 4OLXL 1XIWA 4PJAB 4UINL 4M7LT 2K3TA 3LKQB 3HNVH 1MCOL 1RZ8B 5DHYA 2CKBB 3DX8A 1YNTB 3JTSA 4UTBH 5BMFL 3KHOA 3KLHC 1JWSB 5T5NF 5JW5B 3TNNB 2Y9RT 4WI7A 3LQAC 4XP1H 1AC0A 3QWRD 4GBXC 4F57L 1E6JL 2GJZA 3L7EB 3HAEB 3VWJD 1H8SA 3QWRA 3B5TA 2ZKHL 3WEXB 1FVDA 1F90H 2EDBA 2AEQL 3RFZC 2L7JA 2YPKB 4WO4A 7FABH 4FTVD 3S96B 1M05A 1DQML 3MRNB 2ICEA 4KGJA 2N56A 3SDAA 3BH9B 3HPJA 5L2KE 3K0WA 2VQUA 4PJ8D 3WLWD 3CFEA 1ES0B 1JPST 3KLSA 2LU7A 5I1LA 3C2AL 1XT5A 1ONQB 5H37G 5K93A 5EG6C 4XAKE 1ADQL 2HVJB 2NY0C 2XWBA 4FFZL 4PJHE 1KCKA 5EO9B 2C3VB 4L4VB 5I66B 5K9JH 2W0PA 1A6UL 1RUAL 4PG9A 5KANI 3G5YB 4L9LB 3REWB 5DJDA 3TBTB 2XZQL 4LAQL 4S1RL 4JFEE 4KZDL 3OJDB 1W72L 5BW7A 1JRHL 4K94C 3GBLA 4UU9A 3L3GB 5F96H 5K9KA 3S5LB 2V5RA 3TO2A 3OXSA 1P6AB 3PHQA 4NKQB 3DI2B 5H8DA 3DUUB 3MO1B 5IFAH 5F3BB 5E99H 2EEDA 4ONFH 2OTUB 1YEDA 1CG9A 4FS0A 3OB8A 1IQDA 1JNHB 1TVBB 3U1SL 5DFWH 3EYFB 4BFIB 1NCDL 3G5XA 4XCCL 4YFDB 3F62A 4QRRD 2ATKB 1L6XA 3B9KA 3MLSL 3V4UH 4QRRA 4PGEB 1I4FB 4L9LC 4QY8B 5ALBL 4HFUL 3MV9D 1INDL 2E3VA 3G08B 4NQTA 4RBPH 5I16A 5IB1A 5ACZB 3MV9A 4X7DC 5DFVC 4JM4H 4JZOB 1MQKH 3Q5YA 3MLPA 2BNQD 3WS6C 2FH8A 4PY7A 3BN9D 4RBPK 5FGCB 4GRWB 3I02B 4XXCA 2R2CA 1FBIL 3KPRB 5GRJL 4J7RA 1WTGT 4PGDB 1IAOA 2R1WB 3C60C 2VZSA 3BEVA 1GAFL 1T0MA 2NY6D 3OZ9H 3L3KB 5CKAA 3THMH 4OLVL 1PD6A 4NC1E 4UAOB 4IOSD 1JGLH 4PGZA 4G8GE 5J1TC 2YKLL 4OCSL 5IG7B 4P3DA 3DBXA 5D7LE 3HB3D 5HYIA 5C0ND 2NZ9D 5DD1H 4Q9RH 3WXVH 2VE6A 1NFDB 3AREC 1J86A 3UTSD 3VFOB 4PB9L 5IVZB 1L0XA 4WFFE 2BNRA 1IAII 2W9LA 4RWYH 5ITFB 2HVKA 3MPCA 3UTPE 5D7IE 5CLWA 2HFEA 3G6JB 5HHPA 3NPSB 3ZDYE 3GSRA 4D3CL 3TYGL 2F53B 3QUKA 3RWDA 5J1SC 2CDGA 2DLHA 4GRLB 2E9JA 5IP4A 5DJZA 5FKPB 5LXGH 4LIQL 4UAOC 3QFJD 2B1AL 4ZS6C 3SKNB 2HTKD 1XR8A 4HD9A 5LKNA 1G7MA 4RMTA 3C8HA 3LKOB 3QCUH 3E8UH 5A2IH 1EMTL 1QQDB 1WFNA 2DMBA 2AGJH 4Y4HD 4YDKL 3H3BC 3CDFA 2MPAH 3KXFD 4PJDE 4Z7VE 2BOCA 4Y4HA 1MNUL 4Q9QL 3RX8A 1YEFL 1XCTA 5TQ2L 3DROB 3KXFA 3L3IB 3D87B 2MNUA 3FO0H 4FQQB 3T04D 2HFFA 1H5BB 3VFNA 4JFQB 4X6CF 4KXZH 3OKOA 5EU4A 3JWOH 2PYFA 5GRUH 3DOSA 4JPVL 5GGVY 4ONHB 3ULVD 4PV9A 4N8VA 1NFIB 3JWNC 5IJKA 2XTJD 3HZYB 2IBGA 3QUXC 4X5XA 1QFWH 1BZ9B 2QSCL 3MV8A 1XEDA 1WWBX 5I1DA 5IHZB 3MA7B 3CSYA 4CUCA 4OD2A 3CX5K 1I9RL 5FCUH 1YEIL 4P4KD 3X13B 5BS0E 1N0XL 4MYWB 3RNQA 3NAAH 3RVTD 1FYTB 3F7YA 15C8H 1LMKA 2PXYC 5HPOA 2O5ZL 4G7YL 4L8DB 1RD6A 2DWEA 5HDQL 1ZT7A 1IGFH 5AYQA 2JJVA 3P9MB 3VWKD 3N85L 3CCHA 4ZUWB 4ZFOB 4LQFL 3WFHB 2XZAH 5F9DC 3VWKA 4WI6A 1N59B 1NFKA 1J8HE 1A7PH 5HYJE 3L5XH 1F11A 3L5JA 3QUML 4MLSA 3FTGA 2EXYD 1EZVX 4C56B 1KEGH 3NGBB 1OCWH 4FQCH 4LCWE 5J3HC 5D1ZC 3HZKA 5FHAH 3GRWL 5B22A 4Z7OE 2BVOA 1FAIL 1VGKB 3VXSB 4H0HB 5JHDD 2EO9A 3PGCA 4WIQA 2C1OB 1AKJB 1P5UA 4ZAKD 2XWTB 3FOLB 3UO1H 4MNGE 1X7QB 1PX3A 4UIMB 4HC1H 4S1QL 5C0AE 3FZUC 1QSFB 3GO1L 3DECA 4GKOA 4JFDB 4NWUH 3LZFL 4Q2ZA 3LV3B 3KPQB 4RFNC 4B5EA 3WKMH 4PJXF 3GHBH 1X5IA 1LE9B 1HOCB 2H2SC 4LCCA 5CEZE 2VITA 2DBLH 4LCYB 3T1FA 1NAMA 3QIWA 4XC1H 2GJ6D 3GMQB 4NQXB 5J1AA 2IJ0C 3BPCB 2FHFA 4AG4L 2EECA 3D39E 1FO0B 1MCRA 4HXBL 1CDBA 3GI8H 3T2QA 4P23A 2R23B 1E27B 2APWA 4HJGA 5EUOB 1N6UA 5T1DL 4EUPB 3GSOB 5FHBH 1TVDA 1BQUA 2AEIT 5JA9A 4ODXB 5CEXB 3AM8A 4WHTA 4M8QB 3WNPA 2VN7A 5A2JH 3EYQD 4WUUD 4M9OA 4NKMB 2VWEE 5GRWA 2F54E 5TE4H 1DVFA 4WUUA 1EXUA 4M1CD 4ZPTA 1WC7B 5IBLD 3Q48A 5DJ2A 3OR6A 1GIGH 4R7DB 1NAMH 2HJLA 1S3KH 4F9LA 3HZMB 1FLRH 2H3NA 2GK0B 1YY8B 2ADJB 1GGCL 1WCBB 3NCEB 1F3RB 3ARDD 4XWOD 3MACH 1WBYA 1YC7A 3TPUB 4U2YA 1YMHB 4JQXA 5C3TA 3UPRB 1TZIB 3TBWB 4H20L 5TGBB 1CGWA 1Q8MA 4I5BB 3T1WA 3GUTA 1LVEA 2FSEA 3PE9A 2YPLE 4YR6A 3W2DL 2XQYK 2Q7NA 2AABL 2XFXA 4HMEA 4JVUA 5L8JB 2BSSB 5EULV 4PP1D 3OKDA 1GZPA 4XPAH 2KL6A 4P5MB 4HWUA 1NBYA 3QG7L 4E5XB 2A38A 5FF6A 5JA8B 5JOEA 3O9WD 3VMNA 3HCVA 3EO0A 4L1HA 4L8SB 1BWWA 5ITBL 4U4BA 4JO2H 1QYGL 43CAA 3U9PH 1AR2A 1U6AL 5IVXA 3ZKMD 1XGRA 4HKXA 4MJ5A 2OCFD 4EXPX 3FQUA 1MCCA 1CU4L 1OGTB 5JDSA 1FV1A 5FDWA 2AXFB 3ALXA 2Z4QB 3IYLW 4HCRA 5J6HA 2QL1A 4H8WH 1HXYA 3TO4C 3TH3T 3QWOB 2BOBB 1Q0YH 1U8NB 1FFOB 3GGWA 1WJ3A 3WJJA 1A3RH 5D1QB 1KJMA 3VI4E 4HJJL 3X17A 3D2UD 1P6FA 3PV6B 5E08H 4L8SC 2I25N 3QXVA 2BHYA 2YZ1A 3EOAA 4JPIB 4MJ4A 4KQ3H 4HAFA 5EUKA 1BIIA 1LP9F 1DSFL 2J88L 2X1OA 3HZVA 4IRSB 2GI7A 2APTA 3MOBH 3TWCL 4N90D 1P2CA 3GI9L 2HT2D 4ZTOH 3IKCA 4O2EA 4CVUA 1XZ0A 1E4WH 2P8PA 3WE6B 1CD1B 2NY5H 1ACYH 3GEWB 1DLFL 5HVHB 3VFTB 5D1QC 1CR9L 2AXGB 1C7TA 3ARBC 5C09B 3LIZH 4X6EB 4HLJA 5E2JA 1QACA 1KCVH 1CL7H 5F6IC 3S4SA 2VDQH 4LSRH 1TQBB 3JV6A 3MXWH 2AV1B 3GSWB 1WIUA 1Q72H 1DQDH 1KCUL 3SCMB 4KKBC 4MS8C 3AB0C 5DD3H 2GCYB 3B3IB 1TCRB 4XPBH 3LH2L 4M7KL 2NXYD 3O6KH 2R2HB 4Z7QE 3EDFA 3GBML 2K1MA 3V0WH 3IFNH 1PYWA 2D9QB 1VDGA 3UTQB 2YS4A 4Q6IC 3KGRA 2D2OA 3GMNA 5KSAD 3VRLF 2ZWLT 1GL4B 1LQSR 3R1GH 4I9WD 4WU7B 4JHZA 5I2IA 4X99A 3KLAA 4UQ3A 1AGCA 1JNNH 3HE6D 5JZ7D 5DJ0B 1AI1L 1CLZL 2P4AB 5F6HJ 1FVCA 4YXHL 5E2UH 2XNAB 1PG7L 2DLTA 4NQCA 3U83A 5KVFL 4RAUB 4BK5A 2GTWB 5ESQB 4Y2DD 5CBEA 3WFCH 5DYOA 3BIAX 4G6AC 1RVFL 3CXHK 3MGOA 2HG5B 1QVOA 3DSFL 3FFDB 3O45A 4PJ9A 5DJ8A 5FA3A 4L29B 2I26N 4B50A 4GRWE 4PRPA 3QIBB 3NH7L 1NEUA 2ICCA 4O9HH 2OJEB 3MV01 4FNLH 4KH2A 5DJXA 3VXRB 4V1DD 4OSUL 4U6TA 2IADA 3M17A 1R3JA 3MJGX 3VFWA 5IB2A 2DQEL 1MCPH 4ISVA 3FQRA 4QT5A 4OCXH 3DGGA 2YN3A 1H3XA 1MCLA 2R1YA 3LRSA 5I0ZA 3QI9A 4YE4L 3LPFA 4P57A 4HIJA 2FECI 1PSKL 3D18A 3GK8L 1AFVH 3SHSA 2AK4B 4X6CA 4BH7B 4OGAD 1IBGL 1XGUB 2SEBB 3SJVD 1IC5L 4GAGH 3QIBC 1KN4H 2UWEF 5SWQB 1JHKL 4UTAH 1JV5A 4ORGB 4NYLB 3S98A 4KK8C 3G6JE 5A1AA 1QRND 1INEL 4MD5B 1DQLH 4YJZL 1WAAF 1U8MA 4K8RD 5EOTA 4UB0H 4LASH 4NN5C 5C6PB 4LPWA 3MCG1 3MODH 4XP1L 1YJDC 5IMLB 3V5HB 4LVHC 1VFMA 3RWHA 4F80A 1G9NH 4TULH 1RIVL 1X4YA 4X5WB 1CE1H 2UVEA 4H26A 3DX6A 4RZCB 5IQ9B 4ZFZB 3AS2A 1F3JA 1F90L 1Z3GH 1IM9D 1F4HA 3I75A 3L6FA 7FABL 2AS5M 1OM3H 2PCPA 5AWNL 4XB7A 5INDA 1J88A 4IBLT 4QGTA 3ZKXB 4HQQH 1CFTB 3QJFA 5ICZA 1KPVB 1VFUA 1NDMA 5C0EA 4QWWC 1RZGA 4QHKJ 5AUMA 3KPOB 4XBPB 4ZUSB 1H3VA 4KTEL 5D7JC 5JHLL 1DCLA 3PHOB 2EE6A 3JTTB 3TZVB 3C5JA 4U3XA 3OAZH 3WIHA 5K9JL 3L3OB 1KJ3L 4HPYH 2IC2A 2MTPA 2P5WB 4YHLH 3OAZK 2PO6C 4OZGF 4OCWH 4KVNH 5F96L 4QRUA 1NC2B 2W60B 4GKZA 3BFOA 2M2DA 1AP2A 3E1F1 4UMGA 5IFAL 5HGAB 3ZKXC 1UWXK 4ONFL 3RA7H 1NEZA 1A47A 4Z7NF 4N9GB 1FYTE 1FNSH 4H1LB 3WO3B 3ZE0F 4Q0XL 1H3PH 3UROR 2VXSH 5KVEL 3GSQB 3B9DA 4YHZL 1KPUA 3T2NH 3T3MF 5L2KD 3O3DA 2GJJA 1QBAA 1ROWA 2VH5L 3CZFB 3UBXA 5IW1A 4YHPA 3V6FA 3PWNA 1FZKB 4JM4L 2DM4A 5BCAA 3IJYB 1U8HA 4ZTPH 3F8UB 1BQHA 1N0LA 3QIUB 4XPGH 5IEHB 1OT2A 5EZLB 4P5KB 4JFED 4R97B 5JW4R 1SMAA 2YD1A 5IHUH 5EU3A 3OZ9L 1QSFE 5DMIH 1G0YR 2VJXA 1J0KA 1D6EA 2GTZB 5F7DB 3MUGB 3OTTA 2EIZA 4FMKA 3PWPA 3TA3C 3W9DB 3KPNB 4XAWH 4A6YB 4PREB 4MB3A 4L8CA 4MCYB 3D48R 1I7RA 2MHAA 5EU6B 2LFGA 5H37H 3IJSA 3N1GC 1KELH 1MY5A 4M6OH 5DD1L 1U3HA 4Q9RL 5KJRH 2N7AA 5IK3A 5BV7H 3G04B 1I1RA 2R69H 3BWUC 5GGSB 3WNNA 3LPWA 4RWYL 3P4NB 1Y18B 4J8RB 4NZTH 1OAQH 4OUOA 1OVZA 1RZFH 4PRHA 2ESVE 1MCHA 3LS4H 4YPGA 3RGHA 2VLJB 1OT1A 2XTLA 5GQBA 5GJTH 3CPLB 3DVFA 4ZOAA 1HHHB 2GAZA 4YBLC 4MDJA 1ZKAA 4OF8A 3O6FA 3EDDA 5TH2B 3QRGH 3SY0B 4M00A 3GB7B 5IKCB 1NLDH 4M02A 2AQ3A 2R2BA 3QCUL 3B5GA 5E6IA 2P8MA 4UV7H 3FQWB 4NBXB 4P2RD 1RUKH 1JE6A 3QDAA 2AW2A 2AGJL 3GSNA 2PTTB 4NQDB 4Z7QF 4XRCA 4OLUH 1QZ1A 4G7VH 3VFSA 3F12A 3EOBA 4G8GD 3RL1A 1YPZF 2ZSVB 4LKXB 4O5LH 4Y4FB 5D7LD 5EOCL 1VA9A 4G8GA 4XMPH 4CW1B 3FO0L 5IB5A 3BP5B 3L5WA 5BZDB 3RTQC 1MHCB 1FNAA 5D7LA 2BSED 4J3WA 5CSZA 2WBKA 1KJ2A 4XH2A 3JWOL 4WFFD 5GRUL 3VGGA 2R4RH 5DLMH 4HGKC 5DC9B 5JORA 1ZGLA 3PV7A 4ZG1A 3UTPD 4NUGH 3WS3A 1EHLH 4M3JA 1T0NB 3VXMB 1JK8A 1RFDH 4U31A 1QFWL 3DMMA 3RWFA 1IAKB 3HE7C 5C0RH 2DQDH 3N1PC 4X9BA 4ZO9A 2DWDA 3L3JB 1S9VB 3VGFA 1ERNA 3UTTE 5FCUL 3B2UD 2VR9A 4LRIA 4ODVL 3IAQA 4HGMA 3NAAL 4CMMA 1KNOB 4NNYB 15C8L 3L3HA 4Y4FC 4LCUB 3QUZC 5EFIB 4AENA 1WT5C 1XR9A 1VADA 1IGFL 5SWZE 3ILQC 3DV4A 3CVHB 3W9EA 2F58H 3VXTA 1UB6B 1BVKA 1W8NA 2XZAL 4M7LL 1A7PL 2EO1A 1U58A 3SDDB 3D1MC 3L5XL 1KJ2H 5GIRA 3FJTA 3M8OH 2V17H 4PJDA 1KEGL 1OCWL 4JY4B 2DQCL 3VRIA 1LDPL 1Q38A 2MCPH 5DXWA 5ADPH 4UDTA 4Z7UF 2ITCA 4JPKH 1REIA 4U3HA 4ERSH 2I60H 3FAXA 5MENB 5K9OB 3AXLA 3HUJE 3C5SB 1NKOA 3UO1L 4HC1L 3T77A 4IDJH 1G6RA 3PL6C 4J1UB 5SWSE 2NLJB 1OQXA 5J11B 1ZHNA 3BHBA 4NWUL 4DKAA 1P84J 3HG1B 5D9SB 4XNYL 3GHBL 4OCMC 5BS0D 3TESA 4XPFH 2DBLL 1YYMH 4G9DB 1IKNC 4DCQA 5C09E 4FQIH 4XC1L 5BS0A 2GSIA 2N1KA 4UBDC 1JPSL 1P7QB 2OXHA 5FYLH 1LK2B 5JLZA 4PRNB 1FFQA 1J1XH 3U7AA 1IGJB 4PJ7E 1DBBH 3GI8L 4MWFA 4Z0BH 5FGRA 4U1KA 2GY7B 3JUZA 4LLQA 1B0RA 5HYQA 5HYJD 5C08E 3HMXA 5FHBL 3RWEB 4ZXBD 3ARFB 1J8HA 4Y7MA 4LCWD 4S10A 2EEAA 1CE6B 9CGTA 5IW6A 5EBWB 3MRIA 3U2SB 2FLBT 4ZXBA 2PUQT 1ZSDB 1ZVHA 2VZUA 4LCWA 4J3UA 4QRPB 3I85A 3Q5OA 1AGEB 4NRYB 1JPGA 3P4MA 4HFWA 4YBHA 1RK1B 1T7XA 5TE4L 4JKPH 1GIGL 4P5TD 4MNGA 4ELMF 5C0AA 1XF2A 1S3KL 1A6AB 2GUOB 4OKVA 1FLRL 4OIIH 4HMDA 4P5TA 4KJYB 4XCNA 2YBRB 3V5DA 5CEZD 4OD3H 3MV11 1OAYH 3MACL 5EPMB 4YK4B 3RBGA 3VA6A 3D39D 1IEBA 2Y7QA 4HKJA 3CH8A 4KVCH 3D39A 3HMXH 4J2XA 3QEQD 5C07E 2OK0H 2ZZUT 5FB8A 4UNVA 1CL7I 2YUZA 4AEEA 5GZOC 3EO9L 1UC6A 3DXAD 3RUGB 3VXRE 4U6HA 2CLVB 5DEFB 4OF5A 1MSPA 4YFLF 1FZJA 3NA9H 3U9PL 8FABA 3K81A 1PKOA 2OL3A 4JN2A 3BZEA 3WJLC 3RWIB 1A7NH 3PDOA 3BVNB 2F54D 1RJYB 32C2B 2XKNA 4X4YA 1KUMA 3TBVB 2AJYH 5I8OH 2EYRA 2EKSA 2FX7H 4XNUH 1CICB 5DHXB 1Q0YL 2WBJC 4JRYB 4MAYD 5D4QA 1BWMA 2AJVH 2Z8RA 1A3RL 3P0VH 1PGRB 3IDNB 4W81A 5E4IA 5MHSE 3ZT5A 4OZGA 2HKFH 4ZO8A 1GC1C 3U0TA 3S3PA 1UG9A 5L8LB 1YN7A 3C5ZD 2G5RA 5A16B 2BSTB 5E08L 1HH9A 4NKDB 3MNVA 4F33A 2Y06H 4NNPH 1LNUB 4KGLA 4KQ3L 4NNXA 2I24N 3Q1SH 4DVRH 2XY1A 2EYSB 1NCNA 2NNAA 3U7YH 3WN5B 2GQHA 2YPLA 3MOBL 2X5PA 1ZTXH 2Q8BH 3O6ML 4ZTOL 4FQJH 5EZJA 2F5AH 1WFOA 4GBXD 3ZDXE 2NY5L 1Z0MA 1U8QA 4I4WB 4GBXA 3ARZA 1ACYL 4L3CA 1IGTA 3BN3B 1W72B 4WHDA 1G7JA 4Z95H 2A9NH 4WEUD 1HDMA 4YQXH 3PWUB 1U8LA 5CUSL 5DRZA 1IZKA 1KCVL 1JN6A 3BO8B 2MSPA 5HYSB 4LSRL 1OSPL 4H0IA 1U41A 1KJVA 3GZKA 1Q72L 4D9RD 1DQDL 1DN2A 3U30B 4N1EA 3LEVH 5C70A 3FT3B 4ZOEA 1I8LC 4XPBL 5KN5A 5ABDE 4LAJH 3WN5C 5KS9B 3JV5A 4OD1H 4RMUA 4F7TB 3QO0B 4G6FD 4S1DC 2ZSWB 2FHBA 3IFNL 4NZUH 5CINH 2D31A 3G9AB 4EN3C 3LDBB 4XVJH 4QHUA 5E8DH 4M93C 1DJSA 2BY1A 5I1EH 2VDOH 3MBXH 2HTLC 5F93C 3KR3H 4E42A 1JNNL 2RCSH 4AIZA 2X05A 1WQVT 1XGQB 3WEXA 3MROB 4XZUA 5D96B 3GSXA 5E2UL 1BJ8A 1I75A 2KKQA 4N5UA 3BPLB 4Q58C 4LBEB 3IAGC 2M8XA 3KG5A 3W0WE 3T3PF 3B4NA 2WP3O 5KVMC 2J8OA 1QNZH 4JDZB 2ORBH 2KQMA 4NKOB 3WFCL 5JPMA 4O4YH 1ZA3B 1P1ZA 3HI1A 1VERA 4GQPH 4G43B 3SDYL 4URTB 4JGJA 3VRJA 3DARA 1MCIA 1A6ZA 5FM5O 1Q1JH 2VLLA 2ZCLL 1MRDH 3GSUA 3P40A 2DLGA 1RIHL 2IBZY 1DZBA 4C4KO 4OV5B 4QRTB 1JL8A 2CRMA 4R96A 1VCAA 2CIIA 4LPCA 5E5MB 2VQ1B 3G5YA 4O9HL 4EQ3A 5DURD 1EIBA 3FT2A 5C0CB 5DFVD 4FNLL 2BVPA 3QULB 4X7SH 5D96C 1G7HA 3C9NB 2X4QA 4L3AA 4D0DB 3WS6A 1MCPL 2WBWB 4OCXL 3DUUA 1V3KA 5F3BA 1FPTH 1JZ5A 3GMRA 1ZK9A 5FKAA 1OF2B 5HI3D 3RJQB 3C60A 2YXMA 3IDJA 1JNHA 3ESUF 1MJUH 3AS1A 4MD0A 3MFGB 2UZXB 3T0XA 3PWJA 1KN4L 4UTAL 4F2MB 5IF0A 1EGJL 1T83C 1S9WB 2IG2H 3AAZB 4PGEA 1UZ6F 5K59E 5I8CA 2CLZB 1AO7B 1DQLL 1T6VN 1E4KC 4C4KT 4RIRB 4KI5F 4ENEC 4BFGA 2XG5A 3G08A 4W6WB 4UB0L 2D7MA 4LASL 2VLJE 1CFQA 4P3CH 5D71L 4I1NB 3MODL 4JZOA 3AREA 1TTUA 1DLHB 3KPRD 2E6QA 1T22A 1G9NL 3REVB 5DS8A 4TULL 1BFVL 4XX1E 2MKWA 1T5XB 3FO9B 2Y36L 4WFHE 1Z3GL 1QFWM 1WSST 5DA4A 1OM3L 3QDGB 2P24A 1U42A 4O02H 3ARGC 1A1MB 1UM6H 1VFBB 4HQQL 4ZS6D 1Q9LA 1U8PB 5IW3A 5KSVA 5CAYB 5F8RC 3WMSA 2FX8H 2BJML 4BH8A 1S7QB 3AUVA 4OFVA 1EHXA 4LLWA 1HH6B 1LO3H 1U8JB 5T3ZH 1ZLVH 2ED7A 1XGYH 2CDFB 4HPYL 3LY6A 1ZLVK 1SJHA 3P77B 2E7LC 3A0OA 5EBMB 1P4BH 1FZOA 1GPOL 1RV6X 5CILL 5ITFA 2O61B 3WUWG 2F53D 1D9KC 1U8KB 3UBXI 1XH3B 1MHHA 2DM7A 3G6JA 1AC6A 4NT6B 1N3NA 4KVNL 3R06B 4GKSB 4GRLD 4I48B 3EYOB 2YC1B 4K3DH 2ZOLB 4PLJC 1UYWH 4OM1H 5FFLA 1QSVA 4GW4A 1Z5LB 3FN3A 4KFZC 3ULUC 3RA7L 4HGWA 4K71B 1KG0B 1FNSL 4ORZC 3SKMA 3K8KA 5L9DH 1K3ZA 1D5ZB 5DMKB 1I3RA 3GSVB 2NW2B 1H3PL 5B3NA 4NUJA 5CP3H 3QUXA 5ENWA 3EFFA 5D2LB 4MJIE 2VXSL 4FHBD 3QQ9C 4LMQE 1DBAH 1M7XA 4G5ZH 2I07A 2BVQB 4NQVA 2D03H 3T2NL 2JIXB 2I9LB 4XNMA 2DYPB 3S9DB 4J4PC 4NFCA 3BDXA 2JB6B 2XPGA 2PXYD 4HDIB 3V5KA 1PKQE 3VFVB 3U4BH 1KB5L 2PXYA 1FN4A 4I0CC 4ZTPL 4D0CA 1NANH 2UYLA 3H7LA 1EO8H 2OS7A 1TFHA 4PG2A 4XPGL 2DICA 5MENE 4DZ8B 5B39G 2HT4C 5B3JF 1J5OH 4HH9A 3MBEC 4HV8B 1G7PA 5IHUL 3MZGB 5DMIL 3BOVA 1JYNA 4UOJA 3IDGB 3HG1E 1B4RA 5D1ZA 3RVUD 5IHZA 4GG6F 1IAIL 3JZ7A 4XAWL 2WWMC 4QHNB 4C54A 1BF2A 1FYTD 5C0GB 2VRAA 5D2NB 1AD9B 1KELL 5TDOB 2OR8A 3EHBD 4M6AA 5KJRL 3ROLB 5BV7L 1B0GA 4KK5D 3EIFA 3F5WB 2R69L 5C6WH 5J9PB 4P48A 5CZXC 1I3GH 3G9VA 4XP5H 3RPIA 2PYEB 2H2SD 2Y5TA 2BMKA 4NZTL 5E8EA 1OAQL 1IM3B 4ZFOA 4R7NA 2JK5B 3ZHDA 1RZFL 2P5EB 5HJ3A 4C56D 3IRZA 1HILB 4AK1A 2P45B 3OR7B 4C55A 2ARJA 4OGZA 1DBJH 4TUOB 2Q86B 3BGMB 1T4KB 2B2XH 2VL4A 2YD9A 2VLRB 5GJTL 4AMKH 1JF1B 4QRPE 3VXSD 2DLFH 4PS4H 5CWSA 4P4RA 4TOYH 1UQSB 3QRGL 2CRYA 5DRNA 1QFHA 5TPWH 1NLDL 1EH9A 3RKDC 1QSFD 4UV7L 1RUKL 2MOVA 4XGZB 5LWYH 4PJCE 2Q7YB 1G9MH 3FB8A 4E41B 3I50H 4OLUL 4WW1B 5I76A 3KPQA 4G7VL 3V6OA 4K3EH 1H15A 2R8SH 4MJ2A 3ARPA 4IEFB 4FP8H 1ND0B 2YD5A 3BWAA 4HPOL 1T2JA 4XMPL 4QCIA 4LLVB 2EDTA 3MSPA 1BBJA 1OTTD 1CZ8H 4OF0A 5D5MF 2EIDA 4OZHB 2R4RL 5DLML 1A3QA 2EIBA 4NRXB 1J1PH 2OI9B 4XP9L 1E4XH 1KBGH 1T5WA 4ZO7A 2DRUA 4JRXB 2P49B 1FL6A 5I1AA 3RUGE 1RFDL 5I1CH 1BBDH 2ESVD 3BESR 1FAKT 2VIRA 5C0RL 2DQDL 5C0DB 2ESVA 1MUJA 1UXWA 3HC4H 4ODXA 1QBBA 4TVPL 3OGCB 5DEGB 4LL9A 5DVOA 1M7IB 4WU5B 4YDVB 5JXAH 2BCKA 3DUSA 5I18H 1G9EA 4LNVA 4OCNC 4PJFF 3X3GH 4ZSOE 1ZA6B 3FN9A 3PJSA 4LLYA 3JV4A 1N8ZA 1KB9K 4KMTH 4ODHH 5EO0B 4LSVH 3FRPG 3G5VA 1FNFA 1AIFA 2NY1B 2VDLH 4B0MM 5ACMA 2GK0A 3BD5A 2V17L 3BXNA 3MRKA 1NGXB 3AY4C 3TO4D 4F37F 5ADPL 1C08B 3OV6A 4KAQH 4JPKL 2BERA 3TO4A 4EJ1C 2C26A 1UEMA 1IL1A 2I60L 3ET9F 4EI5C 1BZ7A 4PLKC 4EI6A 4LLUB 5KVDH 5CD3A 3V8CA 4EZMA 1SVZA 4IDJL 1JGDA 3KWWA 1F3DJ 2F15A 3QISA 3ZDZE 3X14B 3UTTD 5DUBB 3MRGB 4L8SA 4GLRH 3G6DH 4G6MH 4XPFL 1FIGH 1ZVSB 3VFMA 3UTTA 1VFAB 1WZ1H 3RVXC 4FQIL 1YYLH 2YD6A 4PTUA 2CPCA 1AJ7H 1AGDB 1NKRA 1LILA 2DQGH 4F7EB 1J1XL 1OSZB 3IFPB 1DBBL 3QH3A 4Z0BL 3IGAB 1UH3A 1FFPA 5SWZA 1NDGB 5D1QD 3QWOA 3VE0A 3ARBD 1SYSB 5KS9E 4U1SB 2VNCA 2A6IB 3R8QA 2W59A 2MFNA 3ARBA 2QEJA 2HN7B 3TIEA 2VKWA 2EDKA 4PRDA 3Q3GB 1X5GA 3C6SA 3U0PB 1T1WB 4MS8D 4X98B 4IOIA 3FFCB 1Q94B 5I71B 4HT1H 1MAKA 5DK0B 3HAEG 3JWDL 1SYVB 1VEOA 2XWJA 3GMMB 1HE7A 3OAUH 4BZ2H 1NL0H 1EV2E 4BYHA 3F6IA 3D3VE 3DURB 3T0EA 3HUJA 4LGRB 1OB1A 1QBMH 1UVQB 1XGPA 1XF5B 4Q6IA 5SWSA 1K9TA 4OIIL 4R4BB 4NGHL 1CGTA 4JHWH 4OD3L 5C09D 1CYGA 1OAYL 1HSBB 4LVOB 5AAWA 4Z9KB 1I3VA 4JY5H 5D7KE 3H42H 1F4WH 3SCMD 1P4IH 4KHXH 1W8OA 5E2VL 2OK0L 1ZHKA 5MI0B 2UZYB 4PJ7A 3EFDH 4L9DA 4G8FB 1VHPA 5C0CE 2B8OT 4S0SD 2WK2A 1ETZB 5ICYB 4WI8A 1TCRA 1RUQH 4EOWH 4JJ5A 3B6SA 5EU7C 5C08A 5KOMC 5D93B 3NA9L 1JUFB 3RI5F 3OKMB 3S5LG 4Z76A 4FZEH 5L2JA 5HGBB 1F8TH 3AS0A 3DWTA 4LVOC 1KLFA 5ETUA 4LIQE 3L7FB 4J6RH 3LKRB 2AJYL 2VDPL 4YHIA 2FX7L 5E1HB 4XNUL 3LN5B 3CFDB 5EH1A 3SKJL 1I1AB 2ITDA 3HNTH 2DMKA 2HAZA 2V2TA 2AJVL 2BNUB 1AO7E 2RFXA 3P0VL 4QYOA 2HKFL 1JZ7A 4Y5XC 1ZWIA 3P4OB 4Y88A 2APBA 2EE2A 1H0DA 3UXFA 3I6KA 3QIBD 3DO3A 2Y06L 2K9UA 1GJIA 3LEXB 4XP6H 5CEYB 1A22B 1MCDA 3MLRH 4KK8D 4PRBB 3Q1SL 4DVRL 4HUUB 3C8KB 5MEQA 1JFQH 3MRCB 2FX9H 2AV7A 4XVUD 3U7YL 1S7RB 3D9AH 5C07A 1XIWB 2Q8BL 4XNZB 2H9GB 3VXRD 1A0QH 5DHYB 2F5AL 4X0KA 3DX8B 3SKUD 3JTSB 2B0SH 4HUMB 5AG9A 4JVPA 3T4YB 3ULUE 1Q9OA 1I1AC 3P30H 2GJZB 4Z95L 25C8H 2A9NL 4YQXL 1PEWA 4M9PA 2AK4D 1J9CT 1RULH 2OR9H 4HH8A 4HZLA 4KKNA 4ZO6A 1OP3K 4JG0H 3QO1A 1FVDB 1LEKA 4PJGE 4WO4B 2IANB 2EYTA 1M05B 4NPYA 2A0LC 4QWWD 2ICEB 3LEVL 4PYGA 5B38G 3SDAB 1QSEE 1I8IA 5MHSD 1CXLA 3HPJB 5D7JD 4OD1L 5HD8C 3CFEB 2B7DT 1LWRA 4FN0A 5D7JA 5I1LB 4GG6A 2FBOJ 4NWTH 4NZUL 4NJ9H 1RZJH 2BHZA 4LLDA 2CK0H 2QADC 4XVJL 3MV7E 2XWBB 1FH5H 4YHNA 5E8DL 5I1EL 1S9KC 2VDOL 5T1MA 4UNUA 1KCLA 2RCSL 5DJDB 4ZFZA 1CXIA 4JM2F 4D9QE 2PO6A 4C57C 4QTIH 4KQ4L 4HKBA 1SY6H 3UDWC 4UU9B 1EFXB 5K9KB 4I0PA 3TO2B 3OXSB 1X3DA 2ORBL 3E0GA 4WI5A 1NGPH 4LEOA 4LEXH 4O4YL 2E7BA 1T3FA 5ALCH 1CG9B 1BP3B 3KPOA 3TZVD 4MA3A 2Q6WA 3BGAA 3QZWA 3SE3C 1KIQA 1CBVH 1MRDL 5TFSH 2PTVA 1WTLA 4P9ML 3PHOA 3G5XB 1O5DT 3KNBA 2P5WD 3B9KB 3BAEL 4JY6A 2VZTA 3NCBB 4BSJA 2B1HH 4QRRB 1QHPA 2QLVB 4RAHA 3DV6A 1WZLA 5C8JA 4X7SL 4XMLH 5BVJA 1C1EH 3IDYC 3G5ZA 5I16B 5IB1B 3MV9B 4OB5H 5FK9B 4PY7B 1CGXA 2G5BB 1OLZA 4DUVA 2FJFA 3MUJA 4MXVE 4N9GA 4PY8J 5H35B 1IAOB 3ZYZA 2NW3A 2R39A 2YRZA 5JIPA 5C2BL 3BEVB 1T0MB 3TA3D 3C09B 4BKLA 3RPKA 5FOBA 3TA3A 2IG2L 4U0QB 3N1MC 5FUOH 2P5EE 4TPRL 2J8UE 1A6VH 3MLXL 3W0WA 3ZKSD 5D8JH 3CZFA 4P3DB 2VLRE 1BECA 3DBXB 1X6NA 3N9GH 1BGXH 4OAWA 3MFFA 3QIUD 4JDVA 4PJAF 2VE6B 1HKLH 4BQ8A 4JFZH 1V7MH 4PJFA 3LEYH 4OLEA 2BNRB 3O0RH 2VC2H 4DJMA 3UX9B 3VG9C 1NANI 2HVKB 3WNLA 3OBAA 4AT6A 5T5FL 4P5KA 2HFEB 3X3FL 3GSRB 3RWDB 1UM6L 3QDJE 3MUGA 2CDGB 5CGYC 5DJZB 2VERN 2Y25A 2FX8L 4A6YA 4OCLC 5EU6D 1GZQB 4BUHA 5SX4H 5L0QC 1LO3L 3ESVF 5T3ZL 1MRFH 1XGYL 3HC3H 1XR8B 5HHXH 1JZ8A 3AFLA 1G7MB 4OZHE 5JPNA 3VMOA 1YEKL 2PETA 1P4BL 4PJEE 4WGWB 1X5ZA 1F02I 3MJ9L 4IRJC 4P49A 4W6XB 4OFIA 4YBQC 1LO5A 5EWIH 4Y4HB 2VLJD 3JWOC 1XCTB 3L9RA 4ZNEE 3DNKA 4EUPG 4NO0D 3KXFB 4GS7B 4KV5F 1UYWL 1YQVH 3RTQA 2O93L 4OM1L 2HFFB 3VFNB 4NO0A 1JP5A 3OKOB 2PYFB 5HHMB 2L0DA 3HE7D 1CF8H 1CGYA 4N8VB 4QHLA 2FEDC 5L9DL 4WFHD 5I9QB 1M7DA 1WCQA 4LVEA 4LRNH 3HE7A 5IKCA 2R56H 4PD4J 4Y8DC 3GKWH 4X5XB 1DBAL 2YD7A 2A2QT 4G5ZL 3MV8B 3BUYB 4NQDD 2D03L 5I1DB 2XTJB 3QXAA 3CSYB 3IVKA 5IHLB 4OD2B 2YA1A 1OTSC 4Y4FD 1CI5A 2C4XA 3SDXF 3RNQB 4Z7WF 3SGKC 5IMOA 5E7FA 3U4BL 4Y4FA 3QUZA 3ILQD 5CBAA 4F37K 1WT5A 1J0IA 1L0YA 3F7YB 4U49A 3BX7C 1PEZA 3BP5A 4OV6F 1EO8L 2DWEB 2XQBH 1ZT7B 2EDLA 3ARVA 3O3EA 4NC2B 1J5OL 3VXMD 3CCHB 4ZFFA 4PJ5E 4KRMB 5F44A 1BVLA 5FUZH 1NCUA 4APQC 5CCKH 1WIPA 5IOPA 4YIQA 3VWKB 5I9QC 2DD8H 3BP7A 1JHLH 3H9SE 4OUUA 1IAKA 3BW9A 1F11B 4OLWH 3W39A 2X10A 2FB4H 3FTGB 4KTDH 2FO1A 2VAJA 3CNKA 1FZMA 4WW2C 2DBJA 3L3JA 4KY1H 3HZKB 1S9VA 2BVOB 3CFKA 5F72S 3ZT7A 4PLNC 3STLA 4M03A 1D5XA 4MJID 4YNYB 3PL6A 1I3GL 4XP5L 1NCAH 3P73A 1JCKA 4MJIA 1F6LL 1FRGH 3HPLA 4Q2ZB 1OLLA 3SDDD 3EGSA 2RQ8A 1RZ7L 1Y6NR 2V7NA 4WHCA 3ZE2F 1IKNA 2Z91A 5TE7H 4LCCB 2VITB 5F7NC 1DBJL 1QA9A 1T1YA 1NFDF 3T1FB 1NAMB 1UKSA 2QR0A 3QIWB 2B2XL 3LPGA 3H0TA 4U1LA 5J1AB 4DAGH 1S7XA 1PKQA 4LARL 1YNLH 4AMKL 1EO7A 4RRPG 2DLFL 1KLUA 3FFCE 1QRKA 4W6YB 3I3BA 4PS4L 5CHNA 1QLRA 5MEND 4TOYL 1TJHH 4P23B 4ETQA 5TPWL 5MENA 1ZEAH 4DN3H 5EU7E 2NR6C 4HJGB 3LKNA 1EEZB 4WUKH 3BZDA 2ZNWA 3PQYE 3HG1D 4GXUN 5LWYL 3L5HA 1G9ML 3I50L 1TVHA 3HI6H 3BEWA 2NYYC 3HG1A 4K3EL 4QKXB 3W82A 4JFOA 4WHTB 5JW4M 2R8SL 1MHEA 1P7QD 4Q9CA 4FP8L 1DUYA 2AI0L 1MWAH 2J12B 3QIWC 5DEZA 1CZ8L 3CZJA 1DVFB 4WUUB 1EXUB 4ZPTB 2OBGA 2CR6A 5DJ2B 3OR6B 1L7TH 4AYFA 1E4XL 1KBGL 5C0BB 2HJLB 4P23C 5I1CL 1BBDL 2H3NB 1BQLH 3ARFD 1QR1A 3DETD 1FNGB 5E7BA 3DHMA 4U0RC 2EE3A 3GIZH 4NO2A 1HNFA 1WBYB 1FORH 3RI5K 4DTGL 4QRPD 4WEMB 1CE6A 5JXAL 1L9MA 5GZOD 3NIFE 4QRPA 5KVGH 3X3GL 1AGEA 3GUTB 2FSEB 4YR6B 2XFXB 2B20A 4KKCD 3W5MA 1ZT1A 5C7XL 3WD5H 3OKDB 1GZPB 3VGHA 4KMTL 4DWHA 4LSVL 4OF3A 1QSZA 5FF6B 1UA6H 3HCVB 4B7IA 3EO0B 3CAFA 3SGJC 4PJCA 2VDLL 5KSBE 2GUOA 43CAB 3IDUA 4RA3A 4F9LC 2KQNA 3TLRA 5TF1H 5IVXB 1XGRB 3GMOA 2VXUH 3BKCH 4HKXB 4MJ5B 3RKPA 3WJLA 3FQUB 4H8WC 3KDMA 5JDSB 2H6PA 3IU3A 3O8XC 1SJEA 4R26L 2WBJD 1G1YA 5J6HB 4JQXC 4RMVA 1HXYB 4XBEH 3CLFH 3EJZC 2X4UA 2WBJA 3E2HB 1SMOA 3RIAF 5F7WC 1CLOH 1QBLH 3GGWB 3U0WH 3IDMA 1KJMB 3WDIA 1MFNA 3RUGA 5JOFA 2J8UF 2D3VA 4OBRA 2CLVA 2NZIA 5IVNA 4LPVA 4G6ML 1YEJH 4MQTB 1WZ1L 3EOAB 4NCC2 1BLNA 1OGAE 4OT1H 1YYLL 4U7KA 5IB4B 5EUKB 1BIIB 1CFBA 4XCEA 3FRPA 1AJ7L 1NAKH 2RR3A 3MYZA 4ZSOA 2DQGL 3HZVB 3W11C 2IANE 2QJDA 1RJYA 32C2A 4GXVH 1CICD 3IKCB 4JRYD 4O2EB 1K3IA 1ZS8A 1XZ0B 5BVPH 2YR3A 2NY3C 2P8PB 1J1OH 2HLFD 1AQDA 4KJQC 2W38A 1FC1A 2WMPA 1KFAH 1F6AA 4WTZA 3VD3A 1NLBH 4OQTH 3A67H 4R9HA 3TP4A 2W1NA 3T65A 3ME0A 5I73B 4ZYKA 4I2XE 3S4SB 1ED3A 3JV6B 1QEWA 3KYMA 5EUOF 2CSPA 1PLGH 2ZOKA 2NXZC 3OAUL 1IARB 1I8LA 3TFKC 4JREB 5DDHA 4BZ2L 1NL0L 4S1DD 3WFDH 2H8PA 1ADQA 1QBML 2ID5A 4MXWH 3SQBA 1FGVL 1UXSA 2NXYB 4EN3A 1PYWB 3CFBA 4JHWL 3GMNB 3ZTJG 1LE5A 3F6LA 1JGVL 4B7LA 1W72A 4F57H 2XZCH 3RDTA 1SEQH 3OG4B 1ZXQA 4JY5L 4X99B 3KLAB 4UQ3B 3TCLB 1AGCB 3H42L 1V7NH 2UV3A 3UAJC 5EIIA 1F4WL 1FVCB 5IIEB 3LMJH 1P4IL 4KHXL 4XTRC 2FR4A 3SQOL 4NQCB 3EFDL 4DZBB 4GAYA 5KSUA 3FT3A 3FQNA 4JREC 1D5MA 1KTDA 1RUQL 5CBEB 1I9IH 5DYOB 3VFPA 4F7TA 2H2PD 3MGOB 3QFDA 2J5LB 1QVOB 1KF9B 1WZMA 4OZIF 3CSPA 2CXKA 4PJ9B 5DJ8B 5FA3B 5SV4A 1CT8A 4FZEL 4M43H 4PRPB 1F8TL 1WBZA 1X5AA 2V9RA 1OWWA 5JUEH 3D3VD 3CU1A 1YC8A 2A1WL 2ZP0T 4J6RL 2X4OA 3V4PH 3S37H 4Y19E 4M61A 1Q0XH 3MROA 3VDAA 3D3VA 5DJXB 2VYRE 3T0VA 3KJ6H 1D5BA 2IADB 2X1WL 3VFWB 5IB2B 2E27H 1QKZH 1P7HL 4J12A 3DRQA 3FQRB 4RMQA 4QT5B 3DGGB 2R1YB 3QI9B 3MLZH 5D7KD 3D18B 1A21A 3KPTA 5JOPE 3GJFA 2J5LC 3KJ4B 4XP6L 3U1SH 1S5IL 3FO1A 3MLRL 4X6CB 5F1IA 1JFQL 2FX9L 4FABL 3VXPA 1T83A 3HAEH 5C0CD 3D9AL 4F7MA 1JV5B 2VQ1A 1A4JA 1A0QL 4K7PX 3ZE1E 1E4KA 4CVXA 1U8MB 1BJMA 3SGDI 4JFPB 1U93A 1G9NC 4YLQT 1INQA 5EOTB 2JKXA 4EEEA 4IJ3C 4UI2A 5E2TL 2BK8A 2FEEL 2CD0A 4R90H 25C8L 4M6ML 3NCYP 4HWEL 1MFDH 3RWHB 5CIPA 4YZFE 1RULL 4H26B 5DJCA 1OF2A 3DX6B 1FBIH 4JG0L 2AJ3A 1F3JB 4FXGA 1YN6A 1RK0A 2BX5A 2KUTA 1EK3A 3I75B 4HX1A 3L6FB 3KJ4C 1U92A 2PCPB 3ARGA 4ZUTA 4MQSB 5ACLA 2ERJB 5GRYA 1AO7D 4R4NC 3QJFB 4JANA 5ICZB 3P9LA 1A1OA 3A6CH 1NDMB 2FGWH 5C0EB 1MPAL 5AUMB 1LO0L 5IUSA 2WIMA 4NJ9L 1RZJL 3TVMC 1N2RB 1YUHA 5TE6H 2CK0L 1S5HA 3C5JB 3T4AA 1MF2H 1FH5L 1X44A 4P2CG 4TYUA 5HHME 2E7LA 2F8VA 5EU5B 4PB9H 5GRVL 5I75C 3QDGD 1D9KA 1B9ZA 1T5XA 4QTIL 5AAMA 1SY6L 3CGTA 2OJZL 1KACB 4QRUB 5E8NA 3ULUD 3FL7A 3LAFA 4D3CH 4GKZB 4FXKA 5DK2A 1AP2B 2ERJC 1KXVC 2ZG3A 1NGPL 5KTEL 1J87A 4LEXL 4LFHG 2X9XA 2FZ3A 1N4XL 4HW6A 4NQSA 5ALCL 1NEZB 1S7QA 3BKYH 5DWUL 2IEPA 4WTWA 2B1AH 4DQOL 5LAXA 5EC2A 1CBVL 1HH6A 5TFSL 2G2RA 3U6RA 3F7VA 4J4PD 3QEGH 2I9TA 5IFHL 4Y2OA 4PJGA 4UILH 1KPUB 1QSED 1EMTH 4J4PA 3RHWF 4A2LA 3O3DB 3P4LA 4AEFA 5BV7B 1QSEA 3PXHA 3IDIA 3UBXB 2RJMA 4XMLL 5IW1B 4M5ZH 1C1EL 3V4VL 4DFHA 5C1MB 4YHPB 3V6FB 4NJAL 3UTOA 3NCYS 2XV6B 3BRDA 3ZYJA 4J3VA 1KGCE 1U8HB 2HT4D 1ZE3C 1OQOA 4U3CA 3MBED 1K4DA 1R3LB 4Z5RA 1BQHB 3MV7A 4LHUD 4NDMA 3MBEA 4JPVH 3HA0A 3K80A 4LHUA 5KOVC 3GRWA 2E9WA 5EU3B 2CQVA 4KDVA 4OBSA 2WQ8A 2YK1H 2YD4A 2EIZB 2QSCH 5EO1A 2V6HA 5HHQA 3H3KA 3PWPB 4K7PL 2I9LA 2X1PA 1VEPA 4LHJB 4R3SA 5IBTH 5CJQH 1F5WA 1I9RH 4OZFG 4L8CB 4BM7A 5BV7C 4U7MA 1I7RB 1XF4A 3N9GL 1BGXL 1SEBA 3D85A 3QG6A 1AHWC 2O5XH 3IJSB 2FIKA 3RP1A 4ALAH 2J7LA 1U3HB 2A77H 1HKLL 4JFZL 5IK3B 1V7ML 2H26A 3CDYA 3O0RL 2VC2L 4MQXC 3VCLA 5DFTA 3IFOB 3GMLA 4PRHB 5J13B 1H8NA 5E2WH 4YPGB 3QUMH 3ROOA 2DN7A 2EH8H 3EO1A 4AZ8A 1TMCB 3NFNA 2WIIB 4MDJB 3O6FB 4YH6A 2PKDA 1MRFL 5HHXL 2Y72A 3WIFA 4D0BA 3V79C 3QNXA 5KBNC 4KJPC 1QPXA 1P5VA 2ZUXA 2PYED 2R2BB 4S1SH 5E6IB 1U3HC 3BYYA 5C0BE 5KG9A 4S1QH 3GSNB 3QHTC 2M26A 3GO1H 2P5ED 4XRCB 4UOW0 5FM5M 1Q9WA 3F12B 3VFSB 3EOBB 1S7UA 2DDQH 2JK5A 3RL1B 5EWIL 2J8UA 4IOFC 4LVNC 2VLRD 5J13C 5J8OA 4G8GB 1F42A 1YQVL 5IB5B 3L5WB 4OIAA 4LP5A 1A3LH 4ZD3L 4S0TD 5D7LB 5DVNA 5CSZB 1KJ2B 4Z77B 5CFHA 4XH2B 1GH7A 2EH7H 5JORB 1CF8L 5JO5A 1ZGLB 3TC9A 4HXBH 3QA3A 4JG1H 3O6FC 4LRNL 1CDCA 3WS3B 1HHJB 1U0QA 1R5WA 4RGOH 1JK8B 2R56L 3GKWL 3DMMB 1YDPB 3RWFB 1RHHA 4M1DH 4E41D 3L95A 5E6IC 5T1DH 2DWDB 4OFKA 2JELH 4YHYB 3QDJA 3IT8D 5B4MC 4LHQB 4L8BA 4O58H 4U7SA 4CMMB 2HJFA 1CFNA 3L3HB 4KROB 3OQ3B 4AENB 3MJ7B 1XR9B 1K2DA 3LD8B 1VADB 4OGXH 2XQBL 4ZQKA 4UT7H 1X5FA 4JRXD 3RIAK 4LMQI 3VXTB 5FUZL 1BVKB 3WHE1 4X6DE 2DD8L 1JHLL 4PJEA 1LEGA 1U58B 2YZ8A 4PD4K 3ZKNC 5GIRB 2FB4L 4PJDB 3AY4A 1N5AA 1WVZA 3WNMA 4KY1L 3VRIB 1KSRA 4HK0A 4ZNEA 1HHKA 1G7LA 3OGCA 1PAMA 2B4CL 4UDTB 1C5BH 5J6GA 2ITCB 1T66D 4EI5A 1B88A 4JQVC 4Y4KC 5GZNC 3AXLB 3W2DH 1D6VL 4XHQA 3V7AE 5JXEA 1NCAL 3T77B 4K3GA 3EYUH 2NY1D 1FO0H 1FRGL 2NY2C 1T03H 3I84A 1ZHNB 2LVCA 3BHBB 3QG7H 3RVXD 5KAQG 2VXTH 5TE7L 1RPQA 3KPLA 4EKXA 4DCQB 1KCSL 5BS0B 4I13B 2GSIB 2HMIC 4EUPH 3V7AG 4YEFA 1CU4H 5JLZB 2OTWA 5FV1L 5LCVH 1QLFA 2AJXH 1TJGH 4AM0A 4TN9A 1NBZA 1TJHL 3GMPA 4MWFB 4PJ5D 4NFDA 4RMRA 1ZEAL 4DN3L 4LLQB 4PJ5A 1B0RB 4KK6C 1FG9C 4F9PC 5HYQB 1UZ8B 1PDKA 1J8HB 3H9SA 4U1IA 4H0GA 5IW6B 1BF8A 3MRIB 5DUBA 4LCWB 2W0FB 5JQ6H 5K33A 1JPGB 1MWAL 3X11A 2PW2A 3P4MB 1A6WH 5DI8A 4XXDA 3ECBA 4OI8A 2VXVH 3BQUC 3C6LC 1L7TL 4NN7B 3TWCH 3IJHB 3GI9H 1YNKH 4MNGB 1CDUA 5C0AB 4X8JA 1XF2B 4OKVB 5F9WC 1BQLL 3QNZA 4XCNB 4HUVA 1V8HA 2AXJA 3V5DB 5F1OB 2Q3ZA 1DLFH 2HN7A 1N6QH 1FORL 3FFCD 3FRUA 1IEBB 4EBQH 4ACPA 4HKJB 3DYPA 3D39B 1E6OH 3VGEA 3IXTA 4DKEL 4GUPA 5KVGL 1VKXA 4FQHB 1EVTC 5FB8B 2XT1B 4ZDHA 2BZDA 3WD5L 1KCUH 1DFBH 2IQAA 1ZHLA 4NQUA 1OW0C 1EX0A 4RFEA 4MZ3A 4U6HB 3LN4B 2FATH 4M7KH 1UA6L 3KPSE 3PQYA 3RWGA 1FZJB 3KHQA 1U91B 2LABA 5TF1L 8FABB 2VXUL 3BKCL 3H6JA 4BSVA 4HJ0C 2HFTA 2OL3B 2HKHH 4JN2B 5DO2D 3BZEB 3NIGF 1QD0A 2DTSA 3B9EA 4NHCH 2V5YA 1Y6KR 2Z8VC 3RZCA 3PDOB 4X6CE 3CVIL 4X80H 4X4YB 2XKNB 1OP9A 3DO7A 1CLZH 2EYRB 5FYJD 2EKSB 3CLFL 4U1JA 2P47B 1U8OA 2G75A 4I18C 2QQKL 2R9HC 1CLOL 1QBLL 2YHGA 3SO5A 4Y5XA 1NMAH 4OZGB 1RIUH 3BISA 3U0TB 4HIIA 1YN7B 1A8JH 4V2BA 1RVFH 2DL2A 1YEJL 2CH8A 1HH9B 4WV1A 1H9VA 3MNVB 1P69B 4S2SA 1N26A 4NNXB 5HGBA 2OP4H 1X5HA 2NNAB 2QV2A 2YPLB 1SQ2N 3WDHA 4GXVL 4D8PB 4WFGE 3LKRA 5EZJB 1I1AD 1R5VB 3NVQA 1JZ2A 5BVPL 3MRQA 1CTNA 3DVNA 5HVGB 1J1OL 1NCCH 5ERWA 1I1AA 1U8QB 4GW1A 4YDIH 2MQ3A 4L3CB 5KSBA 1IGTB 4N0CC 1KFAL 2VDRH 3TBSA 1HDMB 1JRHI 1NLBL 4OQTL 3A67L 4RA0C 4TVSa 1U8LB 2OTPA 4PYHA 5DRZB 1JN6B 2A0LD 3DTXA 3FOMA 5F7FA 5J0BA 4JFYA 4IHOA 1KJVB 1WLHA 1XIWD 4YC2B 1S9XA 1PLGL 5HD8D 2YA2A 4QNPF 2AJUH 1D7FA 4PP2A 1JHKH 2DQFA 2VSCA 3WFDL 5KN5B 3EDJA 4QRSA 2EEBA 2H9GA 3ZHKA 4AH2A 5J89A 2PW1A 5IB3A 1INEH 4MXWL 5CGTA 4PJXE 2D31B 3T4YA 4G6FB 1BJ1H 1S7TA 2LTQB 2NY0B 1MEXH 4WEBH 4DUXA 5KZCD 1OGAD 1MAMH 2XZCL 4QHUB 5ID0A 1SEQL 3FAWA 4E42B 1RIVH 1OGAA 1HIMH 4AIZB 1V7NL 4WO4D 3PXJA 2IAND 4GMTH 5JR1L 3CMOH 4XZUB 3LMJL 3GSXB 3UDWA 3S36X 1EUTA 3SDAD 2IANA 5AWNH 3TN0C 3NFPA 3RHWK 4I3GA 5F1NA 4YC2C 1CGSH 3LSOA 1MFEH 2DLEA 2DI8A 1I9IL 5JPMB 1FE8H 4OF6A 1F00I 1P1ZB 3HI1B 2HFGH 3SE3A 4KTEH 3VRJB 3LQAL 3QXTA 1A6ZB 3CC5B 5HVWA 2VLLB 4QXUH 2Y4SA 3GSUB 4M43L 5FYKD 5JHLH 4MAUH 2LTQC 4I2XA 4R96B 1CDJA 5EIQA 2CIIB 3MLWL 1KJ3H 4HK3N 1IGCH 5JUEL 4YHKH 5E4EC 3V4PL 3S37L 3FT2B 1Q0XL 1EFXD 5CGMA 3TJEH 4X6DF 2BVPB 3KJ6L 5DURB 3PWPE 1G7HB 5GGUA 2X4QB 1JJUA 1EFXA 4JO4H 1F97A 2E27L 1QKZL 2IAMC 2OYPA 1YPZB 2ZG1A 1UACH 2VXQL 3BE1H 3GMRB 5FKAB 2CKBL 4Q7DA 2FGZA 3MLZL 3QT2A 4ODBD 3C60B 3IDJB 5KAQF 1FFNA 3GIVA 4AQOA 3B9KD 4MD0B 2V2XA 4Q0XH 5F7EH 1DUZA 2DJUA 4GH7B 3PWJB 5BO1H 4L3EE 5KVEH 5IF0B 3DX9A 4YHZH 5D1XA 4GOSA 3O3UN 3VFUA 4PRHE 5I8CB 2VH5H 4K94L 3K1KC 1CFQB 5TQ0L 4PJBF 1WIOA 4R90L 1MFAL 3AREB 4R6UA 5FK9A 3ZTJH 1MFDL 1T22B 5DS8B 1FVEA 3K4DA 2G5BA 4F8QA 4UNTA 1OP5H 2CRIA 1UEYA 5H35A 4H5SB 4JFFE 1V3JA 5CGYD 2P24B 1OP5K 4Y19A 2E5EA 2GEEA 4LQ1A 1Q9LB 5KSVB 1PY4A 3A6CL 2FGWL 4GXUM 4RQQB 3JBG7 4BH8B 5F89A 1ZANH 3IS0X 4LLWB 4TNWF 5TE6L 4HG4K 1P4LA 4W70A 1MF2L 4Z7UB 2BNRD 3SGEI 2EKJA 1KC5H 4IRJD 2BHUA 1BREA 1LP9E 3N1QC 3RBSA 2LV4A 2ZUWA 1K8DB 4IM8A 4LLMA 1SJHB 2NPLX 2Z31C 4IRJA 1FZOB 3EAKA 4H1LH 1YEHH 2MQCA 2NY6C 3PP4H 3S36L 1G7IA 5E56A 1MHHB 5L7XH 1ITCA 1FP5A 1N3NB 5JMOC 2ICES 3OMZA 4GW4B 4HGWB 3BSZH 3BKYL 3GNMH 1GZQA 4MGXA 4F7PA 1BX2A 3SKMB 4P2OA 3TIDA 3HB3C 1J18A 4HWBL 2HP4A 1I3RB 1EEQA 4CU6A 5C0NC 4NUJB 4GSDH 2X6MA 3QUXB 5ENWB 4EQ2A 5DJ6A 2JCCF 3EFFB 3QEGL 4LF3A 4WI4A 2I07B 4NQVB 4UV4L 2XZZA 4UILL 5FYLE 5DTFB 4U2ZA 2NY4C 4XNMB 3BP4A 1ZHBA 4M62H 2AEWA 1GCFA 2XPGB 4M5ZL 3SGKA 3UYRH 3HRZB 3V5KB 1CDHA 2HYMA 5T3XH 1CVRA 3U9UA 4Q74A 1HXMA 1FG2B 3S6CA 5EOCH 2PXYB 1FN4B 3VRLE 4D0CB 5HHMD 1LGVA 2UYLB 3HN3A 1BEYH 2DMCA 4A2MA 1CD0A 3QWQB 4APQA 4HH9B 1G7PB 3MV8D 4KDTA 1R0AH 4MX7A 2YK1L 2AAVA 3UYOD 3BUYA 4WI2A 1OY3B 4WW2A 1RZIA 5D1ZB 3LB6D 2C7UA 5IBTL 1JIBA 5CJQL 1XCQA 4G80A 2HJKA 5E00B 5F9JA 4HC1A 3O6LH 4ODVH 2P44B 3Q0HA 2O5XL 5D6DC 1CIUA 4ALAL 2MJWA 2A77L 1ZMYA 1B0GB 1LO4L 3RWCB 2VB5A 3LQMA 3RPIB 3TT3H 4PG2C 3UMTA 4RFNB 2Y5TB 4PGBA 2BMKB 5E8EB 4JQIH 4R7NB 2IPUG 3KYAA 5ILTH 5HJ3B 5D72H 2VDKH 4M7LH 4WHYG 2ARJB 3AROA 5E2WL 5J12B 1LDSA 1ZV5A 2WWKO 1KGCD 3CH1A 4BSWA 2KDGA 2DQCH 2EH8L 4P4KC 4X9FA 1LDPH 2WINA 3IETA 5CWSB 1YMME 4P4RB 3OSKA 1LD9A 5DRNB 2F74A 4PGCA 5DZOA 2VISA 1J11A 1WFUA 1G9MC 4S1SL 1CXEA 2NYYD 4OZFA 5IQ7H 2M1KA 4YNYA 2UWEE 5DMGC 3RGVB 5HDBF 3FB8B 1Y0LA 2KBGA 2OX5A 3O4LA 5I76B 3D0LA 4ODUA 3NZHH 1H15B 2GITA 1PX4A 2DDQL 1R3HA 1WAAE 4XNYH 3QIWD 3BWAB 2EXYC 2W9DL 5CZKA 4QCIB 4E0RA 4HHAA 1A3LL 1JPSH 4M1GH 5J12C 4AEHH 3OL2A 4NQEE 5DMJB 1BBJB 3QJHA 4P23D 2EH7L 4HBCH 4LPXA 1UT9A 1OTUD 1T0PB 4AY0A 4JG1L 3TH4T 1T5WB 2WWKT 5FO7A 4RGOL 1FL6B 4ZAKC 5I1AB 3MJ8B 3X12A 4M1DL 2VIRB 2XXCB 1EEZA 3VXUB 1NCBH 2ESVB 1MUJB 2JELL 3CVHH 1UXWB 3KPPA 3NZ8A 4FQXB 3RGVC 3KLDA 2BCKB 3DUSB 3V6OC 3DJ9A 4OZFH 5C0JA 1MLBA 4O58L 3S3JA 5D2LF 2OQJA 3BPOC 3RVWD 3PJSB 1DVFD 4LLYB 3JV4B 1N8ZB 2FL5A 4OGXL 4UT7L 3WKNA 5F7KC 5C0BD 3NN8A 2VZVA 3SGJA 1PBYA 5B8CB 3EZ8A 3G5VB 3L3DA 3FO2A 1AIFB 5C0BA 1JYXA 4DVBA 4OZGE 2DB8A 5FGBA 1T2QH 3O8XD 1FNGA 3BXNB 4NZRH 3MRKB 1EAPA 4JN1H 5IBUG 3O8XA 2VLKA 3EJZD 1C5BL 4Z7NE 4FQXC 3LRGA 4K55A 3TO4B 3RRQA 1NCTA 1DL7H 3ZE0E 1IL1B 1BZ7B 1EZVY 3OHXA 1MI5A 3NCJH 4EI6B 2CO6B 1L0QA 5CD3B 2ENSA 3QUYB 3EO9H 5IBLC 1JGDB 3EYUL 3KWWB 1FO0L 1T03L 1BFOA 1NMCB 3T3ME 4HZAA 2X9YA 2VXTL 4OTXL 3V6ZA 5AZ2L 5B8CC 2FH6A 1DDHA 1EA9C 3VFMB 1JNLH 2E8YA 3UTTB 1CLCA 3ARDC 3G6AA 1Y6MR 3QQ4A 1ZT4A 2QSQA 4XWOC 3TJHC 3W11D 3SE4C 1IE5A 4PTUB 4JKKA 1A7OL 3P0GB 1SM3H 5LCVL 4LCIH 3OXRA 3WLBA 2AJXL 1TJGL 4RX4D 1I9EA 5SX5H 1QFPA 1VENA 1GOHA 3QH3B 5DRXA 4BELD 1FFPB 3HRPA 1X5XA 5SWZB 4RX4A 1UM4H 3IAPA 4PP1C 3VE0B 1R24A 5SX5K 4PRIB 5F7HA 4Y8AA 5F70A 4X6DA 5AZEH 1EVUA 3ARBB 1UKQA 3QUYC 3O9WC 3TIEB 5A2KH 1G1CA 4JLRA 4PRDB 1NMCC 5F6IB 3FCTA 3C6SB 5IMMA 5JQ6L 1AXSA 3TFKD 4IOIB 3V52H 3ZSSA 5IB4A 1A6WL 3AB0B 4ODSH 2XWJB 4FTVE 4ZPVB 4WY7H 2VXVL 3O3AB 3T0EB 3O6MH 3HUJB 4O2CB 1OB1B 1YNKL 4RGNB 2E8ZA 1F4YH 1HZHH 1XGPB 2AEPH 2QSVA 3KYOB 4Q6IB 3GKZA 5SWSB 5HHNB 4BJLA 3MRMA 3QPQC 1AGBA 3UAJD 3MRPA 1F13A 4P3WA 1TPXB 1N6QL 1WISA 4XTRD 4PJBA 4K9EH 3ZYIA 4I0KA 4EBQL 1HEZA 5CUSH 4MMZC 3E6FA 1E6OL 4NN6C 4WI9A 1OSPH 2OZ4L 5AEAA 1ZHKB 3CFIC 4PJ7B 5BJTA 1DFBL 4AEIH 2C1PA 5DUPH 4CU7A 2FATL 4JJ5B 4GRMA 2CRZA 3B6SB 3T0EC 5C08B 1U3JA 1XGTB 4FG6C 4RGNC 3PHSA 5FXCH 5JIKA 2C4FT 3O2DH 1YPZE 4Z0XA 1T1XA 3FB7A 4Z76B 4TSBH 5L2JB 2HKHL 4JDTL 5ESAB 4ZNCD 4JB9H 4MNQB 4NHCL 1SHMA 1LK3H 2IBBA 3I9GH 3L1OH 4OFYD 4KI5C 4LNRA 1TPXC 5ETUB 3TCLA 1UWGH 4X80L 4OFYA 2ADIA 2XN9A 4NQCD 3UTZA 5I1IH 1CGUA 2R4SH 4YHIB 5IIEA 3JVGC 5DC4B 5C6TH 5T3ZE 1AE6H 2ICWA 1MLCA 2R1XA 2ITDB 5GS2D 3AVEA 2OXGA 4DZBA 1MCFA 1QR4A 3QRFM 2V2TB 1KYOK 2C4FU 2RFXB 1WUNT 4QYOB 2HRPH 1NMAL 1RIUL 1HWGB 4QRQA 2HT3C 3CDGA 1ZWIB 3TT1H 2BNQE 4PJ9D 1OAKL 1H0DB 4XCYA 1BMGA 3I6KB 1EGJA 4PRPD 3E6HA 3SDYH 5KSAC 4NZDA 4CADA 1U3ZA 4Y5VB 2ZCLH 4NSKA 1RIHH 2OP4L 5MEQB 1HHGA 3AU1A 2AV7B 2N4IA 1EAJA 4O51A 4LPYA 4R4FH 5C07B 3HE6C 5JMRA 4Y16A 2LAGB 5JZ7C 4G9FE 2D7PA 2IALA 4X0KB 4K7FA 1T89A 4G8IA 2BXYA 4NO3B 4NN5B 1NCCL 3MXVH 3VGAC 3F7RA 1T2XA 1B3JA 5F8QC 1S7SA 4YDIL 4Y2DC 2E9BA 1Q9OB 3CK0H 3KPSA 4GQ9H 4LVHB 4RISH 3QI9D 1H3TA 2VDRL 1HYSC 4TNWK 4HZLB 1CWVA 3QO1B 4Z7UE 1LEKB 4R4ND 3U36A 3QXDA 4Y5VC 3MC0A 2EYTB 4NPYB 2AJUL 5DRWA 1EGJH 1I8IB 4IDLA 1RZJC 1J0HA 3TBYA 5FEBA 3OAYH 5I17A 2JB5H 3TVMA 4JFPA 5D7JB 3QFJE 1EEUA 4X4ME 2BC4A 4GG6B 1CIDA 1P7KA 4WEBL 1MEXL 4XMKH 4LLDB 1M1SA 2WANA 3OAYK 4QXTA 5D71H 1DE4A 4OKDA 1MAML 5EN2A 4YHNB 1AQKH 5T1MB 4RAVA 1BFVH 1I8MA 1HIML 2DQIH 3RL2A 4GMTL 2EDQA 3DI3B 4WFGD 3CMOL 4O2FA 2PO6B 2Y36H 5MEOA 5F7YC 2Q3AA 5EA0H 4HKBB 2GIYA 1JTTA 3GHEH 1CGSL 4I0PB 1MFEL 4XC3H 1HI6B 4LEOB 1FE8L 4CMHB 5BRZA 1T3FB 2HFGL 3ILPA 2Y23A 2XOTA 4EDWH 2BJMH 3C87A 4WNQA 4MA3B 2Q6WB 2C3GA 1FJ1A 3QZWB 1KIQB 1WGOA 1CS6A 1RURL 4QXUL 5J06A 1N2RA 5DZLA 4MAUL 3VD4A 2A73A 3KNBB 3PIQA 4JY6B 1IGCL 5EU5A 5ESVA 4YHKL 5J4MA 1KB5A 1S7VA 3WL9A 3DV6B 1GPOH 5CILH 3TJEL 5C8JB 3T2PA 3RNKB 4ELME 1EEYB 1Z9MA 5BVJB 5M7QA 1UWXH 3MLTA 1J05B 5M94B 3G5ZB 2CR3A 4JO4L 4HWNA 3PDGA 1B2WH 4I0PC 3V6BR 5IMKA 4PJXA 2XYCA 2P8LA 1UACL 2D0HA 2ZUYA 3BE1L 3DUHA 2FJFB 4OGYH 3NIDF 1MCSA 4FQ1H 2K7QA 4CMHC 3VU2A 2XY2A 3U48A 2NW3B 2VDMH 5FECA 5F7EL 4BKLB 3PF2A 5FOBB 5BO1L 3TA3B 5CSGA 3U46A 2HLAA 3BD3A 3W0WB 1KXQE 4QGYA 5I6XB 1K4CA 1M6OA 1UH4A 1AHWA 5E6ZA 1S7WA 5D7SH 1EHAA 4OAWB 1KB5H 4XAKD 3MFFB 4MQXD 4RNRA 5JHDE 3ZZ1A 4JDVB 1VESA 1SJVA 1R3LA 5F88A 1MELA 4PJFB 2AK1H 3PABA 1ORSA 1MY7A 2X4SA 4AT6B 4ODWA 3EYSH 4KXZI 2DKUA 1KCRH 3PWPD 4JO1H 1FC2D 1PZ5A 5HYEA 5GGVH 3V6OE 5FAAA 4WFEE 1WBXA 1WK0A 4C83A 2BVUA 1IAIH 2GJ6E 1QFWI 4YBLB 4KJPD 2VR4A 5DQ9A 2A6JB 2GSGA 2YMXH 4XI5D 1ZANL 1IMHC 1U3HD 5I6XC 4MJ6A 4QLRA 5GS1C 1KC5L 2NMSA 5JNYA 4L3ED 4KKLC 5JPNB 2Z93A 2V5MA 5I74C 2AJZA 4IIQC 4IOFD 2NY7H 4P2QA 4L3EA 3KVQA 1YEHL 4PRHD 2P46B 3PP4L 4ODTL 1AXTL 4GG8A 3VXUE 5L7XL 3BIKA 1LO5B 3IFOA 3D6GA 3BPNB 3BT2H 2V7HA 4MNHA 3L9RB 3RTQB 5GS0D 4Z78A 3A6OA 3O6FD 4NO0B 3BSZL 5ID1A 3GNML 4ZUUA 1MCJA 2WIIA 4QHLB 3EKCA 5E6ID 4GSDL 1M7DB 5FO9A 4NO5A 3HE7B 2ZUSA 4MD4B 4JFFA 5HBBA 5H94A 5SV3A 3QXAB 3IVKB 3O2VL 3QEHA 5C92A 4M62L 3FN0H 3UYRL 5GGTH 4K23H 5T3XL 4L4TE 5IMOB 4HPOH 3BPNC 3QUZB 3ULSA 4F8TA 5CBAB 1MAJA 2NX5E 1BEYL 1X5LA 4Z77A 3O3EB 4ZFFB 1LP9A 5HTSA 3ZKND 1KIPB 1NJ9A 2DQJH 5FYJU 3DMMD 3LKPA 1BVLB 4XP9H 4JFXA 5IOPB 3N1FC 1O0VA 4YIQB 1R0AL 1HHJA 3BP7B 2EDXA 4NM8L 1W0VA 4OUUB 5I1HH 1YDPA 3W39B 3BW9B 5J56B 1A14L 5ISZA 1A2YB 1CQYA 3T3PE 1H3UA 3N0PB 1FZMB 1UCTA 4Y4KD 4TVPH 2GFBA 3CFKB 3CUPA 4F7CA 3O6LL 5HDLA 3FB5A 4JQVA 2F5BL 4Y4KA 4KROD 3STLB 1B0WA 1D5XB 2YOCA 3DRTB 3S3SA 2NY2D 5BZWA 1CCZA 2FIRT 1RHFA 3MJ7A 3PL6B 5FYLD 3P73B 1D5IH 1G7QA 1MIEH 4WWKC 3TT3L 1A7RH 4H25A 4MJIB 3HPLB 2YWZA 4PRIE 3EGSB 4JQIL 4ZODA 5ILTL 2V7NB 1S78D 5D72L 3ARRA 2VDKL 1ZGLP 1J0YA 2Z91B 4BA8A 2DJ4A 1QA9B 1T1YB 3TEUA 1A9BA 4FQ2H 2QR0B 2EDYA 3H0TB 4U1LB 1OARL 1S7XB 1PKQB 4FXLA 1S8DA 2EDWA 1KLUB 1XMWA 5CHNB 1QLRB 4R0LC 2CK2A 2YD2A 2AKRA 4ETQB 2Y1VA 3IKKA 3MRFA 4F9PA 3T0EE 5IJVB 3LKNB 5IQ7L 3I3EA 2D7TH 4RGNE 4Y5YB 4D9LL 1TVHB 1UZ6E 3RVVD 3BEWB 1XF3A 3NZHL 3RQ3A 1N6VA 4JFOB 4JCLA 1MQ8A 3INUH 4KI5E 2MQ0A 1MHEB 5C9JA 3BQUD 3R0NA 4X8XA 1DUYB 5MP6H 4AEHL 4M1GL 2DM2A 3BQUA 5HI4D 3C6LA 3ARQA 4DKFH 3DYOA 4HBCL 2R2EA 3KPMA 3S4SG 2BVEA 1QR1B 1J8HD 1CD8A 1NCBL 3KAAA 1UB5A 1CTOA 1UZ8A 2GW5A 3CVHL 4Y5YC 4NO2B 4EXKA 4M48H 4TUJA 1JZ4A 4JJHA 12E8H 3OKLA 4KKAD 2W0FA 4MNQE 3ULVF 4JGMA 3VDCA 5FYKU 2H32H 4HIHA 1YMMA 3LHPL 4RCAA 1T20A 1OW0A 1ZT1B 3JWDH 4MXQC 4F58H 2A74A 1JGUL 4JKLA 5C0AD 1GVIA 4ONGH 4TTGA 4TSAH 3TGXA 4K3JL 3IJHA 2UWEA 5MERA 3KYKH 4PJCB 3ARWA 1U2CA 1T2QL 4NGHH 4NZRL 3QCVH 3GMOB 4FQPA 4JN1L 1WAAA 4WHYH 1KN2H 1IEAA 4OLZH 3KDMB 1FSKB 1KLGA 2H6PB 3IU3B 3OKNA 4NQED 2IPUK 4FFVC 2FLRT 4RDQG 3NCMA 1SJEB 4KI1A 2R9HD 2E7MA 4NQEA 1DL7L 2HRLA 2D4DA 4I18A 3NCJL 4FQHA 2X4UB 5E2VH 2WBJB 1CXFA 4GJTB 4PPTA 3IDMB 1JNJA 5LGHH 4YDLC 4O00A 5JOFB 1FNLA 3LN4A 1O7SA 2FJHA 1KTLA 1RJZA 3T08A 1KTKE 4DW2H 3HR6A 3SDCB 3WBDA 1QLEH 1JNLL 1U91A 3ABZA 2X70A 5IWLA 1BLNB 1BD2B 2ZJSL 4KMLB 4XCEB 3SJVE 1VFOA 4ZSOB 5FO8B 1SM3L 4LCIL 1FSKC 3F7QA 5B3JE 5GSVA 1KIRA 2VDPH 5T33H 1ZS8B 1QRNE 3HC0A 4N0CD 1UM4L 4I3RH 2X4PA 4HS3A 4ELKA 3RIFF 3SKJH 1JTOA 3GM8A 5AG8A 1AQDB 4JM2C 4L5FL 5IESH 5AZEL 1JMXA 5H2BA 4DOHE 1F6AB 4GG6E 2ICWJ 4B53A 3O11A 1T6WA 1GYAA 1EPFA 4IMLA 3T65B 2XA8H 4ZYKB 5GS3A 3V52L 3SDCC 1ED3B 3DHJA 4I77H 1QEWB 4ZFGH 2EE9A 3KYMB 2VKXA 4QTHA 3MRDA 2YPLD 2ZOKB 4ODSL 4WY7L 5DDHB 5I8EA 5I19L 4MHHI 3U7WH 1CQKA 3EYVB 1RJCA 2H8PB 5F9OH 3KLHD 4D8PA 5EZIH 1F4YL 1R5VA 1HZHL 3VI3F 2AEPL 1UXSB 2W92A 3IF1A 4YX2H 4EN3B 3QHFH 3CFBB 3UPCA 3NTCL 5FYJH 4LPUA 3Q2CA 1LE5B 4M93B 4HEME 4M6NL 3RDTB 3C5ZC 3QDMA 5DQJA 3J8F7 4K9EL 3SO3C 3BKMH 4DK3A 3TN0D 5L88H 1AXIB 5E94A 5EIIB 3UJTH 1MCWW 3QEUB 1IRAY 1JBJA 3TN0A 2FR4B 1MH5A 2ICWI 1IQWH 2CUHA 3BH8A 2A6DB 4P46B 5T1KD 4GAYB 4AEIL 5KSUB 5DUPL 4X7EC 3FQNB 1D5MB 1KTDB 3HNSH 1QFUL 5T1KA 3VFPB 4CN1A 2NY0D 3C8DA 2DIAA 3QFDB 5DVMA 4YO0A 4JO3H 3O2DL 2FCBA 3VWJA 3H9ZA 1CT8B 4TSBL 3PG2A 1WBZB 2I27N 4JB9L 3L1OL 1LK3L 3I9GL 2WNGA 2O26U 1NEZG 3WDJA 3RDTC 3CSGA 5D5ME 1MFBL 1UWGL 1DN0A 2C5DC 2X4OB 3AS3A 3HS0A 3SKOA 3V0VA 4FTVA 2J6EH 5I1IL 2R4SL 4M61B 4NRZA 4JAMA 5C6TL 3E3QC 3D3VB 4ESKA 5CD5C 1EFQA 1AE6L 2F19L 2IAMD 3F7PC 4KQ4H 5IVXF 1D5BB 1AY1H 5EC1A 1U36A 4PJ8A 2HRPL 2IAMA 4P46C 5LBSH 2QKIA 3DRQB 3TT1L 3WFZA 3UBXG 2X7LA 5F71A 1NBQA 4QXGH 2APXA 3GJFB 1EBAA 1T7WA 3CC5A 3FO1B 5F1IB 3WHXA 4P9MH 4PJFE 3VH8G 4NFBA 2CGRL 2D7QA 1NUDA 5DJAA 3U79A 3VXPB 2AXHA 3BAEH 1BQHG 4CVZA 4R4FL 3OF6D 4LSTL 4F7MB 1VB9A 3DX7A 1A4JB 4U6YA 3CIQA 4CVXB 3OF6A 3O3BA 3VD9A 1U93B 3MXVL 1INQB 2EXWC 1NGWA 4UT9H 3CK0L 4GQ9L 4OQ1A 1ITBB 4RISL 3EJJX 3SDXB 4LGPB 3C60D 3MLYL 4Z7WB 1YPZA 1WITA 3T8XA 5EB9A 5CIPB 4X83A 1MJ8H 5DJCB 2AJ3B 4CN6A 4FXGB 1YN6B 1RK0B 1FHGA 4TUKH 4HX1B 5C2BH 5T3ZD 1U92B 3ARGB 4ZUTB 5FYKH 4BQBA 4U6XA 4JANB 3P9LB 1V3MA 1A1OB 2ADGA 4TPRH 2R15A 1IGIL 2UY7A 1A7BA 3MLXH 1EJOH 2YEZB 2JB5L 2DS4A 3ARED 3S35H 2BNQA 3EJYC 4XMKL 1YUHB 1S5HB 1PZUB 3MJ9A 3T4AB 2XI9A 2Z31D 3BJLA 3JSSA 4KHTH 1AQKL 5HI3C 4N0FA 2Z31A 1L7IL 5MEPB 4P2RE 2DQIL 4G9FD 4OJFL 4R2GB 4H5SA 1D9KB 5EA0L 2BFVH 3K1DA 5T5FH 3B9AA 4G9FA 3X3FH 1JHTA 1MCKA 3F65A 5E8NB 3GHEL 3ZO0A 5IEKA 1Q9KA 4FXKB 5DK2B 1CFVH 3EOTH 3OX8A 4XC3L 4R8WH 5CP3A 2FZ3B 1UWEH 4NQSB 4RQQA 4EDWL 4EDXA 1X5KA 5LAXB 2G60H 5B38B 2ZPKH 5EC2B 2FJGA 2G2RB 3UTSA 2NY4D 1IGMH 3MREA 3OJVC 3U6RB 4Z7UA 4YAQA 3F7VB 2I9TB 2CJUH 4PJGB 1K8DA 3I6GA 1YEKH 3IB4A 2GT9A 4RDQF 5JTWA 4G42A 4HWZA 4R2GC 3MJ9H 1QSEB 3IDIB 2APVA 3Q6FA 4PJIF 2YSSA 1I8KA 2OR7A 2APFA 4D94A 1B2WL 3QFJA 4X4MA 5E24E 1GSMA 1K4DB 4Z5RB 4JE4B 4OGYL 3MV7B 4FQ1L 2RBLA 3QUMB 4NDMB 1IAMA 3MBEB 2IGFH 3QUXD 1DEEB 2VDML 4RMSA 2CIKA 4LHUB 2WV3A 1YY9C 4GW5A 1QO3A 2QQQA 4TTDC 2L4OA 4X9HA 5CJOH 3VXOB 3OWEA 5INCA 5EO1B 5HHQB 3NPSC 1KPRA 5DTFA 3KYNA 4R3SB 3P9WB 4X4ZA 1SJXA 4GRLC 35C8H 4NM4H 3HRZA 4YXKH 1NGZA 1XF4B 2FBJH 5D6DA 1SEBB 1W2KT 2R0WL 3D85B 3QG6B 5D7SL 1FG2A 2J1KA 2FIKB 3ULUL 4IMKC 2EICA 2FYYB 2X1XR 5IFJA 2H26B 2AK1L 3MGTA 3MRJA 3EYSL 3VCLB 1NMBH 1KCRL 1WF5A 3GMLB 4JO1L 4LSUH 5J3HD 5D1ZD 3H7BA 1PQZA 5GGVL 4ELMA 4LSPH 2ZUTA 4P4KA 3ROOB 2QHRL 43C9A 1EERB 2XIDA 4PBXA 1CLYH 1HSAA 3EO1B 5L6YH 3NFNB 2VDNL 2YMXL 5E00A 7CGTA 5HI5C 2VABA 1H5BC 3LOWA 3WIFB 5DMGD 4D0BB 3FZUD 3QNXB 1YEEH 5IM7A 2V9QA 2X4TA 2CO7B 3BD4A 5E5UB 3LVEA 3RWCA 5KG9B 2NY7L 3BDYH 3VJ6A 1Q9WB 1S7UB 1RZ7H 5HPMA 3R0MA 3BT2L 3ULVH 1NSNH 2J8UB 4TRPH 2EDEA 3RVUC 2BP3A 4XVTL 4X6FA 4LARH 1DQJB 3PWVA 1Z9LA 4JVWA 5C0FB 3GFUA 5JHDA 4YHOH 1YEGL 5JO5B 3QA3B 1HCVA 3P0YH 4ZAKA 3EHBC 3FQTA 5GHWH 5ELIA 1R5WB 4KK5C 2WUBL 1RHHB 3DVIA 3RGVD 2W65A 4OIBA 5E0QA 3L95B 2X44D 4WFED 5E1AA 3RGVA 3WIIH 3QDJB 2VSDA 3FN0L 3PGDB 5I1GH 3NGBC 5GGTL 4K23L 4L8BB 2GJ6A 1JI1A 1I7ZA 2HJFB 1CFNB 2AI0H 4XWGH 3QEQE 1T04A 1K2DB 1MCNA 4ZQKB 1JWUB 3DXAE 4RSVA 1C8PA 2DQJL 1W0WA 3VXUD 5AYUH 4PJEB 1LEGB 5I1HL 4YGVA 3MJ8A 3T09A 3VXUA 4FQXD 3MLVH 4LKCA 4CN4A 1HWHB 3MRLA 1HQ4A 1N5AB 4PJHF 4HK0B 1J7VR 1HHKB 1G7LB 4FQXA 4DTGH 5TF0A 1MRCL 5J6GB 3MA9L 1BD2E 3WSQL 1UADC 4EI5B 4JKWA 1I7TA 3QXUA 5GRZA 4XVSH 1OTTC 3MOQA 5HGHA 5C7XH 1D5IL 1MIEL 1RZKH 3N50A 1A7RL 3UP1A 4JCMA 3RIFK 3PDDA 1ORQA 3TJHD 5B8CA 3STBA 2R0KL 3ARDA 3KPLB 5DT1H 4L4TD