3CZUB

Crystal structure of the human ephrin a2- ephrin a1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
130
Chain Sequence
ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYESVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords Ephrin type-A receptor 2
total genus 29
structure length 130
sequence length 132
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3czuB00
2IDFA 4JHUA 3T6XA 1RZPA 1HAWA 1XB3A 4HHGA 2I85A 5B1KA 1L9QA 3T6WA 1KCBA 3DTUB 4E9VA 1JZHA 2J55A 4BWTA 4WTQA 2IAAC 2DWTA 4F2EA 3NJMA 5B7FA 4AKQA 3H56A 3OM3B 1WA2X 1KGYE 1A8ZA 2GC4C 4YSRA 1AOZA 3FU8A 1AR1B 2UXGA 4WKXA 3AW5A 1XB8A 1GSKA 3RYMA 2IDQA 1J9QA 1SHXA 2BP0B 4G7SB 1A4AA 1SF3A 5B3SB 3FS9A 5AKRA 3KW8A 1JERA 2H3XC 4QKTA 2NRDA 2XUWA 3FU7A 4UAHA 5B1JA 4GY4A 1A4CA 4F2FA 2ZOOA 2ZXWB 4E9SA 2QDWA 2VW7A 1GS8A 3QQXA 1WAEA 1ETJA 2OJ1A 1JZFA 2WO2B 1ASQA 1KDJA 1QHQA 3NJGA 3NSFA 4DP9X 2MTAA 3CG8A 3NT0A 4M3HA 4DP6X 2VSMB 3UACA 1OCOB 3NJJA 3ASNB 5EHFA 1ZPUA 1AS6A 1CUOA 4DP4X 4HHWA 2TSAA 4A67A 2QDVA 5LDUA 3QJRB 3PAZA 2QPEB 3N55A 1ASPA 2FQGA 3UAAA 3JTBA 2XWZA 8PAZA 3FSZA 2VMJA 2DV6A 2PLTA 1M9WA 2FWLB 2HRGA 1SF5A 2BHFA 4M4RB 2ZWNA 1NIBA 4AX3A 1L9RA 3AG1B 3WG7B 1J9SA 2XX0A 3NJFA 4GP8B 4E9YA 1TEGA 4HZ1A 2XU9A 5AFAA 2J56A 3IEAA 2PPAA 3HEIB 3T9WA 7PCYA 4YSEA 4N8UA 3IN2A 4A66A 1L9PA 1BEXA 2FNWA 2PCYA 1ZV2A 4HIPA 2VN3A 3FU9A 3FSVA 1E67A 5I6OA 1BAWA 4DP8X 1JOIA 1F56A 3L45A 3CVDA 3NJKA 6PCYA 1BXAA 4DPAX 4G72B 1AZUA 3TA4D 3HB3B 4E9RA 1JVOA 1PLAA 2CAKA 1WS8A 2IWEA 2FJSA 2J57A 3BQVA 4DPCX 1SFDA 1NIDA 1ZDSA 2XV3A 4P5SA 2B3IA 5F7AA 1AZBA 2HXAA 2CUAA 1HAUA 1X9RA 2UXFA 4FAAB 1ASOA 4MFHA 3ABLB 2XV2A 2HZHA 1IUZA 5TK4A 1KBVA 1X9UA 1GW0A 1BYPA 4E9TA 2WSDA 4FA7B 4KNUA 1W8EA 3DIVA 1EZLA 2GHZA 2E86A 4N4YB 2JFCA 3ZX1A 2JKWA 3FU7B 2VSKB 3CDZA 2BZ7A 4KO9A 3WNIA 1JXDA 1JXFA 1SNRA 3FSWA 1E65A 2LLNA 1CC3A 1PZCA 1PMYA 4PAZA 3TBBA 3UGEA 2PPEA 1B3IA 1UATA 2VM3A 2JXMA 3NJIA 3TU6A 4YSQA 1PCSA 4A2EA 2YAEA 3KW7A 1BQ5A 4KO7A 4YSOA 1FFTB 2YQBA 1J9RA 3SQRA 2PPFA 2IDUA 1GYCA 2FT8A 1XMEB 2FQEA 1AS7A 2N0MA 3UAEA 1PZAA 2EIMB 2HRHA 1W6LA 3GXUB 2YAFA 3ABKB 3NJNA 4YSUA 3FT0A 1OCRB 2VW4A 1NDTA 1JZIA 1A65A 1ADWA 1R1CA 4G71B 4NERA 1EHKB 2W8CA 4YVUA 1E30A 2EILB 2HLEB 3C75A 1OCCB 2QPDB 2WO3B 4KOBA 2CBPA 3PAVA 3PCYA 3X1EA 1SJMA 4DP1X 3NP3A 3QPKA 1BQRA 5D4IA 2MRYA 5E9NA 3X1FA 3ASOB 1OE1A 3AY2A 3FPXA 2FT6A 3S3CB 2XVBA 3CVCA 3NSDA 4Q8BA 5B1JC 2H47C 1CYWA 2X88A 1BYOA 4CSZA 3WIAA 3ZBMA 1SHWA 5B7EA 4HCIA 3AG4B 1OE3A 1NPNA 1JVLA 2GIMA 4AKPA 3ABGA 3PAUA 1NTDA 2IWFA 3CZUB 4UANA 4YSPA 7PAZA 2VW6A 4F7KA 2PP7A 3FQYA 1QNIA 4BDVA 4E9WA 3S8GB 2YAHA 5I6PA 2BWDA 5I5MA 1L9SA 2B08A 4X4KA 1DZ0A 3T6VA 3X1NA 1PF3A 1L9OA 1KV7A 4A68A 3WI9A 2BP8A 1PNDA 3N2JA 1ET5A 3FYEB 1KBWA 1NIEA 3PXLA 3OQRA 1ZIAA 2IH9A 1N70A 4GYBA 1WS7A 2YXWA 3BVDB 1PZBA 1TEFA 5PAZA 1NWOA 2HX8A 5I28A 1MZZA 2PCFA 4YVNA 4E9QA 2OCCB 3NJHA 1W6WA 3ABMB 2YAOA 2DWSA 1ILUA 3DKHA 4BXSV 2BZCA 1AIZA 4NB7A 4K9JA 5I5JA 3AG2B 4PCYA 1WA0X 4A2HA 4P5RA 3CDZB 1HFUA 1FWXA 3WKQA 1OV8A 2YAQA 3GDCA 3WKPA 3EF4A 1KYAA 1AZRA 2BW5A 2R7EA 2A3TA 1TKWA 2I7SA 2Q5BA 4ZK8A 3PPSA 4BWWA 3U25A 4A2DA 3EH5B 3H4FA 4TXVB 4GP4B 5I6NA 2DYSB 3TASA 3H4HA 5FC9A 3SBRA 1AG0A 4HCFA 1AANA 1NIAA 1JZGA 3OD3A 1WA1X 3GYRA 1RKRA 1NIFA 3WNJA 2AANA 2OV0A 5B1AB 2GC7C 4GP5B 1JZEA 3V9EA 4G70B 2IH8A 4YL4A 2UXVA 4EF3A 4BK5C 3ERXA 5D4HA 5TK2A 4DP0X 1E5YA 1ZDQA 3V9CA 4DP7X 1I53A 1V55B 1IC0A 6PAZA 3S8FB 2GSMB 1JXGA 4Q89A 4UF7C 1ET8A 5I6LA 1OE2A 2Q9OA 1ZIBA 2UX6A 3QJUB 1PNCA 2FTAA 1JZJA 1BQKA 3TBCA 1GS6X 4KNSA 4W1TA 3UABA 2YXVA 3IE9A 5D4JA 1GR7A 1L9TA 5I5IA 1V54B 2IDSA 1RZQA 2TSBA 2AVFA 4KO5A 2PPDA 2H5UA 1ID2A 1J9TA 2EIJB 3FQ1A 4BDVB 2YARA 1GS7A 4L0PB 2DY2A 2FT7A 1NICA 2YAMA 2DYRB 2CJ3A 1PAZA 1M56B 1QLEB 2GI0A 1YLBB 2GBAA 2AZAA 3FPYA 3T71A 3NJLA 1AS8A 3UADA 3SBQA 2XX1A 3EH4B 2Y69B 4E9XA 2PPCA 3QJSB 5I6MA 4KNTA 3FQ2A 3MBWB 1AG6A 2FQFA 1CYXA 4RH4A 2Y1AA 1SDDB 1NPJA 3MX0B 1A3ZA 3FYIB 3X1BA 3S3DB 3ZDWA 4HALA 4ENZA 4YSTA 1E5ZA 4JHVA 1XB6A 1T5KA 4DP2X 1SDDA 1AZNA 2ZONA 2R7EB 3NYKA 3QJVB 1MG3C 4YSDA 2BO0A 3SBPA 2UX7A 2CCWA 9PCYA 3PLYA 2XV0A 2QT6A 4HAKA 1NINA 3ZIYA 4AZUA 2FQDA 4YSCA 3AG3B 2HX9A 2RACA 4GXFA 1MZYA 1PLCA 4A2GA 3NSCA 3EH3B 1OF0A 3X2QB 5I6KA 1SFHA 4BXVA 2HX7A 1AQ8A 2P80A 4AI7A 1AZCA 4BWUA 1TU2A 3NP4A 2PP9A 2UXTA 3OMIB 5IY5B 4AKOA 2GB2A 2VM4A 1N68A 2XXFA 1IBYA 5A7EA 2P80D 4QLWA 1V10A 3AZUA 4W9ZA 1BXUA 4CSPA 1NZRA 4YSSA 4A2FA 2XYBA 1J5DA 1URIA 5ANHA 1KCWA 3IBOA 2IDTA 1GY1A 1NWPA 1OOWA 2BP0A 4G7QB 5AZUA 1KDIA 2BWIA 1BXVA 1PY0A 2EINB 1IKOP 4DPBX 1GY2A 4YSAA 5PCYA 3X1GA 3G5WA 3EHBB 2AFNA 4NAJA 5B1BB 2BW4A 1FA4A 1PLBA 2X87A 1A4BA 1MG2C 3OMNB 4HCGA 1VLXA 2XXGA 3NSYA 3QJQB 3D12B 3CVBA 3IN0A 1MDAA 2CALA 4G7RB 2J5WA 3S3BB 2YAPA 4DP5X 1AACA 2I7OA 4KO6A 1AAJA 5I26A 1ET7A 1OCZB 2IWKA 4KOCA 4JKNA 2EIKB 1J5CA 1IBZA 2BP8B 3FSAA 2PP8A 1DYZA 1RCYA 3OMAB 5F7BA 2W88A 5B7MA 2AZUA 1ILSA 1CURA 3JT2A 3T6ZA 1M57B 2XLLA 3QJTB
chains in the Genus database with same CATH superfamily
3KR3H 2E9GA 1E7VA 4NO0A 1UOKA 2I85A 5E2WL 1CDJA 2NX5D 4R7DA 3QEHB 2X6UA 1B2WL 2W0KA 3WNNA 3LJ3A 2LT9A 2R69H 4KMLB 1E3XA 3OM3B 4KH9A 2Y1YA 2WWOA 3GHBL 1R33A 4MJJA 3S34H 5CGYD 3QI9D 1YEKH 5T1KA 1NL0H 1R3IH 4Y19B 1FJ1B 2YZ8A 2FHFA 3QCTL 5EBWA 2O4EA 4R4BA 2Q76A 1JK9A 3P4OB 1GYAA 3OJ2C 3TC9A 1HCZA 1IC4H 3HAEH 3CN2A 5F6IB 3C60D 5DWUH 2FX9H 4PJAA 3FS9A 3IAPA 1EAQA 3GMRB 4N28A 1TJGH 5DQJA 2HKAA 5T3ZH 5JHLH 4K3EL 3PWJA 1WUNT 3IPEA 4ZFFB 4KJYA 4P57A 2BRRL 4GSRA 4Y1AA 3CDCA 3FONA 3TBTB 3QORA 1HC1A 5I76A 2ZWZA 5MEQA 1HXYA 2PABA 5AENA 4NS0A 2ZOTA 3UC0H 1UA3A 3ASNB 4KY1L 4AYFB 3C6LA 2WLMA 1AGEB 3VW3H 5GHWH 4FLQA 5L2JB 5EUOF 3CSFA 4X5LA 3Q43A 3WS3B 5E08H 3DGCR 3M86A 4LSRH 1OGTB 3O8XA 4ZTPH 1J48A 2VLMD 1S7XB 4DAGL 2A77L 4ZMXA 3BN9C 4M1DL 2VDQB 3PFQA 3RB5A 5F6HI 1HHJA 2X6VA 2TAAA 1T5XB 2ZJSH 2Y06L 1FAIL 1PU0A 1SLXA 3OJDB 1HH9A 4OBRA 4X6FA 1WWBX 5TTRA 1DJSA 2OXGB 4HZ1A 1HNFA 2XU9A 5FXCH 3V0EA 3BP6B 4RNRB 4L5FH 5LCVH 3BH9B 2P9RA 1OLLA 4POYA 3SKOA 3PWVA 1OGAB 3HG1D 2Z0BA 2X1PA 3LSOB 3D85B 5SWSD 3AQYA 3L17A 3L5HA 1BAWA 2XTJB 4YE4L 4HFUH 4RX4A 4R90H 5IW1B 1I7ZB 2EEXA 4YXHL 4TSAL 1LO4L 1D5XA 4MGXA 3HB3B 4N3UA 3ZE1F 1DSWA 2HLFC 3PHAA 1YPZA 5SWZE 4P59H 2YLHA 1JZ2A 4NYLB 3GI8L 3NSJA 5T1LB 5HPMA 1YY9D 3PGDA 4GRWB 4RZCB 1IGYB 5JO5B 4XPGH 3RKDC 1A7QL 2EDXA 1EHLH 4PRDB 2E8ZA 2D7TH 3BE1L 1AD9B 3MJ7A 5KSAC 2DF3A 1D7BA 4FFZA 3AM8A 1XCWA 2AXWA 4Z0BL 4HFUL 4DK3A 4HJEA 3GLDA 3HG1E 4IKIA 3GRWL 4Y5XA 1QSFE 4AEEA 1GRWA 4Z7VE 2GHZA 2HN7A 5KYXB 1BF2A 4WW2B 4X80L 2CIIA 2DWEA 5HDBB 4JN2A 5F9JB 2EECA 3V2AR 4ZRGA 3W5MA 1PZCA 4JE0A 4M5ZL 3DJSA 1G7JA 2C4FU 1B4RA 2XNAA 4UM9D 4GNKB 3VWKA 1MFCH 4AK1A 5LUMA 3PGCA 4Q6IB 4X6BA 1UWYA 4Z0BH 5HYSA 2WWMC 1U8IA 1ZSDB 2FJUB 4HWBA 5C0BE 2X4UB 4AM0B 5FO8A 1CFNB 1S7SB 3WKNA 2CLVB 4HH9B 2N0MA 4P3DA 1U21A 3C60C 2HRHA 4YLCA 2KLSA 3H55A 2E7LA 4LSPL 2RIKA 5J9PB 3RIFF 2VJ8A 3IJYB 2IVFC 3B9KB 1KB5H 5CP3A 4OUOA 3HG0A 3WKYA 4F92B 2EDOA 3BUDA 1D5RA 3Q7JA 3I9AA 3UAJC 4XN1A 5D7LE 2ZCKH 4ELKA 2EE9A 3DROA 4QNPE 4RESB 2HFEB 2WSKA 4WO0A 4B9IA 5EV7A 1CFMA 4XBEL 2E74C 1E8ZA 2RHEA 5IHZB 4LAQL 3IJEB 2DQ6A 3D39D 4XHJD 4K94L 3IDGA 2GJJA 3ECBB 4QHNA 2X89D 4TLSA 1RULH 4HLZG 5C0CE 3GHEH 5IHUL 4ZMAT 3KHOA 4OJAA 4Z7QB 1DUZB 3ZBMA 3MLRH 3H3PH 4HCIA 3WTXA 1CIUA 3VW3L 1NPNA 2IAND 1ZEAL 3BP7A 3QA3B 1DBJH 4G6ML 3HG2A 3ARFC 4CMMB 3IDNA 2VW6A 3JZYA 4G9FE 5E2UH 4MAYB 2ALWA 5HHOA 5ESQA 2ZG1A 2R1XB 1H6UA 1QNIA 2CO6B 4J28A 4OKVA 3POCA 5DGRA 5F3FA 5GRYA 3UBXG 4D2NA 4E9WA 3PQYD 4Z3IA 4XXCA 3K6FA 4XE0A 3TYFB 1G43A 1R5WB 4UOJA 4UDUB 4LDEB 1T03H 3CQQA 4NI3A 4PWHA 1KV7A 3MJGX 4XMKH 5E4EB 3WI9A 1RI8A 1KV3A 1NIEA 3FYEB 5A2CA 4NP4L 3HRPA 4XR8C 5G4NA 4XC1L 5E6SB 2OW7A 1KIPA 5JHLL 4G8EA 3KM1A 1OSZB 3RX5A 1AQDA 2DWEB 1WGOA 3D2TA 4RMVA 3ZDYB 5C8JB 3WE6A 2BY3A 3QFJB 2P3YA 3BJLA 2BNRB 4KAQH 3ET9F 4YHLH 1JGUL 1S9XA 1D6VL 1TSHA 5J1AB 1A47A 3EAKA 2XNAB 3ARUA 4M7KH 4PJ5E 2YD5A 5EOTB 5ISZD 1HCFX 1JV2A 2PW1A 2AEPH 3HPLB 3B9AA 1RK7A 3MU3A 5FO8B 4KK9C 1JXKA 3EF4A 1KYAA 4XBMA 2EYRA 5DHYB 3UYPA 4K5PA 1L0PA 5AW9B 4NZUH 3DTXB 2ICEB 5E8OB 3RVUD 1WISA 3NESA 3CZFB 3WNOA 4GP4B 1KG0B 3I6LE 1M2VA 4MXVE 1YC8A 4W6XB 5J6HA 5DJZB 2VXQL 2N1TE 1DL7L 3QQ3A 1CR9L 4V11A 5GPRA 3BPOB 1LNUB 3O45A 1WJ3A 3S0PA 1SJEB 3O4LE 4EI5C 3F12B 2JJUA 3I85A 5TE7L 2BSSA 3EFOB 4PRPB 1UM6L 4KRPC 5EC2A 1G4MA 1I1YA 2X1WL 3FO1B 4DWHA 1RJCA 4DKDC 2YRBA 4OAWA 1IJ9A 3QEUA 4UWQB 3MV8A 4DP0X 1MFEH 2OL3L 2EC9U 4AMWA 4S1SL 3UAJA 5JW4N 2QJDA 3FQWA 4OLVL 4BZ2H 2GSMB 2BCMA 3FRUB 4H20H 5CZVH 4IQHA 4Q89A 2R8SL 3T3ME 2NXZD 1JV5A 4DN4L 1OE2A 1LMIA 4RA3A 3CUPA 1ZHLB 1IKNC 1EH9A 2LU5A 1GZQA 2DQFB 4H4NA 1GGTA 5E1GA 1F4YH 2NR6A 2DKSA 3LRSA 4FNLH 1L9MA 3NIGB 3MCKB 1QASA 4GBXD 1UGNA 2WOBA 3VJ6B 4GQ9L 4I7ZC 2EDBA 5HY9A 2PXYB 2DKMA 2XTLA 3FQXB 4N8VG 4JL1A 1D2PA 5FUOH 3B56A 3OV6A 1NICA 4HPOH 2Z8RA 3UXFA 2UWEB 4KHXL 1CG9A 2VXVL 3GEFA 1GZHC 4ODXB 3LRGA 2IANB 4XCNA 1F4WL 2BCKB 5M94B 1JK8B 1OTTC 3PYCA 5E4AA 4GUPA 3E8UH 2AJVH 1IT9L 4HPYL 5LN4A 5HD8C 1AR1C 1TVDA 4P2OB 1CT8A 1I9RH 3L3OA 4ZDHA 3W0WE 2GUOB 1SDDB 3P9WB 4MB4A 2CBQA 2J4WL 2NY2D 1WLHA 2ZUWA 4XPHH 4YSTA 3Q8EA 3SN6N 4J3UA 1PBYA 1DVFA 2C9PA 1CXLA 3MC0A 4AH2B 4FEMA 3QDJB 5E6UB 1Z6JT 4DN3H 4DKAA 2E7HA 1WO2A 2BO0A 3C08L 3A6BL 4FXKA 4FFVC 1Q0XL 3SEPA 4YIQA 2OMWB 1BZDA 4DVBB 1KCSL 3ZIYA 3LQMA 2AVGA 4I9XA 2IALA 5D1XB 4YSCA 2HYMA 3AG3B 4YZWA 5L2KD 2AI0L 1AZZC 1U95A 1XTMA 2LLGA 2J5LC 4M3KB 5FF6A 1IGIL 3MJ8B 2CSPA 1HH9B 2HP4A 1U3JA 3OZLA 5AVTB 2MPAL 3X2QB 5D7IE 1ZHNB 4NN7C 3IVKB 5I9QC 1TFHA 3DUUA 4N90D 5JHDB 3MKKA 3TPUB 1RJZA 4JDVB 4P9MH 4XZUA 2EXYD 2VN6A 2ZP9A 1PG7X 1L9NA 1N68A 1SBSH 3X11A 2L7QA 1QFPA 3X17A 2N3JA 4OY9A 5JQ6L 3RIKA 1NAKL 1QR1B 4NQXB 2DD8H 3WS3A 1SBBA 5AAWC 5D55A 5HJ3B 3ILDA 3D51A 3VD7A 3C2AL 4LCVA 4LLYA 3MN8A 3EDFA 1MOEA 2R1XA 3HAEB 1IGFH 1RPQA 4JBSA 4LCYB 2NDGA 2EIBA 1TPXC 3IDMB 4E41D 2AP2A 2YD8A 4HKXA 3QXWA 3UG3A 4MD5B 1K8IB 2BWIA 4P9ML 4TUJB 1MCEA 2AV1A 4HD9A 2VDMB 1ZK9A 2Y7MA 5INCB 4EBQH 1CLYH 1IKOP 3GXNA 2XJKA 1SBSL 5FR3A 3OKLB 4XO5A 3NFNA 3TEZA 1ZKAA 4HBQA 1QFHA 2I5YH 3QDJE 4M4PA 4AGLA 4GBXA 4AW4A 3O0RL 4GXUM 4O2FB 1JPST 1VLXA 4L29A 5DRNB 2HSIA 1G9ML 5LBSA 3NIDB 1AQDB 4M6ML 3VWJC 4HXAL 2Q10A 3L5IA 2BOBA 5FYJU 2B2XH 3MREA 4NZRL 5IQOA 4ODXA 1LEGA 1T1YA 4DO5A 3NCBB 2D9CA 3B5TA 3GT6A 4Y7OC 2CKBL 3FZUC 1IVLA 3KH4A 3BQUC 4NKIH 4KZCA 3SIKA 3MROA 2VQUA 4P0DA 3WELA 4FQ1L 4KROB 2VMCA 4Y9FA 5AD0A 5AW6B 3T1FB 1X5ZA 3ARVA 5E5RB 5AW5B 1KCUL 1FZMB 1JRHI 1P1ZB 2ZCLL 4JRFA 4EIBA 4PP1D 4QXUH 3MLVL 4I5BA 2R2HA 4TQPA 1NC4B 1SY6A 4XB3A 3NACL 2OL3A 1UTDA 4LHUA 3NCWA 2ITDA 1ZLVK 3CBJB 2RA1A 1K4DA 5KTEH 5DVNA 5F44A 3VVWA 1E3ZA 2D0HA 1A8ZA 1A9BA 1BVLA 3PY9A 3O3EB 5JMRA 1DVXA 2XKNA 5CN2A 4W9LC 1LQSR 5MEOA 1M7IB 4HKJB 5FGSA 3MJ8A 2COQA 4GPVA 3ZJAA 4MCYB 1V3JA 3H9SD 3CDYA 1BYNA 1SF3A 4H88H 4I0KA 3M7OA 3TPUA 3CFKA 3CFDA 4Y4HD 5C0NC 2F5AH 3WTVA 1XCQB 5I19L 4JRWA 3MRBB 4QHPA 1EEZA 2OX5B 3CZKA 4NZTL 2QDWA 4IBQA 4JFYA 5SX4H 3GMNB 4EI6B 3IKCA 1HZHL 4P2RA 4MNGE 5D8JL 2D3JA 3EYOB 4DZBA 1FNFA 2E56A 4Y9CA 3D18B 4L8SA 4MQTB 1SN2A 1KACB 3MZGB 1MSPA 1CUOA 5DF0A 3X3GH 5BVJA 4MMYA 2VO8A 1CK0H 3NGBC 5LDUA 1JS4A 3PAZA 4PGJA 2X1OA 1YVLA 4ZUWA 2XA3A 4FXGA 3KLHD 4PLKC 2FQGA 3UAAA 4BGLA 1M71B 1MCLA 2XWZA 4KVNL 2VMJA 4QT5A 2UY6B 1QG3A 2HJKB 3BHBB 2DV6A 4TSCL 4ODTL 4OFIA 3WYRA 2IIJA 3H3KA 2E6JA 1S9WA 1NIBA 4LCWE 5FFOA 5HVFB 1Z9SA 3HE6A 4GG6E 4K7FA 4BUQA 3ARGD 1FO0A 1PEZA 1K3ZA 3LVEA 1OAYH 4PGZA 5AOKA 5HI4D 3RRQA 1G7LA 1TEGA 2XWDA 4XOCA 3OAUH 4OZFB 3QZBA 4RGND 4X8JB 3VXSE 4DOHB 1K8DB 3N5AA 4IBZA 4RGMC 5F93C 4Z23A 1AXSA 2YOAA 3O9WA 4HJJL 5BVPH 3E3QC 4HWBH 1B90A 1T2QL 2XQYA 3OKOB 5E03A 1HQRB 3NJKA 3TVMC 2OMBA 3C09B 1AZUA 4HKBB 3TA4D 3KLQA 2P8PA 4E9RA 2OJZL 3FCTB 2NYYD 4NP9A 1QUPA 5IBTH 4XB7A 1J1XL 3IDGB 5BQDA 5HYEA 1NC2A 3N41F 1I8AA 8FABB 1YMMA 1IGTA 5AAMA 4W9EC 2QTEA 3H3PL 4JO4L 3MV01 2BIIA 4E9TA 4WWID 5E5MA 1OTSD 1TLMA 2WC7A 5EBMA 3AVEA 1TZGL 2IV9A 3VFRB 2EDDA 3NRFA 1XCQA 3OKDB 5ALCL 1R5IB 3QRGL 5A2KH 5C0IB 5IFJA 1BM7A 1TJIL 2J2ZB 1OF2B 5C9JA 2YGOA 4I9WD 4RGNC 5INCA 3UGEA 3BCDA 3UPCA 3CUPB 2FZ3B 1HWHB 1KGIA 1NEUA 2JXMA 5K9QG 3TU6A 2FO4A 4AG4H 3H9SA 2G9KA 2Y06H 3LY6A 5DD3L 4YSOA 5F0MB 5JQIB 3APFA 2PPFA 3VFTB 2IV8A 2J6EL 1FE8L 4HHAB 1DBBL 3WO4C 3RDTB 4MXVF 4NSKB 3ARTA 3LQZB 4P2RE 4QWWD 3KPSB 3ZE0F 3MSPA 2XA8L 1AGCB 2IMMA 5C0BB 1WSST 2BNRA 4FNQA 3T2OA 3INUH 2AK4D 4GRLC 1LDPH 1OK8A 4WENB 1KXVC 1LK2A 2FWSA 3FB7B 4NERA 4WI9A 2NY1B 3ZR6A 5EMYA 3SE6A 5MEPA 2IQ9H 2IGFL 3JTTB 3MRLB 3O3DA 4KI5F 4K7PY 3HZKA 2VNCA 1MCSA 3LHPH 5HHVL 5E2UL 1A9VA 5J13B 2V9UA 3RP1A 2VB5A 3FFCD 4XNZC 3TBVB 4MVBD 1ZJBA 3LNGA 1QX1A 3RX7A 1T0NB 4KTDH 4QPEA 3O9WB 3KE0A 2FNBA 3TWYA 3VI3A 4C47A 2BS9A 4JFTA 3S3CB 5JW4Q 1HJBC 2EUXA 3D3VD 3KD4A 5C0ND 1UZ6E 3CBRA 5HDOA 5AVQB 2PXYA 1MY7A 2BVPA 2ORBL 1SHWA 1KNOA 4HLJA 1IBDA 4OLWH 4ADJA 1AO7B 1BAGA 4OZHB 2BHYA 4X80H 4QOKE 2OXHB 3CC1A 3CFTA 4MCMA 3HS0B 1RUAH 2YAHA 3TS8A 4AJ0A 2JQZA 1U58A 5DHVA 1AZVA 5DRZA 2BY1A 5HJGA 3OZ9H 2YQ3A 3ECVA 4OJFL 5HP5A 3BT2L 3KPSE 1X7TA 5TDOB 1XF3B 4ZOAA 1GZQB 3G5VA 5G4OA 4BSWB 4DJMA 1WAAA 2V4LA 1JGVL 2HX8A 4R2GC 4F8TA 4S1QL 5ESVB 4NJAH 4ATTA 3L1OL 2LU4A 1N6UA 2BRRH 1AGDB 3FB5B 5I1JH 5DQ9B 2OJEA 4QRPA 1A7OL 3FT2B 5FA3A 4JFFE 3UBXB 3MNWB 4URTB 3MLUL 1RK1A 1VEOA 3U2SB 4WF7A 4OF8A 2CPUA 2D31B 3LAFA 1XWVA 1HFUA 2MQ3A 3VWJD 3ZHLA 1FWXA 2F54A 2VLLA 3D4ZA 4IRJB 3GDCA 5ICUA 2OKMA 3RB7A 1JE6A 1N6QL 2B39A 3P0VH 5K5YA 1HWGB 4BWWA 3WL9A 2Z1PA 2MCPH 5L7XH 4EEEA 1PX4A 4D8PA 4NQSA 2ADIB 3QUXB 3DXAA 2QFRA 4XAKD 3Q5TA 3HPJA 2VZ3A 3WFHA 1PAMA 3NN8B 4POZD 5C1MB 1WFMA 5DURD 2FJHA 3VXUE 4F58L 3B2DC 3DARA 4XI5D 1TZGH 4QHUB 2H1XA 1XGTA 3SKMB 3KJ6H 3CVHB 1J1OL 2ZT9C 3QFDA 4JZJA 2UZIL 2CDEB 3HNSL 1A64A 3LKRA 3QXAA 2WBJB 1OGPA 3I6GA 1TNNA 3V9CA 5HI5C 1I53A 2YS4A 3V0VB 4NENB 4WUUE 2OR9L 1XR8A 3CQPA 4PB0H 1ET8A 4PQXA 1B0RA 4XMUA 5IBUG 1UZ6F 2Q9OA 3NQKA 5F1IB 1K4DB 3H42H 4PIBA 5KBPA 4OJFH 1JZJA 5J6GB 2B4CL 2VR7A 3M07A 2P5EA 4AC4A 4D8OA 1FE8H 1QBML 5IQNA 1AGFA 3QCUH 4HZLB 5I1GH 4A63A 4G8IB 5I5IA 1BM3L 4WU5B 4FNTA 5IBTL 5IWLA 1UADC 3UYOD 2DWYA 4CW1B 4CADB 3U0PA 2ESVA 3F7KA 3HS0A 5CU9A 4QO1A 1X5GA 1GGUA 3DX1A 1I1AC 2R0WH 4MAZA 3UTTA 2W9DL 3BPOC 3KPLB 4Q9RL 4KI5E 3EIFA 1BW8A 4NJ9H 2A6DA 3OKEB 1UM5L 1RMFL 1SYVB 4ORGB 4Q7DA 4WI7A 2JWYA 4H88L 3CX2A 4Y2OB 1KENH 1YEDA 1AS8A 3B2UD 5IBLD 2F0CA 3BKYL 3SDAA 3T6QC 3B8SA 3UBGA 3CU1A 3WJLC 1ETA1 4QEGA 3GKZA 3VGEA 2Z34A 4IBLT 1MQ8A 4B53A 4KY2A 5KSBB 1A6UH 3WFEL 3U9UB 4GSUA 3T0ED 4ZUTA 1F97A 3DX0A 4Y5VB 3MX0B 1CXIA 1E5ZA 3BI9X 3UBXA 3VO0A 1HXKA 2WUCH 1G7PA 1NAMA 2F53B 4N8VB 2YEQA 5CHNB 4LBAA 5GRVK 1U3HD 1DSYA 5TDPA 1CK0L 1F00I 1KCLA 1IM3B 2EVJA 1WFUA 3VI4A 2BNUB 3NCYP 1Z9LA 1U8OA 3NPSC 4H8WL 3UO1H 3L3KB 2GVYA 4M8QB 4OGXH 1G94A 4AZUA 4R7DB 3FQNB 4GBXC 3QIWA 2PYFB 3U83A 4R7NA 4F3FB 1FNHA 1U8JB 3O4LA 3NA9L 1P9MA 1SOKA 2UYLA 5C0RH 4R97C 2BMKA 1KBKA 1QSEA 5CFAA 3T65A 5EPMB 2FBJH 1VIWA 4NPYA 3DJRA 4WEBL 3U4KA 2GB2A 1V8HA 3EO9H 5IFAH 1HQ4B 2DQJH 3GKWH 3QNFA 5JPMC 3SDDA 2X44D 4LSTL 5D71H 2EXWC 1W72B 4JZJB 1N3NA 1VEMA 4X99B 3LKQA 3D30A 4BQ9A 3OLIA 3ZE1B 4H0LC 3UROR 3ECWA 4QLWA 4X0NA 3I3EA 2BC4B 1KJVB 1DBMH 2K70A 3RGBA 4DEWA 2FD6H 4HJUA 3DX8A 4TLUA 2ARWA 4MSWA 4X8GA 3IGKA 5C08A 25C8H 1P4BH 4LEOA 4TPRH 2XQBH 2IDTA 4ETYA 5F89A 2RAMA 2F8OA 3FTWA 3VSTA 1AI1H 2AEQL 4PWFA 3ARBB 4XVOA 5D7LD 1GAFH 2K3TA 3LEXB 2EDEA 1S7WB 2R15A 1LVEA 2ICWJ 5EB9A 4CNIB 4NQDB 3KPRD 3EHBB 2DD8L 2BW4A 1E9PB 1PLGH 3K5RA 2CHDA 3QUXD 1QZNA 3QJQB 1DJZA 4HWEL 4IBUA 4IKNA 2CALA 4U4BA 4LHUB 3V55A 5IJBC 1HTYA 1XZWA 4X5WB 4FFYL 5C0BD 3S5ZA 3WJMB 5IT2L 4F8QA 1Q72H 2R4SH 3QDGD 2X4NA 4XB8A 3IF1A 2EAEA 4PS3A 5C07B 2KYIA 1DTUA 4I89A 1CIDA 2FGZA 2V9TA 2BLFA 4LMQI 4RMUA 4OV5B 1C08A 2NY6B 4NRZA 3JV4A 1SVZA 2GTZB 3DMMC 2OQJA 1HXMA 4LOUD 4WI0A 3DURB 4YXLH 4QT5B 4W70A 4HIXL 4PJFE 5FX3A 2PR4L 3IFNL 3X12B 1O6SA 3SDXE 2HMID 1VDGA 1U8CA 1J0JA 4NHUB 3T6XA 1BDYA 1MCWM 1JWMB 2WBKA 1NGQH 2GPZA 3IJ7A 3T2NL 3BGFC 1J0YA 1T3FB 2WGNB 4RRPG 5JW5A 4GMTL 3NJMA 4JVPA 4AKQA 1P7KA 2DYPA 5T1MA 1KGYE 2Z31B 1NUDA 2F1EA 1NJ9B 5D7IB 1AOZA 4NX0A 1J5OL 2V2TA 3VG0H 5A40E 1FGNL 1WCQA 3LH9A 3VWJB 1YEHL 1WHPA 1GSKA 3WNLA 2P1YA 5AVSB 2F7RA 3ARFD 5ADOL 1KCUH 3O6MH 3SDCA 3OR7A 5D1XE 5C9JB 4CSSA 1MQKH 1TQWA 1RFDL 3STZA 1NAMH 4NBZB 4ONGL 1YEIL 4XWOC 5EPMA 4ADGA 3WCYA 1YUKB 2HJKA 1QI3A 2JKSA 3IDXL 4MXWL 3KYKL 3RX8A 2ZXWB 1YYMH 2LTQC 2DLFH 2ED8A 1GGIH 2YOCA 3T1WA 4LNRB 2W0FB 3QIUC 2ITCA 3MUGA 4N2IA 4B3EA 4BIKA 2ZYSA 2NLJB 4HUVB 2R56H 3GIVA 1DCLA 1I8LC 2MTAA 3CG8A 3MKGA 3DWTA 3N44F 3LRKA 1Q1JH 4AW7A 2D2OA 1R3HB 1XGUB 1QBBA 1T21B 1SYSB 4I4WA 1RFDH 3FB7A 1RK0A 1XGZA 1QVOA 2G2NA 4KX8A 4O9HH 3U1QA 1EJ6A 1ZSHA 2MOGA 1O5DT 3AS0A 3VGGA 2P8LB 1KCSH 4X6BB 4X6DE 1XEUA 1UOLA 1ASPA 3FTSA 3K2KA 1OARH 2DTSA 3JTBA 2UWEE 1FN4A 1M2OA 1NEZG 2Y7QB 1L6XA 1UJTA 3LN5A 1MHHB 4IRZA 3ZDXF 3ESVF 1IBGL 1H9DA 3EYUH 5AG9A 1CE6B 2V17H 2YKKA 2X4TB 2BSBA 5GGTL 1N7MH 2NW2B 2XX0A 2ZCHH 5EU4B 4E9YA 4QHMA 5D7JA 2XCMC 32C2B 2PPAA 1UH4A 5EO9B 3KYOA 1IC7H 4AIZA 4ELDA 2E76C 4NRYA 4PRHA 5C7ZA 3TVMD 1AQHA 4J4PC 5G5DA 3MTRA 2EC8A 2Z7WA 1BEXA 2OS7A 1T22B 1HI6A 5E5MB 1A2YA 1BZ9B 5D1QD 1HSBB 1E67A 5TE6L 1M6UA 2ENSA 3CVDA 4G11A 6PCYA 1BXAA 4E9LA 2OR8A 3MFGB 3AS3A 3CK0L 2JNZA 5AOZA 1Z66A 1H6EA 2DRUA 5FK9A 2YQGA 1JVOA 4JL2A 1WS8A 5CZXD 1WFIA 1I9JL 1SFDA 4JDZB 2HFFA 3CN1A 3IDXH 2XV3A 2XWTA 5KVDL 4KX9A 2AQSA 2WJ5A 1CN4A 3SKJL 3ULUE 2FATH 1KXVA 4N0CC 4EZLA 4L8CA 2G30A 1F18A 3UGUA 3LEVL 5IESL 1KBVA 4ETQB 3QFDB 5KOMC 3ZL1A 2WSDA 3E1ZA 1UB6B 4XNUH 2H1PH 1FYTE 1EZLA 3FRUA 4XRCB 5DHVH 3F6JA 4P23B 3QDMD 4N2AA 2C1PA 3BKJL 4UYQA 1RUKL 2C1OA 2ZOKB 5K59E 1NFDE 4GI9A 1I9RL 4Z7UE 4PJ5B 3WFEH 4HUVA 1QFWL 4PJGA 3W39B 1PMYA 3EBAA 4QXTA 4XNMB 1B3IA 4BH8B 4ZW7A 2XVKA 5I73C 2WZ0A 1PD1A 4YNYA 4PJ9C 5FOJA 5C8JA 3QFJE 5D5ME 5JHBA 4GMSH 1DSFH 4C56B 1F6LL 2CLVA 4HH9A 3K6NA 1ZHBA 3PV6A 3EFDL 3GMPA 2I9TB 2A5UA 2FT8A 3IFLH 1HN1A 3OXSA 4XP6L 5ID0B 3WDIA 4HKZB 2PMZA 2AXJA 1HCYA 2XQYG 3KWVA 1CE1L 4MNQE 2H6PA 4XCNB 3MUJA 2P52A 5F7HA 3GIZH 4PMEA 1OCRB 2VTFA 5EA0L 1D6VH 1JZIA 5GJSL 3GXPA 4ILDA 4WI6A 4G71B 1G1YA 1JPFB 3QUYB 5HYIA 4LF3B 4ZD3H 2A4CA 3GS0A 4W4NA 3VSUA 3NA9H 1B9ZA 3SDAB 4YHML 4NO0D 1H6TA 1LD9B 3VXMD 1Q72L 3CXDH 2Z6FA 1XF2A 2V33A 2QR0A 4OSUH 4QYAA 2XTJD 2OTUB 2D31A 3QZOA 5IVNA 4X4YA 4M1CC 2BNRD 5FAAA 4KV5F 1AGBB 1EQWA 4QHMB 5D7JB 3VGDA 5EOCH 1VENA 5KN5B 1GPOL 5DHDA 3MV9E 5D4IA 1QHOA 1MCDA 2WQSA 2Q87A 3CU7A 5ECJE 4GI8A 2EH8H 4PRPA 4QRTB 3X1FA 4JO1L 4AUUA 5EEZA 3U9WA 3FPXA 4JUSA 7FABH 1CR9H 3MBXL 4JFEB 3VB9A 4KJWD 1R4XA 4NUPA 5KOVC 2BZDA 4FFZL 1AI1L 4FMKA 4LVHB 4V33A 3RWHB 1U95B 5BV7B 3VWJA 1OAUH 2COVD 2ZTBA 3CFBB 1SXCA 3KBEA 1BD2A 2EDNA 4K5MA 4LLMA 2UZIH 3QNXA 4DESA 3TNNB 4Z3FA 4OD1H 2WINA 1JGEB 4AQAA 4ODUB 3T0DA 3KYAA 4AT6A 1IFGA 1MJ8L 1JGUH 2M26A 1JHKH 1SDYA 1OAZH 1JUFA 3GD1C 4M5ZH 4HUKB 4J3OC 1Q9LB 4ENEC 3A4EA 5IR1B 1F3DJ 1HQ4A 3LS5L 1KCRL 2B4CH 4JRYE 1DO5A 4N0UA 4B7IA 1MHEB 1YYLL 2PYEE 5EDSA 4JM2B 2OMZB 3TT1H 4ZX6A 1LMKA 3V4PH 3B1UA 3L9EA 5I1IH 4X4ME 5HHPA 5JIDA 1DQVA 1YN6B 1MZZA 3IDMA 3MGAA 4M6AA 1SYSA 1IAIM 1RZIB 5CD3A 5LWYH 2I32A 3RZCB 3O6KL 4LP4A 5ILTH 2EDQA 1FLRH 4YDLB 4HDIA 4W81A 3VU1A 2EO9A 1J7VR 5IG7B 1XGTB 3SKMA 2DWSA 2YQ2A 4P2AA 2VDRL 4GSDL 4W9CC 5F3HB 5KS9F 4Z95H 4IHBA 1OB1B 5HDBE 2L7JA 1JN6A 4LLAA 3V0GA 2KKQA 2EXYC 1BZEA 2QKSA 2Z7UA 3ELAT 1E9PA 1QSFB 3VH8B 1G0DA 3DOIA 4WU7B 3L1OH 4ES8A 4HX1B 4W93A 5AW8B 3CCHA 3JWDH 4RFEA 1FI8C 3BLKA 1FNSH 2BSDA 3U0WL 4E42B 1F90L 5EU4A 5EN2A 4OU3A 3ESUF 5DO2C 3OKYA 5JIMA 1CFQA 4HC1H 4GRWE 4EN3B 1ZS8A 3ILPB 3P54A 3NZ8A 2IXQA 3L6FB 4YBHA 4PREB 2DLEA 2PETA 2AJZB 4HZAA 2J1WA 4FXKB 2JI1A 3PP3H 1MLBA 5A6MA 5JW4R 5IF0B 3T0AA 5I66B 4FQCH 1XF4B 2IH1B 2MOVA 3BWZA 5CP7B 5I0ZA 2RJMA 5L7XL 2WN2A 4JQIH 2E7MA 3LB6D 4OM1H 4NAQA 1INDL 1QWUA 1OGAE 1WBXB 4YQXH 5KEZA 3QO1B 1AHWA 4J6RL 4X98A 1NGWA 5T8IA 3TFKC 2YKLH 5EUKA 4X8CA 2H41A 4JZOB 2OYPA 2F08A 1CZ8L 4WFGD 4Y5VA 1PY4A 5C3LD 1W72H 1FVEB 2SEBA 3SDDB 1DE4B 3O41A 3WIIL 3GZPA 1NUFA 4PMFA 3FQ4A 5GJTH 3FQ1A 2ICWB 2YARA 3CFDB 2CHZA 3PHSA 1VESA 3P2DA 5FYKD 1SGKA 3TEUA 3S8WA 3HAEA 3L54A 5KVMC 4CVWA 5I15H 3NABL 1UCBL 4Y5YB 5JOFA 3O4LD 4IBTA 2GI0A 5DJ8B 5I1HL 4LEEA 1SHSA 1O6TA 3FPYA 3S4SA 3L4UA 1LP9E 3X12A 4YBLB 3TVMA 1N6VA 2O5XL 5IQ7L 5CLZA 5F96H 3F01A 2X0VA 5BS0B 5IROD 2VXQA 4Z3HA 3MRQA 3L1FA 1R3HA 1XGUA 2VMEA 1W0WB 4PCTA 2UYLB 2CHXA 3HFML 4LASH 4QJ5B 3U0WH 3MLTA 2R29L 5K9KB 4TULH 2R0ZH 2VLJA 3GSWB 3KCPA 4JFQA 1WCBB 2YD1A 3HW7A 2WIIA 3QQ9D 4TMPA 4J3SA 4N6QA 1OD7A 2VKWA 3V5KA 4OLWL 1T5KA 4N0RA 4E41A 4PJ5D 4ENED 1UJ3B 2R83A 1A3RH 4KHTL 5TD4A 3HCVB 3DX7B 4A7UA 1NINA 1XH0A 2EVGA 4L2LA 2F58H 4Z78A 1DQTA 1TQSA 1PPIA 2NY1D 4BK8A 2HT3C 2RACA 5I1AA 4K3JL 4RA0C 4WI8A 4Y19E 2X4TA 3O2VH 1G0YR 4YAQB 5EIQA 1O6SB 1TUPA 2KZ1B 3QORC 5IK3A 4BWUA 3RL1B 4NBXB 2OFQA 1JAEA 4AQOA 4KGLA 2AJZA 1MF2L 3BUYA 3VFVB 4TNGA 2VLRA 1JZ7A 2OR7A 3CV5A 4O2EA 1Z9NA 1TT6A 3GHBH 3Q2NA 3MRGA 4L3FA 2WXIA 4HKJA 4UV7L 4EN2A 1NZRA 5F7YC 1IEAA 4KQ4L 5D72H 2HPTA 3ZDZF 5KZCB 1F8TH 1NBVH 2C4XA 3QZLA 1OAQL 3RVVD 2ZCZA 1PSKH 1NWPA 1OOWA 3LX9A 3H85A 4R2GD 1KFGA 3TBSB 4D7PA 4S0SD 1TQCC 3DOHA 4G8FA 1K2DA 3NPSB 5J1TC 1PY0A 1NC2B 4UM9B 8FABA 1XTLA 4QRAA 1CFTB 3NCEB 3P30L 1MRCH 2WM0A 4TN9A 2ATKA 4PBVC 3IPBA 2JIXD 4KKBC 1NQBA 3QRFM 2W80C 5C6TH 2P44B 2VISA 2XOTA 4W9FC 3VGAC 1DFXA 3N42B 2BOCA 1FVDB 2D0GA 1SVBA 4P05A 1NOLA 2KLRA 3H9HB 2W92A 3KXFA 1KJ2L 4IRJD 2XC8A 4H1LG 1QHPA 3H2PA 5JPMB 3OKNA 1KBBA 1ACCA 3OJDA 4DHLA 2BJML 3WKML 3LIZA 4YEFA 1VACA 3OX8B 4JG0H 4M93C 5I17B 5DSCB 5F7BA 3ZMEA 5AD0B 2GHWB 3EZJB 1QR4A 3ZYZA 4GQPH 4XPTH 3LH2H 1R3IL 4LPTA 3K1KC 1R75A 2BFVH 4LRIA 1IJNA 5SV4A 2XLLA 3EO0A 1UT2A 4PH8A 1RZPA 1NA8A 1FO0B 1RIUH 5DQDH 1DEEB 1A9EA 3I2CH 4EQ2A 3LN9A 3G5YA 1UKTA 4LL9A 4EJ1C 2J55A 2NW2A 1L4IA 5I19H 2DWTA 3LXCA 5CMAA 2V2WB 4QDGA 4YHPB 2BVOB 1ZS8B 4NZTH 2WXRA 3Q13A 3VQ1C 3KYNB 1YPZB 2QL1A 2H26B 3BEWA 3QS3A 4I0PB 3OC5A 4TUOA 5D7HA 4N25A 3K72A 4LCCC 5AW1B 2NQDA 2NNXA 3SKNA 4ZAKC 1P4LB 3RYMA 2X2JA 3X13A 4DVRH 1YQVL 4MXQD 1F2QA 1I1CA 1J9QA 2YUWA 3MJ7B 4QGYA 3HC4H 2P8LA 3WOVA 1C12A 4IRZH 2PTTB 2WV3A 3PQYA 2PCFB 1YO4A 4F7CB 1P7QA 4K9EH 2XUWA 4NFDA 2LU7A 1S7TB 2XN1A 4UAHA 4GY4A 4RWYL 5H37A 4F2FA 2NY4B 2VW7A 4TTGA 3QXVA 2N0KA 4D0CA 2YUVA 3A67L 1ETJA 3QQDA 4RIRA 2EACA 3N1MC 1YUHA 3JV0A 3AQXA 1UYWH 3ZHKA 4PGCB 3TEXA 1OSPH 3HBZA 3OKDA 5BZWA 1JTOA 1LWHA 2XT1B 5J89A 2VSMB 2DIEA 5IESH 3J07A 4B5ZA 4Z7OB 1IC4L 5H2BA 2AK1H 2GABA 1KYUA 2B2XL 3MLWL 1I85A 3TO2A 1ZS2A 2X05A 4A2MA 3PL6A 1Y18B 4MCZB 2W0PA 1OF2A 4H13C 3VXME 1KTKE 2FCBA 3O6FB 1CXFA 1YNKL 2CKBA 3UERA 3SE8H 3QB7C 5L4MA 3DJ9A 1I9IL 4LL4A 4EDWH 3LN4B 1XIWD 4ZFOL 3QO0B 2HRPH 1GSMA 2PWGA 3UOAB 3MLVH 3UJIH 2WYTA 5B38A 3BAEH 3P02A 1KLGB 1NC2D 3BMVA 4JFQB 5AZ2H 1AGCA 2NUPB 5DURB 5EEVA 3T9WA 4L8CB 4YC2C 5C0JA 1JHTA 1GTNA 2KZBA 3GS7A 4B0MB 1NGYA 3NCXA 3I9GL 3QNXB 3W5NA 5HHXH 1ZV2A 4U1HB 3CQFA 3OXRA 4O5LL 1LL1A 1DR9A 2P5WA 3CLEH 1LWJA 3MJWA 4W9HC 5AZEL 4DP8X 3LEVH 1VFBA 2Z35A 4JW3A 5LGHL 1WTLA 5AYUL 3ULUF 4OSUL 3VXPA 4NQSB 4HCRH 2MQCA 4P4RB 2QR0B 2IWEA 2WB1A 2ZX9A 3Q3GB 3N85L 4XN7A 2JTDA 3BSZL 4XCFL 2VN7A 5LG6A 2BVOA 4S11A 1P6FA 3J2PA 4LRIC 5EOCJ 2A74A 1MFBL 1UD5A 3D39A 3K5SA 2EE6A 5DJXB 3D0LA 5ACMA 1IUZA 3QXAB 3CH1A 5ID0A 1OQOA 3FW6A 1YQ2A 1BBDL 3R0MA 3WIHA 5A6LA 2P5PA 1R5IA 3OB0K 4NUGL 2NY7H 1CU4H 5EULV 3SODB 2HJFA 4ONOA 4U1JB 4FE9A 4LOVA 3R4RA 3HS8A 3MRCB 1JWUB 2DQGH 3ZXAC 3QPXH 1SNRA 2JCCA 1IRAY 2LLNA 1CC3A 1MFEL 2TRHA 2OL3H 1AGFB 1SY6H 5DRWB 3FUEA 3PUCA 3FHAA 3MA7A 4NN5C 4YN3A 3SDYL 1XBDA 4UTAH 4JDEB 4PRIE 1D6EB 2JV6A 1F2XK 4A2EA 2A1WL 3FO0L 1H19A 3QS2A 2VISB 1J9RA 4NWTL 4MD4B 5ESVA 4B9JA 1F3DH 2APVA 3VE0B 2V3EA 1ID5I 1F42A 3UJTH 1CU4L 4AUYA 4DFIA 1QMUA 4DETA 1RK1B 2XETA 1KN4L 4YSUA 1CGSH 1QPXA 1ACYH 1CL7L 2FEJA 4XBPA 1PJ9A 2DJUA 3FT2A 5FA3B 3ZRCC 4ZFZB 3AJ7A 2A0LC 4B9FA 1IGIH 1S78D 1TR7A 4R96B 3JTTA 3H3BC 2Z8WC 1W15A 5C0FB 5JUEH 2WLYA 4M6MH 1X5AA 1F0LA 2DM4A 1XSIA 1JFQH 3F3HA 4YDKL 4MMZC 5F3HA 4NZRH 4UV4H 2Y6TE 3WMPA 1EGJA 5C7XH 3EO9L 5E94B 1PG7W 3FOMA 1NFDF 2DLFL 4ELME 1JUFB 3PCYA 3LQAC 3G6JB 1HHGB 3KS0H 1G6RA 2FYVA 1UYWL 1UKSA 3ZT7A 3DPBB 1OE1A 3ZMRA 3KDMB 5B22A 2XIBA 4ACPA 1CLOH 3U7YL 5DZAA 2WKGA 4XPHL 4YH6A 4EN3A 2QV2A 1JK9B 1OM3H 4L0YA 3VFOA 4UTAA 5C0DA 1OE3A 2GIMA 4OZHA 1QACA 3V6OA 4OGQC 2L4OA 1MRFL 1PW3A 4L4TA 2AERT 1VHPA 4UOQA 3TFKD 4I87A 1PX3A 2XZCH 1YAIA 3RVTC 3NJXA 1XBRA 4D9QE 1DDHB 1Z3RA 2Z4QB 4ODHH 2X3AA 3QUYC 2P48B 1C5CL 4G82A 1MCWW 2NYKA 3ZTCC 3VVVA 1PZSA 2L04A 4ZTEA 4CVXA 3WGVB 4AJYV 2BHUA 2AEPL 4HXBL 3BAXA 3BAEL 4ZYKA 1WYJA 3CCHB 4RFEB 2RCSH 3JQOB 1F4YL 4QUOA 4FULA 4ZS7L 4FI8A 5K9QI 1JYWA 2R39A 3UZEA 1EZVY 1MAMH 1S3KL 1NEZB 4LSTH 2LLLA 2Y9RT 5HGDB 1T7VA 5DFAA 3LH2L 2DBLH 1FAKT 4X5RA 2IAMD 1T1ZB 3SCMD 3D3VE 1LILA 5JR1L 4Y5YA 1THCA 5I1AB 1AIZA 3TJEL 2IH1A 1G7QB 3D1MC 4FYSA 4W6WB 1MIEL 2QGDA 4F1ZA 4GXVL 4DKFL 3D2UD 4UMSA 43C9B 3FUFA 4R4ND 2Q5BA 4XCEA 1TO4A 2FSEA 4M48L 4URKA 3EF7A 2F6AA 3FCBA 3FQTB 2DYSB 1LE5B 1BJ1H 2VLJB 3GSWA 2OMVA 4HCFA 4BQCA 4BRJA 2L7EA 3TEYA 2X40A 1BD2E 2AK4E 2BVYA 4BFGA 2BVUA 3E6FB 3PWPE 1NFIA 1PQZB 3IFOB 3WNJA 2WO4A 2O61A 4FMFA 3IVKA 3ZVVA 3MFFA 1A3RL 3HIZA 1X5MA 5BZXA 4LVEA 2VDKL 4DKEH 5DEZA 4JKMA 2F68X 2YD9A 3QE5A 1VFBB 5GSVB 3BZ4B 1Q94A 4JKPH 4BK5C 4HLEA 1N8ZA 3AB0C 4GSQA 5F7EL 4NQTA 3ISYA 3CWGA 4U1NA 2OTWA 4APQD 4ELMA 5IREA 1V55B 4HS8H 2XWBA 1XF5B 3MJ9A 3N1PC 3F8UB 4IDLA 1XGPA 4WO4A 3VGBA 4HOXA 1WH0A 4UQDA 3MRPB 3MRNB 1RSFA 3SZKC 1CGTA 4EZKA 5KJ7E 4YDIL 4BEIA 1TO5A 2UX6A 1PNCA 2QSQA 3IDNB 3VRJA 4G8IA 2JQAA 5J3HC 4NI6A 3T0WA 4IU2A 2DYPD 4W1TA 1UD4A 5DO2D 5IZ7A 5D4JA 5GGRB 4M6OL 1MNNA 4IOIA 3SJVD 1HSAB 1PS3A 4MWFA 4FI6A 1U3ZA 4D94A 3Q5OA 5MI0C 3SOBH 1ID2A 4BUHA 4XPGL 5J06A 4TRPH 2OMUA 2QGEA 4EN3C 4Y4FD 3TH2T 2NTFA 5I1LB 4GUPB 3DVGB 2YAMA 3ARXA 4JPQA 4U1LA 2ZCKL 3FT4A 3K8KA 4WK4B 1NCDL 1O75A 2E7LC 3SGDI 1FZOB 4PRIA 1YA5A 3B7TA 3TBSA 5L4FA 2VR6A 4AQEA 1RERA 2PW2B 3MYJB 4HSQA 2GJZA 4KJQC 1ND0B 2V3DA 2JCCE 3HZYB 4FD0A 2NXZC 1S7RB 5JHMA 4HS6B 3O11A 2VIRA 5I16B 3WDHA 3QDJA 1RULL 2JSFA 2L7UA 3L7EA 2NR6D 3IWVA 2WYZA 3S3DB 3EOTH 4NKMB 3FTGB 3PL6B 3VFSB 4LP5A 5IROA 4JGUA 2VMDA 3DROB 2ZONA 3FKUS 1A5FL 4UQEA 1KBPA 2R7EB 5F8QC 5SWZD 4BSVA 2CGZA 4PRAB 5C0FA 4J7RA 2K6YA 4BQ8A 1CGVA 2XZZA 4Z7NE 3RVXD 5AUMA 3APCA 1DQQA 1KG0A 3TA3D 3WD5L 1MCRA 1NMBH 3W82A 4TVUA 2X4QA 2HAZA 2DQEL 3NCMA 4N26A 1BVKB 2HX9A 2HTLC 4Y5YC 4GO8A 4JFXA 2GEQA 4QGTA 1JFHA 1G87A 3GJFA 3MGTB 3T65B 2FJFB 3OC8A 4HVBA 2V2TB 1WVZA 4FG0A 3ATFA 4UTBL 1OZTG 3ARDB 3ZKMD 4Z3EA 1P7KB 2DYPB 2A6JA 3B9KD 3MRDA 2YN3A 4KXZI 4DZ8B 4LKXA 3SDCB 1P5VB 4OI9A 2OBGA 4U7SA 4LHUD 3GTVA 1LO2H 3QI9B 3WFBH 3RNQB 2F58L 4JGMA 3DRQA 2P80D 1U42A 3RWIB 3SGEH 5ILTL 2WN3A 5KVEL 1ZLEA 5SWQA 3BN9D 1EA9C 2WSPA 4GEJA 3RAJL 5ANME 3V0AC 4G7QB 2WUBL 1U92A 4K73A 4XBGA 1UD8A 3MRMA 5J7CC 3MCKA 1KELH 4CNIA 5FM8A 4KXZH 3VD4A 2YXMA 4LNRA 5F96L 1DQDH 3VXUD 5PCYA 5D6DC 2YEZB 1IO4C 4I18A 2AFNA 4J12A 3TCXA 4A7VA 4B95C 2DMGA 1QVOB 1KB9K 4UV7H 3SGEI 3W0WA 4XRCA 3WEXB 3IXAA 3IDUA 2ITFA 2XZAH 2MCMA 5C0JB 4YGAB 1QBLH 1ECYA 5KS9B 2JK5A 4MJID 3Q1SH 4ONFH 1CICB 5DRXB 4EXPX 1RUMH 3AUWB 3IF1B 5C07A 1FN4B 1U8PA 1AAJA 1EFXB 2E4FA 4R8WL 3W39A 1OCZB 1XGYL 1S9YB 2ZXCA 4K3GA 4A6YL 4QMEA 1T6VN 5EZIH 1JGVH 2BP8B 2RQ8A 5GSRA 3KNBA 5JXED 3KPMA 1Z9PA 3L9RA 5DU7A 3DURA 1KOAA 2R51A 1N0XL 5F9DC 3F83A 2V0AA 3W9EB 4TL4A 1F3JB 1GZPB 1VA9A 3K0WA 5B7MA 4PJDF 4BFBD 4ZMWA 2OL3B 4IRSC 1AXSB 4FHKA 4BFKA 2OCJA 4UT7L 3RUGB 3JVGA 5TH2B 3D25A 2ZWSA 5B1KA 2X70B 1JPTH 4WTZG 3B5HA 1JZHA 1ODUA 3KL3A 3CXHJ 2AS5M 1EHXA 3MODL 1TJGL 3U7WH 3VXNA 5KYYB 2VQ1B 2Y36L 3EFOA 2WZPD 2E27H 1T2JA 3V4PA 5CJ8A 3BUQA 5DC0A 5I8EA 4Y4KA 2G3NA 3V5HA 1XB8A 3MV7D 3L95B 4UILL 4HC1L 3NH7L 3D50A 3QIBC 1P1VA 3BZ4A 4S1RH 3U6RA 2E47A 4Q97A 5CIPB 3T2PA 4HT1L 5DS2A 1A3QA 1RZ8B 4JCMA 2WVVB 2ZX6A 2H0PA 4FERA 4G7VL 5DMYA 3Q5YA 1BVNT 1AKJA 4BZ1H 2D03H 5K9OA 3P0GB 3GI8H 4HJGB 4TQ8A 5HGGS 4AZ8B 2CR6A 2YGNA 3LRSB 3MNMA 4LLYB 5EUOE 1MJJA 1WC7B 4TF4A 4IU2B 3KLAB 3O6KH 4GIPD 2J8UE 5KYWB 1ASQA 2PN5A 4JHAL 3E9TA 3QH3B 2MHAA 2CPCA 3MNVA 2C9RA 2Y72A 2GJ6A 3A4DA 1G9HA 1J8HE 4JO4H 3UTZB 5J8OA 5LGJB 1HHKB 2CLRB 2VDRH 4GSDH 4XXWA 4KKQA 5EHFA 1AS6A 3O4OB 2FX9L 4ONHA 1H5BC 2AJSL 1Y0LA 4N5EC 2C9SA 2KT6A 5H4ZA 3A21A 1XGYH 3UEZA 4A6YH 4I48B 3H9SB 4R3SA 4OGYH 3TXAA 2X2HA 2YPLE 3M6DA 5IMKB 3C5XA 4M1GH 1A4KA 3T77A 5DFWH 4QXTB 2VDOL 5BVPL 1RUAL 4GKOA 5E1HB 5FPIA 1NH6A 4PWGA 2PLTA 2QVFB 3V9FA 2HRGA 3MRFA 4OQTH 3QZNA 4Y9BA 5DUPH 4IS6B 2EUZA 5A3ID 5C92A 4NT6B 1FV1B 2HLFD 1J9SA 3IFLL 4MQ7A 2YUXA 4W9DC 4NO5B 1EXGA 2NX5B 4Y7MA 4G1MA 3UMNA 4D3CL 4JDTL 1ECZA 1HH6B 5KUKA 4K8RD 1VCAA 4YUEL 4BFIA 4EE2A 3QUKB 4AM0Q 3EH2A 3MBWA 3V0WL 3TYGL 4PIRF 4GLRI 3QIWD 4PCKA 3SB3A 4X6EA 1IEBA 1F1DA 1A14H 1TYEB 3FH8A 1A1NA 4YDJA 1LYQA 5KN5A 2IC2A 2VITA 1OKEA 4DPAX 1C7TA 4G6KH 2CA4A 4DCQB 2DLHA 1A1MB 5FDWB 5HHNA 2O72A 2YKLL 4GEIA 4XNUL 4RQQB 2ZCHL 5I2IA 2VN5A 4GXVH 3O6FC 2XBDA 4IMLB 3BKJH 2G9HB 4H0GA 3UG4A 1AZBA 3WD5H 3E8VA 2GSGA 4V1DE 1MWOA 3WN5C 5DK0B 5IVOA 1ES0B 3BSGA 2CRZA 5EORL 2UXFA 2FH6A 3HAEG 4QHKI 4ANKA 2VLKB 2G75B 3DK2A 2HKHH 1J05B 4HJ0D 2KDYA 4WFFD 1Q9KB 1X9UA 3VXRE 5IQMA 4OCLC 5GRZA 2AQ1A 3EFDH 5GGQL 5DJ0B 2I26N 4YC2B 2DQTH 1G7QA 4LQ1A 1T1WA 3N40F 4UNIA 3IMBA 4D0DB 2F53D 4XNMA 3L2NA 4JKPL 3MRJB 5A7BA 3CFCL 3LYRA 5HDRA 3RWGA 1UVQA 2TRYA 4XC3L 4BFEA 4PJEE 2VM3A 3FH5A 5L2JA 1VERA 2MCG1 2B0SH 1TQVA 3GEWB 3WHXB 4U1KB 4EN3D 3BQUA 1HHKA 2DQUH 3U46A 5HYJD 1FFTB 5DMGD 1LO3L 4LRNH 1G9NH 4CDHA 5F1NA 1PZAA 2CM5A 3KXFD 1USZA 2B1AH 2FJGB 4YHNA 3JV6A 2O1AA 4RMSA 1K6QL 5KSAB 4OZIA 3L3HA 3FNKA 2YA1A 4JO1H 4U1SB 5LXGL 3HVNA 4OF5A 5G4MA 1SUJA 3JWOL 3MROB 4IHOB 1VFAB 4HS3B 4GAJH 4XGZB 2QVIA 5JR1H 2G0LA 2QPSA 3T04D 1DJIA 3MYJA 3OG6B 3E38A 3QZWA 3GDBA 1OCWL 4U3CA 4WW2C 3UYRH 3BRFA 1QLRA 3SZ6A 2Z93B 3SHSA 2QPDB 4LPYA 1HIML 4XMXA 2WO3B 5CR8A 2WQVA 1S5IL 3LTVA 3W56A 3O8XD 5DVMA 3QG6B 1SJMA 1I8KB 4BV1A 1AJ7H 5E9NA 4TUUA 1MJ8H 5ISZE 3RTQB 3QDGB 1FL3A 1YMMD 1A9BB 3ASOB 2VQ1A 2FT6A 3BT0A 3FUMA 4YZFF 2J21A 4TLKA 2IXQB 3L6FA 3ROOA 3TURA 4N6RB 1F4XH 3MBED 3NZSA 4UU9B 5DZOA 3V0VA 1JMXA 3FMGL 4WHTA 3HFFA 1NBZA 1MI5B 4DN3L 2RCSL 4Y1AB 3FT4B 5BOJA 7PAZA 3NIFB 4PW3A 2RD0A 1VADA 3WFCL 3UX9B 3QO1A 2F5BH 3FJTA 1UWEH 2KPNA 1HDMB 4U3XA 4M43L 2EH8L 1RZ8A 3AU0A 4ODVH 2V7HA 5HI5D 1PLGL 3TN0D 2ESVB 4GUOA 3BKMH 4AVJA 4E0RB 5T5FL 5EC1B 3SDYH 2Y6SC 1C5BH 5DJYB 1PNDA 4OZGE 1FJ1A 1WC7A 5EBWB 3VRJB 4AQ8A 4CJ0A 5LKNA 3VFWB 1ZIAA 2NY2C 2H2PC 3P0YL 3NOIA 4PRBB 3UTOA 1F4HA 1VGKA 2ALAA 1N70A 3WEBA 3VD1A 4POZC 3M8OL 2EABA 1VZGA 3POHA 4ODSH 5D8JH 3U2SA 4IGBC 2R56L 3FAXA 5ALBL 3TLRA 3VYNA 2ADYA 5FW7A 2B59B 2BDNL 2OXGA 4UM9A 3VWKD 5JXAH 3MRMB 5BRZA 2WXQA 2MEJB 5CN3A 3RIAK 1U33A 3QUYD 1S9WB 4QKXB 5DMGC 3VRLF 4N20A 1FRGL 1L3WA 3BXNA 3MGTA 3KYMB 2BP5M 1SOSA 2WXNA 2EH7L 1HEZB 3T5WA 1E4WL 1KXQE 3U1PA 3VG9C 5AW2B 1U8MA 1I1RA 1RLWA 1H15B 3EH5B 4HUWA 4H40A 3SQBB 3L3HB 5I16A 2KMWA 3MXVH 4FLSA 4QRRD 3H4HA 4CA4A 3M7FB 1NIAA 3MNDA 4PWIA 3I3BA 1N19A 3QULA 4NDMA 4NZJA 4PW4A 1IAOB 1MQKL 4XNQB 4X6CB 1NIFA 2DQHL 1N7ML 4XX5A 3W9EA 4PJAE 4XZ4A 1JZ5A 3LNEA 4PGEA 1JZEA 1R24A 1RZGA 3F7QA 3DSFH 4WJG3 3K1DA 3VRIB 1A9EB 2CBOA 3QPXL 3VI3E 5D4HA 4HH8A 3BUYB 3VFVA 4YXLL 2VDQL 1IQDA 2C9XA 3CIAA 4UF7C 1S78C 4EI5D 2GQHA 7CGTA 3JUYA 5BPPA 3QR1A 5IROC 4N9GA 1MFUA 4OKVB 1DDTA 4CW1A 3F7VB 5C2BH 1QLFA 1GS6X 1P5UA 3TONA 1NGQL 4N2EA 1NMAL 4I13B 1S7QA 4RAUA 4Y4KB 4WDIA 3BWAA 3O8XB 4KVPA 4FCAA 4PB9H 3I6SA 3KGTA 2JTYA 3Q2CA 4YJZL 1X5IA 2FEEL 4ODSL 3PQYB 2OMTB 4P2QE 1NOAA 2JKIS 4NQDA 4UT6A 3ME0A 1SEBA 1U93A 1YRKA 2BVEA 4K71C 2V5MA 3KEHA 1P4IH 1H9VA 3T0EE 3K71B 2JXMB 3NEXA 2BY2A 5E8PB 5DK3A 5MENA 1E0OB 4ABUA 2YPKB 2NXYD 2X4QB 4F24A 5CJOL 3L2LA 3V4VH 2Z65C 1LXMA 3BVTA 1E50A 1WGVA 2CGYA 5IVXE 3F7PC 5F88A 4DIXA 2JELL 2DQGL 3STBA 3VXNB 2FHBA 5KYYA 3TF7C 5T1DH 1T04A 3QWRD 1TTFA 4ABVA 2YSSA 3QEQE 4JPKH 3FFDA 3A47A 3BH8B 2WZ5A 4XNBA 5DHYA 4WW1B 2FJGA 2ID5A 4DF9A 3B5GA 4DQAA 3W11D 4YSDA 3M1OA 9PCYA 2ZPKH 5DSCA 3EO1B 5D7SH 4C54A 5IFAL 3DI3B 4M7ZB 4AMKH 2PXYC 3KPMB 4R7NB 1ADQL 4F3FA 2R4RL 2FBOJ 2ZKYA 1BPVA 3LZPA 3RWDB 3UTTD 3MCG1 2V9RA 1XHHA 4OLUL 4QCIA 1INQB 1XH3A 1OF0A 1MJJB 2FIKA 4WWKA 3M46A 1I1YB 2Y2TA 4MJIA 5DUPL 1AQ8A 3MLPA 4AE1A 1DQMH 1V3KA 4JO3L 1NGPH 4ANVA 5EF3A 3MDJA 3SGDH 2FB4L 3OR6A 5FWQA 2UXTA 1U8HB 2HVKA 1XDTT 3C6SA 1UD6A 3CBKB 2VLKD 3MBEA 3TZVA 4NPJA 3B83A 2QEJA 5CXPA 1JGLL 4X50A 4IK6A 1QFUL 3K7UA 4LCWD 1ZLSL 1G7JB 3P77B 1ZHLA 5IOPB 2ZP8A 5D6CB 3RL2A 3KAAA 4TSBH 3HUJF 3KS0J 5CD5C 4QRFA 1EK3A 4IRZL 3JBG7 4G3YH 1Z5LA 5E9DB 5GRVL 2GSIB 1P7QB 1FLTX 3TIEB 5IMLA 3T3PB 1ZEAH 1UEMA 3EJSA 4G6MH 3VQ2C 1KENL 1X5JA 2OMYB 2P7TA 5EBLA 3KLKA 4GRLD 4PJCE 2F7IA 4MJ5B 3HZVB 2UWEA 4JR9L 1GC1L 2HFGL 1A7PH 2J5LB 3VGFA 4P3CL 1A4BA 3C8KA 2IQAB 3AABA 5I9QB 4PJGE 5FO2A 1ROCA 3D12B 3GBNH 3JXAA 1FYHB 4PG2A 3T09A 4JANA 1IGMH 4N3TA 3T4AB 4HUCA 3I2CL 1M4KA 5E70A 5BOZG 4X9GA 3CZFA 2BIMA 3U7WL 5I8EB 4KQ3H 2HLAB 1NCHA 1IAII 2PP8A 3F65A 3U0TA 1PCXA 3OWRA 3RIFK 1UH2A 2KBGA 3QJZA 2EP6A 4H8WH 5D1QC 3VFPA 4EZMA 5L2KE 1WFTA 1XO8A 5BMFL 1D5IL 5C07D 35C8L 3ZGHA 3U6XA 3TV3H 1TTAA 2C7UA 4GKNA 5KVGE 5T5NF 1XAKA 3FO1A 4JHUA 1XR9A 4W9KC 3H42L 4JY5L 1XB3A 3CZEA 4GI6A 3RY6A 5GXBB 4OFQA 4KU1A 3OKKB 1L9QA 4H7VA 4LPVA 1KGCE 4ZO7A 5J5EA 4G7VH 1LO3H 4LXFA 4P9HC 3QULB 2GKIA 4NDMB 5FIEA 1WT5C 1DCEA 4IHOA 2APBA 5K9JL 4YSRA 4X5XA 2R27A 5D2NB 4U3HA 4F15B 4PJBE 4X7TA 2VAAA 2EIZB 2XV6B 2E6PA 3INUL 4WKXA 3L08A 2Y1ZA 1EMTH 5CGMA 1R24B 3WNKA 5IHHA 3DGDA 1WICA 4PJGF 1OAQH 1NCWL 4OD3L 4WV1A 4KXDA 4FEIA 1MCHA 1PSKL 2A74B 2Q6WB 1KY6A 1P6AB 2ED6A 2QQKH 3KW8A 3QC5X 2AQTA 3DPBA 1NDMA 4L9DA 5C0EB 1CDBA 1UB5B 4U1KA 3VD0A 3VXSA 3NK3A 3GPEA 2WXKA 4FYQA 2DI8A 2Q8AH 3RVWD 1P53A 5IB4A 3VNZA 5BOPA 3F85A 2VDOH 3D3VA 5DJXA 1A7QH 5EC2B 3CFJB 4W9GC 4OQTL 2Z7ZA 4MD5A 3NJGA 3L4TA 3CSYB 4U1JA 4FTVE 1MCIA 3L3DA 4D9RE 1OCOB 4RMQA 4KVCH 3DRTB 1RZJL 2DMBA 1GGBH 1U6AH 4DP4X 5GRJH 3PGFL 4NNXA 5DHXB 4I3SL 4JO2L 2ZNWA 3OG4B 4BA0A 1W72L 1TQTA 2W38A 3US0A 2X4OB 5D4QA 4EAEA 1LO0H 4MJ5A 4E0RA 3QWOB 4TNWK 1R0AH 5E8PA 3LIZL 1D9KC 5GJTL 1NMCC 1FFQA 3ZKSD 2W94A 1AR1D 2UVFA 4LGRB 3QWQB 4TKWA 4Q14A 4N2LA 2XPZA 1A21A 1M7DA 3M1BA 4GLRH 2J1XA 5DUMH 4UUJA 2W07B 4MS8C 5GRJL 3S7GA 4L4TE 3WBDA 5E6IC 2XWRA 4WJ5A 2X9WA 1AFVL 1E7UA 4N8UA 2CRIA 4X4YB 3U36A 1D3CA 1NUGA 4PTUA 3OLDA 4QHLB 1TFPA 2K4AA 2NDFA 5F3BA 5KVEH 4J3OF 2R1WB 3TNMB 3DMMD 4HIPA 2B7DT 1X5HA 1F13A 5ITFB 5ABDE 5EU5A 2AKRB 4P4RA 1UUNA 4PJIB 1SPDA 2ZF8A 1XR9B 4KDTA 3LD8B 3PU7A 1OAYL 1H15A 4QYOB 2EADA 3FUKA 3D2UB 4W9JC 2BFGA 2NY3B 4U2ZA 4R5VA 3MV7E 1JD9A 4P5SA 2XG5A 2O61B 4LCYA 3JWDL 2NY0D 4GKSA 4K3JH 3GPSA 3LKOB 3CFNA 3BCFA 3FFOA 5TGBA 3ULUH 5D70L 1RHHA 1Q94B 5CILL 4BE6A 1RSYA 1RHFA 4R8WH 5ESAB 5B1CA 3HMWL 4LPUA 4ZMTA 1I8MA 1OW0A 3ZZLA 4PLJD 4OCWH 2E86A 4WKZB 4JO2H 1ZTXL 2JKWA 3R7QA 1AXTL 1MFVA 1TOXA 5CGBA 1OPGL 4C58B 5ID1A 1VGEH 4R4BB 5JOPD 3VM7A 2BPBA 5IUSA 1D5IH 2F18A 1E65A 3CPUA 3S35X 3J7HA 4M62L 1JHKL 1GOHA 3TBBA 3CFJA 1E2WA 3QIUD 3NJIA 5EC1A 4TQEH 4X9HA 4CU6A 2X9XA 2K6ZA 3BGMB 1N67A 3ESOA 1BQ5A 2WUBH 5DD0L 1OB0A 3GRWH 3O2WH 3FO9B 3MODH 3P40A 4KXBA 5TPWH 1BEYH 1K9TA 1GW6A 1BLNA 4YHKH 4JPIA 4CC4A 4GG8B 2EIMB 1E40A 5K9JH 4RFNC 1GC1H 5SV3A 2G5RA 1T6WA 2H0JA 3CXFA 5MEQB 5C08E 4PGEB 4CVZB 4FQLL 4LNVA 1NDTA 4NO3A 2OP4L 4Y2LA 5CCHE 4BFJA 1JDDA 1KTLB 3QDMA 1MW3A 2ARJA 4XCEB 3E80A 4N1CA 2W8CA 1E6OL 2F1AA 4J27A 5F88B 4LSSH 1U3HC 3FQTA 2RB8A 2DH2A 4PHZA 1F3RB 2NQCA 3N3EA 2OJZH 3RWJA 1XCTB 2KZWA 4PWEA 1T1YB 3BH8A 4ALAL 3RWEA 4LL1A 2XBZA 4PJBB 5BMFH 1ITCA 2ZYRA 4PTUB 1IAIL 2Z1KA 3HOGA 3HZMB 3KVQA 5I74C 1UZ8B 4PJ7F 4J1UA 1QD0A 3B37A 1KCRH 2QFPA 1NKOA 1OO2A 1B0IA 4ERSL 1JJUA 1JVLA 1H8NA 2JVUA 4ZI8A 5C2UB 1MAML 1Z7JA 4OLZL 4F8NA 5EU6D 5E99H 3ELQA 4AC2A 2BWDA 3MRPA 2CRYA 3D07A 3L5WA 2IBGA 1S7XA 4ETQA 4ZTOL 5J11B 5GZOD 3T08A 1QRNB 1UEYA 3MBXH 4NAMA 1MFAL 4UMGA 1PF3A 3KWUA 3LRMA 3P4OA 4PTTB 4XXDA 1J0ZA 3FFDB 1MCKA 4MMYB 2WQAA 4XT1C 3FBKA 1U8MB 5H4YA 5EZJA 2YXWA 5I28A 1NCCL 2ERJC 4XNZB 3L3DB 2XZCL 1NDGA 2XZQL 3MRRB 3F58L 4N2MA 2ZUUA 3ROLB 5J0BA 3TV3L 4TOYH 3GMNA 4FQ2H 5I71C 3S88L 4NB7A 5F7NC 3D69A 1RZGB 3LS5H 4A2HA 1T0PB 4FQXA 3GLAA 1TJHL 3UMTA 1BX2B 3BUIA 5E9DE 3MMEA 3QXDB 3PP4L 1JPSH 4XWGH 1S5HB 1QRKA 3MJ6A 3H54A 3SYAA 1SXZA 2A3TA 3APDA 3Q8FA 3B2XA 5D7KD 1UCTA 1TZIB 3L7EB 1E4XI 2XKNB 4QIRA 2F7PA 4WK0B 5IB1A 5MEOB 1QYGL 5IJKC 4YDNA 5IEKB 1Q0EA 1Q4NX 4G8GD 2BNQE 2Z0UA 3BAKA 2OTPA 2BWQA 5HHOE 3PREA 2ZXDA 4HIHA 3ZGIA 5L9DL 3ZU8A 3Q01A 1UWGH 2XJLA 4Z7OF 4R2GB 5C2BL 3L13A 2GG1A 3E6HA 1WP6A 2MIZA 3EJYD 4ONGH 5C0AB 3G9AB 1UQSA 5GISH 3GJFB 5K1VA 4YL4A 1S6NA 3ERXA 2AQPA 4TLTA 2DDQL 2F8IA 5BW7C 5F7DB 5FLVA 5HVHC 5JW4M 3K71A 2D3LA 4FXGC 4WFGE 3CVHL 1KPUB 1SRDA 4GAGL 1JXGA 3L16A 5I18L 1SMDA 1OHZA 2EDRA 3Q8CA 3O6FD 2RGSA 2FYYA 4IOIB 1BQKA 4K2UH 4Y1TA 1UD2A 2DQHH 3X3GL 3G5ZB 3BISA 4GH7B 3NBNA 5CJOH 1L9TA 3QISA 5C09B 5BO1H 3ZHFA 4WIQA 2O6CA 3Q6FB 5F9WC 1RZQA 1JNNH 5KJRL 1CE1H 2YEVB 4MJ6A 4XP4L 1S7SA 2O30A 1EEYB 5GJSH 4K0OA 2FR4B 2PO6B 1RY7B 5L2KA 2FWOB 4QRSB 4CKQA 4K8RC 2XWCA 5HYQB 3NIFF 2DYRB 1EJ8A 1PAZA 1XMWA 3C5ZA 4NNPH 4OJCA 5AW0B 1IL1A 2FAUA 5I30H 5E0QA 5IW3A 4OI7A 2MTPA 1DP0A 5A2BA 1ZWIA 3T71A 5C0BA 4LE8A 1RPUA 4KX7A 1PDKA 1JNLL 1NAML 4Z5RA 2XPGB 2WZAA 3EH4B 5DVKA 1DLFH 3UDWA 1KMGA 1JVKA 3FQ2A 3L9BA 1CS6A 1OTSC 2DQDH 3GSXB 3VFRA 3ARPA 3K2IA 4OFYA 3C8KB 2H6PB 2EO7A 1A3ZA 5I8KH 3MXVL 5IMKA 1KSRA 4JAMA 1EFXA 5TJWK 5KBLA 4BZYA 2DTML 3WY1A 4XI5C 2O5ZL 3CZNA 2CCWA 5E8DH 1BQSA 2Y5QA 4XN8A 1W16A 4FMVA 2QBWA 1G7HB 4NKIL 2DLIA 4P8QA 5IK3B 4CMMA 4ODVL 4AYEC 4PWKA 5IHWA 1GGCH 1JBJA 1AOHA 3IJYA 3SDDD 2Q76B 5IB4B 5IEKA 1U8KB 1IGTB 4XAWL 2ADFH 4JRLA 3ARDA 3SPGA 5JPNC 4GRWH 4ZG1A 4ELKB 1FP5A 4HIHB 3F5WB 3UYPB 2B1HH 5F9JA 2DQCL 4WCYL 2OW6A 4JFHD 3ATBA 3F7YA 3FAWA 2C3GA 5GGSB 2OXHA 3TBYB 5EIIB 2HB0A 2ZXQA 2WYIA 3VFGH 3V5HB 2J2ZA 2A4EA 3VWKB 5FDWA 4KK5D 4CSPA 4PJHA 2V6HA 4NCDA 1AKJB 2XYBA 3I9GH 5DTFB 2OZ4A 3O6ML 5F9OH 1WIPA 2VR8A 5EO1B 1KCWA 4GS7B 2GT9B 4Q0XH 3CLEL 5CIPA 4N0YH 1VRSA 5BZWB 3FO0H 4M7ZC 1F4WH 1BXVA 1DE4A 3O41B 4XN2A 3WFCH 2FEDD 2UV3A 1IKFL 4OGAC 1GY2A 4YSAA 2X3CA 3LPGA 1Q9WB 4GAAA 3KPRE 1NAKH 2ESVD 3LZRA 3QEQA 7TAAA 5T33H 4P23D 4FQ1H 2AJ3A 4R7VA 4BFNA 1F6AB 2NY0C 4G5ZL 3B34A 2NNCA 2DQIH 4AENA 3PGCB 1OGSA 2E6QA 2ZWKA 3HB3C 4MDIA 2XFGB 4PV8B 3FOLB 5IJKA 4OZGB 3ROLA 5IMMB 3K6SB 2AKRA 3TT3L 1B3JA 2NXYB 3FQUB 4P5MA 4DGYH 3C8HA 3CFUA 1FHNA 1QSFA 3VH8A 2YIHA 3HJ0A 4FQQB 5LHDA 3V6ZB 5JXAL 5CU5A 2B1OA 1NGYB 2R8SH 3QEUB 1J8SA 2YMXL 5I1DA 3GRBA 3NIFE 3TO4A 5CS7A 5KSAA 3LKRB 5GS3A 3MYZA 4MS6A 2W07A 2WPGA 3GMOB 4FG6C 3U9PL 5HYSG 3PWUA 3PXHA 4BWTA 4K9EL 3CVHA 4NWTH 2FVNA 2IAAC 2AV7A 2XDHA 1T0MA 2E7BA 2WANA 1GYVA 1PG7L 4Q2ZB 1B0RB 3CSYA 3U36B 3QDGE 3LNHA 4LPWA 1KFAL 3ZDXB 3EGXA 5CM1A 4BGDA 1K6QH 4JVUA 2X6MA 3K2UH 4QHNB 2CJUL 2PWHA 3UTPE 4MJIE 1MCCA 3T4AC 1FCGA 2BM3A 1KN2L 43CAB 4ZTOH 4LAJH 2ODIA 3RGHA 5DMIH 4I0CC 3RA7L 1EXHA 2BP0B 3PWLB 4J8RB 4LOUC 2BIPA 3MCLH 4O02B 5HYJB 2NY6C 1FNAA 2VO5A 3JWNG 4QKTA 3TZVD 3MO1A 5B1JA 4G5AA 1A4CA 1BGXH 2GIXA 3P30H 3QZMA 2V5TA 5J1AA 2B5IC 3RY4A 2EE3A 2HTLD 2MHAB 2QHRH 3TFBA 2OJ1A 1WV7T 1FIGH 1V7NL 2EQDA 4J39A 3O9WD 2P5ED 5AW7B 4AIXA 1CT8B 4XZUB 1KEGL 2Q86B 2Z31D 4F1SA 4DUXA 1MPAL 4HFWA 4X4MA 3P2BA 1QRNE 5CAYB 2VLLB 2PYEA 1M1XB 4APXA 1KWGA 1CMOA 4CU7A 5JIPA 2V5RA 4NKDA 4LVNB 1JCKA 4KITB 4J23A 1QKZH 3GNML 4EUPB 4LHJB 3O2VL 4X7SH 1JNHA 1A14L 1M3IA 3KPOB 1IBFA 3U0PB 3MLXH 1BFVH 1DVZA 5B39A 2BNUA 1C08B 4NC1E 4YE0A 3SCMB 3ARFB 4L37B 4E5XA 4K7PX 1U91B 2IOOA 2AJSH 5TE7H 2FX7L 4MAYC 1HVXA 5AKVA 1QW9A 3F6IA 4L5FE 2OYMA 1ZV5A 5DMKB 2JKLA 2J44A 1E5BA 1UA6H 2FNWA 1DBML 2CNZA 4X0KA 2ZSWB 4FADA 1C1EH 3G6JA 3BEVA 4FQXB 4TULL 5E4EC 3P11H 1SM3H 1KTLA 3QDMB 1ZHKB 2Y0SA 1JOIA 3GO1L 2WLLA 2C9UA 1KTJA 4JHZA 3UP1A 2BSSB 2CAKA 1JPSL 3P2TA 1D9KB 3TPKA 1BM3H 1NMCB 3IU3B 4UU9A 1ZDSA 4ABQA 2OMWA 3V52H 4OH2A 3ZTNH 4M62H 3HUJB 4F7PB 1YJDL 1ETB1 4OI8A 2X53A 4JM2F 4TUKH 3HRZC 3KVDD 4IGBD 3ZQWA 5I1HH 3O3UN 2YBRB 5F2FA 4U6YB 1GW0A 1RURL 3BW9B 2V9QA 4JCWA 1KC5H 4Y2DC 3ZK0A 3UPRA 1RJZB 4FI7A 1FHGA 2OMXA 3EHBD 3MLYH 1L0XA 2ZF9A 3CDZA 3ZE2F 4LSPH 1ZD6A 1CGWA 1EO5A 4AY0A 3B8YA 4WTWA 4F33A 1XFPA 2KL6A 4XODA 3HBQA 1INDH 3ARBD 3VE0A 3PNWB 1TZIA 4O4YL 4EI5B 1M05B 4PRNA 1KEMH 3EYQC 2NY3C 3SQRA 2CO4A 3BIKA 1E9OA 4KHTH 1O9VA 1B4JL 5BRZB 2QLVB 1KYOK 1BVZA 3V95A 2J88L 3NJNA 1OPGH 3FQNA 3MV7B 3TTSA 4D9LL 5MENB 2F74B 1U8QB 1FNGB 3MBEC 4OZGA 5EUOB 2ZUXA 3KYMA 4Y4FB 5EEYA 3GHPA 1ZGLM 1X5LA 3FTVA 3H6JA 3NABH 4ZNCD 4PJIE 2OMVB 4IOFD 1FC1A 2OMNA 5HDQH 1IVTA 1X4ZA 3DX4A 2CO7A 3QAZC 4TSAH