3CZUB

Crystal structure of the human ephrin a2- ephrin a1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
130
Chain Sequence
ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYESVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 29
structure length 130
sequence length 132
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3czuB00
1JVOA 2TSBA 3WNJA 4AKQA 3ZIYA 1NINA 4GYBA 4HIPA 4DP8X 4ENZA 1OE1A 4F2FA 1M9WA 2J55A 5EHFA 3OM3B 2BZCA 3ERXA 3NJIA 4W1TA 1ZIAA 1KV7A 3CDZB 1GS8A 3PLYA 1YLBB 2WO2B 4DP4X 3TBBA 5B1JA 3FU7B 2XX1A 4BWWA 2HXAA 4GY4A 4HHWA 2R7EB 3ASOB 4DP2X 2I7OA 1AQ8A 3QJSB 2IH9A 5TK4A 2AFNA 2FT8A 4A2GA 2FWLB 3ABGA 1CUOA 4BK5C 5AFAA 4Q8BA 2UXTA 3T6VA 4PCYA 4HCFA 3ABKB 3CVCA 1SFDA 1ZIBA 1OCCB 3FQYA 4N8UA 4KOBA 1ET5A 1SNRA 2PP7A 2H47C 2YAMA 1ASPA 2J5WA 2JKWA 1PLAA 3X1EA 1PLCA 2AANA 2IWFA 1JVLA 3T6XA 2FNWA 2XVBA 2YAFA 4G7RB 4GP8B 4W9ZA 2CJ3A 3IEAA 5FC9A 2X87A 2YARA 3DKHA 1MZYA 1WS8A 2HX7A 4GP5B 3NJNA 3NJGA 1E65A 5E9NA 1NTDA 1ILUA 1PAZA 4KNTA 1ID2A 1SHXA 1XB3A 2FQEA 4KO7A 2BWIA 1SDDB 1TKWA 3DIVA 3BQVA 4TXVB 1W6WA 3OD3A 5B1KA 2E86A 3FQ1A 1J5DA 4UF7C 2Q9OA 4YSUA 3SQRA 5I6LA 2YAEA 2FT7A 4G71B 3KW7A 1BQ5A 1TU2A 3TBCA 3UACA 2VSMB 4DP1X 1E67A 4KNUA 2IH8A 1HAUA 2CALA 4BWTA 2EIKB 1JXGA 4A66A 1BYPA 3IN2A 2IDSA 2J56A 1BAWA 3IBOA 5I6MA 1NZRA 1OV8A 1AG0A 3UGEA 4G7QB 2QT6A 4FAAB 3NJLA 2HLEB 3N55A 3NJJA 1OE2A 2WSDA 1GSKA 1PZAA 1F56A 3OQRA 2GHZA 2HX9A 3EF4A 5B7FA 4P5SA 3UADA 2H5UA 2BHFA 1A4CA 2PP9A 1V10A 2PLTA 2IDFA 3FU7A 2LLNA 3NJFA 2CAKA 1KCBA 1JERA 4F2EA 1ZDQA 3FT0A 3FSWA 4JHUA 3FU8A 2AZAA 2PPFA 4HAKA 2GI0A 8PAZA 3OMIB 2R7EA 4PAZA 1L9SA 1MG2C 4UANA 1PZBA 3IE9A 5I5IA 3TA4D 3X2QB 2XV3A 1IUZA 1NICA 1ET8A 1QNIA 1AZCA 2GIMA 1XMEB 2GBAA 1PZCA 4K9JA 2HX8A 1TEGA 4KO9A 4BDVB 4DP0X 7PAZA 2N0MA 3FU9A 1JZJA 1PLBA 1TEFA 1JZEA 1URIA 1A4AA 2FJSA 2ZXWB 3FSAA 3FYEB 4JHVA 1BEXA 2XUWA 2ZOOA 1BXAA 4DP6X 1RZPA 2B3IA 5B1AB 1NIAA 4A2HA 3CG8A 1AZUA 1PY0A 2YAQA 3EH3B 2DYRB 2GSMB 4G7SB 3TU6A 4YSEA 2VW7A 1WAEA 4CSZA 4YSTA 1X9UA 5D4HA 2OJ1A 5I6NA 4WKXA 4G70B 1RCYA 2PCYA 4CSPA 1SF5A 2GC4C 4JKNA 3S8GB 4WTQA 2OV0A 3X1FA 1AZRA 2DWSA 3EHBB 2ZONA 1IKOP 1SDDA 3HEIB 1OCZB 2CUAA 4QLWA 1A65A 1ZV2A 3GDCA 5AZUA 3JT2A 1JZGA 3U25A 3AG4B 3NP4A 4AI7A 2DYSB 4A2EA 1OOWA 4E9VA 2MTAA 1NIEA 1A4BA 2PCFA 5I5JA 3T6ZA 3X1GA 1KDJA 1NDTA 3QQXA 4YSAA 1EHKB 1WA1X 3NSCA 4KOCA 3UABA 2BP0B 3RYMA 1WA2X 2NRDA 4E9RA 4AKOA 3HB3B 2YAPA 1N68A 4P5RA 2UXVA 4RH4A 4E9WA 1SFHA 3NJKA 1V54B 1SJMA 2VW4A 2YXVA 4HCIA 2XV2A 4MFHA 3AZUA 2BW4A 1AS7A 2XLLA 2QPDB 1OE3A 3FPYA 2RACA 2W8CA 2XXGA 3FYIB 3ZX1A 3X1NA 3QJTB 3T6WA 1J9QA 1L9RA 1JXDA 3H4FA 3NSYA 4A2DA 3NSFA 1I53A 1GY2A 3JTBA 1QHQA 4DP7X 1NPNA 1HFUA 5I6KA 4E9TA 1AS6A 3T71A 5B3SB 2OCCB 1PMYA 1JXFA 1ET7A 4BDVA 4NB7A 2ZWNA 1L9QA 2Y1AA 1J9TA 3T9WA 1KGYE 3UAEA 3EH4B 1WA0X 4UAHA 4QKTA 4HHGA 3NT0A 3G5WA 4ZK8A 1JOIA 2YXWA 1PNDA 4NERA 4YSRA 1PNCA 5I6OA 2FTAA 2QDVA 3SBRA 4E9SA 4YVUA 4YSQA 1EZLA 2FQGA 3PXLA 2PPCA 2EIMB 4YSDA 1JZIA 4GP4B 4BWUA 3S3CB 1PCSA 2IDUA 4YL4A 3QJUB 1RZQA 5AKRA 3ABLB 2FT6A 4N4YB 1AOZA 2XV0A 2BWDA 1FFTB 3OMAB 3V9CA 2BW5A 3CVBA 1DYZA 3FSZA 1E30A 1NIFA 2GC7C 2UXGA 2X88A 4Q89A 2JFCA 1ZPUA 1KCWA 2Q5BA 3NSDA 1KDIA 1M57B 3NJHA 2BP8B 3S8FB 3WKPA 4A2FA 1MZZA 4AKPA 2BP0A 7PCYA 5F7BA 5PCYA 1RKRA 3PAZA 2YAHA 2IWEA 1J5CA 5B1JC 3GXUB 3AY2A 2Y69B 1CC3A 4DP5X 3PAVA 4KO5A 2CCWA 2CBPA 5TK2A 2I85A 3AW5A 1E5YA 2PPAA 2IDTA 3UAAA 1A3ZA 1A8ZA 3OMNB 1AIZA 2XX0A 1ZDSA 1L9OA 1CYWA 2IWKA 2H3XC 6PCYA 2PPEA 1W6LA 4X4KA 1KBWA 6PAZA 5I6PA 4E9XA 2EILB 1BQKA 2I7SA 2JXMA 3QJQB 1AS8A 2TSAA 2HZHA 3PCYA 3MX0B 3WIAA 1FWXA 3NJMA 1X9RA 1ILSA 1SF3A 1AR1B 2VN3A 4AX3A 1J9RA 3KW8A 4E9YA 4NAJA 5B7EA 3WKQA 1OF0A 2IAAC 2EIJB 2MRYA 2VW6A 1XB6A 1AG6A 1NIBA 2P80D 3NP3A 4M3HA 5F7AA 9PCYA 5D4JA 2P80A 2YAOA 1QLEB 4AZUA 2XXFA 2XYBA 3FQ2A 3PAUA 3WG7B 1CYXA 3FPXA 4G72B 2UXFA 2FQFA 3V9EA 1CURA 1JZHA 4GXFA 5ANHA 1KYAA 1SHWA 1HAWA 3EH5B 2VM3A 1IBZA 1L9PA 3SBQA 3H4HA 2J57A 3MBWB 1PF3A 1L9TA 1GS7A 2PP8A 3ASNB 1IC0A 2A3TA 2QPEB 2EINB 5PAZA 2W88A 2UX6A 2GB2A 1AAJA 5I26A 3GYRA 2UX7A 1M56B 1ASQA 2BP8A 3NYKA 3ZDWA 1WS7A 5IY5B 4KNSA 4YSSA 1NWOA 4A68A 1NIDA 1BQRA 1W8EA 3QPKA 4YSCA 2FQDA 1GS6X 3WI9A 4HCGA 1AZNA 2DWTA 3H56A 1ETJA 4YSOA 5B1BB 2VSKB 2VMJA 4YVNA 3ZBMA 1DZ0A 1GR7A 4FA7B 2IDQA 1BXVA 1UATA 3D12B 3L45A 1AACA 4E9QA 5B7MA 1BYOA 4DPBX 4BXSV 2BO0A 5I28A 4HALA 2DV6A 2HRGA 1GYCA 1NPJA 1OCOB 1T5KA 3ABMB 2VM4A 2PPDA 1GW0A 1AANA 3S3DB 1J9SA 1XB8A 1R1CA 3BVDB 4BXVA 4DP9X 2HRHA 1E5ZA 3C75A 4A67A 5A7EA 1MG3C 1GY1A 5D4IA 1KBVA 2QDWA 3PPSA 2YQBA 1OCRB 2AZUA 5LDUA 3FS9A 2WO3B 3CDZA 1NWPA 3WNIA 1MDAA 3AG3B 4DPAX 3CZUB 3DTUB 1FA4A 3X1BA 1N70A 3IN0A 3CVDA 3S3BB 1ADWA 2XU9A 2XWZA 1BXUA 4F7KA 3FSVA 4EF3A 3TASA 4KO6A 3AG1B 3N2JA 1IBYA 2DY2A 2AVFA 5I5MA 4YSPA 1V55B 1ASOA 2BZ7A 1VLXA 3QJVB 4L0PB 4HZ1A 3SBPA 4M4RB 4DPCX 1JZFA 2B08A 3QJRB 3AG2B 1AZBA 1B3IA
chains in the Genus database with same CATH superfamily
3ULVF 1TTRA 1UM5L 1MVFA 4FQJH 1WBZB 3IBEA 2AMUA 2Y22A 1QSEE 2WINB 4M00A 4F7EB 5J1AB 3OAYH 1EEQA 2I9LB 4F2FA 3RKPA 3FU5A 3KPRB 3O11A 4BD4A 1PSKL 1FZKB 5FOJA 4IGBC 1GS8A 3BPCA 3KBHE 3FF8A 2ZX8A 4I2XB 5H94A 3VU2A 3WOVA 5DK2A 2WSPA 5EU6D 3BDYL 4P8QA 4NHUB 3BN9C 2XTSA 3WHE0 4QYAA 4MD4B 2YUVA 2R2BB 1UD2A 4LSUL 1B4LA 4NQEE 4CMMB 3BD3A 4GXVL 2JLPA 5AVQB 4X6DF 1CUOA 2J1XA 5DEZA 3K0YA 3VFSA 1LDPH 4P2QE 3IVKA 5D6DA 5EA0H 2A9DA 5HHVH 1B9KA 1CD1B 2Q7YB 1LWJA 1U33A 4MCYA 1QASA 3II2A 2YAMA 4ZMTA 4ZNCD 1PLCA 4ZUTA 2MNUA 5D1XE 3VWKC 4PJCA 1NC2A 3TBYB 1ZA3A 3MKKA 3OJVC 4KQ4L 5E6RB 1BLNA 1ZLWK 5FLVA 1X6LA 4YHLL 3QFJD 4FFZA 2G3MA 5DHVH 3MRMA 3G5XB 4X7DC 2Q76A 4OZGF 2NY3C 2Y5QA 3EJRA 3BEVA 3OKNB 2FIKA 5ECJE 1NTDA 3PL6C 3GSRB 1MAML 1IAII 2NNCA 3ESPA 4NYLB 4U1MA 2YZ1A 3UTZA 4QRTA 2E7DA 1U8OA 5HDBF 4ODTL 1C8QA 1JGEB 4RBPH 3A24A 4Z7OB 2YC1B 1IBGL 4JFXA 1YPZA 3AREC 4B7LA 2ZWSA 3Q5YA 5I9QB 1YO4A 2NUPB 1WCBB 2QHRL 3EJTA 3I9PA 3BP6A 3WXVL 1JBJA 3HJEA 5DRNA 1AGFB 2VDLB 3QDME 4MJ6B 4DUWA 4RFEA 3VG9B 3VRLF 1OTTC 1XGZA 2X6AA 2UZXA 3QRBA 4J6IA 3NIDF 3WELA 2B3RA 3OSVA 1T0OA 1G1YA 3VXOA 1UJ3A 1H9VA 2WUCH 3MOBL 5DURD 3SYOA 1JZ5A 2CRZA 2CUHA 2GIYA 1FO0L 1YECH 5AB0A 1U3YA 4P2RE 3WUWB 4D9QE 4BUGA 4Y1AB 4PYHA 2CGRL 2DTML 2PP9A 1G6VK 2R0KL 1AKJA 1SEQH 4MJHA 5KBMA 2IG2H 5LBSA 4LDCA 1AKPA 3SDCA 3UTSD 3WDJA 4AQ1B 1E2VA 3B2UD 4MWFB 4Y16B 1U58B 4LLWA 1BZ9A 2QVIA 5EU5B 2VR8A 1QYGL 3D39A 2VQ1B 1G7PB 1N8ZB 4AY0A 3KL0A 3L2MA 2X4QB 4RMTA 4R8WH 3IMVA 3TCXA 1USZA 3E7JA 3EUDA 5F44A 2IALB 4R96B 1UH2A 4OCNC 4I13B 3S2CA 3L81A 5C0DB 4LVHB 3TL5A 4S1DC 5L4IA 3FCTB 3COOA 4M6OL 3WN5B 4DP0X 1G7LA 2OP4H 5HPMA 4MZIA 1AXTH 1GYVA 4Y8DC 2IH3B 5E8NA 2H2SD 2ZXWB 3RVWC 2FJSA 1DZBA 3SOBL 3GXIA 2VXVL 1XDTT 4OUOA 5JW5A 5IT2H 4HS3B 4AIXA 5DD5H 2DS4A 2TRYA 4ETQA 1G6RH 1I31A 1KN2L 4NAMA 1QRKA 4AGQA 4A55A 2GSMB 4I4WA 3QFGA 1OGTA 1CXFA 1ZCRA 2VW7A 5F71A 3B83A 3HS8A 2K7PA 1QUPA 2J5LB 1UA6L 2DZEA 4DCQA 4JDVB 5J7CC 3UJIH 4JM4L 4Q6KA 3L2LA 2YQGA 4EIBA 4KJPC 3EFOB 4G8EA 2C9VA 4Z3FA 3DTDA 2YS4A 3EHBB 4UT9L 5I8KH 3EZ8A 4NNXA 4GAAA 3IXAB 4KRLB 4Z8FL 1VZHA 4OQTH 2ICCA 2R59A 1OF2A 3GGWB 1JYXA 3Q43A 5I1HL 1JNHB 1S5IL 2Y4SA 5F6HI 3KPSA 4GT0A 5AAWA 3V4VB 1WBXA 3BLKA 4Y7OC 3GF8A 4LNVA 2PW2B 2F19L 1Y18B 3HAEA 3SKMA 3B2DC 5AW1B 3VACA 2DQIL 2BP0B 2WLMA 1WA2X 4HIJB 2YLHA 1ZE3C 3MCLL 4HS8H 2UXVA 4P4KD 3ALXA 2AAAA 4XAKD 4WNQA 4JHWL 3DGGB 1RK0A 4HP5A 3LVTA 2IH1B 1OY3B 4Q9BA 1CI3M 1OALA 2A38A 1X5XA 3FYIB 1I3RA 4BGDA 2HT4C 1P5UA 5J13B 2BIHA 4E5XA 4NUMA 3ZQWA 2ZOKA 4PTTB 4I2XE 3I50L 2QADD 5D7SL 4ZG1A 5CJQL 1OAZL 2IANB 5FK9A 3WL9B 5C0RH 1HKLH 1T0NB 3VG0L 4J2QA 5JIIA 1MN4A 4HJ0C 1QHQA 2AMGA 5MENA 2A4ZA 4LL4A 4OGXL 1SUHA 3KYMB 4ZNEE 3TIEA 2DI9A 5TQ0L 1W72B 4AL8L 4L8SC 2HJLA 4RWYL 1AQDB 4YFLI 2HJFB 1KPUA 2E47A 2PCXA 4M7LT 1IGYA 1NCDL 1JGIA 1I9EA 3SDXF 1E5AA 1KJVB 4HAGA 5GS0C 1LGVA 3TZVB 3T2NH 3QZWA 2PTVA 1DANT 3KWTA 2YK1L 3GJFH 1YMMD 2B5IC 2VYRE 2XQBH 2FYVA 4F57H 4ERSH 2EIMB 1UB6B 3E9TA 5KS9A 4FQXC 5I75B 5K9JL 2EO9A 2OTWA 2VITA 3QJUB 4PW4A 1Q9OA 3O41A 1YQ2A 2ORBH 1A2YB 2X2JA 1CMOA 4FTDA 3HS0A 3RZCA 3CE1A 1E4WL 1HSAB 4AJVA 3ZDYB 5C0CD 4PJ9A 1CPUA 1T2JA 4J8RB 2NX5B 3NGBC 3KM1A 3LNEA 2EH7H 4UV4L 5D5MB 3OF6D 4L3EA 1KDIA 2A6IA 2VDPB 4KDTA 1UTDA 2HH0L 3K6SA 4MAYB 3GHEH 4Z7OE 1FRGL 4K94C 4H26B 1MRDL 4NKDA 4J3OC 3MRJA 5D7LD 2NW3B 3UP1A 2YFOA 4HGKC 4RGMB 3IU3A 5B8CC 4G8FB 1GOGA 4YHYC 4R7XA 5F7BA 3ULVL 4J3SA 2XZQL 3RFRA 4JO3L 2OMNA 5E0QA 3UMNA 2UZIL 4WHYG 3SYAA 5CEZL 2R4RH 4QY8B 4XVTH 2N59A 1E4XI 3V4UL 4C8XA 1XH3A 3RFZA 2CLZB 2GSGB 4TSBH 5C07B 1OSZA 4L9DA 2EIEA 4HDIB 4UTAH 4GRLC 4PP1C 1L0YA 1TQCB 3TYGH 3MGAA 1EO5A 2H1LM 4PWIA 4WNJA 4EDWH 1FIEA 1DEEA 2QGCA 2ATPA 4KTGA 1A3ZA 3RVUC 1AD0B 2DQTH 4KXDA 2XX0A 1KTKE 2YUWA 2BIIA 4Y1AE 3MU3A 3FO0H 3LPOA 2WBJC 2OZ4A 2XFXA 1FZJA 5A2KH 5EBMB 3K8MA 1ZK9A 4JY6A 1T4KB 1CYGA 5FF6B 3O3DA 4N9GB 1BQKA 1KB5B 2YZ8A 3AS2A 1R24A 4F58H 3VD2A 1ZGLB 3MBXH 1FH5H 1Q94B 1DVXA 4OF7A 3BI9X 2XACC 4NI6A 4ZUUB 1MW2A 3VXSB 3NZHH 3SOTA 4JEGB 4Z1PA 1S3KH 2ED9A 2H41A 3RTLA 3GI8H 1GYUA 2J6EA 1R5VA 4DW2L 4XPBL 2OXHA 9PCYA 1U93B 1XGYH 4WWPA 3TWYA 1JP5A 4AZUA 2FZ3B 2J8UB 3A5VA 1QSED 2MPAL 5ITBH 4YUEH 4LLYA 3IT8D 2P4AB 4G8AC 3UZEC 2Q2LA 1PD6A 3VI4B 5DRWB 4HGWB 2EC9U 4YIQB 2VM3A 5GS3A 4WAFA 4D9RE 3Q3GA 3F62A 4JVUA 1UWFA 1M05B 3ASNB 5T3ZH 1A9BA 4XAWH 4WGWB 2KPNA 4PRIB 1R3LA 3SO3C 5F7HA 1H3VA 1MHCA 5PAZA 2QZ5A 3QRGH 1MHEB 2X4RA 2GB2A 1FP5A 4NQED 2PYFB 5CZXC 4ODSH 3PP3K 4M43H 1IM9B 3CFKA 3I74A 3QAZC 3QXVA 4JDZA 3QYCA 3Q01A 4NQDB 1J5HA 4YSSA 1WZLA 4X99B 5JOFB 1TZOA 1ORQB 4G8IB 2Z4QA 4I1PA 5EC1B 1A7NL 4BINA 2HB0A 1U8QB 4P2QD 2PF6A 3QQ3B 4FQ2H 1ODUA 2DQGL 3E3QE 3O4OB 4R4ND 4QIRA 2BIMA 2X2YA 2Q8AH 5JO5B 1D3CA 3FC8A 3UBFA 5I24A 4N8VG 3MOQA 4MJIB 4RAVA 3NIFB 3QPXH 1MCDA 1J0KA 4QRFA 2BO0A 5D1XD 2YUZA 1CQKA 5DJ6A 2IQAA 2DV6A 1S7UB 4R4FL 5TJWK 5BW7A 3HAEG 3WJMA 1HL8A 4N28A 4PG2A 2HTLC 4AGLA 4RMWA 3AADB 4ZFQA 2HFFB 1P7QA 2XQ0A 1N10A 2DN7A 3LSOA 4IK6A 2A74B 2E6JA 4YHPB 4U4BA 2YMOA 1F3JB 3U9PL 2X4PA 4HMCA 4M8RA 1OLLA 3ILPA 1OM3H 3M88A 1R75A 1OARL 1YEHH 4XOEA 1MFEL 1MRFH 4N1HB 3U2SB 4N90E 3QIUA 4D8OA 2IANE 3QUYB 5TDPA 4D9LL 5EZJB 1TMCB 3WNIA 5KZCB 1R3JB 4LLQA 5GRJL 2H45A 1HOCB 3W38A 2F9BT 4KHXH 4CC4A 1UWEH 4E5XG 5LGJA 5GGUB 4AQEA 3UAJD 5D1QB 2ZXBA 1A1MB 1YVLA 2BY1A 2HT2C 2OMWB 4BJLA 2O5YH 4OGAC 4TSCH 3QDMD 3CXDH 3IDJA 4FXGA 5EBLB 1T1WB 5L9DH 3QR1A 2OL3A 4JFYA 3SE9L 2VMDA 3KXFB 1BZEA 3G5ZA 3LIZA 3Q8BA 3BUBA 4G9DB 5AKTA 1UYWL 4RVBA 1QTYT 4L3CA 3LRGA 1ND0B 2QTVA 1KTLB 4A6YH 1AZBA 2NR6D 2IPUG 2UWEF 4X98A 4P2RD 5DD1L 3QZWG 1DBJL 3KBFA 4QRBA 3DHMA 3WEOA 1QX1A 5DC0A 4YWGL 4D9QD 2XIDA 1UXWA 3QT2A 5IFJA 3N1GC 5EF0A 2X89A 2DMHA 1S9XA 4G6JL 1JPGB 1XTLA 3FQNB 1M3IA 4ADJA 1TVBA 3ZDYE 1A6UH 5FKAA 2NX5E 1PY9A 4R7LA 3PU7A 4GAJH 4HUWA 4P5MB 5D5ME 2DI7A 5IFHH 5HI3D 2XX1A 4DGUA 3RUGB 1NFKA 3SJVD 3WGUB 1CBVH 4FGMA 3QWOA 1HQ4B 4LNRB 3PJSB 4MDIB 3RURA 1OPOA 3JWNC 4R6UA 1K3IA 3OHMB 2YUXA 2OYPA 5C6PB 3QXDB 3S3SA 5CUSL 1U8HB 3SKNA 1YEJL 5C07E 5DMIL 1E4HA 3BUQA 4JO4H 4DERA 1XT5A 1WPCA 2KH2B 1FORH 4R90H 4PJ8C 5IB1A 3ZVVA 1BM7A 4HKBB 5JZ7C 2X4TB 2JIXD 5TQ2L 2K1MA 4DEUA 3WHXA 2VDLH 2XVBA 3LRSB 1RIHH 1Z1WA 2YKKA 1MIML 3BUIA 1QNZL 3FL7A 2BHUA 1WGOA 3HNTL 4L9LA 5E6ZA 5E9NA 5EN3A 5IR1B 1ILUA 4PV9B 3IDIB 3H2QA 2FX8L 3DIVA 1BVLA 4GBXD 2YD6A 3QUZC 4GAGL 3UYRL 3EGSB 5JXEA 1J0YA 3CUPA 3WIFA 2Z8SA 3L95A 5EC2B 5IQNA 1JHTB 2FYYA 3TJEL 4HHAB 3VXSE 5B3JF 2NSXA 4PGCA 5AOKA 2FJHB 3MLXL 2JKXA 3MV7B 1KIRA 3M1BB 4TVSa 3TM6A 4BZ1A 2X12A 2ZCKL 1A3LL 2LLGA 3S36H 5H37H 3AU0A 3V6ZB 4PRPA 2J56A 1QWNA 2J8UE 4XN7A 2CRIA 4JDEB 5KOVC 1T21A 1OHQA 3CIAA 1WVZA 3FQRB 1YEKL 2KL6A 4XWOD 4X50A 3VFGH 5GRVL 3VI4E 2CK0H 4GQQA 2AQTA 3WS6A 1I3GL 3RY5A 4X6CF 4MBOA 1JMZA 3WLWD 3EJZD 4M8VA 4PREB 5HDLA 5C9JA 1SPDA 3QDGA 3LKRB 4D2NA 3VX0A 1MCOL 4PRIE 5I0WA 1JERA 1S5HA 1KN4H 4N86A 3FT0A 1HSBB 4JM2A 1H5BA 4NC1C 2VOTA 1L9SA 2MTPA 4H1LB 1CVRA 1FDLL 3K4ZA 4FHJA 3DX6B 2P7TB 4NQDE 4P59L 4NENA 1XF1A 5GGSB 4ORZC 3I2CH 1L0QA 4KZEL 2B16A 1M7UA 3BPNC 3I3BA 1CGUA 2DLIA 5KVFE 2JKTM 2NY4C 3MTRA 4PJAE 3QXAA 3NIFE 2CLVB 5JHLL 3MLYL 3WV0A 1AI1H 5C7XH 3MCYA 3DBXA 2QBWA 4OH2A 3FSAA 4JHVA 1BEXA 3H0TB 1INQA 3VXQA 3JTSA 3GMQB 3V4VH 2Q86B 4ZW6A 2X6MA 3JWOH 1IVLA 1IEBA 4G3YH 3U4EA 3IF1A 2ZKHH 4IU2B 1QQDB 2DQUH 3ZE0F 5FO9B 5I19H 4JZOA 3QUKA 4MMYA 2Z8RA 4L37A 3BP7B 2A2QT 3ETSA 2OULB 1NDMA 4JRYB 1RUAL 4ADIA 4HPHA 4Y2LA 4LEXL 1IKOP 1YYMH 2KZWA 3O8XB 4LARL 2OYKA 4UUJA 5E8EA 5KSVB 1HZHH 3HVDA 4Q14A 2GY7B 4D8PA 5GHWH 4Z7WA 3L5XH 1R5WB 4QGTA 3K81A 5D1QE 4CKQA 1UJTA 2R0LL 2DQDH 3MNDA 4N0FB 4ONFL 3O6LH 3HN5A 4S1SL 1HDMA 5ENWA 5AW5B 4A2EA 2A9MH 5DHMC 3W0WB 3BAKA 4YX2H 3STBA 4CN1A 4KXCA 2YN3A 3VRIA 3LNFA 4TPRH 4PLKC 3FHEA 2VDKL 3VFVA 1JK8B 2YJQA 3I6KA 4X5XA 2ADIA 4KKCD 3ZYIA 1CICC 3W9DA 4ADGA 4AV5A 4PRHA 3KXFE 3MKGA 4QRUA 2BHZA 1CDGA 1S6NA 5EEZA 2FBOJ 4E9RA 3EOAB 5L2KA 1W72H 5G4OA 3D85A 5HGAA 2VXQL 3IDUA 5DT1H 3SDDB 4E41A 4F15B 1ED3B 3QIBC 4WW2A 2YOAA 2JK5B 3M17B 3IDXL 3DX8B 4LCWB 4Y1AD 2BCKB 1TPXC 5F7DB 3K71A 1NOFA 3RVTC 3KVQA 2F54A 1E4KC 4IOSA 5FGCB 2HG5B 4EN3B 3D7PA 1OE3A 1F5WA 3UBXI 5MEOA 2R0ZL 4N0CD 3X1NA 3ZX1A 4LGRB 4LIQL 4XMPL 2B14A 3T8XA 2SEBA 3RDTA 3TX4A 1JXDA 4ZQKB 4YR6B 4PLJD 5EV7A 3DJSA 1MCHA 3WDIA 3RUGE 4OTXH 3P2TA 1CE1L 3VXTA 2WXFA 5AW8B 4HD5A 2XHNA 3ZQXA 5AL0A 4LRIA 1MWAB 1D2PA 5FOBB 3GMMB 4DKTA 5BS0B 1E2WA 3NTCH 5EO9B 3VM5A 4ZZKA 5GZNA 4OLWH 4CVXB 4WHDA 2EIZB 4W9GC 1JD9A 3VXMA 4NNYB 4B3VA 1SHSA 2BNQB 1MNUH 2ZYRA 1KXTA 4QKTA 5EUOF 5J1TC 4B9JA 1GW6A 3T0BA 3WJJC 5ANMB 4LP8A 2FTAA 5JIHA 3TO2B 2J2ZB 3MLSH 2VZUA 4F7TA 1H3WM 1SXAA 4KV5F 4MS8D 1TDQA 2DWEB 2Y7NA 3KLAB 1HT6A 4BKSC 3UYPB 1SEBA 3TN0C 4CVUA 3HNSL 1PCSA 5D70L 1ZLUH 1RPUA 4EZKA 1OTSC 3IFNH 1EZVX 3EHBD 4OZGB 4XVOA 5CWSA 1QR1B 1XHHA 4EZJA 1AIFB 4FNSA 4K07A 1HHIA 1KBPA 5B4MD 5KW9L 3QJFA 3SE8H 2X3AA 1YCSA 1WZMA 1ZWIA 3F12B 5HDBB 3F05A 3HC4L 1DSWA 3BMVA 4MAZA 3NH7H 3FXIC 1P5VB 3CU7A 1RJYB 5F9JA 3P77A 4OZIA 5CXPA 1NSNL 1FNHA 5GS0L 2ZAIA 1XIWB 2R23B 4IHOB 4YPGB 3MRHA 3APDA 5FGBA 2VDOH 2OQJA 3NFNA 3BRFA 4LOUD 2TRHA 1FPTL 3BFOA 3APFA 2NYYC 1R6VA 3MV7E 1Q4NX 4QHPA 1KTRL 3VDBA 3QHTC 3WTTA 2DQ6A 3UDWC 1KB5H 1AGDB 3VFOA 4WY7L 1AGCA 3QNZA 2J3SA 1CC3A 1U4EA 3F83A 1Z9SA 1T7ZA 1YEDA 4YBQD 3ROOA 5BVJB 1SDAB 3BEWB 4TYUA 4M62L 1QSFA 1NCTA 4KQ3L 2YMXL 3QDJD 4Y4KA 3OMNB 2NXYC 3GK8L 4IYKA 1ZLSH 5D1ZI 3FB6B 2F74A 3H7BA 1SBSH 1YUKB 2D73A 5DRXB 2IAND 4JB9H 4K94L 4NQCE 3FTUA 5LNGA 4FFWC 5GGRY 2WXMA 4Q0XL 2DQJH 4LLVB 3T09A 2GTWB 4GSDL 3F7PC 2H32A 3BZFA 4H5SB 2IMNA 4N3TA 2OS7A 3FT3A 4M6MH 4ZX3A 4K7PX 1AQKL 1KY6A 1MW3A 5F1OB 3SD5A 3O3BA 2RD0A 1UM5H 3SCMB 2FNBA 3UZVA 4KU1A 3WIAA 3QUXD 1KULA 3RWCB 1TYRA 2A6JA 2VLLA 3FTXA 4NKIL 1P4LA 4AIZA 2CIKB 1G87A 1E40A 1QA9B 4HJ1A 3TZVD 4Y4FC 1I7UB 1NFDF 1P69B 2FJGA 2DEWX 4ZX5A 1L0PA 2JVUA 3TWCL 2MRYA 4QHKJ 4M3HA 2HN7A 1U8LB 3DOSA 1JPFA 4KXZI 5BJTA 4HIHA 2E9IA 3NCYS 1CGVA 5E1AA 1I3UA 1E6OL 3WIHL 3FRPG 4HCRL 5HBBA 4KI5E 1CYXA 3RWDA 4LSUH 4NS0A 4ATTA 1HHHB 2FQFA 4WVRA 3CVIL 2VLRA 4H8QA 2LE9A 4LHUB 5TGBA 3QNXB 3HR5A 1SHWA 3ES6B 3FQ4A 3VFTA 4U6VL 1EH9A 2NX5D 4UZSA 5E9DA 3B7TA 5B38B 4JRYE 4NEHB 1JPST 1RH8A 1GS7A 2VQ4A 3GXFA 1KB9J 3QJHA 3ORJA 4FFYA 4MAYD 2QPEB 2WLLB 3ZY7A 3QFJA 2NZ9C 2OMYA 3R8BB 4YAQB 1SM3L 3I9GL 4EUPA 1M56B 5HHPB 1GJUA 4P23B 3LAFA 1HK6A 4KQ4H 3O2DL 4X5LA 2YFNA 3PJLA 4A7TA 1BQRA 1W8EA 4YHLH 5CEXA 3IETA 3VFPB 5C07D 5IKCB 1E8YA 3W3BA 4U1IA 4YSOA 2VMJA 4ZDHB 4HSAC 1QFHA 1IVTA 3TVMD 1FNSL 1R3KB 2KS0A 4APQC 4EI6A 1AJ7H 3KS0J 4E9QA 1AACA 1X5JA 1MAMH 2CA3A 1BYOA 1OP5K 2R1XA 5K9KB 3OGCA 4ODTH 2J43A 2MEJB 1OCOB 2QVMA 1S7RB 4LCWE 3S3DB 1R1CA 1MFDL 4RGOH 4J23A 1MUJB 3E1ZA 4AM0A 1OGAA 2QHRH 1E5ZA 3WXVH 4JFTA 3K5RA 3Q0HA 4XO8A 4MTMA 1RZ8B 4BFEA 3IJHA 4XNQB 2N01B 2R2HA 4WSGA 4EE2A 3BAEL 1QLFA 2C7UB 4NJAL 3Q2VA 1DQJA 2NNXA 3CH1A 3ZKXB 4CADB 5GXBB 8FABB 1EANA 1J1PL 5T33L 5TFSH 1J87A 2IF7A 3CDZA 3LKOB 1HL9A 1RIVL 3VNZA 5IESH 2CHDA 4JO5A 1EV2E 3ARBA 3OHXA 3BGFC 3MOBH 3VXSD 3KBEA 3QZNA 5K1VA 5BS0E 1CU4L 3AABA 1L5GB 3VFNB 1FO0H 2WQWA 3FUKA 4KK8D 3UTSA 3SDXB 5KSBA 4XO3A 4KJYB 1YNTA 3TASA 4ELMA 1QG3A 2AVFA 1BPVA 4OGQC 4Y2OB 2DTMH 4I0PB 5BRQA 1N18A 2BNQE 1NAKH 2C4FT 2WVVB 3L3DB 2R0KH 3U4KA 3QHZH 3CFDB 5GGSY 2V2TB 3MGOA 2XCMC 5ANME 4PBDA 1PDKA 3O0LA 1L9NA 3TBVA 4OIFA 2D03L 3QI9C 1QYGH 1PYWA 4FD0A 3Q44A 4ZMWA 4LE8A 4PJ5A 5GS2H 2Z6FA 3HMWL 1HH6A 4HJGB 4OZFA 2AV1A 1SJHB 1NOLA 5D6DC 1A3RL 5DTFA 3QWRD 4OZGE 3TNMA 2EDJA 4OCLC 4ODHL 3U1SL 4GINA 4DP8X 4PRID 5MHSD 4GRWH 4G6KL 4M6OH 5C0GA 1WIOA 2AXGB 4AMWA 3SOBH 3V0AC 1MFAL 5IJKA 2VXVH 1IM9D 2EO7A 4Y9FA 2WO2B 4TTDD 1ZHKA 3LNDA 2JI1A 3MLTB 1Z5YD 4NQDD 4OLUL 4GY4A 4F3FA 1KN2H 1NC4B 5ECGA 3N0AA 1W9XA 5DJCB 1UZ6F 2ZKMX 3BKJL 1UCTA 1DVFC 2R7EB 5E2UH 4PYGA 3OKDB 5KVEL 1UA6H 1WISA 3QJSB 4X7FC 3V0FA 4JM4H 4RESB 1XF2A 4U1KA 4PFEA 1OANA 4X8GA 5BRZA 1MWOA 3K8KA 4UT9H 2C9RA 3C6LB 4NKMA 1M71B 3U4BH 1X5FA 1J1XL 4ZYKB 4ZFZA 5EOTB 3T4AB 4Z8FH 1K9TA 1JVKA 2BSRB 3N1QC 3HR6A 3S4SB 4Z78A 1Q0YL 1DJGA 1S5IH 4LFHG 4EZLA 3AGWA 4C4UA 4ZXBC 3DV6B 3UBGA 4G7RB 5DLML 5I17A 3KPTA 4IOIB 3QUYD 3MLRL 4MHHG 3Q48A 1ADQL 3QH3A 2F19H 3A22A 4M7KH 5E7BA 4WIQA 4UOJA 1F8TL 1ZSHA 2VISA 3DVIA 3O2VL 1WT5C 3MZTA 2M83A 2D3JA 2ZUQB 4JO2H 4UT6A 4U6TA 3OJDB 5B39G 5D1QD 4OJYA 4K5LA 1BG1A 2WVUA 4ONGH 4JHWH 2PXYD 1JWMA 5DHYB 5IVXB 2WTPA 4Z7UA 1XF4A 2E86A 1J5DA 1PJ9A 4U6XA 4PRNA 2YAEA 3KXFD 5C0BB 2WP3O 32C2A 3WNPA 1UWYA 2KLRA 3S5ZA 4ZFOL 1MCJA 3I50H 1BPLB 5D7SH 2CHNA 3FZUD 5CJQH 1OAZH 1JXGA 3B43A 2VDKB 3NUKA 1J86A 1SJEA 1Z2KA 2DQCL 2EADA 4TNWF 5CGBA 3GSVB 1N19A 4P2AA 1KLGA 3R0MA 4RDBA 4R83A 4OGXH 5ABZA 3HE6B 5TQ0H 3PQYB 5CN2A 4AL8H 4AEFA 2BNRB 3CBRA 3DRTB 4FAAB 2A9CA 2HUEA 5EBWB 1I8IB 1N3NB 1F56A 4RWYH 5I1KL 4R26L 1NCDH 4ZUVB 3PABB 3WJLA 2RH0A 4V2BA 3I75A 1BDYA 1BOGB 1ZHLA 3Q7JA 2P8PB 4MMXC 3ZTDC 5FIEA 2NLJA 4RAUB 5CZRA 2IDFA 2YK1H 2CJTA 3NAAH 1XF5B 1DE4A 4JW3A 3N1PC 5CLXA 4XXWA 4FERA 5D6CA 3FU8A 3F7KA 1K4CB 15C8L 4XCFL 3VH8G 1MG2C 4MJ2A 5ADPL 2E9JA 2PO6C 1O9WA 3ULUF 1JRHL 4JPSA 5F9WB 3X2QB 2GAZA 4HWBL 2X2IA 4O2EB 3OF6A 1QNIA 3SKJH 4EUPG 3FUDA 1UOLA 1F6AA 4GW5B 3O3AA 4O51B 4OB5L 1E4WH 5IQ9A 4MYPA 2DL2A 2VKXA 3BFWA 1KXHA 1MJ8L 4QYOB 1RY7B 1CLZL 5EZOL 3KMDA 9CGTA 1L7TL 3NDZE 4CVZB 1ZHBA 4NN6C 2HH0H 3U46B 4XMKL 4DP6X 1FRGH 2B3IA 1IFHL 1M1SA 4PJHB 4L23A 4WO4C 3MJ8B 5KANG 4BSVB 4YDLC 3QEUB 4HS6B 1WWCA 1FHGA 4BSWA 2G2NA 4FS0A 5D4HA 4B9FA 3B5TA 3EJYC 5SV4A 3TA3C 1LQSR 3VFWB 2XZQH 3ULVH 2BVTA 4JO3H 3IJSA 3NIGB 5FEBA 5CEZH 1OD7A 2UZIH 4BKLB 5L6YL 3QIWD 3LDBC 6FABL 5DFVD 1AZRA 3CH8A 3MNZB 3V4UH 2ZONA 2WJ5A 4QAWA 2EC8A 3W9EB 2P45B 3ISRA 3TTYA 1A65A 3TBWA 3OXSB 2P42B 1CFQB 3MJ7A 3P3YA 5DK3A 4G9FE 1JD7A 4AI7A 3SDXE 5KEZA 2P5PA 4MSWB 4NZFA 1DDHA 4MLIA 2NMSA 1IJNA 3MXWL 4Z77B 4J1UB 4GKNA 1VGEL 5E95B 1P9MC 3L9BA 1AVAA 5J12B 1KBGH 3P54A 4B5EA 2BZDA 1UT1A 4QXGH 1IE5A 4FLQA 2UWEB 5DZPA 1XZ0B 4FQHB 3OB0H 2BSCA 1TVHB 1RQ5A 3N06B 4DO6A 4MNHB 5LDSA 1BM3L 4FTVD 4LB8A 5EH1A 1AC0A 5L0QB 3BQUB 2AJZB 1QLRA 2C3VA 3AZUA 3J27A 4NQCD 4XO9A 2AKRB 1CFBA 2W8CA 4KTYA 4DW2H 2NQCA 3VA6A 4XPBH 3FQUB 2A6DA 4PJCF 3DUUB 4K23L 3H4FA 1FYTD 1N64L 1WWAX 2I69A 3T08A 2MPAH 2PABA 2Q20A 3WGVB 5CD5D 2YWZA 4EBQH 1I1YB 4PGBA 1UENA 1CG9B 4HX1A 2KDYA 4QRPB 4FQQA 3TBTB 1A6ZB 4FKKA 1AS6A 2E9BA 1Q38A 3IXTB 5I8CB 3UTTD 3ZZQA 3RJQB 2XTLA 3LRLA 5DMJB 3HCVB 2JJTA 3BP4A 3U36A 2DF3A 3FT4A 4H0IA 4KI5D 1G7QB 3A6CH 5AL8A 5AG9A 4LLMB 3EH1A 3KYOA 5BRPA 1ZVSA 5IBLD 4L18A 3AGVA 2BNUB 4OKDA 2VC2L 5DUPL 3F7YA 3BLPX 4OLEA 2R69H 5JIDA 2IDUA 4XP5L 1A7NH 4HWZA 2NQ3A 4JRYD 1WZAA 2DQGH 2YRBA 4ODWB 3MRKB 1AGBB 3O8XD 2C3GA 4MNQB 1F13A 1PL3A 3ARFA 3SGKC 3H3KA 2XV0A 4QXTA 3HI5L 4M61A 1I1RA 4GS7C 3QK0A 4R4FH 2GJ6A 2AQNA 1OT1A 3QCVL 1GIGH 4NO3A 4PY7B 1F4HA 3GPEA 5DD6A 4RNRA 5IVXE 5T1MA 5HGHA 2EAEA 4JKPL 1JK9B 4CVWA 5C0BE 2O61A 2DIJA 3S8FB 1MI5B 3IS0X 1KXVA 4NQXA 2DMKA 4KK6C 3L4UA 1OARH 4GSUA 1MFEH 3MFGB 4OCSL 4D9LH 5HDOA 1AHWB 3KE0A 3QDMA 3SZ6A 1FFOA 2PW1B 5GRJH 4G59C 4YDKL 5IIEA 3RIFF 5BVPL 3T2QA 4EN3D 3U6RB 1D5MB 1E27A 3QCUL 3PQYE 2P5WA 1B90A 4P2OB 5D2NB 3RHWK 3MGTA 1RHHB 2FB4L 4ZFFA 3GSUA 2IDTA 5B3NA 3MTXA 1L9OA 4APXB 4GUOA 4PRDA 4Y19B 3SE9H 3L5IA 1WG3A 1J9CT 1WUNT 1UYWH 2J25A 1NCAL 5CCJA 4LLDB 5CGTA 3I85A 5BS0D 2CLRB 4KC3B 5DD1H 3CFNA 3DTXB 1W0WA 3IDGA 4YWGH 2HZHA 2X2UA 3WY1A 5E56A 2Y2YA 2CDGB 1HILA 4KGLA 4XCYA 2AVGA 5DD0L 1X5MA 3A4EA 4OF3A 4OSUL 3WAKA 2X09A 2Y36H 5L7XL 2FEDD 4JZJA 4FJ6A 3FOLA 4NAJA 3SJVA 2MSPA 4QCIB 5L4JA 3DVGA 2BX5A 4ESKA 3PXJA 1UXSA 1XB6A 2IQ9L 2BVQB 2XKUA 2B59B 1RXLA 1UD6A 1ZY9A 1NLDL 2Z35A 2ZICA 3IGFA 5EWIL 5A16A 2WKGA 2NUTA 4BFNA 2WWOA 2WJ7A 4PJHE 3APCA 5GRYA 3ZE0B 4Y2NA 5KYUA 5ANHA 3LZOA 1YYCA 5A6LA 2H7WA 2FWUA 2QGDA 2G4EA 3NIGE 1OGPA 1XEUA 5CUSH 2VABB 3N42F 3B9EA 5DMIH 1IC5H 1XIWD 2ZSVA 4LCCB 2OA9A 3LQZA 3O6FB 4XNZB 1QABA 4ZS6D 4OZ4A 2XJKA 1A6PA 3L7EB 4FQIL 1RFDL 5F3HA 5KSAC 4KK5C 2ED6A 5HYSG 1ASQA 5I2IA 2BP8A 4WTWA 2ISDA 1JXJA 2HVKA 3CHOA 4KNSA 1NM9A 5KYYA 3UZQA 2OX5B 2W9DL 1KEML 1MIMH 3Q1SL 1J0ZA 1VENA 1QNZH 2DWTA 2J72A 2FD6H 3G04A 4EKJA 4DHLA 4ZPVB 3WEMA 4YVNA 3HNTH 3LVEA 2UWEE 3CZGA 5HSFA 3AY4A 3G9VA 4O02A 3STLB 3GSOA 3K72A 3F5WB 2FX8H 2HRGA 4GAGH 4LLUB 3EGXA 1W0YT 4PBVC 3EYQC 4XPHL 2PPDA 3UYRH 1XB8A 1BV8A 3RX7A 4XGZA 5E6IA 3KPNB 4WRLA 2A0LD 1ZXKA 2AJYL 2BOBA 4OI7A 2KZKA 3JVFC 1S9VA 1WBZA 4IRSC 5ESVA 3C6SA 5KSUA 5E08L 3MLXH 2NY1B 2Z93B 4NQVA 4UMGA 2CO1A 4C83A 2ZCKH 5K69A 5IK3B 1A3LH 4FXKA 5KS9F 3FB5B 1RMFH 3PG2A 1EEYB 1TMQA 3GSWB 1BF2A 1CT8B 1KPVB 1JNNL 4XNUL 1YEKH 4QRPE 3VYNA 4XX1E 1A14L 4F7CB 4MXVF 1U8MA 1I3GH 2YBRB 2IOIA 5CM1A 3FN0L 2BVUA 2O5XL 2FHFA 5GS1B 4I48A 4ALAH 4LVNB 4P3CL 3P11L 4LEOB 4NPJA 3SDAC 1M9SA 2N1KA 3NA9L 2CBQA 2HSIA 4IRZL 1WC7A 4W4NA 4MB3A 4MKMA 1FDLH 1JZFA 1BIIB 3L2NA 3QZPA 5D7JC 2HG0A 3Q8CA 4HUXB 1DLFL 3RL1B 3AQDA 4P59H 1B3IA 1KCSL 1LO4H 2OMBA 1GGBL 4H8UA 1ETZA 5BMFH 3ZZLA 3ESMA 4WI6A 1JYNA 3P40A 4KZEH 4PJFF 4MA8L 3G6AB 4HIPA 1B4RA 4MNQE 3L5WB 1Y1UA 1SHMA 2FWOA 3TO4B 4HC1L 1U3HA 4PRBA 3CN1A 3HFML 3NJIA 3V55A 4DZ8B 2FSDA 3MLYH 5JHLH 4QF1B 1IC7L 3T77B 1K5NA 5JOEA 5DJ8B 1VEOA 4UOZA 5AOLA 1GYWA 2XN0A 3EYSL 2MNJB 5HI5D 4HUNB 3SODB 3S3JA 4ONOA 1WH0A 4F37K 2HFEB 3FONB 4Z3JA 4NQSA 4AW7A 4BH8B 3HC2A 1JZ8A 4U1SB 2I7OA 2VL4A 5IQMA 1MI5E 1B2YA 1QBAA 1WFOA 3K2MC 3LNGA 4CAGA 4HULB 4XBEL 2PUQT 3C8DA 1E3FA 1EGJA 2CDEA 4GSQA 1KENL 1RUAH 4C57C 1A9EB 1L7IL 4LEXH 5C0JA 2UXTA 4MJ6A 4BFJA 1PG7H 4UDUB 2EE0A 1KGCE 1DN2A 1IAOB 2AK4A 5C09E 5D2NE 5M7QA 1U8PA 2VB5A 1F11B 2R0LH 3ISWA 4LGPB 4S1SH 3HZVA 5K1JA 5BUPA 4P2YA 3DIFB 2IWFA 3QPQC 3MRRB 4S0SD 1F97A 4JLRB 2VDKH 3CQPA 2YA0A 4D7BA 4Y19E 4AGOA 1WBYA 3KEHA 2YXMA 2ESVB 4Y0GA 4A1RA 1A5FH 3K4DA 5C08B 4B96A 3P4OA 1O0VA 2VXQH 3TOPA 1KIQB 4G9FD 1QFWM 1TUPA 4AQ1A 4N6RB 4ZW3A 1ZRUA 4F2MB 4WI0A 2HKHL 3IDXH 1D5XA 3ARYA 5ICZA 3CNKA 3OKKB 5D7IB 1KWGA 1G7PA 1NGWB 1NFDB 1J8SA 4I0PD 4L5FL 4P57B 2DOCA 3SQRA 1EA9C 3WTSA 1JGDB 2R0ZH 1TU2A 3RNKB 1NGYA 2MQ3A 3V6OA 5E0FA 1PZ2A 3FCTA 3AB0B 4M4RA 2M8XA 5CNHA 3MBEC 4JFVA 2B9BA 4P3DB 5D93B 4OCMC 2E4TA 1OQXA 5DQDL 4HYTB 3V4PA 5DJDA 1CE1H 5I6MA 4UM9A 3ZE0E 1PIFA 4WFFE 4P5TB 3TYFA 2X4OA 1ZE3H 2WSDA 4XC3L 3B5GA 2XBTA 2XFGB 5IVZB 2HX9A 3VWJC 4X4XA 2I5YL 2HMIC 4QNPF 1RJZA 2A83B 3LKQB 2HJKA 4O2CA 1NC4D 3CIQA 5LBSL 2VUKA 3EFOA 3TIDB 2PCPA 3VFUA 5HYEA 3FB7A 5DI8A 3C60A 3KPLA 4QWWD 3E8UL 4KHTH 3IXAA 3N40F 4AQ8A 1U8CB 4OZHB 3HNSH 3SGEI 2AJ3B 3JSSA 3H2WA 2P48B 2GT9A 2NY6B 3EO0B 1BFVL 3C6LD 5K9OA 4MA3A 3MNWB 1KB9K 4I9XA 4K9JA 1MCCA 5KW9H 4IIQA 2YD8A 2W94A 3E2HB 3F64A 3HC4H 1NEZA 1Y18A 2JKRM 4HIEB 3SYPA 1LE5B 1PLBA 2ADGA 5DK0A 1OAUL 4M1GL 5D72L 3ELAT 4XHQA 2OR9L 4DPRA 1NSNH 5E00A 3C9NB 2YJLA 2JF1A 3T1FA 3L3IB 4A2HA 4Q9QH 2V5RA 4ODBD 5E5LA 5MP6L 1MCWM 1SOKA 5EEXA 5FCSH 4IS6B 1FPTH 3EO9L 4MBRA 2C1PB 4ZI8A 1HEJC 4ZX4A 5I6NA 2OMZB 4R5XA 3D9AL 1MEXL 1QBBA 3AFLA 3V79C 4WY7H 4WW2C 1MAJA 2DKUA 2BDNL 2GC4C 3AT0A 2BSED 1M2VB 4ZUWA 3BUYB 3MO1B 4Z3GA 2FL5B 2DJMA 2FO8A 2H2PC 3QDJA 2ICWB 1RZJC 1KLUB 2VQUA 1X9LA 3SY0B 5IW1B 4DZBB 1RPKA 4MA7H 3U7YH 1CFSA 2IBZY 4AENA 5C0BD 2WQXA 1D9KC 1DSFL 3KPQB 1Y7VA 4KQ3H 2CQVA 3FRUB 2DYSB 3ZHDA 4G7VL 3GKWL 3GK8H 3C8KA 5SV3A 3UGUA 1W0VA 2NZ1A 1ZANL 3VB9A 1KDJA 1LEKB 1AQDA 3ZMNA 4LCYA 4AMKL 1PFOA 3QUXA 2Y1ZA 4Q0XH 5F6HJ 5HPOA 2P28B 3DX1A 2XG5B 4GSDH 3MUZ1 3PQYD 4YXKH 1E50A 4I18B 5AW7B 4ANUA 3B9AA 3HB3B 1CE6B 3MLUL 1E5UI 1AQKH 4NPKA 5D1ZB 3RBSA 3CX2A 4PM1A 5IOPA 2P5EA 4YBLB 3KBPA 3ARTA 1RZ7L 4NKIH 1XCQB 3HN8A 3MV9A 4KITB 3TJHC 2AJVL 1UB5B 4WUUB 5FFGA 4OV5B 5JTWA 5EORL 3IDMA 4EDXB 2I9TB 1S7TB 4ZQTA 2XXGA 3QJTB 4JCMA 3TWCH 1WFUA 3BH9A 4N2BA 1ONQB 4TL5A 4DN3L 1RZFL 3REVB 3UMTA 2E74C 2XZAL 3BPOB 3IM1A 3WKNA 2ZG2A 3I3EA 3EYVB 1E5CA 5JORB 3WIHH 3RVXD 4ORGA 1CVSC 1YAZA 2DLHA 4FKEA 5B3SB 1BZ7B 2F58L 1RI8A 2X3BA 4FYRA 2Z31A 1KZQA 5HD8D 3U7AA 5GGQL 3EH4B 2B0SL 3L3OA 1I8MA 3N3EA 2F53B 1DJYA 1FV1A 1RUML 1JDDA 4N25A 4ODUB 5I6OA 4QY8A 3X12B 4X83A 1T80A 1IKFL 2FQGA 2Y24A 1EJ6A 3I9GH 2ADJB 3PXLA 5CJ5A 4ENED 2V2XA 3TVMA 1XD1A 1CFNA 3DROB 3F85A 3FN9A 3GSNL 2VO5A 5IQOA 1XWVA 2XWBB 3VGDA 2IV9A 1T66C 4PVMA 3DHPA 5IHZA 3CSYA 1HJCA 2F1BA 4ILDA 2ESVE 1GAFH 1BCIA 4J4PA 5C08E 5DVLA 1UZ8B 5AVYB 2VIRB 3OMAB 4ZO6A 3HW7A 2X4SB 3AQXA 2MH4A 3SGJA 3QW9A 3CXFA 1NIFA 1EEZA 4F2ME 5DDHB 5FF6A 4PN6A 1D5RA 1FVCA 2F2HA 2Q5BA 4N9GA 5EO1A 1MFDH 1RURL 5D7IE 1NFDE 4E68A 3NJHA 3WY4A 3WMQA 2FDBP 3UO1L 1ZGLA 3W81A 3MRPB 1K4DB 2CO2A 2G3XA 3BAEH 4K7FA 1QFWL 4NJAH 5PCYA 4G2AA 5IEKB 5T33H 2QLYA 4KVPA 1J1PH 5BZDA 1UFUA 1SQMA 5TDOB 5BV7C 4ZO9A 1RIVH 3OKEB 4XCEB 1N0XL 1U93A 3MRGB 3VCLB 5DMKB 2RGSA 3VD5A 2W60A 3NVQA 5K39B 2HVJB 1CU4H 2J8UA 2QTEA 4JAMB 1B3JA 4FLOA 3T65B 3LZQA 3CVHA 4IMKA 3ZDXF 1GOFA 5EIIA 5TH2A 3IJYA 1AIZA 4QRRB 2DYPA 3FU0A 3QJOA 1KELL 1NUGA 4PV1C 4YIQA 4M7ZB 3PWLB 3FH7A 2EXSA 3ME0A 1N6UA 4XNBA 3HMXH 4XP1L 3L5HA 3V7AE 4H25B 1FLTX 1SYSB 4QRPD 1F4AA 2D03H 3VXRE 3CHSA 3M45A 4N8CL 1T1ZA 1UH4A 1KLFA 3FUEA 1FLRL 1MHEA 4OZHE 2PYFA 1RUKH 1Z5LA 3HMWH 2W0PA 3PCYA 1A3RH 1IM9A 3JWDL 1U2CA 3CZNA 1G7IB 5FUCC 4P4RA 5IB4A 4ODHH 3U1SH 2H1PL 4RQQA 1ORQA 4HBCL 3EGDA 1D7FA 2NZIA 2XIBA 1TQBC 1U8QA 4NUJA 3VTTA 5I1DA 5IHBA 1NAMA 1I9IL 1WTLA 2A1WL 1MFAH 2XZZA 2IAAC 2IOOA 2ZYSA 5DGQA 4PJIA 5EU7E 3ZTJH 4POYA 5JLZA 4JQVA 3D2UA 2QKIA 4KGJA 4OLUH 4KKRA 4PJAA 5GSRB 4ECNA 5I1AA 4X6FA 1RAMA 1I85C 3D0VA 1P1ZA 1G7JA 4OJFL 3K8LA 5DJ2A 4MNQD 5KVEH 3BP5B 3HRPA 3QORA 5EMYA 1KYAA 1H8OA 3GZQA 2AQ2A 5CLYA 1M2OA 4DN4L 2YEZB 4WW2F 1L9TA 2XZCL 5DYOA 3ZDZF 2BK8A 4K2UL 5TDNA 1J1XH 1IC0A 1A7BA 3O11B 1OT4A 2P47B 2W88A 2KI6A 2DMGA 3AM8A 4JG5A 1Q0YH 3BPCB 1N6QL 1MI5D 3OL2A 5H94B 1ITBB 5DK2B 5BZWA 1C5CL 3J2PA 5E24E 4WW1A 4TQEL 5DLMH 5E8DL 4RZCA 3NCXA 2OMWA 3MLRH 4G5AA 5H4YA 3WI9A 2EDBA 4HWEL 4NO5A 1F8TH 2PXYA 3VD7A 3O2VH 1KGCD 4ZOCA 4F91B 2M26A 5JOPE 5CKAA 4NM8L 5C09D 1J12A 4Y1SA 1INEL 1HCYA 3KXFA 3B2UC 3VFSB 3IVKB 4G9DA 5HGDB 1E5BA 4XI5D 4S0HA 2Q0ZX 4QTHA 4GQ9L 3Q2WA 4QO1B 4HK3N 4MCYB 4Y19D 4WUUE 2DDQL 1FYHB 4YHIA 3A6BL 1VHPA 4FHKA 4ZUTB 4PJCB 1NC2B 1K2DA 1JPGA 1BLNB 4POZC 2A9NL 4PIRF 4B9ZA 1NKOA 1EJOL 1G9MC 4KVCL 3CZFA 3MRMB 5JNYA 2DQCH 4QTIL 3BWUC 2W65A 1QPXA 1FSKB 1VJSA 2Q76B 5I8OL 5HHOE 1OAXH 2W07A 5CCHE 1CD9B 2ERJB 4U1GB 3U0TA 3WY2A 3RUGA 1XAUA 3LB6C 4MJ4A 4U1MB 3SD2A 3OR7A 3UTZB 4QRTB 1KEGL 1JRHI 1U8OB 3DA0A 4QRSA 1EVTC 2H0JA 1S8DA 4R26H 4MDIA 4XMLH 2XYCA 3ZT7A 1RLBA 2WYZA 2NTFA 1OSPL 2JJWA 3BD4A 2CO7A 1FFNA 1YPZB 4G6ML 4JFXB 4WK2B 3VQLA 4OZIF 2OL3L 2F53E 4BZYA 2EQDA 2BP5M 4NDMA 4TNEA 1OEZW 4WFFD 3RKDC 5DRNB 3SBPA 1F45A 2P26A 4XCFH 3SPIA 1J8KA 4H8WC 3VGGA 1QPPA 4RFEB 1OXYA 4QAMB 5I6XC 4XTRC 3WFCL 1KBKA 3HG5A 3C5ZC 4K5MA 2L7EA 4A7VA 2K78A 2VDRL 2UZXB 1UWXH 5IWLC 1JVOA 4HWBH 5KN5A 4B60A 3FUJA 3VXOB 1UJ3B 4GYBA 2X28A 4HJIA 1CDIA 3O6FD 4G83A 3OAUH 2NNAA 2V5SA 2F15A 3DDFA 1O5DT 1MJ8H 3KEDA 1CLZH 5EZOH 5LQBL 3FUFA 1L7TH 2ZNWA 1KXQE 3LH2L 1R46A 4ZO7A 4XMKH 1AKJB 2QSQA 1IFHH 2ED8A 4P4KC 3SDCB 1I1AA 3QIWA 3CHPA 3NPZB 4YC2C 4LLWB 1BZ9B 2X5PA 5JQHC 5JIQA 1AQ8A 3GI9L 3D39B 4R7DA 3T4YA 5I1GL 5EC2A 3U2IA 1RZIA 5HYFA 3LD8C 5L6YH 5AFAA 2FK9A 1CI5A 2RALA 2QADC 3JUZA 4CSSA 3FB8B 2Q87A 1LO3H 5HPMB 4QPEA 4G80A 5JW5B 4JDEA 1PGRB 3AC0A 5C0AE 2AANA 2I07A 3T6XA 3QRFM 4KY2A 4JPIA 1H3XA 4ETQB 1EVUA 1QEWA 2CJ3A 1M1XA 3MXWH 4I4WB 1VGEH 5FC9A 1OGTB 4WFHD 4FTVA 1X5IA 5A6IA 2CKBL 3DKHA 4LSVH 4M5ZL 4F5CA 1JF1A 1TJMA 4DCQB 2MOQA 3IB4A 1XVSA 5EIIG 4B5ZA 1C9SA 3LKRA 4NQCA 3MROA 3ULUE 4WZ9A 3CWGA 3LCYA 4G8EB 1XCWA 4Y9GA 3ARPA 5A40E 2OCJA 3FFCE 5I71C 1BM3H 2CM6A 3WJLC 3NEXA 2Y6SC 4H1LA 2J1ZA 4NNXB 3IJ8A 4TVUA 1W6WA 4GUPA 5GJSL 2IFGA 3MRLA 4ABVA 1T7VA 1FC1A 1FYTA 1MREL 1OF2B 3FNKA 4XXWC 3L3HA 4JFQA 4UAOB 2BSSA 1BQ5A 2DBLL 4HFWA 3KPSB 4JPWH 1Q8MA 3H6AA 2VDNL 3OG6B 1WBXB 4K23H 1PCXA 2ZXQA 1J11A 2EIKB 4JFDA 1WFJA 1IC4L 1N64H 2H9GA 1FF5A 4TOYL 4F1SA 3HAEB 3SKMB 1E9QA 1ZK5A 5JPMA 5E2TH 1BAWA 3UTTA 2EUWA 1Q90A 2ILLA 1YN7A 4JE4B 4F8QA 5IOKA 4AJYV 5KAQG 2KQNA 5IHLB 2RB8A 3P3SA 5E7FA 4ZMYA 3N42B 4WNQB 1PKOA 1RK0B 4P5SA 1EAQA 4WI9A 3LKPA 5IUCA 1CDUA 3FU7A 4H88H 4YBHA 2Q7NA 4YS4A 3QQNA 4U0RC 5AW0B 1I3RB 2ZUXA 1P5UB 3B2PA 4E5XB 1T04B 2XNAA 4YLBA 2ZOKB 3X17A 1IAKA 2VC2H 5DUPH 5KSVA 3QB7C 1E3XA 4HSCX 4UANA 4K7PL 1J0JA 1LHZA 2KZ1B 5FK9B 1GRWA 1BXXA 3A4FA 3NRQA 4OD1L 5GGVY 4UNTA 5HI4D 2IC2A 4DEPB 3F3HA 1XGQB 4FYQA 2YD3A 4ICXA 4RETB 2X05A 2VH5L 5MENB 2QZQA 4BBWA 1CCZA 3TIEB 4HU8A 1KMGA 2KERA 3LV3A 1X7QB 2HX8A 7PAZA 1U6AL 3HI5H 2HJLB 1CBJA 3ZOAA 1FL5A 1KPUB 1IGYB 1TEFA 1JZEA 4XXDA 3A23A 1YNTF 4UQEA 4ELMF 1VFBA 1T3FA 2GPZA 4YDJA 3QCVH 4FRWA 3QZWB 1FVDA 2QPUA 1JPTL 3ARDA 2KBGA 4ODVH 5DQ9A 4YXLL 3TFKD 4ZOAA 4U6HB 1EHXA 2ESVD 1OB0A 4JL1A 2AGJL 5C08D 3P2BA 4O9HL 5KS9B 1LO5B 1TQWA 2OTWB 5F7DA 2WXRA 2DWDB 4ANXA 4WKXA 2BINA 4AZ8A 5IJVA 2IAMC 1SY6L 4ZOEA 2VITB 2YPKA 4OCSH 1EMTL 1Q9OB 3O41B 1UEMA 2XY2A 1U8IA 1QFUL 2X9XA 3HS0B 4GRMA 3RZCB 2X44D 4Z76A 4PJ9B 1OCZB 4CKVX 3QCUH 1WO2A 4XVSL 5DA0B 5F0JB 1VESA 1X9QA 3WBDA 3U25A 2EUXA 4L3EB 4IBYA 2A6IB 2P8MA 2FUQA 5FOBA 3K6SB 4PJDB 5BS0A 4DQOH 3S5LA 1YPZE 5EO9A 4H2CA 4XNDA 4NKDB 1D7BA 1MQ8A 4NNYA 3IU3B 3UG5A 4XPAH 1NCAH 1BF8A 1Z9PA 1Z3RA 1DQTA 3MC0A 4AKOA 3UCRA 1PZ5A 3ML8A 1XH3B 5BO1L 1OSZB 5IBTL 1WFMA 5KVDE 1SJMA 1RZJL 4MFHA 3NN8A 4KDWA 4UBDD 5DD0H 1IBBA 4GG6E 2XLLA 5L7XH 5KJ7E 1EXUA 4R4NC 3H9SA 1DEEB 4HMDA 2ATPB 2EDKA 3NFPA 3VXRD 5IBUG 2VDQB 2IQ9H 1HXMA 5K5YA 3WHE1 2ZWLT 3OAYK 1YJDC 1FZJB 1NLDH 3EIFA 5EWIH 1ODAA 4HLJA 3FFOA 4KKLD 4TULH 5JIPA 5D1XC 1DJWA 1SMDA 4JY6B 4JFFD 4M1DL 3ZR6A 2PWEA 2WWKO 4DP7X 2FHCA 2IIJA 2YN5A 3O3DB 3D39E 1Q0XL 5AB9A 1JXFA 2MHAA 4OCYL 5GGVH 4FABL 4GXUN 3EJCA 1K3ZA 4PCTA 3WMPA 3T2LA 5LWYH 1RVFL 4Z7UF 1AGDA 2YXWA 2ZP8A 3S98A 4DK6A 3TEWA 1R5VB 4FQIH 1RFDH 3GXTA 5FYLD 5G55A 1HCVA 3H55A 3BT2L 4FEMA 3BEWA 3WFEL 3UAJC 2W9DH 3S3CB 3WENA 1KEMH 1TTAA 3BSZA 3Q1SH 4LLYB 3B8SA 4YE0A 4ODXA 1USQA 1AOZA 1OGSA 7TAAA 3KYNB 4M3KB 2UVEA 2BW5A 2WB1A 1MHPL 4Y4HB 4YH6A 3Q3GB 2EEBA 1XH2A 2ICEC 1GOHA 4LLVA 4MJ5A 4XPHH 2I60L 5FYJE 1A9BB 2VXSL 1F90L 1R3LB 2NR6C 3A3YB 3O9WA 5IJBC 2ZNXA 1MHCB 2KC0A 4QEGA 3ZXAC 3FQWA 2AJYH 3QUHA 4M1CC 4JQXA 2X4RB 2CCVA 2YEVB 4NP4L 4DETA 3OLEA 3RWCA 1T0PB 3CFKB 5JOPD 3EOYG 4JDZB 4PCSA 3KPSE 2EVJA 3ULUH 4H1LG 4RBPK 2Z4QB 1KNOA 1OL0A 3KLQA 3DMMD 5D1ZD 1L9MA 4LESA 5AB1A 4PI2A 4XP6L 1J5CA 2BPBA 2JLLA 3NABL 4Z7QF 5HI3C 3H3BC 1JNNH 2ZXDA 4RAVB 3BVUA 4WUUD 2YGOA 4XCNA 1A14H 4HUCA 4F93B 3NCCB 3SGDI 3TF7C 5DJ6B 2IQAB 1YN6A 3C8HA 3WJMB 1YY8A 3AREB 3FN0H 5AAPA 5BQ7A 1ZDSA 2O5XH 1CYWA 1P7QB 3ES6A 2IWKA 4P3CH 3P11H 5DHXB 5I1IL 3LSOB 4DTGH 1XGRA 4HKXB 4F92B 2PPEA 1W6LA 3HE7A 2X4PB 4UQ2A 2D9CA 4IRZH 5HHOD 5ADOH 1PD0A 3BWAA 3EDJA 3ILPB 3VD4A 4JG0L 3PP4L 5FM4A 3FFDA 1G0YR 1JNJA 3GZOA 4PD4J 1RU9L 3DHUA 3QIUB 5TDPB 1GGBH 4XHJD 2P3YA 1AHKA 4LLQB 4MB5A 1CGSH 5BV7L 3DJZA 2YRPA 4MA8H 4JBSA 4N1EA 5MENE 1IGML 2F53D 5DHVA 5LGJB 2VN3A 4AQEB 5FFLA 2F7IA 2VLME 3HFMH 1LLAA 1IC7H 1QFOA 3NRPA 1UADC 1OF0A 2V4LA 3IDJB 4WJG3 4FXGB 4HQQL 1AG6A 2QHLA 3EYSH 5J57B 3F7QA 2QL1A 2EJ1A 2P80A 3AROA 4JFYB 2K7QA 4A63A 1LILA 1YY9C 2DQMA 3VMOA 3EDEA 4GBXC 1O5PA 4MXWH 4L3CB 5KJRL 1ZTXL 4OBRA 1CL7H 1BBDL 2E4FA 5KS9E 3MUGA 4QOKA 2R39A 3GMRA 4XBEH 4X98B 1V5JA 4WI4A 4KFZC 5ID0B 2DLFL 1L9PA 1KENH 1UXWB 1MELA 3H4HA 2J57A 4KMQA 5IFJB 1L7IH 3GRWA 4ZMVA 4LCUA 2WOYA 1S9XB 3KGRA 4KTDL 1TVBB 1KIPA 3EH2A 2IADA 4MXVE 5FKAB 5JPNA 1E90A 4ZAKA 3VVVA 2UX6A 3NK4A 1IBFA 1W15A 4CC1A 5JQIB 4HUWB 4L3EE 3WCYA 1M4KA 4OFVA 3ETBJ 4Z6AT 1KFAL 5D8JL 3LH8A 4PJDE 4I3RL 1D5BB 3MLVL 1XQ4A 4FFZH 4G9FA 3Q6FA 1P4UA 4I8DA 4NPYB 3VTMA 2NNRA 4NX0A 3QWOB 3WLWC 1AZNA 5FO8A 12E8L 1MLCA 1JCKA 1EO7A 2FJFA 2V2TA 3U0PA 2YR3A 1UA7A 3L45A 3H3PL 3BW9A 5E70A 5C0AD 3WIIL 4BXSV 1O9VA 3US1A 2WKOA 2BVOB 4MQTB 4TUJA 2G3ZA 2VM4A 4UT7H 3D18A 3N40P 4WHYH 4L5FH 5IB1B 4HEME 2ZXCA 3A67L 4PJEA 4UZUA 3WHXB 1VPOL 1A0QL 3I02A 4PGDA 1GCFA 5E4IA 3UP6A 2F1EA 1X3DA 1WZKA 3FQXA 3VX1A 3FFCD 2WO3B 4AEIL 1TO5A 5DQDH 1E7UA 5KVDH 5IHUL 4L9LB 1IQDB 5LNDA 2Z7UA 3VSVA 1X5HA 3X1BA 2QEJA 4EI5A 5DJCA 1ADWA 2W9EL 1FNGB 1Q1PA 4F7KA 1HHKA 2VUYA 1DBML 3GHBH 5E1QA 2R9HD 2R83A 2GJPA 2I5YH 3C6EA 3CUPB 1WFNA 2LTQB 3FTWA 3WIFB 4ZJ9A 3L95B 1V55B 4BA0A 2FYYB 5LBSH 4FQJL 5ACMA 5IF0A 4PGCB 1MY7A 3HG3A 5E5MA 1KIRB 4U49A 3E8UH 5H2BA 3ZT6A 5L4FA 1NL0L 3DX4A 2G60L 2KLSA 2OW7A 3FT1A 4Y5XA 4PRPB 5I9QC 1G9ML 3AT8A 4R0LA 5LLIC 1EAPA 3GJFK 2TSBA 3HHRB 1T21B 1BFVH 4H4NA 5GZOA 3WNJA 2ITEA 1U42A 3VG9C 4URKA 4JHZA 1T2QL 1DTUA 4KKCC 3SE3A 5CP3A 4GI6A 3GIZL 1OAUH 1NLBL 3MOAH 5C9JB 4DP4X 3QDGB 3BVVA 2R1WA 3KDPB 3O81A 3OJDA 4X5WA 3KYAA 3V0GA 1S5HB 4L05A 4DKAA 1AFVL 2BSEA 5MP6H 5EA0L 4JM2B 4D0DA 1H5BB 2RQ8A 4H8WL 1WICA 2IH9A 2XN2A 3D9AH 4NENB 4PTUA 3RJOA 1BAGA 1MEXH 4AQ1C 4N0CC 2FWLB 2BDNH 3L4WA 4Q6YA 4Y16C 1KJ2A 3VGAB 1FGNL 3QZMA 4PLJC 3NGBB 2WZ0A 3QXAB 4H13C 1BAFH 3DBXB 4LVHC 35C8H 1INQB 1NC2D 4FN0A 3QRLA 3GKWH 4G7VH 3JTSB 3VXQB 4QNPE 1JVLA 3PYCA 3HG2A 3WN5C 1L4IA 3TESA 3VFMB 2ZD0A 3DETD 5LN8A 1IEBB 1Z3GH 1ZANH 1M42A 3U4EB 1GPOL 5FECA 3HAEH 3STZA 4AMKH 4ZUVA 1BOGA 3GJFA 3QG6A 4JZOB 3QUKB 4MMYB 2LFEA 4L37B 4RMUA 3RI5K 3TT3L 4UT6L 3MZGB 3HLAA 4UQBA 3JYBA 2VR5A 3MDJA 1Z6JT 3AMKA 4MCZA 5E99L 4MS8C 2WGXA 1LK2A 2J5LC 3DJ9A 4UWQB 5GRWA 1SN2A 5LHDA 5B38G 5HYJB 2ZKWA 4GRLB 1RZ7H 4UUJB 2BXYA 2IBGA 5E8EB 4D8PB 4JMNA 4Z7WB 3KAAA 5EORH 3EHBC 4FFTA 1HDMB 3LHAA 2VSMB 5ENWB 4PS7A 4DN3H 2WUCL 4GMTH 4NBZB 1PBYA 1X6NA 5C0EA 2XZAH 4W9LC 3VRIB 2EEDA 1KCVH 3VXNA 1M53A 3LN5A 3B3IA 3VFVB 4X5XB 1B4TA 2ADIB 1Y6NR 3IN2A 3S97C 3W9DB 2CXKA 4PRHB 4QRUB 5HYQB 2V8LA 2GK2A 5CMAB 1T7WA 4J3TA 5IMMA 5L2KB 3JWOC 3D85B 4DF9A 1TTCA 2ZYHA 1E9OA 2IG2L 2F58H 3OPUA 5HGAB 3E3QC 4E41B 5CEYA 4U0QB 4LOUC 3CFIC 3CBKB 1ML0A 3ZDZB 5GGQH 5I73B 1WP6A 4MRCA 3K71B 3VFWA 2H5UA 2F54B 1AKJD 5HGBA 3VSQA 1RUMH 3SDCD 5MEOB 4U1LA 2F8VA 4N24A 3FDWA 1IKFH 4UTAA 2AZAA 2EIBA 3T8XB 1G9HA 2SEBB 3RDTB 3IE4A 3D39D 3K4AA 1PZBA 1GTFA 3GSNH 5I5IA 4LKXA 3D4CA 5J13C 4KROB 3VXTB 5DEFA 1E0OB 4Q58C 5FYKU 2VUOA 3HOGA 1SXSA 1OSYA 3HKFA 2GBAA 4OBSA 1QFWI 4FG6D 2G5RA 4TMPA 3KH4A 3H7LA 1H19A 4G8GE 3VXMB 3ZO0A 2YPVA 1KXTB 4ZTPH 3W1ZA 4W9FC 1SUJA 4XMZA 2OR7A 1RZPA 2PTTA 2EDNA 1WQVT 5AOIA 3UO1H 4KPHL 4UMSA 5I8KL 1B0GA 3Q2CA 25C8L 3QO0A 3LH9A 2X70A 3TZVC 1T20A 3K46A 1SEBB 1QFWH 1CDBA 2WP3T 2OK0H 4OQTL 4JL2A 5I1LA 1O7SA 1TYJA 4K3DL 1OD9A 4U3HA 3FHAA 4JKNA 5CWSB 2E9GA 5FYJD 4F27A 4R4BA 3ZK0A 5I75C 1H8SA 2AK1L 4XN1A 3QJFB 4XE5B 4ZBJA 1ZWIB 1ZV2A 3GDCA 1E43A 4AYEC 2PKDA 1CDJA 1YHPA 5LAXA 5F9JB 2QPSA 3P77B 2H6OA 4OZIB 2MTAA 2VDQH 1QACA 5FUOL 1YEIL 1E8ZA 1E3ZA 1A4BA 1KELH 5CF3A 3QCTL 5HHNA 3MRHB 1NDTA 1BHGA 3BMWA 2OQJB 3IXTA 3NFNB 2GIXA 5I8CA 1P84J 4XP1H 3CQQA 2WNKA 4WQOA 5A7BA 4MAYC 3PFUA 2NRDA 4Z7OF 1J5IA 4N8CH 4D0CA 3EFDL 1GMEA 4IKNA 4GW4A 4KH9A 1G7QA 1FLRH 4P07A 4PRPE 1AGCB 5GJTL 3VFOB 3QNZB 3SBWA 4RGMC 1KTDA 3V0IA 4S0TD 1SFHA 1Z9SB 3JWDH 1YEDB 4YGVB 3ROOB 4EQ2A 2H1PH 1GC1L 1S7XA 3QS3A 3EJPA 4AV4A 5C0RL 1HKLL 4L1BA 1E7VA 1QSFB 4JVWA 2J6EH 4Q7DA 1UOKA 2OTUB 1AGBA 4Y4KB 4MNQA 3S4SG 4WV1A 2LT9A 1OAJA 1JZ4A 2F74B 3H7BB 5J89A 3IKKA 4BK5A 1TQCC 3QDGE 4S1QL 3X14A 4ANKA 4HUUA 1KSRA 1AHMA 4OJFH 5MEND 2IGLA 1CF1A 2H32B 3IKCA 1HL4A 1P6WA 3BZFB 4XRCB 3WTWA 3JYCA 1PG7X 4LPXA 3FT3B 4DK5A 2VLMD 3CDGA 4NFBA 4DOHE 3UZVB 1JAEA 3GTNA 3O3BB 4DN4H 1JK9A 4F57L 3B2MA 4C4KO 2VLLB 2EDWA 1QR4A 2XZCH 1P4LB 4AIZB 3JV6A 4WGKA 4BKTC 2F0CA 1TFHA 4FL4B 3VXPA 3ATEA 4E9SA 2MQGA 1N6QH 5E1GA 1Z66A 1HCFX 2HN7B 5BJTB 3DOSB 1JPFB 2RIKA 4HD9A 3T04D 4M7LL 3IMTA 1XGUA 2H26A 3LZRA 1YJDL 5E8DH 5E1AB 4Y5VA 5C09A 2B1AL 2O26U 2BIPA 2EH7L 3RWDB 1Q1JL 3T0EA 4HWEH 3IFPA 3PWJA 1ECZA 2VLRB 2OSYA 2AEQL 5TGBB 3KLKA 3RZCD 2APXA 3B9KA 3HR5B 4PJ9D 3MJ9L 5JA9A 3VFTB 4XZUA 5E9DB 1INEH 5EEUA 4IMKC 2OKMA 2VJXA 1R33A 4L3ED 4HEPG 4A6YA 2YD1A 3QEQA 5HYJE 4F7PB 3I3DA 2CLRA 4GQ9H 2P1YA 4AYGA 4UQ9A 3QFJB 4WFGE 1JZ7A 4Z7WE 3ZZSA 2DDQH 4HZLA 3US9A 4EUPB 3A6BH 5IROA 4EIZC 4DFHA 5HY9A 2MCMA 4AC2A 3NEEA 5J9PA 2A9NH 1EJOH 4LSTH 3GPSA 4KVCH 4JANA 5CEXB 1MNNA 1ES0B 4XB3A 3IETB 4EDWL 2DBJA 4IRJD 2MQ0A 3GXUB 4U1IB 4TTDC 2Y69B 4K3HA 4KI1A 3TCLA 2GQHA 4EI6B 4TLSA 2CBPA 5L2KE 2DIBA 3KHOA 2R1XB 3OGCB 4E41E 3V0VA 1KEGH 4FLRA 1E5YA 4UIKL 2H4EA 3CBJB 3ZDZE 3HBQA 1J5OL 2EEAA 3L3GA 4G6MH 1OSPH 5AG8A 3PP3H 1QSZA 1BGXH 2OL3H 4AM0B 2F54E 3JXAA 3KPMA 1OGAB 5HJBA 4RIRB 1PFCA 4RCAA 4X4KA 3IJHB 1BVKA 2R2HB 5ACLA 3AU1A 4JS7A 1QLFB 4XMUA 3OKMA 3TP4A 3BGAA 4MB1A 3NZHL 1DQJB 2JTYA 1FAIL 1A21A 2A74C 3WFCH 1SZNA 2VDRH 2G30A 1VRSA 4UQCA 2BS71 3NJMA 1X9RA 4BUQA 1E9PA 2O6EA 3ARBB 3OHXB 3BZ5A 5T5FL 4K8RH 5DRZA 3QUYC 3UTSB 5F7FA 1V3MA 1D6EA 1T83C 4PVLA 5KSBB 1YNTB 4ELMB 3DO7A 5LQBH 3LH2H 1IGJA 4DVRH 4K7PY 1NIBA 2OR8A 2NXZB 1JV5A 4R2GB 2F1AA 5D1QC 4ZSOE 3B9VA 5AAMA 3F5WA 1PDKB 2EE9A 2FSEA 3HVNA 5I76A 5T3ZL 3TBVB 2GKIA 1K8DA 5EOCL 4OD2A 3GI9H 1PYWB 2W80C 3L1GA 1VSCA 5I1GH 4PJ5B 3QRGL 4Y4HD 4OZFB 2AV1B 5DTFB 3ZT5A 4A37A 3E0GA 4Y2DA 3TNMB 5DS8A 2VE6A 3FZUC 4RRPA 4KX9A 4AE0A 5C0GB 3FB5A 1RL1A 2YSTA 4LVEA 5TE7L 1PX3A 1EX0A 2B7DT 1WIPA 2C1OA 4FQ2L 3VWKD 5KWYC 2OJEA 1QD0A 3GYRA 2EACA 3OBAA 4LPYA 4MQ7A 4UB0L 1ZHKB 1D2OA 4OZIE 2XKSA 1S2EA 4UILL 2E7LA 4F3FB 2IEPA 4Q97A 3ZDYF 1JGLL 4A68A 3O45A 1DVUA 3S96A 2ZUYA 3X3FL 4EAEA 2YBRA 4B9GA 3QWQB 1SXBA 5D5MF 4F9PA 2CKBH 2VAJA 2QLVB 1WFIA 5B1BB 3BZEA 3H9ZA 2Z8VC 3Q8EA 4XX1G 1XF2B 1H3GA 4U1KB 4A38A 2OCFD 2WNWA 1WITA 4XO4A 4IMLA 4LHJB 5BRZB 2EICA 5EZIH 3ARED 1NPJA 4ZFZB 1MRFL 5GJSH 3BLBA 1HHGA 1P7QD 3C5XA 3RL1A 3TPKA 1PAMA 1TZIA 1RLWA 1OVZA 3P0YH 2VM9A 3FT2B 4Z78B 4KZDL 1QSFE 3SE4C 4KHXL 4BZ1H 2N7SA 1E28A 5LKNA 2VDNH 1OTTD 5IM7A 5I17B 2EVIA 3UH8A 2O5YL 3QH3B 4NZ8A 4TSCL 1NWPA 1JGVL 1TQSA 2VISB 5DZJA 2V3FA 1FBIL 3ZMRA 5F1IA 1MJJA 3KPOA 3LNIA 1K6QL 4LGSB 5I1JL 1WD9A 1BXUA 2BP3A 3AAZB 4MXQD 3UX9B 3FH8A 1JWMB 4MRBA 4X2UA 4RSVA 4Z7UB 2ZF8A 4U6XB 5IEHA 4PRNB 5CBAB 1NANI 2V5YA 1A9EA 32C2B 3PWUB 1E2ZA 4L0PB 4NN7B 1NEPA 2XBZA 4K7PH 1A6UL 4N9OB 4OD1H 1SJEB 1DLHA 3T8MA 1F11A 2EDDA 4X9GA 1QO3A 1WTGT 1KLGB 2OM5A 4L8BA 4GAJL 2X89D 4S1DD 4CN6A 4ZMOA 2VLRE 4PJ7A 5I15L 1IKNC 1D5IH 1CBVL 2RMNA 4MQXD 2J8UF 2WANA 3CFMA 1QPKA 3B3BA 3PWVA 5E9DE 1ZLUK 4J12A 5FW7A 3I75B 1ZHLB 1YLBB 1T5WA 1II4E 4UYPA 2NLJB 5DZNA 1JF6A 3HPLB 3HHMA 3RILA 1LMKA 4JFPA 5D6CB 4H8VA 4CN4A 3OKKA 4YHOH 4O9HH 5HVGB 4P57A 2KDGA 3ECVA 1FORL 3GIVA 4R90L 4HOZA 4RFNB 5ICYA 5J5EA 1SY6H 2AFNA 4WNSA 4XH2A 5TK4A 1EMTH 4G8GD 2GAZB 3ABGA 4GI9A 3ILQD 4O58L 4I88A 4CU8A 4ZUSA 1FC2D 2VDLL 5GSVA 2OSXA 3O3AB 1HXYA 1G9NC 4P3DA 4ZZFA 4I5BA 1OCCB 4XVSH 3FN3A 2H47C 2YA1A 4JKLA 4NNPL 5CD5C 2HCZX 1FH2A 3KGSA 3TC9A 1LD9A 3UBXA 5KBLA 1DJIA 2UY6A 1ZHBB 5KAQF 4PJIF 5F0LB 2FX9L 4ZTOL 4R9HA 4PJAF 1CTNA 2LABA 4X7TA 1OGAE 4L0ZA 2ENSA 4BSWB 4XMTA 2YARA 1ZGLM 4LSRH 1CGXA 5LCVA 4YLQT 2A83A 2VXUH 3W5MA 2MJWA 3IJSB 3D6GA 4KI5C 5SWSD 2AC0A 2C9UA 5ILTL 1PAZA 3IWVA 1R17A 5IBLC 5BO1H 3VXRA 5AVTB 2G75A 1RZJH 5FUZL 3TBWB 3P3RA 3MJ7B 3UTSE 3ASWA 3KW7A 4Z7IA 3O8XC 4JFFA 5KSBE 4ELME 5L88H 4DP1X 4OVVA 4BHUI 4UQDA 5KUKA 4ZMAT 4PD4K 1S46A 4GKNB 4AGNA 4A66A 4HIEA 2MCAA 1V3LA 3HG0A 1CFVL 1TZGH 2NYZA 3LRHA 4M1DH 3VXUD 4HU2A 4M5TA 5LNEA 4B9CA 2ADYA 1ZHNB 3MNVA 2YIHA 4JPVL 1KN4L 1Q0XH 5IB5A 3MCKA 4PJ5E 1OE2A 3OC5A 4FABH 2D2CC 1SN0A 4TKWA 2HP4A 2FBRA 3A0OA 5GS0D 2H0EA 4P9MH 3ULVC 3QDGD 1QLRB 2C3VB 4MYWB 3SDDC 4F15C 1JI2A 2FBJL 4JMXA 1M2VA 4JM2D 1PX8A 1GZHC 2FL5A 3C5SA 1T4WA 1KLUA 2A6DB 4IDLA 3BT2H 4EN3C 3ARSA 2O5NA 4YNYA 1N12A 3WFEH 1MVYA 1IUZA 1NICA 4PGBB 4HX1B 1CLOL 4FQQB 2K6WA 3JWOL 1TEGA 4KNQA 1QOKA 1XSJA 3RUGF 1ACZA 1X4XA 3BAWA 5BRZE 3MUY1 2I60H 2E3VA 2VXSH 1F90H 3BP4B 4J3OD 3U36B 3DMMA 1G43A 3FT4B 4JGMA 4F8PA 4MHHI 4NP4H 1QMUA 4HJSA 3TU6A 2DYRB 2VN6A 2VRKA 2HRPL