3CZUB

Crystal structure of the human ephrin a2- ephrin a1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
130
Chain Sequence
ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYESVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/signaling protein
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 130
sequence length 132
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3czuB00
4AKOA 2HXAA 3GDCA 3NJJA 4Q8BA 1TEFA 1WAEA 3X1NA 4TXVB 2Y1AA 2FT6A 3OM3B 3KW8A 2FQDA 3S3CB 4GY4A 2YAMA 1JZGA 2HRHA 3FQYA 4L0PB 1GS8A 3NSYA 1SDDB 1PNDA 2J55A 2J56A 5I5IA 3HB3B 2ZWNA 5B3SB 4A2EA 1TU2A 2XWZA 1WS8A 3DKHA 1NIDA 2GHZA 3UGEA 5I28A 4E9SA 3V9CA 5IY5B 3WNIA 1KDIA 1ADWA 3T6VA 2H47C 4BK5C 2BP8A 2EIKB 6PAZA 3X1FA 1ASPA 2VSMB 3FU8A 3QJTB 4YL4A 2XLLA 2BP0A 1KGYE 2UXVA 1GR7A 1L9SA 3EF4A 4G71B 1F56A 1PZBA 2AANA 2TSBA 2AZAA 4HAKA 4ZK8A 1ID2A 1GY1A 1ILSA 4X4KA 5I6KA 1NTDA 1PZAA 1B3IA 1NICA 1CYXA 5D4HA 1CYWA 5I5MA 3TBCA 4E9YA 2FTAA 4DPBX 2BW4A 3GXUB 3FU9A 4A2HA 2YAOA 4EF3A 1MG3C 1A4BA 3X2QB 3T6ZA 2XXGA 2FT7A 4QLWA 3S8GB 3QJQB 2FJSA 1BEXA 2WSDA 3FYEB 3NJLA 1QLEB 5D4JA 2BZ7A 2GIMA 5AKRA 2UX6A 2HRGA 1JZFA 2XX0A 2YAFA 3AZUA 4HHWA 3AY2A 2DWTA 4BDVA 4PCYA 2H3XC 3V9EA 4BWUA 1CC3A 4AI7A 1PNCA 1JXDA 1CUOA 4E9WA 1SFHA 1L9PA 1NPNA 2VW7A 2OV0A 1M9WA 2CUAA 3WIAA 4DP6X 2FT8A 3X1GA 1XB3A 1SF3A 1HFUA 3FPYA 1OCRB 1I53A 1L9TA 3FS9A 3QPKA 3ZX1A 1T5KA 2GB2A 2X88A 3AG1B 4YSDA 1FA4A 5B7MA 3WG7B 1E30A 2YAQA 4YVUA 4YSCA 4CSZA 5I6PA 2W88A 1WS7A 1XB8A 2PP7A 1MZZA 1ZIAA 3FPXA 2A3TA 4Q89A 2E86A 1L9QA 2YAPA 3FU7A 5B1JA 1AS8A 2DYRB 1OCZB 2B08A 3OMIB 5I5JA 2FNWA 3T9WA 4BXVA 4G70B 1NIEA 3NSDA 3FQ1A 3FSAA 2CBPA 1JXGA 2MTAA 2HX7A 2AFNA 1V55B 3IBOA 3NJMA 1JERA 1NWOA 1IUZA 3WNJA 1L9OA 2H5UA 4KNSA 2PPFA 1ZPUA 3C75A 4GP4B 4KOCA 4F7KA 2Q9OA 3OMNB 4YSOA 2IAAC 3EH5B 2J57A 3NSFA 3JT2A 1AANA 3PXLA 4KO5A 4AX3A 2PPDA 1MZYA 3ABLB 2BZCA 3UAAA 1AS7A 1IKOP 4HIPA 1RZPA 1W6WA 2DV6A 2ZXWB 3DTUB 1OOWA 5PAZA 4HCGA 3X1BA 1HAWA 4F2EA 1WA2X 5I6MA 1JZHA 2TSAA 1JOIA 4YVNA 2QPEB 3UABA 3OD3A 7PCYA 2VW4A 4A2FA 1AQ8A 2XV3A 3SBRA 4RH4A 1A4AA 1ZV2A 3MBWB 3NJGA 4A66A 1UATA 2IDTA 3N2JA 1OF0A 2IDUA 4GYBA 3IEAA 1JVOA 2EILB 4G7QB 4DP2X 1PLAA 3SQRA 2YAEA 2PLTA 3ABMB 3N55A 3NT0A 4GP8B 1NIFA 3PAZA 1URIA 1BQ5A 4HCIA 4WKXA 1AS6A 5I6OA 3QQXA 2EIMB 1ASQA 3CDZB 3WKQA 2NRDA 2VW6A 3CVCA 2CAKA 1DYZA 1OCOB 4MFHA 3EH3B 2FQEA 5LDUA 4YSQA 3ASNB 1EZLA 2XXFA 4BWTA 1NINA 4DP8X 2EINB 3UADA 4YSSA 4P5SA 3MX0B 1SF5A 1J9QA 1X9RA 4W9ZA 3S3DB 2W8CA 3L45A 1AG0A 3NJKA 4E9XA 2YAHA 3PLYA 4DP7X 3NJNA 1N70A 2UXTA 3EH4B 4ENZA 1KBWA 2BWDA 3CVDA 1TEGA 4KNTA 1ET7A 2Q5BA 3FQ2A 4NB7A 5FC9A 5E9NA 1A8ZA 2CCWA 5AZUA 1NDTA 3NSCA 2P80A 1PY0A 2VMJA 2QDVA 4YSPA 4YSRA 1OV8A 1KCWA 3ERXA 5B1JC 5TK4A 2HX9A 4P5RA 3UACA 2PCFA 5A7EA 1KBVA 1WA0X 2X87A 3PAVA 3NJIA 2CJ3A 1GS6X 2JXMA 3UAEA 2XUWA 2WO2B 4A67A 1XB6A 1OCCB 2LLNA 1SDDA 2VN3A 4M3HA 3TU6A 3TA4D 1W8EA 1AOZA 1GSKA 3H4FA 2RACA 2BP8B 2Y69B 2BO0A 2MRYA 4YSUA 4UF7C 2DYSB 2BP0B 1J5CA 2CALA 3ABKB 4FAAB 2ZONA 2HLEB 2IDSA 1PMYA 4A68A 1AZBA 5I6LA 4BXSV 3NYKA 3SBQA 1MDAA 1NZRA 2J5WA 1BYOA 1ILUA 2QPDB 2XX1A 5B7FA 2YQBA 3WI9A 1OE1A 2EIJB 2GC4C 3DIVA 3S3BB 5I26A 4A2GA 1ETJA 1VLXA 1AIZA 1E67A 4K9JA 2IH8A 4A2DA 3FYIB 1A3ZA 2WO3B 2AVFA 1NIBA 4BWWA 1NPJA 3S8FB 3ABGA 2BW5A 1PLBA 3FSZA 2PP8A 3PPSA 3T6XA 1ET8A 2DY2A 2FQGA 4DP0X 2IH9A 1MG2C 3QJVB 3TASA 4HALA 4G72B 1KV7A 4BDVB 3TBBA 1J5DA 1M56B 5B1BB 1BXUA 4DP9X 1GW0A 1ZDSA 4DPAX 4NAJA 3IN0A 1ET5A 2GC7C 4YSAA 4UANA 4M4RB 5B1KA 2YXVA 4DP5X 4JKNA 3OQRA 4N8UA 3JTBA 1QHQA 2XV0A 3BVDB 1ASOA 1J9RA 3PAUA 1OE3A 1BQRA 1GY2A 2PPEA 2XV2A 3AG3B 3AW5A 2XYBA 1SFDA 1RZQA 1X9UA 5AFAA 1AZUA 1R1CA 3CVBA 3IN2A 1RKRA 2BWIA 3HEIB 2R7EB 1AG6A 2HX8A 2IWFA 3FU7B 3QJRB 8PAZA 1BXVA 4G7RB 4CSPA 2I7SA 4HHGA 1BXAA 1KYAA 4E9TA 1TKWA 1QNIA 2PPAA 3FSWA 4GP5B 4G7SB 4KOBA 5PCYA 4HCFA 1OE2A 5D4IA 3H4HA 3KW7A 4NERA 1M57B 5ANHA 3WKPA 4AZUA 3CZUB 1SNRA 3NP4A 2IWKA 3X1EA 4AKPA 1FWXA 2GSMB 2AZUA 4QKTA 4W1TA 4F2FA 1IC0A 2BHFA 2GI0A 2PPCA 1ZDQA 4DPCX 3CG8A 2ZOOA 3NJHA 3ASOB 2UX7A 4YSTA 2OCCB 2PCYA 1AZRA 4FA7B 3H56A 2VM4A 4DP4X 4KO7A 1SJMA 1KDJA 1JXFA 7PAZA 2GBAA 3OMAB 1AACA 2XVBA 3ZIYA 1V10A 1IBZA 2JKWA 3T71A 1V54B 3ZBMA 2IDQA 1PLCA 4KO9A 2VSKB 4HZ1A 1WA1X 1AZCA 1J9SA 2I7OA 2IWEA 1NIAA 2QDWA 2IDFA 4N4YB 1JZIA 3QJSB 4AKQA 1XMEB 2YARA 2P80D 1GYCA 1RCYA 2FQFA 3AG4B 1N68A 5F7BA 3PCYA 1E5ZA 5TK2A 3AG2B 1YLBB 2UXFA 1GS7A 5EHFA 1W6LA 1IBYA 3GYRA 3ZDWA 1A65A 2JFCA 4PAZA 1PCSA 4KNUA 3FSVA 1HAUA 4E9RA 2OJ1A 4KO6A 2XU9A 3IE9A 3U25A 1PAZA 1A4CA 1PZCA 5I6NA 1AZNA 3NJFA 6PCYA 2FWLB 1ZIBA 2I85A 4GXFA 1AAJA 3SBPA 4WTQA 3EHBB 2QT6A 1JZEA 1JZJA 2VM3A 1E5YA 2UXGA 5F7AA 1BAWA 2B3IA 2N0MA 2R7EA 4UAHA 3FT0A 3QJUB 2DWSA 3BQVA 1DZ0A 3G5WA 3D12B 1J9TA 1PF3A 1L9RA 1SHWA 1JVLA 3CDZA 4E9QA 3RYMA 1KCBA 2PP9A 4E9VA 9PCYA 1CURA 3NP3A 1NWPA 1SHXA 4JHVA 4JHUA 1E65A 1BYPA 1EHKB 4DP1X 2HZHA 4YSEA 5B7EA 1AR1B 2YXWA 3T6WA 5B1AB 1BQKA 1FFTB
chains in the Genus database with same CATH superfamily
1BF8A 4BV1A 4C47A 1FNLA 3KEDA 5D7SH 2CBTA 5IFHL 3NJJA 1KGCD 1V27A 2VXQL 1M7DA 3EOYG 1WQVT 2R1WA 5DLLA 1NA8A 5EEZA 5BZDB 1JIBA 3CHXA 5D6CB 2QSCH 2NCEA 1J9CT 4YHMH 2LVCA 3ZGHA 4HAFA 1HYSD 4RMQA 4Y2LA 4ETYA 1CD1B 3FQUB 3RZCD 3VNYA 4L0YA 1EX0A 1J5HA 2NR6C 4WW1B 1KCRH 4XAWH 5TQ2L 5IHZA 5JDSB 3ZU8A 4Q2ZB 5IQLA 2CLVA 3ARYA 2XWZA 4TUOB 5IMMA 5JPMC 1W80A 3SDCD 3KPTA 4HWBA 1TUPA 2FH8A 5I28A 4E9SA 3KNBA 1W0VB 3T6VA 2CIKA 2AEPL 2YD9A 1FPTL 3RWHA 2V4LA 2KDGA 3H7LA 4YL4A 2BP0A 4KX8A 5AKTA 2PYFA 2Y5TB 3SKNA 3S36H 4X98A 2MTPA 5DZ9A 4K3JH 5SWSD 2Z31C 5AAMC 5FUZH 2XFGB 1WAAF 5JPMA 2CSPA 3ZE1E 2OMUA 2LABA 4H88H 4RMTA 4YZFE 5AVQB 3GGWA 1G1KA 2QLYA 1HEHC 3VXRD 4AV4A 1DVUA 1NDMA 2VUKA 4RA3A 3RWCB 2O6FA 2YZ1A 2WWKO 1NGWB 2ZX9A 4Y9BA 1B0GB 3DGGA 3OKYA 1Q9KA 5AAWC 2YAOA 1LEIB 3IVKA 5F3BA 4WCYH 4ZPTB 3O0RL 1ROWA 2OMZA 1I4FA 2MSPA 4GIOA 4L8SC 5EBMB 3EYFB 3E9UA 1MCOL 1E9OA 1HIMH 2VXVH 3KBEA 4ISVA 4LNVA 4D0DA 2GEQA 3P11H 4TSBL 4PY8J 1YEKL 2BZ7A 1CFVH 3T4YB 2YA2A 4JR9H 2NY0D 2UX6A 4NLHA 5C0AE 3AUVA 3FCTA 2H6PA 4ENEC 1OY3B 4RMUA 2Y36H 4Z76B 1CC3A 5I8EB 4HKXA 2NNCA 1HXMA 5E8PA 4U1LB 1W15A 2YA1A 1IAKB 3ARFC 4PJ5B 3RTQD 1MHCB 3MLUH 3D07A 3I3DA 4AG4H 5EU5B 4WRLA 3NN8B 3P3TA 2FT8A 3PV6A 5LGHL 4XPFH 1HHHA 4NO5A 3FPYA 4G8EA 3GUFA 3MLYH 1MREH 1RVFL 5GZOD 2XWXA 3AG1B 4GSQA 4YSDA 5AYUH 5B3JE 1DO6A 3CLWA 1E30A 5I8OL 5D93B 4AOFA 3NIDE 1E4KC 4UDTA 2BS9A 3UTTD 3EYUL 4E41A 3O2DH 5ABDE 3ARFA 4NENA 1SJVA 4HA1A 3TT1L 4YQXH 4GXUM 1FZKA 1NCOA 3MRGB 3OMIB 2X28A 3ZMRA 4R90H 3GZKA 1CN4A 1NBVL 3L81A 4WI2A 3BGFC 1BAGA 1QPKA 1VFMA 4HS3B 4MJ5A 1RULL 5KSBA 4G9DA 1BFTA 1E4KA 2N3JA 1DVSA 3NJMA 3V5KA 2Q8BL 1OF2B 3WNJA 3F6LA 2ZXQA 3SCMD 3GMMA 4UQ3A 2Y1ZA 1DUYB 4PWFA 5FWQA 5LGYA 1QR1A 3IKKA 3OMNB 4YFLF 2CO6A 3ILPB 3QB7C 3X11B 4BSVA 4KUCD 3VRJB 4RDQG 1JXJA 3RWIA 1J10A 4BZ1A 5I71B 4KQ4H 1PJWA 2G75B 1UG9A 5D96C 2CGRL 2EECA 4GRWB 4M7ZC 3ABLB 4RGMB 1SJXA 4IKKA 1BFVH 4LSRL 4DEWA 5GSVA 5H4YA 3ZL2A 1M1SA 2X6VA 3WIFB 1WA2X 1KF9B 1E7VA 3ASWA 4FFZH 4N0FA 5KYUA 1MRFH 4XT1C 4MJIA 1ITCA 1FRGH 2KL6A 3L5IA 3VXUA 1H3GA 3QIUB 1UXSB 5CD5C 4P5KB 2NYKA 1N6UA 5KEZA 1P6AB 3P0GB 1SXBA 2WQUA 3EFFB 4N2FA 4PD4K 1I9JH 3O2DA 3QCTL 2YRBA 1AKJD 2LFEA 2AJUH 3P30H 3Q8FA 4O02B 3WTTA 5HHXL 5EWIL 4Z7UE 3MBWB 1SOKA 3DROB 3IJ9A 4PB9H 3CSFA 5C0CE 1YMMB 2NNRA 2FLMA 4J27A 5HI3C 2PYEA 1AO7A 3IB4A 3UTSA 2VKWA 1V7NH 3DHJA 5D9SB 2XWCA 2FJUB 1SBSL 3W81A 4X9YA 2I9TB 3DSFH 1TVDA 2FEJA 1AS6A 2OQJB 3L3DA 5KBNC 2X9XA 4I1NB 1XMWA 4PY7B 4WWID 2DJ4A 3OLIA 2WMPA 4U3CA 4JDVB 2PW2B 2OJEB 2RJMA 1KG0A 4OJFH 4NUPA 4QY8A 5GS2H 2ZCHH 4PJDE 2WV3A 2ATPA 4K8RL 3B9AA 3QWRD 3T3PB 3KG5A 2HUHA 3D6GA 2EINB 3MYJA 2AAVA 2JCCA 3I6GB 2A9MH 1GGCH 1M42A 3PWVA 3ALPA 4P5SA 1KGIA 4PGDA 2UYLB 4UT9H 1A7PH 2AQSA 5TE6H 3RNKB 3UX9B 4DGWC 5ADOH 1A66A 4GAYA 1NFIB 2XBDA 5F96H 1KBWA 3KJ6H 3QWOA 4ESKA 4EKJA 3TO2B 1KYOJ 4FFZA 4E42B 1WBXA 4OZIE 1RHHA 1YYLH 3SDAA 4TQHA 1UD3A 1DTUA 1LEKB 3DURA 4AENB 4R4BB 2P45B 2JKLA 1FG2A 2BXZA 4IOFC 4XP4L 5EU6B 4Y4FD 1EK3A 1WA0X 3CFBA 2YS4A 4NDMA 4QNPF 4WFFD 3MLWL 3UJJH 4I18A 5LJYH 3QO0B 1E3ZA 2JXMA 4FZ8H 1R47A 4F3FA 3DIFA 2HPOA 3CIQA 1RZGA 4JREB 2EYSB 4TTDC 4XWGH 3FRPG 4X5PA 1CYGA 2Z34A 4ZS6D 1XIWC 3OB8A 4UOW1 1H6TA 4Y9CA 3ZT6A 2ZONA 3ME0B 4N85A 5GZND 5I82A 1ZA6B 4ZO9A 1RMFL 2PUQT 2ZCZA 1M7XA 2XXCB 4KKZA 1LE5B 2BSSA 5E6ZA 1K8DA 2Z7UA 3BPLB 4M7KH 1AZBA 1ZLWK 5I6LA 1NGQH 2VITA 4AIOA 3GZOA 4ELMA 4UNUA 2VLRE 3A0OA 5DZJA 1N0LA 2DTSA 4G82A 4KKLC 4ZFFA 3VFPA 4Z7NF 1XIWA 4S2SB 1DBMH 3C5ZB 3BWAA 4J3OF 4LVNC 5IWLC 2R69A 3QG6B 3BKML 1AIZA 5GS3A 6TAAA 3LZOA 1G9ML 4BA0A 4PRIA 1CS6A 3W57A 4HLZG 3B37A 1EEUA 4PWIA 3VXTB 1JN6B 4Q9RH 1BXXA 3WUZA 2XNAB 2W9EL 2NUTA 1XGRB 3AY4C 3MGOB 3MNVA 3Q5YA 1MFMA 1VFBB 3Q06A 1DEEB 4X8CA 5B1BB 4EAEA 4HX1A 1J0ZA 1RIHL 3QA3A 1C5DB 2DQTL 3VFNA 4PS8A 2MWCA 2JIXD 1ZE3H 1BA9A 4UANA 1MRCL 4TNVF 3RU8L 2A0LC 2IADB 4KI5C 2OI9B 3WSQL 4GRLC 2NZIA 1DZBA 4RAUB 2X4NB 1BGXH 5E8OB 2FVNA 3JTBA 1BOYA 2HLAB 4B5EA 3NDYE 4R83A 4HZLB 2JKIS 4XXWC 1OE3A 2X4TB 3WJMA 2LU5A 5HSFA 1NCIA 5GGSB 5LBSH 4G1EA 3FTGA 5DO2C 2VDPB 3QDJB 4C4BA 3MLTB 3NDZE 1JNLL 2YN5A 2V9TA 3VTAA 1V7MH 3TV8A 1Z3RA 4B5ZA 4PGCB 4GSUA 3RGVC 1DUZA 2FX9L 4K55A 2ZXAA 5DEGA 1G5GA 1M6OB 2AKRB 4XXWA 1MCFA 3GLDA 1G4MA 2X1PA 4M8QA 1ZE3C 2HJKA 4WDIB 5GGUA 3U6XA 3FU5A 4JY5H 4N0YL 43CAB 4XVJH 4W9CC 1P2CA 1IJNA 4HK0A 5T5NG 5K59F 2VERN 3EGDB 3EADA 1Y6KR 4JHWH 4JO5A 4W68A 5E2JA 2GI0A 4HV8B 4HIHA 3CG8A 4W6YB 1KZQA 3ASOB 5L2KB 3MHZA 1YEFL 1HH9B 3OAZH 4ZOCA 3H56A 4ODXA 4WWNA 1AQDA 1KXQE 4UB0H 4BFJA 1YSOA 1WYJA 1IL1B 4C56D 5AL0A 5A2IH 1UXWB 2JI1A 3LNIA 1A1MB 2NLJA 3LZQA 1OAUL 1X4XA 4XI5C 1P5VB 4QYAA 4JKKA 4P2OD 4HIEA 4PJ9D 5D71L 4U1MA 2FHFA 1WZ1H 2OTWB 4TPRH 5LBSA 3HZVB 1G1CA 2F68X 3QBTB 5F7BA 1G43A 1Y6NR 4KRPB 1E5ZA 3QEUB 1PS3A 3LHPL 5TK2A 5FYLL 4OGAC 1IBYA 2Y5EA 4S0TD 3IMSA 4NKDB 2Q7NA 3QEHB 4WW2B 4A6YA 1HAUA 2FX8H 2Y7LA 5F88A 1G7HA 5MI0B 4KO6A 4QHMB 3IE4A 3IMRA 2YJLA 2FIKB 1A4CA 3ZT7A 4EI5A 2K8MA 2CJTA 4HWNA 5SX5H 3V5DA 4ODVH 4C57C 4XCCL 2C3VA 3JWNE 3ZDXF 1ESOA 2IGTA 4HOZA 1MDTA 4WJ5B 2YFNA 4B6ZA 3MNZA 5BW7A 4HUUA 2FD6L 5ANMA 2W60A 1U8MB 1IQDB 2ESVE 1FNEB 3L3IB 3C87A 3ZE1B 3AREC 1UQSA 4K71C 2O61B 4MXQC 4U49A 1IGTB 2YBRB 4PRDA 4E9QA 4FGMA 3FQTB 2C9AA 3DXAA 3CFQA 3B1UA 3QAZC 1CPUA 3NP3A 4YDJA 3VXNB 4BH8A 1JRHH 5EFIA 4JFOA 1UB5B 5B7EA 4HK3N 2VIRB 5J1TC 1A6WH 1U95A 2O4EA 4APQC 2XJLA 3AREA 1I1AB 4PJEE 2F53A 1ZLUH 1O5PA 5K9JL 2NY1B 5K39A 1O7DE 3ZYIA 3RWGB 5EO9B 1T1YB 2H45A 2XV6B 4JKMA 2BS8A 5BMFH 2ZUQB 4FN0A 3O4LE 4OF3A 4HIIB 2V2WB 3Q2CA 4JDZB 1A7NH 4IMKA 2ATAA 1NFDF 3CZFA 1U8OA 5CJXA 4U1JA 4YGVB 5DHVH 2NZ9C 4L0PB 1U92B 4G6KH 4J3OD 3OJ2C 2CK2A 4APQA 3NSYA 5I0ZA 3E9TA 2F1AA 1QSEA 2ITDB 5F9JB 4N2MA 2ZG3A 3WFHB 3PJSA 4P9HL 4PPTA 1T5XB 2NY5L 4GH7B 4HEMA 4X7TA 3BIBX 3DKHA 2VWEC 4U0QB 3BH4A 5I15L 3ARBD 4D3CH 3OLEA 4AGMA 3VDCA 1R33A 5J7CC 3FOMB 3NIDB 2B9AA 2WQWA 4R9HA 4X4ME 2VSMB 4WO0A 1S7XB 5F7WC 2XLLA 2UXVA 4JL1A 3T04D 4YDKH 1OM3L 3RAJH 3RVTC 3QI9C 1AXTL 2AZAA 3OKEA 4ZK8A 4AM0B 1JK8A 5BOZG 3BH9A 1T20A 1ID2A 4Z5RB 4U2ZA 4PMEA 3BVNA 2VC2L 5I8CB 5DS8B 5ECGA 3L1OH 3S2AA 4LL1A 1OT2A 2R0LL 3FFCD 5DT1L 2NY4C 5I18L 3L54A 4K7PY 5ICUA 3O2WL 4Y2NA 2GTWB 3CX5J 3SE4A 3B9DA 2XDHA 1OW0C 2VNCA 1A25A 1WP6A 2R29L 4W9GC 3X2QB 2A6JB 2XKUA 3QI9A 5D7IE 5KYWA 2H32B 1BVLA 3F01A 4EN3D 1JYWA 2XZQL 4ZMVA 4M48L 3MUZ1 4CN6A 3EDEA 4P2QB 5KVFE 5ITFA 5FWRA 1LXMA 4PV1C 4IKLA 3S0PA 3IDNB 4FL4B 4FTVD 2GIMA 2K6WA 3V7AE 4HH9A 4BM7A 2LE9A 2XJKA 1U3YA 2LT9A 1FIEA 3MJ9H 4WHTA 5J1AA 3V95A 5C0DB 2BY1A 2EDXA 3WY2A 1FE8H 1PG7W 4RMRA 1UZ8A 1J1PH 4UBDD 4M43L 1SFHA 1U91B 4Q9BA 3PUUA 3IK2A 2D7TL 3WIIL 1BQLH 1KLGB 2ODIA 1G9NH 2VKXA 4NHCH 1EEZB 1S7TA 5JOPE 2FSDA 4AQ8C 2B59A 3NQKA 4XP1L 1CICD 4Z7UB 3DX8B 3SKOA 5MEOA 1GPOL 3IXTB 3MRDB 1U8LA 3IDJA 1O6SB 2JKSA 3R4DA 3IRPX 1T1ZA 3D2UB 3RDTD 3WFZA 4QDGA 1DLFH 1MZZA 2PP7A 2DL2A 3VTTA 3N42B 1Z3GL 2MQ3A 4M00A 4LSQH 2VDRL 2AMUA 5TGBB 1VRSA 2A5UA 3SE3A 1NGYA 4KZDL 4Y5VB 3N1FC 3H9SD 4HCRL 5F1IA 4MD0B 4AQ8A 1JRHI 3PAYA 4JN2B 4JFPA 4CSSA 2FGZA 1AQKL 4IKNA 3GSNH 2AJYL 1F00I 2XWEA 1YECH 3SD5A 1OAYL 3UEZA 4GO8A 1D9KD 4LHUG 1L9OA 3PP4L 4PJDB 1G9NC 3IMBA 3HNVL 2R4SH 3QULB 3WXVL 2WXIA 5E2UL 4NRYA 2VAAA 4JPVH 3ZTNH 4HGWB 3MJ9A 4OB5H 4ERSH 4F2ME 2EO7A 3RL2A 1AXSA 1Q9OA 1TNMA 4DKTA 3M8OL 2F58H 2N0KA 5DHXB 4HKBA 2APFA 2WNXA 1RZKH 3FOLA 4MXWL 4F8LA 4ZQTA 1R3JA 1JD9A 1WIUA 4PJAE 3MCG1 4M7LH 2APBA 1OOWA 2IO5A 5JHAA 1OP5H 4MKMA 1LQBC 2IANE 4YHZL 5D7JC 3LSOA 1A4KB 4I4WA 1T1WB 1H3WM 4G7YL 4LLMA 3QDMA 3CFJA 5TH2A 1O9ZA 3KWWA 4CVWA 2WXFA 4HLZH 3ZDZF 1LK3L 2Z93A 5AYQA 5TDOA 2AQ3A 4LLUB 2DQJL 4HF5H 4R3SB 3O6LH 5H94A 1RUKL 3FT3B 3HUJF 5C0EB 2R0WL 1FNHA 2PLTA 2GYSA 5I66B 3GSNA 1KFGA 3TOPA 4WTXA 5C08D 3VG0H 4HUMB 4K94H 1RZKC 1SY6L 3FRPA 3NCYP 3VFUB 2ZSWA 1OKEA 2N4IA 1MW3A 4B27A 2EIMB 2X4SB 1C5CH 2QKIC 4U6XA 5JHDA 2ZOLB 3H0TA 3VE0A 3V4VB 5DRZB 3HE7D 1FYTD 3CDCA 4POZC 2MPAL 5IQ9B 5BUAA 4Y16C 2WYZA 3ASNB 5B39G 4Q0XH 4Q4EA 4JFFE 3MJ7B 2DBLH 5CJOH 1JVKA 3SDXF 1NINA 4DP8X 5FAAA 3EDDA 3IDYB 2DQHL 1SM3H 1B2YA 5L4IA 3PUCA 4G9FB 2HJLB 1JP5A 3IS0X 4YDIH 2C7UA 5H2BA 3Q6FB 4H2AA 1FGNL 2Q5BA 5E2TH 1IAOB 1CDYA 2QKIA 3CFEB 1IM9A 2Z35B 1AGBB 4MDIA 5AZUA 1FJ1B 5GRJL 4OD2B 1XL6A 2FEDD 2Q20A 4H0IA 1EEYA 3MRIB 2QDVA 2FYVA 3HB3C 3P4MB 4K3EH 4K94C 4OZGE 4WI9A 5J4MA 2KLRA 5DI8B 4NYLA 3GM0A 2CRIA 2G4GA 4NLAA 3U9UB 4GKSA 4UDUA 3FHEA 4DH2A 3ZE2E 4PRHE 2ZAIA 4UAOC 3TVMC 3KVQA 2D7MA 2XIBA 3VXOB 2V6HA 5FGBA 1BLNA 3OKKA 1AOZA 1F8TH 1LNUB 2RACA 3CX5K 3JZ7A 5E5RB 4DW2H 4YPJA 3O11A 1UXMA 1KYUA 1YNKL 4FQJL 1V3KA 4JHAH 3RVWD 4H8WL 3NIGF 2A9NH 1CFSA 2ZUYA 1U58A 1I7RB 5E9DE 2DEYX 4QPEA 5IB1A 5CJQH 2UUDK 4CW1A 3D08A 2P4AB 3T8XB 4XNMA 2R1YB 3F12B 3VXMA 4TUUA 2YD4A 3MRMB 5JXAH 4LVHC 5JPNB 1ED3A 3BH8B 3LXCA 1U4FA 3BSZA 2FBOJ 2DI9A 3OG6B 4CN1A 4XPBL 3NABL 1SUHA 5GGQL 2BDNL 2HJFA 3MV01 3HFFA 3PHQA 3STZB 1I8LA 3QUXC 2AVGA 3QCUL 4FHJA 1PYWB 5D4QA 5D2NE 5BRQA 5CFAA 4R5TA 4NCC1 4K9JA 4BSJA 4Y19A 3E0GA 3EUDA 2NYYD 3LS5H 1TETH 2OMVA 3KYOA 1T03H 5BVJA 3PV7A 1D2PA 1PX4A 5EOQH 5FX3A 3UZVB 2IQAA 4TKWA 4BCXA 5D1XD 4X5XB 3OZLA 3F5WB 4EUPG 2Y06L 3TASA 4ZNCD 4RFOH 4RSVA 1J5DA 4MA3B 3T77A 1N8ZA 2E74C 2V2XA 5JW5A 4TTGA 1VGEL 2CXKA 3IN0A 3CHQA 3G6AA 4ODHL 5HYJE 4DUWA 4K2UH 3BP4A 1LQSR 2WVVB 5DMYA 2PR4L 3QUZD 3NBNA 5D1QC 5IEKB 4KVCL 1F4HA 4IRZL 4C8XA 3LKRA 2XV0A 4MQXD 1OGAA 4G6FB 1JD7A 1IKNC 1UT9A 1XTLA 4NQCD 5EIIB 1E2ZA 1C5BH 1GY2A 1NFKA 4X6DB 4Z7QF 1MLCA 3O8XD 2JH2A 1RZQA 3GLEA 4L3EE 4XXDB 4AEIL 3NA4A 4ZW8A 2R0ZL 5I1LA 4XNAA 5ISZD 3KYAA 2ICWB 3FH5A 2C1PB 3QJRB 1RIVL 1T1XA 4CSPA 2OX5B 5LG1A 5KVGE 2P8MA 5FO7A 5CINH 4FQ1H 4XNZB 4UYQA 2Y7QB 2OMWA 2DPKA 2E4TA 1A3QA 1NKGA 2CQVA 4JMXA 4G7SB 3BRDA 3V9FA 2R2CA 4HSCX 5DD5H 2KLTA 2NXZB 4KK6C 4HQQH 4LEXH 1QYGL 1HH6B 1RP9A 2UV3A 2FJHB 2IWKA 3EHBD 1F1DA 4F5CE 3PDGA 4FQHA 3B5GA 2ZSVA 3EYVA 1ZT1A 1JGUL 1N4XH 3MO1B 3JV0A 3NJHA 4JFZL 3TN0B 2BRRL 3ARDA 4YSTA 1UUSA 1F4WL 4NI6A 1J0IA 2I26N 2X09A 1B9ZA 3LD8C 4EBQL 3EOTL 4OCSH 3AQXA 3GSRA 4PJEB 1THCA 1U8PA 1KTLA 4ONGH 1KDJA 4N8CL 7PAZA 1KGWA 4PYHA 3ZIYA 2YSSA 1V8HA 2EDMA 4ZUUA 5FV2A 3O4LB 4WSJA 3QYMA 1A4JA 3DYPA 3CLEH 4XMWA 4IBVA 4TL5A 1E27A 5B8CB 3GK8H 3RP1A 2VC2B 5DUML 4QRRE 2K78A 3IFLL 4XPTL 3SDDA 1GZPB 1SJHA 1M6UA 1A65A 2BSCA 4FULA 2R1XA 3NAAH 1BG9A 5DUJA 4LDEB 1DBAL 2QVIA 4F58H 3U25A 4MMZC 4E0RA 2FO4B 4GKNB 4IHOB 1FDLL 1MCWM 2VUYA 1QBLL 1JGVL 3VFSA 3EJJX 2I07A 3TIEA 2XZCH 1KIRA 1BVZA 2A38A 2ZX7A 4NHUB 3MRPA 1A64A 3EJRA 4K3GA 4JG1H 3O6FD 5C3LD 1JZJA 4GKZA 5E0QA 2IH3B 5D7LD 5EOCL 7FABH 5FYJE 3WD5H 4P5TB 1T2XA 4AV5A 2P9RA 1B4JL 1GVIA 4IK6A 4EQ2A 1QWNA 1KELL 3A4EA 2WW8A 2DLFL 3D12B 2ROXA 5I6XC 2KPNA 3QHFL 1EHAA 2YXMA 3L3HA 4IJTA 3CDZA 2NX5B 5MENA 3IDIA 5D1ZB 5IBUB 3BXNA 5BXFB 2R2HA 2EADA 2W38A 4AUJA 3AT9A 4ZFZA 1W72L 5IUCA 5D7IB 2HZHA 3OJVC 1RIUH 1CIDA 2WIIB 5GRUL 2HTKD 5B1AB 4FFYL 3DX9B 1A3RL 3NACH 1CU4H 4MCZB 4NQEA 3E2HC 3RLSA 3H2QA 2XA3A 1HWWA 3AXLA 2VDRB 5FYJL 2GAZB 2VZTA 1NCTA 5F9WC 1S78D 2G9HB 2FWOA 3OKDB 5K9KA 4HFWA 1JZGA 2QFRA 1XHHA 2VJ8A 5E8NA 5LXVA 1G7JA 1NAMH 1WCBA 3A4FA 4NZUL 2UWEF 1G7QA 2J56A 5MEPA 1RUAL 1FL6A 4HXBH 3UC2A 4OZ4A 1CLVA 2X10A 3VGEA 3KCPB 1YY9D 4UM8A 5BRZA 5C09E 4GRMB 4H8QA 5LKNA 2PXYB 5J6SA 4CKQA 1CLYH 1TVBB 4ZX5A 5E8DH 4OCXL 2A77H 4XVTL 4N3UA 4BUQA 1EDYA 3FU6A 1TZIB 1JNNH 1IM3D 2ICEA 1L9SA 3GXFA 5CJ5A 5ICYB 1H6FA 5GS0L 4IRSA 1J1OL 3UZEC 4ADIA 1ZTMA 3V4LA 4W6WB 1OP4A 5ERWA 3QR2A 4DJMA 1CCZA 1G87A 3S37X 5GSRA 3UZQB 5IB5A 5D4HA 3ZO9A 3KYNA 3KWXA 1JMZA 3G9VA 3T0XA 1Q0XH 4OAWA 3H53A 3CAFA 3D4YA 3G5XA 4A2HA 1PDKB 1XTMA 3FCBA 4HUWB 4GMSL 1JV2B 1KTDB 1LILA 3FHAA 3UZEA 5D70H 3CSBA 4JRWA 3K4DA 4MAYA 4ZSOA 1M05A 2JKRM 1V3JA 3UGXA 4F2MB 3Q0HA 5C70A 5EEXA 1EBPA 4G8IB 4NFDA 1FNSH 4FNQA 1B0IA 4NN7B 4BUGA 1YN6A 3NCEB 4PJAB 3PQYD 4Q7DA 2X89D 5DVPA 2VXUL 4PJGB 5ALBL 3AZUA 5I75B 3RVXD 1NL0H 3X12B 4HIXL 4QHUA 5J56B 2YD6A 3B2UC 5T1KA 2P5WA 3AM8A 3DK0A 4WJG3 1ADQH 4PVLA 2IGFL 2CXGA 2E9GA 2XWRA 2CUAA 1DQQA 1JGLL 4PU2A 5I1JL 1VKXB 2BHUA 3GMNB 2P8LB 1BIIB 3MOBH 4XB8A 3IAGC 3VFGH 3CVHH 3ES6B 3ZDYB 1FN4B 3R0MA 3FUNA 4ZXBA 2D0HA 3WG7B 3MLRL 3QDHA 1WJ3A 2H2SC 4JFHE 1TG8A 1BAFL 2AQPA 2I9LA 4P9MH 3WNNA 5D2LB 5MERA 2VDNH 2F19H 2ZKHH 4KJWC 4QI3A 2Y2WA 1REIA 5B1JA 2CHWA 1QG3A 1QHOA 2FX7H 3AQZA 5SV3A 1OCZB 2B08A 2F8OA 3E6HA 1HJBC 5D5MA 3E8UL 5CGYC 2AJSH 4HJGA 2LW3A 2C8NA 5K1NA 1N5AB 1NIEA 5JNYB 3FSAA 4I1PA 4RGOL 5CCHE 3STLA 1LO0L 5ABZA 1K3ZA 3GRWL 5F1NA 5IMOA 2VE6A 2QJDA 4JFFB 4PW4A 2FCBA 2QADB 3QUHA 4WWKD 3NIFF 5HJ3B 1F90H 1PSKL 4BK8A 1I3UA 1KXTA 2JELH 3UC0H 1LK2A 3FH8A 4GXVL 2OYKA 3OZKA 3NSFA 3VFMB 1Z9SA 3QC6X 2KBGA 2QQNL 2OSYA 5B39A 3T0EE 1ADQA 1MZYA 1KJMA 2VISA 3GMQA 4LPXA 1WTLA 1IKOP 4OZGB 4ELDA 5I24A 2DQEH 1OSPL 1NC2A 3DX2A 1BIHA 1HKLL 3CVHA 3ZE2B 3GSVB 4PRHB 2IF7A 2H0JA 3HBPA 3O0LA 4TNFA 1JZ3A 3OD3A 1HZKA 5A2AA 2Y72A 3GBML 5DJ0B 2VW4A 3BVTA 5HDQH 5BZZA 4DVRL 3HCVA 5DZLA 4XMTA 3ABZA 2W59A 2YK1L 4EUPH 4PJ7A 4PJIA 2G60L 4XCEA 4NZTH 5I8KH 2O93L 3UBXB 1FC1A 4XVUC 3MLSL 4JN1L 3CSGA 1LMKA 2N7AA 1HWHB 4U6YA 4IRJC 4NKOA 5C07E 2G0KA 1IARB 2P44B 4XP5L 1XXFC 3VFWA 3VI4F 1AC6A 5HHMD 5C9JB 1EA9C 3FCSB 5E9DB 1FAIH 1EAPB 5KJRH 5FHAH 1YEGL 5KSAC 4DQAA 1NCAL 1S9WB 3A6OA 4QGYA 1QPXA 5C6TH 1UURA 3MACL 4JUSA 1YHPA 5E94B 4ZDHB 3FMGL 2NPLX 2J8UF 1JPEA 1MCHA 4NWTL 3VO0A 3OF6A 4AIZA 3C60D 2VDML 1GCYA 2QGDA 1OAKH 3CK0H 3MV8E 3QSKB 4PJXA 4H25B 5D2NB 4F9LC 4PR5A 4FHKA 1D5IH 1ZK9A 4UV7H 4XP6H 4BZ2A 1CG9B 4KK5D 3RA7H 4QUOA 5ETUB 2Q3AA 1WBZB 1NC4D 1KXHA 1B4LA 3LRKA 4LASH 1ZHLB 4CNIA 4TQEL 2YAHA 3PLYA 2QV2A 3GPEA 4LPYA 4N86A 5DF0A 5HGGS 3QFJD 1FIGL 1NDTA 5CEZH 4K73A 1BZ7B 3NSCA 3GSXA 1PY0A 4QLRA 3EDFA 1PW3A 1S9KC 3BUTA 5ESVB 1P5UB 4JFDE 3M86A 1DVQA 4M6NH 4RMBA 6FABH 4YXHL 4YEEA 4OD1H 4UT6A 4LQFL 3AT8A 3B83A 1CLZH 1CD1A 4K23L 5CGMA 3UAEA 2DDQH 2XUWA 3QG7H 4JFEE 5CIPB 4M3HA 4N0UE 3BVWA 5JW3H 4WW1A 3TA4D 2R4RL 2ZOTA 2V7HB 5JDSA 1GSKA 1DLHB 4RGND 4LIQH 4FFWD 1MFAH 1TKWB 4L3EB 1M71A 4UYPA 4QJ4B 4TUOA 3V0FA 1TITA 4PTTA 2MKWA 2PTVA 1ZJBA 3D25A 4Y5XB 1W0VA 1BD2B 3C9NB 1H3PL 1LP9F 3L95A 3ARGD 3V5HA 3V6OE 1BBDH 3A23A 4N26A 4DAGH 2GSGB 3GMPB 3QT2A 2Y5TA 1H15B 2YEZB 4M1CD 3WE6B 1OE1A 2PO6D 4P5MA 2KH2B 3CXDH 5EMYA 2DMKA 5DMIL 4XCYA 2ZICA 5CLYA 4WGWB 2HCZX 4KVNH 4YXLH 4FLHA 3CVIH 2X2HA 4AQZA 2NCMA 1PKOA 3H2PA 3RWCA 1UH2A 2GG1A 2XKNB 1MFVA 3S4SA 2DEXX 1B0GA 1U4EA 5HHOB 4FQXB 1LEIA 3UXFA 3ROOB 1BEYH 2IH9A 4ZPTA 1ERNA 3MRBB 3E38A 2VXTH 2ZOKB 3EYOB 3IXAB 4GIAA 5EBMA 3EYFA 3FO2B 1Q1JL 3TH2T 1AIFA 1VF5C 1BXUA 35C8L 4QRAA 3BYTA 3RWJA 4GAAA 3FT1A 4NAJA 2TAAA 4PB0L 2CBMA 4J6RH 2VQ4A 4Z3HA 3T4YA 3OAZK 2J25A 4L4TD 3EBIA 4YDVB 2YXVA 4EKXA 3P77B 4Z76A 4QRRB 2BLFA 3MNWA 4TVUA 1UM6H 2AC0A 5I8EA 5GGTL 3LKOB 1NUNB 2DTMH 1QHQA 4D2NA 2WBJD 1MQKH 2X40A 1MHCA 4PJ5A 2O5YL 4JQIH 3S5LB 4AVKA 4GUOA 5EU5A 5BS0D 3NN8A 4JZOB 1QLEL 4AE1A 12E8L 1LWJA 2GEEA 2ZCLL 3K2UH 4GO6B 3VXRE 3TPUB 1W72B 1MF2L 2UZYB 4DN3H 4Q6IB 1RZ7L 5KZCB 5BQDA 5KW9H 3BI9X 3N50A 3GKWH 4O02H 1E4JA 5EF0A 3KLHD 1JUFA 1LDSA 4FDWA 2Y6SD 2D3JA 4L3FA 5DJZB 1OGTB 2A74C 5FM5M 3TNNB 4G7VH 5SX5K 2ZUVA 5EIVA 1JE6A 1QFWL 1CGUA 4DT2A 5I71C 1PPIA 5BO0D 1HOEA 1A14L 2Z91B 4UT7H 1OF2A 4ZO7A 4RGMC 2XN9D 5L9DL 1F45A 3S34H 1CDUA 1DUYA 2E27L 1KIQB 2WLZA 1XF2B 2EVJA 3HOGA 3CPLA 5DMGC 1F4XH 1KLFB 3C8KA 1NBQA 1RLBA 4FXTA 3V8OA 2YA0A 3ILPA 4HULB 3VVWA 5JUEL 1FLRL 2XVBA 3QIUC 3MBXL 3VRJA 3TCLB 2LOEA 1ETB1 1V54B 1MI5D 1XGQB 3P0VL 2IDQA 3G6JE 1UGNA 1T21A 3QCVL 3D85B 2A9DA 1UFGA 3V52H 4L4VB 3QUKB 2ZNXA 4HPYL 3F83A 4N4YB 3ULUE 2EEXA 4IKJA 3QEGH 1EAOA 3LB6D 5SX4H 3ZIMA 1ZLUK 3OZ9H 2QQKL 1E50A 1PY9A 2G5UA 1QKZL 3A67H 3WIFA 3TYGH 5ITBL 1X5JA 3HE6D 2UXFA 1O6VA 1Y7VA 3N44B 5EHFA 2BJMH 3KPLB 2QPSA 3GLAA 3INOA 4D0BB 5L6YL 4P5KA 3CWGA 1PCSA 4PHXA 2EUVA 3VMPA 1WC7B 3GSQB 3QNYB 5TD4A 3EFFA 4KPHH 4LOUC 5C09B 2PN5A 4O02A 4Y2DD 4ZAKA 3QORB 3M7OA 3BIKB 4LEEA 4P3DB 1L9NA 1MJUH 2JKTM 3IDMB 2X9ZA 4Z7WE 5F7FA 5T1LB 3TONA 2E56A 3DROA 1U8KA 3PU7A 5FEBA 3SOBL 1YMMA 1Z66A 4C83A 2BK8A 5FPIA 3H7BB 1CL7L 3RPBA 3QDGA 5D9SA 3U7AA 1BAWA 1P84J 4UAHA 3RURA 2WCPA 5HYQB 2I9TA 3PABB 4IBWA 1AQMA 2FB4H 4QKXB 3RIAK 2HVJB 2OQJA 3FN0L 2KT6A 3UYOD 3DPDA 4N2NA 1RQ5A 3KWTA 2DQIH 1T66D 3FO0L 2PW2A 3BPNB 2OJEA 3MU3A 4OLVH 2B1OA 1CURA 5IW3A 2Z7ZA 4FJ6A 4RMVA 1E65A 4DO6A 2JKJA 3ETTA 2BNUB 3F8UB 2H1PH 1UVQA 4AGPA 5K9QG 1NGPL 3I6GA 4I89A 2X1XR 4KKNA 3RNKA 2CE6A 1D5BA 2UYLA 2VABB 2ZP9A 3D18B 5J1SC 1WFNA 5IVNA 1BPVA 5IUSA 1NFIA 4Q8BA 4U4BA 3ECBB 1PG7H 3CXFA 2GTZB 4R8WL 5EZIL 1MUJA 2FR4A 1JNJA 2JJSC 5DURB 4M6OL 3CIAA 2Y1AA 1HK6A 3QPQD 4R84A 1ZSHA 1J18A 4N5UA 4E42A 1TJXA 4JREC 2J5LB 1U8CA 3LIUA 1QVOA 3DDFA 5CF3A 2HRHA 1LEKA 5LWYL 3FQYA 4AENA 3K2IA 2UY7B 4HWEL 1MCRA 3ROLB 2O5NA 4R4BA 4IU2A 3QQDB 5FYKH 3SOTA 1K6QL 4ZMLA 5EU6A 4V1DD 1RXLA 3ZKND 4KDWA 3MV9A 4A2EA 3F58L 3BPLC 4CL7A 4KGLA 5I0WA 3VGGA 4GQZA 3SQBA 5AW8B 1KDIA 1DQDH 1P1ZB 3LZLA 4JJ5A 4FABH 2EYSA 1EJ6A 3TZVA 2APXA 2J6EA 3V6BR 3JWDH 5IJKC 2GJRA 1D5XA 1OB0A 2GITA 3NJVA 3LIZL 3P9LB 2EKSB 2X3BA 3EF4A 5I0XA 3ME0A 2BFVL 1ZA6A 1B0WA 4IHBA 4JO3H 1LE5A 5HVGB 4ICWA 2WB7A 1ILSA 1BVNP 2BSEA 4ZTPH 2VDPH 5DDHB 1PZAA 5E1AA 3CN2A 3JUZA 2BIQA 5T3ZE 3W38A 5DD3L 2HFGH 1HHJB 1NBZB 3CU7A 2WBWB 3C6LA 5FUCE 2FTAA 1WAAE 3FU3A 4S2SA 4PRNB 3C5ZA 5IFHH 3LAFA 2VXQH 4X50A 3QG6A 2QQLL 4TYUA 2ZCKL 4AUYA 4NPKA 1TTRA 4KXAA 1PL3A 3I84A 1HHKB 1N6QL 5EO1B 2VN5A 5SX4I 1W16A 5E6SB 4C55A 4XB7A 3VXTA 1JN6A 2EXSA 4ZMYA 2VH5L 2O6EA 2OI9C 3JWDC 2XETA 1J0HA 2XNAA 3BRFA 3QGVA 5TQ2H 1JCVA 4O2FB 2X5PA 4LCWD 1VFBA 2EJ1A 4NM8L 1TYEB 4O9HL 5KSVA 3FUIA 3QZPA 5T3ZL 5IB3A 5HY9A 3L4TA 3FUMA 1C5DA 2CJUL 1EAJA 2XQYA 2X3AA 5E1IA 1AGCB 2VDMB 1FPTH 2ITEA 4NZ8A 2IADA 2CLZA 1HFUA 2GW5A 2AQTA 2ZUWA 2X4NA 2EE2A 4RAUA 4LL4A 3T2NL 3UTQB 2HLAA 4CJ0A 1LGVA 2BNQB 2X88A 4GAGL 4HZLA 5KSBF 3FFDB 5KJ4A 4XN2A 4HKJB 2V9QA 4CSZA 5C07B 5GGSA 4KKBC 1NCCL 4L8CB 1JPFB 3QDJA 3DMMD 3MLTA 4GW1B 5I5RA 1I7TB 2WQ8A 1AS8A 4W81A 1R3IL 3BLKA 4IQHA 5FFGA 4ZJ9A 4DKAA 1X5MA 4YOKA 2QL1A 43C9B 4ZMXA 2GQHA 5J5EA 3QPXL 5IVXE 3X14B 5JLZB 4ZUTA 4PCSA 2ZIDA 2JI2A 1JXKA 3O0RH 1KJ3L 2I24N 2Y1YA 3LN5B 5HJDA 3MV8B 4K3DL 4N25A 1MCOH 1WTGT 4N5EC 4WDIA 2H5UA 3HG2A 4DUXA 1K72A 3TYFB 5CJBA 1AY1L 5F8QC 5IBTL 1YQVL 3MCKB 5DZNA 3W9EB 1UA7A 1CO1A 1YEKH 3EGDA 4RRPM 4J8QA 1QNZL 2HFFB 4HV8A 2PKDA 4G42B 4LKXB 2B8OT 5DQ9A 3EYQC 1MEXL 3I6LD 4WV1C 2VLKD 4KV5E 5L2KA 1HH9A 2WXNA 3F7RA 2KQMA 1T89C 4EEEA 4NC2B 3GXPA 5LGHH 3TF7C 1IL1A 4JFDB 4HIJA 1RVFH 1TF4A 1UXWA 4XPHL 5LAXB 1A1MA 4F2EA 5EIIG 3LH9A 1P84K 1P5VA 3MTRA 1AMYA 4YC2B 3DX7B 5I8OH 3KLLA 1W8NA 2QPEB 2R9HC 4IIQA 3UTPE 4AK1A 3KDMB 1OOAA 5EZJB 5F0PB 1DDHB 3EYUH 5GRVK 1AQ8A 2OTWA 3WJJC 2EEBA 3HZVA 3MUJA 4JFEB 1KPRB 3OC5A 3TT1H 1QWHA 5FW6A 3QEUA 3W9DB 4L5FE 5ID0B 2XIDA 4O2CB 4RLDA 1NEZB 1QOKA 4NSKB 3JWNG 1UATA 3QEHA 4L4JA 4NNPL 4WW2A 3WFEL 5CKAA 4TVPE 1E8YA 1NBVH 2ENJA 3UCRA 3PGCB 4QHMA 1P6FA 5FA3B 1RULH 2FIKA 3MC0A 3RPKA 2JCCF 1IBGL 3O3UN 4QYOB 1JGEB 2Q8BH 1KFAL 2AF2A 2XQBL 1EO8L 4ODSL 1IGCL 1E4HA 4F8QA 3IFPB 5MHSE 2BP3A 3BZ4A 4NO2A 5FOBB 2F0CA 1U8MA 1IQDA 4OLYL 3L3IA 4C56E 1DYZA 4MNGE 1I1AC 2O61A 5B38B 1Q94B 4XNUL 3K8LA 4L5FL 2CGRH 3KM1A 4X4YB 4YH6A 4JRYD 4JFSA 1IGTA 1XFPA 2YBRA 5EDSA 3UADA 2F54E 4CGUB 3FQTA 4R7DB 2D31A 4TVPL 4OF5A 3WEMA 4LSRH 4J3SA 1AG0A 3BDYL 1QTSA 5T3XD 3VXNA 5A2BA 5EC2B 1M2VA 2HKHL 4NFCA 1MCBA 2PNDA 3ZO0A 2DM3A 3CVDA 3FQ2A 5AOIA 1RZIB 1C1EL 5CZXC 5DVMA 2VIRA 2WWMC 4NC0B 3RX5A 2Y3NA 1I1AA 2JVUA 5DSCA 5IV2B 3VSVA 4DEUA 3QCTH 2Z3FA 5EO9A 3RWGA 5HHXH 1TQUA 5EWIH 5IW1B 4FADA 2HX9A 4P5RA 2QKSA 2V2WA 1YG9A 2NZ1A 5C0AA 3BFWA 3ETBF 3HMXL 3CV5A 3MROB 4JDZA 4PUBL 1KBVA 2ITCB 4PGZA 4ELMF 5SWSB 4AEEA 2V2TB 4HPHA 3IJ7A 3DX0A 2D3NA 4OUOA 2RFXB 2CR3A 4WUUE 3WXWH 4MMYB 3GSOB 2ITDA 4HEPG 5F9JA 3WFHA 1IC4L 4XCFL 4E2OA 3VXRB 4YSUA 4KUZL 2DMGA 1OZTG 2JNZA 3WEOA 4UMGA 1NM4A 3WLWC 1NUGA 3QNXA 1BYNA 4E41E 3CFNA 4JY6B 2HLEB 5CN1A 3FOMA 5EIQA 3K8KA 4Y4HC 3TNMB 1S7XA 5TF1L 1NCJA 1MVFA 4XOBA 4K8RH 3OVUB 1MDAA 3Q48A 3GSUB 1UJ3B 2VN7A 1U8HB 4MVBD 5FK9B 5IBUG 4ATWA 1DJYA 1E9QB 5I8CA 5C2UB 5DS8A 1ZOXA 3NPZB 3K6DA 3TH4T 3DOIA 2RGSA 5IVZB 3FYIB 4HHAB 3NZHL 4FL4C 3BT2H 5HYSB 4NFBA 2YQGA 1RK1B 2D2CC 3ABGA 1KGUA 3RTQB 2GTWA 3V6ZB 5E4EB 2CNYA 2YPVL 4BQBA 4XP4H 1B3JA 2A6JA 1H3UA 1NM9A 1Y07A 2H32A 1KV7A 2A83B 4NJ9L 3C5SB 3MLWH 4OLZH 3G6JB 1OPGL 1S8DB 1A6TB 3WBDA 3S37L 3TBYB 2O26U 4D9RE 3IDNA 2VR8A 3UTTB 4K8RC 5DJYB 1T0NB 4XRCB 5DS2A 5C0DA 1CDBA 3LN4B 3RY6C 3Q9PA 3VXUE 5IG7B 4H1LB 3MA9H 4FFVD 1RMFH 5JOEA 3PAUA 3V0GA 2ICCA 1KLGA 5CMAB 4PG2C 3A22A 3HJEA 3QHZL 2PPEA 4MJID 1I9EA 1KIPB 2LQRA 3HHMA 4LSVL 1EEZA 5CLXA 5H8DA 5AFAA 3AQDA 4JM2B 4HT1L 4QRQA 1KJVB 3A4AA 2E9BA 4Z7UA 4Z7WB 3DX8A 3IXTA 1HCYA 2J88L 4QAMB 1XEUA 5C0CA 1YMHB 4AYBA 1S7SB 2YGNA 3D2UA 5IMKA 2EC9T 3L7FB 3MFFB 2E5EA 3BKMH 5DYOB 2PYED 2GJJA 3QUYC 1J48A 1AO7D 3KLQA 5TGBA 3UTSD 4PG2A 3FQXB 4YIQB 1G9MH 4OT1L 4Y5VA 3H4HA 1G7LB 3KW7A 1EHNA 1T0MA 4MD0A 4DZ8B 4ZFOA 3NP4A 2ZX8A 3V0AC 4JN2A 5CD3B 2EIDA 2W9EH 3EJPA 5FW7A 3W5MA 2GSMB 1IIKA 5SWQB 3NA9L 4U6VL 4EZMA 3D30A 4PJDA 2J71A 4JE4B 1RIHH 3GIVA 4WSKA 1NJ9B 3F7VB 3QULA 1HE8A 4JNXA 5C1MB 4CAGA 1MRCH 1NMBL 3RU8H 1AKJB 4FLQA 5E9AA 2DWXA 2GJ6E 1ZXQA 3WSQH 1O6TA 2DF3A 3BEVA 1KTCA 3AVEA 1FORL 4P8QA 1MW1A 1ODAA 4N2KA 2Y2YA 1D6EA 4OZIA 1AR1D 2XKSA 2XPYA 4J4PA 4PLJC 1G9MC 1TYJA 3SDAD 3KEHA 4R26L 1JNLH 1P7QB 3LKSB 1OPOA 4EZKA 3H9SE 4AGOA 4L9LB 1GS7A 4F1ZA 4JL2A 1A4KA 3NCMA 4P23B 1T1WA 2FX9H 4NBXB 5J13B 4GI8A 2E9JA 3KPMB 3NGBB 3ISYA 3GDBA 5DVLA 2WSPA 4M5YL 3G5VA 4OI9A 4WNQB 5IMLB 3MXVL 2K70A 3TM6A 3VSTA 4XNDA 3LNFA 1AD9B 1SN0A 3D3VE 3MNMA 4N0YH 4R3SA 3SBPA 5H35A 3EJYD 3MJGX 5C0EA 3VQ2C 4FNTA 3ZTCC 5IB2B 2DQDL 5I66A 1J7VR 3P30L 3T8VA 5E6ID 3G5YB 3IDYC 4GUPB 5FLUA 1YEFH 2VLRA 1HU8A 3VFUA 4JK0D 4PB9L 4U2YA 2K9UA 3WN5C 1WFUA 3WHXA 1U3JA 2ZOLA 5CLTA 3VGHA 3V4VA 2D0GA 3UTOA 3U4BL 1OQOA 1XIWD 1R5VA 2DQUL 4JHVA 5IQ9A 4KRLB 4Y4FB 5HHQA 1OAUH 3MJ7A 2GUYA 2ZYIA 1A6PA 2FJFB 3JV6B 3MLZL 3U7WL 3WHE1 3WY3A 1I7ZA 2QSTA 4LCUB 5D71H 2ZPKL 2HJLA 2JB5L 4PRID 3DX3A 3HRZB 2ILLA 4F7TB 2WXOA 1IIIA 3Q6FA 3LHPH 2AXGA 1IAOA 3FONB 5FYLH 4TXVB 5GIRA 5C3TA 2Z35A 5K9QI 4KKLD 2FQDA 3PG2A 4OD2A 3HG1E 5I76B 3MRIA 3P4MA 1DANT 3DV6B 1TZGL 1IGFL 1EWHA 2BVEA 2X1WL 5DI8A 4U0RB 1A7PL 3L08A 1ZLVH 4X7DC 2AQQA 3U9UA 1T5WB 4TNWF 3UBXG 3UTZB 4I9XA 3UO8B 5T5FL 4XCCH 4PJBF 4BGLA 4HOMA 2N59A 3R1GL 4MGXA 1XZ0B 3N40F 3VXOA 1KB9K 1XF4B 2FD6H 2VLME 4BELD 2XN2A 5I1DB 1XCTB 2H47C 5FO8B 1FYTE 1SLXA 2EUZA 1A0QL 1ASPA 4X6FB 1KPUB 2P48B 4OIBA 5KVEE 4KI5E 1PU0A 1ZLEA 4POYA 4G71B 2WLIB 4FG6C 1TFHA 1NCHA 1A7OL 1I7RA 3DO7B 3EDJA 2ATKB 3T6QC 5IVXB 2A0LD 5AZEL 3T8XA 2YEVB 2R1YA 2ZWKA 1K5WA 1JZ4A 3SE9H 4K4KA 3BD3A 4HVBA 3NPSB 4PGBB 3QO1B 4DHLA 5JPNA 3BH8A 5K9JH 1Y1DA 3JWNH 5CM1A 3JVFC 2C3HA 3I02B 2JIXB 4NRXB 4OCWL 3STZA 4FNLL 1OL0A 4LXFA 4RDQF 1PYWA 2P7TB 5IBLC 2Y25A 4J1UA 1TQWA 4JRFA 4WIQA 5A3IC 3RIAF 1SXAA 1Q0YL 3ZYZA 5BJTB 5J57B 5HDLA 4XX5A 4S1DC 5KVEL 4P2RE 3B7SA 2GUOA 4XWOC 1EAQA 5G55A 1XGPB 2D2OA 4X5XA 1KXQA 3C6EA 3F5WA 3PWLB 1OALA 3TX4A 4XVOA 1MAKA 2X4QB 1N26A 1RZ8B 3K74B 4P9HH 2NY5H 2H41A 1VAHA 3C5XA 3NEOA 2EABA 4JZJB 4PCYA 3V9EA 4OGYL 3LDBB 4AI7A 5I15H 3VGFA 1NDGA 4U1GC 3ALWA 3J27A 4Q9RL 3OHXB 4Z7OF 1Z32X 1OK8A 3UBGA 2WVVA 5FA4B 2CMRL 4E36A 3REWA 2EEFA 5IEKA 3JWNC 4XBGA 4JO2L 2GVYA 4JB9L 4XNZC 3AT0A 3L3OB 5EC1A 1OM3H 3CN1A 1XR8A 5EIIA 1AXTH 4CC4C 2GIXA 4XVSL 4YSCA 5I6PA 5E6UB 2NXZC 2VC2H 5IFAH 2BX5A 4Q74A 1S3RA 1XB8A 2QR0A 2EVHA 2R0LH 1JK9B 2ICWA 3K2MC 5DT1H 2C1PA 4XI5D 4XE0A 4EI0A 2AERT 5I18H 3NJXA 1EEQA 5HVHB 2F5AL 3VX1A 2OX5A 4EI5D 3O2WH 2XTJE 4BXVA 3CU1A 1JFHA 4P9HC 3B7RL 2NY5C 3LVTA 3CFDB 4U6HA 3TN0C 4X5LA 2R29H 2EXWC 3ZKMD 2H9GA 2ESVA 1MELA 4OGAD 4C56B 4MNGB 1JBJA 2XZQH 2V37A 4M48H 3POHA 2CU9A 1HH6A 4YHYC 1U8NB 3NZSA 4P2OB 2FJHA 1DCLA 4CILA 1MVYA 2A2QT 2ZTBA 4ODWA 2F54B 3EH1A 4RAVB 5E03A 5T33L 3MO1A 1NUFA 4KTEL 5J89A 1H6UA 2AJVL 3TN0A 2NNAA 4BFFA 3DXAD 4M43H 1CDCA 2D7TH 1T0OA 4P4KA 1WZLA 3WIIH 1MPAL 4PJEA 3JT0A 5HI5C 3UAAA 4AQ1B 5A6LA 1AS7A 3ARED 4KK9C 2YZ8A 1QFHA 2F53D 3VSQA 2K3TA 3Q05A 2HUEA 1ITBB 4KDTA 1A1NB 3IU4L 4RSYA 4XP1H 3O4LA 4MXQD 1GPOH 3S5LG 3VMNA 4FCHA 1HEJC 2CUIA 2VDLL 3TP4A 4N0CD 2DS4A 3DOHA 3QEQE 3V0IA 4U7SA 5B8CA 4QOKE 2GIYA 5CILL 1Z3GH 4WUUB 2CHDA 2IALB 1E7UA 2VDRH 3BKYL 3K81A 3W82A 3HS0C 1VENA 1VERA 2FWSA 5CUSL 5LN4A 4KZDH 4APQD 5C0NC 4PHZA 1FSKB 2B20A 4D9QE 4HCRH 1QSED 3N2JA 3MTXA 3KPOB 4EXPX 4P5TC 4N9OB 1R5WA 2ICWI 2W0FB 1VFAB 2LGNA 4DP2X 1AQKH 3RBSA 2AJYH 3FJTA 2FO4A 2R29A 4GKNA 1ZXKA 2FYYB 1BOGB 1OAYH 4OBRA 4X4MA 3BAYA 3C5JB 4KTDL 3PP4H 4HEPA 3PAZA 5KSUB 1THAA 4UNIA 4UTBA 3VQMA 4NHUA 5IROC 4LU5L 3KM2A 1ZHKA 2I25N 3G08A 2AMGA 3WXVH 2IH3A 5E2UH 4Z3EA 5C0RL 5BZWB 5DHEA 1T4KB 5EF3A 1A47A 1XO8A 3ARTA 4P5TA 4AGLA 2HT4D 1AXIB 1D7BA 5AB9A 1TTCA 2CK0L 2YN3A 2WC7A 3M8OH 4LPWA 2XXFA 2X0VA 1LWRA 4WFGD 1F1AA 4PJ8A 2FO1A 4DKFL 4MXWH 3BJLA 5BOJA 1S7UB 1TO4A 1SYVB 3MX0B 3CHSA 3II1A 4ZUVB 2IBZX 5HDBF 5JO5B 5IZ7A 5D1ZA 4AYDC 5BXFA 2UXTA 4NM4L 5JZ7D 2D73A 2ZG2A 4L9DA 1DJXA 3BGFB 2MH4A 5D7IA 4G43B 3MSPA 4YHZH 1U3HC 1XBDA 1HILB 2WIIA 3BP5B 5AENA 1YN7B 4XHJC 3RVTD 4D8PB 1YAIA 4G7YH 3DX9A 3TEWA 4MCZA 1AZVA 2V33A 2V7NB 4W9EC 1SEBB 1N3NB 1LK3H 3KZ8A 3OJMB 3IJHB 2WXRA 2GAZA 3BJ91 2NY4D 4ODUA 3D69B 4UTAA 5I16B 2DQJH 2G9HA 2PXYC 1IEBB 3A47A 4BH7B 3OKDA 1RUKH 1R75A 3ZPDA 3IS1X 3PAVA 4BINA 1MFDL 2R0WH 2NY6C 3I74A 3NJIA 1KTKE 1KPVB 2MNWA 3H1ZA 3LZNA 2WO2B 5D96B 5DD0L 3ZHKA 3TU6A 1YNLH 3WKML 1OB1A 1XF5B 3BN3B 4EVNB 3OKOA 3N91A 1SY6H 2IG2L 1HT6A 2BO0A 4XXCA 1U93B 4JFUA 1A7NL 1FH2A 1J5CA 2VMCA 3KCPA 4QXVA 3ABKB 4GRMA 4U4IA 4WK4B 3WU1A 2YUXA 2CLRB 4BE6A 1TVBA 4DNLA 2R51A 2IDSA 3VRLE 15C8L 4OKVA 1HL8A 2MPAH 4WF7A 4JGJA 4FCAA 4GBXD 4EN3B 5ICYA 3I9PA 5DYOA 1ILUA 3UYRL 1A9BB 3BZFB 3ZKQD 2DQHH 4P46C 2RQ8A 3MJ8B 4DERA 4M61A 3DRQB 4FTVB 1HINL 3NRPA 4HZAA 4PCKA 4UQ9A 4F9PA 1MIML 2VB5A 4L18A 1FGNH 4H8VA 2OL3L 4AGNA 5I1GL 1G7IB 1QHPA 4NN7C 5GRJH 2APSA 1GW6A 3RDJA 1NIBA 2PCXA 3BESR 5CBEB 5I30H 2I69A 5I75C 1PDKA 3B9KC 5DK0B 3EOBB 1JV2A 1KTDA 3SPJA 1UA3A 2GJ6B 4NOBA 1CLOL 4WFED 5T1DL 4F2MA 3V0WL 3AS1A 4I0PA 5C0BE 4G8IA 4UQDA 2VDKL 2C3XA 4F1SA 5M95B 2NY7L 1UYWL 1M4KA 4IDLA 3I50L 3T0DA 2YGVA 2DLEA 4PJAA 4U1SB 4PJGA 3WN5B 3X12A 1YNKH 3T4AA 3HI1B 1URLA 4PBDA 4H8WH 4JHZA 3IBEA 1XR9B 3NOIA 4ZMAT 2IANA 1JHKL 3H9SB 2APTA 1KCUL 2J1KA 2X70B 2XYBA 3ARVA 4H5SB 1FNFA 1AYOA 3QDMD 4M03A 2JI3A 1PFCA 3IJSB 2ZE0A 3N85L 2BWIA 5HXMA 3ES6A 4FA8A 1FN4A 4G7RB 3Q8EA 3D3VB 1CGYA 2XQ0A 3P3YA 3NABH 4LARL 4XPBH 5GGQH 2BDNH 2WP3O 3QCUH 3FQWA 1G9NL 1OSEA 2PPAA 3FSOA 3Q6GL 4UI2A 1BFOB 3U2IA 1DN2A 1OE2A 1QRKA 3QUML 4W4OC 5CEYB 3ZDXB 4Q56A 5ACMA 3HZKA 5IJBC 5FECB 3MREA 1N5AA 2Y06H 1VPOL 5JNYA 2RALA 2C1OB 1IFHL 3LPOA 5EUOE 1JWMA 3JV4B 2OJZH 4JFFA 2BVPA 1VGEH 3ZSTA 1N0XH 3FTZA 3OGCA 2Y5QA 2OYMA 4ODHH 5HJ3A 1CD8A 1E3FA 2EZ0C 3LX9A 4RZKA 3WNOA 2PR4H 4XOCA 2MQCA 3E3QC 4KVCH 1QRND 4IRZH 4LVNB 3T71A 2C9RA 3FB7B 3VFMA 5DJ6B 3ZK0A 3AXHA 4NQVB 2I7OA 3HG1B 1IM9D 4FG4A 4ELKB 4AKQA 2YGPA 1OQXA 4OZGA 1Y1UA 4AEIH 3HPLB 2R0ZH 5C08B 1KXVC 2DIAA 3NESA 3D09A 1RIVH 4OB5L 2DMHA 3TJHD 3K1KC 2ZP8A 3GSVA 3IJYB 4PRHA 2ED9A 2WXKA 2BH0A 4NN6B 2F58L 4OF8A 4DUVA 4HJJL 4ZI8A 2LU4A 1DQIA 2Y24A 5DJ0A 4B0MB 3I9IA 4RDBA 5HD8D 2R2EB 5CR8A 1R4XA 1PAZA 1NBYB 4ONHB 1FYTB 1KJ2L 1X44A 3CFIC 4UCFA 2APVA 1J05B 4ZFGL 4Z18A 2WPGA 1QYGH 4GRLB 4KQ3L 5CIPH 5CCGE 2WCSA 3ZJAA 5C9JA 3FCSA 1JGUH 5E9DA 4AVHA 1EAPA 2R7EA 3D0VA 4UQAA 4ZUSB 4JRXD 4JFZH 1TOXA 1CR9L 1S9WA 4L1HA 1DZ0A 1F4WH 4ZDHA 4EBQH 3VXMD 3ILQC 1PF3A 1Z5YD 3T1FA 3RWEA 4KHXL 2WO4A 4DKDC 1RK7A 3RIKA 4N8CH 4R2GD 3MUUA 1QASA 1J8HE 4H25A 5D2NA 3RGVB 5F0LB 4WFHE 4JQXC 1UD6A 2WQRA 4B9CA 1CG9A 4LCYA 1TJMA 1HEZA 3U4AA 4YLCA 5ETUA 1WBZA 4IGBD 1FFTB 4NNYB 4WHDA 4Y19D 3RVVD 1ZHLA 3IDGB 4P2RB 4KJQC 3CZJA 4PVMA 5DUMH 4XPTH 3IFLH 2F08A 1IC5L 3O9WC 2CDGB 4ATTA 2H26B 3BVUA 4MDRA 5CR1A 1BZ7A 5F1OB 4LRIA 4JQXA 5SWZE 4QT5A 1DBAH 4DZBB 5HHME 1P5UA 1QW9A 1FDLH 5HYJA 4GW5B 1QBLH 1JGVH 1NEZG 3AFLA 4N2HA 3OR6B 4Y5XC 1B2WL 5GQBA 4UIMB 3DIDA 2ZWNA 2EDTA 1HSAB 1RHFA 3NK4A 1NIDA 3U0TA 1AI1L 1KB3A 1QR4A 3SHSA 9CGTA 4N2LA 1V3LA 2AJXL 3EFDL 4YUEL 4JO1L 5EOCH 3UBXI 1PZUB 1DLHA 1LL1A 4L3EA 1FFRA 2B1HL 4QXUL 1KELH 1JZ2A 2DLFH 4PRPD 2B15A 3QHFH 4ZZFA 5D1QE 2JCWA 4Y5XA 1PZBA 2UVEA 5IQMA 5TQ0L 4KC3B 2XTJB 3C9NA 5IR1A 2H0FA 3CSYB 5EH1A 5I6KA 1OAXL 3LCYA 1F8TL 1W72H 4LCIL 2KQNA 3RX7A 2R8SL 4F7EB 3GMPA 3CCHB 1H15A 5GRUH 4FQXC 4FFYH 2VDLB 4TNEA 1A3RH 1LDPL 3DVFA 2CZNA 3ML8A 3GXUB 1X5XA 2FE0A 2EXYC 4I5BA 1LM8V 4PI0A 5JMOC 4F5CA 1AHWC 5FYJH 3VTMA 3T6ZA 4XO9A 4LLWB 1NSNL 5E2WL 3H42L 1SZNA 1JI1A 2XKNA 4LO9A 4HXAL 5JXAL 1BEXA 2BIPA 2ZOUA 3DUSB 3NRFA 1G9EA 2A73B 3S3PA 1COBA 2R39A 1C12B 3ARDD 3BO8A 2YC1A 4P49A 4U1HB 4N24A 3ROOA 4NZUH 3GB7B 3MRBA 3COOA 1A9VA 3WTVA 1RUAH 2ZOKA 1JZDC 3HNSL 3IXAA 1GJIA 1MXDA 3O6ML 1KYFA 4PP2B 4YBQD 3CC5B 3FO2A 3QAZB 3TWCL 1JXDA 1CUOA 1G7MB 2MKLC 3TV3L 1F4AA 1UH3A 3FTWA 4Y1AE 4OCXH 3QEQB 4Q6IC 4QOKB 4XVTH 5D5MF 3VWKC 3ZXAC 1EFXB 4QRRA 1FZMA 2YPKB 3N1QC 3MRHB 3RIFK 1BPLB 4FRWA 2DICA 3LKOA 5AB2A 5GS0H 3IF1B 1J1OH 3SDDD 1KENL 3S5LA 1TSHA 2O1AA 2F9BT 4JZOA 1ZGLP 1EDQA 3P0YH 1RSYA 3ZDZB 4HS8L 3FPXA 1W72A 2N7SA 3QAQA 3CH1B 4DVBB 2UZYA 3LEVL 4PV8B 2BXYA 1HJCA 4FFYA 1NCWL 1UWYA 1CTOA 3D7PA 3T3ME 4OCLC 2NUPB 3ZY7A 1OARL 2A6IB 4GMSH 3RVUD 4KZEL 1S7VB 5EU4B 1T83A 5HYSG 2Y9RT 2OSLB 2AITA 5DJZA 1OGTA 3MJ6A 3TNNA 1Z0NA 3OG4B 1ZTXE 3CSPA 2AS5M 4Y4KD 2JK5A 3C75A 1I3RB 4NGHH 3F3HA 3FZUC 3WTYA 5DFTA 2VXUH 2ORBL 5ALBH 4Z0BL 5GS0C 2PF6A 2Z91A 5MEND 4HIXH 1DJGA 3RWFB 1VSCA 3JT2A 3OKNA 2VQUA 5DD5L 1KIQA 1AANA 5L0QC 1D2OA 4PJ7F 4PJIF 1XF3A 1IBDA 4OM1L 4IMLA 1T04B 5I1JH 1XCQA 1WLHA 2ZXWB 3AAZB 4URKA 3TCLA 4H1LG 4NQED 2UY6B 1MSPA 3D85A 3QORC 2AW2A 3MLRH 3QUKA 4TQ8A 3U4EB 1BAFH 3VACA 1ZTXL 4GG6E 1SXSA 2QBWA 1RJYA 2OL3B 2XY1A 4XBMA 4F15C 1SLWA 4H2CA 2DLHA 4Z77A 2C4FT 3EH2A 3KPLA 3PWUB 4D0BA 5BRZE 3E8UH 5ESAA 3T0WA 1TJIL 1WC7A 3QNYA 1CQKA 4RFNC 2RB8A 5C09A 1PLAA 1YEWA 3QORA 1CMOA 2YAEA 3SQOL 4RGOH 4P3DA 3VRIB 1QSZA 2FL5B 3IDMA 4YFDB 5T1LA 3GRWH 5DMKB 3H9YA 2XY2A 3BPNC 3QH3B 4WKXA 5IGXL 3H7BA 1LO4L 2OP4L 4X9GA 1PSKH 4GT7A 3TESA 3P3RA 2VL5A 4GXVH 4IRSD 3DJZA 4L2LA 4UNTA 5DGQA 4Z78B 5BQ7B 4N2BA 2FQEA 4MCNA 3VXSE 2HVJA 1NAKL 2CDFB 3R19A 1U8QB 2QZQA 1IQWL 2QQNH 1CE6B 3O41B 3KXFE 5DQJB 2WXQA 3VAEA 4Y8AA 4BRVA 4AT6B 3L45A 3LRSB 4W9FC 1S9VB 2XZAL 1EGJL 4X9IA 3D51A 1HKLH 3BYYA 4N1CA 4KNTA 2GK0B 4NB7A 3FU0A 1VEPA 2BNUA 5GS1B 2XPGB 1MN4A 1P7KB 1ZHNB 4ZD3L 3AROA 2FO8A 2M1KA 3GBMH 5C0BB 2P80A 3NEEA 5C0IB 4DVRH 4MAYD 3D18A 3TTSA 4RA0C 5JQIB 4YSPA 4UQEA 3ECBA 1KCWA 1XVSA 2GTZA 2YK1H 3DVIA 2G60H 4NKIL 3IGLA 4OZHE 3CN0A 4ADGA 2M2DA 5JR1L 3MLSH 4JN1H 2I5YL 4N1HB 4X9HA 1C9SA 1IM3B 3QUMB 2CR6A 4TMPA 1SN5A 2MPVA 4D94A 4BK4A 4A39A 4XP5H 3ROLA 3TBTB 1XB6A 1ZT4B 5I17B 1YEGH 3BGAA 1AQHA 2ICWJ 2E76C 2ZP0T 3J07A 3GRWA 4W4NA 2W9DH 3MACH 4WI7A 3KE0A 1M1XB 3FMGH 3UAJA 5B22A 4F7CA 3NZ8A 4MNQE 1RPQA 1L6PA 4X4XB 5JORB 2NW3B 2VDMH 1MVUB 2WTOA 2V5SA 4Z7QB 1PMYA 4ZXBD 2VJXA 4LBEB 2CDEB 4BYHA 1PTZA 4Z3FA 3HC2A 1GGIL 5TPWL 2EKSA 1NZRA 1RJLB 1P7HL 4QRPE 4FMVA 4G83A 2DI8A 4ZYKA 4TQEH 3F62A 1X5IA 1IC1A 1Z9LA 1UCTA 3RTLA 4ANVA 1LYQA 3PQYB 5DDHA 3ULVF 1XH0A 2J12B 1E67A 3WLBB 1HHJA 4OJAA 5EUOB 1NBZA 1FIGH 3MR9B 4YHKL 1JZ5A 1J11A 3F7YA 2IOOA 4PRNA 5GRZA 1BW8A 2PWFA 2XVKA 3ATAA 3MZGB 5IKCB 4KJWD 5LCVA 4MB1A 5E2VL 3GUTB 1E90A 2FQGA 1KJ2B 1MG2C 2A9AA 2WN2A 5L4MA 5FO2A 2ZAHA 4DGVL 5FFLA 3FTVA 4LQFH 1C16A 1CE1L 1IE5A 5CGYD 4JZNB 1A6ZB 3EDKA 2ZOWA 1I8KB 4K23H 1UGKA 4Y16B 5A6IA 4LKCB 3T0EA 2R4RH 2YBGA 5FF6B 1BLIA 4BHUA 4O2FA 4HWUA 3MA7A 1HE7A 3IFOB 1FFQA 5E1QA 3MPCA 3RFZB 4EIGB 4N2GA 4LB8A 1EO5A 5DU7A 1NC2D 2YMXL 4TLSA 5DRWB 4E68A 3LRHA 1BFSA 3NFSL 4M62L 4KH9A 3SO3B 1H3PH 1NCDL 3JVGC 4ABWA 2P8PB 1OTUC 3HAEG 3UTQA 2Z64C 3DECA 5CLWA 2HX8A 1XCWA 3FFDA 2PW1B 4WWKB 4U3HA 4HKJA 4EO5A 4HC1A 5C07A 3IM1A 5DMIH 3FH7A 3TVMB 1FFOA 4L8CA 1JPFA 2R23B 4GW1A 3LRMA 3BPOB 4PS4L 3MOBL 3L5XL 3REVB 2ZT9C 1H8NA 1UT2A 2SODB 3FB5B 5TFSL 4PH8A 43C9A 2OKMA 2IAMD 1N5YL 3X14A 5EF1A 4PJXE 5JOFB 4GRWF 5FGSA 5KYYA 3LN5A 4JFWA 3MV8A 1LO5B 4XVUD 1J8HB 2F19L 4DPCX 4Y7OC 3OF6D 5AW6B 4PBWD 2CUMA 2PCPB 35C8H 1RD6A 3TYFA 3VJ6B 4ANKA 3WEXB 3MCKA 5JA9A 3W9EA 4GW4B 2QEJA 1AZRA 4DP4X 2HFFA 3ZQWA 4LVHB 2QPUA 2WINB 4YC2C 2G5BB 3EW3B 4G42A 4LKXA 4AMWA 2BIIA 4N8VA 5GGTH 5KTEL 4M4PA 2O5YH 5J6GB 4X6CE 2IBBA 5SWZB 5F7EH 1QLEH 5TE4L 5GJTL 3IAPA 12E8H 3FB8B 5HHMB 2ZCLH 5ACZB 4JFDA 1OAZL 5I9QB 1G0DA 3UC0L 1MF2H 4HWZB 1XGTB 5LAXA 3PCYA 1BZEA 1RZ7H 3AG2B 1HQ4B 3TFKC 2BHYA 4LFHG 3VA6A 1KGXA 2BIMA 4LVOB 4OGXL 5HI4D 3KDMA 3FT9A 5EZJA 1DDHA 1I1YA 4NQQA 4JFEA 2V3FA 3C60B 4N0UA 1RP8A 4JFVA 2UWEB 3A21A 4ADJA 3WIHL 5ID0A 4JPIB 4O2CA 1LO3H 3NJFA 1NEZA 5EOTB 4NSKA 4B95C 2YOCA 4BFNA 4ZS7L 3VFRA 1ZLVK 4Z7VE 3H3PL 4K7FB 1GL4B 5E70A 4N9GB 4C59B 5D1QB 4NT6B 1QFWH 5DO8A 4AEFA 4LPCA 1GTNA 3PGCA 3T3PF 1N18A 3FFOA 1UTDA 3JTTB 2YPLE 4WK2B 1A14H 2O30A 1JGEA 2B3IA 2IPTL 3BRGC 5HHPA 5L9DH 3RZCC 3V6OA 1YO4A 5INCA 4CSTA 1FLTX 2E27H 4XAKE 3POCA 1AE6L 1U8JB 1IBHA 1B88A 2FRGP 3AB0B 4R4FL 4FNPA 3U6RB 2COQA 2E7HA 5TTRA 2PP9A 1FVCB 5DJ8B 5JUEH 1FLRH 3MBXH 3SDCC 5CP7A 1FAIL 2K4AA 3UOAB 5B38A 3P0VH 5GGTA 5FHAL 3VFOB 3QCVH 4EJ1C 1HOCB 1VCAA 4HBCH 5HDWA 3ESPA 3LZRA 4R7DA 5CO1A 2IH1A 5CEZD 3R8QA 4YDZA 2R56H 5EC2A 5ITBH 3X1NA 5IB4B 1RZIA 4EMZA 3BP7B 5L6YH 3QUGA 5F9AC 1GSMA 3EBGA 5J3HD 3QIWA 4ZRGA 4MYWB 1N7ML 3LHAA 2D7NA 4Y1AB 4U3SB 4LIQE 5IW1A 3ULVD 1SDDB 3PRZA 1S6NA 2E7DA 3MROA 2D8KA 1MCLA 2ITCA 3WFDL 1L9MA 2WNKA 5CN2A 4FQCL 1CL7H 5I1AB 5SV4A 3IGKA 2BPBA 2V2TA 3HC3L 4F57L 2XFXB 5LO7A 3WNIA 1ADWA 4MMYA 3CFCL 2XWTA 2CJSA 3GSOA 4PJ5D 3E80A 4KGJA 1KY6A 4TUKL 5AVSB 2E7MA 5KS9E 3VXRA 1RL1A 3MXWH 1UJ3C 3D87B 3PPEA 4JRYE 3FN0H 4H1LH 1HQRB 2ZKXA 1GR7A 1R0AL 1YA5A 1BDYA 3APCA 4JY6A 3FO0H 2FUQA 4JJOA 4I87A 3BHBB 3T3MB 4FTDA 4WO4B 2O5XL 3H9ZA 1A6AB 3NG5A 4PWJA 3RTQC 4ZOEA 1T7WA 3M88A 1NBCA 4MMZB 5E4EC 3DBSA 1NGPH 1H19A 1YYML 3HVNA 3FT4B 3GSUA 1UJ3A 1U8HA 5GZOC 4LLVB 4XZUB 4H0GA 1E9QA 4L4TB 4R8WH 5EZIH 3IPFA 4KMLB 4PJFE 3QS3A 2XXGA 4MD5B 5IVZA 1BJ1J 4HHAA 4I9WD 1RJZB 5AVYB 3QJQB 2EDBA 1RK1A 1OD9A 5LWYH 2WSDA 3FYEB 3V6ZA 5BS0B 4HWEH 5I6XB 1K6QH 2EIZB 2JQZA 5AKRA 3BVXA 3K0WA 2XPZA 3N6YA 1AHKA 4EXKA 2NSMA 5CXPA 3F58H 4RIRB 2OXGB 3C5SA 1YRKA 3G6JA 3QZBA 4ZBJA 1A6TA 3MODL 4JM2C 3TBYA 3DHMA 4K5LA 5I1IL 2VW7A 4WEBL 5DJYA 1T0NA 4PG9B 5BV7L 3SCMC 4GG6B 3RKDD 1CXFA 1QFWI 5I19L 1WWCA 3LN4A 5CHNB 3LIZH 5IG7A 3VD1A 1A7RL 2BFVH 1FA4A 1E8XA 3EO0B 4XNQB 2FIRT 5ILTL 5F9WB 1WFIA 2HMIC 3OKLB 5CMAA 1OLZA 1UH4A 4O51B 1K3IA 4JM2A 1E6OL 1KJVA 1S2EA 5IP4A 4Z7WA 5DD3H 4ZAKD 5F8RC 3HKZA 1TTAA 3MOAL 3PHOB 3RHWK 4AL8C 3QXUA 1YMHA 4J6IA 3VH8B 4WTZG 4D7PA 4PN6A 3QYNA 2WTRB 4JQIL 2Z65C 1YMMD 4P99A 3CQQA 3L7FA 3MFFA 1C08B 1OT4A 2QQLH 2ZCKH 4JFQB 2Z6FA 3EG9B 4MXVF 4Y89A 3NSDA 1MJ7L 1SBBA 2CBPA 3QDGD 1JXGA 3FQXA 4UUJB 1N6QH 2HX7A 2IVFC 1G7LA 5G5DB 3BDXA 1H0DB 5EUKA 2CKBL 2EEDA 3NCJL 3VU1A 2VH5H 4QJ5B 4G6AD 5BRPA 2J8UB 5CD3A 2PPFA 4PTUA 2C34A 2VDQH 2Q9OA 1PCXA 3K46A 3PL6B 5SWQA 4NM8H 2MQGA 2OMTA 5DJXB 4O9HH 5A6MA 3EH5B 3CZSA 4MD4B 5T3ZH 2DZEA 4QCIB 2WZPA 2CJUH 3KVPA 4JX0A 4F7PB 1NJ9A 4LHUB 2X3CA 1QSFE 3F7VA 2H3NB 2H3KA 4MQ7B 2OYLA 4KX9A 1GHFL 1ZA3B 2BZCA 4L9LC 5F3HA 3UPCA 4WW2F 4ZOAA 3BZEB 4P23C 1CL7I 4GLRH 1UB6B 3ESUF 3T2NH 4LLDB 4OZHB 4AZ8B 4GAGH 3S34L 1KCKA 3Q3GA 3LNEA 3QJXA 3ZTDC 4IOIB 3UERA 3L4VA 4NP4L 1J87A 5DJCA 3UABA 4BZ1L 1NCCH 1DVFB 1X7TA 3GJEB 2XXMB 4JDEB 4LP8A 1P7QA 1X6NA 3LKSA 4GQQA 4M6AA 5A16A 2VERA 3PWPE 1R3IH 2DJMA 4OR1A 5I2IB 1PX8A 1KLUB 2HTLD <