3CZUB

Crystal structure of the human ephrin a2- ephrin a1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
130
Chain Sequence
b'ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYESVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
molecule tags Transferase/signaling protein
source organism Homo sapiens
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
total genus 29
structure length 130
sequence length 132
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3czuB00
1M9WA 3GXUB 1EZLA 2XVBA 4HHWA 5I6NA 1FA4A 2B08A 2IDUA 2XX1A 2IH9A 1PZAA 1ZDQA 1AANA 4YSQA 1L9TA 4M3HA 1QNIA 3L45A 3NT0A 2XLLA 4BDVA 4DP6X 3WIAA 2TSBA 1IUZA 4KNUA 4UAHA 3CDZB 1T5KA 1XB8A 3QJUB 4G70B 3ASNB 1ASQA 2FQFA 2BZCA 2VW6A 1PZCA 4G7RB 2BW4A 3T6ZA 2X87A 5I26A 1NTDA 3N2JA 3AZUA 1SFDA 2VSMB 1NIAA 3DTUB 5AKRA 2WO2B 2XV0A 5D4HA 2EIJB 1ZIBA 1BQRA 2XV2A 6PCYA 1AG6A 1ET5A 1SFHA 2Q5BA 6PAZA 3DIVA 2FQDA 4HALA 4AKQA 4YVUA 4BWWA 4YSEA 3NYKA 1A4BA 1B3IA 2Q9OA 4AKOA 2AZUA 1MG3C 2BWIA 2ZXWB 1AZBA 2I85A 1KDJA 5B7MA 1E30A 2XUWA 1W6LA 1GSKA 3CZUB 2QPDB 4L0PB 2FTAA 4HCIA 4KOBA 2VN3A 5IY5B 1YLBB 1J9TA 1ZV2A 3AG1B 1NPNA 5B7EA 1GS6X 2VW4A 2I7SA 2IDSA 2GHZA 3MX0B 1SHWA 1WAEA 1AOZA 1E5YA 1E65A 5B1AB 4DPAX 1EHKB 3T6VA 3PXLA 4DPCX 2LLNA 2DV6A 3ERXA 3WG7B 1X9UA 3OD3A 5LDUA 2YAQA 2QT6A 2IWKA 3CDZA 1MG2C 3EHBB 1OF0A 4NB7A 2PCFA 3H4FA 1KV7A 2J56A 3FPYA 3GDCA 3T6WA 4JHUA 4TXVB 2VMJA 2EIMB 3EH5B 1W8EA 1ET8A 5B7FA 1JZFA 2VW7A 3FU9A 3KW7A 1KDIA 3G5WA 4BK5C 3NJHA 3NSYA 4E9TA 2RACA 1PLBA 1NIFA 5PAZA 5PCYA 3TU6A 4YSDA 1HAUA 5I6MA 2CCWA 4AKPA 2DYRB 3S3DB 1V10A 1AS7A 2BZ7A 2BW5A 2FT8A 1JZHA 2TSAA 1TEFA 2XU9A 4A2DA 4WKXA 1GS8A 1NWPA 4G72B 2IDFA 3IN0A 2UXGA 3FSAA 2YAFA 2PCYA 2YAOA 4G71B 2BP0A 4YVNA 3OQRA 2CJ3A 3NJMA 3FSZA 1N68A 4DP1X 5B1BB 1ASPA 4CSPA 1JVLA 3OMIB 2OV0A 4GP5B 4K9JA 1SNRA 1BQKA 1SDDA 1F56A 1KBVA 2R7EB 4GP8B 3QJTB 4BXSV 1TEGA 4A2GA 1OOWA 3V9EA 3FU7B 1MZYA 3H4HA 2Y1AA 1OCOB 3TA4D 2JKWA 1TU2A 1HFUA 3NJLA 1CURA 3QJVB 3V9CA 3UGEA 4GXFA 2FNWA 1PAZA 1PLAA 2QPEB 4DP7X 2PPDA 1XB3A 1CYWA 1NZRA 1N70A 5ANHA 5I6LA 4YL4A 4HZ1A 4W1TA 5I5JA 2IH8A 3PAZA 4DP5X 1PNCA 1OE2A 3NJJA 2XXGA 1WA1X 1ZDSA 2AZAA 2PPCA 1AS6A 3OMNB 1FFTB 2IDQA 4EF3A 1PNDA 1GY2A 2H47C 3IN2A 1BXAA 3FQYA 1NDTA 2YAHA 5B1KA 2VM3A 4QLWA 4YSPA 3IEAA 4F2FA 1AZRA 1IBYA 2VSKB 3D12B 2HRHA 1V55B 5TK4A 1ADWA 2OCCB 4YSRA 2J5WA 2PP9A 1NICA 1IKOP 3ZBMA 4A67A 4JHVA 2WSDA 4ENZA 2HXAA 3UABA 2H3XC 3FPXA 2MRYA 3ABGA 1J9SA 3UADA 1OE1A 3BQVA 2W88A 1PMYA 1IBZA 1PF3A 3OMAB 4PAZA 3IBOA 1QHQA 1HAWA 2EINB 2XXFA 1AIZA 1ZIAA 3FSWA 3IE9A 3PAUA 1ASOA 4ZK8A 1BYOA 2I7OA 3H56A 3FQ1A 1A65A 1WA2X 2NRDA 3ABLB 3QQXA 1M57B 2IAAC 1TKWA 3NJGA 1ETJA 1IC0A 1AZNA 3C75A 5B1JC 1SF5A 3AG3B 5I6OA 3SQRA 2WO3B 4E9XA 4HHGA 7PAZA 1WA0X 1CC3A 2J57A 3QPKA 3TBCA 1J5DA 3FU8A 3WKPA 1AZUA 4E9VA 3NP3A 2AFNA 1WS7A 3NSCA 1PLCA 3FSVA 1BYPA 2EILB 4KNTA 5EHFA 4Q89A 2X88A 3ASOB 1MZZA 2OJ1A 3BVDB 4P5SA 5D4JA 1A4AA 3NP4A 5B1JA 1X9RA 2BP0B 2HX8A 3OM3B 4N8UA 2JFCA 4GP4B 3ABMB 2CUAA 2IDTA 4KNSA 1SJMA 1OE3A 3UAAA 2DYSB 1JXFA 2UX7A 3EH4B 2YXWA 3T9WA 1AG0A 4GYBA 2YAPA 1BXUA 4E9QA 5I6PA 1XMEB 5TK2A 4G7QB 4X4KA 2E86A 3JT2A 1GY1A 1FWXA 4E9YA 4Q8BA 2A3TA 5F7AA 2UXTA 2UX6A 3NSDA 2J55A 2QDVA 4G7SB 1KGYE 4BXVA 4FA7B 2YAMA 2GSMB 3NJKA 1ILUA 2FQEA 1UATA 2GC7C 2P80D 4A2HA 2PPFA 1BQ5A 2IWEA 1KCBA 2FT6A 2UXVA 3PLYA 4CSZA 2GI0A 3JTBA 4KO7A 4DP2X 3N55A 1RKRA 4W9ZA 1L9QA 2BP8B 1NIEA 2P80A 1CUOA 2FT7A 3FYEB 1PY0A 3WNJA 2YXVA 8PAZA 2N0MA 1KCWA 2AVFA 4JKNA 3TASA 3X1NA 4DP9X 3AG2B 4HCFA 1JXGA 4NERA 2XYBA 1J9RA 5A7EA 1JZGA 4AZUA 1AAJA 2GBAA 3S8FB 4QKTA 3WNIA 2DY2A 5E9NA 1L9OA 1XB6A 4KO6A 1JVOA 2DWTA 3AY2A 1AZCA 1M56B 2HRGA 2BO0A 3RYMA 3CVBA 5I5IA 1SF3A 3WI9A 3CG8A 4E9SA 2JXMA 2BHFA 2PPAA 1NIDA 2PLTA 1OCRB 4KO5A 1DYZA 1W6WA 1KYAA 3ZX1A 1DZ0A 2PP7A 3QJRB 4HCGA 4UF7C 4KOCA 2YAEA 2W8CA 1E5ZA 1AR1B 1RZQA 2FWLB 2PPEA 4BWTA 1A8ZA 4F7KA 3NSFA 4YSUA 3NJFA 1L9SA 3EH3B 2GB2A 1AACA 1BEXA 3FU7A 3X1GA 1JXDA 3X1FA 4FAAB 2R7EA 4N4YB 1QLEB 1SDDB 2AANA 4DP0X 5D4IA 3DKHA 3X1BA 1PCSA 4E9RA 3EF4A 3PPSA 2ZONA 5I28A 1OCZB 2CBPA 3AW5A 2ZWNA 1PZBA 5I6KA 1KBWA 3HEIB 2HX7A 3GYRA 1I53A 4GY4A 3UAEA 5B3SB 4BDVB 5FC9A 2GC4C 2MTAA 4PCYA 3T71A 3X2QB 1ID2A 1NIBA 5I5MA 1SHXA 4DP8X 4YSOA 2BP8A 1ILSA 4M4RB 3WKQA 1ET7A 2XWZA 9PCYA 1V54B 2HLEB 3S3CB 3AG4B 4HAKA 1A4CA 1JZJA 2CALA 5AZUA 1NINA 1RZPA 4KO9A 3PAVA 4A2EA 4DPBX 3PCYA 1RCYA 2CAKA 1JZIA 2QDWA 1AQ8A 3NJNA 3ABKB 1JZEA 2Y69B 4F2EA 3HB3B 1E67A 3KW8A 2IWFA 1L9RA 1ZPUA 2HZHA 3S3BB 3SBQA 2H5UA 2EIKB 4E9WA 3T6XA 4YSTA 2PP8A 3TBBA 4BWUA 2YQBA 2XX0A 1NPJA 3FQ2A 3FT0A 3ZIYA 4A66A 4YSSA 4AI7A 1GYCA 2HX9A 3MBWB 2XV3A 4P5RA 1J9QA 2DWSA 4DP4X 1GW0A 1NWOA 3QJSB 3X1EA 4YSCA 1BAWA 3QJQB 7PCYA 2VM4A 3UACA 3U25A 3ZDWA 1JERA 3NJIA 3S8GB 4WTQA 2B3IA 1GR7A 3FS9A 4A68A 3FYIB 2ZOOA 4NAJA 1L9PA 2GIMA 1J5CA 4YSAA 4RH4A 1JOIA 4A2FA 1CYXA 5F7BA 1VLXA 1URIA 4UANA 2UXFA 1AS8A 4HIPA 2BWDA 1WS8A 3SBRA 4MFHA 5AFAA 1OV8A 3SBPA 1A3ZA 2FJSA 2FQGA 1GS7A 3CVCA 3CVDA 1MDAA 4AX3A 1OCCB 1BXVA 1R1CA 2YARA
chains in the Genus database with same CATH superfamily
2R56H 1NGZA 2CQVA 3MJ7B 2VH5L 5GS0L 3L1OL 4QHLB 1YEFH 3CFDB 4HJTA 5FECB 2ZOUA 2CRZA 3JUZA 5I1AA 1MQKH 3NUKA 5HHQA 3EJUA 5C07D 4EOWH 2BRRH 5KSAA 3AFLA 5E1GA 4KQ3H 4M00A 5KYXB 2JQAA 2B1AH 4ABVA 1MCNA 1JHTA 2TRYA 3RHWF 3MBEA 3ASNB 2ETWA 1S7RB 2WQAA 5E7FA 3A0OA 1MCIA 5DJ2A 1KTBA 2ZJSH 3GBNL 3OF6D 4G80B 1CFNA 2D3JA 4WJ5A 3C5ZC 1IFHH 4WFFE 3WHXA 5I23A 5F96H 1F3DH 1HHJB 3TJHD 4I85A 2XKNA 1BJ1J 5KYXA 4HJUA 1VACA 3UP1A 1WIPA 3E1ZA 4Q58C 4JRYB 2WXOA 2X0WA 3BUYA 3ULAB 4PP1C 5IROD 1K85A 4AL8H 1IM9D 3UDWC 3OPZL 5E8OA 5AAWA 2Z91A 4FERA 2Q5BA 5JQIB 1ZV9A 5JOPD 4TNFA 1UEMA 3S3PA 3KWVA 4PBWD 5I1HL 3MLVL 5DSCA 5T1LD 2AQPA 1H3XA 1RIVL 3SDXA 4JM0A 2WB1A 5CP3A 1H3GA 4N2AA 2RIKA 5EH1A 2BDNH 2EZ0D 1EIBA 1EO8H 1KLUB 2V2XB 3EBHA 3PDDA 2F5AL 1OM3L 5IF0A 2EVFA 3RKDC 1XL6A 4Y1AD 1EAPB 2E7BA 5AL0A 3HI1A 2QSVA 4BRVA 3U0PB 3K91A 5J9PA 5ICXA 5DZAA 2DJMA 4C47A 5IB4B 5C08D 2XRAL 3P3SA 5LVEA 1EHKB 3IDIA 3QDAA 1YDPA 4PY7A 2DQJL 3SKJH 4MMXA 1HYSD 4LIQH 4AUYA 1HHGB 1LDPH 2VXQA 4X6CB 3RBSA 2XZAL 3SPHA 3IFNL 5FOBB 1EGJA 4Q52A 4TUUA 4KY1H 4L3CB 2DQHH 3U1SL 2AERT 5ACMA 3WIIL 5ACZB 2MMXA 4MJ5B 3G6DH 3H4FA 2P5PA 4M7LT 3IAGC 4F7CA 3DTDA 1EAJA 1MSPA 3HS8A 3MKGA 4P2OC 4U49A 1GA2A 1AGCB 3C5ZD 4AIZB 3WE1A 3T6WA 4PJCE 1J1XH 2QSQA 1FYTD 4X6BA 3KW7A 2MHAA 4AJVA 4ZO8A 2P7TA 5IHBA 3MJ7A 3H42H 2FSEB 1JHLL 2JV6A 4I0PA 3GZOA 5HVWA 5D7IB 2ZJSL 5DWPA 3WEBA 4G8EA 2HKFL 3MRFB 4RAHA 5IQ9B 4O02L 1AHWA 2GYSA 1U8MB 1UJ3C 1KGCD 1SEQL 3B3IB 4M7KL 5TE6H 5EDSA 4U7MA 5B3NA 2A7BA 4JFFE 43C9A 2DS4A 3KWTA 2ZWSA 3PL6B 3KWWB 1QFUH 4MYPA 4BYHA 2BIMA 1OPGH 3BZ4A 3WO4C 5E5MB 1H6UA 4NFCA 4DKDC 4IOSD 2Y6SD 4AMXA 3NSXA 1M9SA 2PWHA 1KJ2B 5DD1H 4FNQA 4AUUA 1MHPL 2VN5A 4KV5E 4JAMB 5C1MB 2A9AA 3AS0A 4LU5L 4R7DA 4UIKL 1NUFA 5SV4A 1LP9E 3LX9A 3P4MA 3AXIA 2P1YA 5BZDB 4EKXA 4FZ8L 1YNLL 1MCJA 4A2GA 1CLOL 2Y2TA 3C8KA 3LRSA 4X8CA 1B0RA 2ZSVA 1G7JB 4U31A 5K9JL 4YX2H 5JHDA 3C2AL 1ZE3C 2B9BA 3N43F 1J0HA 1GMIA 5BMFH 1DQJA 1N64H 1J05A 1PGRB 3LZPA 3REWB 5KYNA 2A4ZA 4PGDB 3ZL2A 1U8HB 4C4BA 3F05A 5JYLA 2CDFA 3KPQB 1N70A 3CH1B 4U1KB 4QRSA 4Z7VB 1FZKA 2Z8SA 5MERB 1JD9A 4DW2H 3GSNL 4EDWH 1EO5A 3G6JF 5IB1A 3KGTA 3IS0X 4AM0A 3WO4B 1OLLA 1VSCA 3NG5A 4HJGA 4ZX5A 4YAQB 2B0SL 4NC1C 3MGAA 4YBLB 1EXUA 3I50H 1AGFA 1QRNE 1Z9LA 3UBGA 2IMNA 1H8OA 2Y6TE 5B4MD 5LBSH 4J3SA 3H54A 1CPUA 4JFEA 1NFDA 1EXHA 4NM4H 3UIYA 4Z0XB 1V7NL 4JFDA 3I2CL 3MUGB 4UQEA 1NICA 2UZXA 2JB6A 1NOFA 2HXAA 2Q7YA 3GMMA 5TDOB 3CN1A 4QY8B 3IVKB 2VXTH 1PG7L 3L3DB 4L18A 3FTGB 1FZOB 3V6FA 4UQDA 4L37B 1J9SA 1GZPB 1XF2B 5E8PA 1CFQB 2WVVB 1YMHB 5B3JF 1IBZA 3I9GH 2C3WA 3KAAA 2E7HA 3C9NA 3H55A 4PP2B 1AD9A 2DQFA 3F7VA 3KPLA 2BIHA 4JREB 1GC1L 2DQCL 1VCAA 4QNPF 3J2PA 1OT1A 2LU4A 1IAOB 3HE7A 4OZIE 1BYOA 4NNYA 2YLKA 4JL1A 3ZDYE 3SKMA 2G4EA 3BP5A 2LABA 4QRAA 4ETQB 2IAAC 2YUXA 3IFLH 3KYMA 5DRXB 2LU3A 4DH2A 1EHNA 1G9MC 1CWVA 2PWDA 5FB8A 5I6OA 1T80A 2GW5A 4AIXA 3DJRA 1Z9OA 3E8VA 2NDFA 2W5PA 3ZDXF 1S3KH 1T2JA 1J1OL 2EDJA 1HEHC 2BMKA 1MIMH 3EOBA 2AV7A 3MJGX 4Q89A 2BS9A 2VJ0A 4NKDA 2BSEA 5A40E 4TUKH 3RL1B 4UT9L 4RZCB 4B5EA 3FZUD 2VJ8A 2X9WA 4PGBB 3QO1B 1DP0A 4HHAB 1DTUA 3K1DA 2P8PA 4I4WB 5CP7A 4ZXBC 3FCSB 4MNQA 1AG0A 5K39A 4L4JA 2P26A 3T6QC 5I1GL 1IAIL 1WK0A 1U42A 2BHZA 1NKOA 2R23B 3IKCB 2UY6B 3AB0B 2Z4TA 5DZVA 4A6YH 1L6XA 4NO0D 1OGAE 4BHUI 3QNZA 5D1QC 1BZ8A 2AJUH 2FE0A 1XZ0B 4JFSA 1WZLA 4LHUG 4U3SB 1FZJA 2ICCA 4MNQD 3ZHFA 4ZUSB 1GRWA 2OBGA 4UQ9A 4JW3A 1HQ4A 5GRZA 2NUTB 5T1MA 4LAJH 4XAKD 5BZZA 5IMKA 4CVXA 4Y4FD 3MMEB 1RI8A 2Q76A 1SUHA 3FRPB 2ZX8A 4U3SA 1FYTE 4P2OB 4D3CH 3JSSA 4XO5A 1CS6A 3TWYA 3TBWB 3QHFL 5F7KC 3IT8D 3D2TA 3EG9B 1THCA 2RD0A 5AOKA 5DYOB 3HAEG 1UCBL 3SQBA 2K6YA 3UROR 1PY0A 3TO4D 4FNLH 8PAZA 2WQSA 1IKFH 2FECI 2J6WA 2ARWA 4K07A 2PNDA 1N5YH 1TLMA 1OK0A 2IH3B 2R4SL 2ED8A 3OHXA 1RUKL 2NLJB 3KGUA 2H45A 1A64A 1WZMA 4JPKL 5HGHB 5MENE 3QG7L 2CJTA 5G55A 3VXSA 1LL1A 3TYGL 3ULVL 5DUPH 1MCPL 3CSTA 5AVUB 5ADPL 5KSUA 3MJ9L 4JFYA 4AEEA 4KZEL 3B83A 5D1QA 5I5IA 4Z6AT 4RISL 5GISH 1YN6B 1J0IA 2IIJA 3HMXL 1W6WA 1IL1A 1EVUA 3G5ZA 3QA3A 4OLUL 4R97B 4U1GB 2BM3A 2XV6B 3L4XA 4XP5H 3O6MH 5CGYC 3CFIC 4HETA 1T22A 4OLVL 3U2IA 5E8DH 3QZNA 4OGZA 4HKBB 5HYIA 1HOCA 4IRJA 2VLME 2JB5L 2EXYC 4ZMOA 3T2LA 4J3WA 2WINB 3DSNA 3HAEB 4AQ1C 4PP2A 1A6AA 3BI9X 3QULA 1ZS8B 1QSZA 2J8UB 4PS8A 3VJ6B 3X1GA 4Y4FC 1JXDA 1YYLH 5E2TL 3X13B 1MCLA 1YNKH 5KWYC 4FJZA 2VLJE 2H1PL 3PDOA 1S7TA 4LCUB 2Z8WC 3DKHA 3X1BA 3EOYG 3ES6A 3EF4A 5FA3B 1IGYB 1NKRA 2BSED 4G7VH 3LN4B 2ENSA 2ZWNA 3AW5A 3QPXH 4QHMB 4H40A 2PWGA 2RGSA 5K9OB 4JHWH 1G9EA 3SBWA 2XWJB 1Q1JL 4KI5C 4CDHA 2VKWA 5FC9A 1Y07A 2WW8A 2D0HA 1H8SA 3GINA 3P9LA 2K1MA 2AC0A 1O7DE 2ZKXA 4G9FB 1OTUD 4K55A 4DP8X 4YSOA 5B39G 3QWRD 4G6KH 5EUKA 3KBHE 2YJQA 5L6YH 2VITA 3TN0B 1EAOA 2Y5TB 2IAMB 3M86A 4Z77A 3HZMA 3VRIA 1N9PA 2CALA 1IC5H 4ANUA 4LSVL 1FN4B 3KXFD 4M1GH 5AW3B 1ZA6A 4AC2A 4JN1L 4RMTA 2R4RH 1JRHH 2CDFB 1JZIA 1D7FA 4XNUH 3FFOA 4PJDB 1XF4B 1NC4B 5E4IA 3QAZB 4GSQA 3RG1C 4F2EA 2KZBA 3E8UL 5ECJE 4J3BA 1JGDB 2DWEB 43CAB 1E6OH 5HDBB 3LV3B 4WWPA 3JXAA 3ZTEA 1JZ4A 4D94A 4CW1B 3I9GL 4HXAH 3MRCB 2W94A 4XH2B 3QI9D 1BJMA 4RMUA 4XNQA 4A66A 1D6VH 4MS6A 1Q9KA 4HLZH 3TPKA 1UD3A 4LCYB 1PKQE 4JFTA 4N9GA 5C0BE 4BSJA 5IVXE 2VM4A 4ZW8A 2H32B 3NCJH 1N3NA 3APCA 4FKHA 3STLA 1M1XA 4Y8AA 3LVEA 1CDBA 4N8VG 4WTZG 1G84A 3GDBA 2PN5A 4D9QE 3BCDA 5BJTA 1UZGA 4NWUL 1WZ1H 1X44A 3NZUA 4YSAA 1JOIA 4JRXE 4G8GD 1D5MA 4MDIA 4M61B 5EU6B 1U2YA 1JGLH 2R8SH 4MJIE 1G7PA 2EYSB 4IW4C 4JFZL 3T2PA 2YRLA 1K8IA 3VM7A 1HZHH 1XF4A 3QW9A 2PXYD 5GSRB 3LIUA 5AFAA 5TF0A 1X7QB 1PQZB 3MRFA 1NGPH 3VGDA 1DJXA 1XF1A 4YHYC 1QFHA 3CPLB 1EZSA 1MJ7L 1IGCL 1IFGA 4KI5F 3DVNA 4ZQKA 3WMSA 5DLMH 3BKCL 4PGZA 4HHWA 3GXTA 2BWQA 1HJCA 5FFGA 3JVFC 4Y1AA 3O6LL 1A7PL 2BFVH 2EUXA 4APXA 2AK4B 5DQJA 2IDUA 3H7BB 4BZ1A 3T0DA 2ICES 4DZBB 3OPUA 4M3HA 1QSEA 2D0FA 3DLQR 3FUMA 4N8PA 4L3EB 3WIAA 3L1FA 2BNQA 1IUZA 3GHPA 4HU2A 4HDIA 5D7JD 3FTVA 1YA5A 1PDKB 4G70B 4OZFA 3WMQA 3ULUC 2E9WA 3BWUC 1QBLH 4XMLH 4RWHA 2A6IA 1IZKA 3FB6A 1NGQH 3O0RH 3RFZC 3PDOB 4J4PA 1HXMA 3U46A 3ZE0E 1B2WL 3PNWB 3EDJA 1MWOA 5EF1A 4ORGA 1T7YA 3DX7B 5B3JE 3PY9A 5J9PB 1GAFL 2ZUSA 3C6LB 4ZOEA 3U0TA 1L9MA 1ZTMA 2QQKH 5GSVA 3O6KL 3KPTA 4PW4A 5IKCB 2FQDA 1HKLL 1O9WA 1QNZL 3VVWA 2G60H 2HVKB 4RFOH 1SN2A 2A77H 1NBQA 3UP6A 3UZQB 5C8JA 4M6MH 2F08A 3SDXB 1VRSA 2I85A 4G2AA 1N6VA 4UNIA 4M48H 5AZEL 2F8IA 1AFVL 2D7QA 2W65B 4DGYH 3R1GH 2V5RA 3HE6D 2HMID 4D9QD 4P5MA 1HE7A 3APMA 2E8ZA 4XC1H 5IB5A 1MLCB 1OW0C 2V6HA 3GMQA 3UPRB 3D51A 3QEGH 2XICA 2VDNB 4FULA 5T5NF 3SJVE 3SGJA 3X12A 2FO4A 4OM1H 1MY5A 1VFBA 3DOIA 1S9XA 4MHHG 4LPXA 3OR7A 3QI9A 3D5OF 4MA7L 3Q6GL 4DPCX 4EZLA 4WJ5B 4LLVA 2LTQB 3SDCB 3VFOB 3QUKA 3QFJA 5HHVL 3B9KA 3DGGA 3OAUH 5LQBH 1IJNA 4M8VA 2HA1A 3GSNB 4B9PA 5HYJB 2EEXA 4W6YB 5I82A 2A4EA 1G7MA 2YK1H 2K3HA 5KOMC 1P4IH 4RGNE 4Y9BA 1P2CA 3BD5A 2XWTA 2J56A 3C6LC 3BLKA 2P43B 3U4BL 2IXQA 1LMKA 4L3AA 5T1DL 1LEKB 2CXKA 5BV7L 5HHQB 2H0FA 3EJYD 4HWBL 3IDYC 3UEZA 5L8KB 4PS4H 3IGKA 3RA7L 4HJIA 5MI0B 1I9RH 4BK5C 1HQ4B 2BDNL 2CCVA 2HJFA 2PXYA 3O6ML 3EFDH 1KACB 2VB5A 1TTRA 2Y06H 5KBNC 4K9EC 3TPUB 1PLGL 5DVNA 3N9GL 2X6BA 3T1WA 1T2XA 1NMAL 4AGOA 4KTDL 2IAMD 4PBDA 2N59A 5EFIB 2VDPH 4G6AC 4U6TA 5FUCE 2C9SA 3VX0A 5ICZB 3KEHA 4D9LH 1BEYL 1BBDH 4MXQD 1AH1A 1GZHA 4TUJB 5L6YL 4PGBA 2YA2A 5GGSY 4LLYB 1D7DA 3DX9A 2VGLM 1R5VA 3B9KC 1AY1H 2JJWA 3Q5YA 4G42B 4XWOC 1E9PA 1CDYA 1USQA 1P6FA 3IGAB 3ZDZE 1DVYA 2ZX9A 4NZRL 2HTLD 3GXPA 2PO6A 3IK2A 3C5JB 1UQSB 2VN6A 4DTGH 3PWPA 1NEUA 5IBLD 4EOWL 1LNUA 2KZWA 3L54A 3SE9L 4KTDH 3RVWC 3ARXA 3FUHA 2R69H 1NAMH 5AD0B 2QKSA 3B7SA 2Z0BA 5CCGE 2WUBL 3AWFA 1PLAA 4PRBA 3EFDL 3OL2A 3QORD 3WJLA 1MF2H 4IRSD 5TD4A 5I6LA 4PMFA 4Y4HB 4PS4L 1BREA 3RU8L 1SPDA 4Q2ZA 3VG0L 3RVVC 4WJKB 4AEFA 5E8PB 4KZ0A 4M93B 4KDWA 5AENA 5E2JA 2CG9X 1NCAH 3PQYD 3MNVB 5I2IB 4UIMA 3QORA 4U1MB 4KHTL 3SPCA 4MQTB 3BH9B 4GINA 1QSFA 2VXSH 2IPUG 4IS6A 5LG6A 1G5GA 4YNYA 2Y24A 4PJFB 3MZGB 3N40F 3U9PH 3GJFK 4I1RA 3DX0A 3UTSE 1HNGA 5AOLA 5CN2A 4JFEB 5IJDC 2OCCB 1IRAY 4GKZB 1AMYA 2OJEA 4KMTL 2MPAH 4QMEA 3QFGA 3OKDB 4JDZB 4X99B 4WWKA 2E7LA 1NCDL 3RI5K 3KPSE 4XZUB 1GGIL 1MRCL 5F8RC 2CGYA 4Q14A 1LO3L 2IDCA 4ZI8A 3BLBA 2RTTA 2W38A 1M6OB 2X4PB 3OG6B 1BZDA 1RSYA 1ZTXH 3FB8A 1WAAE 3CFMA 1ZSDA 4GKSA 1HAWA 1QWNA 2CPCA 5ERWA 3CH1A 1OGAB 4LOFA 2Z31C 4QKXB 2JIXB 5BVJA 3REWA 5I8EA 3RVWD 4BQCA 4N0FB 5GJTH 2MQ0A 2XTJC 2XIIA 3D69B 3ARDA 4J3OD 2YBRA 1LQBC 3AG3B 1CD8A 3OLEA 3SQRA 3PS6A 3FCUB 4PGJA 4KXDA 2B8OT 3QO0A 7PAZA 1A4KA 3LMJL 3VGHA 5ALCH 4OQ1A 3NSCA 2NW3A 5KS9A 4W4NA 4YHMH 5INCB 3QUZC 3F83A 1W80A 3T04D 3TBVA 4TVUA 4HS3B 1X9LA 1NGQL 3O0RL 4ENEC 1JI2A 1U0QA 5B1JA 3OVUB 5FR3A 5L8JB 5AYUH 4WNJA 2Y36L 4NRYA 1OE3A 3JZ7A 1UB6A 5AKTA 2OL3A 5E4OA 5E6ZA 4TNWF 1XIWA 2G4GA 4Z7WF 5H2BA 2IADA 3BFWA 3W9DB 2ZNXA 3VX1A 2AJXL 5FM4A 4R4NC 3TO2B 2UZIL 5I1LA 1G9NL 2VXQL 3KPPB 5CGBA 2VISA 1HX0A 1BF5A 4M7JL 2UX6A 3GLDA 2OMBA 4Z23A 3RAJL 2BP3A 2VLRB 1A6PA 4OZGE 2L7UA 4I0PB 5DVKA 2YAMA 2NY3C 1UH2A 1CDCA 2F19L 4M8RA 1E27A 3I75A 3HMWL 1PL3A 5F9JB 4GBXC 2WZPD 2NX5B 2BRQA 2ERJB 2ADIB 2V8LA 3D4GA 2NMSA 2FUTA 1BQLL 1KGJA 4MQ7B 1NBVH 4JCLA 4OF5A 4V33A 3R7RA 1BGXL 1TQBC 1D5BA 3EDFA 2X4NB 2W92A 4K71C 2FJFB 1BAFH 3A5VA 3ZTNL 2EO9A 4P06A 2HT3C 1QEXA 1KCWA 3V6OA 1TO4A 1XXFC 3B3BA 4L3FA 4L3EE 4Y2DA 3ZKND 4EPSA 1IQDA 3P4NA 3REVB 1NANI 3L6FB 4HIJA 4NERA 3CFCH 3MRGB 1RMFH 3OJ2C 1G6RB 3LNHA 4K94C 4D7BA 1DR9A 1F4YH 2V7HB 5E9NA 2YD0A 3V4VA 1OPGL 2G5BA 4TSCL 3U0PA 4OW6A 3TNNA 2JKJA 4JDTL 4K8RD 5I73C 4EI5B 4HXAL 1OK8A 2X2HA 1RZJH 1JP5A 4LLMB 3I50L 1UGKA 1NIDA 1JNLH 4KGJA 1MI5A 3LNFA 4YGAB 2C8NA 1DZ0A 1SN0A 5HHXH 1IV8A 3HC3H 4H0IA 4YL9A 2HPTA 1PU0A 2EIDA 4AIEA 4F1SA 3D4ZA 1OAXL 5GHWH 2ADYA 3IXTB 4KROD 2WWKT 3II2A 4FYQA 1P5VB 1U8JB 3UGUA 1T7VA 1A8ZA 4TVPD 5KOVC 1J1XL 4B53A 4OQTL 1PW3A 4L1TA 1S9VB 3NSFA 4K5PA 1LE9A 1A02N 1PFOA 3CX2A 4LSUL 1HJBC 3PFUA 4LASL 2YWYA 4PJ7F 2C1PB 1E28A 4PGEB 4NO2B 3FMGH 4GT0A 2P45B 2WZ6A 5KVGE 1XF3B 1P69B 4GW1A 1HHJA 4I9WD 1UFGA 5K33A 4PJGA 1PCSA 5MP6H 2BFGA 5I74B 3P77B 1RIHH 5F7WC 1J1PH 2OCJA 1AGBB 1WCBA 4X8JA 4LHUA 2Q1EA 1E50A 1M3IA 3S3SA 1YMMD 1KXTB 4OIAA 2BC4A 2ZXGA 4I48A 1VJSA 4EUPA 4NAQA 2YD9A 4X4YB 3QIBB 4OZ4A 5HDQH 3MU3A 4PWEA 1SY6L 5J6SA 5JOEA 1P4LA 5JUEH 4OIIH 5ESVA 2Z64C 2FRGP 3VXMD 3MNDA 4F91B 5GRWA 3HW7A 4NKIL 4K8RC 1BECA 3KPMB 3O4LD 2QVMA 1L0PA 5CZVL 3SE4A 3HRPA 3BDBA 5L8LB 1Z9SA 4Z8FH 3P9MA 15C8H 1E67A 1D3CA 2AJVL 2Q2EB 1R3JB 3IRZA 2FEEL 1ZEAH 1ID5I 1JZ5A 4DQOL 3IDGA 5DMGD 3WD5L 3DV6A 1MAMH 3R06A 2YFNA 3KE0A 4JY6A 4AI7A 4YDKH 1NCWL 3N0PB 1Z1WA 3WNPA 3EYVA 3KDMA 2VDNL 4HVBA 4ODXB 1TZAA 1RD6A 2F0CA 3ALPA 4GO6B 5C71A 4QRPB 5F89A 5C08E 4J2QA 3ESMA 4Y16C 1RUPH 3PREA 4MXWL 5BVPH 2WIIB 5DZLA 5H94A 2NY5H 5CEZL 5KSBA 3GIVA 5EUOB 2JJSC 4WHDA 2OTWB 2GIMA 2UZYA 4DVRH 3MLXL 5I5RA 3L4TA 5E6RB 5F7BA 2VMDA 3K6SA 3QEQA 2AGJH 4G8AC 4K9EH 1L7IL 4LL9A 3VWJB 1T5WB 3I3BA 3L1OH 4RBPK 4MFHA 1A1OA 2FH8A 3WXVL 1NFKA 4XP9L 2NYZA 3IMRA 3MV8E 1IJ9A 2BSRB 5L2KE 1IQWH 2YXFA 5DUML 4ZPTA 1Z0MA 4GMTL 4B7LA 4OJEH 2D7OA 4PJ5A 4K3JL 2WXNA 2DLTA 4MJ2A 5CEZH 3WS3B 5ESQB 3UO1L 4XPGL 3VXRA 1Z66A 1MFCL 3GEFA 4WFFD 1AANA 3C09B 3G6AA 4YR6A 3VWKD 2E6JA 3L45A 2A83A 3LDBB 2H8PA 3NZHL 3P1VA 2AJYL 2BXYA 5C0ND 1MAML 3D87B 5AVXB 4OLYL 2BNUA 3CBJB 2ZOLA 3U7WL 4JDVB 2PW1A 4N3UA 5EBGA 5BO1L 1YQVL 4R3SA 2X6UA 3FTSA 4KK6C 3ENEA 3ZTJH 1EA9C 2ZOKA 2GSGA 3IETB 4UNUA 2N1KA 1FAKT 1YMMA 3FQUB 4DKFL 4EVNA 3RURA 1UM6H 2VUKA 4Z95H 1WBYB 3K4DA 1WHOA 4MLSA 4DGVL 4MNGA 2ITDB 4UTBL 5A43C 3TBYB 2X2UA 1L7TL 6PAZA 3B1TA 5KG9A 2Z31B 2IG2H 1YRKA 3UC2A 4F1ZA 1CGWA 4RIRB 4FD0A 1LWRA 4X0KB 1QBMH 3B37A 4EEEA 2CO7A 2Y0SA 1ACZA 2XTJB 2WLMA 4ODTL 4Z7UA 3T4YB 4U2ZA 1SQ2N 5D9SB 3VXMB 4AGQA 4AQAB 1T1ZA 2DQCH 1EJFA 4JVUA 1WZKA 3UBXG 1GXEA 4LSQH 5KVEE 1T4KB 3L3KA 4AGMA 2Z92A 2FB4H 2UWEA 5B7EA 1G6RH 3V5HB 2A74B 3G7TA 1Y0LA 4NOFA 4R7VA 5H35A 2NT0A 3O3EB 1MJUL 1YMMB 3F00A 4MA3B 4MSWA 1J11A 1N5AB 5JR1L 2PTUA 1O75A 3SHSA 5HHMB 1N8ZA 3WG7B 1QLRB 3ZZQA 4E68A 3D85B 3TFKC 4NSKA 3MRNA 3EOAA 4LSUH 1JK8B 1NGWA 4HBQA 2DMCA 3EHBB 2H8PB 4O9HL 5CMAA 2A4CA 1NMCB 4Z95L 3G6AB 3EZ8A 2WQRA 4I18A 1AZVA 4JFQB 4F37F 4WUKH 2YQ3A 1X5KA 5FHBL 2DQUL 1T04B 2GITB 4NC2B 4DKAA 1ESOA 4L8CB 3QYNA 1ZRUA 5CIPB 4ZS7L 1TT6A 3OAZH 4KROB 2WTRB 3I6LE 4N24A 1IAMA 4G8IA 1NBZB 5DEGA 4YXHL 3WEAA 3RILA 2NY0D 1DQDH 4CMMB 3O8XC 4OZGB 3CMGA 4KBPA 1AKJA 3GXDA 4AKPA 5FYLD 5BOJA 2FATL 4HUWB 4B6ZA 2VZSA 4L8SA 3B56A 3D85D 5IQOA 5CEZE 5D8JH 2B1HH 1MPAH 3QCVL 5I18L 2EC9T 4MA1C 3VGGA 4X7TB 1VEOA 4RMVA 1GC1C 1GGBL 1IBDA 4AYMC 2JELH 2H3NA 4QJ3B 4RMWA 4NSKB 2CR3A 1ND0B 3WY4A 1EX0A 1KJ3H 2YQGA 3GI8H 3N85L 3BESR 4ZOBA 5FYJE 1KBVA 4AVIA 4MSWB 3W5MA 3GB7A 5C2BL 1D7CA 2OQJA 4GNKB 1G9HA 4HLZG 4LVHB 3VXPA 1NSNL 2Z8RA 4X5WA 4FQIH 1J8HB 4ONFL 1J86A 1WWCA 3MUZ1 1O7DC 2G0KA 3G08A 2NX5D 2NYKA 3TH3T 4F33B 3QJVB 3L5JA 5AVVB 4EAEA 5FYKD 1P5UA 4ISVA 4M9OA 2H1LM 2ZF8A 1VDGA 1C12B 3B9EA 3EGDA 1M7UA 4NQEE 2KZKA 3WENA 4WO4D 2VLRD 1JSYA 3D0VA 1TTFA 1QVOB 3HE7C 3CFKA 2OMUB 9CGTA 3ARDD 2DM2A 1WG3A 1KN4H 1T4WA 4WY7L 2CLRA 4NQEB 1T83A 4PYHA 1I1AC 3B2XA 4WW2F 3F65A 4RESB 3T5WA 2FHFA 1FBIL 4QTIH 5AYUL 1QUNB 2NSXA 5E08H 4H5SA 3H9SA 4OVUA 2BC4B 4GUCA 4LSSL 3UYRL 3ZTJG 3VI4F 3CDGB 3UERA 5IESH 5EC1A 5DEFA 3F5WB 1OAUL 4HJJH 5FO7A 1FSKB 2YS4A 3BRGC 1IKOP 1BX2A 5FA4B 2WSDA 2Q8BL 3LMJH 1NM9A 3UTSB 3KMDA 3TH2T 1XIWD 4QI3A 3ZRSA 2QQLL 3LHAA 5T5FL 4XVJH 4MD4B 1JWSA 2MRYA 2VLKA 3KGSA 3NIFE 4P2RE 1AE6H 4WK0B 1XF3A 4Z7QF 4AMKL 4JPVL 5J1SC 2Q7AA 5FLUA 1DVXA 1SBBA 3F8UB 3CDFA 5ANME 1CK0L 5EWIL 3U6XA 3QUYB 1DVZA 3VWJD 3VFMB 3R0MA 1EO8L 1OM3H 3VFRB 4FC3E 2VZOA 1YNTF 4DGIH 4UDUB 1TYRA 1O5PA 1D9KA 1AZNA 2L3BA 4HS6A 3ESPA 1HIMH 1RP8A 3DRQA 2WAHA 5C0AB 3B2PA 3OPZH 1IGJB 5IK3A 3GRWL 1QYGL 2FX8L 2HN7A 4CNIA 3NFSL 3OX8A 1I7TB 1CLYL 1YUKB 2HVJB 1VF5C 1KCRL 4IKKA 4XBEH 4KNTA 2A0LC 5FGSA 1W2KT 4P48A 3LEXB 4HH8A 2F15A 1WHPA 4P5SA 4LQFL 5E2WL 2VXSL 2BIOA 3BAJA 4AXWA 1TETL 4WI0B 4X8GA 5FYLL 4N8UA 3NPSC 2G0LA 5C9JA 2OSXA 3WY2A 5TH2A 4Z5RB 4LF3B 2H32H 4ZTPH 5HHOA 5CM1A 4N90E 2WXLA 1KGUA 3LHPL 1G6RL 5CSZA 3JWNG 3PQYB 4FNSA 5I6PA 2EZ0C 3GF8A 2R1XB 2O6DA 1FWXA 2Y7MA 4L8SB 3KYAA 4LL1A 3EBIA 5IQ7L 3Q1SH 4BFJA 5MEQB 4ZTEA 2V9RA 5C0GA 3RUGF 3U36B 4KXZI 1FNGA 2QDVA 1UFUA 3V7MA 3P9MB 4OD1H 4PWGA 3SPVB 2J3SA 5F1KC 4Y7OC 3O4LE 4XR8C 2FGWL 3K6OA 1ILUA 3ZT5A 5DI8A 4V2BA 3ZZLA 3QIBD 3D39D 2H2PD 1Z9NA 1UXLA 4QXGH 3U9UB 1D5ZA 1HHIB 4JG0L 1A3QA 1LGVA 1DQQB 5ANMA 4PJBA 3JTBA 1I1YB 1U6AL 4Y19B 3DX8A 1ZJAA 3RVUD 4PG2A 2IADB 2AXJA 3WNJA 1XH0A 4JKPL 4FXGB 3D48R 5GS1A 4PSPA 4P2RA 1N2RA 3S34L 3DX3A 4F5CE 2O5ZH 4X98A 4ZSOE 1W0VB 3T77B 2A6KB 4UQBA 1MFEH 3CSPA 2QGEA 1T3FB 2DWYA 4K94L 1RZ8B 2GBAA 4PJGB 4F8PA 3MLYL 5E6YA 1I9EA 3HNTH 4HWEH 2L4OA 2DWTA 4TRPL 4P99A 4YE4L 1BPLB 1M56B 4OGQC 3HZYB 5D1XA 1ZLDA 1USZA 3WI9A 3WTTA 2BK8A 3ZUCA 3BVTA 2OZ4L 5E1AB 3SE3A 3TGXA 4LKXB 1T89C 1P1VA 1ZV5A 3M45A 2P46B 3ISRA 3LD8B 1UYWL 2CO7B 2NPLX 4HBCL 2J88L 3SKUD 3IXTA 4PY8I 4A7UA 3WXVH 4L9LA 3TEUA 1RZQA 3HKZA 4NUMA 1D2PA 4OGXL 4G3YL 4HEPA 4R0LC 4XMUA 1OAZL 1P9MA 1TU2B 2GY7B 2YRPA 4OGAD 4LLMA 3GSOA 4JZJA 5DD0H 4E36A 2X4PA 3ZQWA 4ACPA 1GVIA 1CO1A 3W3BA 3X1FA 5KZCB 3TNNB 2YPVA 4ORZC 1I3RB 2AANA 4GIPD 1WT5A 2NY6B 4JJOA 1A6ZB 5BRZA 4DP0X 3PYCA 4WW2C 4L48A 4HWZA 4LLQB 2PYEB 4RQQA 3LH2H 4Y8DC 3IDNB 1CVSC 4X9YA 1OCWH 2HX7A 2F53D 3B6SA 3KPRB 3REVA 1FYHB 4TS6A 1ACXA 4JK0D 4J23A 4XB3A 5TJWK 3Q9PA 5DC2A 2V7NB 4WFED 2FWOB 4DGYL 4R26H 1SLWA 4M48L 3VXRB 4UQAA 1SHXA 3LJ3A 3NACH 1GZQB 4R8WL 3WKQA 4PJ5B 4MQ7A 2TRHA 1FJ1B 4P9HC 4FZEL 3F6JA 1XH2A 3UYOD 1CICB 1TTAA 3AG4B 5AVTB 1FZMB 4R97C 1DJIA 3LNIA 3I6LD 1RZPA 3LQAC 4NQQA 4KMTH 4U0RC 4H88H 5TF1L 5AVRB 3L9RB 3FQXB 3S2AA 3VE0A 4MAUL 1G7HA 2KZ1B 4QD2E 3SY0A 1NSNH 1Q72H 3D07A 4JPSA 4WI5A 2OZNA 5IVZB 2ATAA 4AWJC 3CFJB 3CVIL 3IJSA 3TBTB 3V0DA 3SBQA 3RPKA 4IU3A 1UM4L 1YPZE 2IH1A 3UL4A 4E9WA 2IQ9H 3CZGA 4YSTA 3QP3A 2PP8A 3DYMA 1C5CH 3RTLA 1PX4A 3W9DA 5BXFB 3ARPA 3KYKH 3NEEA 5KSBB 4YHNA 3L17A 3W11D 3IPBA 2P28B 3C5JA 4GRWH 5F89B 4NKMA 1A1MA 1BAWA 3CSYB 4JVPA 5A7BA 5HVHB 3PWLB 1DEEB 3IE4A 4K73A 3BIKB 4RA3A 5E9DA 4LSPH 2XA8L 4Z3IA 2VDQB 1Q72L 3EH1A 1JN6A 1KWKA 1EJ6A 4FMFA 2EE6A 4PWJA 1KTCA 1E4JA 2VDRB 1FORH 3LKRB 1HZHL 4G43A 1A3ZA 3V4PL 2ICEA 5BCAA 1F90L 2YD4A 3KPMA 4R8WH 1MDAA 5I8EB 3GLZA 3BGMA 5HJDA 2J5LC 5HHXL 3W39A 5KJRH 1CICA 2QZQA 3KXFE 4ODHH 3AU1B 4FQ1L 3QT2A 5EU6D 4WF7A 1K4DB 1FA4A 2E9JA 2QQNH 1H6TA 2HG5A 1A66A 2IXQB 5EZIH 1CXIA 4YSQA 1ZY9A 2X3BA 3P4LA 1V7MH 2VLLB 1L3WA 4RSVA 5DJZB 2XWTB 4KJQC 5AW8B 4DP6X 4N0UA 4PBVC 3UTTD 4DCQA 3P73B 1RMFL 1ZAGA 1FE8L 3K6FA 4OKVB 1Y6NR 5KN5A 3O81A 4U1IB 3HFML 4X7DC 1H6FA 3EO0A 3FO0H 1FGVH 4PFEA 4R4BA 5KYUA 3W38A 4GKZA 5F3FA 5C3IA 4GRLA 5DQDL 5DZOA 4WNQB 1GYUA 3OR7B 3QI9B 1MCWM 1GHFH 1BGXH 3S5LG 2J72A 3BKJL 4GG8B 2CO3A 5DJ8B 6PCYA 2R1YA 3O45A 5EIIB 1LO2H 4HKJB 4WW1B 5DQ9A 1JUFB 1NC4D 2LTQC 3SDCC 2EXTA 2N1TE 1B3IA 4P23D 2Q9OA 4DOHE 3SPIA 5BS0D 4FYRA 1WF5A 2X6AA 4GOSA 2ZXWB 4KKZA 1NJ9B 3KXFB 4Y5YC 4HD5A 3RWDB 5I75C 1MCEA 3CZUB 3HZYA 3E0GA 4HIXH 4NO3A 1UACL 1EZVX 3ARSA 3BFQG 3QEQE 2JI1A 2GHZA 4FQLL 3LPFA 4ORGB 4JKPH 1E65A 3UIZA 5B1AB 2OM5A 1ZPLA 1X5ZA 4M5TA 4AT6A 1W0VA 4JG1L 2HJLA 2OTUB 5E2UL 4ANXA 2RALA 3RIKA 3EFFB 4HSQA 2WZAA 3H3KA 3S5LB 3OC8A 3VDCA 2X1QA 2P52A 5JHMA 3T3PE 4C55A 3CDZA 3RNQA 3DX8B 4D0CA 3H85A 1CDJA 1JTTA 2ZSWA 5KSAC 4DZBA 2FYVA 2VDRL 3L08A 5E8DL 3JWOH 1IU1A 1MRFL 4ANWA 4M9PA 3FL7A 4IBLT 1HSBA 3GUTB 3QZWB 2NX5A 3THML 1W8EA 4PUBL 4HIIA 4XP1L 4PWIA 2WQUA 4UZSA 3ZZ1A 1UURA 12E8H 1VFOA 4POYA 3N41B 5GISL 4LSRL 4G82A 1W91A 3Q8AA 3SPVA 1MELA 4Y9GA 2DJUA 5DO2D 1GGCH 1G9ML 1ZXKA 5DXWA 4FFZA 5HDBE 4L8DA 4XP4L 1K6QL 1WAAF 2X2IA 3QNYB 4K5OA 1ZTXL 2R1XA 3V0EA 3FAWA 5C0JA 5EF3A 3KCPB 3SYOA 1DE4B 1XSKA 3HHSA 2ENPA 3OZLA 4FJ6A 4LPVA 4WU7A 1GIGH 4DEPB 4TOYL 3B9AA 1KPRB 3U4AA 5EBMB 4C83B 3GM8A 1DVUA 1MJ7H 2BHYA 4ICWA 2E4FA 2HFGL 4WI0A 3G5VA 4JKMA 1OSZA 5I66B 1L4IA 4YOKA 5J1TC 1NAKH 3TBVB 5DO8A 2X89D 4YGVA 2Q10A 3OSKA 1T1XA 5FF6A 2XSKA 2FCBA 2ZXDA 5ALBH 4PJGE 3HN5A 1S7XA 2HWZL 4FGMA 2QPFA 3QSKB 1A4KB 2WWMD 4UOW1 3SGKA 4NPYA 5DK3A 2PMZA 4DERA 3EBAA 3IDYB 3PE9A 5A2BA 1BVOA 4S2SB 5CZVH 3VG0H 2OSYA 4Y4FB 1TKWB 43CAA 4BFFA 1QMUA 1JGDA 3ZVVA 4H8HA 5EZLA 1SEBA 3LPGA 4ES8A 1OF2B 5DS1A 3VQLA 2N7SA 1NC4A 4KK6D 5F9WC 1SY6H 1IBGH 1F4AA 3DJTA 2Y1ZA 5ANHA 3U4KA 4HZ1A 5ERWB 4NOBA 3TT3L 3QDJE 2R69L 2B77A 1M42A 3GMNA 3NRQA 5HI3C 1BZ7B 4KJPD 1E6JH 2NDGA 1AS6A 4ZO9A 3GKWH 4JDEA 4HJJL 1CDUA 3EJSA 5GSVB 3VXTA 2H47C 1RZKC 1TQCC 1TVDA 2VCOA 4FQCL 5TF1H 4EN2A 1WVZA 2ZKMX 3C09C 3S3JA 3VMPA 1NGXA 1ZANL 4OI9A 2WUCL 5IQNA 4R7NA 2AQTA 4L3ED 1B0GB 3O41B 1HXMB 1QX1A 3WL9B 4GKNA 1U95A 1NL0H 1YC8A 2J5LB 3EOTL 3FMGL 2HP4A 5K9OA 1B9KA 2RBLA 5DJCB 3QQ3A 3QEHB 1IE4A 3SOBH 4IS6B 3QDGD 5CNHA 4OZFB 5FYKL 4UT7H 1URLA 1WISA 4L3EA 3MNVA 4XI5C 3QBTB 5LGYA 1QSEB 4P4RB 1NFIA 2RCSL 1IVTA 2WIMA 1AXSA 1I8UA 1M1SA 4Q2ZB 3LRGA 3R8QA 3KLKA 3I6SA 2X7LB 3MRPA 5B21A 4U6XB 1YEEH 5FX3A 1QVOA 4ONGH 2Z4QA 3G04B 4K4KA 1JV2B 5LXGL 1ZKAA 1C12A 3INOA 4R4FL 3T65A 2E59A 1M57B 3DVNB 4FXTA 4ZQKB 4G8GB 5D7LA 1RPUA 4JX0A 4JFXB 4S1QH 1Y18B 2ADGA 3FF7A 4LESA 1AC0A 1CL7L 4L2YA 4AE1A 5HY9A 3MC0A 3G5ZB 4UQ3B 1AQHA 1KIRA 4UAOB 3FU8A 3U4BH 4E9VA 4I3GA 4MDIB 5CJOL 4LPTA 4E5XB 2AJZA 2PO6B 1MFAH 1OAQH 2OPCA 4LLUA 4NQTA 4OR1A 4PIRF 2HT2C 2MOQA 5LAXA 3SDYL 3V4PH 4GQPH 4Z3JA 2I9LB 5LGJA 3HI6H 1M1XB 4M62H 2R27A 5IMMA 1DSFH 2JKSA 2D03L 2H3NB 4AEHL 4NJ9H 4FL4C 2IPTH 3FT3B 3IF1A 2E7CA 3V6OC 4F8LA 3H2PA 2UX7A 1OW0A 1ZLUH 1DJYA 4DW2L 5DHVA 4PJIE 1EXGA 1D5XA 2QHLA 5DRNA 1CN4A 1BVNT 4GJTB 4LCIL 5AOZA 5CBAB 5DUPL 3EAKA 2GJ6B 1FL3A 1KYUA 4HUWA 2CDEB 2IFGA 1T0MA 5J57B 4PJIB 5F7AA 3TPUA 5ELIA 1MXDA 5DJAB 1AO7A 3FRPA 3F6IA 1JF1B 1K2DA 4QXUL 5IQLA 4BXVA 4YLCA 3OKNA 3CBRA 4L4TD 2ZP8A 3SCMD 3ZU8A 1COBA 2AJXH 2I07A 4NKOA 1WQVT 1SGKA 3LY6A 4CMHC 3ULVF 4P2CG 4A2HA 1YZZA 4OD3H 1FH2A 5EB9A 1CR9H 5L9DL 3ARUA 2FT6A 3BMWA 1ZOXA 2FEJA 2Z7UA 2CMRH 1FPTL 3QCUH 5LN4A 1U6AH 1JK8A 1NGWB 3FUNA 2NYYD 3OWEA 4HKZA 4MJ6B 5D93B 4W93A 3OJMB 2XETA 3QFJB 4CC4C 5IQ7H 2EE2A 3VFOA 1IAKA 3IWUA 2WWKO 1WFNA 3LPWA 2Q20A 1J9RA 3MRQB 4F9LC 2ZPKH 2X5PA 4K3DH 1OARH 1HT6A 5KVEL 3Q2CA 1DBKH 4OZFG 3UPRA 1L9OA 2VZVA 4CJ0A 3O6FC 5IB5B 2UV3A 4OJYA 3X13A 3VJ6A 1PYWA 2HRGA 2D8KA 5FYLH 2EYTA 2VM9A 2DYPB 4NZUL 2F1EA 5DEJA 3NRFA 3VXMA 3V52L 3DROA 2PLTA 2WO4A 3VFNB 2IAMC 1PX8A 2KT6A 3VTAA 2C5DC 2ICEC 4XNDA 4UF7C 4GRWB 5FO9A 3ZE1E 3ZYIA 3KJ6L 2C34A 4IRJB 3BH8B 4R2GD 4XB8A 4QTHB 4KFMA 1B9ZA 1SRDA 4MMXC 4XPFH 3C5SB 4D0BB 4NDMA 5FO9B 4WDIA 4EIGB 4NNYB 5GS0C 5IB2B 3HE7B 4FP8L 3VFNA 3WS6C 3WSQH 5CKGA 4P46D 1A47A 3JV6A 1WBYA 5BQ7A 1H3UA 1CBVH 3AT9A 3ZZSA 4O02B 4HJSA 2MPAL 4C56A 1KENH 3HN3A 2F5BL 3LIZL 5C6PB 2I25N 4K71B 4WIQA 1F11A 4BCXA 5IB3B 2F7QA 3GRWH 2ZOKB 3CN4A 4XC3L 2CKBA 4NQCA 5F9AC 4DVBB 1GGCL 1HWWA 2IPKB 3PJSA 1FVCB 5JORA 5TDOA 5HYSG 3GTNA 5EBLB 1MVYA 4J3OF 1CF8L 5HGHA 4IDLA 3KVPA 2NLJA 1MLBB 2IH3A 5DEZA 3OAYH 3UAEA 4GSXA 4P2OD 4EE2A 4NBZB 2BS8A 2J8HA 4YUEL 4FQHB 4JO8A 4BFNA 3T71A 5EZOH 4HKZB 3KPNA 4QRRD 2H26B 5EC2B 4Y1AB 5ADOL 3UTQA 1RULL 3TTSA 4LSSH 3UYRH 4AMKH 3Q8BA 5ETUB 3TBWA 5ITFA 4ZS6C 4PUBH 4XP1H 3IGLA 3GBMH 1E8ZA 2CK0H 5CINL 4A2EA 6CGTA 2Q8BH 5JW4Q 2DLFH 2VDRH 1PZSA 2E7LC 2Z35A 1Z2KA 2YUVA 3QDJD 1SVZA 4XNZC 4DFIA 2CLZA 1A9EB 5KSVB 1FCGA 4ODVL 4AVHA 3GK8L 3BN3B 5GRJH 2BVYA 1D5MB 3N06B 4GG6E 4MJID 3QPQD 1M71A 3T0BA 2HTKC 4ZFFB 5JHDB 4MS8D 4N5ED 5F93C 2FD6L 5D6CB 3RIAK 5DRNB 3BUPA 4HT1L 4NRXB 7TAAA 3NSJA 1I1FA 5JA8B 3FO2A 4QRPA 4X8XA 3LEYL 4TNEA 3QJSB 5IV2A 5LWYH 2B15A 4N9GB 1ZEAL 5BZWA 2OZ4A 2JNZA 1QATA 4X9GA 3VSUA 1G43A 2X28A 3D3VA 5HJGA 1A7RH 1VERA 3VXUB 3GSRA 1UB5B 1KJ3L 1CG9B 1TPXC 3LV3A 4Q6YA 3SJVA 3RRQA 1U36A 2JJSA 4WKZB 4XNMA 1OY3B 3WXWH 1LO2L 2K7QA 4L9DA 2ZXEB 4OTXL 1E3XA 5AOIA 1J87A 3X3GL 3JVGA 2EYRA 3S37X 2ZOTA 3CVDA 4I3RH 3AXLB 4ATTA 1KTRL 4NNXA 1M9WA 4X9HA 5ESVB 1CFBA 2P7TB 4Y1TA 4RMQA 5ESAB 3SE8H 3AGVA 4UB0H 2J4WH 3MRPB 1FIGH 3OAUL 5CHNB 3BAEH 4X6EB 1QNIA 4PRIB 3BN9C 3CCHA 4C56D 4AGPA 2P24A 5JHLA 3VGAB 1EVTC 3K7UA 4MJ5A 4XMTA 4UAHA 2E3VA 4W9GC 5KBMA 1T5KA 4LHUB 3SYQA 2XG4A 5IJKC 1HL9A 2RQEA 1JXJA 3H42L 3LKQA 4KUCF 2R4SH 1GSMA 3SEPA 3DBXA 4M6NL 2DIBA 3D25A 4N85A 4Q9QL 3P2BA 1NFDB 2OJZL 4HFUL 4JPQA 4PB9L 3N2JA 1RVFL 2F7OA 3AZUA 2VLJD 4PRHE 3SY6A 4UT6L 2OR9H 2F54D 2Y25A 4L5FL 3GXNA 1EAPA 4GFTB 2WBKA 4HALA 5JXED 2QHRL 1PZDA 2OAAA 3BWUF 1J18A 1A4BA 1QO3B 3RJQB 1MFNA 4WFHD 1HHHA 1OF2A 3ZKNC 4N2HA 5IUCA 4GIOA 2FHBA 2QPDB 1XFPA 3OXRB 3UAJD 1QFWH 3WE6B 2P42B 3FQNA 3NIGF 2EIZB 3GEWB 5CJXA 3UH8A 4HUUA 4OFDA 2ZICA 1HL4A 5DJYA 3AG1B 5A2AA 2FB4L 3DO7B 5I1GH 3VFVB 4IJ3B 3RWEB 5EZPA 1AP2B 1VACB 1WAEA 2R0KL 3CMOH 1NBYB 4GG6B 4AV0A 2WLLA 4WCYH 4BCZA 5JW5B 4Z1PA 3DRTA 3MNWA 3CZEA 3V5KB 3L6FA 2ZUVA 4HIJB 4APQC 3P4MB 1NGYB 4MAUH 2C3VB 5MHSD 2W0FB 3CFBB 1B0WA 1S7RA 3BZFA 4J6RL 3S0PA 2NXZC 5C0BA 1GJIA 2X1OA 3HMWH 1SYVB 5DDHB 5DT1H 1EV2E 5HTSA 4B3EA 4N2CA 5EU7E 5CJBA 3FPYA 1UA6L 4YDZA 4S0SD 3KHOA 2MNWA 3WU1A 1NGPL 1QUPA 4TXVB 1JPTH 4QCIA 4RDQF 2MKLC 3IMVA 5B7FA 2OMNA 1OHZA 4J3UA 3CFDA 3NSYA 2RACA 3NMEA 2FZ3A 4KVCL 5E8NA 1A7QL 3MO1A 3L4ZA 4WO4A 4HPYL 1ZVHA 4LFHG 5F7EL 3MDJA 4JFFB 4CC4A 4R26L 4EBQL 4CU7A 2B2XH 1RZFL 2APXA 4BINA 4FHKA 4YO0A 4HISA 2MHAB 1V10A 4K8RH 1S3RA 4QCIB 2D7PA 4MQXC 1HSBB 3D3VE 4A2DA 5JDSB 3SDAC 4NC0B 1XWVA 2LLGA 3GSQA 4HIHB 2ZSWB 3EBGA 3FTXA 2IDFA 1UB6B 2LU5A 3CQFA 5F6IC 3QO1A 5ADOH 3V2AR 1WBXA 3ARFC 4CSPA 2LT9A 1IQWL 2J1XA 2WGXA 1L6PA 1SDDA 3DDFA 4N86A 1P84K 1SOXA 5I1KL 3DRTB 3MNWB 3ISWA 2L0DA 2HRPH 2Y7OA 3HOGA 4PY7B 5AOMA 3O6FB 4FLSA 5H37H 4APQD 1CD1A 4PV9A 4GG6A 4CN1A 3QG6A 1L7IH 3ZRCC 3VFVA 5J5EA 2GKIA 2JKWA 4CBPA 4JM2D 5TE4L 2ZD0A 1R5IB 4GAGL 4QGYA 1HFUA 2NZ9C 5BNXD 2OZ4H 4TNGA 4YJZL 5JW3H 4LSVH 4M1GL 3OXRA 4ETQA 1TMQA 4QHKI 3RX7A 4YPGA 1PAZA 4EBQH 5BVJB 3RDTA 4U1JA 3MACL 4IIZA 2DQDH 3RDJA 4YE4H 1XB3A 4J3OH 1LJMA 1QPXA 5D1ZB 4N0CC 3LQAH 4HK3N 3X11A 2YMXL 3UBHA 3KPLB 1KZYA 3FTZA 3L3JA 3FQRB 3GMPB 4K94H 4AQ1B 1Z3RA 1JPTL 2Q8AH 2HLFD 1KNOB 2OXGB 1M6OA 4WSKA 4TSBH 1FNLA 2D7TH 1M2VA 2NR6C 2MTPA 4YS4A 1MCBA 1E8YA 3IM1A 1IEHA 1QRKA 2QR0B 2VM3A 4F7MA 4WW2B 4F2FA 3MCG1 5MENB 4UTCA 1EANA 3ARFA 4PLJC 4YDJB 1XR8B 5JUEL 3CQPA 5C0EB 3BUQA 3T4AA 4P9HH 3QXUA 5KYUB 1UUSA 3VH8A 3VXSD 5MENA 4OU3A 3OQ3B 4JHVA 1F5WA 4OKVA 2XFXB 5KN5B 4C56E 2NZ1A 1TTGA 1NCCL 5DQDH 3ARFD 1Y6MR 4J3TA 4XXCC 5I2IA 3G5YB 1D5IL 2VR4A 4RFNC 5BRPA 1MCQA 2W88A 3ROOA 3ZW3A 3U7YH 1J1PL 2CO6B 1KELL 1E4WH 1PMYA 1FE8H 2VL4A 1LWHA 3IBOA 3L3GA 4RGNB 5DHYA 1SMOA 5HDQL 3APDA 5DRWA 1QTYT 4S0TD 3IJ7A 1RU9H 2ALWA 2AJ3B 3ABLB 3WY3A 4ZAKA 4ELDA 4OCWH 3TVMD 5LCVH 1F0LA 4ELMA 4Y16B 2AQNA 4QF1A 3HNVH 4XBEL 5CWSA 4M56A 4IK7A 1TZHA 4PJ9D 1JF6A 3EZJB 4WKZA 3SJVB 4QRTB 3JV4A 4P4KA 1WS7A 2H1XA 3NIDE 3FSVA 1UQSA 1ZT4A 3WDHA 4EZMA 2ITFA 1BYPA 2EILB 2EP6A 1DBAL 4JM2B 5BV7B 3BVDB 4PS7A 3WJLC 4Q9QH 5KBLA 4GP4B 4AQZA 2QKIA 4TSCH 3WTSA 1HNFA 4FQXD 3JVGC 3EH4B 2FNBA 3BEVA 2V5YA 4X0NA 3UG5A 5EO1B 5GIRB 1K5WA 4M62L 3LH8A 4ZD3H 3IDJB 4NN7B 1DDHA 3NCCB 3QUYC 4QF1B 1CVRA 4JGNA 1A21A 1NCCH 4GSDH 1PBYA 2VQTA 3I9AA 1ANUA 4ESKA 3O3AA 3MO1B 5FO2A 4QOKD 1AO7E 1RIVH 3ZSTA 3MJWA 4PJ7A 5E6IB 3OB0K 2E74C 2FQEA 1X5GA 3L3HB 4OTXH 3QRLA 4LCWE 3HHRB 4XX1G 4LMQE 2QZ5A 4W9EC 1DJWA 3CHRA 3VTTA 3VYNA 3FH5A 3Q1EA 3I6KA 5EC2A 3P3RA 1H15B 4TUKL 2QVFB 3CFBA 2O61A 3OKLA 5HJ3A 2DICA 5J13C 4LPUA 1V3KA 2YKLL 3MPCA 2VC2B 8FABA 3N1FC 1OOAA 1J1OH 5DC4B 1OAYH 3OKOA 2NY3B 5KVDE 1DQIA 2WP3T 1VFBB 3VI3E 1KN4L 1PD1A 4AYFB 5ICXB 1AMXA 3V4PA 2VJXA 2OMZB 4N68A 3HI1B 1AZCA 2CE6A 4P3CH 5J8OA 1QTSA 1RV6X 1FAIL 3DSFH 4AQEA 4LDEB 1MHHA 3LKNB 2JXMA 1UCTA 3L3JB 1W72L 1HHHB 1SYSB 4IKIA 1F41A 2YUZA 1ETZB 1Z3GH 5JPMC 2WQWA 3C5SA 1QO3A 1BFSA 4D0BA 4HPHA 5JO5A 1U3HB 4QTHA 3BH8A 1E5ZA 1ETA1 4IDJL 4WTXA 2DBJA 4YMPA 2FWLB 2JJTC 4DN4L 1RUMH 1IBGL 4MWFA 1M53A 3HG1B 3SKOA 3JWDC 1RULH 3RB5A 3VDAA 4K3EH 4NT6A 5GRYA 3VWKA 2DM7A 1AACA 2EYTB 1O5DT 3T2OA 1FFNA 3ELQA 3PNWA 3U46B 1SDDB 3WHXB 5IFHL 3FB6B 3L95B 3D25B 1Q90A 4FFWD 4KX7A 3ZL4L 4CVWA 1RZFH 1GPOH 1KCSH 3LKQB 4HF5H 2LU7A 1KXVC 4WV1B 4PJEB 5FW6A 4GO9A 4IBSA 5F3BA 3S36X 2VLJB 4HDIB 3WYRA 2BNQB 2XJLA 1A6WL 2LFGA 4X98B 4OF8A 1OSPL 5EU5B 2EH7H 3LPPA 2JTYA 4M93C 2DI8A 3GSQB 1QFWI 4FXGA 5KSAB 2APSA 3X2QB 3H7BA 2J2ZB 4W9DC 1DQLL 2HFGH 3HVNA 4B9ZA 4M4RB 4N2FA 4DK3A 5ANMB 5K9KA 1BQSA 3SDAA 5KVGH 1N64L 4JFFA 1JGLL 3BPNC 4WUKL 1CGTA 3RGVC 1FFOA 4H26A 3IXAA 3MTXA 4YIQA 2XPGA 4BH7A 3KD4A 1RUAL 2WXRA 3COOA 1VEPA 4NWUH 5C6TL 4FFTA 4KVPA 1T7WA 5AW1B 4UCFA 3APNA 5LCVL 5EU6A 1S78D 3QCTH 5HI5D 3OHMB 3RIFK 1KY6A 2X0UA 1AQDB 1DFXA 3WNKA 4MXQC 1HI6B 5G5DB 3D3VB 1KTLA 2WB7A 2EXYD 4LCVA 5ES4B 2G5RA 3THMH 1CGUA 2DRUA 2R2EB 4MKMA 5DHVB 4ZUWA 5DD1L 3B1UA 2BHUA 4X6DF 5BZWB 4DP4X 4Z5RA 3R7QA 1U4EA 1NGYA 5FYKU 1KZQA 3U25A 5KANI 3N50A 1R34A 1KUMA 3KH4A 3MBEC 1X7TA 1GR7A 2B3IA 2MFNA 3LEXA 4U3HA 1OAKL 2X2JA 4V2CB 5D6CA 3SDDC 4DGVH 5IVXB 3FYIB 3QXAA 4XNYH 1M05B 2PF6A 4ZFFA 2ATPB 1FPTH 2EIZA 5AEAA 1UM6L 5DGRA 4UQIM 2DWEA 1I3GL 1QQDA 4CU6A 1AS8A 4GW5B 1KIPB 3VD2A 1UXSB 4UDTA 2VMCA 3DPDA 2OK0H 3CXDL 1S7QB 1YEKL 3RTQD 1QR4A 1E90A 2R29A 4G6KL 3GGWB 5LHDA 4UDUA 4EKJA 3Q3GB 4G8GA 5D7LB 2AJYH 1R5WA 3TJHC 4YDLB 2CNYA 4DO4A 3IJEB 4W4OA 4RGOH 2VITB 1O9VA 1ULVA 1KJVA 1TEYA 3DURB 3QDJB 1FL6A 5BO1H 3MACH 1MUJB 3HRZB 2FX7L 4ZTOL 3HA0A 2IH9A 2G75B 2L7QA 2Q3AA 1ZGLA 1C5BH 1HXYB 3PP4H 2CGZA 3NT0A 3ARVA 3DIDA 5KAQF 2J6EA 4DK6A 1MW1A 1NKGA 1XB8A 3DBXB 4AYBA 1TF4A 4KRLB 4PCTA 1T21B 2DKUA 4QRRB 4AK1A 5JORB 1U95B 5DEFB 2NUPA 4G7RB 3V5DB 5LB1A 5IHZB 1UT9A 2WBJB 4KU1A 3RA7H 3DGCR 4I8DA 1FH5L 2VSMB 2J8UA 3N44B 3W1ZA 3F7YB 1EEZA 2ZP9A 1RLWA 2HFTA 2XV0A 4L1DA 3HG5A 1OWRM 1MCHA 3GI9L 4XMVA 1AG6A 4G7YL 5C0IA 4L8BA 4Q4IA 1OTTD 4HKBA 3GMNB 4W70A 2K7PA 3D06A 4JFOB 1CFVL 1VZIA 1XEDA 2EYRB 4X5PA 3M07A 4HC1H 3CWGA 2O93L 5FS5A 3BPCA 2XUWA 3FN0H 2Z3FA 3MLPA 2PXYC 3GMRB 3AACA 1CG9A 4JPKH 1K72A 2VN3A 3T2NH 4U3XA 1QSFD 2YC1B 4IJTA 2GSIB 4ZS6D 3VXPB 2C1OB 5EPMA 4IOSA 5SWSB 5I1CL 5CJQL 5AAPA 2YD6A 5EOQL 3T6VA 3HPJA 3UZVB 4KUCD 3PWNA 2JVUA 2HJKB 3QHFH 5DJDB 3RWIB 2V3EA 1I1FB 4JMNA 4K15A 1KLGB 4FJYA 3MGTA 2KI6A 4NRXA 3LIZA 1OGTA 3QWOA 2VDMH 3BAWA 5EBMA 4C83A 3N85H 3WIHA 4MHHI 3L4UA 1FFQA 3QXDB 2H2SD 4YBQD 1XSIA 3GDCA 4V1DB 3QFJD 1HU8A 3FCGA 4HUNB 3NA9L 3OV6A 5B8CC 1FCCA 3MMEA 1CIUA 1GW6A 1LEIA 4P23A 3FCBA 2Y72A 3OKNB 4CMMA 5PAZA 1FC2D 2ERJC 4PJAB 1JZ7A 4L4TE 3TZVA 1CZ8H 1F4XL 1X5HA 2R2HB 2BZ7A 3MXWH 2FT8A 1EHLL 2TSAA 3K5SA 3L13A 3K0WA 2R23A 1BFVL 4L4TB 4K7FA 5KUMA 3SCMB 8CGTA 5E9DE 3EFOB 3DI3B 5ALBL 5F88A 4YXLH 1ZGLP 1SLVA 4POUB 4D0CB 4OCLC 4ALAL 1R3HA 1TZ8A 4Q56A 2YAFA 2BJML 2A6DB 4LCCC 2YAOA 2VABA 3E9UA 1IBHA 3UEQA 2PYFB 1QI3A 3MV9A 4FI8A 1N68A 3WTUA 3GRBA 5B1BB 4BFEA 5JMOC 1BG1A 3EJTA 1WC7B 3NK3A 2BNRA 1JF5A 4LPCA 1YJDC 1YPZA 5JW4M 1T1YA 4BSVA 4N0YL 4C56B 2ESVD 3BAYA 4XHJD 4NCDA 2UWEB 2VLMD 3QIUA 1UA3A 4PVBA 3ATBA 5E6SB 3IRCA 3L3KB 3HB3D 3CZKA 5EU4A 1Y18A 4KKQA 4KROC 1ZHBB 3FQWA 4JN2B 3JWOC 1X6LA 4JY4B 3OXSA 5BZXA 1X4YA 5T5FA 4DP7X 1P7QB 3S5ZA 4NGHL 1JV2A 4ELKA 3L7FA 4G3YH 1I8AA 3EYOA 1HINH 3VD1A 1A0QH 2CR0A 3PAZA 4JGUA 4P5TA 3D30A 3QNXA 1YMHA 4XX5A 1CE1H 5IMLB 3BAIA 3MQIA 2OMTB 2XVKA 4XNUL 1LO4H 2IDQA 1V8HA 3FTGA 3S4SG 5IEHA 4HOXA 3NIDB 4RAVB 1MCSA 4XCFH 4XE0A 4WI3A 5E9AA 3ZDYF 2IVFC 1AXIB 2VDPB 2HLAB 4WV1C 2FLRT 1IM3A 1XBDA 3LYRA 4LEXL 4O5LH 5CSGA 4YHZL 3Q2VA 4JG5A 5CLYA 5AW2B 4NLHA 2DW5A 5JPNC 1ADWA 2CO1A 2PCPA 4YSRA 2Q86B 3MLYH 2AKRA 2VXUH 4HWBA 3U9WA 4KKPA 3SGEH 4P9MH 1AGFB 4ALAH 1DQTA 4XAWL 4BZYA 3NCYP 3RX5A 5DJZA 2P4AB 2A83B 4NYLB 1TJIH 4D0DB 2OR7A 3TIDB 4XO8A 2UUDH 1CU4H 3L3OC 3RWGB 1ZHLA 1AR1D 5DD6A 1RJZA 1ASOA 2VNCA 4PLNC 1YNKL 1RK1B 3FZUC 1ES0B 2X4UB 1R47A 1A65A 3FC8A 4NLAA 5EU3A 1MFCH 2HT4C 2VLRE 5GGQH 3WIFB 4BZ2H 1JF1A 5DWUL 4ADIA 4XTRD 3L16A 3LRHA 4ERSL 3V0WL 3GBLA 3WFBH 4GMTH 5CEXB 1I1AB 3EJJX 2ZSVB 3PGFL 4NPYB 4ZRGA 3TBCA 4ZMQA 4P2YA 2X70A 5KW9H 2VSDA 5C7XH 2IC2A 5L88L 1U8QA 4WRLA 1DVTA 3NCFB 4E5XG 1E9QB 5GGUB 5ILTH 1QAWA 1A4AA 4PJ8D 5GS1C 1X9RA 3BPOC 2ZQKA 4XVSL 2AQRA 2DWXA 1G7LB 5DRZA 5IMOA 4KZEH 4LRNL 1FG2B 4TQHA 4Y5XB 1BV8A 3UAAA 1S7UB 3JV5A 4LLUB 3SPGA 4EN3D 6FABH 4IKNA 2YZ1A 4IIQC 1CE6B 1DE4A 2B59B 1XMEB 3N04A 1Q0EA 4LQFH 5E2WH 4BFIA 4G7QB 4HS8L 5DJ0B 3EYSL 4TL4A 2ZUTA 4F2ME 3TL5A 3QNYA 2FECL 2IBGA 5CEZD 2X6MA 1OP5K 1I8MB 4HUVA 3O4LA 2NY7H 4GAJL 2B5IB 3NSDA 4MMZC 4NPKA 5FYLE 4R6UA 4ACTA 3S37L 3QG7H 3TIEA 3BISA 2IWGA 4H1LA 3QDMB 4TVPH 3SY0B 2NXYC 3FUJA 4R2GB 4WI4A 3VSQA 1NFAA 3BO8B 3WFDL 4HIIB 3FQXA 2AK1H 4BQBA 1IKFL 4ZNEE 2K70A 3O2DA 3GI9H 1NA8A 2NNXA 2ZTBA 5HHOE 2EDHA 2PO6C 2A1WH 2YEZB 1JCVA 4PW9A 4ZSOB 2VO5A 4ZW5A 5ACZA 5HGAB 5I1JH 3NZ8A 3HUJF 3S5LA 2FJHB 3LZRA 2YPLE 1HHGA 1KXTA 3NPSB 4IK6A 4JQIL 4MMXB 5FFOA 1V05A 1T0NA 4QHNB 4R7NB 3DX2A 1RURH 2ZPKL 4WHTA 1F2QA 3ZKXB 4UOZA 2APWA 1E42A 2H6PB 2OS7A 3KR3L 3M17B 5DHEA 1I3RA 3PAYA 4KO6A 4F2MB 1FNSL 4GW1B 4GEJA 3KCWA 4YHKH 5D7EA 2IQ9L 4PRHB 2L8AA 4BV1A 3EJZD 4BFRA 1A9BB 1NC2D 4UINH 3AJ7A 4E9SA 1KYAA 3ZX1A 1OCRB 4G59C 2GJZB 2ZCHH 2AP2A 3BKMH 5CUSL 1E0OB 5KTEL 3WFDH 3AAZA 1AI1H 1CMOA 1P5VA 1U8JA 2LGNA 4XNBA 2FH6A 2E9BA 1UTDA 3WTVA 1MJJB 2D2CC 1AR1B 1DSYA 1G94A 1LEGB 1NUDA 2PPEA 4NZFA 4Q7DA 1BEYH 4WFGD 4XPHH 5EEZA 4OZHA 3EGSA 4I77L 4AW4A 1EEYA 1RUQH 1IFHL 3GJFH 4OGYL 4KXCA 5BUGA 5D1XC 5BS0B 2GJ6D 4XXWA 3SQOL 3TF4A 2CHZA 2EO1A 3JZYA 2XKNB 3EDEA 3N9GH 2L04A 1HESA 2G5BB 4TSBL 3CN2A 4GRLB 1UD5A 3D0LB 3EJPA 3GT6A 4FQIL 4ONFH 5EO9A 3RZCB 1RZJL 1NLDL 1UASA 4XX1E 3O9WB 5HJBA 3QEUB 1EERB 4JO3L 3T77A 2X3AA 2FJUB 2W59A 1T7XA 5D7HA 1MAJA 4Z0BL 4PCYA 5C86A 4NJ9L 1QABA 5L4FA 4RLDA 3KCPA 4I5BB 5I17B 1O9ZA 3VQMA 3TURA 1ET7A 1I1YA 4Y19A 1GGBH 2QTEA 5CZKA 3SDYH 3TEXA 3UJJL 2WHVA 4AZ8B 5FPIA 4QHLA 4HAKA 4HWBH 2Q0ZX 1O6SB 5T1KB 2NCEA 2DH3A 4HGKC 3RTQA 1P7QD 4WVRA 4IBVA 1UUNA 2PABA 1OEZW 3G5XB 5C0FB 3EJZC 4BELD 2ZG3A 1LO5A 2J8UF 3BUIA 1L5GB 2AJSL 1NCUA 2NNRA 2R2BA 3KM1A 3BQUA 4DN3L 4EZJA 3PFQA 3HB3B 2I60H 3KJ4B 3ABZA 3EIFA 3EJRA 4PJAE 3GPEA 2VR3A 4ODSH 5D70L 4JQIA 1JN6B 2WXQA 1OB0A 4FQLH 3V0HA 1C8PA 1U2CA 5IOPB 2AQQA 5DZJA 4TRPH 4W9JC 1MFBH 2OMVB 1QSED 1OZUA 5HHME 3FDWA 4YSSA 1E4XL 3MBWB 4IEFA 4A55A 4YHYB 3PWLA 4LF3A 2JKTM 3UG4A 1NWOA 2VXUL 4L1HA 1U3ZA 1Q9WB 1JHKL 3UACA 1A1MB 3FT2A 4MA8L 2IOMA 3TEZA 1WBZB 3HMXA 4NRZB 4FKKA 4YK4B 2DJSA 1L3NA 2W9DL 4OIFA 3B5GA 3FO1A 2OMXB 3MLWL 3F84A 4NAJA 1PZ5A 3AWGA 3MRMA 2XG5A 4F8QA 4WWNA 2HN7B 4CNIB 1PEZA 3L2NA 3MNMA 1T83C 3BKYH 3QUGA 4XOBA 1BSIA 4NQVA 2YBRB 2ZXQA 2N0KA 4FTDA 4ODUA 5CEXA 4R83A 1QR1B 1JCKA 3L5WA 1QEWA 4X6DE 1CFSB 4NXSA 3EYQC 4YDMA 1RFDL 3L8QA 3NOIA 3P0VL 5HPOA 4TTDD 1P4BH 3MA9H 4YHOL 4BE6A 4GG8A 1DVSA 4OJCA 4V1DD 2BPBA 3FHQA 1DLHA 1GZQA 3A3YB 2VR6A 1IFRA 1SMDA 3IJYA 4NHUA 1CCZA 2OW6A 4H7VA 4WNQA 5FWRA 4MVBD 4MD4A 4ZTPL 1FGNH 5J3HD 4WFEE 5CJ8A 4UT6A 5HYQB 1IGCH 3QJUB 2WBXA 1AKPA 4MNHA 3MCYA 4N2LA 4U1IA 2VERN 4OSUH 4ZXBA 3OGOE 4OAWB 3QIWA 4LLQA 1PZCA 4R96B 2IQAB 4DKEH 1PZ2A 2BW4A 2JK5A 3CDGA 1E4XH 2APVA 4PLKD 3LSOA 1NTDA 1QWHA 5EN3A 2VZ1A 3BKCH 3MUUA 1KCRH 2HG5B 1J5IA 4NEHB 5EA0H 1ORSB 5T3XE 2QJDA 5AKRA 4IGBD 3AU1A 1IARB 1F3JB 1XCQB 1E7VA 2Z7ZA 1NMBL 2CLRB 4L9LB 2C7UA 4WEEA 3BH4A 1N59B 3L5WB 1MH5A 5IFAH 4K3GA 3J27A 4KI5D 1OIOA 4PRNB 1B6UA 4X42A 3BEWB 1KDJA 2XZZA 3ZKXC 1P5UB 1WDAA 5FEBA 2M2DA 3I3EA 3I6GB 4ZUVB 3VFSA 1XBRA 2XRAH 4NCC1 3BQUD 2XTJE 2XG5B 5K5YA 3KYKL 2H0PA 1YEHL 2G2NA 2CRYA 3QWNA 2HYMA 1JGUH 1U8CA 3J7HA 1P1ZA 4YQXL 5I1HH 1XGTB 2NOYA 2F74B 2JTDA 2O6EA 5FW7A 1NAML 1BLNA 2JKXA 3LD8C 4MB4A 2G3XA 3FFCB 1CBJA 2FR4A 1MRFH 2IBZY 1S7VB 1IEBB 4D2NA 1WC7A 5A2LH 3PPEA 1R46A 2QTVA 3ERXA 2EE9A 4N8CL 1C08A 1S7SB 3T09A 2YGOA 3V55A 4PGCB 2JLLA 4Z78B 2BSTA 3ECWA 1XGZA 1NLDH 4GH7B 3HVDA 5D7IF 3MBWA 4IEFB 4P2QD 2K8QA 3VI4E 1INDL 1Q0XL 3DX4A 2A6DA 3E6FB 5HI5C 3B2VL 4RGOL 1XVSA 1BVZA 4NB7A 3PWPD 1F6AB 4X7TA 4HOZA 4JG1H 5B38B 4UWQB 2EAEA 3EFOA 2D31B 3RGBA 2CZNA 2NY2B 4WI6A 3QAQA 1I9IH 2EIMB 2R2BB 4XPHL 2VW7A 4E9TA 5D93C 1XTLA 5C70A 3POCA 1YY9D 3CLWA 2VZTA 5GPRA 2WNWA 1NBZA 5PCYA 1FNGB 4FKEA 3VD9A 1FZMA 3BCFA 3MRDA 5MEQA 5CIPA 3ZKMD 3RDTC 3CQQA 2AV1A 1YN7B 3MOAL 2GHWB 4HGWA 4V1DA 4G72B 4BQ8A 2NSMA 4JFVA 2O1AA 4DEWA 5BPPA 1I8IB 2JB5H 2Y7SA 4NQXB 2EDBA 4KPHH 5BV7H 4G6ML 3O9WA 1ZHKB 3UCRA 5JHAA 2R56L 4JQIH 5TDNA 1ASPA 4Y2LA 4GP5B 1SHMA 3DMMA 3KJ4C 5DK0B 4I13B 2QMJA 4YC2C 2O4EA 3QEQD 1MVFA 3UTTB 4FFVD 1QFWM 4PWKA 5KBDA 2WVTA 3JUYA 4XMXA 3TNMB 5EPMB 3H4HA 1NCBH 2FAUA 3X12B 1SOKA 3VA6A 2YC1A 3K81A 2DZEA 2ZKYA 3M1OA 5C0AA 3TTYA 5I6XB 3ME0B 3AY4A 1M7IA 2BVTA 3NJLA 4HS6B 4JZJC 5MI0C 3HMXH 3RWFB 2FL5A 4NFDA 2W65A 1MJJA 4MS8C 3BRDA 5LKNA 1A7NL 3T0EA 1N5YL 2IANE 4ADJA 2QPEB 2DQTL 2DQDL 2F9BT 3UZQA 5C8JB 3TV8A 4DO5A 4H8UA 4LKXA 2QADC 3K74B 1AIFA 3MODH 4UV7H 4YL4A 5TGBA 5I1IH 3U30C 5KJRL 1ZVYA 2HVKA 1RXLA 4HZLB 3QUHA 3NJJA 3UZEC 4TLUA 2XOTA 1OAXH 1HWHB 5GHWL 4MZRA 4M6OH 4HS8H 3QK0A 3RP1A 1VADB 3DPBB 1HDMA 4L1SA 3DIFB 1JTOA 3PHSA 3LCYA 5IM7A 1PSKH 4HXBL 1IC1A 1KJ2L 2H2PC 4GAYB 3RZCC 4MD5B 4GI6A 1HKLH 1QNZH 2ROYA 3FQUA 1AZRA 1T0NB 4QHNA 3EH2A 4JZNA 2GSGB 5CN1A 4QWWC 4H25A 5DHXB 5TK4A 1U3NA 3D1MC 2CHWA 2ZWLT 4IU2B 1FQ9C 2PW1B 1GYAA 2FGWH 1UGNA 3PHAA 4B96A 2FJHA 2I26N 1C9SA 1ECZA 1SLUA 4J3XA 3SODB 2OLDA 3ZBMA 3AMLA 3HUJA 3KNBA 2APFA 1H5BC 1GGYA 5D96B 1PJWA 1OL0A 3MGOB 1LWJA 4AITA 1UJ3A 3U4EB 1N7ML 4PJAF 4AE0A 2Q6WA 3OB0H 4QHUB 1MUJA 3HRZA 3KLAB 4NHCH 1DEDA 1ETB1 3O3UN 3PJNA 3OLGA 1U8KA 3OWRA 3LZOA 4ZPTB 1JNNL 5DMIL 3G9VA 4GQ9H 5B22A 1MI5E 4P05A 3CPLA 2Y1YA 5KVMC 4DSYA 3CDYA 1N18A 3G08B 4P46A 5GSRA 2KPWA 2VO8A 1J8HA 1CXHA 1KIPA 4XVUC 5F3HA 1UA6H 2XT1B 5DJ0A 1CC3A