3CZUB

Crystal structure of the human ephrin a2- ephrin a1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
130
Chain Sequence
ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYESVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 29
structure length 130
sequence length 132
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3czuB00
4YSTA 4HCGA 1HAWA 3D12B 3C75A 1L9RA 1L9TA 2UXGA 3FQ1A 1JZEA 4PCYA 2ZWNA 1T5KA 1TEFA 5B7FA 1BAWA 1J9RA 3MBWB 3S3BB 1JZFA 2YARA 3PXLA 1DYZA 2VM4A 2PP9A 5I5IA 2EIMB 1L9QA 1NICA 4WKXA 3OM3B 1WS8A 3JTBA 4X4KA 1A65A 2BW4A 2CJ3A 4JKNA 3ABMB 1XB8A 2XYBA 4GP4B 3NJJA 1AZNA 2WO2B 1WA0X 3GYRA 3NP4A 2Q5BA 5AKRA 1IBZA 4UAHA 1OCRB 5AZUA 4A2HA 3OMIB 4E9RA 3WI9A 1AANA 3HB3B 1PLBA 1M56B 1EZLA 1URIA 3WIAA 2EIKB 3ZDWA 2FNWA 1JXDA 4A66A 1SF5A 5D4HA 2FQGA 2YAPA 4CSZA 2BO0A 1KGYE 5I26A 2YAEA 5I6KA 4G7RB 5EHFA 1JZGA 2IWEA 2QT6A 3AG1B 1E67A 2N0MA 3CDZB 3AG4B 3FT0A 4NB7A 4RH4A 3KW8A 2OCCB 1PLCA 3OQRA 3FYEB 1OOWA 3FPXA 4DP5X 2Y1AA 3QJSB 4UANA 4GY4A 2DWSA 1CURA 4JHVA 1SF3A 3AW5A 2IH9A 1KBWA 1ZDQA 3PAUA 4JHUA 1X9UA 5IY5B 2ZXWB 1ASPA 4YVUA 5D4IA 3TU6A 3X1BA 1QHQA 4KO7A 2FT7A 4DP6X 2YAMA 1XB3A 3H4FA 2AZAA 2P80D 2HX9A 2I7OA 2B08A 1JZHA 4KNSA 2AVFA 3SBRA 5ANHA 1WS7A 4A2FA 1IKOP 4L0PB 5AFAA 2IWFA 1QNIA 3EH5B 1W6WA 3ERXA 3N55A 3FS9A 4BXSV 4DP7X 4AI7A 9PCYA 1RKRA 2WO3B 3FSWA 4YSPA 2HLEB 2HX7A 1RZPA 4N8UA 2OJ1A 1GS6X 2MTAA 1PF3A 2B3IA 1AOZA 3H4HA 1RCYA 1GYCA 1BXVA 3S3DB 4BXVA 8PAZA 1AS6A 1GSKA 1PZBA 3FSVA 5PCYA 3L45A 1BQ5A 4AKQA 5B7MA 4YSSA 3UADA 4BK5C 2RACA 1BXUA 2VSKB 3FQYA 1ASQA 5TK2A 1W8EA 3AG2B 2FT6A 2YQBA 2VM3A 3KW7A 4DP0X 1N68A 5D4JA 2XV2A 4YSUA 2X87A 3WKQA 3FU7B 3X2QB 4E9VA 1GR7A 4F7KA 2VSMB 1CYWA 3OMAB 3EF4A 2J55A 2AANA 3MX0B 3QPKA 3QJUB 1BXAA 3HEIB 2FJSA 2GBAA 5F7AA 4FA7B 1J5DA 1KDIA 1MZZA 2PCFA 3FU7A 1AZUA 1FFTB 3ABLB 1JERA 4HIPA 3SQRA 3DTUB 4E9XA 1MZYA 2TSBA 1J9QA 1R1CA 1RZQA 2FTAA 3ZBMA 2IDTA 3CG8A 1ID2A 4G71B 3NJHA 3H56A 1PNDA 2PP8A 4TXVB 2HRHA 5E9NA 2IAAC 2H5UA 2XWZA 1SNRA 3AZUA 3NP3A 4W1TA 3EH3B 1GS7A 2HX8A 2IDFA 3IN0A 1SDDA 1FA4A 1BQKA 2LLNA 5B1JC 2QPEB 2AZUA 2XX1A 1OE3A 2PPAA 4Q8BA 2ZOOA 2GC4C 2DV6A 2EIJB 1NPNA 3TBCA 2VW7A 2MRYA 3TASA 4HAKA 3UAEA 2IDQA 2IWKA 5B1AB 4G7SB 4YSRA 3QJQB 1CC3A 1A4AA 1JXGA 2GB2A 1M57B 3T9WA 4GXFA 4UF7C 4DPBX 1J9TA 2EINB 3ABKB 4KO9A 1E5YA 5I6OA 1GY1A 1XB6A 2JKWA 2QDVA 3WNIA 4AX3A 4P5RA 1ET5A 2FT8A 2VMJA 3NJMA 1JVOA 2XLLA 1KCBA 1WA2X 2XUWA 1JXFA 2CAKA 2UXVA 4KNUA 2BWDA 3FPYA 5B3SB 1BEXA 3CVCA 3T71A 2PPDA 4E9SA 2XX0A 1AS8A 1OCOB 2GIMA 1IBYA 1V55B 1GS8A 1NINA 1EHKB 4M4RB 2VW6A 3T6WA 1CUOA 4HALA 1A3ZA 5B7EA 3X1EA 3IBOA 1MG3C 1M9WA 1J9SA 3CVDA 1KBVA 1I53A 4E9QA 2BP8A 5LDUA 2A3TA 6PAZA 4BWTA 1AACA 2YXVA 4HHGA 4YVNA 5I6MA 1F56A 1E5ZA 1ETJA 3WKPA 3X1FA 3V9EA 1NIFA 1BQRA 2AFNA 2XV3A 4E9WA 4MFHA 3S8GB 7PCYA 3FYIB 1OE1A 4HCIA 1XMEB 3DKHA 4YSDA 1X9RA 4QKTA 4ENZA 3V9CA 4P5SA 4DPAX 1NIBA 2YXWA 4DP1X 1NIDA 4QLWA 1PAZA 1NWOA 1ZIBA 1PLAA 4K9JA 3WNJA 3QJTB 1ZDSA 3QJVB 3ZIYA 2GSMB 2BHFA 2QDWA 5I6LA 1OE2A 3NSCA 3X1NA 1A8ZA 7PAZA 1KCWA 1DZ0A 2JFCA 1GW0A 2I85A 1WA1X 2W8CA 3WG7B 3FSZA 3IE9A 2BP0B 2ZONA 3CVBA 4GP5B 3NJIA 4A2EA 4G7QB 3S8FB 1V10A 3X1GA 3NJGA 2VW4A 4BWWA 3UAAA 3DIVA 3ASNB 1E65A 1ZV2A 4HHWA 4HZ1A 5I6NA 2BP0A 1FWXA 4KNTA 3PAVA 1PCSA 1UATA 3PLYA 1IUZA 1AIZA 1SDDB 2WSDA 4N4YB 2E86A 3UABA 1NDTA 2PPCA 2XV0A 3OMNB 1PZAA 2GC7C 4AKOA 4NERA 2IDSA 1MDAA 2DWTA 3BQVA 3T6ZA 2VN3A 1SFHA 3QQXA 2CCWA 4YL4A 5I5JA 2EILB 2XVBA 1OF0A 2QPDB 3IN2A 5PAZA 1JVLA 3JT2A 1AG6A 4GP8B 1OCCB 2H47C 2CALA 4G70B 2PLTA 4YSQA 2PPEA 1JOIA 3NSDA 5B1JA 3CZUB 3NYKA 3BVDB 3G5WA 3NSFA 2BWIA 4DP2X 3T6VA 3PCYA 2BZ7A 3GDCA 1TU2A 4PAZA 2Q9OA 3TA4D 4YSCA 5B1KA 4YSEA 1GY2A 2J5WA 2XXFA 3ABGA 2I7SA 4DP4X 2FQDA 4F2FA 2FQEA 2BZCA 4W9ZA 2DYSB 6PCYA 3PAZA 1NIEA 2HRGA 3NSYA 2UXFA 1SHXA 1HFUA 4AZUA 3FSAA 5A7EA 1ET8A 1KYAA 3EH4B 1SHWA 2CUAA 2HZHA 1VLXA 2W88A 1ILUA 1JZJA 1AS7A 1MG2C 3OD3A 1PMYA 4KO6A 1AZRA 2BP8B 4FAAB 4BDVB 4KO5A 4A2GA 4M3HA 4KOCA 2PP7A 2R7EB 3EHBB 3GXUB 1WAEA 1SJMA 2J57A 3UACA 1AG0A 3CDZA 4YSOA 2UXTA 1ILSA 2CBPA 3SBPA 5FC9A 4BDVA 1PY0A 1A4CA 2BW5A 1NZRA 1QLEB 3FU8A 5TK4A 2R7EA 2J56A 3QJRB 1ASOA 1PZCA 4A68A 3RYMA 1NTDA 1AQ8A 1CYXA 2FQFA 4G72B 3T6XA 4DPCX 4A67A 1KDJA 1JZIA 2GI0A 1V54B 4F2EA 1TEGA 1ZIAA 1HAUA 2HXAA 4WTQA 2YAQA 5I28A 2DYRB 4DP8X 3PPSA 1AZCA 4E9TA 2NRDA 2FWLB 1YLBB 1AZBA 2P80A 2X88A 3FQ2A 4HCFA 2TSAA 1AAJA 1ET7A 3NJLA 2GHZA 3ASOB 3AY2A 4NAJA 3TBBA 2DY2A 4EF3A 2YAFA 1ADWA 1B3IA 1L9OA 3NT0A 4E9YA 1IC0A 1KV7A 2PCYA 1ZPUA 4ZK8A 4AKPA 3S3CB 1E30A 2YAHA 1TKWA 5I6PA 1NWPA 2OV0A 5B1BB 5I5MA 3SBQA 3N2JA 1NIAA 2UX6A 5F7BA 1BYOA 2H3XC 3U25A 4KOBA 1AR1B 3NJKA 3ZX1A 3NJNA 2PPFA 1PNCA 4Q89A 1N70A 2IH8A 2Y69B 2JXMA 1W6LA 4BWUA 2UX7A 1L9PA 1A4BA 2XU9A 3AG3B 3NJFA 4GYBA 3UGEA 1OCZB 1J5CA 4YSAA 1L9SA 1SFDA 4CSPA 2YAOA 1NPJA 3FU9A 1BYPA 2IDUA 3IEAA 4A2DA 2XXGA 4DP9X 1OV8A
chains in the Genus database with same CATH superfamily
1INEH 5E8PA 1M53A 4Y5YC 3B7YA 2VN4A 4L1LA 4O51B 1VA9A 4I85A 4KBPA 2YXMA 3LKQB 1AI1H 5A3ID 4U6VH 3AMKA 4GQRA 2YARA 4V33A 4H0LC 4XGZA 3KYMA 4P2QB 3VXOB 1A7QL 5I5IA 3A24A 3L5XL 2Y6SD 3IFOB 3TCXA 2DQDH 3WY2A 5INDB 2W94A 4G6FD 2C4FU 5GRWA 4M7KH 3S96B 2OPCA 4RBPK 3RKPA 1H0DB 3T3PF 1GGUA 1HILB 1DVTA 4EN3A 5B8CB 1JDCA 2L7JA 1F0LA 2LV4A 3NFPA 5D7JD 3OGOE 3MLRH 2BHUA 1JXJA 3Q5OA 2VGLM 2X89A 4XCEB 2DN7A 4NN6B 2AITA 4AIZB 4ZSOB 3FONB 4K71C 3L3IB 3V4PB 3VXMA 2AGJL 2W5PA 5I26A 3K0WA 4AQEA 2IWEA 2ED7A 3QR2A 2H0JA 4EI5C 4LEXH 3KPRD 2I9LB 1GJUA 1N7MH 4GSXA 4IRJC 2FO4B 2DTML 1U8PA 4P3CH 4XVTL 5HVHC 1G9ML 1EAJA 5HSFA 1YEJH 3HPLB 4NRXB 2FB4H 3VACA 1S3KL 3GJEB 1R5WA 2ADGA 1A3QA 2A9AA 3I6LE 2ZXWB 1ZT1B 3L5IA 3T0EA 1NAMH 1SPDA 4PJXF 4XNBA 3ZE1B 4HPOH 5D1QC 1YEIH 3V8CA 1SN2A 2J1WA 3AT0A 4JFDA 3NIDF 1U8LB 4QGYA 1IKFL 3II3A 5HI3C 4JM2A 1U30A 1YEEL 1N4XH 4FQJL 4JRLA 5AOIA 3VW3H 4BSWA 5ANHA 1EFQA 3C8DA 4EI0A 2OL3L 3PQYA 5IBUG 4L0PB 3GHBH 4AUUA 1F1DA 4DZBB 3O81A 1GCYA 5I8OL 1S9VA 1LP9E 3MBEB 1HOCA 1LD9B 2NYYD 1WHPA 4R0LA 5DJ8A 5KANG 9PCYA 3IFPB 2NYZA 3GZQA 3NRQA 3E6FA 4L0ZA 5H4ZA 3MQIA 4YDMA 5J6HA 1R3JB 3L7EA 4L1HA 2BNRE 3PG2A 3ESOA 4XB3A 5DD6B 1RULH 3PGDA 5LGHH 4HFUL 4HKXB 3B9EA 4K07A 1OANA 2JQAA 3BAYA 1TJGH 4Z77A 2RACA 3BVNA 2DD8H 3MGOB 4WI8A 4MNHB 2YEQA 2XA3A 1U36A 5EEYA 1PDKB 3ILEA 5EBWA 4X6DF 3SE3A 1TCRA 2ENQA 2XZCH 3QUGA 3IGFA 5TK2A 5FF6A 4B27A 5C09E 3DSFH 2QGCA 1D5XA 1I7TB 2XJLA 3VD0A 5KG9B 5E8PB 5ESVA 4LHJB 4XPAL 3UTQA 4R8WH 4OT1L 1G5GA 3FHAA 1B0WA 5D2LE 5FUZH 4Z5RA 1PAMA 3ZVVA 1I9RL 3E1F1 3NVQA 3OMAB 5KVFE 1DQQA 2CK0H 2VZVA 3RPBA 2HB0A 5F9OH 3V0JA 1FNGB 1JMZA 1II4E 2EE6A 2OYMA 3WUZA 2FO1A 2EEFA 1RZFL 4GKZA 1PKQB 3KYMB 4NZUH 4H26A 1U8KA 2EC8A 2VISA 1NQBA 1UC6A 3DTUB 3TFBA 1JNJA 1BP3B 3LS4H 5SWZD 3EOTL 5J6SA 1ZCRA 4CA4A 1D5ZB 4EDXB 1NGQL 4FXGC 4BQ8A 3MV11 4XCYA 2VXSH 1MW1A 2I07A 2IVFC 2NSQA 4M9OA 3LDBB 3MPCA 2WQ8A 4MS8D 1ZLEA 2VR9A 2WZAA 2QR0B 3MYZA 1DVZA 3BUYA 4PJ6A 1OAYH 3EO9L 4OB5L 3K72A 3NFPB 4WJ5B 1PS3A 4ADJA 5KSBF 1T03H 1N10A 4HS8H 4ZFOA 3PJNA 1HC1A 3L4WA 5JHBA 3UJIL 1HYSC 5HJ3B 4KXAA 5F71A 4RMBA 4OZIE 2LLNA 1XHHA 1LYQA 3COOA 5GGSY 4ODVL 4XX1E 4OFPA 2OW6A 4DK6A 4GNKB 4KAQL 4DTGL 2IEPA 2DQEL 3SGDI 2GEEA 1TETH 4ODTL 1PG7X 3MV01 5JQIB 4M5ZH 3EH1A 4JW3A 4J3UA 1F90L 4QXUH 4QGTA 4J3TA 5EU5B 1GAFH 4FA6A 3F7RA 4JFEB 4KRPD 4B3VA 3WTSA 4JLRA 1R24A 5DQJA 3WFCH 3WXVL 4RGMC 1SXCA 4I8DA 1U8PB 1BVKA 3BZ4A 2W91A 2XQYK 4IBQA 4FQQA 2CHWA 4CVWA 3SD2A 3JWNG 1K4DB 3NEXA 3EFDH 4NIYE 1KNOA 1U8OA 3PUCA 1R5WB 5FO7A 1HSBA 4R5TA 2ADGB 2HFFB 5DHDA 4F15B 5A2IH 3T0EB 4YHYC 5K39A 1ET5A 2VMJA 4HXBH 4HUUB 4KXBA 3UZQA 5DXWA 3ZQXA 4WFGD 5DVMA 2X2UA 4HOMA 4TTDC 1A7NL 1INQA 5TJWK 3TPKA 1WA2X 2V2TA 3PWNB 2HH0H 2C7UB 5EDXA 4ZMQA 1NEPA 1OAQH 3GD1C 3QRLA 4YHOL 3VFPB 2COQA 1EDQA 5DS8A 2NPLX 4BSWB 1T0PB 1C7SA 1I31A 3PQYB 1RZ8A 2WBJD 5T33H 4Y16C 1NL0L 3FRPG 2X9YA 4YXKH 2GHWB 2D4FA 1OP5H 1S9VB 3IBOA 4JO2H 1HOCB 1UOLA 4PCSA 1E9QA 3DWTA 4Y2DA 3TVMA 3IRPX 2YK1L 3GS4A 1I53A 4I1NB 4M4RA 1D9KD 3L7EB 4M56A 5DWUL 2IAMB 3RVWD 3VWKC 3MV8B 5IBLD 2VM9A 2Q8AH 1ETJA 5I66A 1EANA 1GIGL 1FQ9C 4BGLA 4FTVA 4KI5F 4P2RA 4F8LA 4GT0A 2ATAA 4YHKH 5KVFL 5KAQG 4XC1L 2DDQL 5L2KD 4X6EA 4NI6A 1TCRB 3MUHL 5FYKH 1D5XB 1L0XA 3TWCH 5F3FA 4DPAX 1RZJL 5ESVB 5DK0B 3O3EA 4EVNB 3LEYH 1JAEA 3EJZC 2AXWA 3FL7A 4ZMOA 1HZHL 3JWDL 3AGVA 3DJSA 5HD8C 2WMPA 1L0PA 4PJAF 5F6HJ 1BQHB 3TBYB 3RVUD 2F58L 3U79A 1E40A 4UQAA 2HN7A 2X4TA 3NIGB 4H8PA 3VI3E 3X1NA 4HWEH 3DJRA 4KZCA 5ES4B 4NUPA 1MHPL 1MXDA 4H26B 1U8KB 2VISB 3GNMH 4CILA 4GAJL 2Y36L 3ZO0A 4KU1A 4OIIL 5C0FB 1EGJL 1MHHA 1SM3L 3MACH 1FH5L 3JWNH 4K5LA 4YAQA 3WEXA 2DQJL 1ZEAL 2YRPA 3NMEA 2I07B 1D5BA 4U33A 2NUPA 3B7UX 1VIWA 3CPLA 1PCSA 1Z66A 5JR1H 4YFLF 4ZFOB 4LO9A 3TURA 3EOBB 5CXPA 3EUDA 4JFFD 1BX2A 4G3YL 4TQEL 3S97C 1WK0A 2VXQL 3BPOC 2OI9B 2GC7C 1DEDA 2VYRE 4HUCA 5DHEA 4IU2B 4DFHA 4F57H 5FK9B 1T83A 2IXQA 3HFFA 4MZ2A 1G9NL 5HHME 1D2PA 4B0MB 4XWOC 4CMHB 1U8MA 2CA4A 1PFCA 3N41F 3UBHA 1EBAA 4JLRB 1FRGH 1HZLA 4KPHH 5AYTA 1KELH 3WFEL 3BZ4B 4YWGH 5HYFA 1UUNA 1IGML 4NNPH 3OKDA 5FB8B 3GBEA 3G08B 3F58H 1KNOB 4G9FD 1U8OB 3BISA 2WOYA 4MA1B 2Z7ZA 4EI5D 5DJ2B 3RWFA 4IRJD 1PX4A 5K39B 4QD2E 3SGKA 3UZQB 4JPVH 5DC0A 4LIQH 3WS3A 2V2TB 4X5PA 3SYAA 3PAZA 1OXYA 1LWJA 4MXWH 1T2QL 5KZCB 5BOZG 1SHXA 5DS8B 1NFDA 5BV7H 4ANXA 1FNLA 4Q58C 5D1QD 5AW1B 2F7IA 2BCKB 4LRNL 3CLFH 4Q52A 3RTQA 2CUAA 4GRMB 3GSXA 3WNMA 5MENA 1MLBB 3WTTA 1MLCB 2AERT 1MG2C 1HINH 1KIPB 1O9WA 3QHZL 4NAQA 5HI3D 4FABL 1BZ8A 4Y2DB 4YHML 2B77A 4KITB 4IRSA 3B5HA 4BDVB 5DTFA 1I1YA 5TH2A 4LHUD 2A0LC 3QFDA 2DQMA 4FTVB 4XPBL 5DFWH 4P2RB 3VXPB 4H8WL 1SY6L 3SBPA 4UQ2B 1OB0A 4XZUA 2H45A 4NBXB 4OCSL 4BQCA 3ULVC 4WEBH 4X6EB 4YFDB 2Y0SA 2KQMA 3U4BH 5LG6A 2YUVA 4ZMYA 3HC4L 2HLFD 3OHXA 1T0NA 1MSPA 2OJEA 2OLDA 3O3EB 1ES0A 1WAAA 4N2HA 4XO3A 1FDLL 2Z0UA 2VWEC 2WMPB 4A55A 1XGRA 4XN1A 1P84K 5TPWL 2A77L 3OG6B 1L6ZA 4P07A 1NDMA 2FWLB 3SPVA 2X4TB 2XBTA 3I6SA 3VTMA 2X88A 1TQTA 5TQ0L 2C3WA 4ORGB 2DJSA 3HR5A 3MLUH 3MYJB 3V0DA 1F00I 4Y5XA 3QIWB 2Q86B 2YFOA 5CR1A 2F7RA 1A4JA 1MHHB 3KYKL 1KV7A 3ZT6A 4UV7L 4ONOA 3GKWH 1E30A 3VFRA 1GYUA 1UXWA 5I6XB 5F7YC 4FMFA 1D5BB 4ODBD 5IVZA 1G4MA 3WN5C 5MHSE 3MCYA 1AR1B 3BVWA 1SJEB 3CPLB 3KLLA 3B34A 4HEMA 3QB7C 4KJPC 5D2NE 3ZMNA 4F5CE 3CFBA 4DQAA 5IIEB 3UYRH 5JHDD 3QDJE 1LWHA 1BX2B 4LCWE 2WKGA 1OCZB 3BSGA 2WNWA 2O5NA 2JIXB 1U3YA 2CLVA 4UINL 3AU0A 3WNPA 4BH8B 3IPEA 1HYSD 1U8MB 1MFCH 1WG3A 1LO2H 2CO7B 4WUUD 3OC8A 2OZ4L 5DEGA 2ZWNA 1T5KA 3OKDB 5CHNA 1DSYA 3WV0A 1J1OL 1MCPL 2NR6C 4HH9A 1T7YA 1DSFH 1TJHH 4UUJB 5LNEA 3FTGA 2EC9U 1A9VA 2BVOA 4ZFFB 3TH4T 3RHWF 1WWCA 2V5MA 4BH7A 3QULA 3MNVA 1MKFA 3WNOA 1KTBA 1X3DA 1WS8A 4OJEH 2VLRE 3VGEA 1UACH 4XAWH 5HDQH 2MCMA 3F7VA 2EEDA 2WZPA 3QO0A 1NFDB 5AZ2L 1D7DA 2QQLH 3BIBX 4IKKA 2QVMA 5AVTB 3VFNB 3KGSA 4TTDD 1KXVA 2NT0A 3GSXB 5MENB 4IS6B 1D5MB 1M56B 1COBA 1URIA 4R4NC 3S4SB 1LP9F 2EEAA 1JHKL 4A66A 4F7PA 3QI9B 4HD9A 4IRSB 3LN4A 2YMTA 2ZUVA 2ZWYA 4NWTH 5DHYA 4CSZA 1I1YB 4F58L 1DVFA 2C4XA 1KGYE 3QCUH 1CO1A 1A7PH 4Y16D 5F8RC 2XICA 2GTQA 4G7RB 1JZGA 4OGQC 1P4UA 2Z6FA 3ASWA 1RZKL 3D39D 3Q9PA 2VXTH 2WIMA 3BE1H 4N2GA 2V7NA 3LHPL 1WAPA 4XZUB 4Y1AE 3GO1L 2XWTA 3ESVF 4Q0XL 4GRWH 2NNAA 1WBXA 4LBEB 3UYPB 3N9GH 3VWKD 2WWKT 4MQ7B 4NSKA 1KC5H 1CURA 3GK8H 4JGMA 1ES0B 2HVBA 1YA5A 1IM3A 4HJUA 4BUHA 3DSNA 3BD3A 4UTAL 4O2FA 3QHFH 1F4YL 5D2LF 1XX9C 1IAIH 5IEKA 1KUMA 3L6FA 1CFQB 2E8ZA 2CIKA 3V5KA 2VZ1A 1AHWB 2XPZA 4A6YA 2FHFA 4MMXA 4BZYA 3SPVB 5CLYA 1T89C 4RA0C 2P80D 3JYCA 4KK8C 3EJZD 1AI1L 3OF6D 5HD8D 2K7QA 3DBXA 3IJ8A 3ZTJG 4QRQB 2DQIL 4EOWL 3GXDA 1NSNL 5DJAA 1QPKA 3VFRB 4HLJA 1EUUA 4JG1L 2NNRA 1GYWA 1LQSR 4FFYH 4UOQA 1HCFX 1U8JA 2WO3B 3D3VB 2ICEA 3MO1B 1RZPA 3B2XA 4M7KL 5CLZA 2WPGA 5AKTA 1PF3A 3CFBB 5C0CD 3PJSB 1S46A 1YN6A 1IAKA 4KUCD 4M02A 1AHKA 2DEYX 4PRPA 4RFNB 3TEWA 3VDBA 4LAQH 3DX9A 3DGGA 3T65B 4OZIF 3WU1A 1HE7A 3EJRA 1MRCL 3HE6A 2GJ6D 1JHTB 1QSED 4MJIE 5TGBA 5F3BB 3MLRL 2CLVB 4JDEB 4JHBA 2O5XH 5BQ7B 4TOYH 4KKAC 3DROA 3IRZA 4FFVC 3BGMA 4BJLA 5EU6B 2ODHA 3K0YA 4Y19B 2EIZA 3FUFA 4JDVB 4YC2C 4YZFE 2VDOH 3EGDA 3IJ7A 4N6QA 4W4NA 1F6FB 3BOVA 4G8GA 1NCJA 4XWOD 4JFWA 3Q13A 2EJ1A 2ADFL 1J5DA 2GFBB 5HYJA 3V6OA 3FTGB 1WO2A 5IQ9A 5AYQA 2BVOB 1DLFH 1BF2A 4FNRA 3BAEH 1E4XH 1A1MA 5GSVB 1AD9A 3MNVB 1YEJL 4M5TA 4A37A 3TXAA 4BKLB 1NBYB 4PV9A 4Z18A 1ZXQA 3F7VB 3OTTA 3O9WD 4PIBA 3ZPDA 1NAML 3QO0B 3ZBMA 4BQ9A 2AW2A 1R47A 5C6TH 4WWKB 4HPOL 3MA7B 4UOW1 1TTCA 2AMGA 3D25A 1OQOA 1Z6JT 4GUOA 3BFQG 3C6LC 4LMQI 4YLQT 1L9MA 4TUKL 2OTPA 3L7FB 3TP4A 1MVYA 4NX0A 4R5VA 1N4XL 4AE1A 3QJFA 4PYHA 3SGEH 4PRHD 5IHZA 2BY3A 2MOGA 5F93C 1KBKA 3BDBA 5L8KB 2ZD0A 3LN4B 3GHBL 3JV0A 1BGXL 1DVFB 1NKGA 4XI5C 3MJ9H 3PXHA 3ZTJH 3D08A 3S5YA 4MLSA 3Q8CA 1F41A 3OZ9H 5FDWA 2APFA 5E2TH 1MVUB 1P6WA 3I3DA 1S4IA 1A4AA 3MGTA 3Q2VA 3L3HA 1HS6A 4NO0A 4RESB 1WBXB 1MCEA 5DMKA 2JF1A 1CN4A 1IX2A 2XWEA 3VA6A 1RULL 4GBXA 1S2EA 1ROWA 1T21A 4C57C 2A0LD 3MSPA 2NY6B 3QUMA 4TM9A 3QWRA 1TJGL 1IM3B 1JGVH 2DD8L 5AVYB 4L8CB 1BSIA 3DSNB 5EUOF 3ULVD 3N3EA 1E4JA 4LDOB 2X4NB 5KYWA 4MJ2A 3DSFL 3L6FB 1Q9WA 2CIKB 4PLOB 1WD9A 3BSZA 2EUVA 4MMXB 1BJ1H 1MWOA 2UXVA 3K5RA 3HJEA 5FUZL 1I3RA 1ED3A 4TLUA 2XX0A 2N01B 1OCOB 2QKIB 1AQMA 1Z9SB 3GB7A 3J07A 2IMMA 3IJHA 1AY1H 1FAKT 2BFGA 3FO9A 3T0BA 1KYOK 1HQ4B 3WTXA 2E6JA 5DJAB 1AH1A 3LMJL 3K74B 4NZUL 3VGFA 3CQQA 1I4FB 1J9SA 3CVDA 1FO0A 3UTPD 2G5RA 2ICEB 3LS4L 4AMWA 2HRPL 5E6RB 6PAZA 1TXKA 4YVNA 1EFXA 1YN6B 1IAKB 2VXSL 5GPRA 3O6FB 2X3CA 3DX9B 2NW2A 3ZDXB 2JMRA 1NOFA 3HE6B 4B9GA 4ZX6A 3BW9B 4U0QB 4HSQA 5CO1A 5TGBB 1KENL 4HS8L 1OE1A 5ITFA 2WXHA 3FOLA 4KJPD 1X5XA 3DROB 1A3RH 5HHNA 5AWNH 3L3JB 5CINH 5AVWB 1KYUA 2VQUA 3V55A 3BX7C 3NBNA 2NCMA 4NXSA 2GSIA 3T0WA 2D3NA 3THMH 1TETL 3O0RH 3WNJA 3L3KA 4G8GB 3BMVA 1PD1A 3T5WA 1OTTC 1GAFL 4XOBA 3ZKNC 3CHXA 2EEBA 5F70A 5HYJB 1U3HC 4G1EA 4UYQA 4JFHE 5FUOL 5C07E 3WFCL 3QSKB 4AIOA 4MCZA 4MKTA 4OR1A 2BSRA 1AD9B 3TJHC 1HHHB 3L1OH 2X10A 4V1DA 3ZMRA 4YZWA 2LU4A 1OVZA 3M1BB 2NSXA 5T3ZE 1EAQA 3LKNA 2NR6D 3GM0A 3RY6C 3FQNB 4U3XA 1WBZA 3C5SA 4TSAH 1BQLH 2QVFB 3VAEA 5ABAA 1QHPA 4NRYA 4KNTA 3PAVA 2HH0L 4N2MA 5CKGA 4JFXA 5DJYB 2WQXA 4Y4FB 3PP3H 1OAQL 2RQ8A 2Z8VC 3RWJA 1WWWX 4GXVL 5IHZB 2DIAA 2QGBA 1GMIA 3QQ3A 4W68A 1NGXB 3BUQA 1UG9A 4JPKH 1V27A 4YXKL 1A6UH 5JORB 3HZVA 4DESA 1XIWA 2EC9T 4IBYA 1ZLVH 1DJGA 1N12A 4R4ND 1EAOA 2NUTB 2HT4C 3CN3A 2X2IA 2WLIA 3MGTB 3L3HB 5C0AE 2Q8AL 4QTIL 2DQHH 2FLMA 1GMEA 3CD4A 1T21B 5IWLC 2BWIA 4FMVA 4KUZH 3QUMB 4YHKL 2MOQA 2Y4SA 1EJ8A 1WCBB 3GDCA 3EJYC 2NY3C 1BLIA 2UWEE 5KYWB 4Q97A 5E5LA 4L23A 5CN2A 2DM3A 1Q9WB 2EDTA 2OULB 1F3DJ 1GGTA 3KCWA 5IJKA 4JY4A 4ZOEA 4L3EB 1H6EA 4OKVA 4FEIA 1NEZB 1U0QA 4AVJA 4H0GA 4LSRH 3R7QA 4HSAC 1I3RB 1KOAA 3S2AA 5I82A 3EUUA 3K6DA 2VRKA 3OR6B 5F7DB 3MV9D 1ZA3A 5B39G 3IAGC 1QEXA 4B9ZA 1ET8A 1JZ2A 2WLMA 2QSQA 1UM4L 4JKKA 4KTDH 5DD1L 3RWIB 2JKSA 2J3SA 1T1ZA 1CGXA 2X1OA 1NLDH 4KK8D 4G8AC 3U1PA 1S7UB 5C9KA 5HXMA 2XETA 5EF3A 5I75B 5IMOA 2AXFB 2ISDA 1J5HA 4GO9A 5CUSH 4JM4H 2A9CA 3OKLA 4WW2F 2R7EB 1EFXB 4ONGH 4NPKA 1QATA 3QPQC 3TBVA 3UACA 5IW1A 2NNXA 1MHEB 4U1MB 2VOTA 4PJ9B 2O5YL 3WFBH 1U91A 2NW2B 2VXUH 3L1EA 4F8TA 5FC9A 3W82A 1PY0A 4OJDH 2WXPA 1H3UA 5ITFB 4ODUB 3II1A 4LE8A 1AMYA 3AB0C 4YPGA 2N4IA 3FOLB 3S6CA 4RX4D 3QJRB 3FB8A 1O9VA 3WJLA 5KS9E 3PABB 1P53A 3UCQA 2FUQA 5MEQA 4M00A 5D96B 1KBPA 2GSIB 1FN4A 1Z3GL 4ZNCD 5CBAB 5T3ZL 5T1DH 3QIUC 4WTWA 3HOGA 3CFCH 1KDJA 1JZIA 1TYRA 2C34A 3L3KB 4F2EA 5AEAA 4OM0H 2B8OT 4KKAD 2OYKA 4E9TA 4G1EB 5LCVH 4FFVD 4WI3A 5GZNA 1FRGL 3JTTA 4KPHL 1MFBH 5GZOA 3IXAB 3Q06A 5E9DB 3QVAA 3UC0H 1LNUB 3ULUC 2FH8A 4A1RA 3NJLA 4HK0A 1I7RB 3IYLW 2FJUB 2G4EA 3F58L 2WUCH 5JHMA 3P2DA 5C2BL 2R8SH 4EF3A 1M7IA 1F2XK 3LKNB 4RMSA 4KJYA 2AI0H 1F02I 1WBZB 1NLBL 3VNZA 2KS0A 2ZSWA 2OAAA 1TSHA 5K5YA 3VD4A 4NKQB 4X9IA 1JF1B 3RL1A 1G1KA 2WVVA 5DQDH 4JFXB 1BM7A 1Q90A 2FVNA 4QRAA 4MXWL 1DEEA 5LNDA 4WSKA 3RWJB 1JTOA 3Q5TA 2WBKA 1F18A 2UX7A 2WNKA 2GPZA 2BNQE 5EBGA 5IBUB 1I1FA 2BP3A 5FHAL 4JB9H 1F1GA 1ADQH 4DAGH 3FRPA 1ZLDA 5F0MB 4YX2H 4ZG1A 5FOBA 5FDYA 3CLFL 4WI7A 4BZ1L 1K5WA 3W57A 3C6LD 2R69H 4N85A 4OGYL 3MUGA 4MYPA 1XIWB 4Y4KA 3US9A 3L2MA 2VLMD 3K46A 4R9HA 2DJUA 4X4MA 1QLRA 5AL8A 2F8IA 3EAKA 4NKDA 1JGUL 2IPKA 5AB9A 2WLIB 5AB2A 2DAVA 1Z7JA 3I75B 4P8QA 3OKNA 4ELMB 4XI5D 1T80A 5BJTA 1YYMH 2EO1A 2EYRA 3OLIA 4Q74A 3TBTA 3WNKA 3VMPA 4WEBL 4N8CH 4JE0A 5CP7A 2CIIA 2PP9A 5F1SA 3U4BL 3EZJB 2EXSA 2DQCH 1FNHA 5C0BA 5E7FA 4P5KA 1VFOA 4OV6F 2P47B 4P2QE 3T04D 1NC2B 3GZOA 3W0WD 2Q7YB 1P7QD 4XZ4A 1ACCA 3O4OC 1NGZB 3H9SA 2V0AA 3FT3A 1RJYA 1BFSA 2F6AA 2VLKA 3GYRA 3INUH 4LHUG 5DZLA 4EN2A 3IK2A 3AREB 5D1ZA 3SPIA 1WYJA 4JO8A 3VGAB 3E8UL 1A21A 3RTLA 3VYNA 5BW7C 4E9RA 2PCPA 3R8BB 2DWDB 1YNTF 3EGSB 1KXTB 2P42B 1CBVH 1QFPA 4F20A 3BFWA 3S9DB 2CHNA 3GF8A 3ZDWA 4P0DA 5FR3A 2DIJA 5LKNA 4NZDA 5FA3B 1CFTA 3RWDA 3GKWL 3OKLB 1TQCB 2CHXA 3FO2A 4MAZA 3L3GA 4ZSOE 1WZ1L 1RHHA 4HWUA 2XNAA 3FQRB 4B9PA 1A7RL 2EECA 3N40P 2WYTA 4K8RC 4F7CB 3E38A 4DP5X 4WO0A 3UYRL 4YPGB 3BGFC 3VG9B 4J3SA 2AXJA 1T5XA 3FB8B 4JFVA 5F7LB 3X11B 5KVDH 5MEQB 1FN4B 1UQSA 1N6UA 3AXLA 1OAXL 3O0LA 4YZFF 4TSCH 3IMBA 2R0LH 3TU6A 3VX1A 2CDGA 2WXJA 2BVUA 3OJVC 1MFCL 1M7XA 5FHBH 3LQAC 2IGFH 4K55A 4YPJA 1IJ9A 3JTTB 1LO3H 3ZE1E 4A7VA 4RFEB 2B08A 5JIKA 5E08L 2VZTA 3L9RA 4QYOB 5CN1A 4LOVA 1WEJH 3UG3A 1DSFL 3KXFD 1TJHL 1OTTD 3ZKND 2Q87A 3Q3GA 5AFAA 1QNIA 3EH5B 2BK8A 4MAYB 4RWYH 4UBDC 2QJDA 1U3HD 3S88H 5E4EC 2E3VA 5JW3H 3GQFA 4MJ5A 4BM7A 3RL1B 4I0CC 3TJHD 1IILE 1XH0A 4BIKA 2HX7A 4P3DB 2OJ1A 4XAWL 5HDQL 1DEEB 1MEXL 1I7UB 2H1PL 3TN0C 4N9OB 3HRZC 4PBVC 3PWPD 4M5SA 2QQLL 4FX5A 1GSKA 1SEQH 4OFKA 1Q9OA 3EYUL 3APFA 3P11L 3D4GA 3EBGA 1CL7H 1HXMA 1ZTMA 5FOBB 3ZHKA 4B5ZA 5DI8A 3KBEA 3WMSA 1A02N 5T5FA 1ORQA 4LLDB 4Y4KB 3Q1EA 3BQUC 4HUMB 5BMFH 5EBLA 3KR3H 3WEMA 1FNEB 2QPFA 1T66C 5C0RH 4LBAA 3V2AR 2N7BA 1BVOA 3T1FA 2CDEA 4DGYL 3QCUL 1ODAA 1A7PL 2VMEA 2IOOA 3GRWH 1RV6X 5BJTB 3H55A 3H7LA 3IDJB 4G7VH 1IQWH 4MNQD 3US1A 4GW1B 4NCC2 4B7LA 2EYRB 3B9KC 3GSVA 3Q2CA 2A1WL 1CIUA 2NX5D 3MRRA 5DURD 2HT4D 2LTQC 4FNUA 3T8VA 4LSPH 2CIIB 2HG0A 3LIZH 3ABLB 3N9GL 4D8PA 2B5IC 3L3DA 4FNQA 1LQBC 2PYEE 3SDAA 3GK8L 5C0BB 4P5KB 1PKQE 4M6MH 2F5BL 3QFJB 5HVGB 1RZQA 4Q6YA 2ZCHH 3GIVA 2J20A 1FL5B 1BMZA 1NANH 3H9SB 4AYMC 4FLSA 3EJYD 1G94A 2NY3D 5F96H 2VLKB 2APTA 4JO3H 4QHKJ 2GG1A 2WXFA 2EABA 4N8PA 5C2UB 3KH4A 2OMTA 1GS7A 2OYLA 1C16A 3UTTA 1HHGB 2VMDA 5HTSA 1IKNC 2IOIA 3C5ZA 2GSGB 2NY2D 4NDMA 5B3JE 1M7DA 2QLYA 1ZLUK 4RAVA 4JZOA 2XX1A 1U92A 5GGTL 3RWDB 1MFVA 2ZZUT 1PLGH 4X6CA 3UERA 4XMKH 3PV6A 4S2SB 2DV6A 3FO2B 3L3GB 3TV8A 2VW7A 4UT9H 2IGTA 2XNAB 5CEYB 4MQTB 4ZS7L 1OM9A 3KDMA 4HG4J 5C1MB 1J9CT 4OZFG 4Z78A 2P49B 1XAUA 2A6KA 5KSVA 2R1XA 1WSST 3SDXA 2OZNA 1ZOXA 1T5XB 2XTSA 4PVNA 4JFEE 3QPQD 1S3RA 1DJYA 4LGRB 4OJFH 3HUJA 4P23A 1E5YA 1TPXB 3AXLB 5IM7A 2V3DA 4TOYL 3R18A 4EXKA 2YMOA 3O11A 3OKOB 1QLFA 2ROXA 2AJSL 3Q6GH 1IRAY 3ZN6A 2XTJC 1UZ8A 4R90L 5T1KA 3T0EE 3F62A 4XNQA 5E1GA 2Y7QB 5TFSH 3VFSA 2PPDA 2OJZH 2B20A 5IFAH 1EWHA 2ZXEB 3QIUD 1CFNB 2XPGA 3L9RB 4FFYA 4HZAA 4AQZA 4PLJC 3RGVD 1YVLA 3KJ6H 1C5BH 1UWGH 4N0YH 5HGHA 1JDDA 2VUKA 3WTUA 5ECGA 4HALA 1P1ZA 4IOSD 1I1RA 3TYFA 3LKOA 3BAEL 2PXYA 2KUTA 2BINA 3VCLA 2PN5A 4MJ5B 3GSQB 5I1DA 5L9DH 3ULUD 4K3JH 4L4TA 1DJXA 2VMFA 4M6OH 4ZUUA 1HWWA 1HL5A 3P77A 2A3TA 1CGSH 1RHFA 3QXDB 1USQA 5AW9B 1U2CA 4CNIA 3UTZA 4FYSA 5C6TL 3QZBA 4IBZA 2J12B 5CGBA 2NZ9C 5E8EA 1HXMB 1DBMH 3S8GB 3MV8E 2IADB 4QRRA 5HVFB 2FJGA 2H32B 4EUPB 4IGBA 1XH3A 5L7XH 1AE6H 1CLYL 4XCNA 3RBGA 3SJVA 4FXKB 3W1ZA 1ZE3C 4YDLC 5EPMB 4AW7A 2A9DA 2UZIH 2OX5A 4JY5L 5E2TL 3L4UA 1X4ZA 2EH8L 4N0RA 1LK3H 1G7QB 3MRRB 4XAKD 4NN7C 1LHZA 1EXUA 1VFBB 3UDWA 4IHOB 2O6EA 4JFZH 3NH7H 2UWEF 4D8PB 3FFDA 5JA8B 2R4SH 1HHKB 2W8CA 3L3DB 4NC2B 4RIRB 3SDAB 4YQXL 3IU4H 1KCSH 1E6OH 1KCLA 1N6VA 3GIVB 2XWXA 3TF7C 3NJGA 2FX7L 3VXSA 3RX5A 2KHAA 5H94A 3EYFA 3VFTA 3ZT7A 1SMDA 2EP6A 2OMTB 1NCNA 1FAIH 1H3VA 3MZGB 4GI6A 4LCUA 4PJ8C 2C9XA 2QBWA 4U1SB 5KYUB 2WSDA 1PFOA 4QOKA 3GI9H 4NDMB 1M7DB 1GYAA 2XV0A 1AY1L 4P46B 3QG6A 1BD2A 4RAVB 2XHNA 1FNFA 3NACH 4JZOB 5A16A 1U92B 1MDAA 2ZF9A 4HKZA 1RK0B 2NXYC 5ERWB 3U7WH 1L0QA 3T6ZA 3PV6B 1UD3A 1JDAA 5HY9B 2ZOLA 4LVHB 3IN2A 4BFRA 2Y7NA 3CDGA 2XJKA 1JUFA 4Z78B 2A6KB 2W60B 3DETC 4L2YA 5KSVB 5B1JA 1X6LA 3HMXA 3PNRB 4KGLA 2AJZB 5MP6H 3SDXB 3RIAF 4DWHA 5T5NG 5E6ZA 1DO6A 1FV1B 3GS0A 4AGQA 2YJQA 2YUWA 5KS9F 4DKDC 4HCRL 3JSSA 2FATH 3BJLA 3BLKA 3HUJB 4P23B 1K85A 3CSBA 3NTCH 2BPBA 1E9OA 1MY5A 3DPBA 3LY6A 4K8RD 2VE6B 4YSCA 5IM7B 2ITCA 3ML9A 2DYPD 2M2DA 3KPNA 3UXFA 3LPFA 4X8JA 1QLFB 2I7SA 4JUSA 3AM8C 2E75C 5AWNL 4NKOB 4EI6A 1UZ8B 1NIEA 3VGHA 2HFGH 4ZMVA 3VFSB 3O0RL 3ZKMD 4MRBA 5CZKA 3I02B 1YMHA 4G9DB 2D03H 5GS1A 2V37A 1S5HA 2P8MB 4K7PY 4LB8A 3NZUA 2QQQA 3F6LA 4YNYA 5IB2A 1FYTD 4BCYA 1G9HA 4DGIH 3K80A 4LSDA 7TAAA 1P1ZB 1C8QA 4LOFA 5D7JA 5EEZA 3LKOB 5DA4A 2H9GA 4M1GL 2AABH 4L3CA 2ITDB 5BUPA 2XQ0A 3F6IA 3DX4A 1MY7A 1M4KA 4N2NA 2VDRH 3IF1A 4Y9BA 1THCA 3QDGB 4OM1L 4CMMA 3P77B 1TZHB 1I7ZA 4Z3HA 4CNIB 3DVGA 4E68A 2ZKMX 4UBDD 4YHIB 1MCWM 4U1GC 5JOPE 3P9MA 3QA3B 4QRUA 2EVFA 3GMMA 3FBKA 1TF4A 3KPRA 2IWGA 5E6IC 3UO1L 3JVFC 4WY7H 4ZBJA 4MCMA 3NFSH 5CKAA 1MWAH 2J56A 4P2RE 2FJGB 3N6YA 3TN0D 3EG9A 2YSTA 4Q14A 3DRTB 1XSJA 4QJ5B 1T22A 2ZYHA 1XF4A 1VADB 3LD8B 4OSUH 1MJJA 2MHAA 3SJVB 3U48A 1A6UL 1UKTA 1IC4H 2Y7OA 4A67A 4QRTA 1DFBH 1V54B 4PJ7A 1E27A 3N44F 3M17B 2OX5B 1K3IA 4EKXA 3BQUD 4HK3J 3GBLA 3FZUC 4JZNA 3VYOA 4F27A 3FUNA 4LHQB 2WV3A 4Z7QB 3B2UC 1T66D 3GMRB 2ZX9A 3FFDB 1ET7A 4LCIH 5I74C 4KUZL 4LDEB 3SCMC 2HJFA 5K1VA 1ADWA 1LMIA 3HS0C 3PYCA 1ZSDA 2WLZA 3BAWA 4OLWH 5J11C 5I30L 1PG7H 4DHLA 3B9KD 3X13B 4LVOC 5I5MA 3SBQA 3N2JA 5F7BA 2UUDK 1CD9B 1OSPH 3VFTB 3RBSA 1G84A 2OQJB 2AJYL 2A6DB 4GRWF 4Q89A 2I26N 3AS3A 5HI4C 4CKVX 1W6LA 4HGWA 3C8KA 3VFUA 2V9QA 2CUMA 2GITB 3QG6B 4KKNA 1BD2B 4YSAA 5A16B 1HESA 3CLEL 4KTDL 3NCWA 4HKZB 5DC2A 1BYPA 2F5AL 3DDFA 3K91A 5IFHH 2GK2A 3CDGB 4TVPH 1D5RA 3G5XB 1JUFB 5KTEH 3C75A 4GEIA 5CUSL 4EKJA 4JM4L 4ONGL 3ZE0B 1AMXA 1JZEA 3DJTA 1ZT7A 4JL1A 1NBCA 2WLJA 3WFBL 4EQ3A 2VRAA 2VXUL 4PD4K 1OT4A 3AFLA 1JZFA 1ZLWK 4LVNB 3DPBB 1HDMB 4G2AA 1XCWA 4YDIH 4KZDH 3KPNB 3WAKA 1G5AA 1LO5A 5KN5B 3W9DB 2WVTA 3LQZB 2L7QA 2WQRA 3GXFA 1SLXA 5ITBH 5SWZA 4L1TA 2VQ1A 3FB5A 4XT1C 3CFCL 3B43A 1WT5C 4PBDA 3ZE1F 3L8QA 1YQ2A 2D3JA 4NNYB 4OM0L 3MRBA 3ECBA 3QNFA 4YNYB 5CLXA 3FCTA 3BUBA 5LCVL 1MVFA 2J1ZA 1RJZA 5D7JB 3UC0L 5E2VL 1NFDE 5KVDE 4POUB 4L3CB 3QDMB 4D0CA 2WUCL 5ID1A 2R8SL 4IJTA 3IF1B 4BHUA 1ETB1 3M1CA 4PLJD 4XB8A 5MENE 1D5IL 1R5VA 1RLWA 1I7ZB 2YZ8A 2AI0L 2P8LA 1GGYA 2B16A 1AVAA 4NB7A 5I16A 3AXHA 3SKMA 3P9MB 4QRUB 5DQDL 1PLCA 4KKPA 2CLZB 4ZTPH 1BQSA 4GW4A 2ZIDA 4JO4H 5BZWB 4G8FA 4NO5A 2P5WD 4UANA 4M29A 2J88H 4JB9L 1EO5A 3KLSA 1ADQL 3IPFA 4K7PH 4DAGL 4DN3H 1T22B 4RMWA 3ELAT 4PTTA 1G1YA 1HXYA 2NZ9D 3D0LA 3PAUA 4N0FA 2DOCA 2R69L 1YPZA 2CU9A 1H3XA 1HL9A 2X4OA 3AQZA 4FG2A 4PJ7B 2ZXQA 2DQTL 2VDLB 1D6VH 5GISL 2WC7A 4XPTH 4JZNB 4ZAKB 1QI5A 1RURH 1KEMH 1LEKB 1HVXA 2AZAA 1CE1L 1A0QH 1JZHA 3R0MA 1YYML 1W0VA 5KYNA 3CCHA 3KBFA 5LBSL 5GRUL 3QYNA 3MKGA 4NQCD 1OP3K 2E7CA 4QT5A 1F45A 3ARBC 3MRLB 3IGLA 1ZSDB 4N8CL 2R0KL 2WBJA 4XMLH 1JN6B 2M26A 3QZWB 2LQRA 3P54A 4Q9BA 2DQCL 2QFRA 5CM1A 2OMUB 2H2PC 4FQHA 3OPZL 4LLUB 1D9KA 1PIFA 3MXWH 5DRNB 3LZQA 4BSVA 1NMAH 1MIML 5B39A 3C8KB 3VFUB 4CN1A 2CZNA 4DKAA 3D3VE 3A47A 1KPUB 4BZ2H 2GCYA 3FSVA 4PFEA 5B3JF 5PCYA 4PJHF 4HEME 4GS7B 4AKQA 5JTWA 1JTTA 4Q6IC 5C7XH 1T2XA 2D8KA 3R0NA 5L2KA 43C9A 1LWRA 3P3YA 4PJ8D 3UZEA 3L4XA 5E0FA 1JV2A 3O4LD 4G6JL 1Y7VA 3QWOA 2WXNA 5HDLA 3FUHA 4FP8L 1KXHA 4HIIA 2NXYD 2XKNB 1ZT7B 3OKYA 1XDTT 3W56A 5EU6E 1Y0LA 3APCA 5JXAH 4N5UA 3R06B 4Y19E 4TNGA 2FBOJ 2JWYA 3ATFA 4YDVA 3GTTA 4MGXA 1OHZA 5D7LD 2PCFA 2O61A 4Y5YA 3DETD 3E2HC 1LO5B 2IG2L 5KVDL 2OXHA 3DXAE 3VI4A 4RVBA 5I17A 1MZYA 2TSBA 5IQ7H 3VFGH 4M7JH 2ALAA 3F83A 2J1YA 5KVGH 2VQ1B 3FB5B 4RRPG 3V6BR 2FTAA 4TSCL 1FPTL 2IDTA 4HV8A 3PREA 3GSNB 3DV6A 1RZIA 3MRBB 3ECBB 1BLNA 3QIBC 5IHUH 2MKLC 3CZGA 5DJ6A 4X80H 5FHBL 2IGFL 2H5UA 4XC3H 1LO3L 2FSDA 4ZO9A 3AZUA 5IV2B 5FYJE 3ZRCC 1NC4B 5LG1A 1CWVA 2YPLB 5IOPB 3ES6B 4ABWA 1L3NA 4Y9GA 3CC5A 2CMRH 2G9KA 4JFFA 4N24A 2DIBA 2PO6C 5TF1H 2Q6WA 4RWYL 1HKLL 2B2XH 5I15L 5ETUB 2FK9A 2GC4C 4JQIH 5JW3L 3K2KA 3TASA 1A8JH 5I16B 3TZVB 5SV4A 3ZTDC 3SKMB 3UGUA 2CE6A 4A7GF 4FQLH 3WO3B 3B37A 1P7KA 4KRPB 4GW4B 3D48R 4HGMA 5AW0B 1U8CB 2WVSA 1U4FA 3P9WB 4UF7C 4G9FA 1RJLA 4PTTB 3WEOA 5LXVA 2COVD 3JVGC 2P1YA 3NGBB 5IG7A 3D0LB 2QQKH 5DZ9A 4EI5A 1X9LA 2WXMA 1YPZB 2QADC 2ZUQB 4FYQA 5E6ID 3WNIA 4AX3A 4OLXH 4IRJA 4H40A 5BMFL 1OGAD 2ZP8A 1JVOA 5I1GL 1XCQB 1XH2A 1CXIA 1IAOB 2ROYA 5B21A 5IKCA 5C0RL 1VGKB 3GLDA 3V5HB 4E5XG 3GMOA 4ALAH 4PJBA 5ILTH 1QSVA 3GRWL 4YO0A 1YQVH 2FWUA 2JCCA 1E50A 1LGVA 2QGEA 4OLYL 2W0KA 3CCHB 1IQWL 1MUJB 1RXLA 3DGDA 5IP4A 5D1QA 1EHKB 1U41A 1OB1A 3MRPB 4F2MA 2WBJB 2XFGB 3FZUD 3T6WA 4YMPA 1TZIB 1VGEH 1JGDB 4FKHA 1DJIA 3B2UD 1UGNA 1BFTA 1IC1A 4NP4H 4WHTA 4ZXBD 4FQHB 3KE0A 4M6ML 4X0KA 1D9KB 4ZUVA 5GQBA 1AC0A 5E99H 1L7IH 4BSVB 4XBGB 4LHUA 2WXKA 5F96L 3X1FA 2WKOF 3IPBA 2PWEA 5FWQA 2HFEA 4X6BA 2GCYB 4JO3L 2ZPKH 1G7MA 2P5ED 1EJFA 1VPOH 4HU2A 5C0JA 2XYCA 3RIFK 4H44C 2FHBA 5CCKH 5HI4D 2RD0A 1J8SA 1QQDA 3ZDXE 5GS0H 4JHWH 1JV2B 1YN7A 2G0LA 2WAQA 4TNWK 1ZAGA 2KLTA 5LJYH 1U6AL 1MCNA 1L5GB 2W9EH 3RZCB 3QWOB 2Z3FA 2B7DT 3G6AB 3EYOB 5DO2C 3E80A 1G9MC 2YIHA 3LIZA 3UEZA 1QO3B 3HG1D 1Y0LB 4Z3EA 4KZEL 5I0VA 2WD0A 4N87A 3ZRFC 3CIQA 5IR1A 1UCBH 3IDYB 2O61B 4Y5YB 1MCHA 5DRWA 5IB3A 5FYJL 2P8PA 2V3EA 4B3EA 1YCSA 4O02H 5HYJE 3VI4B 5I17B 5MERB 4Y5VC 3WEAA 1V10A 2VAAB 4Y2OA 5EZLA 4NQXA 3EF7A 2VC2H 1LE9A 2H32H 4EUPH 4AYDC 4FLQA 2F74A 1BLNB 2G60H 3RLSA 5C9JB 3A22A 3BYYA 5DJ6B 2BP0A 1JYXA 4LGSB 3U1QA 1CXHA 5HGAA 4X9HA 4MVBC 3RG1C 1WFIA 3BAXA 2OJZL 2WLHA 4OZHA 3APMA 5IFAL 4XPFH 5JHDA 4FXGA 3LKSB 3D8MA 5D7KD 1UWGL 3ARDC 4N0YL 1TJIH 2DWTA 4GRLC 2R83A 4IEFB 5I1LA 1BW8A 2ZG2A 3ZHNA 3QQXA 2VIRB 1TOXA 1FZKA 5L9DL 3JT2A 4XBPA 4K3JL 4E41B 1FVDA 4U6XA 4M6OL 1P7KB 4WUUA 2VDNB 3NYKA 5BXFA 4HWBH 1NDGB 1U8HA 2W65B 4W9FC 1A14H 3KBPA 1U95A 2ADIA 4BA8A 4G9FB 1RJLB 4YHLH 4DETA 5TQ2H 5IG7B 1XL6A 2IQ9H 4KI1A 4KMTH 1E8XA 4EI5B 3EDKA 4IRJB 5B1KA 5I9QB 3ZY7A 3DOIA 5ADPH 5IVXF 5HVHB 2LVEA 5L7XL 1AE6L 2V33A 4Q4EA 2EE0A 2D9CA 1MW0A 4PJBB 3HE7C 3NSYA 1XH1A 3TPUA 2FAUA 4YO0B 4AJYV 5LHDA 3C2SA 4J28A 5JUEH 2EVHA 1GZPA 1P84J 3NA4A 4L3EE 5K1JA 5A7EA 4OCMC 2YC1B 5D1QB 1OB1B 4F2MB 2G4GA 1X5YA 3HB3C 2BWQA 2YN5A 2W88A 5ICXB 1ILUA 1AS7A 1RU9H 2R4SL 3O8XB 4BFIA 3BUIA 4MMYA 3ZTEA 1UWEH 3IU4L 1BVNT 2CDFA 4X0KB 1S8DA 4ZUVB 3VD2A 1E6OL 5TDOA 1IC5L 3ARBD 5KANI 5DEJA 2Y24A 1N64H 1RUPH 2GTWA 3GXUB 4Y16A 5DHVH 3CHSA 1J5IA 1IGCH 1ILSA 3D39A 1A6WH 2XY2A 3HVDA 5K59E 1HQRA 2H2PD 2E56A 2PTUA 4OLUH 2ENYA 3O41A 3W81A 2ZQKA 1MF2H 4JRYD 1TQSA 2J6EA 1TQBB 4RWHA 5FS5A 5I1HL 1QQDB 3GI9L 4FFZA 3VWKA 5KYYB 1RUMH 1ZTXE 2W0FB 3NACL 4WK0B 1CYXA 3I6GA 4DPCX 2HLAB 1RMFH 1XQ4A 3W2DL 5KBLA 4OZFA 4M1DH 2X3AA 3MLYH 3OR7A 3S36H 2EDEA 2P80A 1JK9B 4QHUA 3LRKA 1O7DE 1DE4A 2D2CC 3QGVA 1W72H 3OF6A 3QH3B 2L4OA 3QUHA 4JX0A 1IM9B 3FULA 3NTCL 5E9DE 5J13C 3RNKA 3ETTA 5CD5C 2CO2A 4Y2OB 5I6PA 4GQ9H 4TVPE 4ODSL 1LE9B 4MX7A 2F74B 1QSFB 4RNRA 4AGLA 1UH3A 2VDPH 1TVBA 3DRQB 3GSOB 5HGAB 2XTLA 2CBTA 2HFGL 2G3XA 1TJXA 2HJLA 2JKIS 3PRZA 4KTGA 5C0CA 3MV7D 5JHDB 1T7XA 1JJUA 2D03L 1J0JA 1QRND 3G6JB 5I1EH 2PWDA 3QIBD 2GJ6A 1QSEA 1UB5A 3LPPA 2WXQA 2YAOA 2AABL 2BH0A 2D31A 1FZKB 2R2BA 4IBTA 4K9EL 4YEFA 4TRPL 3HNTL 4L3FA 3P3RA 2I5YL 1NUFA 3QUML 4ZOAA 2VSDA 2VJXA 4U6XB 3W9EA 5CU9A 4E0RB 1XFPA 2PO6D 5JXEC 4EIZC 3DO3A 3AU1B 1T7VA 3IDIA 3HPJA 4WU5A 1NBVL 4NM8H 1RZJC 4XNMA 2ADIB 4ZUTA 1OTUC 3BSZL 2YRBA 3JWDC 2DH3A 2M83A 3AQYA 2ED6A 4ELME 1RUKL 2Z91A 1MWAL 4QUOA 4NBYB 4RGMB 3MLTA 2Z8SA 1ZY9A 1UOKA 1U3JA 5ICYA 2E9WA 3HA0A 1FF5A 4OSUL 4P59H 5EIIG 4JDTH 4QDGA 7FABH 1XR8A 4HBCH 2OMXB 2LHAA 2AQTA 4XXCC 3TPUB 4MA3A 1I8KA 3O9WA 4WJKB 3VD9A 2QADD 5HYSB 2WO2B 4KK6D 1XXFC 5ESQA 3P9LA 2MFNA 4NQVA 3OKMB 5I1IH 1CD1B 1B4RA 3CVHB 3K4ZA 3QW9A 4LCIL 3ARTA 1EZLA 2AF2A 4LLMA 4BFIB 3STBA 4PRHA 1T4KA 4MMYB 4MAUH 4I0PC 4G59C 2CDFB 5IJCC 1ZTXL 2Y72A 1BVNP 2YAPA 5TDOB 4OLWL 2Z64C 4AVIA 1PG7L 1AGFB 5SX5K 2R15A 3WBDA 2HAZA 2GTWB 3OWRA 3U7AA 1OSPL 4YUEH 4O4YL 2WY3B 5EZOH 3ULAB 1G9NC 1HQRB 4JQXA 5ENWA 5GGUA 5I71B 3QUKB 1B9KA 2R0ZH 4BFKA 3BKYH 4GXUN 3VWKB 1RUAL 1G4RA 2DWSA 3DX1A 1WHOA 2IPUK 1M05A 1WFNA 3E1ZA 4JREB 1JHLL 4EZJA 4F93B 3TTYA 2NY4C 1AZVA 3TT1H 3VUAA 3I6GB 5CJQH 1NUNB 3LZRA 2ZOUA 1IBHA 2K9UA 1ASPA 2Q20A 5GSRA 4OZFB 1GZQB 5CEZE 4TVPL 4WHYH 3GDBA 4KO7A 1FSKB 4PRNA 5DSCA 1J12A 2E4FA 3OR7B 4AC2A 3VH8G 4ELKA 1TJMA 3QXTA 5EN2B 2HX9A 4K8RH 4QHUB 5DO2D 4Q2ZA 1DE4B 3PWJA 3VMOA 2Z65C 15C8H 3ETBF 3A4EA 5AKSA 5D1ZI 1IGFL 3RNKB 2ERJC 2E7HA 4YDIL 2J4WH 3FFCD 3PPEA 1H5BC 2Y2TA 5EOTA 4MX7B 3BAKA 1JP5A 3QRGL 4XODA 4HKJB 5L8JB 3PWUA 1TVBB 5ITBL 2AAVA 3FU5A 3DVFA 1V8HA 2HJLB 1BPLB 1QSZA 2PNDA 5LVEA 5C0CB 1IBFA 3BPNC 4IDLA 2FHCA 1A6TA 4YR6B 3KJ4C 1XGYH 4NQDD 2P24A 5A2KH 3FN9A 5E4AA 2QPUA 2N1KA 2ID5A 1QSEB 1UB5B 3SKUD 1UZ6E 5C08B 3WN5A 4MVBD 2R2BB 1TZ8A 2D31B 1IIIA 2XV6B 4H8WC 1RERA 2PW1A 2YQBA 3D34A 4LFHG 32C2A 3C08H 3GSRB 1J0HA 4QTFA 3BPOB 3ARDD 3FU7B 4HIEA 4V2CB 4WZ9A 4E9VA 3HPJB 5D7SH 4GRLD 4WU5B 3VO0A 5I0XA 2K4WA 4GQZA 3O3UN 3QUYB 3EOAB 2XVGA 3F04A 1T5WB 1ZA6A 4ZUTB 3CFQA 4H25A 4ZTPL 4AEEA 2EDOA 3WLBA 4WNQB 3EYVA 4I88A 4JO4L 5FYLE 1XO8A 3MLWL 1NCWH 2Z91B 5J0BA 1VEMA 4UV4H 3MLTB 3WY3A 5FO9A 1XTMA 3MX0A 2CG9X 5ICYB 3SGJC 3AY4C 3KPLA 1VEPA 2Z31C 3ARUA 2NR6A 2VERA 1I8KB 3U46A 4XVUC 2ATKA 5AB0A 5C0BE 1D6VL 5T3XH 5F1IB 1TZAA 3QFJE 2PP8A 4GAYA 4XPTL 4F8PA 5ESQB 4BCZA 1LMKA 2MQ0A 4NQVB 4HJ1A 1RURL 1KEML 1W8NA 4J1UA 3LV3B 4F9PC 2WQWA 4HF5H 1A0QL 4MD0A 5J3HC 5EWIL 2VLKE 3QWQB 1FG2A 1SDDA 1CU4H 2CR6A 3HE7D 2MCAA 4PRHB 3TEUA 3ZKQD 1T4KB 4LSQL 3QORC 4BKSC 2GEQA 1RL1A 3M88A 5DR5L 3UBXG 4XMLL 2XKSA 1KYOJ 4HBQA 3HB3D 3GBNH 4OIAA 4GG6A 4OD3H 5EN3A 1IB5A 2IDQA 3WHE0 3FO1A 5CEZL 3KGUA 2XRAL 5IEHA 3QUXB 5FYKU 1PZ5A 2GB2A 2EE3A 1NMAL 4W9GC 3NCBB 1HEZB 4LK4A 4EIGB 1MI5B 2ENPA 3MJWA 4BZ2L 1EEYB 2B59B 3ZDXF 4PB0H 1P4IH 5C7XL 5J4MA 1J5OH 1EV2E 3IB4A 3CX5K 1S6NA 4P2YA 1EXGA 4U1LA 43CAB 5GSRB 3I6LD 3OAZH 3RURA 3BC9A 3RX8A 1KJ3L 3O45A 1J8RA 3QPXH 1QI4A 4PRNB 5DSCB 4M03A 5DLMH 4ELKB 3CU1A 1TTAA 5JDSB 3CVCA 3G5ZB 4H8VA 4OGXH 5JW5B 2MH4A 2XXCB 1KFGA 3IJYA 4PJDB 1TDQA 2EDBA 3MV9A 4XOAA 4ZPVA 5JXAL 1CMOA 4FLHA 2GUOB 1B6UA 4C83B 3L3OC 1HK6A 2KPWA 4PM1A 2A5UA 3B83A 4ISVA 1T89A 1SYSB 3F6JA 3GKZA 4FADA 5EOTB 1EHNA 1MG3C 4AIEA 2LFGA 4UCFA 3MRMA 3ML8A 4HAGA 4RSVA 3VFGL 4K3GA 1F58L 4M7JL 3B1UA 1FZMB 3VWJD 3DVIA 3U36A 2HP4A 2BIMA 4KY1H 1JYWA 2D7MA 2BNRD 4U1JA 1P6FA 5CD5D 1KYDA 2OMZB 1F8TH 1Q1JL 5IHUL 1A6TB 2P24B 1BQRA 4XC3L 4S1RH 4LDCA 2AJVH 5IVOA 3IVKA 3WN5B 4GKOA 4OF8A 4R4BA 2Y2YA 1UJ3C 1RZKC 2E5EA 4RX4A 1IAII 3CN4A 2PW1B 4YSDA 4ABUA 4WAFA 5C09D 5TF1L 1TITA 2B2XL 5AOMA 4EDWH 3EYSH 1PAZA 3KMDA 4JQIL 1N6QL 1O6VA 2PR4H 1TTFA 1KGWA 4K94L 1ZHBA 4U7KA 1JCVA 2F19L 2N59A 1TTRA 3CZFB 3WLBB 4D2NA 3TA3C 1A8ZA 4UI2A 2P3YA 5JXED 1DHKA 5I19H 1Q94B 2I85A 4NS0A 4WK4B 1DQMH 4ZMPA 1KTLA 1M3IA 3KPLB 1YUKB 4H1LB 1OTUD 5MEPA 1JNNL 5D2NC 4WW2C 5JQ6H 2R2HB 4E2OA 4OLXL 4OI7A 3ZYIA 1JPTL 2JKNA 3CFIC 3DX0A 4GAYB 3PIQB 4J1UB 1KJVA 3NA9H 1UD6A 3HI5H 4MD0B 3SPHA 2ED9A 4FXLA 2UY7A 1YQVL 1SDDB 2BSCA 1VDGA 3RDTC 3FN0H 4PJGA 1KB5H 3RJDA 5FAAA 3BEVB 1VGEL 4Z7NB 1UEYA 1Y07A 3C6LA 1AIFA 4P9HL 2JCWA 5BPPA 4WO4C 2XVBA 4GG6B 5JMRA 1K4CA 3IM1A 4BFNA 3DYPA 4UIKH 2AHIA 1YC8A 3PS6A 3N0AA 2VR7A 5IEHB 4I0PD 1PZ5B 1L7IL 5HP5A 5AG9A 5K59F 3CFDA 3QJXA 3BVDB 1E4XI 4PRBA 4EIBA 5ANMA 2FIRT 2ZPKL 3EGXB 4HJGA 5AVUB 5KEZA 3SDXE 1VPOL 4WUKL 3T6VA 5ADOH 4U1LB 1JGLH 4HIHB 4Y9CA 2PW2A 1BA9A 1OGTA 4TYUA 1CFMA 4PS3A 4HA1A 4B96A 5CCKL 4JHWL 1S7XA 3O45B 4R84A 3P2BA 4CVUA 5KSAB 1G7IA 4F2FA 2ADJB 2BMKA 4MA7H 3CMOH 2HRGA 3W0WA 1P7QA 2NY4D 3MA9L 5C0IA 1CK0H 4DEPB 1ZHLB 3HNVL 3IJYB 4XB7A 2BY2A 1JZ6A 4JUTA 1DBAL 2XXMB 3AADB 1UCBL 5I1JL 2GUYA 3H6AA 4ISVB 2VDNH 1Z9OA 3FAXA 8FABA 5IQMA 2YPVA 3D1MC 2X2JA 4O02L 3MRMB 3FTWA 1N5YH 1R34A 3ZT5A 2PETA 2DQFA 3RWHB 5BZZA 3U30C 3MRHA 3U36B 4G42A 4DKFL 5CP3A 4U1JB 2VC2L 1NUGA 3TOPA 3N1QC 4X4YB 4HMCA 2G60L 1UKQA 2P7TA 3QDGE 2UXTA 2XIBA 3TESA 3A5VA 3GHEH 3QYCA 1E3ZA 1KGCE 3IVKB 1YEGL 3QDAA 4U1IA 5KBDA 4XPFL 1CF1A 1QR4A 1QWHA 3ESNA 5DJXA 1X5IA 1R0AH 2F7QA 2HVJA 1XSKA 2AEQH 3RYMA 3B2PA 4TUOA 1AO7D 2VO8A 1GKOA 4IBUA 3KHOA 5JA9A 2C1PB 1ZHBB 1WF5A 1EZVY 2VTFA 3HG4A 2D7PA 3NDYE 2H26B 2YHGA 1AGCA 5IMKB 2E7LC 1MHCA 3U82B 2AS5M 4XH2A 2HT3C 3HIZA 4X7SH 4ELMF 1J7VR 3QEUA 4YC2B 1JD9A 1NCHA 3QXWA 4EZMA 1P4BH 4PTUB 3CFKA 4Z7QE 1KTLB 2C9AA 3AJ7A 3KXFA 4KQ3H 4O2CA 4X7TB 5TQ2L 1ZV9A 3TTSA 1WCQA 2IQ9L 4P99A 3W38A 4HC1H 2Z7YA 3GBMH 3VRIA 1EJ6A 1U3HA 4JFYA 3WS6C 4P4KC 1E5AA 1NIAA 5ADPL 3V4VB 4TQIA 5E2UL 2WWKO 2D0FA 3DX3A 3HCVA 3KPMB 4OCNC 2HUEA 1MFDL 4OKDA 2ZP9A 1X5ZA 1VENA 3QZOA 2Z31D 3JV6A 5D6DC 1AGBA 3F5WA 3RY6A 1REIA 4XVUD 2XU9A 4XMXA 3GSWB 3UOAB 3RFZC 3WIFA 2X7LB 2K8QA 1TO4A 4CSSA 4JCMA 2JVUA 3OHMB 1O5DT 1T1XB 1L9SA 5IFJB 1KMGA 3NIFB 1K8IA 5AAPA 1AIFB 2HKHH 1M9SA 1NPJA 4ADGA 1RU9L 3RA7H 5J3HD 3QNXB 2CNZA 3AT8A 3LNDA 1UWEL 5D1XB 3I9PA 3PAYA 1W2KT 4TPRL 3W39B 4F33A 5BUGA 3QORD 3OJMB 3LB6C 3B7RL 3CFDB 1XSIA 4RBPH 1N64L 4PRBB 5I18H 5ANMB 4IYKA 1IGCL 4HJGB 5F7KC 4MNQA 1ZVNA 1ZHNA 4UT7H 4YHPA 3KPOA 4PVLA 3CZLA 4ZJ9A 5TDPA 5L2JA 2NX5A 3D7PA 3ZE0E 4XMPL 2PW2B 4D0DA 1MF2L 1BJMA 2EIMB 1MJUH 3HBGA 4KROB 2IBBA 1RUML 4Z7WA 1G7IB 2YGVA 5IWLA 5EUKA 3PHQA 4X4KA 3ARQA 3BHBA 4JFOA 3W0WB 2WIIA 4YHNB 5C0IB 3AQDA 4M1DL 1AZNA 4PR5A 4U3CA 3T2NH 3UTSD 4N22A 4AL8L 3SE8H 1WITA 5AZUA 1SOSA 2B15A 4A2HA 1TO5A 3OMIB 4ZFQA 4S1SL 8FABB 2BFVL 3HAEG 2BLFA 2ZKYA 3CN0A 2DBJA 1CICC 1INDL 4Z95H 2PWHA 3SIKA 3HC0A 2DQFB 4QWWC 1QBLH 5CF3A 5CJXC 2NW3B 5EC1A 3QDME 1Q9KA 1XL4A 4O58H 4XNYH 1KLUA 2ZSVA 4RH4A 2NLJB 4ZW5A 2GBTA 1FI8C 1JPGB 5AOJA 3FFOA 4OIFA 1UZ6F 3NK3A 4PJEA 3QJSB 3QAZC 3DX8B 3QZMA 5LQBH 4OAWB 1UKSA 4YXLL 4I0KA 1A47A 1ZKAA 5DJXB 4MKMA 5KJ4A 2CR3A 4TUOB 1Z9PA 1YJDH 1GOFA 2OTUA 3CVHH 3FW6A 4JHUA 3EDJA 4GSQA 3V0AC 1W72A 3CTTA 4QYAA 1VKXA 3C5JA 4OQTH 2F1EA 1F5WA 1W16A 5CCHE 2XQYG 4U1NA 1AGCB 3H4FA 4PJ7E 2MPAH 3RWCB 5G5DA 3SE9H 4PV1C 5KAQF 2D7OA 3QIUA 4MQSB 4PVMA 3MRJA 3RGVA 1BZDA 3H9ZA 3KXFB 4O2CB 5HVWA 2A99A 3MI6A 2XWCA 3B1TA 3DOSB 2FNBA 3VRIB 1W6WA 4IOSA 1MQKL 1U3HB 2GVYA 3GMNA 3TA3D 5CD3A 4C8XA 1LO4H 2F2HA 3CIAA 4P59L 5CR8A 2HLEB 3P0VL 4JDTL 3UIYA 3MODH 4BHUI 7FABL 3HCVB 3U6RB 2B1HH 4HBCL 4FQPA 4PS4H 5MHSD 1GS6X 1J18A 2NY0C 3L81A 4R6UA 1SJHA 3CZNA 5IQNA 2VZ3A 4AVKA 2MWCA 1BXVA 4BXVA 2P26A 3LRLA 3QDJD 3WIFB 1PZBA 3T3MB 4QO1A 2X4QB 2ZCKH 1WBYB 3JWNC 4YSSA 5I1IL 2EDHA 2J2ZA 3RRQA 1K8IB 4PGCA 3O6KL 3BUTA 2V2XB 3FUIA 3NZHH 3QJOA 4TNEA 4F8NA 5J06A 4ETQA 1IGYA 4URTB 3DO7A 2YA1A 4KKLC 3VYPA 1DN0A 2VM3A 3ATEA 3KAAA 3RDTD 4F33B 5I8KH 2XV2A 2X87A 3BRFA 3UCRA 1QFWH 2Y1YA 5HPOA 3Q9QA 2DWYA 5T3XE 4XOEA 4AMKH 2XWDA 1QR1A 3WTVA 3P0GB 4RMRA 4WO4D 2NT1A 3MU3A 3QPKA 1ZHNB 2X5PA 3QQDB 5DS1A 5T8IA 5TDPB 2LABA 1KG0B 5F1NA 3H3PH 5LB1A 4D0DB 3BKYL 1ULVA 3BZEA 4PS8A 4HIPA 1FGVH 1FFNA 1QEWA 3T4AB 3D18B 5LN8A 5DEFB 1G87A 1QZ1A 1Y1UA 4DKTA 3HI6H 4QHNB 3TT1L 3WMQA 3MCLH 4JFOB 1KBBA 2VLRD 4MCYA 2WIIB 1GHFL 4B9CA 4OW6A 4CVXA 3E3QE 1T1YB 3IGAA 5KUKA 2NY3B 1PNDA 2E8YA 3L5WB 2AQRA 1NOAA 1R3HB 3DVNA 3RU8H 1G7PB 5F7WC 2CO4A 5C70A 5C86A 4OF7A 3ZOAA 5A2JH 1QMUA 1OK0A 1JBJA 2SODB 5J1AA 3H9HA 1DQVA 5FGSA 3NABH 1XGTA 2WSKA 3I9GH 2YPLE 2BIQA 4QRSA 4Q8BA 2R56L 3WFDL 1PTZA 5EC1B 5BV7C 3JWOH 1JRHI 1JWMA 4Y4HC 1RIUH 5BW7A 2ZSVB 3OXSA 3F00A 1I8IA 3S5LB 4NZTH 5F44A 4HUKB 2B9AA 1JK8A 1SQMA 1KJ2B 3IKCB 5GJSH 4QTHA 1JXGA 1B0RA 4Y1AD 1OY3B 2BERA 2FE0A 4JVWA 3FUKA 2Q2EB 1BVLB 4RISL 4D9LH 2LOEA 2VDLL 1J9TA 4DPBX 4WCYH 2VJ8A 1MQ8A 1XGYL 5C3LD 5CWSA 1EMTH 4B60A 3ZXAC 2V9UA 3EZ8A 1BM3H 1F11B 4H88H 4NWUH 2OTUB 4QHLA 4F1SA 3OLEA 4AE0A 3D30A 4FFWC 4PBWD 2R2EA 5HI5C 2DYPA 1YYLH 2A9BA 1XGZA 4GLRH 4A38A 2ALWA 2WYZA 3JV4A 4YGVB 3C08L 3C8HA 1YPZE 4KNUA 4Z23A 4FLOA 1XF3A 3D2UD 5D7SL 5G5DB 5F6IB 4PMEA 3QIUB 2CKBA 3MVSA 1O75A 4GINA 4U7SA 3BWSA 3ZMEA 1FYTA 3V7MA 1GXEA 4ZNEE 1CDCA 2HWZH 1NCWL 3ORJA 5CD3B 1KXQE 2HT3D 4KXZH 5CJ8A 2J44A 5HYQB 2BNUB 1M2VB 4AGPA 4L05A 2EYTA 2ZWLT 1C5DA 3EHBC 5CZRA 1SJHB 1N0LB 5I6MA 1AJ7L 2APBA 2QVIA 3FHEA 3U9PL 5T3XL 4P4KD 2CRMA 1NJ9A 2J71A 2UZYA 2V2WA 3IJEB 2EIBA 2J2ZB 4EZLA 4HF5L 2CLRB 2J8HA 5DJZB 4ETQB 2W07A 3HG0A 1K3ZA 3DKHA 2EDQA 1DN0B 3TN0A 1JTPA 3QJZA 3HRZA 3SO3C 3UJJH 4TULL 1W0WA 4PI0A 3ARGC 5DRZA 4KVPA 4LKXB 3G5YA 3QJTB 3FQTA 1QR1B 3L2LA 2OBGA 5F88B 1PEWA 3BQUA 1CFVH 5EZJA 3NPSB 3I6KA 1U2HA 3SDXF 5D5MB 3D6GA 1YAIA 2AGJH 4OLVH 2WGNB 4U6YA 1KCWA 3LB6D 1SMAA 3GSNL 1G43A 3CLWA 2EDKA 1GW0A 3BZEB 5A2CA 3BPCA 1FFNB 1QEWB 4PB0L 1J5OL 1ZGLP 3LNGA 1OQXA 5IW6A 2VUYA 2G2RB 4A7QA 5FUCE 4MCYB 4XNXH 2DTMH 3B9KA 4CVXB 3P4MB 4NXKA 3ZSSA 1V7NH 3MRFB 4DO4A 3KCPA 3IGAB 4XVTH 5IJVA 3ASNB 1DUYB 3QPXL 3VH8A 4XX5A 4WI0B 4C4UA 2ZNXA 4R26H 1CL7I 1HSAA 5DLML 3EXJA 3V6FA 2CHZA 4CL7A 1EX0A 1JPFB 4Y8DC 1A1NA 1DUZA 4PP1C 3WN6A 5GS2D 2PYFB 3O4OB 5J1AB 3UABA 1XGTB 2IDSA 2YD3A 1SLWA 4ZZFA 4YL4A 1JWMB 2JI2A 2QPDB 4G5ZH 4FQJH 1G6VK 3O2DL 1I8IB 2VR3A 8CGTA 1IKNA 1Y1DA 3DX6A 1JK8B 1MOEA 2OL3H 4H1LH 1CICD 4OJAA 5KSUA 4RFOL 2ZUYA 4QTHB 5FW7A 1B0RB 3RVVC 4KY1L 4QWWD 2ITFA 5I8OH 4R7DA 4E41E 1I1AB 3MRKA 3JBG7 5CWSB 1T1WB 4S1RL 2AJVL 5EEXA 2NZIA 2O6FA 4X4ZA 3S3JA 3RNQA 3WDIA 1NANI 1TTBA 2DYPB 3QDHA 4AVHA 4L29A 1FUNA 3I50H 1MPAH 3OZLA 4G9FE 3MTRA 4GMSL 4HFUH 3JV4B 4ZODA 3QG7L 4U2YA 2BSTA 4W9ZA 4FQXC 1V3JA 4EDWL 5B8CC 3EYSL 2EO9A 5KVEE 1SYVA 2X9XA 2Y5TB 1A1OA 2G5BA 1UWXK 4PJBE 4Z7QF 3MRNA 4OT1H 5I19L 4OV5B 2L0DA 3BZFB 3LTVA 3KYNA 1I9RH 5D1QE 1DQML 4LL1A 2X6CA 2EYTB 3OAYH 1C5DB 1I8LC 4FD0A 4NQED 3X3FH 5JQ6L 2J57A 3ECWA 1NGPH 2BDNL 4ODHL 2Y6TE 2DKUA 1N0XH 3ILPA 2DLHA 2WKLA 3NA9L 3EOTH 3HI5L 1N59A 2OR8A 3BKCH 2W07B 2XZZA 2NY0D 4QLRA 2P5WA 1ASOA 3UBXA 1GOHA 2HUHA 3EXLA 1QX1A 3OXRA 4PEEA 4Z7UB 1BIIA 3UTOA 3WGVB 1XAKA 4WJG3 3G5YB 3FQTB 3ILDA 4LLVB 1M6OA 3UJIH 2NY7H 3GPSA 3HN8A 3P4OB 1TZGH 4UIKL 3REVA 3ISWA 3QE5A 4KKLD 1WZAA 2NRDA 3I6KB 5JPMC 1HEJC 5CSZA 4FKEA 4L9LB 3ZE0F 5C07D 4JFHD 1HU8A 5KUMA 3KL0A 3BT0A 4HOXA 3ASOB 1QW9A 5LNGA 3QEQD 1F90H 4NQCA 2DY2A 5AD0B 1B3IA 5IW6B 2IFGA 4UQDA 4PD4J 5ADOL 1JGLL 3OSVA 5T3ZD 2OV0A 4H0IA 1DQKA 2Y06H 3MNMA 3KCPB 4NRZA 1JD7A 3LRSA 3T2PA 5IJVB 4XX1G 2B5IB 4ZTEA 5EU3A 3MKKA 5E8NA 2DLFL 5BS0B 4MA7L 1AKJD 1AQDA 3KHQA 3VD3A 1S7SA 1QSFE 3WTWA 3ZE2F 3HZ3A 4GYBA 1J5CA 2P4AB 3MLXL 3RILA 4P2AA 1ETA1 3C60B 2H6PA 5JHDE 2VDNL 2MJWA 4P5TC 4KRMB 3QCTH 3VB8A 2YD5A 3G6JE 4PJ8A 3GEFA 4PIRF 1OEZW 2NY5L 3O4LA 1GOGA 5KSUB 1NL0H 3ME0A 2DMKA 4HSCX 4RAUA 3L16A 5E00A 1ECZA 1DBJH 3KDPB 4Y4HD 2XWJB 3FTZA 3V4VH 2AQ2A 2BOBA 4LPWA 1SLUA 4J3VA 1DQJB 1IGIL 4PWGA 4TVUA 3S3BB 2A74C 3CQFA 3PXLA 3GXNA 5D7LA 5DWUH 2VM4A 5JLZA 2N56A 2X70B 3VG0L 2AAAA 3EW3B 3VGDA 3RAJL 4QXGL 1R0AL 5GRJL 4I13B 3KD4A 2AEQL 1YZZA 3RUGB 4FF9A 2IJ0C 3ZKXB 4D0BA 1AZZC 1FNAA 4JFPA 2CJ3A 4PJ7F 3LDBC 4PRIB 2XYBA 3ZZ1A 1SYVB 4TS6A 4FFWD 2O26U 1A1OB 2IANB 3NJJA 5DT1L 5HI5D 1EUTA 2Q5BA 1L6XA 3LQMA 2R1WB 3TLRA 1A25A 4FEMA 5EO9A 3AM8A 1T04A 3MRNB 3GFUA 4X7SL 2XTJB 2VLJB 3VFOB 4OI8A 1UHVA 1QPXA 4UTBL 2ARJB 2R39A 3J7HA 3LZFH 4FQ2L 1URZA 2AQSA 4KQ3L 5C0GB 3CU7A 4AJ0A 2AQ1A 4U2ZA 2CO6A 4HC1L 3GBML 4AGMA 4L1BA 2BO0A 2Z4QB 3FT9A 1FBIH 1MHPH 5I8CB 2KLSA 2XZQL 4GAJH 4MWFB 4I77L 4W9HC 4OIIH 1EGJH 3GMQB 2X09A 4M6NL 1SM3H 2FWSA 1FH5H 1N59B 3EHBD 4M8QB 1KPVB 2P5WB 2P44B 2WP3O 4MMZB 5GS1C 3SODB 1SXNA 1G7LA 2EACA 1NMBH 3PXJA 4M5YH 2BHYA 5FKAA 1BIIB 3UBFA 1QAWA 1JNHA 4ECNA 1KWGA 2HKHL 1QA9A 1R3LA 5E6IA 3RA7L 3ZDYB 4BSJA 1M6OB 4IIQC 5TD4A 2ARJQ 4LEOB 4J3XA 3REVB 2JB6A 1OGAA 2KLRA 2VXQH 3DUUB 2WXGA 2YGNA 2WVUA 4FULA 1YEKH 5E2JA 4UQIM 5CSZB 3ARGD 1M2OA 2AJ3A 3RL2A 5I18L 4M9PA 3WFHA 5D9SA 3NESA 4YDLB 1HEHC 4NQCB 4P05A 2H8PA 1IKOP 3U2SA 3WIHH 1H8OA 4NCDA 3HVNA 5D72L 1RAMA 4RZKA 4YIQA 1MAKA 1IGMH 3L9EA 3IETA 2W9LA 3SY0A 3ZSTA 3H54A 4PGEA 2IAMC 5EU3B 4ZXBA 5E8NB 3P3UA 3SCMA 1KCUH 3HS0A 1S7SB 1RCYA 5A2FA 1PJWA 2RH0A 3T2NL 2BNQD 1L6PA 4K2UL 4ATWA 2XC8A 2P5EA 3ARSA 5C0CE 2H6PB 5EO0A 1T2QH 3HW7A 3AG2B 4R7LA 4PP1D 5AAWC 4ZPTB 4Z95L 1QSEE 5CBEA 5C08E 1OSYA 2RTTA 2ESVB 3U0TA 4J8QA 1IE4A 2XN9B 4O58L 4XNYL 5E00B 1HIMH 4ZYKA 1AP2B 2X12A 3S98A 3QQ4B 2BVEA 1X5KA 3HG1A 3IRCA 2EUWA 3HKFA 5EC2B 3FU0A 3GRBA 3CZSA 5D7LB 4I9WE 5JLZB 4JKLA 1E90A 1I3UA 3D0VA 3DMMB 3RVVD 4U1HB 3M86A 2HCZX 5DVOA 2DZEA 1SY6H 4S10A 1YJDL 1FFPB 3ARFB 2ZG1A 1YPZF 1LM8V 2WTRB 3CVHL 3B3IB 3QNZA