4I3SH

Crystal structure of the outer domain of hiv-1 gp120 in complex with vrc-pg04 space group p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
222
Chain Sequence
QVQLVQSGSGVKKPGASVRVSCWTSEDIFERTELIHWVRQAPGQGLEWIGWVKTVTGAVNFGSPDFRQRVSLTRDRDLFTAHMDIRGLTQGDTATYFCARQKFYTGGQGWYFDLWGRGTLIVVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer domain of HIV-1 gp120 (KER2018 OD4.2.2)
publication title Outer Domain of HIV-1 gp120: Antigenic Optimization, Structural Malleability, and Crystal Structure with Antibody VRC-PG04.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Viral protein/immune system
total genus 39
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i3sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i3sH01
4KRMB 1A64A 4AYFA 1J18A 1JPFA 5JXEA 4U3CA 5CZXD 5GS0H 4QHNB 4R7DB 3QFDB 3BKYH 1F2QA 5DQJA 1Z9SA 35C8H 3UYPA 5C08D 4NQXA 1WC7B 2DICA 1N3NB 2EIDA 5DK0A 5DQ9B 3SDAA 2COQA 5BRZD 5HDOA 4WEUD 1L7TH 3CFKA 3MV7B 1CD1B 4HH8A 3PV6A 5JDJA 4MHHI 4YHOH 4Q9BA 3EIFA 4KRPB 3U2SB 4LHUG 2X4TB 1MFEH 2E7LC 2X1XR 3G08A 4XVUD 3FN3A 4QHLA 3EYVB 3VFMA 5F7MC 4D9LL 5ICZB 2D31A 4MWFA 4PJIB 4RAHA 3FZUD 5FGBA 4YDJB 3R06A 3RAJL 4PREB 2C1OA 5EU4B 3V4VL 1NEZG 1U8PB 1MJ7H 3QA3A 3UZQA 3V0WH 3KPOA 1IFHL 4IJ3C 4WU5B 1CXLA 1CXKA 4U1KA 3SDXB 5IHZB 1JL8A 2FZ3A 4CL7A 3RA7H 5GIRB 3NZ8B 4PG2A 1HINL 3TZVA 3IU4L 5EZJB 2F54B 1F3JB 5JPNB 5HGAB 4BFGA 1UH3A 2EYTB 1X5XA 4I77H 3S5LG 2VERN 4IOIA 4Q74A 3DYOA 1CD9B 3EOAB 1ZWIA 5JXAH 4QRPA 1CVRA 1KTKE 2ITCB 5ESQB 4OCRH 5IW1A 1U42A 3P77A 4D9QE 2OQJB 5J06A 1MAJA 3CK0L 1XGTA 3ZKMD 4LCWA 1IEAA 1CGYA 4HPYL 3UO1L 3MLPA 3NIFF 1XF3A 3L95A 2WW8A 5L7XH 3QNZA 2BY0A 4DOHE 4ZOAA 1MFBL 1RAMA 1KN4H 1NGPH 5EC2B 4MX7B 4F7PB 2WIIB 1FNGA 4QRRA 3AREC 1AD0B 3SPVB 5D7JC 4W70A 1A6WH 3NA4A 3LKPA 1PQZA 1XGRB 2CQVA 1U2CA 1M7XA 2DJ4A 4X80H 3QNYB 3TYFA 5I16B 3VCLA 5HHMB 3V7MA 4OUUA 1JV5B 3DX6B 2HMID 2W9EH 5FYLH 3JWDC 4XZUB 1JF1A 1FNHA 1RZKH 3CIQA 1QSED 2MQCA 3ARDD 1ORSA 3KPSE 5F6HI 3RDTD 1MSPA 1IAII 1PKQB 5F1OB 3MRKA 4MAYB 5K9KB 2PR4H 1UM6L 4MA7H 4P46A 3QI9B 3WJLC 3AAZA 3TN0C 4Z78B 2PF6A 5DD3H 2K3TA 4JM2F 5F8QC 3B9VA 2CLZB 3NABL 4PJ5B 1P9MA 4ZNEE 1KN2L 4M5YL 3N85L 4LMQI 4MGXA 3SKNB 4Y1AA 1QFUL 1PX3A 4XP6L 5DK2A 4BH7A 3BQUB 1KEGL 4F33B 3G6DH 4WUUA 2YD3A 2A77H 4NBXB 1EVUA 1EXUB 4MNGE 4J4PD 4ZXBB 2P47B 4GAJL 2CPCA 2F19H 5F1NB 4F58H 2FX8H 1AIFB 4MQXC 2F9BT 3RVUC 4JFEE 2ICWI 2CMRL 1WBXA 2YUVA 3D18A 3HAEB 4DK6A 4EXPX 1FFOB 3HNSL 3NAAH 1OP5K 3PG2A 4G8GA 3AY4A 3MV11 4LP4A 1G6RB 4NQSB 3RWCB 2AK4D 1I1FB 4M48L 5EOCL 3CUPA 2HVKB 2Z4QA 1S8DB 4ODSL 1BJMA 3VFSA 3QHZL 3UBXG 1XCTA 1VA9A 1Q9WB 5TQ2L 1OW0A 2B5IC 4LKCA 2NXZB 5FA3A 3TVMA 1GC1H 3BIAX 3PHOA 2E7MA 5IMKB 2F53D 2CR6A 2VDQL 2PW2A 4DGVL 1ZA6A 3P11L 3OF6A 3QEGL 1J5OL 3HNTL 5IGXH 3KPPA 1AXSA 1JIBA 4NUJA 1JZ4A 4JRXB 3AXLB 3IAPA 5GRUH 1ZHNB 5EU6B 1KPRA 3MNZB 1QRNE 3HRZB 4MSWA 1NEZA 3HR6A 5C0BA 2D9QB 4X83A 3PHSA 1F00I 4KY1L 1H3PL 3TBYA 3V5KA 2VLJD 4L8CB 1NLBH 2UUDK 4PBXA 4CJ1A 3ULUH 1J8KA 3VFRA 1NUDA 1B0RB 3BP7B 2EIZB 4HMCA 5F1SA 4NQDA 3PP3H 4KUZH 3CDYA 4HF5H 3UC0H 4Y5XC 3DHMA 3U6RA 4OD2B 4URTB 5SWQB 5IW6A 3OB0K 3S5LA 4KZDL 2J12B 1P4IL 3CH1B 4PJXF 4J8RA 3I3BA 1CWVA 5C0RH 1SBSH 3MGAA 3PGDB 4UB0L 3WIHH 2VB5A 1OT1A 1C16A 3CVHH 2HFGH 4C56E 1H5BA 2DRUA 1LK2B 1G9NH 4NO5A 3F62A 5LCVH 5HYQB 3C5SB 3FO2A 1IAMA 3P3YA 4ODBD 5C70A 1WLHA 1T66C 4NN6C 3R8BB 4RFOH 2F74A 3T04D 2X41A 1ES0A 5JOFB 2YEZB 3EOTH 3O9WD 4ZYKB 4F57L 1FAKT 3MRLB 1CBVH 43C9A 3HRPA 4MAYC 2VIRB 3T2NH 2X5PA 4PJHF 5CJOH 1OQXA 1Q9KA 3T0EE 5E99H 5F1IA 2EDTA 3H3PH 4L5FH 3ARBB 4D0DA 1EHAA 4CN4A 2VL5B 25C8L 4X9IA 4P59L 3EBAA 5GSRA 3PWLA 1G6RL 2LU3A 5IB3A 2AKRA 1U93A 5HHOE 5A2FA 3GSNA 4TQEH 4IIQB 3BQUC 5HJ3A 5C07D 4Z7VE 4AIXA 4WI9A 2OL3B 3RI5K 4XNYH 2IJ0C 5HDBF 3K0WA 1MWAB 3MR9A 3DO7B 3LSOA 3MMEB 3MV7E 5C0NC 3QB7C 2VN7A 2EDEA 2H32H 4FFYL 4PR5B 2ZCHH 1O0VA 3D6GA 1F58L 4AM0B 3GMMB 3OJDB 1H3UA 4K3GA 5DFVC 1NBQA 4H20H 2C3HA 3QIUB 1U8HB 1FSKB 1A47A 4QNPE 3HG1A 2OTPA 3WIFB 3WDJA 1O7VA 1S7VA 4NDMB 1OLZA 2IBZX 3ZTNH 4LIQE 1FZJB 1KF9B 4JFZH 4LVEA 3MCKB 3MLZL 4KK5C 2QR0B 3K8KA 2R9HC 3MLUL 1B4JL 4Y16C 1YMME 1HEZB 5E00B 1I1AA 1JMZA 2VO5A 4HH9B 2NXZC 4MS8D 4L8DB 5IJKA 3AROA 3OKMA 3RAJH 1K5NB 2E6JA 1A1MB 6FABL 2MMXA 4HD9A 3E8UH 3V4VH 3LZFL 5E8PA 5IVXA 4P2QD 2AV7A 1IFHH 1CZ8L 4MHHG 4PJCA 4LHUD 4AH2A 5JQ6L 1GGCH 1F3DH 1EJOL 1F6FB 1GSMA 1IGJB 1X5ZA 2A6IA 1HINH 4AT6A 5JW4M 2RB8A 3IU4H 3FOMB 2V5YA 5IB2A 5C2BL 1OSPL 5EWIL 3UBXA 5I1EL 3LN5B 4CU7A 4YZFF 3QJHA 4N0CD 1BX2B 4JB9H 1OD9A 4OT1H 5BZDB 4OZHE 1K4CB 5DT1L 2G2RA 2EEBA 2XY2A 5GISL 5FDYA 1FBIH 3DWTA 2DQJL 5GGSB 3UO1H 2NNAA 4YX2H 1G0XA 1T22B 4H0HB 3KPRB 4NQDD 3OAUL 2UVEA 4BZ2L 3WMSA 3BDYL 4LLDA 4PRNB 3Q1SH 3VGGA 2IAMD 1AC0A 2CDGB 3WE6A 1R3KB 4I0PB 3I6KA 2JJSC 3SE9L 4DKDC 2PCPB 1MHPH 3MV8E 2DQTH 1FLTX 1E28A 2UWEE 1FNSL 5GGRB 4GRWE 1F4XL 3SCMB 2OL3L 1XH3A 1MWAL 3WNOA 1G7JA 3ZYJA 1MI5A 1I85C 5DI8B 2F5AL 1DN0A 4Z0XA 1QLRA 4Y4KB 5EUOB 1UKTA 4OD3L 1EEYA 3SE4A 5J13B 3ARBC 4PJ5E 3V6BR 2FEEL 1HHHB 1S9WB 3WEXB 1S5HB 1Q38A 4GKNB 4N1CA 4QCIB 3K2UH 1UM6H 3W0WE 5IQ9B 3OGOE 2CRZA 1UYWL 3U46A 3ZTJG 2VSCA 4D9QD 2NX5E 4IIQC 4QRSB 5JW4N 2V5MA 4HJJL 5DEGB 3DV6B 1ZHLA 3RZCA 3QJFA 2NZIA 3VFPB 4OFYD 1AGBB 4Z7OE 4Q97A 2VR4A 3FO0L 3N85H 5DZLA 5KN5B 4DK3A 1U58B 5JMRA 4DN3L 4OLYL 3MOBH 5GGTA 4N8PA 1KEGH 5DMKB 4UINL 4KK6C 5IWLC 3SDCC 2YMXH 1NC4B 1AGEB 3EDFA 5JMOC 5KAQG 5HVGB 4IRZL 3ZDXE 4YH6A 3BE1L 2A0LC 3LDBC 1KJMA 3LMJL 4PB9H 4YDVB 4B53A 3H9SD 1Z9MA 3LS5L 4XPGL 1XEDA 2ADGA 3VXSB 4FQQA 2B1AL 5DJAA 3HNSH 4RGMB 2DYPB 1LMKA 3EGSB 4P4KA 4J1UB 2XY1A 1X44A 4M48H 3DIFA 1QSFA 2XN9E 3VFOA 2Y25A 4KU1A 4ODSH 2AAVA 4MD4B 3QHZH 4IOSD 4XCYA 3DROB 3MC0A 2Z93A 3QDJB 5DGQA 4YHLH 1S7RB 3RBSA 3F7YB 1UH2A 2VDQH 3P9WB 4ZFZA 1Z5LB 1FNAA 2YD2A 4I2XE 1UEYA 3P11H 1KTRL 3QCTL 3GSWB 4JHWL 3D0VB 4F7TA 5CIPA 3DRTB 1EHNA 3DMMA 1J5OH 4S0TD 1YEFL 4U1HB 1QVOA 4YHML 4WW1B 3GK8L 3HPLB 4DWHA 2AEQL 1A2YA 1FJ1B 4RQQA 2Z9TA 3TJHC 3VI4F 2VWEE 4LARL 4M5ZL 5FF6A 3QDHA 5I30H 5IFJB 2FNBA 2YSSA 1BWWA 4LLWB 1ND0B 5C1MB 5E9DB 5HPMB 2FHBA 2I9TB 4HDIA 2X70B 4WJ5A 4XGZA 4JREB 5DR5H 4RX4D 2FRGP 3DURB 4JFDE 5ESAA 4I0PC 2R69L 1P4IH 3GJFA 3O3EB 2YXFA 4YGVB 1HHIB 5AUMB 3O2WL 2X10A 2YOCA 4JJ5B 2NY7H 4PJAB 5I0DA 2AABL 5F6HJ 1JWUA 3SCMC 5I66A 3PQYA 2ZOKA 5ERWA 2HAZA 1SJVA 1DLHA 4HJGB 4LSQL 1O5DT 4XB8A 3MV9D 5ETUA 4GXUM 3CC5A 4JVUA 4MLSA 3VWJD 1KJ2A 4LFHD 4QOKA 3NFPB 5AYUH 4K3JL 5J13C 2RFXA 3TA3D 5JR1L 4KKLC 4PJ7A 4MXQC 4F57H 1OY3B 2RJMA 5DWUL 3O3BA 5IBUG 5KJRH 3C5ZD 1N64H 2V5SA 1QHPA 2D0FA 3VDAA 2CK0L 1QRND 2FEDC 4HJ0D 4RMQA 3JTSB 1D5ZA 4XH2A 3CXDL 25C8H 2CXGA 1QP1A 1T0PB 1ZS8A 4P59H 2AXFB 1H0DA 2DM2A 4K94L 3MROB 3QEQE 4ZUWB 3T2QA 5HY9A 1JUFA 2CLVB 2OTWB 3MRRB 2AXGB 5EG6C 4E5XB 1D6VH 1FG2A 1U36A 3D5OF 3KWWB 3LQAC 2EIEA 1K2DB 5H35B 1X5LA 3ZLQC 2X4UB 1AI1L 3AS3A 4EDWL 2X44D 3ULVF 3GMQA 1KEML 4FFYH 1T7ZA 1RIVH 1QQDA 1MQKH 3DECA 1F58H 4YDLB 2XACC 3NTCL 1IKFL 2VXVL 1RURL 4LSSL 1Q9LB 2VZVA 3UX9B 1A6AB 2OZ4L 5EUKB 4L4TE 1CTOA 4GRLD 4RGMC 3VXNA 5DVOA 2NY1D 4NFBA 4XCFL 1OARL 2F8VA 1A14L 4K94C 5D7LE 1Q8MA 1I3GL 4PG9B 1ZHKA 4OZFG 4QXWA 3MLZH 1PLGH 3N9GL 4YR6B 1B4JH 3FOLA 3T2PA 4OV5B 2CDFA 4X5WB 4LCIH 3EO1B 1FGNL 1T5XB 1VFUA 4RIRA 5C6PB 1X6NA 3T0ED 2CDEA 4ZUSA 4RFEA 3WJJC 1KJVB 2DD8L 3LZFH 3QUKB 3V9FA 2VABA 4DUVA 5ANME 3FCTB 3WO3B 3T3PF 3ILPB 1CZ8H 3LPWA 1D5IL 5JQ6H 1EJOH 4WTZG 3RHWF 1OP5H 4PJBA 3R1GL 3UAJD 4KUCF 5KZCB 5C2BH 3QCVH 3V95A 1K4DA 4M1CD 5EWIH 5CEZL 5I1EH 4TNWK 1BOYA 2ICWA 1CFSA 2IANE 1I3RB 1C5BL 4PRHE 2ZUTA 3X13B 3NFNA 1PX4A 2ZP0T 5DT1H 1D5MA 5IVXF 2YWZA 4JREC 3BT2L 3UTSE 3QXAA 2DQJH 3NCCB 1JYWA 4ODWB 4UI2A 1ZGLB 2WBJB 4ZSOB 3MXVH 4Z0BL 5GGSY 3TLRA 2ZUXA 1ZLSL 5DJCA 1G7IA 2X9WA 3ELAT 4U1MB 1ZLVH 3ALWA 1SHMA 5MEPA 4FFZL 1U92B 3KPQB 1RZGA 4FTVA 1H8SA 2IMNA 3QDGE 1YYLL 1YMMD 2GJ6B 2VLRE 3O3AA 2EEDA 3NIDE 3L3JA 3FB6B 1FNSH 2B4CL 4M61A 3PXHA 1RIUH 1IQDB 5I17B 4K55A 2EKSB 5FCUL 3VFNA 1H3WM 1T1WB 1A1NB 4O02H 5HGGS 1EHLL 1MCBA 4MXWL 4ZDHA 3M17B 4FMFA 5FDWA 4BH8B 5IFHL 2X2YA 2XZCL 1HZHL 1WCQA 4LRIA 4V1DA 4OD3H 4G9FA 4CN1A 3GSUA 2I5YL 1G7QA 4GS7B 3GSXB 3DX7B 1KIRB 3ZDYE 4ODVL 1YEIH 4L1DA 2IF7A 1NBYB 2DMCA 1UYWH 1B0WA 2BOBB 4OCLC 4QYOA 1TQBB 1LE5B 4UDTA 1OAQL 2IH3B 3EFDH 5IROC 4HJJH 3B6SB 2J6EL 1KCVL 1CXIA 2RAMA 3RIFK 4EI6A 1OAKL 2J4WH 5A2JH 1FNEB 5TH2A 1S9VB 4QGTA 3FO0H 2X1WL 3ARFD 1T5WA 3MUGA 1RK1B 4DN3H 4OLYH 1FRGL 4JFYB 5J6HB 3OG6B 2BVPB 1R3HA 5TE4H 2J8UA 3VXSE 4UINH 1CT8B 5DJXB 4KDVA 1HSAB 4HCRA 2PO6B 3MACL 1IRAY 3HE7D 5EA0L 3MV8D 5H2BB 3BH8B 4U1GC 3BE1H 5HHQA 5B8CB 4OD1H 3MBEA 4JN1H 5GHWL 1HDMB 4I4WB 3LS5H 3RWHB 4XPGH 3C2SA 4RGNE 5JHDD 2BNRB 3LKRA 1UZ8A 2B1AH 3P73B 4JM2B 4XHJC 3B9EA 1BFTA 3MLXL 3SGKA 4XP4L 5C9JB 4NRYB 3CH8A 5FHBL 4Y89A 2BY3A 1SEQL 2IEPA 4ELKB 5T1LA 4KTEL 3ESVF 4OI7A 2GUOB 5C0AA 1T0NA 2FJGA 2G75B 2QHLA 5GRZA 4HIJA 1F2XK 2YD5A 4M8QB 1KLGA 3VD9A 3BW9B 3S97C 1DVFB 2ILLA 4WEBL 2G5RA 3RIAK 5D70L 5BV7B 32C2A 4H25B 1W72L 4OZ4B 2AQ3A 5DA0B 1P2CA 2NTFB 3PE9A 4KV5E 3QCTH 4JHWH 1CICA 1G0YR 2HT2D 1F4WL 4GAGL 2XNAA 3FRUB 1YEFH 3DXAD 4WO4B 4YHMH 5DJ6B 3GK8H 2C1PB 1R3JA 5GRYA 1RZ8A 3W81A 5K9OA 4WNQB 4HSQA 1KPUA 5I18L 4EVNA 1SJXA 2IWGA 3RNQB 1FPTL 2HN7A 1FAIL 4M5ZH 3HZMA 2CO6B 2R4RH 5EZIH 3KNBA 1KELL 1OGAE 1OWRM 3IFNL 4KZEL 3D85A 2NZ9C 4WFFD 3BPLB 4WTZA 2WBJC 1JCKA 5CEYB 2DI8A 4R90H 4IMKA 4PJAE 1MCEA 2QQKL 2HWZH 3C60A 3F65A 1NKRA 4PBWD 3BGFB 1IKNA 5DURD 5E4IA 5MHSE 4ZFOB 2FH6A 5E8NA 4O5LL 2EE6A 2AJUL 1S9XB 4NHCL 3CVIH 2D7NA 2VLLA 1C7TA 2A73B 4HC1L 5E5MA 4JO4L 2XYCA 1WCBA 3V4UH 2AABH 5FKPA 3OKDA 4MDJB 1IM3A 2XN9D 4OF8A 1UKQA 3L7EA 3IFOB 3NN8B 1DFBL 1FFNB 1YNLL 3DBXB 2OR9L 4NT6B 1XF2A 2BSTB 3KLAB 1CFQB 4FQ1L 4NCDA 1EGJA 1OTTC 1PBYA 4K3JH 3LN4B 5JR1H 1ZLWK 1Z0MA 3AU1B 2ZSWB 4PRPA 5JLZA 3G04A 3CFEB 5DWUH 2ZCLL 3BIBX 4GS7C 3MXWH 4K7FB 4D0BB 5EN2B 2IQAB 4YFLI 4WWID 1E6OL 4G9FD 5AD0B 4LPYA 2WINA 3GMLB 2GITA 3CCHB 3ROOA 1TQBC 4PJXB 3BWUC 3GKZA 3X14B 1HCFX 3D69B 3QQ4B 1I8KB 1AD9A 4W6YB 1U8KB 3Q6FA 5IMOB 5T3ZD 4N0FA 5ISZB 3S37H 2HJLA 4XCEA 4R3SA 1BWMA 1FLRL 1T2QH 1IBGL 2HLAA 4NIKB 1ZVYA 3HR5B 4AEHL 5D1QB 3O6FD 4GBXA 2C3WA 3BIKB 5JHLL 3IXTB 4CJ0A 4AEFA 1I8MB 3CFCH 3FB7B 5BV7L 3MLSL 3TF7C 3G9AB 3HUJA 5L88L 3F5WB 1KEMH 4Y5VA 2GSGB 5LXGL 3FFDA 2OMNA 2R8SL 5IM7A 4LLAA 5SWZA 3NTCH 1OF2A 2VXVH 2D7TL 4PJHB 1RURH 3WD5H 4LSSH 1A1OA 4GAYA 1UG9A 2V2TA 4JM2C 1P4LA 1X7QB 3MRQA 2Z35A 5DTFA 5BMFL 3C6LA 1P5UA 1J86A 4F7MA 1OARH 5GXBB 4ZO7A 5F3BB 4K23L 4OLZL 5DJ0A 1JNHA 3EO0B 4PTTA 1TETL 1KLFA 1A6PA 1I3GH 1U3HA 4I1NB 1A4JB 2FJFB 4U2ZA 2V7HA 1DBBH 4FMKA 3IB4A 1BGXL 4O9HH 4RNRA 1DVFC 4ZUUB 1MFDL 5BV7C 3PDDA 1FVCA 4MDIB 4ZFOL 2C9AA 5FYLE 3IJHB 5DS8B 4U33A 5FCSH 4TUOA 4OZGE 3QWOB 4V2CB 4QRQB 3BEVA 4WO4C 4I3GA 4YNYA 1D5IH 1XIWA 3PWPB 3KDMA 3IETB 4LPTA 3QEQD 1TDQA 3UDWC 1CICD 1KB5A 2P8LB 2XRAH 2V7NA 3R1GH 4DGIL 5I1LA 3VFTA 2VLKB 3LKQB 4ZPVA 2FX7L 5CEZH 1HXYA 4ODTL 2KPNA 3LRGA 4RAVB 1ONQA 2FH8A 4ZSOE 3ZHKA 1C5BH 2XXMB 1NCWL 4FQIH 3BPLC 5D8JH 1ACYH 3RX8A 4X5XB 5CWSA 3BDBA 4G8FB 3O4LE 3JSSA 5CP7B 4U7KA 3BGFC 3ESUF 1MFNA 1Q0YL 2JCCA 4RMWA 5DFTA 3IDMA 4KKCC 5DQJB 4GJTB 5I19L 5IJVA 2DKUA 1QD0A 4S2SA 4Z0BH 3FFCD 4PJBF 2X4QB 3Q3GB 1ZLSH 3CFKB 4I18A 3E6HA 2VDOL 3PV6B 5D7LD 1CE1L 4FFZH 4PBVC 3B43A 1VDGA 1YYLH 2LU7A 3J7HA 1NDMB 3G08B 1IARB 4AEIL 4QHLB 5GGVL 1B4RA 3VFMB 4KH2A 1BHGA 1R5IA 1XGUB 2B4CH 4FG6C 4JFQA 4MWFB 5FYKD 1AY1H 1RIHL 4XNQA 1VKXA 3X11B 1K8DB 2BMKA 3DNKA 2NW2B 3R06B 5FCUH 4NKQB 2GHWB 2C1OB 5F7UA 5D7IF 1OGTA 5KVDL 3SDDB 5F88B 4YDKL 3V5DB 1LWRA 5SV3A 2GT9A 5F7EL 3U36B 5IFHH 2XZCH 3TESA 2BCKB 4K8RD 4GT7A 4EIZC 5HD8C 5T3XD 4M7ZB 3TZVB 2I5YH 3I75B 1BD2A 4XHQA 4Y2DD 2ADFH 2X7LB 2BXYA 1EMTL 5K9QG 2VDLL 3DYMA 4C59B 4PB0L 2B0SH 2BVYA 5D5ME 2P5EB 4QRPB 1HOCB 5K33A 1OAQH 1MCPH 5GJSH 3Q48A 5IW1B 5CD3B 3P77B 3UTSD 2Z31B 5D1QC 3WFBL 4F2MB 2J6EH 1KCVH 3QFJE 5C0GA 5D9SB 1YC7A 1OAKH 4LCWB 5EORL 2GEEA 5CD5D 4DGYL 5JIIA 1E0OB 2AJXL 5JTWA 1FNFA 3B2UC 3L95B 3ULUE 4PRDA 3DVIA 4A6YH 1FRGH 4Y5YA 2X1QA 1PDKA 1UQSA 4JGUA 3G5ZA 1J0ZA 4JFPB 2DQCL 3KLHD 5FYJL 2JELH 3EHBD 4CVZA 3N1FC 3MACH 4LSUL 1NANH 1FNGB 4QRRB 3RL2A 4PS4L 4N8VA 1OAYL 1AP2A 1NGQH 4QHUA 4Y88A 2PXYA 5DHYA 4JGJA 3TBTA 4BKLA 4X6EB 4KMQA 1FNLA 2VKXA 2R0WL 2EYSB 5E1HB 3QIWA 1T4KA 3VCLB 2GTZA 3MLXH 5DHXB 4YFEA 1QBBA 4OUUB 2XZZA 2EH7L 4KROD 3SJVA 3NPSB 1U3HD 1WSST 4KTEH 2Z92B 3W11D 1HHGB 3DARA 4WFHE 4Y4HA 4Z9KB 1BVKA 4WEBH 4X6DF 3RWEA 5D70H 3MRKB 1ZT1A 4MJIE 3CFBB 1W72H 2DI7A 4B7LA 4W6WB 1N59A 5KS9E 4XBPA 3V0AC 2NY5L 1DBKL 5E8OB 1MCLA 3QUYD 4Y4FA 2DM7A 2KUTA 4HUKB 1F4WH 4GAGH 5EC1A 5GS3A 5ID1A 2A6DA 2Y5TA 2EXYC 5D72L 4NQVA 1M71A 5I8CB 1N5YL 5I18H 4O58L 5GSVA 4Y1AB 5DK2B 4BH7B 1FPTH 2Q76A 1FAIH 1TZHB 4YFDB 1WWCA 4WUUB 1AO7A 1E4KA 1KELH 2NQCA 4H1LH 3IFNH 4KZEH 3FRPG 1CDGA 4YLQT 5BVPL 3QQ9C 2HFEB 3RIFF 1GIGL 1VGEH 4AK1A 1PY9A 3HMXH 3C5JB 4RGND 5B39G 2AJUH 3MBXL 2NY5C 2DTMH 4FQHB 2C7UA 2XPGA 4WWKD 5J89A 1MIEL 4G8GB 4HC1H 3U7WH 4JO4H 1EAPA 3N1MC 5KTEH 1RUPL 3VGAB 4NO0D 1IGMH 3L5WA 5FGBC 1KPVA 4FQJL 4NJAH 4G6AD 2AJSH 4JFXA 3CUPB 1DFBH 1MUJA 3T09A 1YNLH 3SDDC 1J8HB 1TPXB 3VFSB 3E6FA 1T3FA 4Z95L 1XCTB 3QIBB 3VH8G 3WFCL 1FH5L 2GCYB 2YPLE 4Z7WA 4FQ1H 4LKCB 3RTQA 5FA3B 3QP3A 5HI3D 2A2QT 1AKJA 4PG2C 3TZVC 1CF8H 4G6JL 3EOBA 2ZCLH 3OKLA 4GKZB 1T89A 4QO1A 1HI6A 5ISZE 2W65A 2FJHA 3OKKA 5ACMA 4JFOA 1AXSB 3V0VA 3GUTA 4NUJB 4Z7NE 4PGCA 2GJZB 1JGEA 1EHXA 1KPRB 5FAAA 2C26A 4M6MH 5HI4D 3HC4L 3K1DA 5DO2D 5C0BB 4F9PA 2I07A 2Z31C 1K3IA 4MB4A 2NW3B 1QA9A 3V5KB 1JZ3A 4Y0GA 1EBAA 4MNQE 4K7PY 1FLRH 1IBGH 2EICA 3GMRA 5MHSD 2DQUL 3WSQL 5IF0B 3SGEH 2DQDL 3PHQA 5JHLH 2L0DA 3O8XA 5GS0D 1DEDA 2BRQA 2W1NA 3HTLX 3U6RB 5SWSD 3MLSH 5KSBA 3T3ME 1CDYA 5AG8A 5E7BA 5L88H 4I5BB 5FECA 1BBDL 3VXME 4OM1H 2EDOA 3BP5A 3CFDA 2R8SH 3PABB 3ZE2F 1HN1A 3UJIH 5B3NA 2D7TH 4BZ1L 4TULH 1V3LA 3S88L 1VACA 1ED3A 1H5BB 5BMFH 4PP1D 2P8MB 4XAWH 1OAXL 5KSAD 5L2KB 1CGUA 1DBJL 2VXQL 4HQQL 4OLZH 3NPSC 3VXPA 4IOFD 4U1SA 1WZMA 4KK9C 5HBBA 1YEEL 4FP8L 3S96B 12E8L 3EJYC 3VG0H 3HUJF 3SJVD 4JCLA 4I8DA 4WHTA 43C9B 2FB4L 2QLVB 3LAFA 2VQ1A 4P46C 3H7BA 3WHXA 3ZO0A 1Q9KB 5DEZA 1Y6NR 2W0LA 1D3CA 5D7KD 2D7QA 4YXLL 5E5UB 5F9WB 4EUPG 4NCC1 3MRBA 1P9MC 1RZFL 3MJ9A 3PWLB 4H26A 4FFWD 1FYTE 1G7PA 1FVDA 4NHUA 5B22A 4DGIH 4Y4FD 3CPLA 3GSNB 5HJ3B 2FX7H 4ODTH 1JN6A 1MH5B 3REWA 5IOPA 1RQ5A 1UFUA 3VD5A 3SKOB 3GBNL 3HZVB 1KXVC 2PTTA 2R2EA 5BCAA 4PJEE 1GVIA 4LL9A 3TBVA 1AR1C 1IM9A 1EFXA 3FQWB 3LOWA 3GM0A 1O7SA 3LIZL 5EBLA 3T0XA 1MY5A 1Q0YH 4ZUTA 5D2LF 4O2EB 1Y18A 4S1RH 5I19H 1MJUL 2GW5A 1JRHL 3KPSA 2BP3A 2HH0L 4TSBL 3AY4C 4F7EB 4LHJB 5EFIA 2ENSA 1FV1A 1H3GA 1CXHA 3RVWD 2YPVL 3FRPA 1S7UB 2VYRE 3DETC 4QRUB 5I76B 2AVGA 4GUPA 1TPXC 4RSVA 3V6ZB 4ENED 5GGVH 5DHVA 5F9JA 3MLTA 3QIBC 2DQEL 4GMSH 5JORA 1OW0C 1RIHH 4XVSH 3B83A 1FORH 5FYLD 5B39A 4TTGA 2ESVE 3MX0A 5I1IL 5F7NC 5E2VL 3UYRL 2FL5B 1UJ3A 5FA4B 5IVXB 3GIVA 3ZL4L 5KVDH 2AV7B 4UUJA 4YDKH 5J3HC 3Q5OA 1YNTA 5F7EH 3MRNB 4XP1L 4YJZL 3MZGB 2JB6B 4JFEA 4KVCH 4L29A 4NRZA 4GQ9L 1BEYH 2A6IB 1SEBA 3PP4L 1OB1B 5I1AB 2AGJL 5C09E 5L6YL 2E7LA 1I8IA 1EMTH 3VH8A 3CDCA 3GMNA 4CMMB 5HGHA 4PB0H 4LLVB 5A16A 1PGRB 3EJZD 4LQFL 4NQCB 3VRLF 4PD4J 3WFBH 1EO8L 1A7NL 4YHNA 4GXVL 2PW1B 2Y1VA 3ZE1F 3PDOA 4P48A 3ULVL 2AJXH 1ZLWH 3IVKA 1MHEA 4OIAA 3ISWA 2APBA 4K9EH 3UJJL 4HXAL 1JZ7A 4LCCA 3CNKA 4ZFFB 3BD5A 1QFPA 5DRXA 5MENB 4LLDB 4E9LA 4PJGE 3V4PL 1WZKA 1T04B 2X9XA 1TVHB 4ODUB 1KIQB 4LSUH 3WE6B 5I1JH 1H5BC 4PS4H 1OAYH 3I6KB 2I60L 2Y7QA 2ARJQ 1MLCA 2VH5H 3GSNL 3RUGF 2DM3A 4ZO8A 2ENYA 4Y19A 3L9RB 3BFOA 1NFDF 4TUJA 1WWWX 1MI5B 3PNWB 3ES6A 3VXRB 1XCQB 1QLRB 3ULVC 3LS4H 4HHAA 4MA1B 1DQQA 4ELME 1KC5L 2MQ3A 3RJDA 4XCNB 1DE4A 5F9WC 1RFDL 3RFZC 1HNFA 5KANI 3NOIA 4XMPL 2O5YL 4PV9B 3P0GB 3LEYL 5D7JA 5CJ8A 4OF7A 1U8LB 1SMAA 4PJFA 4OIBA 1DBKH 4LNRA 1JWSA 3QFJD 4C56A 4K3EH 5FK9B 4XXCA 3DLQR 3ULUD 5E7FA 3UPRA 2ICES 4BK5A 4E41B 4KAQH 1QFWL 1BFOA 3IRPX 4EUPA 2ZG1A 2MSPA 5CGYC 4XMLL 1FL5B 3KPMB 4YC2B 3P0VL 3LHPH 2AEPL 5BVPH 1TJHL 1IM9D 4R2GB 3QUZD 2XT1B 3D2UB 3WJLA 5C0EA 3MGTA 3GJEB 4RBPK 4UQ3A 3TN0A 3T4AA 2SEBB 1FFPA 1XMWA 4GRMA 1YPZE 3MBXH 4FQQB 3L3HB 5IEKB 1INEH 4P2RE 3HAEG 4HUMB 4AL8L 4P5KB 1ZT7B 1J8HE 1LO2H 1HSBB 3MV01 5DJAB 5EOCJ 4YK4B 1MIEH 4XTRC 2YPKA 1I1AC 4MD5B 1RUPH 1MPAH 3HE6A 1KCLA 5JIHA 4AQ1B 4P4KB 2PYEB 4FQJH 4U0RC 4QHNA 4R7DA 3VFOB 3QFDA 5HYFA 1DCLA 3WUWB 1WC7A 4Z95H 1FH5H 1JPSL 4XCYB 3JV6B 2Z93B 1YN6B 3OSKA 5HPOA 3MV7A 1CD1A 5DEFB 1UKSA 3U2SA 2VZUA 4G6JH 2X4TA 4F7TB 1BQLL 3GNML 1NCUA 3SKMB 1JFQL 2P5WB 1QVOB 1G9EA 1OL0A 3KJ6H 2W0FB 5ICZA 2IGFH 5KW9L 3QSKB 1A2YB 2X1PA 5ELIA 1QSZA 4PJIA 4RQQB 4YDJA 2DQHL 4IRJB 4PREA 3D48R 1KACB 5J1SC 5FF6B 1U8PA 4N0UE 3MRGB 2YSSB 2N7AA 4QRTA 4WU5A 4X6FB 5F21B 1W8NA 5I0ZA 1IZJA 5TPWL 4OF6A 4NFDA 3NZ8A 2DQDH 1HKLL 1N8ZB 4MB5A 4XGZB 5EZJA 3BVNB 4PJDE 5JPNA 5HGAA 1DQJA 5ESAB 4YEFA 3FTGA 3MRJB 3GJFB 1BBDH 2XWJB 2DIJA 4KK8C 3PIQB 2R4SL 3A6OA 3C6SB 4XWOC 5CBAA 5ESQA 5H37H 4BZ1H 3H42H 2OQJA 3S88H 3CLFL 5IMMB 1DLHB 4PTUB 3U83A 1OAXH 3QUMA 1DBJH 1PFCA 2YPLD 2KBGA 2VXQH 4HQQH 5DDHB 4DKEL 5ADOL 5I8KH 4L3ED 4JDTL 3A67L 1CLOL 1MHCB 5GGTL 4TPRL 4MA1C 4Z7QE 4OZHA 1YEEH 4QOKB 4FP8H 5CILH 4KI5E 2RFXB 12E8H 1L7IL 4I48B 2E6QA 4MX7A 4P3DB 4F7PA 2LTQB 4YWGL 2APVA 3C8KB 1A22B 3SPVA 2ZNXA 2ZKHH 3MOQA 5T33L 1AGFB 1LEIB 4D8PB 2Z8WC 1I7RA 4XNMB 1NCTA 2D7MA 3ARED 4ALAH 5BVJA 5I16A 2VUYA 1ZS8B 1RZFH 4M7JH 4NKIL 4R0LB 3HI5L 2YWYA 3DX6A 3TO4A 2AP2A 1H3TA 1IEHA 2UWEA 4QTIL 4XZUA 3OG4B 1WEJH 1FG2B 4PJ9B 4Z77A 1TJGH 1DDHB 4NUGH 5LQBL 3O45A 2VC2L 4MAYA 4R2GC 4DQOL 5K9KA 3VXMD 3GMQB 3QI9A 1FVEA 1G7LB 4P3CL 4Z78A 1WFTA 3DOSA 4NZUL 3WXWL 1AH1A 1G0DA 3X12B 4Q9CA 3THML 4PJ5A 1BZ9A 4LDEB 1T03L 4TSBH 4YK4C 4CRPA 4WI7A 4ZFGL 1ZEAH 5DD0L 3W0WA 2CGRL 2IFFL 4L4VE 4P4KC 1I9EA 1VPOL 4OTXL 2NX5A 2YPVH 1VFBB 1KGCE 3GGWB 3HPJB 3MUHL 1EXUA 4ZXBA 4OQTA 1FC1A 1P7QA 4K2UH 4RIRB 1AIFA 2NY6B 2W0KA 3DVNB 2AS5M 3MA7B 4U7SA 5E2VH 3BD3A 5I8EA 2P24B 3UYRH 1IAKB 4NZJA 3ZL4H 1Z3GL 1NFKA 4EN3B 5HYJD 2AQ1A 2VL4A 4HIXL 4MQXD 5F1KC 2XZAL 1S3KL 2JF1A 3RVUD 1XT5A 4XP1H 3BZDA 1BFSA 5I8OL 4NQSA 2VDPH 4JHBA 3RWCA 5JIPA 1I1FA 2MQ0A 5L6YH 3UTTB 2QJDA 3MCLL 4ZMAT 4H8WL 2HVKA 2BDNL 3HI1B 2R0LL 2ICWB 3SQOL 1J05B 3SGJA 1CFSB 4F37K 1MCNA 4MB3A 2BX5A 4EBQH 1WISA 1KJ2L 3NCFB 1IL1B 4LQFH 5DC0A 5MENE 1ZOXA 3FT2B 4OCXL 1I7ZB 1A7NH 1NMAL 4GXVH 1U8IB 1RHHB 1T7WA 2UY7A 5FB8B 3LB6C 3ULVH 2G5BA 3M45A 3ARYA 5D7IB 3UJJH 4JRXA 2HRLA 3I85A 3AXLA 5EU6A 5I73C 1ZANL 1G7IB 2F54D 3MNZA 3HRZA 5ILTL 3W9DB 3VE0B 1X3DA 4UZGA 3V4PH 5MEPB 1IGIL 3AC0A 4RDQG 1N4XL 1LEGB 4KXZH 3ZKQD 4L8CA 4JKPH 3O3AB 4GW5A 4M62L 1BF8A 1QR4A 2M1KA 3K8MA 1B0RA 4M61B 4LNVA 2IQ9L 3BP7A 2EIZA 5SX4H 3QUXD 1OP3K 3GRWA 4JKKA 4G9DA 3VFNB 5D96B 5MP6L 3VRJA 3QXVA 4OD2A 5CUSL 5SWQA 2LTQC 1B6UA 2X4SB 3LY6A 3CH1A 2EDDA 2VLME 1QSVA 1FFRA 4NO2B 1KC5H 3PGDA 1YY9C 4V1DB 2F8XC 2E3VA 3HB3C 2ZJSH 4FQLL 3PV7A 5KSVB 2O5YH 1P6FA 2JJSA 1DUYB 4JG0H 5HYQA 3HC3L 3Q5TA 3C5SA 5C0CB 1A7PH 3B3IB 4E41E 2XQBL 4QYOB 3BHBB 2HYMA 4NO3A 3QEUA 5JOFA 1T21B 3B9DA 4PJ9C 1N0LA 2IADB 4ZYKA 1I85A 1K8IB 1RJZA 3W9EA 1T66D 5IHUL 4CGTA 2Y72A 5E2UL 2IC2A 4G7YL 3MUGB 1QFWH 5KANG 4TRPL 4XMLH 3D3VB 4X7TB 3EYQD 1MLBB 1UM5H 1TJHH 3JWOH 2KL6A 4ACPA 4MJ6A 1OHQA 4XBEL 1RUKH 1NUFA 4PJFF 3QBTB 5IB4A 4MZ3A 4X6DB 3SDYL 1W0WB 3VWKD 5KG9A 3N1GC 1SYSB 4IIQA 2D2OA 2CIKA 2P1YA 1UZ8B 4NM8L 1SYVB 4JPVL 3DO7A 2D4DA 5HHXH 3OL2A 3MMEA 3BQUD 4Z5RB 2NY6C 4PR5A 15C8L 1CLYL 3BKCL 3UTPE 1C5CH 2Q20A 4LLUA 2B2XH 4AM0A 5I2IA 4NNXB 1BVLB 2BNQE 3LN9A 3MJ8A 4KI1A 4EN3C 5K9JL 3QIUA 1JPSH 4WGWB 1U8HA 1MCQA 3WIFA 5J12C 3K3QA 5DFVD 4NDMA 5KVGH 3V52L 1CIDA 4CMHB 1FZJA 3GNMH 1ITBB 1UJTA 4L4TA 5AAMA 5E00A 2O61B 5KW9H 4CU6A 1RZ8B 5K9OB 5BRZB 1A3RL 1F8TL 4L8DA 1KPUB 1IC7L 2JK5B 4Z7VF 2DQHH 4KK5D 5F89B 4ODHL 5D1ZA 4YPGA 1ZT4B 4Y16D 4UAOB 5CEZE 1Q72H 2FR4B 2XZQL 2NXZD 2QSVA 3KLDA 2YD8A 5TPWH 3OZ9L 1DQTA 2XICA 3H2WA 4C4KT 1IGJA 3M1BB 1W8OA 4NKMB 1HKLH 1KCRL 3FOMA 4P2RD 1JMXA 4WFGE 5E6IA 3WIIH 3LN5A 4JRXD 2XTJE 4QNPF 2OS7A 1QFHA 1BX2A 5ABDE 5E5MB 5I15L 1DQLH 5J4MA 5FKPB 5BZDA 1SVZA 3H3KA 1G9MC 3SE8L 1YEHL 1X4ZA 1IM3B 3CLFH 5DMYA 2EZ0D 2X4PB 2ZUWA 5D96C 2V2XB 2FYYA 4FQCH 5DMJB 4PLNC 1MRDL 1T22A 3JVGC 4DKEH 4JDTH 4PRHA 1CLOH 3KPRA 4OGXL 4XAKE 4Z6AT 3LKNB 4PRNA 1R0AH 4HCRL 1L7IH 1HHKB 4RAUB 2CDGA 1R3KA 3G04B 4I0PA 3GEWB 3ILQD 2PCPA 2CSPA 3X3FH 1I1YA 2WINB 3IDYB 1QZ1A 3D0LA 4GG6E 3SCMA 2B39A 1ACZA 4NQED 4HAFA 4JQIL 3QDGA 5DI8A 4NKIH 3HI5H 2DJUA 4N0FB 4Y4KA 3W5MA 2OP4L 4HUNB 5EUOA 3VDBA 1DBML 4OZHF 4QTIH 5HHNA 1MCSA 2WBKA 2HLAB 3JUZA 1P7HL 1LVEA 1WICA 4OLUH 1HHHA 3WEXA 4MZ2A 2VC2H 4LCUB 4QCIA 1QR1A 3UYOD 3O6ML 5IQ9A 3MBEC 3ARBD 4P3CH 2HJKB 3DSNA 5CIPH 4NZUH 2QL1A 5IM7B 4XPTL 4DAGL 3THMH 2OSLB 4QRSA 5D7SL 3EZJB 5DEGA 3DV6A 3PXJA 1CK0L 3BYYA 3MRQB 4P9ML 2Z35B 5DTFB 3VFPA 1QSEB 1TZIA 1AGBA 2DL9A 3TT1H 4ZFGH 5FGSA 3SGKC 5HYIA 5KN5A 3RDTB 2X40A 3MFFB 5DD0H 1JHTA 4TNVF 2UWEF 1U58A 4GRWF 3BO8A 2H9GB 2EE3A 1VPOH 2JIXB 4OTXH 1JNHB 5LAXB 5DMKA 2ZPKL 4XVTL 1LO3H 2V7HB 3QG7L 1NC4A 1AGEA 3VD4A 1OWWA 1QBML 2Y9RT 1YEDB 5C3TA 4PV8B 5TE7L 4YDVA 4KK6D 1WFOA 3SDCD 3PWVA 1REIA 4BSWB 4RBPH 3VXSA 4CMHC 4TUOB 4CVWA 4EDXB 1Z3GH 3GJFH 1QKZH 4YGAB 3MJGX 1IE5A 5D2LB 3KXFE 4HIXH 4JFFD 2WNGA 3BEVB 1KBGL 4Q0XH 4LPUA 5KVFH 1XIWB 4LPXA 2DYPA 2X89D 4GKSA 5I8OH 2V7NB 4N8CL 4J1UA 2DL2A 2A83A 2AJZB 1RZJL 2HLFD 4ZAKD 3D39E 1HXYB 4UAOC 4H8WH 4W81A 2BDNH 2R0LH 4UQ2A 3SQOH 4Z7OF 4RWYL 1IAIM 1KJ2H 3QDJA 1EGJL 4IMKC 5EH1A 5CWSB 3F7YA 4WY7L 3C60C 4OCXH 1KXTB 3PGFL 1LDSA 3FZUC 3GSWA 3D0VA 5ALBL 2AK4B 4CADB 2XWTB 1KNOA 5I6XB 3IDMB 3WXVH 1CI5A 3VFWB 4PRIE 3ZDXF 4WW1A 4U1LA 2OZ4A 3HS0B 4N1HB 1E27B 4L4VD 3E6HB 5EBMA 3TPKA 4AIOA 2LV4A 1SJHB 5E95B 1KGCD 4LKXB 5J9PB 1HXMB 4XC1L 1GGTA 5IFJA 1NLDL 4HWBH 5D2NB 1T1XB 3D9AL 4M62H 2W9DL 4LLWA 3TJHD 3KS0H 1B2WL 2H3NB 4JFQB 4ODXB 1M6OB 1BF2A 3LPFA 5E9DA 1VKXB 1YYML 4OZIB 3L5XH 1H8NA 3DURA 4LAQL 5MP6H 2IH1A 5CUSH 5ESVB 3ZTJH 5IG7B 2FATH 5C0CE 3B9AA 1HHIA 3LD8C 5CEXA 1NAMH 1PZUB 3BAEL 4JJ5A 4PJAA 5ADPL 5ENWB 4A2MA 3T4YB 3GO1H 1ZSDB 4FQLH 3WNMA 1BD2B 2YBRB 3UTOA 3GBML 3VRIB 3OX8A 4FS0A 4LVOB 1IAIH 3NFPA 3RUGB 1AFVL 5CBEA 3UP1A 4POUB 5C0GB 2BRRL 3VJ6B 1NFDB 5IHUH 2VE6B 3IFLH 3KGRA 4KJQD 5E2UH 4G7YH 3MREA 2CJUH 3BKJL 2HMIC 3QDME 2BFVL 2J1KA 4MXQD 1OTUD 3JTSA 1RU9L 3RWFB 3RL1B 4CVZB 5DD1L 2DKMA 1DR9A 2AXFA 3O9WB 4N8VB 4XBEH 3C6LC 1KB5L 1A6UL 1AP2B 4J3UA 4AMKL 2FEDD 3GHBL 3MROA 3WNNA 2CLVA 3IXAB 2OTWA 4WHCA 3MRRA 2AXGA 3TBTB 3CXHJ 4S1SH 2B8OT 4Y8DC 4EOWH 2FHFA 3KWWA 4X99B 2EDWA 2EC8A 3KYOA 1K2DA 3U0PB 2X4UA 4OLWL 1T4KB 3TNNB 5CGMA 4UNUA 4MCYB 2AI0L 5E03A 4ZS6C 4JO3H 1BQSA 15C8H 5DJ2B 1RVFH 4HLJA 2B7DT 2UYLB 2AEWA 1PG7L 5CJXA 1Q9LA 5C07B 4CAGA 4DVRL 4JHAL 5K9JH 1A6AA 5EUKA 3WFHA 1WAAE 1BVKB 5C08E 1C8PA 4P5TD 1XIWC 5BRZE 4XBPB 4NQTA 3STLB 3IU3B 3RVTD 4PLOB 4W68A 1SJEB 5EC1B 3BMVA 2DYPD 4OV5A 5BS0E 3WNLA 3EO1A 4XCCH 4F8TA 3DI2B 1AGDA 1NGYA 1M71B 1A3RH 4C83B 1F8TH 1IC7H 2IPUK 1NJ9B 2UZIL 4NGHH 4HWUA 4DJMA 2VXSL 3N1PC 1JP5A 1KJVA 3QUKA 4X7DC 4NBZB 1G1CA 1AO7B 2XZQH 3FCTA 3ME0A 1R5VA 3ILPA 2F58L 4JR9H 1VB9A 4JDVA 1D6EA 1F6AA 4WW2F 3JV5A 5IV2B 3F6LA 4AENA 4I18C 5IK3B 1KCRH 5IVZA 2Q7YB 3NCJH 3ZKNC 5T1KD 1A9BB 3QWRD 5D2NC 1BIHA 1I3RA 3QRGL 3X13A 3OJ2C 3I6LD 3UTPD 2DF3A 3SE8H 1YEHH 4LQ1A 4U3XA 1J1XL 1KPVB 1JRHI 4L9LA 3OXSA 4NC0B 4TYUA 3M07A 3MUJA 4OSUL 3LKSB 1MRDH 2BVEA 5FO9A 4ODWA 3BZFB 1T3FB 4ZSOA 3O3DB 3G5VB 1FO0B 3O4LA 1AKJB 4HCRH 3OAYK 3KPQA 3EOBB 4LRNH 4MMZC 1P7KA 3BH9A 4BQCA 4MA3B 3PL6A 3RGVA 2GJ6A 3OKKB 1V05A 4JFOB 1UCBL 4OLXL 3V0VB 5CZVL 4LVOC 1MFCH 2EO9A 5ACZA 4PGBB 3MRCB 2EKSA 3NVQA 2I07B 5CEZD 2BVQB 3OKEB 2FLRT 1A1NA 4KJWC 1OP3H 5HDLA 1I75A 2OP4H 3M17A 1TVBA 2PTUA 1F4AA 1DBMH 5FUCE 4RDQF 4GSDL 2OK0L 4Y5YC 3NH7L 3INUL 2H1PH 2KZWA 4WFGD 1UXWB 3WUZA 2JJVA 1TTUA 4JLRB 1NBYA 2CUHA 4OZFH 3CFJA 1DUZB 5B4MD 4XPTH 5BJTB 2IH3A 1BQUA 4L3CA 2OJZL 1BIIB 3B6SA 1VACB 1CK0H 1LILA 4P9MH 4XP9H 3QIWC 3NIDF 1FNEA 3L3DB 1S9VA 4U6TA 5B3JE 4Q7DA 3RU8L 3N06B 1RK1A 5AZEL 4WV1B 3G6JE 2K9UA 2BVPA 4Q58C 2OLDA 2ZPKH 3DGCR 1CQKA 4XVTH 1CT8A 3GBLA 5DJXA 3VMOA 3QG7H 1HSAA 5HVHC 4XC3L 2PO6A 4HS3B 3BH8A 4TSCH 1QBMH 1BFVH 5B8CA 1H9VA 3LCYA 3LQZB 5F3HB 3H6JA 2VQ1B 5TE7H 5MEOB 1HDMA 3WHXB 4WDIB 3H8NA 4I4WA 4QXUH 5EO1B 3OKNB 4J6RH 3RWHA 4DOHB 3GSQB 5EIIA 2BNRA 3QHFL 4JM2A 4TVSa 3ZDYF 1N6QL 3MRBB 1KBGH 1J0IA 2BSSB 2I25N 4L8SA 3MLRH 5C9JA 4HUVA 4NRYA 4JEGB 4EI5D 3F6IA 5FYKH 4NHUB 4N8CH 5C0JB 4ELKA 3NMEA 5KOMC 1RZJH 3EYOB 4XHJD 3QAZB 2G75A 1MCKA 4HKJB 4M8QA 1E4KC 3IDUA 3BW9A 4RWYH 3U9UA 2PTTB 1OOAA 1J0HA 4LP5A 2X4NA 1EGJH 4I0CC 3TBVB 1SM3L 1EFXB 4OZ4A 2OCFD 4HIIB 3RWDB 4XPAL 4M43L 2NMSA 1MHHA 2F53E 4OM0L 1NGXB 4Z8FL 5ALBH 3RWGA 1Y18B 1YN7A 3BN3B 3TYGH 2MPAH 5DJ6A 3FRUA 4WO4A 1DQDL 2R56H 2IFGA 3KPSB 2C1PA 3UDWA 5JW3H 4MJIA 2HRPH 5KZCD 4WNQA 8FABB 2A6KA 4KKBC 5ITBH 2BOCA 4OZIE 3WL9B 5I1CH 1KJ3L 4XC1H 1G1YA 1IC4L 1NLDH 2OJEB 4U6YB 3QDAA 3QNXA 4M4RA 1XR9B 2AJ3B 4G7VL 4GUPB 3FB5B 1INQB 2VLJE 5CEYA 1B2WH 4JRYD 3RTQC 4N0CC 1VFAA 5GGUB 3VDCA 1YYMH 1JI2A 5B39B 2VDKH 5M7QA 1GCFA 4LAQH 3FMGL 5J11C 2NZ9D 4PIRF 3KXFD 1S9XA 2WBJD 1T89C 4MNGB 4UIKL 1YNTB 2R2BB 5DRNA 3R8QA 4KV5F 5ADPH 3RVXC 4JFEB 1XGYL 4MDJA 4L29B 4I3RL 2H32A 1SEBB 2JE8A 3UEZA 5I1DB 1I8IB 3GKWL 1FFNA 1NCDH 3GBMH 1MCJA 3GMNB 2BSTA 4G6KL 4LLQB 5GZNC 1LO4L 4F3FB 4QKXB 4X0KA 1AFVH 4NP4L 1CD0A 2ZSWA 3STZB 2BRRH 3CFEA 4PD4K 4PRID 4R6UA 4K7FA 3P40A 2IQAA 3A0OA 3VD3A 4PJAF 1OTTD 5AD0A 1EDQA 3BKJH 4Z7UB 3CCHA 1GGBL 1MCWW 1QBAA 3VWJB 4PJXA 5DRXB 1K6QL 3X14A 3D69A 3QQ4A 1I8KA 1EEZB 5DD1H 3P0YL 1UM4H 1U8KA 4YXKL 3TA3B 1KB5H 5ISZA 4AMKH 3L5JA 4WI5A 2Q3AA 1FG9C 3LEXB 3C5ZB 3OR6B 4WV1C 3WKML 1QRNB 5GRVK 5D1QA 4XVJL 1N0XH 4NPYB 3BIKA 4S10A 3IXTA 5K59E 3LH2H 1I8MA 3ZHLA 3FB7A 2AJVH 1D5XB 3ES6B 2AI0H 4JCMA 4MNQA 3H9ZA 3TCLB 3F5WA 2WUBL 1VENA 2EXWC 2GSGA 1MRCH 4HHAB 2W9LA 3MZTA 3X3GL 1DJSA 1PG7H 4PJHA 5DA4A 4HFWA 3ZMRA 2DMBA 4JHAH 3JV0A 5DMIL 1VEMA 1BZ7A 4AEEA 2RR3A 5LGHL 5EO9B 1KUMA 1X9QA 3FONA 3F58L 4OCWL 5F3BA 4OGAC 4YAQB 4FXGA 4JM2D 2FD6H 2BHYA 1LNUA 2FIRT 2IPKB 4RISL 1A4JA 2FJFA 4JO2L 1D9KA 3C09B 4C56B 4G6ML 1P1ZA 1J0KA 3VGHA 4ZUUA 2PN5A 3UPRB 5JA8B 2NY1B 4MDIA 2A38A 2UZIH 2YKLL 1BFOB 2VXSH 3IJHA 5DS8A 4BQ6A 4EUPB 2LQRA 4JN2A 1BOGB 1AQDA 2MCPH 1DVFD 1X5IA 3EO9L 3QWOA 5IT2L 4HKZB 4QRQA 4P2QE 4S1QH 1HIML 1CN4A 2BVOB 2F58H 3HKFA 3MLWL 3PWPA 3IETA 1HQRB 2P8LA 5BW7A 2E9JA 2O5XH 5FO7B 1FFPB 3T0EB 2VLKA 3LKQA 4GRMB 4X7FC 5DMGC 2X05A 3W2DH 2A74A 4PJ8A 1WFNA 4OB5H 4ZOCA 3HE6B 1FYTA 4G8FA 5CP7A 5HHOB 1J1XH 1J1OL 4Y7MA 3VG9C 3DI3B 1AE6H 4Z7VB 1UJ3C 5DC4B 5DLMH 2WUCH 2XKUA 2KQMA 4PJEA 4ZQKA 2X4QA 3Q3GA 4POYA 3BISA 2D7OA 3CGTA 3MRHB 4NQDE 1GYAA 2QHRL 3MYJB 3VGDA 2A9ML 4KKCD 4OZGF 3Q0HA 5L9DL 1BP3B 3UZEA 3HI6H 5BS0D 3L7FA 4JM4L 4KTDL 1NDMA 2H2SC 4RCAA 3BOVA 1CXEA 1UCBH 2HTLD 3WN5B 1XGUA 5CZVH 2XQYG 1U6AL 3VXUD 3X11A 1K8DA 2NW2A 5F9OL 1S5IL 2Z91A 4PGEA 4CNIA 4N0YH 3SDDA 4FG6D 2WLYA 5F88A 3V5DA 1IGTB 4QRTB 3ARGA 1YMMB 3U36A 2BY2A 2BCKA 4GSDH 2OK0H 1F4HA 5TF1H 4LCCC 2X9YA 3VWJC 2X09A 2ESVA 2YD6A 3INUH 3ZE0E 4WFED 3TJEL 3I75A 5FOBA 1VESA 2X7LA 1FL6A 1DQJB 2ERJB 3TA3C 1YNKL 3FTGB 1YEJH 3NA9L 5HYSB 5TGBA 1J0JA 3QEHB 3MODL 2DWDB 2P5EA 4M7KL 1HOCA 4WU7A 5CBAB 1FDLH 5CD3A 1FZKA 4LPWA 3P4NA 2Z31A 4F2MA 2R0ZL 1U3ZA 5D9SA 5C09A 4BSJA 3T1FB 3R0NA 3QUMB 3JWDL 5EPMA 3ZYZA 3RU8H 3S35L 1UB5B 5D1QD 5GPRA 2Q8BL 4OZHB 3ZYIA 4JFPA 5FHAL 2EDQA 3B2UD 4XC3H 1NMCC 1A7RL 1OAUL 5JDSA 4WI2A 4FZ8H 3S3JA 3ARFB 1HYRC 4RMTA 1I7RB 4TTDD 1CU4H 4X6EA 3H9SE 4LBEB 5F6IB 1U9KA 3KYKL 1N6QH 2EYSA 5BVJB 4MVBC 2P7TB 1QHOA 1E4XL 2CK2A 3GMOB 5GRVL 1TTGA 3NIGE 3HG1E 2DI9A 3S4SB 1AJ7L 4XXCC 1CLZH 5D5MF 1A7OL 1F42A 2IG2L 3MV8B 3TO4B 2Z92A 1HHGA 2UWEB 1KOAA 4D3CH 4GRWB 4P2OA 4PY8J 5JHDB 1CFVL 2YD7A 4Z77B 4HZLB 1VGKA 4U7MA 2KDGA 4HIEB 4U1NB 3O45B 4X7SL 3TNMB 1JBJA 3CFBA 3CMGA 1FVEB 1SM3H 2HA1A 5ICYB 3K46A 4XPAH 4M43H 1OTSD 4OM0H 5E8OA 1A4KB 2BHZA 3T0EC 4F80A 4J3VA 5FYJD 4M7LT 1BZ9B 1MVUB 1DQDH 3PWPD 4PJCE 3TH3T 1RJCA 5D71L 2XA8L 1S78C 4O2FA 4U1IB 5I8CA 3W0WB 3HE6C 1NFIB 4G43B 4LIQL 2DDQL 1TZHA 4D2NA 5GJTL 2NX5B 2EXYD 3UAJC 2D0HA 3I50L 1IC4H 4BFBD 3ARXA 4X8XA 4G7VH 1S7QB 4X9BA 2EH8L 3DXAB 1P7QB 2HFEA 2O5ZH 4ONGH 5JXED 1JVKA 4WI8A 1ZV5A 5FGCE 4C4KO 2D03H 3C5JA 4KRPC 3FMGH 5I8EB 4E0RA 3SDAD 4HS6A 4FQHA 2XXCB 1JGDB 3L3KB 1F4YH 2NY3B 1TXKA 3GI9L 5KS9F 3LVEA 4ZD3L 4I3RH 4JZOB 4M9PA 2V17L 1YQ2A 2A9NH 5FUOL 5DURB 5DD5L 3QUML 3GKWH 4KKAD 1J8HA 3O2VL 3G9VA 3MV9E 3QIBA 2GCYA 4P23A 4KVNL 3V5HB 4Z7UE 2BVUA 3BPNB 3IDXH 5TE6L 4XNXL 3JV4A 4NP4H 4HK0A 2XN9B 4GKZA 2ERJC 1EAJA 1C5DA 3OAYH 2G5BB 4QY8B 3S7GA 3OHXA 1NL0L 3BWAB 3K2MC 1ZLVK 2GJZA 1GGBH 3TZVD 2BSRA 2IPTH 4HBQA 1LO0H 4X4ZA 1K6QH 4I2XB 2NCMA 3HHRB 4JY4A 4UBDC 3MJ9H 1U8OB 3CX5J 2VDNL 4HBCL 2NW3A 5JNYA 2E6PA 4LSVL 1YJDL 4QRPD 2E27H 4GW5B 3VMNA 3WKMH 4HGWB 2UY6A 1AGCA 5IF0A 1I7TB 1S7TA 1KIPA 4LCWD 4XVJH 4CDGC 4G9DB 3VRJB 4LDLB 4N0UA 2WUBH 4I5BA 3GIZL 3I02B 2OBGA 4P57B 5CJBA 1U8QB 3PABA 4V2BA 1QUNA 1TCMA 1R24A 1C1EH 3CMOH 1W0YT 4QRRD 3F12A 3QO1A 3WFDL 5DMIH 3O6FB 1HCVA 4AJ0A 5L8KB 4JFDB 1P69B 2P8MA 4A2LA 5E2TL 4Z7NF 5L2KA 5LGHH 1LP9E 4MMXC 4DN4L 3F58H 3TO4C 1YJDC 2WWMC 2AV1B 3RNKA 4R97B 3P30H 3U0TB 4DUWA 4JO2H 4NO3B 4UILL 1C12A 3QEUB 3S96A 5DHVH 4G6MH 4OQTL 1BBJB 1RJZB 2CUIA 2CRMA 3W9EB 1Y0LB 1CTNA 4JO1H 3QI9C 2YKLH 5FYJU 5E2WL 1QSFE 5E4EB 3F7RA 3EJYD 4NOFA 5TDOB 3RP1A 2R29L 2ORBL 5IT2H 4EXKA 3T3MF 4NWTL 5HVFB 4UV4L 3WYRA 1HIMH 4P46D 1WFUA 3MLWH 4MJ6B 3D87B 3DV4B 4ZO6A 5IB4B 1CGXA 3GI8L 5KG9B 3EZ8A 3PJSB 2CIKB 1MH5A 2D4FA 3SKOA 2NY0D 2OX5A 1BM3L 3HZVA 2HT2C 1OAZH 3MRFB 4ZXBC 3EDJA 4Y1AD 3RJQB 2VZOA 5E24E 3FQWA 3QEQB 4WUUD 5FKAA 1J1OH 2YS4A 4O2EA 3OAZK 4LLUB 5I2IB 3JWNC 3QQ3B 2VAAB 3MJ8B 1AR1D 4PYHA 5GZOC 3WUWG 1UWXK 4M3JA 4BUGA 2NY3C 3HN3A 3S34L 4F7EA 2QHRH 2A9MH 2HFFA 3L3GB 2VDRL 4WW2B 5L9DH 1LEKB 4JM4H 1S7UA 2LVCA 4G8GD 4HFUL 2MKLC 4QRUA 5I76A 2LABA 5C0DB 4O4YL 3V6ZA 4L4TB 4YBHA 3MRDA 3SGJC 5IR1A 4D9LH 5F8RC 4CW1A 1KB9J 1YEKL 3GRWL 3BPNC 4KDTA 3STBA 1ZAGA 3DETD 4YIQA 5D1ZB 4YPGB 5D7LB 2R23A 2FL5A 3HMWL 5FA4A 4IS6B 2QBWA 4PJEF 3TVMD 3W39A 3MRNA 3MUY1 2JB6A 1BQHB 3OF6D 1OB1A 4PJ7E 3TJEH 5I1AA 5J3HD 5IFAL 5E6IB 5ANMB 2HJFB 1L9NA 1WIPA 3NA9H 1NGWB 4YBQD 3V8OA 4CMMA 5L8JB 4LLVA 1T2XA 4N5UA 4M7KH 4MD0B 4OF3A 1A7BA 5C0BD 4FXKA 4NQCA 3CK0H 2R0ZH 2VWEC 3DO3A 1QACA 2PW1A 4F8QA 2C3VB 2FYYB 4HPYH 3MRIB 1MOEA 3JWDH 2IANB 3BP6B 2OR7A 4EUPH 3S35H 4PRHB 3ARQA 1JTPA 2CKBB 4U4BA 3KVQA 1ZVSB 4ZFFA 1NEUA 5C9KA 4OI8A 5MENA 1MFBH 2WSKA 2PTVA 1M7DA 1Q9OA 5FHAH 3FQRB 1T04A 2MOVA 3B9KA 1TVHA 4ODUA 1KIQA 1A7RH 1OAUH 2P49B 3O6FC 4QWWC 3UTSB 3VI3E 3AGVA 4JPKL 1D5BA 5FOJA 2MKWA 1I1YB 4R97C 3D0LB 5BO1L 4WTWA 3L9RA 2ICCA 4WUKL 5JHDE 1U8MB 5L2KD 3VGBA 3PNWA 3QDGB 3VXRA 1UWEL 1XCQA 5FO8B 3B2VL 5DRZB 2VLRB 1A7OH 3S9DB 1RUAL 5DJ8B 3UZVB 3OKYA 5HHNB 4X98B 4IRSA 5E4EC 2VQUA 4XCNA 1UADC 5J8OA 5KVEL 3ULVD 4PV9A 1P53A 4X7SH 2AK1L 3JXAA 1QR1B 3ALPA 4BYHA 5MEQB 1U8LA 3LRSB 2M2DA 1XF5B 4I3SL 1KXQE 4YO0B 3P9LB 4LMQE 3NABH 2DLIA 3DXAE 5FK9A 1KN2H 4M5YH 4BFIA 5D71H 1TZIB 2XA8H 4KJYA 4JKLA 1JHTB 4E41A 4NM4L 1WGOA 1QFUH 3NZHL 2DDQH 3BO8B 1MEXL 4XP6H 3V6OE 5HDQL 5GJTH 1FL5A 3I50H 3KPMA 3QUYB 4GAJH 3VXOB 4DFIA 3QIUC 3D2UA 4WFFE 5IMLB 1FSKC 5C8JB 1JE6A 3GJEA 4ELMF 5CGYD 2CMRH 2JJWA 5EULV 2SEBA 4P5MB 5BZWA 3PWVB 4WW2C 1XR8B 1NH6A 2ADJB 2DQGL 3L3HA 4DCQB 4JPWL 5IEKA 1HHJB 5ICXA 1P6AB 4P5KA 1ZT7A 1HSBA 4OKDA 3HG1D 4HMEA 4LEOB 4MD5A 4K8RL 4ZD3H 4GKSB 3GFUA 4CBPA 4KUCD 4NYLB 4HLZG 5FUOH 2A83B 2PYEA 2ZCKL 4FTVE 4I9WE 4R4FL 5D1ZC 5DD5H 5EOCH 3VXTB 2H41A 1Z6JT 4RGNB 2DLTA 4XTRD 1I1AD 1LD9A 4UQ2B 3WUWA 3O2VH 2D3VA 2APFA 5ACLA 4WWKB 5TQ2H 3JV6A 4CU8A 1YN6A 5E8DL 4ZS7L 3EYUL 5TE6H 4XNXH 5DEFA 4DGVH 3LEVL 4NO0B 1I9JL 1DSFL 4N9GB 1KNOB 3QEGH 3SKMA 2Y23A 2BNQA 5E6IC 3HNTH 4QXTB 4H0GA 2P5WA 5FM8A 3U7AA 3WBDA 3G5XB 4U1LB 2W0FA 1QLEL 4G9FE 1YPZF 5H8DA 5EBMB 1H3VA 3KS0J 4K8RC 4IRJA 1J11A 4APQB 4KY1H 1H3PH 2OMBA 3U79A 3RKDC 4PP2B 4O2CA 3MRGA 3VXQB 5T3ZE 2E9IA 2C5DC 4X6FA 4H1LG 4DZ8A 1E6JL 3FT3A 4M1GL 1ZGLP 1I7UB 1CL7I 1J7VR 3KAAA 1A8JH 4LF3B 4H88L 3VFVB 4YQXL 1S9KC 2NY4D 3DUHA 1N8ZA 3BVNA 1NGZB 3DX9B 2DLFL 2IH1B 1T7VA 1HH9A 1KENL 1VSCA 2DJSA 4KZDH 1OGAB 3MRJA 3GSRA 4Y8AA 1URLA 3GIZH 1NAKL 5CD5C 2XWJA 2BNUB 5CEXB 1RMFL 1KG0A 3PIQA 3C6SA 1DANU 2J8UE 4UB0H 3AM8A 3DHJA 3MJ7B 1MQ8A 2YN5A 4O00A 5IMMA 5CCKL 4G3YL 2W59A 4PTUA 3KLHC 4N9OB 4KHTL 2R1YB 4XWOD 1JZ6A 1Z2KA 5DDHA 3FAXA 4Y4KC 4DN4H 3OX8B 4HUUB 1MHCA 2WP3T 3KG5A 3IJYB 3ZSTA 4YUEL 3LQAL 3EDKA 4GMTL 4X4YA 4UILH 1N5AB 1MI5D 3VXRD 5CBEB 1NC2B 4I48A 3HZYB 4JRWA 4P3DA 4JKMA 3C8KA 2N7BA 3CZJA 1XGPA 1II4E 3U4EB 5IW3A 3V6FB 3QXTA 1AGFA 3HAEH 1PW3A 5E2WH 1LEIA 3MREB 4D8PA 4Q9QL 4XNMA 4JANB 2R29H 2ORBH 4PJDF 4YHKL 4S1DD 4UV4H 1FE8L 4HK3N 2VSDA 3QH3A 2ICWJ 2B1HL 2GY7B 4QT5B 4R0LA 4YHPB 3QT2A 1G6RH 3E3QE 5HI5C 3V8CA 1E4WL 3P4MB 3VU2A 5ITFB 4G80A 1DL7L 2ATPB 3TIDA 3RZCD 4PJ9A 5E1AB 3KYOB 2RIKA 3CXHK 3QUYC 2EDKA 4IHOA 2LFGA 2Y5EA 1DDHA 3ZSSA 4FOMA 2ARWA 5TF0A 3TBWB 3KHOA 4Z7QF 1G7LA 5EU3B 4BM7A 4KI5F 3TC9A 1HWGB 3X12A 4FQXA 1PSKL 1EO7A 1KYOK 2UV3A 3WFHB 1IGFL 1FN4A 2J8OA 1N26A 3MSPA 5JOPD 1IVLA 3FFCE 3S34H 1ROWA 5EIVA 4HZAA 2CR3A 3ZYOA 4A6YA 2Q1EA 4UNTA 1VFBA 1OD7A 4ETQA 3AS2A 3GGWA 3HPJA 4RGNC 5CSZB 4K3DL 3MLUH 4AIZB 3S3SA 1PAMA 4P4KD 4L4JA 1AGDB 1NGYB 4X6CE 5E08L 4JQVA 4G5ZL 3UROR 3DVNA 1QSFD 4LGPB 4N68A 5FYKE 1QO3A 4GLRI 2H45A 3MA7A 1V3MA 6FABH 2P24A 4QHMA 2D9CA 1IAKA 5CFHA 4EN3A 3VFGL 2W07A 3OJVC 4G6AC 3CSYA 1R5VB 1PG7X 3ROLA 3EOYG 1JF5A 1JI1A 3CU7A 4QXGL 2A6JA 4JDVB 1D6EB 1F6AB 4AENB 1CDIA 3DMMD 5IVZB 4PRPE 3NCYP 1OSPH 3KPTA 5T3XE 1UGNA 2UZXB 3UTTA 5HI3C 4APQC 3BKYL 35C8L 4OZGB 3HI1A 1J05A 2DQIL 4L9DA 1V3KA 2GFBA 5H94A 3ARWA 1IL1A 1EUUA 3TGXA 1FYHB 4XX1G 3FT2A 1I7ZA 1MFEL 4MYWB 5GISH 1U8IA 1RHHA 4L9LB 4PRAA 3OXSB 3D39A 5D1XA 4N5ED 3TBSB 5FB8A 1HQ4B 1T7XA 5FO9B 3NACL 2WM0A 1MREL 5D7IA 3RI5F 2W60A 5MI0B 2Q86A 1HKFA 3BUYB 3OAUH 4LLYB 5FIEA 4BZ2H 3BDYH 4ORGB 3O4LB 3W9DA 3VE0A 3LB6D 4WI4A 1TITA 1ZMYA 4MA8L 1LEGA 1P7KB 3BH9B 1IILE 5GS0C 1UXSA 4H1LA 4FQ2L 5E5RB 3SE9H 1UB6A 3PL6B 3RGVB 1F6LL 2DWEA 1XF4B 3PQYD 5K9QI 3MTRA 5BO1H 3H9HA 1F4XH 2B20A 2MWCA 2OL3H 3HMXA 3ZZ1A 5ACZB 5F7KC 1MWAH 4WUKH 5JW5A 5EU7E 3MQIA 4PGDA 1FZOA 1UWEH 2F5AH 3B2VH 1YEGL 2J3SA 3JVGA 2X4SA 4PP1C 4NSKA 3UTZB 1TVBB 5JXAL 2QKIA 3MRPB 4QOKD 4NO2A 3BZ4A 4OCRL 5CINL 4N90D 4J3WA 5KSVA 5KVEH 4IOFC 3VD7A 4X4XB 3MRMB 3U9PL 2W92A 2GK2A 2YA0A 1DUYA 2AK1H 4HWNA 3ZDZE 5C0CA 1YY9D 3B3IA 1WTLA 5JQHC 1AR2A 3NGBB 2MNUA 3BHBA 5I9QB 3CFJB 4L3CB 1T21A 2IADA 5DC9B 3CSPA 1K8IA 2BC4A 1A6WL 4U6HB 4EQ2A 1IJ9A 1MEXH 5D5MB 1RPQA 4PJ9D 4YDLC 3D3VA 4X7TA 4X80L 5GRJL 1MLBA 5CJXC 3CAFA 3QFJB 4J3XA 1YC8A 4K3HA 3WFEL 4IRZH 4P3WA 1X6LA 1JTOA 3LMJH 4X6DA 1JPGA 2P43B 1W0WA 2JCCE 3FHQA 3QDMA 1X4YA 2YXMA 1SYSA 4JQXC 4JPWH 1RZKL 5EIIB 3QG6A 4IDJL 5I1GL 1SYVA 4P0DA 3CSGA 2NPLX 4L8SB 2VN4A 4P4RA 4HUVB 4Z5RA 1EH9A 3QUZB 2APWA 3DUUA 1R3LB 3BZEA 2ITDB 4R4FH 2QSQA 1ZKAA 4NNXA 1BVLA 2KZ1B 2FO1A 3CVHB 3U9UB 3OAZH 5E8DH 2X4NB 2R15A 3ARZA 1UWXH 4EN3D 3ECBA 1I9JH 1MHHB 2Y06L 1DSFH 3G6DL 2ADIB 2A77L 4IBLT 3RWGB 1YN7B 3ARTA 3T8XB 3VA6A 1RZKC 1WAAA 4F58L 5C08A 1CFTB 2O61A 1QLEH 2WK2A 2AEQH 4MJIB 5BRZA 2XG5A 2A6KB 2GK0A 2JK5A 5C6TL 2BOCB 3U48A 1IAOB 4OAWB 2OR8A 5F89A 4LARH 4ESKA 5KS9B 3FT4A 1ZT4A 2IMMA 4L9LC 4R4NC 5J56B 2FR4A 3FQXA 3NAAL 3RKPA 1K9TA 3QNXB 1E6JH 4L8BB 5DJYB 4UDUB 4H88H 2GSIA 1VFAB 4YQXH 1KV3A 1CG9B 4XXDB 3IGAB 3M1BA 2E9BA 4NKMA 3PGCA 4UOJA 1IC5L 3MLYL 2Y6SD 1KENH 2R69H 2ZG2A 2ED7A 3PL6C 5SWSE 3RGVC 1NAKH 1MF2L 3O2WH 5CHNB 5DRNB 2H32B 4FTVD 4I9WD 3QXDB 3CLEL 4G3YH 3QCUL 2X4PA 4LSQH 2V2XA 4IJ3B 4B41A 5GS2H 2PKDA 1B90A 4YUEH 3LQAH 4EEEA 4GMTH 4X0KB 3LKNA 1HHKA 3BESR 3MUZ1 1OCWL 1I9IL 4RAUA 2P8PB 3OR7B 4OV6F 4NN5B 3SJVE 1NLBL 1PY4A 3LKOA 4V1DD 1JK8A 4ZTPL 2EDHA 2YPLB 2CK0H 3I2CL 2WV3A 4Q9QH 3NGBC 2CO7B 3BPCB 4TOYL 1AC6A 4KUZL 4YHKH 3UC0L 5D7KE 3WLBB 3CXDH 4P2YA 4X6BB 3WHE0 2B1HH 4G42A 4K94H 4N8VG 1YUHA 1SBSL 1E4WH 3ET9F 2C4FT 3FKUS 1DL7H 2JKXA 2YK1L 1WWAX 2FDBP 5E8EB 3ZKSD 3FQUB 5LBSL 4ORZC 1AI1H 4EDWH 2PO6C 5LCVL 4LCUA 4R96A 4MNQB 5B8CC 3JTTB 5INDA 3DVGB 2HJKA 3WS3A 3CD4A 1CGTA 5JZ7C 1PSKH 1IKFH 1LQSR 2OSLA 4HFWB 1TNNA 3EOTL 3ARPA 2L4OA 2OZ4H 5H37G 3B8YA 4JPIB 3O4OB 3MBED 1BZ7B 1QSEA 3ARDA 1CBVL 4YHIA 4XCFH 4L8SC 3RDTA 3MFFA 3B5GA 2L7UA 2DLHA 3FONB 1JWMA 3QUZC 5F93C 3VXMB 1A14H 4GG6F 2H9GA 5E99L 1TVDA 2JIXA 4FXGB 3X17A 1EK3A 4UT6L 5LAXA 3ARSA 3HFML 1Q0XL 1LNUB 3L1OL 2GAZB 4GO6B 4K3DH 1D9KB 3N9GH 4CKVX 2VUOA 3K4DA 1INDL 1P1ZB 2Z8SA 1FGNH 2CD0A 3KJ4B 5T1LD 5J6GB 1PEZA 4G5ZH 4FN0A 1J0YA 1OP9A 1YEDA 3L5HA 4PV8A 1F02I 5C0AD 1LE9B 1RUML 2VXUL 5F7DA 2DD8H 4BSWA 1CDCA 1S7WB 1E4XI 4JN2B 4EDXA 1AQDB 3C08L 3EYSL 5MERB 2YRLA 5D2LA 5GGQL 4FABL 1EA9C 5A40E 2OM5A 4WCYL 2J88L 3QO0B 3KPLB 4Z7WE 4QXGH 4J4PA 3NCYS 2ZCHL 2V9RA 2XOTA 2L7JA 1EVTC 2AJZA 1UACL 5INCA 1IMHC 4TVPL 1KSRA 4F15B 2DQIH 2O26U 2VITB 4H20L 2A74B 5HYJB 4PJ8B 3H3BC 3O6KL 1FYTB 4U05A 2WBWB 3ZTNL 3BT2H 4UTAL 3D85D 4JFZL 2AK4A 4CADA 2XWTA 2FWOB 3VFWA 3NACH 1MREH 2GTWB 3SHSA 4NZDA 3C60D 3HS0A 1GGIL 4PJEB 4ZQKB 2Q6WA 1E27A 4PY7A 3RWIA 1D7FA 1SJHA 2EDJA 2F53A 3E8UL 4K7PL 4LKXA 3FQNB 3NCEB 4MA8H 3RPIA 5KSBE 5J9PA 1HXMA 4FFVC 4FQ2H 5C2UB 3L7FB 1PKOA 4POZD 5D2NA 1T1XA 1NSNL 2B5IB 4RA3A 2IBBA 1GGCL 2H3NA 4ODXA 2MJWA 1M6OA 4ZUVA 4OBRA 4LOUC 4OZIA 3I9GL 5IQ7L 4DVBB 2Z91B 1QBLL 4PGEB 4CNIB 5BXFA 2FO4A 4UOW0 3K4AA 5ESVA 5IG7A 1S7SB 1EHLH 1YEGH 4MXWH 4NN5C 2CIIB 3ARGB 4JB9L 2VLJA 5EOQL 3BP4B 3GSOB 3REVA 1HZHH 1NUNB 1T1YA 4OT1L 5CINH 5ENWA 1P84J 3QXUA 2YRPA 4PRPD 1ZGLM 4M6NL 3T4YA 1XFPA 2ESVB 3GZKA 1ZSDA 1FBIL 3QUXB 2YBRA 5FOBB 3U9PH 1BJ1H 4YX2L 1FL6B 4JFHE 4WEMB 4ODVH 5F7YC 2ED8A 3VRIA 5TGBB 5F7LB 1IT9L 5GRXG 4WU7B 4IEFB 1FZKB 3Q1SL 3RUGA 4Y5XB 3P4NB 4L1HA 5I75B 5C09B 3VJ6A 4PRBB 1NFDA 1MHPL 2VE6A 2DQTL 3QPXL 4TNWF 5EPMB 3DRQB 5A1AA 1F11B 4GBXD 4NFCA 1U3YA 5DFWH 4X8JB 5IBTL 5GRJH 3RWFA 3RL1A 1DLFL 2NLJA 5JPMB 3WFEH 5EA0H 5JDSB 3O9WA 3O4OC 2VR9A 2D0GA 5SWZD 5GHWH 4NN6B 4XMKL 1YZZA 3IXAA 1Q1JL 5LKNA 1X5GA 1IZKA 4HX1B 5EOTB 1EZVY 4X99A 2EIBA 3C6LD 4PJGB 3U0PA 4Y2OA 1D9KC 1A6ZB 2XKNB 4IDJH 5I1GH 4WHYH 3TNNA 1P4BL 1GPOL 3K2UL 4MCYA 4B0MM 4XP4H 4DKFL 3IFPA 3KJ4C 5FHBH 2JIXD 1SEQH 3MPCA 3OGCB 1G84A 5I1HL 5DJ2A 2UYLA 2YC1B 3S35X 3VWKB 4MJ5A 5C07A 4P2OB 3PWJB 4ZS6D 1WVZA 4HIHA 1V5JA 1VGKB 4NNYB 4HEME 3KPNB 5BW7C 3OJMB 2J5LB 3MOBL 2Y06H 2XQYK 4XPBL 3STLA 4ELMB 3ARRA 3IU3A 1SJEA 3SQBA 1IQWL 2YMXL 4F15C 5CP3H 1XIWD 4PLKC 4X9FA 1KTLA 1TCRA 4PJ8C 5ECJE 4O2FB 4C83A 1CR9L 4PB9L 2PYFA 5C6TH 1NJ9A 3QXWA 1VERA 1IEBB 4CVXA 2QADB 5EZLB 4HUXB 4BUHA 2DB8A 2H8PB 2VXTL 3RQ3A 4X4ME 2QQKH 5IV2A 5DK3A 3BGMB 5IK3A 1UA6L 2Q7YA 4BQBA 1IC5H 4E0RB 3P2TA 4O5LH 3SO5A 3MLYH 1QEWB 1CXFA 1WAAF 4UT9L 4Y16B 4HS6B 4NHCH 5AAWA 4P2QA 1A9BA 3ZT5A 1MF2H 3IS1X 4YHLL 5AWNL 3K80A 4LHUA 3ZKND 2YUZA 3C9NB 3CLEH 3AUVA 4M6OL 1YPZB 3QCUH 1G7HA 1VEPA 4P2RB 5I71B 3LKSA 3FHAA 1JNJA 3BZFA 1WZ1L 2OR9H 1PEWA 3IDGA 3ARGC 3IDJB 3O3DA 4P23B 3G5VA 1CFBA 4OCMC 5L2JB 4L3EE 1FO0A 4Y19E 4BZYA 1I1CA 5L8LB 1A9EB 3FJTA 3JV4B 4M7ZC 1OCWH 1I9IH 3QPQD 4HK0B 1UWGL 1FQ9C 5JO5B 1NCBL 3QUXC 5I30L 5FM5O 4MA3A 4OJFL 5FV1L 1C5DB 1M7IB 5TDNA 3OHXB 1JHKL 4ZTPH 1E6OH 5JUEL 1FHGA 3I2CH 3TH2T 3NCBB 2ZUSA 3UTQB 1KT2A 2BSRB 1MAML 4TOYH 1BD2D 3RIAF 4PGBA 1A6TA 5DR5L 2P45B 3MRCA 2BY1A 4JY4B 2F15A 5T1MB 2BVQA 3OKEA 2FSEB 2AEIT 4LFHG 5I75C 5JNYB 2FGZA 3S3PA 2IAMA 5HYEA 4J3SA 3CX5K 1SMOA 5CLTA 4PJFE 2NY7L 2YK1H 3Q6GL 5F7WC 4AEHH 1AGCB 1S7TB 1KIPB 4KJWD 5LBSH 1C08B 2VKWA 1UXWA 5BV7H 5F44A 4NQEB 4N0UB 4JKWA 4JLRA 5EBWB 5LXGH 1DUZA 3MO1B 5BJTA 1U0QA 5AYUL 1BVZA 1KIUA 1R24B 1BIIA 3DVFA 3F12B 3CZFB 3QO1B 2ID5A 4PJDB 3SGDI 3RHWK 5LGJB 2K1MA 3EYQC 2PXYD 3L3DA 2NXYB 5KJRL 3WLWD 3E2HB 1N64L 2NR6D 4K23H 2HTKC 3RNKB 4WV1A 5DVLA 4J2XA 4UT6H 1TETH 3HFMH 3KLSA 1Q0XH 3L1OH 3QIWD 5C3LD 4HEPG 1AHWB 1GHFL 1ZE3C 3VWKC 2H26B 1IGYA 1C12B 3BN9C 4P2OC 1BGXH 1RZIA 4Q2ZB 1INDH 1I4FB 4HS3A 4W4NA 1MFDH 4OFYA 3LQZA 5F3HA 5MEOA 1A3QA 1RUMH 2W38A 4WDIA 2VXUH 1SY6A 1WIUA 5EO1A 2J5LC 3OKNA 4Y4HD 1D6VL 1MNUL 2Q3ZA 2R2HB 3C08H 3GSQA 3EYSH 3EYFB 5GGQH 4FABH 4P99A 5C7XL 4WCYH 2J88H 2BSSA 1QYGL 4PFEA 5HYJE 2HT4C 3S36L 2CLRB 2ICEA 1JJUA 1RIVL 2XIDA 4F9LC 5C0JA 3OQ3B 4G6FB 1MQKL 1UACH 3EYOA 1E4JA 3H9SA 3SDCB 4ONFL 4TVPH 4HKJA 2QADC 1WF5A 1CS6A 2VISB 4YXHL 5DJZA 4Q9RL 1NCWH 3LDBB 4JFFB 3O6KH 5B3JF 4PJIE 3HZKB 3PDGA 3G6JF 4ZTOL 4HIIA 5E0QA 2HT3C 3RWDA 1AO7D 5FKAB 5LJYH 1GL4B 1NGXA 4UTAH 3TFKD 2Y36L 1I8LA 1PLGL 4ZAKB 1X5AA 3IKKA 4LCIL 3B8SA 3SDXE 4X7EC 1GGIH 2EDNA 1YA5A 2MFNA 4ONHA 4Q6IB 2VDOH 8FABA 3VGAC 3DUSB 3WL9A 2HFFB 1CE1H 4K7PH 2F54E 4BSVB 3AVEA 3GMPB 1CYGA 4O51B 1BAFL 2OJEA 4PGZA 3OBAA 4U6YA 3WDIA 43CAB 5I71C 1NSNH 1I9RL 1XR9A 2AJ3A 4RZCB 4KKBD 2Q87A 4AEIH 3FB5A 1INQA 4ZNEA 3MRDB 5IR1B 3BEWA 2H6PB 4P23C 4CW1B 5GGUA 3I9GH 5IQ7H 2QSTA 4L4VB 3QCVL