4I3SH

Crystal structure of the outer domain of hiv-1 gp120 in complex with vrc-pg04 space group p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
222
Chain Sequence
QVQLVQSGSGVKKPGASVRVSCWTSEDIFERTELIHWVRQAPGQGLEWIGWVKTVTGAVNFGSPDFRQRVSLTRDRDLFTAHMDIRGLTQGDTATYFCARQKFYTGGQGWYFDLWGRGTLIVVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer domain of HIV-1 gp120 (KER2018 OD4.2.2)
publication title Outer Domain of HIV-1 gp120: Antigenic Optimization, Structural Malleability, and Crystal Structure with Antibody VRC-PG04.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Viral protein/immune system
total genus 39
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i3sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i3sH01
1M7IB 5MP6L 3RY5A 2FGZA 3FQWB 4CU7A 5GGUB 3M1BB 4CN1A 5D70H 1BD2D 2Z35B 1BD2B 4LPTA 5C2BH 4YDKL 4LPYA 4JFXA 4HKXA 4MJ6B 3KWWA 5IW1A 2CRIA 5DHVB 4YZFE 1U8IA 4KK9C 5B3NA 4XCNB 5GRWA 4P5KB 3K74B 3FCTB 3MV9B 3MV9D 4U1NA 5DUPH 5HI4D 1BF2A 1F4XL 3HNSL 2E9BA 3EYSL 1MFCL 5B38A 3SDAA 2QHRL 3LKSA 2ZCLL 4MQSB 4WU7B 2BJMH 2P5WE 2W38A 4JHWH 1EAJA 1H0DA 4DTGL 1ROWA 4APQA 1QFWI 4Y16C 3OKEA 4QRTB 2J8UA 3VFTA 1UVQB 1I1YB 4RA0C 3K0WA 4ZODA 5E1AA 1YQ2A 1I1RA 4NNPL 3DX6A 5DJXA 3H2WA 4K7PL 5HHNA 12E8L 2O93L 4XVUC 2AJ3A 4OV5B 3U46B 1BBDL 3HG1E 1AGBA 4GKSB 5LVEA 4CVXA 1INQB 1YPZA 1F58L 1PAMA 4ZTPL 3ARBD 2C3GA 3ARBB 4P5TD 5F70A 1KNOA 2IH1A 4EVNB 1LNUB 1ACYH 3D5OF 2CPCA 4FFYL 4DW2L 1XF3B 5DWUL 3GSQB 5D72H 2YC1B 4MJ5A 5L88L 5LQBH 3HB3C 4N0YH 5FF6B 2OQJB 5IHUH 1QLEH 1BMGA 1Y6MR 3QUXD 3QUXB 4W68A 2N1KA 3WLBA 3NZHL 1JZ6A 4NP4L 1AC0A 4S1DC 4Y4KD 4Y4KB 4IOFD 3MJGX 2YHGA 1M1SA 1R3JB 1T1YB 3QXDA 3GKZA 3VFOA 3HR5B 1ZT4B 1KPVB 4NNXB 4N1EA 4ODTL 3RGHA 3U9PH 2APVA 2P5WD 2NY0D 2P5WB 2NY0B 4FFVC 5INDB 1PYWA 4DK3A 1JZ2A 1FCGA 1EEYB 5SWSB 5CJQH 3TJEH 1VGEH 4JY4B 4Q6YA 3NPZB 1NEZB 3G5XA 4MA7H 1ZS8A 4HH9A 3NN8A 4N0CD 1CFQB 2BCKB 1P1ZB 2HFFB 3UX9B 4PR5A 3ARWA 3UCRA 3UTQA 5D7IE 4RAVA 3HG1D 3IDUA 3HG1B 4KJPC 5DVMA 5EU4B 1T1WA 3D18A 3BEVB 1AP2B 2A6IA 1OPGH 5JXEA 4DGYH 3IGAB 3NPSB 1T7YA 3ROOB 4J1UB 1ERNA 5E5MA 3NOIA 1G7LB 1EERB 2VB5A 5SV4A 4NC1E 2AEPH 1FNGB 1EHLL 1P7QA 5B3JF 1H9VA 5CS7A 4BKLB 3QG6A 1QRNB 4JPVH 3L3JA 4N5EC 3KR3L 3QQ3B 2GFBA 3ARUA 4FNLL 5E8NA 2Z31D 5DFVD 1B90A 2Z31B 4YFEA 3MNVA 4H20L 5I1HL 4ZQKA 1B0RB 4OQTA 4BUHA 2CKBL 3UTPE 3CGTA 4AJ0A 5KSVA 4PGCB 5ACMA 1GGCL 4BZ1H 4L4TA 3QG7H 3AC0A 1A1MA 4DEPC 5L6YL 1HH6B 3F58H 3QZWA 5CGYD 1I3UA 1HQRA 2O5YL 4U1MA 1NCCH 3TCLB 3NIFE 4OLZL 1O0VA 4PYHA 4YHMH 1JGEB 3RIAF 2ERJC 1K8IA 3CFEB 1EGJA 1NJ9B 1MWAA 3LRGA 5DMJB 2J5LC 3TBWA 4M5YL 2QBWA 3PL6D 3PL6B 5IQ7H 5LWYL 43CAB 5D7IB 3UXFA 1KN2L 2QHLA 4YFLI 5F7YC 3HAEH 1A4JB 1AGEA 3SGEH 2BHZA 3P0YL 4WHTA 3MRKB 4Y1AA 3W5NA 2MPAH 1A64A 4NHCL 1CR9L 1MAMH 1FNFA 1ED3A 5JA9A 1GOHA 3W11D 4ZPTB 4WW2F 1J88A 2P49B 4JKPH 5HGBB 4YGVA 4JKLA 3QJHB 1U6AH 1NUDA 3UBXA 1MHCA 2YRPA 3S8WA 1BGXH 5D1QD 1OD7A 3CLEH 5D1QB 4UOW1 3OXRB 3IDMB 3U7WL 3O4LA 1LDSA 1IKFL 4TSCL 2NX5A 2Q6WA 4WV1C 1INDL 3WNOA 5EZIL 4TQEL 3FB6B 1X5IA 2W91A 4GT7A 4PJBE 5BW7A 3OKNA 1DVFD 5MENE 1DVFB 1K5NA 3UTPD 4NO5A 1OAXH 2NY3C 2A74A 3AM8A 2QR0A 5A3IC 1ZSDA 2FBOJ 3E2HB 4YFDB 3S9DB 2R4RL 3U7YL 3U48A 2AAVA 3B2VH 4HJGB 3S36H 1F2QA 4N0RA 4U6YB 4DVBA 2HJFB 1J11A 4JJHA 4HK0B 1MY5A 3X13B 2DRUA 4ZO8A 3WIHL 2Q76A 1XF5A 4NIKB 3LKRA 5IESH 5AYQA 2WUCH 2JB6B 2B1HH 3DHMA 4OF3A 5DURD 5D70L 5DMKA 5C09E 4MD4A 5A16A 1P2CB 2ZG1A 4UI2A 2FIKA 4X4MA 2GQHA 3X3FL 4ZO6A 2J12B 2BSSB 5DD3H 5D7KD 3RL1B 3ZSTA 3BXNB 3NA4A 2A2QT 2FEEI 3IDIB 1UYWH 3R0NA 4WCYH 3JWDC 3LEYH 4P2RA 5DUPL 5E8PA 3CH8A 4U1SA 3KYAA 5BV7C 5DJ8B 4K3HA 4JFFE 2P48B 4PRAB 3ULVC 4X9HA 4XBGA 4PYGA 5HGGS 2CLVA 3ARGA 5EIVA 4PD4J 3NGBB 5I8CA 4MWFB 4Q6IC 1E0OB 5C7XH 1G6RH 5C8JB 4HC1H 5MEND 3EO1A 1CXKA 1U42A 5IB3A 4JO1H 3WO3B 5CFHA 5B21A 1U91A 4MCZA 5MEOB 1AD0B 3SKMB 1DBAH 3VMNA 5KG9A 4ZS7L 3V5HA 3RKPA 4Z5RB 2EKSA 2AV7A 2HN7A 3DGCR 5F9AC 2ZUTA 3BE1H 3M45A 2J8UF 3MUGB 5GGRB 3HZYB 4RIRA 1PSKL 4BK5A 4KKCD 3REVA 2IADA 1EX0A 3ZKND 3WUZA 4DZ8B 1ACYL 1MPAH 1QLFA 3HHRB 3NFNB 1YY8A 4KKLD 5B8CB 1JGUH 2EE9A 2CDGA 1FNLA 3RDTA 5LQBL 5C09D 2DYPA 5IHUL 1QLEL 5JOFB 5ICZA 2DBLH 1HSAA 3ZT5A 4MXQC 2VR9A 1I1AA 4CW1B 1A0QH 3PP3K 1CG9A 2X44D 1B4RA 1KN4H 4KXZI 5IIEB 4PTUB 5D6DA 2P5ED 2P5EB 4G8GE 3OAUH 4PGJA 3NZ8A 3ZDYE 3U9PL 3EO0B 2AXHA 2GJ6A 4GW1B 3B9VA 3V7MA 4OD1H 5CJQL 4KAQH 5K33A 1WBZA 2GY5A 3J7HA 1VGEL 5MERB 1G7QA 4XX1G 4YHZL 4MA7L 3GO1H 4PREA 3ALXA 1C16A 1KG0A 3TBVB 5ITBH 1T04B 4L3EA 1ZT1A 3VRIA 2CJUL 4JJ5A 1GOGA 1UZ8A 4PP1D 1NGZB 3EIFA 4QHNA 1QZ1A 1UJ3A 3UTZB 4FQXC 3QA3B 1OPGL 1PY4A 1DQQB 2JKXA 2C3VB 4DGYL 1CU4H 1HXMA 4WO4B 3AS1A 3E6HA 4RNRB 5KSBE 4ZUUB 1UKSA 1BM3H 4E41A 2EIBA 2AEPL 4RMUA 3QHFL 1AHWC 1HNGA 2BNRA 1BZQK 5A43C 4JPVL 3GSVA 1QFUL 4WWKA 4L5FH 3O3AA 2AV1A 5EBMA 1U8MA 3TZVB 3V5DA 5JW3H 2CO6B 2Z91B 1XH3B 5MI0B 5I8EA 2OK0H 4PS4H 3TNNB 4BJLA 3WFHA 4NKQB 3ZTJH 4M02A 1FIEA 1LEIA 3QG7L 3FO9A 4G8GB 4G8GD 4HMCA 3LIZH 3AUVA 2DS4A 2DQCL 2WP3O 3F58L 3RJDA 2ZP0T 4NWTH 5DRNB 4UQ3A 4IRJC 2YWYA 1JFQH 1NCCL 4IMLB 2Z8VC 2VLJE 1I3RB 4LHJB 5D1ZA 3OF6A 4OI7A 4X6CB 4HT1L 4JG0H 4UDTB 3SCMB 3SCMD 4WY7H 5F71A 1HILB 3I3BA 3THMH 5JNYA 2VZOA 1IEBB 2FH8A 2ZJSH 5IQ7L 5AAWA 1IC4H 5CUSH 4NO3A 2QV2A 3MCLL 1DLFH 2E9WA 1TTFA 1MFBH 1NGPL 2FD6H 1ZT7B 5C0JA 3S35X 4U6HB 2ADIB 1CVRA 2MPAL 5K9QG 2R1XA 1A7NH 3ZHDA 4J8RA 4UV4H 1DN2A 1U2CA 4DZBA 1FZOB 3FOLA 5I17A 1GZPB 1RURH 3OQ3B 4Q7DA 2IH3A 5HVGB 1RZ7H 5EUKA 5D7JC 2DQUL 1U6AL 1ZXQA 5EO9A 3GSOA 4XP5H 3S7GA 3HE7D 3HE7B 3WJLC 1I8MA 4K7FA 5J06A 2X05A 4M4RA 1AI1H 2P8PB 1U8OB 3WL9B 2FYYA 1M7IA 3VI4E 1WWAX 1EUUA 3FQWA 3EOTH 5GGUA 3M1BA 2QEJA 2BVEA 5CINH 4WI9A 1RUKH 1OAZL 2Z35A 1BD2A 1RIHH 2HKFH 3DO7B 4M6ML 4M1GL 1QSFD 2PETA 1QSFB 1OWRM 4CVZB 3PABB 4MJ6A 3QIBD 5DHVA 3QIBB 2NLJB 3B2VL 2VLJD 3RTQD 3RTQB 4XCNA 5FV2A 1W0VA 3KHQA 1IGCH 4P5KA 3FCTA 3MV9A 3OG6B 4ODWB 1HZHH 3QQNA 3LV3B 3RIFF 3MACH 2NY7H 3Q3GB 4KJQC 4B5EA 1HWHB 3X17A 5IESL 4LSTH 2WUCL 1KBGH 5F7EH 3T3PF 4G8FB 1M4KA 4PB0H 3KYMB 2XN9E 4WU7A 4HKZB 2LVEA 4ORZC 1ORSB 3P4LA 1NL0H 4Z7UF 1RK0B 4GKNB 5KAQF 1CTNA 5ESQB 4QRTA 1UVQA 1I1YA 1UYWL 3CU1A 4WCYL 3BVNB 1L0QA 4PGBA 4L9LC 5BMFL 2V5RA 2JJSA 4X6BB 2XZCH 1WFUA 1YJDH 4OV5A 3U46A 4GKSA 3MGOB 4O2EB 3IF1B 1W0WB 1INQA 3AB0B 1EVTC 3MFFB 4PG9A 5C7XL 1G6RL 3ARBA 3CK0H 4IOSD 3L5WB 4EVNA 5D96C 1LNUA 4RZCA 1XF3A 2RHEA 3GSQA 2YC1A 4JO1L 5FF6A 2WBJC 2OQJA 2X10A 3SE4A 4RAHA 1DBAL 5I1IH 4DAGL 3W39B 3QUXA 5HGAB 2HH0H 3ULUL 3MMEB 5F44A 2DL9A 2EIEA 2VXSL 1B0GB 1MCEA 1FLRH 4Y4KA 2Q1EA 4PV8B 5K9KA 2R9HC 1NFDE 1S9XB 1R3JA 4A6YB 2R69H 1LD9B 4GRMB 1JGUL 1T1YA 5EUOE 4BQ9A 3CFDB 1I7RB 2CGRL 4Q2ZB 3HR5A 1ZT4A 1KPVA 4NNXA 1T0NB 1YEDB 2P5WA 5INDA 1EEYA 2DBLL 5SWSA 2HFTA 4HIXH 1UWXH 2A0LC 4JY4A 1RZIB 3PWPE 1NEZA 2CLZB 1EO8H 3LZFL 1NANI 4L8SB 1CFQA 3RWFB 3PV6B 1KN4L 4GSDH 3MNZB 5KS9E 2BCKA 1P1ZA 3VFMB 2HFFA 4HXBH 1BVKB 5D7LE 5DZLA 1LE5B 5IVZB 1BREA 2D2OA 4HIJB 4MMXC 3GMQB 1P4IL 3HG1A 3OAUL 5FM5M 2NPLX 5EU4A 2N7AA 3BEVA 4MS8C 5EO0B 1AP2A 1T89A 4C54A 1CCZA 1QFHA 4P2CG 3IGAA 4OD1L 5GIRB 3ROOA 4J1UA 1G7LA 1WF5A 1FZMA 4AEFA 3G5YB 3GO1L 1ZEAL 1U3ZA 3RX8A 1FNGA 2PCPB 1T20B 3SOBL 3S3JA 3EAKA 5ITBL 4BKLA 1QRNA 5TDNB 5HHQB 1RZKC 2FX7H 3QQ3A 5I9QB 5CEZE 2B7DT 1JL8A 4XNYL 2Z31A 1JF6A 4KI5C 3AY4C 1CU4L 1NFDB 1B0RA 5CP3H 1RUAH 1QYGL 3DIFB 4KTYA 1CGSL 1JV5B 4PGCA 1GCFA 5EUOB 4G6MH 1BM3L 3MJ8B 4XXDB 5E70A 4HIIB 1HH6A 2IAMC 1UXSB 1Q9LB 5I19H 1CGTA 3V79C 3TCLA 4QEGA 3IU3B 1C12B 1JGEA 2VL5B 5EOCL 5ADOH 4M43H 1NMBH 3O2DA 2ZKHH 3CFEA 3PWPD 3PWPB 1NJ9A 5JW3L 4LPVA 4KUCF 3KLDA 4PS4L 1AY1H 1KCSH 5KS9B 3LEXB 5IP4A 1JPTH 5D7LD 3PL6A 4TRPH 5D7LB 43CAA 3LIZL 2OJZH 5D7IA 1V7MH 1Q9OB 3QBTB 2EDHA 1A4JA 1A6TB 4ODUB 1UM6H 5HI3D 2KQMA 3V8CA 3HB3D 3MRKA 4MD0B 4KKBD 2XY1A 4JG0L 3BAEH 3MREB 5M7QA 2ZUUA 3ULVF 2AERT 4ZPTA 3O6KH 5DD0H 3QRFM 3QJHA 5EO1B 1F00I 5E2TH 2ZJSL 4XBPB 5D1QA 5M94B 3OXRA 1IC4L 1DFBH 3D25B 3IDMA 4Y8DC 1DLFL 2J2ZA 1MFBL 2FD6L 3KXFB 3UTTE 2E6JA 5CEZD 3U9UB 3MA7B 1KFAL 3FB6A 4PLOB 5JR1L 2X4NB 4OCMC 3T1FB 1DVFA 3K80A 1A7NL 4UV4L 1I9RH 5CKAA 5B38G 1EFXD 3TEUA 1EFXB 1I9EA 3BN3B 1RZ7L 5DRXB 1KLFA 1V8HA 3T2NH 4LSUL 4XP5L 4HJGA 4KRNA 3HFML 1EK3A 3MUZ1 4U6YA 4OT1H 2HJFA 5JZ7D 1CK0L 1SYVB 1B9ZA 2H2SC 2X40A 3JXAA 4HK0A 4AIOA 3X13A 3K46A 2DLIA 5IMMB 4KJPD 4RWYH 3OGOE 3EOTL 4QKXB 2JB6A 5CINL 1NKRA 2BOCB 1RUKL 3P9WB 1FGNL 5TH2B 5ISZE 2VQ1B 1RIHL 2HKFL 1JTOA 1P2CA 4F3FB 4YDLC 2BSSA 4NC2B 3LKNB 3RL1A 3BXNA 4M00A 1IGCL 3RVUD 3RPIB 4F15C 3IDIA 1BAFH 5H94B 4NKMA 1FQ9C 5D6CA 2E27H 2EEBA 2R0LL 4R6UA 3Q48A 5IW6A 1ZE3C 3QFJE 5DJ8A 4DN4H 1AO7D 2NY7L 1AO7B 1MWAL 4PRAA 5CSZB 4DFHA 3MXVL 1JYXA 1KBGL 5F7EL 4HK3J 5KTEH 1GZQB 4AK1A 1A9BB 1GPOH 4MWFA 4OJFH 1A2YB 2EH8L 1NL0L 5C8JA 1KSRA 4PJBA 3WV0A 2FH6A 4J7RA 4JB9H 3MROB 1O7SA 4NN7B 4WIQA 4L8DB 1SVCP 5MEOA 2MKWA 1AD0A 1Z5LB 3SKMA 3DVNB 3HS0B 2XZCL 1FNEB 2ICES 4HAGA 2HJKB 4Z5RA 5GGRA 3DYPA 5SX5H 3HZYA 1OGTB 3QEUB 5JPMB 3CK0L 3KJ4B 3DETD 1OSPH 4XTRC 4DZ8A 1Y6KR 3NFNA 5B8CA 1KEGH 5J56B 2AEIT 4ZDHB 1SEQH 1FPTH 1F6AB 2DQGL 4JQVC 5H35B 5B4MC 5ISZD 2VSCA 2J88H 3CU7A 5GGRY 2VXQH 4JN2B 5I1IL 5JOFA 3X3GH 1S8DB 5DJ2B 2HTLD 1XF1A 1DBMH 3BKYH 3WYRA 1XT5A 4KWUA 2FLRT 1FLRL 2MNUA 4PLNC 2YD3A 4CW1A 5C0CD 5T5NG 5C0CB 3F6IA 3QFJD 3QFJB 2LVCA 5IIEA 2VITB 3ZZ1A 1D7FA 4PTUA 2P5EA 4ELKB 3IFPB 1F4YH 2FHCA 3NTCL 4FQJL 3QO1B 2BC4B 4WI3A 2YWZA 4K23H 3GRWA 2ARJQ 3TFKC 3TH4T 1PDKA 3EO0A 3BPOC 4GW1A 5JPNB 4HCRH 4P4KB 1H15B 3MR9B 4YHYC 3G6JB 5ETUB 4HIXL 1AH1A 4JY5H 1HIML 2NY5H 5MERA 1T03H 4PLJC 4AQ1B 1P69B 2Q7NA 3QZWG 3TBVA 1XF4B 4GSDL 3D48R 4WEUD 2D7NA 1T04A 1TQCB 4M6AA 1XGUB 2GW5A 4G8IB 3ARED 3AREB 3T0BA 1NGZA 3MRJB 2BMKB 4TUKH 1WITA 3D9AH 4WFED 3UTZA 3QA3A 1DQQA 2C3VA 3CFKB 1CE6B 4WO4A 3CFIC 5JHLH 2KZWA 3HTLX 2VKWA 2DJUA 4RNRA 4ZUUA 3DNKA 1OSZB 3VGFA 1AGCB 3SDCD 3SDCB 4XP1L 5T3ZD 4LSSH 4BK4A 4LLUB 3IAGC 4OFYD 3KPMB 3WXVH 4P9MH 5DT1L 4GKZB 4KRMB 3ARDD 3ARDB 2GKIA 2DQJL 1RZFH 4PJXE 4OZHF 2Y06H 3F12B 1MNUL 1LE9B 3TZVA 4NN6C 2Z91A 4JQXA 1XH3A 1IAII 4XC1H 1RUAL 3TNNA 1CLCA 3RI5K 4Z7VF 4G6ML 5KVDL 4R97B 1HEZB 4G8GA 4PRHB 5E99H 2GHWB 1RV6X 2IBGA 2I25N 1JN6B 3BGMB 5DRNA 1A02N 4QRUB 1U95A 3DJ9A 4IMLA 3LS4H 1I3RA 1JNJA 3DURB 2ZUQB 2CIIB 5F21B 3WSQH 4LSPH 5FUCC 1KB9J 2Y4SA 4UDTA 1IGYB 3SCMA 8FABA 3DGGB 4X5XB 3ZE0F 5JW4Q 1HILA 4M7ZB 1R3LB 4MXWH 1AY1L 1KCSL 1IEBA 4KK8C 2EDWA 4WI8A 1H5BB 1JPTL 3H9HB 5EORH 4FXLA 4LOUC 2OJZL 4XVTH 4X5WB 3WNPA 3NIGE 1ZT7A 1UM6L 4U6HA 2ADIA 3LPGA 2QSVA 3W9DB 3WFBH 2JTDA 5JW4N 1WISA 5CJXC 3BAEL 1NUFA 1X6NA 1FZOA 4OF5A 1GZPA 1U8KB 4K9EH 1KB5B 1ZA6B 1U92A 3O6KL 5DD0L 4IEFB 3FFCE 5E2TL 1AKJD 1AKJB 3PWLB 1UWEH 3SGKA 1DFBL 3HE7A 3FB7B 2DJSA 4YDJB 4PJXB 2FNBA 4TTDC 3QUYD 3QUYB 2P8PA 4ELMF 4RGOL 2VXVH 1U8OA 4PRIE 3WL9A 4BSWA 3LQMA 1ACZA 3SGDH 2BNQE 4HJJH 3F7QA 4X9FA 2YD9A 3DO7A 2FO1A 1QSFA 4CVZA 3PABA 5JORB 4NYLB 1KJMB 1WT5A 3QIBA 1X3DA 2NLJA 2X09A 3RTQA 2Y5EA 3RBGA 1G6VK 1FV1B 5DR5L 4OT1L 2V2TB 1FYTB 1EH9A 4YXLL 3QISA 4ODWA 4ZOCA 3U4AA 1S5IL 3SDXF 1IC1A 2WWKO 2C7UB 3LV3A 2BXYA 4RWYL 2DD8H 5DO2C 3TV3H 3Q3GA 2CLRB 1ND0B 2APBA 2YKLL 2AABH 4G8FA 4YH6A 3KYMA 4BUGA 4HKZA 1FE8H 1EA9C 1RFDH 1ORSA 3QDGE 1QG3A 3AFLA 4PY8I 4RCAA 4HH8A 5FYKU 1RK0A 4GKNA 5TE6H 5ESQA 5EC1B 3BVNA 2E27L 4EUPH 1KTLB 1GGYA 5FYJU 4DN4L 3NAAH 2D7TH 4X6BA 5LGHH 3FFCD 3FFCB 4RAUB 2P47B 3MGOA 4O2EA 5KTEL 1V7NH 3IF1A 1W0WA 4JRYE 5IF0B 4AMKH 1VA9A 3MFFA 4P59H 2VZTA 3L5WA 4PRID 4EDXB 5L7XH 2BNQD 2BNQB 4JB9L 4XP4H 3RA7H 3FOMB 5GGQH 3K4AA 2BDNH 4JKMA 3CSYB 3W39A 4Y4FC 4LVNC 5HGAA 3AGVA 2PO6C 3OB0H 3SY0B 1I3VA 4WTZG 3MMEA 3DECA 1B0GA 3VXRE 4KI5F 4PV8A 2Y25A 4JM2D 4JM2B 4A6YA 1J0JA 3BPCB 5CSGA 4ISVB 5L0QB 4NQCE 1KJVB 3V2AR 4HS3B 1LD9A 4JFDB 4GRMA 1KEGL 5DJ6B 1FFPB 4OUOA 4U05A 3CFDA 1I7RA 4Q2ZA 4UIMB 3BGAA 2UZXB 2X1XR 3VXQB 4ZOEA 1JPFB 5I16B 1T0NA 1YEDA 2VXQL 4YBHA 3X3GL 3JV6B 3QDGD 3QDGB 1PJ9A 4R96B 2XWTB 4LCUB 5DTFB 2E7MA 1NAMH 2X4QA 4ONHB 1RZIA 2QLVB 4YNYB 2CLZA 1E4XH 2GAZB 3CPLA 5FKPB 5B22A 4L8SA 3RWFA 3O11B 4WFFE 3PV6A 1D5BB 2ICWI 3MNZA 4YK4B 3VFMA 1PZ5B 1BVKA 1LE5A 5IVZA 5FKAB 4HIJA 1Q72H 3GMQA 4XP9L 4K23L 3JSSA 4JRYD 5EO0A 4JRYB 4MAYD 4GAFB 5GIRA 2X41A 3TO4C 1C7TA 4EN3D 4EN3B 4N8VG 5HHMB 4GXUN 3T2OA 2NY5L 5JW5B 1T03L 4H1LH 3JTTB 3QWQB 5DEFB 5LXGH 3G5YA 4QXUL 2PCPA 4OUUB 5E8DH 4OF0A 3JZ7A 4J6RH 5GS2H 3WNNA 5J89A 5TDNA 5EU6B 4LMQE 5HHQA 4TUKL 4C59B 1FO0L 3D9AL 3VXRD 3VXRB 4ZMAT 1N26A 1BWMA 3MV7B 3P9LB 4Q0XH 4JGJA 1NFDA 3DVFA 3HE6B 3DIFA 1JV5A 2OZ4A 5EUOA 2ZPKH 1KACB 3K2UH 3MJ8A 4XXDA 3S5LA 4HIIA 4LSSL 5T33L 4PY8J 1UXSA 1Q9LA 3GI9L 4P9ML 1CDGA 1FRGH 4XNXH 4XT1C 3IU3A 2DIJA 2BHYA 4O02H 1C12A 5GS1C 1WC7B 1RZFL 1OTUD 2Y06L 1T2QH 4QXWA 4I18B 4DKFH 3PWPA 4PJIB 3WJJC 4TSBH 3C6LD 5LBSL 3C6LB 4LVOC 4XHJC 4M8VA 2WV3A 4UINH 4WTXA 4WFFD 4LLVB 5HPOA 1F5WA 5KS9A 2LAGB 3VG9C 1GH7A 3LEXA 1J12A 5D7LA 4YQXL 1CGXA 5E99L 1Q9OA 4CL7A 1A6TA 4ODUA 2OI9B 2A1WL 3V6BR 4RQQB 3WSQL 3MXWH 4MD0A 4LSPL 1J10A 2YUZA 1OOAA 4DOHE 3MREA 1LEKB 3S88L 3H6JA 4LKXB 4YAQB 5EO1A 3B9DA 1SJHB 4XBPA 3VGDA 3D25A 4XVTL 4P4KC 4X6CF 2CDFB 3H9ZA 3B43A 1GC1L 2VN7A 3KXFA 3GJFH 5F89B 4Y8AA 3B9KD 3U9UA 3MA7A 5EPMB 2X4NA 3T1FA 5K9OB 3SE9H 5D71H 3ZKQD 2OR8A 5TGBB 1JWSB 4W4OC 3T0VA 1J8HE 1EFXA 3WS3B 4MQXC 1YUHB 4K9EL 1JIBA 2FX9H 5DRXA 4B7IA 4YX2H 3ILQD 2G5RA 3NCFB 5E4IA 1YEJL 2F5BL 3F8UB 1CD0A 4P5MB 3UYOD 2VXVL 1OP5H 5IMMA 4JHAH 3E8UH 2ZWLT 1FSKB 4K8RC 4HJJL 2BOCA 5TH2A 5J1SC 4W6YB 4NN5B 1KB9K 4YFLF 4C57C 4ZO9A 1MCDA 4RWHA 4F3FA 3OGCB 1T0MB 2X1WL 3LKNA 3V4VL 4MJIE 2R39A 1OL0A 2BK8A 3RPIA 5F6HJ 5T3XE 5I1DA 1OW0A 4P23C 1FFNB 4CBPA 5H94A 4F8QA 4Z7NE 4Z7QE 3M17B 2DD8L 5GRUL 3AROA 1AO7A 3HI6H 5CSZA 1FL5B 2X9WA 3EZJB 1DP0A 5DFTA 2FRGP 2HT3C 4ORGB 3H8NA 3W5MA 3WLWC 1GZQA 1QPXA 1A9BA 7FABH 1FE8L 1AR2A 1PVHA 1QBMH 1DQMH 5IBUG 1A2YA 5DEZA 4M48H 3UDWC 2WANA 4G5ZH 5TE6L 1JZ3A 5E6ID 5MHSE 5E6IB 3FL7A 3MROA 1J8HD 3TVMC 1S9YB 2IEPA 2CUMA 4NQXB 4L8DA 2MQ3A 3NAAL 2A9NL 2D7TL 1Z5LA 2FEDC 3HS0A 5LGHL 3QXTA 1IE5A 1FNEA 1WFTA 2HJKA 5GS0D 1EBPA 3TBTB 4XNZC 4M7JH 1V7NL 3G5VB 1OGTA 1EZVX 3QEUA 1NEZG 4P59L 5JPMA 3GHEH 5SX4H 3L7EB 5L7XL 1X5KA 4OBSA 5D2NB 3L5HA 2GEEA 4ZDHA 4HG4K 3IYLW 3TH3T 1F6AA 5H35A 4XP4L 2EZ0C 2XPGB 5EDXA 5GGQL 5JIHA 1T6WA 2BDNL 4PJCE 1S7VB 1TTUA 4JN2A 3T0EC 4KGLA 1S8DA 5DJ2A 1P84K 5I74B 1BOYA 5D4QA 1K2DB 2PN5A 1OCWH 1B4JL 1XF2B 4YHPB 2Y5TB 2NXZD 2NXZB 4PJEB 3C2AH 2H32H 5T3XD 4RGMB 1J0ZA 2FB4H 5FM5O 1EXUB 3H9SE 5IFAH 5C0CA 2IBZY 1KELH 3HNTL 3QFJA 1VFMA 1RUQH 2VITA 4OZFB 1RJYB 4GS7B 4ELKA 4MJ2A 4WUUE 4K3GA 3IFPA 5J3HC 2E8YA 4L4VE 4X4ZA 3QO1A 4U1HB 2BC4A 1D6VH 1YMHB 5ANMB 1PEZA 2R0WH 3NMEA 5EOQH 3MR9A 4QNPF 3G6JA 3C87A 5ETUA 1NAML 4UAOB 2NTFA 2RAMA 1E4XL 2DKSA 3IJYB 1XF4A 4LARL 1OTTD 2YOCA 5CILH 1XGUA 1K9TA 4G8IA 4UBDC 3QQ9C 3AREA 1LWRA 3MRJA 2BMKA 4KDTC 2OTUB 4O5LH 4RRPA 3CFKA 4GOSA 4N8CL 1TQBC 1CE6A 4YIQB 4YC2B 2BHUA 2Y23A 1U58B 4I13B 5LXGL 1OSZA 1AGCA 5TQ2L 5INCB 3SDCA 4TNVK 3LN4B 3QXAB 4JKKA 5GGTA 4A2MA 5F9DC 5E8DL 4LLUA 4XZUB 1UFUA 4K94H 3KPMA 4J6RL 4OFYA 5GSVB 4FXGB 4PJGF 3U1SH 4QRQB 4GKZA 1IL1B 5DI8B 3VRJB 3ARDA 5E2JA 1J0HA 4P48A 3F12A 1VFUA 1EO7A 4EUPG 1MJ7L 1LE9A 1EJ6A 5E94B 4Q0XL 1HQ4B 3EW3B 1S78D 2VMFA 3H9SD 3H9SB 5GGSY 3BJ91 3DTXB 5HVHC 1MCBA 2ZPKL 5EU7E 4WUUD 4WUUB 4XCFH 1HEZA 4D0BB 2FJGB 4PRHA 1JN6A 4QRUA 4YHLH 4LQ1A 4XNXL 1J5OH 3DURA 2CIIA 1IGYA 5C0RH 3DGGA 4X5XA 4P0DA 3MV01 1NH6A 3B8YA 3I6KB 1R3LA 1CQYA 4UINL 3NCYP 1FC2D 4LPCA 1H5BA 2CMRL 3EYUH 3H9HA 1XGQB 3CXDL 1E6JL 4JRWA 3MV8E 2K3TA 3TPUB 4X5WA 5C0DA 1QPPA 3ZL4H 5BOZG 1WFOA 2ADFH 1I8IB 1MCIA 1H8SA 1UEMA 2WIMA 2V2WB 2QQLL 1CVSC 3BIKB 5K9QI 3KPOB 2E7CA 4WJ5B 3W9DA 5FOBB 1U36A 3T09A 5HGHB 1HOCB 3EUUA 5EIIB 1WQVT 1I4FB 3VXUE 2R2BB 1U8KA 1G9MC 1KB5A 5F7FA 3LPWA 3MO1B 5GGVH 3EYQD 2VC2H 1AKJA 3PWLA 4LEXH 3DLQR 1KCRH 43C9B 3FB7A 2JIXD 2JIXB 4XPTH 4YDJA 3NVQA 4PJXA 3QUYA 3RZCD 3RZCB 5I8KH 5DQ9B 3BUTA 1MRCH 1IAMA 3SE9L 5D71L 5JQHC 3CZFB 4KVCH 3PGFH 1QSEE 2J4WH 3SBWC 4QNPE 4YX2L 4JO2L 5JORA 4NYLA 1IM3B 1KJMA 3UAJD 4PBXA 5F7KC 5CWSB 2AVGA 1FV1A 3HE6C 2V2TA 1FYTA 3SKJL 5T1MB 3RU8H 4KK5C 4DN3H 2EDDA 2C7UA 3G6DH 1MAJA 4X8JB 4JHAL 4Y19B 4YWGH 1YEHH 2CLRA 1ND0A 3E8UL 4Z95H 2VZ1A 5BO1H 3HC3H 2YD4A 5C0IB 5I6XC 1EHXA 1S9WB 1T83A 2Q3AA 4QOKD 3T65B 4QOKB 4D94A 3ZE2E 5TPWH 4XMKH 3N85L 1DQTA 2P44B 3IFLH 3QULB 5EC1A 3MRPB 3VXUD 1KTLA 4N90E 1DTUA 1KEMH 3FFCA 1EUTA 4RAUA 4X6DE 3GBMH 3LHPL 3LN9A 1FORH 4KJWD 2FDBP 1WZLA 3C60D 3C60B 5IF0A 1DQML 1FFRA 3SN6N 5D1XC 4XXCC 1G7JB 4EDXA 3VXPB 1D3CA 4G6AD 2PR4L 4M48L 3SQOL 2BNQA 3QPQC 4TPRH 3UPCA 5CZXC 3FOMA 1WICA 1E4JA 1QSED 3CSYA 3O0RH 2Y7QB 2A6JB 4DK6A 3VGAB 2DQDH 4NUJB 2MJWA 3C5JB 2BX5A 3PGDB 3C09C 4KI1A 3RUGE 4NSKB 1OT2A 2NCMA 3GKWH 4JM2A 2DIBA 35C8H 3BPCA 2A73A 4XPHH 3KPTA 4ISVA 1KJVA 4HS3A 4KHXH 4JFDA 5DJ6A 1AR1C 2OX5A 2DTSA 3TC9A 1IC7H 4UIMA 4FMKA 3VXQA 4JZJC 1HKLH 1JPFA 5KVEH 5I16A 3UYRH 1X6LA 3JV6A 2VDOH 3QDGA 1R5WB 4R96A 2XWTA 1P53A 4LCUA 4M8QB 5DTFA 2W0FB 1BFSA 3C2AL 4I9WE 3E6FB 4KDWA 4ONHA 4YNYA 2ICCA 4ESKA 2GAZA 5FKPA 2FB4L 5KSUB 4N90D 1KELL 3O11A 1D5BA 1RUQL 2VZUA 1PZ5A 3S37H 5DS8B 3O2VH 5T1LB 2ZCHH 4X6DB 5FKAA 4XNMB 1D6VL 4JDTH 2VH5H 4JRYA 3QSKB 1DBJL 3OPZH 4LCWE 1BQHG 3GZKA 4GAYB 3VXTB 5EOQL 3DX9B 3LVEA 4EN3A 5GZOC 5JW5A 2DM4A 3JTTA 4RGNE 5DEFA 2Y6SD 2YD5A 5EFIB 3L5IA 4OUUA 5D8JH 3A6CL 4EKXA 4IIQC 3HMXL 5FCUH 5CILL 2CRMA 2L0DA 3VWKC 1EDQA 4V2CB 2DQEH 5DVKA 4G8EB 5EU6A 3BD5A 4S1SL 2BVQB 2P46B 1F4WH 3VXRA 1N6QH 4F7TB 4O5LL 4DFIA 4XAKD 3P9LA 4S2SB 1MVUB 4WEBH 5E2UH 3LQAC 5IQ9B 1AJ7H 1KUMA 5SX5K 3SDDB 2H9GB 4BH7B 2B4CL 5BVPL 3LD8C 4K94L 3AXLA 1CXFA 3MNWB 4PJFB 4F80A 5C0ND 1WC7A 1WIOA 1ZAGA 3MJ9H 4XVJH 1Z9SA 5D2NC 3QI9C 4I9WD 3FMGH 4I18A 4PJIA 3KYNB 3OAZK 3D85D 3D85B 3C6LA 4LLYB 4XB8A 1C1EH 4JANB 4A6YL 4JN1H 3G9AB 4LLVA 1FZJB 1R0AL 4ALAL 4C56E 4XCFL 1A1OB 4DVRH 4U31A 2I60H 2DQFB 5KVMC 4P46C 5F1NB 5HYSG 4NGHH 1J5OL 3KPPB 1CGYA 4RQQA 1BLNB 1F6LL 3HZKB 2FATH 3VCLB 5C0RL 4L3CB 4RGND 4RGNB 1LEKA 4DKEH 1R24B 1TMCB 5EBGA 1JTPA 1TVDA 2E9IA 3D39B 4LKXA 4NQTA 4UTBH 5IROC 3VGGA 3VD5A 1ZVYA 4YAQA 1SJHA 3EYUL 4M1DL 3CX2A 2HLFD 2H3NB 4P9HC 5E56A 2CDFA 4CJ1A 3ZL4L 1ADQA 2ADFL 3FFDB 4G6JH 4UAOC 4POYA 1NGYB 5F89A 5I15H 1AQDB 3MZGB 2X4RB 5EPMA 2HT2D 5K9OA 1U3HC 1ZTXH 3WDHA 2HFGL 1BECA 4I2XE 5TGBA 1JWSA 2EXYD 2D7QA 2X4SB 3BKCH 3WS3A 4Y4HC 3ZYOA 2XNAB 5GGVL 4HUUB 3R06B 2VC2L 4M4PA 1KCRL 2DWEB 5F88B 3JWDH 3BRFA 4XPTL 2FX8H 4QT5B 2X1OA 3SHSA 3ZMRA 4UT6H 5BV7H 2ED7A 4P5MA 3WD5H 2OBGA 3ULVH 4I3RL 1MRCL 2BZDA 1LDPL 1WSST 5D2LE 5IJKC 4XH2B 2NY4C 4KVCL 1U8NB 3PGFL 4AEHH 5GZNC 1WEJH 2J4WL 4TVPH 4PTTB 3OGCA 3QUZC 3U30C 3ZHLA 1T0MA 1BEYH 4LRIA 1YEEH 5FHBL 2VOTA 4OZIE 2NY6B 3TN0B 4BSVB 2HMID 1YQVH 2OLDA 1S7WB 5DMYA 3WN5C 1FFNA 5CGTA 3RU8L 2QSQA 4DN3L 1U0QA 3G6DL 4HULB 3M17A 3BSZH 3OBAA 5AZ2H 1DN0B 4YWGL 1OP3K 4Z95L 1FL5A 1MREL 1MUJB 3I2CH 4ORGA 5H37H 3HC3L 4JFPB 1AQKH 2Z8RA 1TZIB 1H3WM 3BJLA 1IGTB 3C08H 2F53E 3MA9L 2IFFL 4M7LL 4LDOB 5IKCB 1FBIH 3LH2L 3V6OA 3FHQA 2XTJE 5JIIA 5TPWL 4LNVA 4JHBA 4XMKL 3IFLL 4I2XB 4C4KO 5E6IA 2PKDA 4FQLH 1J8HA 2NY1C 3OHXB 4OI9A 1S9YA 3OJVC 4NQXA 1DQDH 2WMPA 1N3NB 3IETB 1KEML 4CNIB 5J13B 2PXYC 3DSFH 5AYUH 3GM8A 3TBTA 4MNQE 1FORL 3PQYE 2F54E 2F58L 3G5VA 3LSOB 1Q8MA 4RMVA 4QGTA 5C0BB 3L7EA 4UIKL 5DHVH 1HYSC 5D2NA 5D2LB 3STZB 4TPRL 4J3UA 2XPGA 1YEFL 1IKNA 5FYLE 1S7VA 4YBQC 3O0RL 4GLRH 2DQDL 1G7PB 2VAAB 4I0PC 1K2DA 3BHBB 2YN5A 1XF2A 1P4BH 3ZTNL 1OVZA 4YHPA 2YZ8A 5CEYB 4IRSD 5CD3B 2Y5TA 4IRSB 1EV2E 1JF5A 4ODHH 4PJEA 1XGTB 4FA8A 2DLFL 1FNSH 2H8PB 1X7QB 3Q5TA 3S96B 2YS4A 1QR1B 1EXUA 2JB5H 35C8L 4XPHL 5DSCB 1S5HA 3ABZA 5BXFB 4OZFA 1RJYA 1VKXB 3K1KC 2VLRD 3U0TB 2VLRB 4D9LH 1IC7L 5J8OA 1KYOJ 5HD8C 3BQUC 4U1HA 1CDJA 2CIKB 1YMHA 2F53D 2F53B 4OSUH 1KTRL 5ANMA 3BGFB 3Q2CA 1CE1L 2XTJD 2XTJB 3L3IB 1N0XH 4FP8L 1FIGH 5KOVC 3G08B 4M1CC 5D7SH 4Z0XB 3OV6A 1DUYB 4XI5D 3S5LG 3VDCA 3IJYA 2ZNWA 4OLYH 5EULV 3O2VL 4KROC 2ZCHL 5IFJB 4JREC 2VKXA 2HKHH 3PQYD 2OTUA 4RFNC 3CCHB 2VH5L 2F54D 2F54B 4H88L 4JDTL 1HE7A 3OPZL 4NQUA 4UNTA 4NQDE 3CSPA 4KV5F 4PGEB 3ZO0A 2WIIB 1X5YA 2NYYD 3U79A 2BOBB 3CC5B 4UV7H 4YIQA 5JDSB 4FQ1H 5HI5D 3UPAA 5T5FH 1E27B 4E5XB 1U58A 4NCC2 4I5BB 3P9MB 5I1KH 3AMLA 2BVUA 5F7UA 4ZFFB 5INCA 3LN4A 3QXAA 5I73C 5D8JL 1IGIH 2YPLD 4XZUA 2YPLB 4B50A 5FCUL 5GSVA 4FXGA 2FHFA 4P23D 4QRQA 4BA8A 1IL1A 1YC7A 5DI8A 3VRJA 3HI5H 1T7XA 1N6QL 1N7ML 3RVTD 5E94A 5C6TH 1HQ4A 5EOCJ 4WEBL 3H9SA 5E2UL 3UBXI 2O5XH 3E3QC 3DTXA 4ODVH 1AJ7L 4WUUA 1UWGH 4D0BA 2FJGA 4H26B 5DMIL 2DM2A 1RMFH 4M61B 5E7FA 5D93B 2BY1A 5BS0E 4JVUA 1JYWA 1Q0YH 4HQQH 3U6RB 3EDFA 5DYOB 3MJ9L 4XVJL 2WWMC 4PJ9C 1MCOL 2FEDD 4FOMA 3FMGL 4OAWB 2W0KA 1U8QB 3I6KA 1C1EL 4MVBD 4QXGH 4ZFOL 4JN1L 2M26A 4HKJB 4M9PA 2B0SH 5LG1A 1S9VB 1XGQA 1QNZL 1QSZA 3WXWH 3TPUA 2I60L 4Z77B 2H41A 1NFKA 1HXYB 1G6RB 4PJIF 4R4FH 1I8IA 4NQDD 1GSMA 2V2WA 3OTTA 2EZ0D 2NW2B 3BIKA 4MDJB 4WW1B 3KPOA 2WUBL 3DMMB 1NAKH 3PP4H 4GXVH 4K7PY 4O58H 4WJ5A 5FOBA 5HGHA 3WO4B 1HOCA 4J4PC 4OCYH 4MLSA 6FABL 1YNLL 1I4FA 1ES0B 2R2BA 4DKEL 3MO1A 5TFSH 3LPFA 4CVWA 4JDVB 4UTBL 2DKUA 5BCAA 3JWNC 4R8WH 4HWEH 2KDGA 1LQSR 3NCJH 2LTQB 3AVEA 1BOGB 43C9A 3QCTL 1NCWH 2JIXA 5J9PB 5CEXB 4MNGB 3VE0B 4G6JL 3KNBB 5I15L 1CGUA 2VDLH 1PLGL 3RZCA 3O6FB 5DQ9A 3OX8B 1ZTXL 1IGFL 1TXKA 3CZFA 3J8F7 3BKCL 2CH8A 4X9IA 1IC5H 2DM3A 4L1HA 2MSPA 2IALB 2GUOB 4UNVA 2X70B 4EOWH 5GGTL 3PP3H 5L8JB 2HA1A 1IM3A 4HFUH 5F7LB 5BS0D 2FJFB 1IAKB 1OWWA 5CWSA 4NKDB 1TVBB 3JWDL 1QFWM 4UT6L 1ONQB 2VNCA 4U1NB 5BV7L 5CJOH 1IJ9A 5L2KD 3WD5L 5L2KB 4X6FB 4MCYB 1RIUH 2RB8A 5CSBA 4TNVF 2F74B 4FG6C 5GJSH 3SDDC 2FECL 1ITCA 4X8JA 5IVXE 4HD9A 4Y19A 2NXYC 3HUJF 1WIPA 2RR3A 1NC2D 1NC2B 1W72H 1B0WA 1RIVL 5C0IA 2YUVA 2VSDA 2BY3A 5J1AB 2QKIA 1EEZB 3KYOB 1S9WA 1INEH 4QOKA 3T65A 1BEYL 1YEEL 4JVWA 4NZTH 3DVGB 3K4ZA 3EOAB 1YQVL 3QULA 4PJAF 4Q74A 3MRPA 4F9PC 3BSZL 5AZ2L 3VXSB 5EWIH 2R56H 3MRFB 3V5KB 4OZGE 1AQKL 4HHAB 4LCCC 4D3CH 1L0YA 4G80B 1I1CA 3C60A 1CZ8H 1FBIL 3QYCA 1NPUA 4RBPH 1G7JA 1IFHH 3VXPA 4KMQA 3RIAK 3RVXC 1X5LA 4PJ7F 2VAJA 2X9XA 4JR9H 1TPXB 1DQDL 1FDLH 3O3BB 2Y7QA 3I84A 5CBAB 2A6JA 3DSFL 1GJIA 4NUJA 3ZKXC 2PNDA 4GRLD 4GRLB 5AYUL 3C5JA 3PGDA 4MZ2A 4LK4A 4PGDB 4JPKH 4F33B 5F6IB 4NSKA 3BPNB 5KZCB 3FO1B 4J3XA 1UB5B 4NBXB 3O6LH 3Q5OA 4P2QD 5HY9B 4P2QB 1OB1B 3DXAD 3DXAB 2FL5B 3UTSB 2CUIA 4UOW0 5GRJL 4U1GC 1N6VA 5FHAH 1KV3A 4OGYL 5EG6C 3FT4B 1NLDH 3HC4H 4YXKL 4RRPG 2XWBB 1R5WA 3HCVB 1R6VA 1URLA 4M8QA 4G42B 2W0FA 3MRQA 3E6FA 1FNSL 3MBEC 3TIDB 4GQPH 3WNMA 2JB5L 5KSUA 4UOJA 4YHIB 2AK4E 3ME0A 3QIWC 5DS8A 1I9JL 5T1LA 1RZKH 4X6DA 5A2JH 4D9LL 3IFNH 4OZGB 4PJEF 5C3LD 2NY6C 4N5UA 3TN0C 3D18B 4OSUL 2GSGB 3EJZD 1NGQH 3DI2B 4XB7A 5C3TA 4GAYA 3VXTA 4Y5VB 5I2IB 4EBQH 3DX9A 2HT4D 4XPGH 1FIGL 2HJLB 5D7SL 2AJSH 5EFIA 2XKNA 3DBXB 2EXWD 2ITCB 5FA4B 4D0DB 3MRNB 4HPYH 3SGJC 4QLRA 1QFWH 2HKHL 4G8EA 4UQ2B 4TOYH 1WTGT 2BVQA 4F7TA 2DTMH 4KTEL 4S2SA 4NUGH 1MVUA 1FC1A 3UPRB 2OL3H 4UV7L 3FT3B 4RISH 3RPKA 4OF8A 5IQ9A 5T5FL 5DK0B 3DYOA 2RCSH 3SDDA 5I1KL 1UZ6E 2YXFA 4QRPE 5HJ3B 5F8QC 4BH7A 1HCFX 1IGIL 4KUZH 4S1RH 4O00A 4YPJA 4EI5D 4EI5B 4JAMB 4J3OC 4S1QL 3MNWA 4PJFA 3HI5L 4ZOAA 2B39A 2J8OA 2V7NA 4JRXE 5EZJB 3KYNA 1UA6H 3DOSA 3D85A 3N9GH 5T3XH 1KYOK 2HTKC 4LLYA 3V8OA 4JANA 2AK4D 2AK4B 1FZJA 4G6KH 2G75B 1A1OA 4F9PA 3MLWL 3O4OC 2DQFA 5F1NA 2OR7A 5CZXD 1Q0YL 4HQQL 4U2YA 3KPPA 1BLNA 3VXME 3HZKA 2R0ZH 1MCLA 3VCLA 1WZKA 3PWUB 4X4YB 3FN0H 5HHXH 4L3CA 2CSPA 5DUMH 3RX5A 4PJHE 5GRVK 2XZZA 1DR9A 1CICC 4QXGL 1KXQE 1R24A 2PW2B 2W9DH 3D39A 1VFAB 2NTSP 3TA3D 5FFLA 3TA3B 3BRDA 3WXWL 2H3NA 2R23B 5E24E 1NBZB 3FFDA 4R4FL 3QB7C 2XQYK 1NGYA 1AQDA 4Y5XC 2X4RA 1OLZA 4QHUB 5I75B 4NRXB 2ZUSA 4GXVL 4O58L 3NCBB 5DEGB 2WLYA 2BVPB 5E8EB 4NO5B 1JRHL 4OCYL 2X4SA 5A2IH 5E03A 4Y5YB 4QRPD 1SMAA 3M07A 4Z7WF 5TFSL 2XNAA 5GS3A 1E4WL 1HHIB 3MTRA 4GMTH 4HUUA 3R06A 3CZJA 4R0LC 4HWEL 4HUWA 4R8WL 3SO3C 3NCJL 1JBJA 1A4KB 3MLZH 2DWEA 2DN7A 5F88A 4QT5A 3KPQB 1B6UA 3EKCA 4JRXD 2VDLL 3I02B 1M71B 1A6ZB 4GBXC 4XH2A 1A3RH 3SKOA 1H3UA 1DUZB 1H3VA 1U8NA 3ES6B 1NMCC 1H3PL 4EOWL 4PTTA 4HFUL 4YXHH 1MHPL 4R3SB 2V5MA 4Y2OA 3ESUF 1CDYA 1IMHC 2V5YA 1I85A 3TN0A 4BSVA 2NZ9D 3VXMD 3VXMB 4P2OC 5I76B 1S7WA 4FQCH 5CJOL 5GJSL 1RIUL 2ZG2A 2UY7A 4LU5H 2Q8AH 1DN0A 4GQ9H 4WI7A 3O8XB 1IVLA 5DF0A 3SE8L 4KHTL 5IOPB 1XIWB 1MUJA 1W72L 2MFNA 3VWJD 4I77H 3K81A 4JFPA 4I48B 4JPWH 1TZIA 4BFEA 4UTAH 4QRRE 5I8CB 1IGTA 4NO2B 1ZLWK 1KC5H 5IKCA 5F9WB 1U8LA 4QHMB 3TIEB 2GSIB 4I2XA 4PPTA 3OHXA 4ZFGH 5EZOL 1N3NA 4GG6F 5EWIL 3IETA 5KSAC 4YHOH 4CNIA 1Q0XL 4R4BB 1T6VN 2BVOB 2PTTB 2XZAH 4WENB 2D0FA 3EDKA 4D3CL 3JV4B 3MSPA 4IHOB 3ARFB 2IG2H 3DMMC 4F9LA 1GHFH 3WO4C 1N59B 5ABDE 2EEAA 3LSOA 3KLSA 4F7CB 1IFHL 4NNYB 4LSRL 4H0HB 1N5YH 2CDGB 3P4NB 1K4DB 5D2LA 3WFZA 5ICXB 3STZA 1JZ5A 1UM4H 2F8OA 4JR9L 2LTQC 3ULUC 5BRZD 5BRZB 1AGFB 1FDLL 2OXHA 1A7RH 1G7PA 2VAAA 3FN9A 3BHBA 5IBLC 4OZIA 5CEYA 2IPUK 5CD3A 2G5BB 1U3YA 4IRSA 1XGTA 4JPKL 3QDHA 1LP9E 3C8KB 2H8PA 1X7QA 4EQ2A 3S96A 1QR1A 3I6GB 5DSCA 1C5CH 5BXFA 4PJDE 4IJ3B 3PWVB 4GMSH 2XYCA 3O6LL 4XC3L 1VKXA 1SY6H 2A9ML 4UZGA 2AJZB 2VLRA 3L3KB 3U0TA 4CADB 3HAEA 3TP4A 5IFHH 4QRRD 4NO0D 4HV8B 4QRRB 5DQJB 3HZVB 2CIKA 3HC4L 1A6WH 1NLDL 1OTSC 2F53A 1MFAL 3ARYA 3Q6GH 1FAKT 3L3IA 4LVHB 5GHWH 4ZD3H 4YDVA 2OR9L 4Z7WE 4NM4L 3G08A 4HWBH 1GRWA 2Q20A 3JUZA 4Z0XA 1DUYA 3SDAC 3ZDXF 4X9BA 4P99A 4L3EB 1RZKL 1X4YA 5DDHB 5IFJA 1FVEB 3IFNL 2JJVA 4HDIB 3S3PA 1M7XA 4APQC 5CIPH 3VI3F 2GJJA 3CCHA 1J1OH 2F54A 3L9RB 5DK2B 1J0IA 2ADJB 4GRWF 5F1IB 1NGQL 4PGEA 2Q7YB 5LJYH 3KYKL 2WIIA 4EBQL 4U1JB 2BOBA 3CC5A 3LY6A 5JDSA 4OCXH 2EIZB 5KJRH 1GGTA 4XPGL 1E27A 1QHOA 4E5XA 4I5BA 3P9MA 4BELD 5JHDE 3CFBB 4ZFFA 4NBZB 4KQ3H 1RZGA 3RIFK 2YPLA 4IM8A 1A7BA 1KENH 4HPYL 3OJDB 1R3IH 4TOYL 2YD7A 4HK3N 2DTML 1LP9B 2H2PD 4NUGL 2G60H 2OL3L 4RISL 4N8VB 3L3OB 1QA9B 5IK3A 3T2QA 1MI5E 4H26A 5CD5C 3IB4A 2N56A 5ERWB 4M61A 4KUZL 1P6FA 4F7PB 3BD4A 2NY1D 2KL6A 3U6RA 5A40E 5DYOA 4LLAA 4LFHD 5HVFB 4OAWA 4GG6E 5EB9A 1UA6L 5DHXB 3CX5K 5T3XL 1U8QA 2VDRH 4I8DA 2C1PB 3OZ9H 3BKMH 2AJXH 4HKJA 4UUJB 5ALCH 3FQTB 3N1FC 2W60B 1S9VA 2AQ3A 3B2UD 2APWA 4EI6B 5TJWK 4Z77A 3K8KA 3QAZB 1HXYA 1G6RA 1EMTH 2VIRB 2ESVD 2ESVB 4NZUH 4F37F 4HC1A 2QQNH 4NQDA 4M3JA 2NW2A 4MDJA 4WW1A 4H5SB 4KXZH 1WBXB 2YD2A 2R0ZL 4IDJH 3FN0L 5HHXL 2VLKE 5DUML 3MFGB 5C0AE 5JHDD 5JHDB 1ES0A 4LASL 1ETZB 1AFVH 3DUHA 2CXKA 2W9DL 2XXCB 4JDVA 4TULL 2QADD 2QADB 4NWUH 1ZVHA 3O2WH 3W82A 5C86A 2Z8WC 5JXEC 2VISA 3AU1B 2CQVA 1BOGA 4MYWB 3IXAB 1I3GH 5J9PA 5CEXA 3E3QE 3VE0A 2A6KB 5IMLB 4WGWB 2DI8A 3KNBA 1KCKA 4ZNCD 1WAAE 4NQSB 3O6FA 5DA0B 2GI7A 3OX8A 4MQTB 5HD8D 1CFSB 2AXFB 3ESVF 4URTB 2ICEB 5DGRA 2AKRB 2IALA 2GUOA 2X70A 1CLOL 2CD0A 4GMTL 3EOBB 2FJFA 1IAKA 4RX4D 3MLZL 1DLHB 4NKDA 3TCXA 1BQLL 1TVBA 4FFWD 1W0VB 4XPFL 1ONQA 1CL7I 5L2KA 4X6FA 4CUCA 4MCYA 2F74A 1FCCA 4QXTB 2DKMA 2AXGB 4KU1A 5HVWA 5ECJE 1A3RL 4OLEA 1NC2A 3DROB 2EO9A 5L9DH 2YRLA 3PGCB 2RGSA 4UT9H 3U83A 1X44A 4LNRB 1DCLA 5J1AA 1V3JA 1EEZA 3KYOA 4YXHL 3GBNH 4WNQB 5D5MB 5E95B 3BDXA 4ERSH 1I8KB 1OGAE 3DVGA 2UWEB 1RULH 3EOAA 4DJMA 4EIZC 1PGRB 2YPKB 4L9DA 1T21B 2VLKD 3UTOA 2EDNA 4PGBB 5C0AB 4LU5L 5C0AD 2Q8AL 3VXSA 4GQ9L 5E4EC 3MRFA 1WWBX 1RUPL 3DUSB 3T8XB 5CLTA 4KQ4H 3ZHKA 1Z9LA 4NJAH 3V5KA 4I77L 2B5IB 4HHAA 4R2GC 4JPWL 1ZLUH 1FO0B 4UTAL 4G80A 4XPBH 4PG9B 4YPGB 2X4TB 2ITDB 4P5TB 3Q5YA 4R4NC 2Q87A 1HDMB 1CXEA 1MAKA 1XZ0B 3FRUB 4RZCB 4OZFG 1X5ZA 4LF3B 1BFTA 4ZFGL 1SBBA 1YY9C 2YD6A 5I1CH 3O3BA 3LB6C 1G9NC 4YHOL 1MCPL 2VR5A 3P3YA 5CBAA 1NGXB 2JJTA 1QO3B 1ZGLM 4GRLA 1TFHA 5BW7C 1WIUA 2IG2L 4PGDA 2M1KA 1QRKA 4F33A 1UGNA 5K9KB 4HF5L 5I66B 3AM8C 3FO1A 5IBUB 2Y36H 3W81A 1UB5A 5HYIA 5IVXA 1N5YL 3PWNB 5HY9A 4P2QA 3QFDB 1OB1A 1JHKH 1V3LA 3DXAA 2FL5A 5F7DB 3UTSA 5IEHB 3EHBC 3RKDD 1G84A 3UP1A 3DV4B 3KLHD 3FT4A 3CUPB 5HHOE 4BH8B 2XWBA 3HCVA 1KXTB 4KTDH 3H9YA 4HKBB 4PLKD 4N0UE 1J1PH 2DF3A 4G42A 2JCCE 3GMPB 3RWJB 4LP4A 3TIDA 5I1LB 1NCUA 5ICYB 3NIDF 1C5CL 1X5FA 1R5IB 4M7KL 4YHIA 4GMSL 2C3HA 2NY2D 2NY2B 1YECL 4ZS6D 1SY6L 5IMOB 4LRNH 1CDUA 4OZGA 1O7VA 3HKFA 5IFHL 1A6WL 2DI7A 2GSGA 2O5ZH 4Y5VA 2OS7A 3Q6GL 5I2IA 1DBBL 5GHWL 4ZD3L 3EOYG 1NCAH 3HLAB 3LCYA 4HWBL 2HJLA 2W9EL 1FZMB 4K3EH 1W0YT 1KLGB 1CN4A 2DJ4A 4LCIH 1KOAA 1NFIB 3ARGC 3BN9C 3DBXA 3RVVC 2ITCA 3ZSSA 5FA4A 1JNLH 4D0DA 1T1ZB 3RY4A 2YA2A 3MRNA 1IQWH 2P24B 4Y2DB 4Y2DD 4KK6C 3S98A 1WV7T 4N8PA 4UQ2A 4Z7OF 1J1OL 3DPBA 5F3HB 4LLWB 1CLYH 3QH3B 3UPRA 5HGDB 1NC4D 1XMWA 1NC4B 5E2VL 4TSAH 3FT3A 3QEHB 1JPSH 3BH9B 3S36X 5KJRL 5DK0A 5EBLB 3VH8G 3MCKB 3V4PH 1T3FB 4LSQL 5HJ3A 1E6OH 4X7EC 4KQ3L 1T66D 2W65B 4GJTB 3NH7L 2RQ8A 1KENL 4RFOH 4JAMA 4EI5A 1MLBB 5HHOD 2YEZB 4POZC 1R3IL 4X7DC 2XG5A 1FL6B 4N0UB 1G0XA 2ENSA 3LDBB 2JCCB 3FZUC 2M2DA 1E28B 4JFQB 4HS8L 4D9QE 5EZJA 5IHBA 4OF7A 1OAYH 3RDTC 2G60L 5CKGA 1ZVSA 3HRPA 5AWNH 2AK4A 1CBVH 5CAYB 3EO9L 3MLPA 4XRCB 2G75A 3G5ZB 2UZYB 3VW3H 1MIMH 4LKCA 1YYLH 4OLXH 3UJTH 3VDBA 1I1AC 3QDJE 3CDYA 3O9WD 3O9WB 4OFVA 2RFXB 1A6UH 4IJ3C 4X4YA 3ARRA 3PWUA 1A6VL 5D6DC 5J11B 3KPNB 3CVHH 4EUPB 3RAJL 3RWEB 4HGMA 3OZ9L 2PW2A 2OTWB 1VFAA 5ALCL 1D5IL 4ZTOH 2DWDB 4WFHE 2DDQH 5DHYB 3TA3A 5I1JH 3IDYC 2R23A 4L8BB 4R26H 3TJHD 1EMTL 3MRRB 1NBZA 1EBAA 2FGWL 4PRPE 1NANH 4NZRH 4NZUL 4KVNH 4K8RH 4QHUA 1K6QL 4CMMB 4NRXA 5DEGA 3TGXA 2BVPA 4IDJL 5E8EA 5HHPB 1R3HB 3FB5B 3QHZH 1RUMH 4YEEA 4Y5YA 2YUXA 1I75A 4ONFH 5FV1L 1NBYB 3EJYD 1HHIA 1UJ3C 5FYLH 4NWUL 3ORJA 3RGVD 2I5YL 3RGVB 3H3PH 1A4KA 2GCYB 3QIUD 3QIUB 1I3GL 4POUB 3KPQA 4D9QD 1WBYB 3I02A 1M71A 3TT1H 1A6ZA 4FQQB 4LVEA 5IM7B 3QQ4B 2X4PB 5AEAA 1HHHB 5KOMC 3ULUF 2EDXA 1DUZA 5DURB 3VA2C 5C2BL 3ES6A 5IB4B 2X5PA 2XT1B 4WWKC 1Z0MA 4JEGB 4OZ4B 3EYVB 4I4WB 5TDOB 4R3SA 3QDJD 3QDJB 2L7JA 1NAMB 2D03H 3D1MC 3GSNH 1KGCE 3VXMA 4YJZL 5I76A 1W8NA 4KMTH 2IQ9H 2E7HA 1IQDB 4NKMB 3NFPB 5D6CB 5IW6B 5B3JE 3L3GB 3V0WH 3O8XA 4JY6B 5IOPA 1XIWA 3VWJA 5L9DL 2HFEB 1FGVH 1KIQB 3QT2A 5F72S 4I48A 4UT9L 5D1ZC 4WFHD 3C5ZD 3C5ZB 4N0FB 2CRZA 2BJML 3EGSB 4NO2A 4EDWH 3TNMB 4QTHB 2NMSA 4PRPD 3S34H 3T08A 3BDYH 4MB4A 4JHWL 5E9DE 1S7RB 4PJBB 1CFVH 4QHMA 1HK6A 5MENB 3TIEA 4H1LB 2E7LA 1RULL 2GTWB 2GSIA 4HUKB 4MA1C 1QBAA 4JHZA 5CP7B 4N9GB 5DMGC 5DLMH 5GS2D 5C0EB 4G9DB 3QAZC 3PDDA 2PUQT 4CMHC 4R4BA 2BVOA 1CT8B 2PTTA 2CDEB 3JV4A 1JYNA 1BJ1J 4IHOA 3ARFA 4XPBL 1N59A 3C8HA 2DMKA 3CVIH 5CP3A 4F7CA 3K3QA 4NNYA 5AG9A 2H6PB 1JZ7A 2EH7H 3P4NA 1K4DA 1F90H 3OG4B 3RVWC 5D72L 5ICXA 2QJDA 4DKDC 1YPZF 3A6BH 4N0YL 4HGWB 5C09B 1YYMH 2IJ0C 5FGCE 3JVGA 1AGFA 5FOJA 5BRZA 5I1CL 1IEHA 2A6DB 5LGJB 5C70A 4OCRH 15C8H 4M6OH 4NKOB 3NCYS 1MRDH 2G5BA 1KGCD 3MBXH 2VDNH 5I71B 3C8KA 3O3EB 3NACH 1JPST 3I6GA 2CR3A 4IMKA 2YR3A 4JFFD 5ALBH 4JFFB 2EDYA 3VJ6A 3PWVA 2P42B 3WKNA 4HLZH 4F2MB 1JHKL 4ZSOE 2AJZA 3L3KA 1SVZA 3RJQB 2FHBA 4NBYB 4CADA 1CIUA 1BIHA 4HV8A 4QRRA 1TDQA 5DQJA 3HZVA 2ZSVB 3VFWB 3L3DA 4P4RB 1LO5B 4KTDL 3MC0A 5HI4C 1A3LH 4WTZA 5GQBA 3TJEL 1D9KD 1D9KB 5FUZH 3ARZA 4HW6A 3QHTC 2LU4A 2XTLA 1JGDB 5F7HA 3SO5A 1L0XA 2BXZA 2KPNA 5IT2H 5DDHA 1FVEA 4LRNL 4X6EB 3DWTA 4HDIA 3GJFB 3VGBA 4WGVB 1SJEB 3L9RA 5DK2A 4KH2A 2ADJA 3B5TA 5F1IA 2O5ZL 1BVLB 2Q7YA 3MCG1 4RMRA 4U1JA 4BM7A 1NCAL 2JJSC 2EIZA 1MHEB 1Z2KA 2YBRB 4KKNA 4LIQH 2R0KH 2MCG1 3CFBA 4LCIL 4NQEE 4X98B 5FGCB 4RBPK 3KPLB 4NFBA 3OJDA 3ARBC 3FKUS 5CCKH 1OY3B 2VXUH 1CLYL 1BQHB 4WW2B 1LP9A 5T5NF 4FXKB 4GFTB 4H8WC 4N8VA 2AI0H 1JPSL 3SE4C 2FWOB 3L3OA 2I9LA 3WNLA 1QA9A 2Z93B 3R8QA 4BZ1L 3QUXC 4ZSOB 1BQUA 1E6OL 2ENYA 5ERWA 1U8JB 4F7PA 1U95B 2X6MA 3I3EA 4RFOL 4Y4KC 4IOFC 5LGKA 4XWOD 2ZNXA 3A6OA 3NBNA 1ITBB 4OM0H 2H26B 4J3WA 4YHML 4M93B 3D0VB 1G9MH 8FABB 3Q6FB 2K1MA 4LEOB 1PG7H 1OAYL 2C1PA 3FQNB 4S0SD 1UXWB 5AWNL 1MCJA 1CBVL 4LDLB 4UUJA 4QWWD 3FQTA 3C6SB 2NY0C 2RJMA 2J8UE 2W60A 3VRLF 1KIRB 1T0PB 1XGYH 4EI6A 3DHJA 4CDHA 3WBDA 2VIRA 4UILH 1MFNA 3UJTL 2ESVA 3GBLA 4AEIH 1Y0LB 3VD4A 4H5SA 1WBXA 4N0CC 1A6UL 5ACLA 3TYGH 1MAML 4OLWH 5KSBB 3CVHL 3GIVB 4K71B 5JHDA 4NQED 1GC1C 4NQEB 1ETZA 3CXHJ 4JKPL 1U92B 3SKUD 1CIDA 1T89C 1BGXL 4ZTOL 3MPCA 4F57H 3AU1A 3CLEL 3VFRB 2FJHB 3W9EB 5I1JL 3NPSC 1ZLVK 3IXAA 4R26L 4DGVH 4PJ8D 4PJ8B 3G9VA 4RDQG 3VD7A 2A6KA 5IMLA 4ENED 4NZRL 5JDJA 4NQSA 5HYSB 4KVNL 3CLFH 4K8RL 5TF1H 4BSWB 1Q94B 1QVOB 4XCEB 2HRLA 1OAXL 1CFSA 2IWGA 2JELH 2AXFA 4XNQB 1RUML 2CXGA 4MB3A 5E1HB 2ICEA 2FCBA 4U33A 3UMTA 2AKRA 3UC0H 3FB8B 3OSKA 5FYLL 3EOBA 2B1AH 5E8OA 2Z31C 4GUPB 4RMQA 3H3PL 5DFVC 2VLJB 1DLHA 3SQBA 1R5VB 4FS0A 4KKAC 4NC0B 4K3JH 2H32B 3S36L 2M8XA 4CU8A 1K4CB 3TT1L 2ADGB 4FTVE 4OFDA 4QXTA 4MNHB 2AXGA 3V7AE 5F3BB 5CGYC 1YMME 1YEIH 2B1HL 3RWCB 2DM7A 3DROA 3PGCA 3KLAB 4W6WB 4LNRA 2EDOA 4ZXBD 4ZXBB 4HCRA 1WVZA 5DD3L 2X1PA 1IAIH 4WNQA 4KRPD 5D5MA 4KRPB 1CWVA 1RD6A 4X4XB 1I8KA 2D03L 3GSNL 2UWEA 4ODXB 2C4XA 5DJYB 2YPKA 4KMTL 4I3SH 3UEZA 4WU5B 5HYQA 2IQ9L 3LEYL 1T21A 3PL6C 3MOBH 5C0AA 2VJXA 3FQUB 4U0QB 3DUSA 3T8XA 1VB9A 4X80H 1U93B 2Y72A 1FO0A 5C9JB 4EDWL 4YPGA 3BDYL 5J11C 2X4TA 3WEXB 2ITDA 4P5TA 4HC1L 1HDMA 3W11C 1XZ0A 3FRUA 4V2BA 4ZUTB 5IWLA 4LF3A 4JFYB 4GAJH 1OARH 5CHNB 5D1QC 3RNKB 3HAEG 3KDMB 5DLML 3NABH 3DSNA 1S3KH 1G1CA 1NGXA 4OQ1A 3LOWA 1QO3A 3EBAA 1HHJB 3IDXH 5FDYA 3BE1L 1DVFC 1GIGH 3KJ6H 1ZMYA 5I66A 3CVIL 4TN9A 4U0RB 5IHZB 1EHNA 1WZ1H 5GPRA 3WDJA 2F9BT 4FTVD 3CAFA 3E2HC 4FTVB 4AY0A 1MPAL 2Z9TA 2EH7L 4FQIH 1A1NB 3PWNA 1YMMD 1YMMB 1NCDH 3QFDA 5F7DA 5IEHA 1ZANH 3A6BL 4KC3B 2XN9D 2XN9B 5DD6B 5F1OB 1P5VA 3DV4A 4U1IB 5JMOC 3QNXB 4OCRL 3CUPA 15C8L 4BH8A 4M6OL 1NDMB 1YNTB 3MODH 3V0AC 1L4IA 2NR6D 4HKBA 3X12B 3X14B 1MRDL 1Z9MA 2X4QB 1TITA 3GMPA 3RWJA 3GI8H 5I1LA 2AGJH 1A0QL 3CPLB 3NACL 5DZOA 4KZDH 3BPLB 5ICYA 2XXMB 4PD4K 5C2UB 1R5IA 4P2YA 5ALBL 4ZAKD 4ZAKB 4IS6A 3A67H 3BP6B 4RMWA 5IMOA 2WK2A 2DQIH 1F13A 1OHQA 1BJMA 3LQAH 4LHQB 3U0WH 1PZUB 4YLQT 4KAQL 1A3LL 1NQBA 3HLAA 1S7UB 2NX5E 5FUZL 4U6VH 1T7ZA 1XR8B 1JZ8A 2L4OA 3F6LA 1KLGA 4KK9D 1FNAA 4WUKH 1NFIA 5HDBF 1F97A 4YHNB 3NGBC 1TNNA 1T1ZA 5IT2L 2P24A 4Y2DA 3VXOB 5F3HA 3U2SB 4LLWA 5HYEA 3QH3A 3RZWA 2MOVA 3OAYH 2FBJH 5HGDA 5DZNA 1NC4A 5GJTH 3T3PE 3QEHA 3BH9A 1CGVA 4G7VH 1JNNH 1ULVA 5EBLA 1NBQA 3MCKA 2WBWB 3IJHB 1T3FA 1NEUA 2R0KL 3S5LB 3IFOB 2W65A 4Y16D 5HYFA 4Y16B 2YA0A 4Z7UE 1MLBA 2WNGA 2X89D 2YEZA 4KKCC 5DRWB 1KTDB 5CCKL 2FZ3B 4DUVA 3ZKNC 1FL6A 2JE8A 2VXUL 3GFUA 4KKLC 4L5FL 4N0UA 4WVRA 5B8CC 5KVGH 2JCCA 1E28A 4JFQA 4XVUD 3UO1H 2WAHA 5DD1H 3TM6A 3FJTA 3STLB 1MHHB 2OK0L 2H1PH 2AI0L 5E00B 1JP5A 4P9HH 3ZYIA 2P45B 4XBEH 4XRCA 3G5ZA 3MZTA 3O81A 3FQXB 5BZWB 4NWTL 3IAPA 1JFQL 4ETQB 1ZA3B 3ARPA 3O9WA 2EKJA 2RFXA 3RX7A 4X5LA 1V3MA 3F7PC 4OGXH 4ETYA 4KZEH 3KPNA 4EUPA 4W6XB 3RWEA 1PG7L 4WY7L 2W07A 4GLRI 1HCVA 3GMMB 4S1DD 3THML 2OTWA 1XGRB 2DWDA 5CUSL 5DHYA 3ZKMC 1XGYL 1DE4B 2IF7A 4L8BA 1TZHB 3MRRA 4UILL 3MRIB 5J1TC 3UZVB 2E3VA 4YDIH 1LK2B 3NCMA 4CMMA 4HLZG 4AT6B 3PIQB 5HHPA 4OLWL 1R3HA 3FB5A 4FFVD 1VENA 1XEDA 1RURL 1F4XH 1NBYA 1DANU 3MLYH 5AUMB 3I9GH 2XQBH 4Z7UB 1MFCH 4P3CH 3RGVA 2R2CA 3BISA 3CFJB 2GCYA 5IVNA 3QIUA 4WO4C 2EYRB 4Z0BH 2OXGA 4PB9H 1AI1L 1WBYA 4CGTA 5J0BA 5TF1L 4FQQA 1ZHBB 5IM7A 3QQ4A 2X4PA 1HHHA 1KIPB 4UB0H 2JELL 5IB4A 1N5AB 3WFEH 3BMVA 3UC0L 3DI3B 4NNPH 4OZ4A 3EYVA 4I4WA 1FLTX 2B1AL 5TDOA 4U3XA 2KZ1B 3TZVC 3QDJA 1VEMA 4JQXC 1NAMA 5MI0C 4U7SA 4K3JL 3CDGB 5HDBE 5I1DB 1F58H 1IQDA 4ZTPH 1HZHL 3NFPA 5J6GA 3B9AA 3L3GA 4N5ED 3MACL 4JY6A 5FM8A 4LSTL 4MAUH 1YEIL 4HEME 1B88A 2IQAB 2HFEA 1KIQA 4PB0L 5IW3A 1ORQB 3C5ZA 4N0FA 3EGSA 4JFOB 4M93C 3TNMA 4QTHA 3UTTD 3UTTB 3SCMC 4FN0A 1S7RA 3NZHH 3ZTJG 1YZZA 3GNMH 4OBRA 4DEPB 5MENA 1YEGH 4H1LA 2GTWA 3BZ4B 3PF2A 1VFBB 5CP7A 4N9GA 4OFIA 1BFOB 3TO2B 4FHBD 3MOBL 3TBYB 5C6WH 1AXSB 5C0EA 2ERJB 4G9DA 4X80L 2AEQH 1CT8A 1YJDL 1Y18B 2CDEA 2UWEF 3VFVB 3JTSB 4QY8B 4E41E 2J5LB 1E4KC 1N2RB 1X5GA 2DYPD 4ODTH 4KPHH 1IGJA 5FM4A 3SE3A 5TE4H 4NCC1 3QCUH 2H6PA 1QFPA 5B39B 1MEXH 4GAJL 5ISZB 4HGWA 5DJAB 3NABL 3HE7C 5C09A 3SGKC 2A6DA 5LGJA 1BX2B 1S3KL 3OAZH 3U36B 4NKOA 1JRHI 2IPTH 2HH0L 3IDXL 1H8OA 4K55A 4R7NB 1GIGL 3ULVE 3KJ6L 4OCSH 5HDLA 2WZPD 2DBJA 1BBJB 3O3EA 4ZFOB 4LHUD 2R69L 4LHUB 4MMZC 4ODBD 2YZ1A 4JFFA 3IXTB 3IVKB 4WV1B 1NCDL 4YZFF 1KPRB 4F2MA 1WT5C 3QIBC 4BFGA 1ZANL 4TVPE 3BI9X 3RTQC 3MRCB 1QLRB 2HYMA 3VFPB 2ZSVA 2VWEC 4MSWB 1M7DB 2NY3D 2NY3B 5C08E 3VFWA 5A3ID 5AD0B 4P4RA 1LO5A 3STBA 1P7KB 3RWGB 4OM1H 1D9KA 5JXAH 2NTFB 4BQCA 1RZJC 3HA0A 1EO8L 2AGJL 4KZDL 1D5XB 1JGDA 1ZHLB 4U7KA 1DSFH 2CKBH 5DC9B 3A67L 4HXBL 5E0QA 1BVZA 1SMOA 4X6EA 1MCCA 3GJFA 1SJEA 5DD5H 4GW4B 2OMNA 2XKUA 1JCKA 4KUCD 1LHZA 1BVLA 3D69B 5J57B 3F7YB 4G3YH 2H45A 2AP2A 4AZ8A 5HDOA 4N9OB 1ZLUK 4WRLA 1MHEA 4PG2A 1P4LB 2YBRA 3OXSB 4WUKL 1F45A 4X98A 3ZYZA 1JWMB 3E0GA 1FVCB 3KPLA 1UCTA 3AB0C 3OKDB 3T2PA 1UC6A 5LWYH 5BV7B 1KN2H 2FX7L 5IHLB 3ULVD 1BQHA 4WW2A 2JJWA 4FXKA 2B4CC 2FBJL 3CH1B 2A77H 4LSDA 5AG8A 2FWOA 4G7VL 1JNNL 2VZ3A 3V6ZB 5C6PB 2Z93A 4Q6IB 4ZSOA 4LMQI 4K07A 3KPRE 4TVPD 3RBSA 4GRWH 1N0LA 1U8JA 3C8DA 5I19L 5C08D 4HUXB 5C08B 2AQ2A 3E1F1 1OP3H 2H26A 1TZGH 5ADOL 3D0VA 3U7WH 4M43L 4DGIH 3Q6FA 1NMBL 5FXCH 4LEOA 2ZKHL 5KVGL 2V17H 4PIRF 2H1PL 3FQNA 1UXWA 5KANI 4LGPB 2XI9A 4NT6B 3V52H 4P9HL 4XBEL 4PY7B 3C6SA 4D9RE 4TRPL 2ZUXA 4P49A 1KIRA 3SJVE 1Q38A 1V7ML 5C0DB 1TIUA 5IB2B 1A8JH 1HWGB 2Y07H 1Y0LA 3BPLC 1E4KA 3VU2A 4L8SC 3UYPA 1IBGH 1EAPB 4OGXL 4KZEL 5KSBA 4R90H 5D7IF 3GIVA 5EH1A 4EEEA 3ZKSD 4EXKA 3L3HB 2AEWA 4NQEA 2ATPB 1OP9A 3WIHH 4MXQD 1JK8B 5JW4R 3VFRA 2FJHA 3W9EA 1SHMA 4PJ8A 3X3FH 3RY6A 4YDIL 1N64H 4I1NB 5HYSA 5I1EH 2NNAB 3JBG7 1Q94A 1ODAA 3IDNB 4FZEH 1P9MA 1QVOA 3RFZC 4XCEA 4BQBA 4RMSA 1I9RL 4XNQA 3VFSB 4AEEA 3LRHA 3VG0H 3KPRD 4L29B 3KPRB 3MLYL 3I9GL 2XQBL 3FB8A 5I9QC 3T2NL 4GUPA 4P3CL 4F58H 2VLJA 2B8OT 1R5VA 3IU4H 2H32A 3TH2T 4Z0BL 4PB9L 5EA0H 3BDBA 1K4CA 2CK0H 3BP5B 2ADGA 2WP3T 3P4MB 2DL2A 5SWSE 4MNHA 3RHWK 5F3BA 4UB0L 4FQXD 4FQXB 3NIFF 3RWCA 4D9RD 3KLAA 3SJVD 5FA3B 3SJVB 3WFEL 2QSCH 1BPVA 4ZXBA 5FCSH 4ZS7H 1RJLA 4S10A 4X4XA 3TPKA 4ODXA 5DJYA 5CZVH 1AHWB 4WU5A 1BAFL 1KLUB 4U4BA 1PSKH 3BH8B 1IAOB 1OQOA 3HMXA 3FQUA 4MAUL 3QUMH 4OZHE 2HVKB 5I0ZA 5HI3C 1U93A 4U1KB 5C9JA 3K4DA 4KKBC 1GPOL 3H42H 4OJFL 3WEXA 2BFVH 2MMXA 1QRNE 4PRIB 4Z7VE 2Q8BH 3GNML 2XA3A 5CZKA 1YEGL 1SJXA 3QJFB 5FGBA 4ZUTA 4E42B 2XACC 4IRJD 4IRJB 4JFYA 3OKMB 2QQQA 5CHNA 3RNKA 3KDMA 5M95B 3GSXB 4LPWA 2A38A 3N1QC 2AEQL 3IS0X 4PJBF 1HHJA 3MLUH 3ZE0E 1MFEH 4LGSB 4ONGH 1FN4B 4KPHL 4AH2B 3BOVA 1CDHA 1OSPL 5IHZA 1K3ZA 2GTZB 2A73B 5TE4L 4FTVA 5SWSD 2BVYA 3QCUL 1EZVY 2EDEA 1A1NA 4FQHB 1SEQL 1YMMA 1FPTL 2Z0BA 1D5MA 4DUXA 1MEXL 2J88L 4YHZH 5JIPA 2VO5A 1PQZB 2XN9A 5DD6A 4U1IA 3CD4A 3QNXA 5JZ7C 1UG9A 3WIFB 1NDMA 1DBML 1YNTA 2IPTL 3BKYL 2CJUH 3X12A 3X14A 3PWJB 5D7JD 5D7JB 3RWIB 4OCSL 1MJUH 2PF6A 3U4BH 4ZAKA 1RSFA 3UROR 3BP6A 2AJYH 2LFGA 4OZHB 1F4YL 3GSUB 2MQCA 3MJ7B 1ZLSH 4AYFA 4ELME 3RVUC 3QHFH 2N4IA 1OW0C 4MAYB 3VMPA 4HCRL 4M62H 5IV2B 1QRND 3K2MC 4M5ZH 4Z7VB 3OWEA 2EDFA 4JY5L 4OM1L 5JXAL 1QFUH 1UQSB 5IBTH 1S7UA 4EXPX 2EC8A 1XR8A 5E6YA 4WI5A 5F6HI 4KKAD 1JUFB 4YHNA 1DSFL 3T0AA 1NCNA 4GW5B 3NFSH 1T2JA 2AJVH 2J6EH 3HRZB 4LL9A 1CD9B 3GJEB 3TBSA 2P8LA 4LFHG 3SDXE 3VXOA 5C0FB 2DQCH 4KJQD 5DD5L 3U2SA 5I1AB 4NN7C 1M6OB 4G3YL 4NQCD 5GGVY 4NQCB 3TYFB 3PNWB 1CXHA 5JHLL 2W92A 4HT1H 3IJHA 4OCNC 3IFOA 1NGWB 1JGLH 4Y16A 3WXVL 3AXLB 4BFIB 5TE7H 1F2XK 2I9TB 2X89A 5DRWA 1KTDA 3KJ4C 3LRSB 3DETC 2FZ3A 4L9LB 3JWOC 3MCLH 1EIBA 1F42A 5JW4M 1S9KC 1NGPH 1UJTA 3W2DH 1BQSA 1S7XB 5D7KE 5I18H 4XC1L 3STLA 1MHHA 2A77L 1A7OH 1W72B 5E00A 2VE6B 1KPUB 5IMKB 5DJZB 3ILPA 2HTLC 1WUNT 3FQXA 5D96B 4YUEH 5BZWA 3T0XA 4ELMB 2DQUH 4HMEA 3T4AB 3LS4L 4ETQA 1ZA3A 4MDIB 2ZUVA 2WBJD 3I85A 1TZGL 2WBJB 4XMLH 4U2ZA 4DGIL 4NRZB 4MGXA 2V17L 1CS6A 3SKNB 3ZDYF 3FRPA 3LKPB 3GMMA 4MXWL 4V1DE 3FO2B 4RA3A 4HUVB 5GRXG 3V52L 3B5HA 2R9HD 4KI5E 5EORL 1XGRA 1OAZH 3K1DA 1DE4A 2W0LA 5IB5B 1TZHA 3SDXB 3MRIA 4M1GH 4M6MH 2Y07L 4ZYKB 3B83A 3B9KB 1LMKA 2YD8A 3OJMB 1LK2A 3QP3A 3WFBL 1TETH 1IBGL 1QKZH 4AT6A 3PIQA 2GITB 3V9FA 4ZUSB 4R90L 1TQCC 1DQLH 2X7LB 3AREC 2A0LD 5AUMA 5BQ7B 3INUH 3BRGC 4Z7UA 1UWEL 1NUGA 1LILA 3CFJA 2WBKA 3U4EB 1GL4B 3H3BC 4I0CC 4TNWK 2EYRA 5KSBF 1MFDH 3CMGA 1N64L 5I1EL 1ZHBA 3SDCC 1KIPA 4FZEL 3F62A 2GJZB 4MS8D 1G7MB 2JJUA 3TLRA 1A9EB 3VG0L 4N68A 3ARDC 1DL7H 1N5AA 3V0VB 5BMFH 2ZUYA 1U41A 4IDLA 5GSRB 4OIIH 2P5EE 1K3IA 4F58L 2VQTA 1J18A 4HWZB 2X4UB 4OCWH 3IU4L 3QUKB 3CDGA 1HNFA 3O45B 5EA0L 2CK0L 4DOHB 2WM0A 2VZVA 4R97C 5FGSA 3TV3L 3VXNB 1UENA 4V1DD 4V1DB 3JV0A 3QR2A 4GAGH 2HP4A 5E2WH 2AABL 2IQAA 4KI5D 1L7TH 1ORQA 2ZUQC 3P77B 2QSCL 4JFOA 1UADC 1RFDL 3UTTA 1G7HB 4DAGH 3ALPA 2V9RA 4M7ZC 1ZGLP 3ULUH 2IAMD 2IAMB 3BZ4A 2XFXB 1YN7B 2VXSH 1VFBA 5CZVL 1H5BC 1UEYA 1J8HB 1BFOA 3TO2A 3P40A 3TBYA 4CJ0A 1AXSA 1KJ2H 2J7LA 4XAWH 3QUML 5EZLB 3MRHB 1Y18A 5JMRA 2CGRH 3VFVA 3JTSA 4QY8A 1N2RA 5FGRA 4AMKL 3OR7B 3H42L 3WFDH 2OL3B 2BFVL 2Q8BL 5B39A 3RA7L 5ISZA 3LZFH 5DJAA 3KS0J 4U6TA 5F8RC 1BX2A 2E9JA 3MX0A 3U36A 3QUYC 5DJ0B 3VI4F 3MJ9A 3MLUL 1GYAA 4MJID 4MJIB 3UZQA 1P4IH 1MFEL 4R7NA 4ONGL 3LAFA 4GXUM 1I7UB 1U8PB 1BBJA 2BSRB 4C55A 1QTYT 4ZFOA 1S5HB 3ZKMD 4LHUA 5L8LB 2DLTA 3IXTA 4X6CE