5F93C

Blood group antigen binding adhesin baba of helicobacter pylori strain a730 in complex with blood group h lewis b hexasaccharide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Cell adhesion
total genus 27
structure length 114
sequence length 114
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f93C00
3F7QA 1PLGL 4JO3H 5JW5A 2R39A 1Z9SA 4X6CB 4GRMB 5DGQA 2FLBT 1U95A 1N0LA 4F8QA 3DI3B 1EHNA 4NC0B 3DV4B 1J05B 4HIIA 1UVQA 3QUXD 4Z77A 3WIHA 3LN4A 3ULVC 1UQSB 5JIHA 1GGCH 2J8OA 1CFSB 5IKCB 1BZ9A 3QQ4B 1DQQA 1A9BA 2LU3A 4L4VE 5KANI 1M7DB 3ZKXC 3U0WH 1X4YA 4S0SD 5JHLH 3B9KD 4LF3A 3KPSB 2WNGA 3MREB 3SY0A 4NCC2 1JNHA 4JANB 4NHUA 2EE9A 1PFCA 4LGRB 5GSRA 4ZQKB 1I7ZB 2O5ZL 5D2NB 4ZFGH 4MJ2A 2KL6A 3KPMB 4CJ0A 3GBNL 1KB9K 4PJ9A 1CBVH 4N8VG 1X5YA 2P5WB 4KH2A 4K55A 2CUMA 2AV1A 3Q1SH 4ZSOE 1QFHA 2X09A 1A3QA 2XICA 5D6DC 1RULL 2X1PA 3EYFA 1DQLL 3AUVA 4X6DA 2MQCA 5TE4L 4OLVH 4K94C 2EC8A 1QOKA 2PR4H 5EO0A 2VLJE 1OAXL 1YYML 2DL9A 5I73C 2CKBH 2VDPL 1HXMB 4KJWD 3RHWK 3HR6A 1AGDB 3MUHL 3IB4A 1G0XA 5I74B 4PLJC 5ACZB 5JW3H 5KVFH 2JTDA 4GQ9L 4LIQE 4OZIB 4I9WE 3IDNB 4N0YL 4U0QB 4TUOA 1A3RL 2Z31B 5BS0A 4MQXD 1NFIB 3VWJD 3EOAA 5FOBB 4K2UH 3CVHB 2C4XA 1E4XL 5HYSA 2BNRD 4ZFFB 4EI5C 5FV2A 4NRZB 5FA3A 4LCCA 4KRLB 4PGDA 3RVVD 2FR4B 5HI3D 5FO8A 1FC2D 1Q0YL 2ICCA 1RHFA 5CCKH 2X44D 4LASL 2NW3A 1IGIL 4TOYL 3DO3A 3MBEA 4GG8A 2DN7A 5E6YA 4XPFH 2NLJB 3PABB 1FZJB 3DVFA 3S3PA 3V6OA 1SEBA 1EBPA 3ARVA 3LOWA 2FJFA 5E2UH 4PTTB 1AHWA 5DO2C 2VLLB 4OBSA 5KSAB 4NQEB 1F6AB 2Y5TA 4B41A 3U36B 2OP4L 1IZJA 2NYYC 3T77A 2UWEA 4FQ1H 1FZOB 2VXQL 1U9KA 3UTZA 4Z6AT 3V6ZB 4NDMB 2AW2A 4IDJL 4BFBD 3RP1A 5F6IC 2DQUH 3MV8A 3QDMA 5INCB 5T3XD 3MTRA 5D5MF 4H20L 5IFHL 3BKCL 5DJ0A 5EUOA 2ITCA 4OJFL 5J8OA 2VJXA 3I02B 4H0HB 4UIMB 4YLQT 1FZMB 1KC5H 4HDIA 1OP5H 5K9KA 5IV2A 4FQQA 4JDTL 3RVUD 3GEWB 3M45A 3MNWA 4HUMB 1PYWA 5DK2A 5IFAL 1R5WB 5D7IB 2A83A 5C6WH 4Y4KD 4PJ7A 2JB6B 1ADQA 1VGEL 4XCCL 1H3TA 1HNFA 3FN3A 4QXGH 5LCVH 4UB0H 4JRYE 5L2KD 1XR8A 3JUZA 3SKMB 3VXUE 2BRRL 3HNVH 3CNKA 4GRWB 2VLKE 3MLTA 4KWUA 1U8IB 5F93C 4JPVH 3KVQA 3UJIL 4TVPD 4Y19E 4P2RD 2VYRE 5D70L 3A6CH 1F90H 4MNQD 1BREA 1U91A 4GAGL 1F8TL 1FH5L 4H1LA 5T1LA 2FX8H 4NKIH 4GRLC 4OKVA 3WUWA 1DANT 4XC1L 3GSWA 4K23H 3QA3B 1FBIH 2CDGB 3EAKA 1EVTC 1GGIL 2XQBH 3NTCH 1ZWIA 4N0RA 4YDVA 4LLWA 3BN9C 2CO7B 5GRUL 4OFKA 5SWSD 2NY5H 3B9AA 2YD7A 4LGPB 1BVKB 4R96A 1IQDA 2AK1H 1M1SA 4ZAKA 1BLNB 1IGFL 1F6LL 1R5VA 2J88L 5FUCE 1I85C 1YEJH 3AU1B 4NT6A 1Q1JL 3DSFL 1JP5A 1A7PH 4JFZH 1JN6B 3DVGB 1KCVL 4YIQA 1YNLH 3LMJL 1E27B 4HMEA 4HK0B 2ZCHL 3GGWA 3QEQB 5E6ZA 2KH2B 1W0YT 4Z8FL 3GMQB 3VFVB 2CO6B 4ONOA 4NC1E 2P49B 4KAQL 4ZTOH 3RI5F 4MNGE 3DYOA 1B4RA 4S1RH 5CJOH 5FGRA 5TE6L 1NSNL 4WRLA 4BFIB 3MXVL 1BVLA 3B5TA 3TBSB 3C5JA 5CGMA 2JE8A 4MXQC 4P2OC 3SGEI 2G9HA 3V52H 1X5AA 1DVFB 4PJCF 4HUXB 5I8KH 2XG4A 1UKTA 1MHCB 4QRQB 4D94A 1MAKA 3S88H 1QBLL 5KVEH 5AYUH 1C12A 4MDJB 3L3OA 3G6AA 3ZSTA 2OSLB 3ULUH 4XTRC 1WEJL 3T0BA 3BKJL 1QR1B 4KVNL 5HGAA 4IRSB 3QHTC 4HMDA 2QKIB 4M1GL 1B0RA 4OSUH 2YPKB 5C7XL 5FYJD 4F7PB 5I0ZA 2J6EH 3E6HB 3NFPB 1QLRA 5EA0L 2WUBL 5D4QA 3RVTD 5TF0A 2IQAB 3HUJF 4LCWD 3EDDA 1AKJB 1Z9LA 3LKSB 3VXMD 1DZBA 1NGXA 4JQXA 4ELMB 2DL2A 4ZXBC 5IMMB 5D7SH 5EN2A 3L7EB 3T65B 1LMKA 1KIRB 1ZTXL 4JY4B 4N8VA 5DUBB 5C07B 1FGNH 1P4LA 3GIZH 1Q9LA 3NIDF 4UMGA 1PJ9A 3EJYD 4XPAH 1GCFA 4M1DL 1SM3H 2BDNL 4JR9H 4Z78A 4QOKE 4QRTA 1E6OH 3GUTB 4Z18A 5L6YL 4XP1H 4YDJA 4L8DB 2PCPA 3NACL 4I48A 4MJIE 2P5EE 3NCBB 4DEPB 3D85A 1ZEAL 2W9DL 4XNMA 2DTMH 3B43A 3T0ED 1EPFA 1SMOA 4EZMA 2XQYK 3OX8B 1BAFH 4MA3B 5C0GB 3KPRE 3MFFB 5GRJL 2HFFB 4X99A 5I15L 1CFVH 4PRBA 4R2GB 4WWKC 3ARFD 3O2VL 5INDA 3G6DH 4LSVH 3WKML 2V2TA 4CDGC 3HAEB 2HLAB 4JQVA 4NZTH 1Q8MA 4Z7NF 2NZIA 3CU7A 4KUCF 2ADIB 2NW2A 1KENL 3D25A 4QRPD 3BP6A 1JWUB 1BP3B 2BSRB 1RUAH 3DURB 4YHOH 4OGYH 1WC7B 3VMPA 1QP1A 2RR3A 3B9DA 2PNDA 2VITA 3RU8L 3LEYL 1M05B 4APQC 1MIEL 3FKUS 5L7XL 3EOBA 3HE7A 4K3EL 4P23B 1J86A 1TJGL 2VZTA 3QIUC 5D72L 1NMAH 3W0WD 3HI5L 1SJXA 4CU6A 5JOEA 2X2YA 1FJ1A 4L29A 4KRNA 3VFSA 1FE8H 1NAMB 2ZSWA 4NWTL 5GSVA 3BAEL 3PHOA 2EH7H 5CAYB 1UJ3A 1YJDC 1CLOH 3TN0B 2ZCKH 2BNQE 4YXKH 4KY1H 3X14A 2VDML 5DEFA 1RVFL 1CTNA 1PLGH 2BSTB 1QKZL 1JHKL 4GAFB 5FO9B 2YWZA 3MOBH 1UKQA 2APFA 4PJIF 3T1FA 2FIKB 4DW2L 4D0CA 4LAJH 5FYJL 2WQ8A 3WSQL 5JW4R 4WW2C 4BFEA 4CUCA 5C0EB 4XP5L 3D69A 2HKFL 1IGJB 4ZD3L 4H25B 4L8SC 4NNYB 1SBSL 2Z92A 5C0BD 4NYLB 1U8KA 3A6BH 3I6KA 1S3KL 3BUYB 5GGTH 2IEPA 2PTTB 1A6ZA 4LVHB 4R7DA 4Z9KB 1AQDB 2QADD 5GJTH 2R1WB 2CKBA 2NX5D 3NPSB 3FN9A 2O5ZH 1BIHA 3OPZL 1A1MB 5EU6A 2DI7A 4OF8A 3GBNH 4XI5D 5FK9B 5IP4A 3KPOB 1WZKA 4P2QA 2LAGB 8CGTA 4M6AA 2FEDC 3M17B 1DBBL 1RULH 5HVHC 4PJAA 1DQLH 2HTLD 4LVOB 5TE4H 3DROA 1DBJL 1CXEA 2GK0A 1OAXH 1YYMH 2O5XH 1G7MA 4PJFB 1ROWA 3DHJA 1HH9B 3D1MC 5L0QC 3BGMA 1KB5H 3O6FC 3RWHA 3VXSA 1OARH 1ZHLB 4O2CB 3MV9B 1G7JB 1S7WA 2VL4A 2F5AH 3KYAA 3T4YB 3C6SA 3WFHA 2WBJA 5HPOA 3TO4A 3G5YB 1V7ML 3UO1H 2YEZB 1A3RH 4NFDA 4C57C 3P4MA 1T03L 4JHWL 1OGAB 2EYRA 5F9JA 3R8BB 3K1DA 4OQ1A 4HWNA 5F3HB 3BT2H 3UX9B 1E4XH 2NZ9C 4Q9RH 1IAOB 3VH8A 1RK1B 2A74A 4PJDF 4M03A 1Q0YH 2DS4A 4R90H 4KMQA 4KK8D 2J7LA 2WW8A 5IBUG 4QWWC 1I4FA 5IB5A 1IGIH 3VXRB 1ND0A 1A8JH 1MCBA 4PR5A 3DWTA 1TFHA 2DQEL 5BV7B 2BHZA 1S9WB 1DTUA 3N85H 3HMXA 4LLUA 43C9B 3BEVA 4BZ1L 4C56E 2R9HD 1OWWA 2KZWA 3FOMA 3RX7A 5CJ8A 2F53E 3OKDB 3S5LG 1AO7E 4E5XA 1YECL 2OP4H 3ROLB 4XCEA 3QUML 3RWJB 5GHWL 1X7QB 4JKLA 2EE3A 2BRQA 4Y5YB 3TVMA 3ZE1F 5C9JB 1AGEA 4IDJH 5F7FA 3IJHA 2X4NB 1HHKB 4NOBA 4D2NA 3RX5A 4H20H 5IFHH 2B4CC 3BKCH 4W4NA 4J4PC 1ZT4B 5IBTH 3BD3A 3OR6A 4OJFH 4ISVB 3EYQD 3QFJE 1CDJA 3DARA 5C0NC 3WFEH 3AAZA 1KLGA 1UCBL 4P49A 5IFAH 1B6DA 1GPOL 2H2PD 2HLFD 1MFEL 4XCCH 1N26A 3WNMA 4WGVB 4X6EB 5GZOC 3SKOA 2OI9B 2BRRH 3F6LA 1HILA 3OKEB 4IOIA 4F7MB 1Q38A 1XCQA 3O9WB 4L4VB 1YEKL 1TJIL 3O6ML 4JFEE 2HN7B 4FXLA 3K3QA 3NZ8B 3UJIH 4RGNC 4JREC 4LBEB 4A6YL 3RL1A 2JJTA 3OF6D 3DO7A 3UC0L 2MHAB 4XP6L 1W0WB 1YY8A 3WN5A 3OKOB 5ADOH 3ARGD 4G7YL 4GAGH 1FH5H 1U36A 4K8RD 5DS8B 4F7EB 2VXTL 3UTTE 2C3VA 1BWWA 3PGDA 3C5ZD 4PJBF 5BOPA 4XC1H 3O0RH 1S7XB 4YPGA 5K9JH 4KKCD 4GAJL 4LPUA 2DKMA 2GJ6D 3A67L 1E6JL 4G9DA 2VISB 3K2MC 3U0PA 5GRUH 2VLJB 2HJLA 2V5MA 2EDEA 1FVEA 5I1AA 2OZ4L 3DLQR 4P5TA 1MCWW 5JIKA 3SJVE 4MWFA 5DR5L 3T8XB 3OJVC 3CH1A 3TA3A 3X13A 1YEIH 1CQYA 5HVGB 1IGFH 1I3VA 5E2JA 2J88H 2KQNA 2YRPA 3RJDA 1VKXA 1LEGB 1Q1JH 3DSFH 5IF0B 2BOCB 3L5IA 3VMOA 4GO6B 4JLRB 4MQ7A 4JB9L 5CWSA 3KPQA 5DJ6B 2IWGA 5FDWB 1KCVH 1U8QA 1TVHB 3BWUC 2E7LA 3FB6B 3LMJH 4XXCA 4BQ6A 3U7YL 5JO5A 2ZCHH 3BIAX 3BWAB 4OFDA 5D7LB 3VD4A 2I9LA 1FN4B 3WFZA 2PYFB 3JBG7 3STZB 5IW1B 2Y6SD 3TH4T 2R56H 4KTEL 5KS9A 2CLVA 2ITDA 3DIFA 1ITBB 2CLZB 5JPMB 1RZFL 3TJHC 4L3ED 1GZPB 4TN9A 1QVOB 1ZS8A 4WI7A 1TPXC 1WISA 5J89A 1RV6X 2NNAB 5FGSA 2XNAB 1ZLWK 4KAQH 4RA3A 4MSWB 4I0PC 4PP1D 4ELKA 4L9DA 3MRCB 1FPTL 3MLUL 5CJXA 2YK1H 2WQRA 2XN9A 4S2SB 2D7MA 5TE6H 2Z0BA 3MZGB 3MXVH 2XKNA 3JV4B 3VA6A 5EBMA 1QFWH 5DQJB 3EUUA 5LQBL 1JZ5A 3D3VA 4WTXA 4ZOBA 3ARED 1IJ9A 4UV7L 3WJJC 4BYHA 1DEDA 1UG9A 1I1AB 4Y5XA 3TJEL 1QPPA 3MRHA 1QBLH 2XZAL 2F54E 2PYEA 4KDTC 1JHTA 1CU4L 3VRIA 1T1YA 4YHPA 3BKJH 2ERJC 3QNZB 4Z7VF 4KVNH 1MOEA 4M1GH 1P7KA 4CBPA 3B2UD 3BPNC 3T2QA 5C7XH 2ARJA 4G8IA 4KKAD 4M93B 3MQIA 3QNXB 2E7MA 1XGTA 5EA0H 1MQKL 5DRNA 1ES0A 1N5YH 1AXTL 1WJ3A 2YUWA 4OCMC 2X4PA 3MRMB 3OJDB 3LKQB 5I8CA 4U6YA 3QHFL 5C3LD 1DN0A 1E4KC 4Y8AA 1EZVX 2ICWB 4DVBB 5EO1B 3IDXL 1ZTXH 5CZXC 3QWRD 1ZVHA 2DQDL 2VR5A 3EJJX 2BOBB 2P48B 3IAQA 3HI6H 5F8QC 1XZ0A 3VRJA 5EU3A 4EN3A 4R97C 1J0HA 1KYOJ 3NFNB 2VLKB 2AV7A 3FT2B 2BDNH 4QLRA 1VFOA 1U8LB 3BZ4B 3SPVA 5L6YH 5F72S 4LSTL 4KRPB 1T0MA 4LMQI 3NACH 3LS4L 3PV6B 3RNKA 4M61A 1ZEAH 2W9DH 4PFEA 2G5RA 3F58L 5DD5H 5IHUL 5GRJH 5DVKA 4JPIB 5D1ZA 3HC4L 2Z8VC 3KYNB 5CINL 4NN6B 3O2WL 5I15H 3FQRB 5GGVY 1QBMH 4N1HB 5I75C 4KVCL 3CSYA 4M7JL 3AS3A 1LK2A 4IMLB 5H8DA 1MCKA 3OWEA 4HUWB 4UILL 1A5FH 5GQBA 4LU5L 2X40A 5CGTA 1KENH 1I1YA 5I76A 2XFXB 4X6DF 4OF0A 5JMRA 1A7QL 5E6IC 4QYOA 3IDIA 43CAB 3CX5J 5TDOB 2W0PA 3LEYH 4X4MA 3NBNA 4J3TA 1ZGLM 3BESR 1MIEH 5J4MA 5L7XH 1AP2A 1NEZG 1G7LA 2BMKB 3BFOA 3AGVA 3D39A 1UCTA 1MUJB 1TJGH 3L3GA 4HSQA 3S5LA 5D72H 3BZDA 4EOWH 5CGYC 5MEOB 4MMZC 2P8MB 4LPXA 4U1LA 4LKXA 4NWTH 3L5HA 3BAEH 4LEOA 4UDUA 5D5ME 2P45B 1SQ2N 4NN7C 3LN5B 5I18L 2VIRB 4NO0B 5CFHA 2VDMH 1RVFH 4OD2A 5C0AE 5FUCC 4JJHA 3MC0A 1H15A 1JHKH 1L7TL 4MA1B 2YXMA 3ROOA 2MQ3A 1FFOA 4MNGB 1XF2A 2OL3A 2DB8A 4ODWA 4DW2H 5HHOB 5JXED 1KG0A 5FYJH 1Z2KA 5IB1A 3G6JA 3QI9B 3WSQH 1HYRC 2F8XC 2JLLA 3HZKA 4IBLT 4XP5H 1W0VA 5I19L 2HKFH 3UJJL 1SBSH 1WT5A 3NCFB 4PYGA 4XP4L 1P1ZB 3O45A 5KZCD 1S3KH 1IQWL 1K5NB 5DTFB 5JOFB 4L1DA 4J6RH 4NC1C 2LVEA 4XWGH 3PGFL 1A6UL 2ZJSL 4M7ZC 3QWQB 4KQ4L 6FABL 5CD5D 1K8DA 5ITFB 3DMMD 4GH7B 3IU3A 3OV6A 3QIWB 1PZUB 2HT2D 5DEGA 2GTZB 1A9EB 1OAZL 1ZVSA 4H8WH 1D9KB 2ZUXA 4JY6A 1NC2D 1A6TA 2GHWB 2ATPB 4CJ1A 4RQQB 1DBBH 1FIEA 4Y0GA 3MGOB 3C6LB 3MRDA 2NY0B 2ADJA 1A6AB 3FJTA 5F89B 2NY3D 1T5WA 1DBJH 1J5OL 1Z5LA 4U2ZA 3BKMH 5GZNC 3ARBC 3E3QC 4ZFOL 2A38A 3RWCB 5EOCL 1R3IH 1UEYA 4MAYA 5E0QA 1M7IA 4YEFA 1NEUA 4L8CB 1S9XB 2NY1B 1HH6A 3GHEL 2KKQA 3FONA 3EGSA 4QOKB 1N6QH 1V7MH 3SDXB 1C16A 3ECBA 4NO5A 1MI5E 3DX7A 3IAPA 1T03H 4MJIB 5SWQA 3ILPB 3ULVD 3DRQB 3JUYA 4WO4A 5E03A 1L4IA 2EDJA 4PJHE 2ICEB 1PSKL 3HS0B 1Q9WB 4L9LC 4AY0A 5HYFA 4G8GB 3MV11 2FL5B 4M1CC 3QCTL 1T5XA 2ENSA 4UT7L 5FO7B 2ED8A 3TNNB 3P77A 1D5ZB 1OVZA 3P4LA 1EHLH 2DQEH 3QUXA 2GSIB 1R24A 4HG4J 2R15A 3QIBC 5CIPH 5A16B 1ZHNA 2IADB 1FO0B 4DUWA 2C7UB 1PX3A 1F3DJ 4BZ1H 4OCXH 4XX1E 1BQSA 2G2RB 3QP3A 4ZTPL 1AR1C 3VG9C 5T5NF 1TZIB 3B9KA 3LQAL 1YECH 3KPSD 4PJCE 4WJ5A 3QUMH 2LTQB 5GHWH 1FG9C 3RBSA 2NTFB 1TJHH 4HIXL 1XH3A 4I13B 4LGSB 3W9EB 1CGTA 2NY2C 5C09E 4PJ9C 2P5WD 1YEDA 4KPHH 1N6VA 1HHGA 5HJ3A 2BNQB 1EEZA 1JV5A 1RFDH 2R1YB 1UADC 2HG5B 3RY6A 3WHXA 3GMMA 3HUJE 3P4OB 5EU7C 1KTLB 2D7PA 4CW1A 3BPOB 4H26A 2KZ1B 3H0TA 4EI5D 1UCBH 2D7QA 2R23B 3V2AR 1GPOH 3FO9A 3RUGA 4ZNEA 4NQVA 3V5KA 3ABZA 3NIDE 3CUPA 2Z31D 3UYPA 3PQYE 3VWJA 5H94A 1HK6A 2AXGA 3NAAL 2R1XA 1YEKH 4XNYH 2GEEA 1T7XA 1TJIH 3O6MH 1NMCC 2BNRA 1DSFL 2DBJA 3MR9A 1FNEA 3TIDA 2BSSA 4A6YH 2FHFA 1IGML 1KPVB 1N8ZB 3OGCB 3JV6B 2UVEA 4XP6H 1F5WA 5E00A 4FXGB 3F12A 1UZ8B 3IVKB 4WNQB 1WSST 1QA9A 1JI1A 4G7YH 1RY7B 3DXAD 5HHNB 1VFUA 5JW4M 3MBEC 2VXTH 5B8CB 1VADB 2ZUQC 4YEEA 3V6OC 4HHAA 4L1HA 2ZUWA 3ULVL 4GAJH 5DJCB 3A67H 4Z7NE 2IMMA 2EEDA 2R2EA 1AHWC 4LLVB 5KSAD 4NQED 4F15C 1MCOL 3VFPA 4E0RA 1HNGA 2OZ4H 2GT9B 2W59A 5DR5H 3K0WA 1M6OA 4Z76A 4LKCB 4OI9A 4N0CD 3V8OA 3S3JA 1WWBX 5I8EB 3X12B 3HZYA 2ARWA 4LVNC 4JB9H 1UXSA 1AGCB 5IM7A 3PF2A 2IPKA 3OMZA 3U7YH 4NKQB 1YA5A 5JOPE 5KVDH 3GSXA 1M4KA 3PP4L 5C08E 3S4SG 5LGHL 4M7LL 4TPRL 5CZVH 3PP3H 5D8JL 3U9PH 4BUHA 4Y4KA 4UNVA 4QO1A 1HOCA 3NH7L 3SDAB 5L2KA 4PJIE 1FPTH 4X98B 3REWA 5DC4B 3MLUH 1VENA 2Q6WB 4C56B 4S1QH 5D9SA 3KLHC 3BRDA 2F53B 1OTSD 5HI5C 5LQBH 4AH2B 1IC5L 2EIDA 2YSSA 1IAKA 1AO7B 4FQHB 5ISZE 4P2RA 3EOTL 3WXWL 5J6GA 1BPVA 1PEZA 1MLCA 1F58H 2NY4C 3CMOL 3BN9D 4GKSB 4XH2B 2CR6A 4MNQA 4LHQB 5IMKB 2QR0A 5EC1A 1CU4H 4X9FA 3K8KA 3NN8A 2OTWA 1KV3A 2C1PA 3QXWA 5CBAB 4MCZA 4JRXE 4YC2B 3V0WL 3UAJC 1MQKH 4O4YH 2X05A 4RSVA 1AXTH 5KSVA 2X7LB 3BO8B 3V5DB 1NDMB 3QFJB 3C2AH 3JWOH 3GSUA 5IOPA 4U6HB 3QHFH 5SWSA 4PGEA 1HQRB 4WEBL 3IDXH 2XA8L 3N9GL 5IESL 4Z7WF 1WFNA 2HT4D 4ZAKC 1T0NB 4E41E 4X7FC 1NH6A 5FF6A 5DJYB 3SGDH 1BBJB 4Q6YA 4X7DC 5BVPL 4QXUH 2F5BH 1VESA 4LSTH 4XCFL 5EOTA 1FAKT 4OFVA 3LS4H 1CFQB 3ZKQD 3QEQD 5ESVA 3SN6N 3QO1A 1HQ4A 1N59A 5D7JB 2E9IA 4ZNCD 4KDVA 1F2QA 1JZ2A 3F58H 3F62A 5IHUH 4YBLC 4XMKL 4NWUL 4XTRD 2YUXA 4HUKB 4KVCH 3UTTB 5IQ7H 1IGTB 2AXFB 4FABL 5F3BB 4FHBD 1T4KA 4R4BB 1T7YA 2V17L 5FECB 2AAVA 3DGCR 4LU5H 4WCYH 1JZ4A 3UPRA 5I6XC 1DVFD 4DKDC 1T20B 4CVXA 5T3ZE 3DV6A 4G42B 4ZXBD 2FX9L 1HHJA 2HJFA 5ERWB 2D03L 4WFHD 4I77L 4JHBA 4U1MA 4UOW0 3ZLQC 1C5DA 5I66A 4IRSD 4UV4L 5DURB 4AEFA 4X6BA 4M7KL 3ZE1E 1KTRL 4NFBA 5AUMB 1E28B 5TDNB 4LCWA 3VXMA 5CKAA 3FN0L 1AKJD 5HHQB 3VGBA 1MJJA 1BQHB 1MCSA 1RHHA 4JZOB 3ARDB 1FG2A 4JQXC 4N5UA 1CD1A 3QDJD 5I18H 2RBLA 1XR9A 5KSUB 2V2XA 4U1IA 1F3JB 5C07D 4HGKC 1CFNB 1L7TH 2A0LC 1JUFA 4P3DA 2LU7A 1DDHA 4HKXA 2IALB 3ES6B 4HEPG 3ARTA 2DM2A 5IFJB 3LKOA 2JJUA 4ALAL 1JPST 4WWKD 4MVBD 4OF5A 4B50A 4J1UB 1U92B 2AJUL 2EDTA 3GMPA 4KK5C 3UJJH 4XP4H 5EFIB 4HWEH 4PRIE 4N0UE 2BC4B 3BP5A 4BK4A 1FFPB 5D6CB 2AKRB 3HC0B 1INDL 3T0EA 4QHMB 3PGFH 2QSVA 4TTDD 5DD1H 5GGSB 5BMFL 4KQ4H 6FABH 5DHXB 2Q86A 2W0FB 3ARFA 4R2GD 4LNVA 3OR7B 2X4RA 5C0FA 4HIHB 1OAZH 2VDLH 5GGUA 1QR4A 2GITB 2XA3A 3KS0J 3SQOH 1EMTL 4JQVC 1ZHBA 4M5YL 4QRPA 4GMSL 4PJBE 4OB5L 2R2BA 1NCNA 1WLHA 4P46B 2BVPB 3TIEA 3HN3A 3I6LE 4HWZB 4I3RH 3GM0A 4X5XA 4POYA 2Y5EA 1J5OH 1S7TB 1RURL 3RTQB 2IG2L 4M8QB 1X6LA 3ZE0F 1E4WH 5EOCH 1RZJC 2DI9A 3ULSA 3PWPE 1FSKC 4P23D 2GSGA 3HE7C 4DZ8A 1HEZB 3W0WA 3C8KA 3VU2A 5CIPA 3QBTB 3GHBL 3CFDB 3PIQB 4WFGD 5TDPA 1GVIA 2NMSA 1UJ3C 4U1GC 1E0OB 5TPWL 4GAYA 3TN0D 5ITBL 1QQDA 1IM9D 3LZFL 1AD0B 1YY9C 4LLMB 4OZHF 1S8DB 4PBVC 4JGJA 3MSPA 1Z6JT 2YD8A 4JQIL 2M8XA 3QCTH 5IEKB 3SO3B 3UTQA 1NDGB 4IOFD 3HKFA 3K4AA 1CIUA 4AIZB 4UT7H 2XG5A 3HG1E 2H45A 3U7WL 5DRWA 4V1DE 3EYVA 4YDIL 3VI3E 5C0BA 1C7TA 3S4SA 1BZ7B 1UZ6F 2AXHA 2FJHA 5T5FL 5E9DD 4ZTPH 3RZWA 1KCLA 2EO1A 3QUYB 2A9NL 2IFFL 1FAIL 2FEDD 2VLRE 3LQAH 3LSOB 1JWSB 3QULA 2NX5A 2NTSP 4WI8A 4RWHA 5J1SC 2W0LA 4F7TA 4HIXH 3DGGA 4JVWA 3DTXB 1CDIA 1S7SA 2FX7L 5D5MB 4HX1B 3SEPA 4LEXL 4O2FB 1IGYB 4ZUSB 3MRGB 4NRXB 5J13B 5C0AB 3U82B 5KS9F 4Y1AE 4JFYA 5IVXA 2CDFA 4KJPC 3F7RA 3EDKA 3ULUF 1EUTA 3EYOA 4XCNB 3T0AA 1Q9OA 3MV9D 4ODTL 1DR9A 3HB3D 4QWWD 4JFDE 4Q6IA 5FYJU 1LO5B 2WBJC 3PP3K 1EO8L 3OXRB 2FIRT 1T6VN 4UU9B 3ZT5A 2B2XL 3C5SA 1YJDL 1DSFH 4YGVA 1IGMH 1NGZA 2OZ4A 1F4HA 4HUUB 1YMME 4HGMA 1FCGA 3O11A 2E7BA 4H0IA 1EIBA 3AS0A 1KIPA 1OSZA 4H5SA 3VXRD 2Y7QB 4FG6D 1CGYA 3UDWA 1MY5A 4ODHH 1NAML 3RWEA 2CLRB 4F2MA 1HHIA 4ZUTA 2Y36L 3RWDB 3ULVH 4PRNB 1YEEL 3QZWB 3U46B 3WD5L 1ZANL 4FQXB 1DE4B 4O58L 5FYLD 3ME0A 2DWDB 5F70A 1L6XA 3FQXB 2Z93B 5AD0A 4BSWB 3EO1B 4N9GA 4RGMB 2D0GA 3TVMC 4NSKA 4YO0B 5ANMA 2BY2A 3PWUA 4L4TE 3BW9B 1YC8A 2VKXA 1I1FB 1MI5B 1P7QB 3G9AB 1PDKA 4WUUB 5GZOD 2VAAB 5SWZD 2DM7A 3MA7B 1D3CA 1OHQA 1JGUL 4JPKL 3TNMA 4HWBA 1MWAH 4K94H 4OAWB 2HJKA 5TH2A 4PJ8B 2W07A 1N0XH 4M7LH 5LGHH 4TPRH 4HBCH 5HPMA 1AQKL 5D8JH 4D8PA 3RIAK 5F7YC 1G0YR 3DX6A 4M48H 2IH3A 4HCRA 3P9MB 3QISA 1WCBA 2Z35B 5DQDL 1V3JA 5DD0L 3VCLA 3SDYL 2DLEA 1SVZA 4Z7UF 3RL2B 3MRJA 4L4VD 5DSCB 3FMGL 2YD6A 1IC5H 5CSZA 3UBXB 4PJCB 4ORGB 3WXWH 3EOTH 3OBAA 1JMXA 5SV3A 2X70A 3OF6A 3EJZC 2ADGB 4HKJB 3CMOH 3JTTB 3TPUA 2VH5L 1LHZA 4M43L 4ZPVB 3WN5C 5KSBA 1RMFL 3ARGA 3TFKC 4LSUL 5DFVD 3RWGA 5E95B 2AK4E 4G6KL 3S96B 1G7IB 1T2JA 2AQ3A 1LO2H 4HBQA 5C09B 5DJZA 1U8PB 4XNXL 4QHNA 4WU7B 3C5ZA 4BZ2L 2ORBL 4X8XA 4WTZA 4L3CA 4ZO8A 3QXAB 3V0WH 5C0CE 5ICZA 3HUJB 4P4KB 1U8HB 2GJ6A 1Y18B 3GSVA 5F88A 4G80A 3L3IB 4XNZB 1G7QB 5IJVA 2VLJD 3MRRB 4MS8C 1VEOA 1HXYA 3HNTL 2I60H 1FL6B 4BQ8A 4OLEA 3LDBC 1KCRL 5I1LB 5DJ8A 2VN7A 1KNOB 4WEBH 2XA8H 4P5TC 3N9GH 5IESH 1R0AL 3V0VA 4D3CH 1UB6A 4LSPL 1G7PA 2UUDH 4I9WD 4KK6D 1F13A 3MOQA 5I1GL 5DUMH 1VACA 3PQYB 2EECA 4KMLB 3FAWA 3L3KB 4JN1L 5JHDE 4C59B 4NUJA 3BI9X 2B4CL 4X5WB 2E7LC 3GMOA 4XXCC 3P30L 5DLML 4XCFH 3GRWA 5FYLL 3T08A 5JDJA 4DAGL 4YAQB 2ZUTA 3CLEL 2WWKT 1Q9KB 4O51A 5IR1A 1CG9A 3NABL 4L3EA 4EUPH 2AABL 1TTGA 4Y4HB 5TGBB 1FZKA 1QEWB 4OCWL 5BCAA 1NBZB 4QXTA 4TQEL 2X9WA 4I3GA 4XMKH 2EDXA 1J0ZA 2GCYB 2X4SA 4NWUH 1K3IA 1IL1A 5CJXC 4FABH 3CFKA 1A7RL 4Y4FC 4XNQB 1QACA 2V17H 4PBXA 5DRZB 3HC3L 3FZUD 3AREA 3FOLB 3U4AA 4QCIA 3DETC 2WAHA 4DTGH 3GKZA 5D1XC 3B9EA 1U8MA 4HS6A 1N6UA 1I1AD 3LRSB 3OXSA 3MNZA 4JJ5A 4Y5XC 1NBQA 2D03H 3JXAA 3L7FB 4W6YB 4I77H 5I1JH 4QRSB 3W82A 5LAXB 4N5ED 4R0LB 5E7FA 4UV4H 4OCYL 3GI8L 4M7KH 4AIOA 3VGAB 1EBAA 2A77H 5EU5B 3GJEA 5E94B 2YUZA 3JTSA 2FZ3A 2Q8AH 1FNSL 5DMGC 1SYVB 5IB2B 5B39B 4YXHL 1MCJA 1TVBA 3GMLB 5C08B 1JWMB 4JM2C 3THML 3G5XA 1R6VA 3IXAB 1U3HC 3BOVA 3QWRA 3VMNA 1GHFL 4PV9A 1RPQA 1E4XI 4JRYD 4PJIB 4Q2ZA 2O61A 1I3RB 3VG0L 3VXUD 3FQTB 4N0FB 3BUTA 4OFYD 1F4WL 1P84J 2VLKD 2VXVL 3VE0A 1IKNA 4ALAH 4KKBC 2GFBA 5GS2D 2HT3D 2XWBA 5ISZB 2BCKB 3MXWL 4Y19D 4IRZL 2EH8L 1FLRL 2WWMC 4ORZC 5DGRA 1NGYB 4BH8A 1GIGL 1INDH 1K4CA 3C9NA 3AB0C 3TBTB 1SMAA 2K9UA 1OD9A 4ZFOA 5BMFH 4NQCE 2Q3ZA 4LIQL 4OD1L 4JVUA 3WIIL 4KTDL 4ZOEA 1INEL 4HJGA 2PW2A 4Q9BA 1F11B 1EMTH 5CGYD 2JIXB 1VFAA 2A6KA 5GRXG 4M5YH 3LEXA 2QQLL 4GMSH 4JKWA 4NO3A 2XTLA 4OB5H 1LWRA 3GSNB 5F1OB 4OCRL 5JORB 1YMHB 3KYMA 5GIRA 4KKLC 4MD4B 1RURH 1LEIB 1O7VA 5CEZE 2IG2H 4GW1B 4DN4L 2HMID 4E41B 1YPZE 1A02N 2QSCL 3BZEB 2YPLE 4BSVB 1RZIA 3GHBH 1V7NH 3HE6B 1WQVT 2YC1A 4PJEF 5DMKB 5IG7A 1NFDE 4L8BA 4UBDD 3VA2C 4TNVF 1VPOL 5ITBH 1MCPL 4NO0D 3L9RA 3CXDL 1ZT7B 3LZFH 4XGZB 3FHQA 1PG7L 4JQIH 5LGJB 4HPOL 3HCVA 4PTUB 4PJDB 5HHXH 2D2OA 4U1HA 5JXEA 2EIBA 4LNRA 3QI9D 5HGDB 2X1QA 2WINA 3U7WH 1JE6A 4PJXF 4YDIH 2B0SL 2RCSL 4JFQA 1TENA 1I7UA 1KJ3H 3HMWL 4U6TA 2E7HA 3RZCB 4NQXA 3L5WB 5T5FH 3AXLA 3CX5K 4MHHG 2A9NH 2IFFH 5GJSL 1IC4L 1ORQB 4ENEC 4F3FA 2QQQA 2XTJB 1VERA 1ZGLP 3DMMA 5GZND 1JTPA 1MVUB 4QXWA 4NOFA 3QIWD 2VDOH 4GJTB 1DEEA 5E4IA 3BVNB 2DMKA 4HS3B 3L1OL 5L2JA 3D87B 5EBWB 2XWJB 1NC2A 1ETZA 2FX7H 1FV1B 4OGXL 2Q76B 3DECA 4LEXH 1OTTD 2EYSB 1EERB 3LKNA 4JFHE 1KB9J 4CMHC 3TV3L 2NY0D 3IF1B 1U8OA 2LV4A 2YBRA 3CSBA 1KJVB 1FDLL 1VHPA 1RSFA 2X4QA 1KIQA 4M1CD 1QBBA 4QHLB 4DGIL 4Z7WE 4QTHA 1T1WA 3CFJA 4ODTH 5HGHB 3HAEH 1S7RA 4QOKD 1RU9L 1EO8H 2L4OA 3BZFB 5GS3A 4DFIA 4PRIB 4N0UB 1EK3A 4QHUA 4I3SL 3QIBD 3D0VB 2P5ED 4I18A 2B2XH 4PY7A 5EPMB 3H7BA 3UROR 1YJDH 1MNUH 4WO4C 3ZYZA 4YE4H 3IU4L 4FZ8L 4YHKL 1J10A 3KPRD 3TBVB 4GBXC 4PJGF 1HKLL 2EZ0D 4X6CA 5FUOL 2NXYB 3N0PB 3U7AA 5EZIL 1TZGL 4YK4C 4LSSL 2WV3A 3DV4A 3WO4C 2A9ML 3CCHA 3GI9L 3CLFL 5DRXB 2IGFL 5FKAB 2MWCA 3SGEH 4URTB 1FORH 3D0LB 4I1NB 1CFSA 4PJBB 3LS5L 5IKCA 2NY2D 4UUJB 1W8NA 3QQ4A 3C60C 2Y36H 4D9LH 1YEEH 1M7DA 2E7CA 1UWXH 3WD5H 5IWLC 3DVNB 1ZANH 2Y07H 1MHHB 4O58H 1QD0A 3BJLA 5K9QG 3B9KC 1U8JB 3KPSA 3MREA 3D6GA 4HLZH 4EXPX 1RJCA 35C8L 2IANE 1JNJA 3GKWH 1I7ZA 5DJAB 2E6JA 5D2NA 3FB8B 3PL6B 1FL3B 4ODBD 3PWNB 4L5FL 1N5AB 4ZMAT 2BHYA 2P5WA 4AT6B 3MOAL 4IHOB 2IPUG 4KI5F 5HBBA 2BNQD 4PP2A 1QG3A 4EDWL 3DX9B 3RY6C 3HPLB 1UB5B 1JGUH 3WL9B 1LVEA 4EI5A 1YDPB 1HXMA 2E8ZA 1AGDA 4KJWC 4X0KA 3HG1B 3HPJB 4LPCA 1L0QA 5ACZA 5MENB 4OZIA 4GS7B 1NUDA 5DQDH 2HRLA 2Z31A 5DD0H 4X6FB 3SDYH 1CK0L 2BVEA 1NFIA 4MQXC 2HWZH 4JFFB 4IRJC 4P9ML 3VWJC 2EXYD 3NGBC 4UT9L 4X9IA 3FMGH 4HH9B 3CVHA 4JM4L 3MRFB 4X9GA 3VJ6B 3TBYA 3HAEG 2J8UF 4NRZA 4YHLL 1U6AH 2FR4A 3RVVC 5HI3C 3WFDL 4U3HA 2VH5H 1ODAA 4M43H 1JHLH 4DFHA 1RMFH 4LSUH 1GXEA 3DXAA 3QG6B 4G6KH 3HLAB 4Z7VB 2EO9A 2NLJA 5T1MA 1FZJA 4LHUB 3SGJA 3P0YL 3ORJA 4XNXH 1A2YB 4BZ2H 2ORBH 1KACB 4DUXA 4M62L 2BVOB 3LPFA 1WK0A 1SJHB 3V0AC 3WIHL 4JZNB 1OT2A 4PTTA 1H3WM 5DD3H 5KSAA 2VQ1B 1F6AA 2H8PB 1RZGB 1U8NA 4NQEA 3JV0A 3U36A 1LO3L 4J3SA 1GGUA 3HNTH 1KCRH 1FNFA 1PQZB 4QRRE 1R0AH 3V6ZA 4NDMA 1LDPH 1OWRM 5JW5B 4NJAL 5EUKB 3CC5A 4LSPH 3U4EB 5DHVB 4JFDB 1PKQE 1DQJA 1U95B 3ZE0E 5INCA 1V3KA 5I1GH 2DLIA 3L5JA 1JRHL 1HDMB 4JN1H 1WV7T 2VE6B 5FGBA 1RIHL 2B4CH 5ID1B 3P30H 4YBHA 5DLMH 4UIMA 4AYFA 3KLHD 3RVUC 4DAGH 1A9BB 1MCLA 3CLEH 1JF1A 1YMMB 4W68A 3NABH 2AABH 4OZHE 1R5WA 5D7IA 1YQ2A 2NY4D 2JB6A 4OCWH 4TQEH 3SDAD 2IMNA 1WUNT 1I7TB 4CAGA 3ZTNL 1CXLA 3DRTA 4C56D 1A7RH 1QLFB 5TE7L 1U8IA 4LFHD 1B0GB 1CFBA 1U3JA 3HC3H 2F53D 5A40E 1AO7D 4EJ1C 4X6DB 5MI0B 2O5YL 1SY6L 4ZS7L 3OAZH 2BY1A 4LQ1A 5D2LF 4L4TB 4GG6A 2F15A 3B6SB 4HQQL 4DGVL 4QF1A 3HRPA 4PRPE 4YHML 3DVIA 2E27L 5IHLB 2KUTA 1KJ2L 3AVEA 5CS7A 3DOSA 2JCCA 3UZVB 1YUHB 3QFJD 2GK2A 4YXHH 1XAUA 2H6PB 3IDMA 5MI0C 3EOAB 2IFGA 5DD6B 1WGOA 1TQBB 1BVKA 3THMH 2PTUA 3NA9L 1G6RH 4S1DD 3RPIB 5FA3B 5K59E 3EZ8A 4LCCB 2VZVA 4UT6L 3FRPG 4U1JB 3FQNB 3AU1A 3VG0H 3UTSE 5HDOA 3ULUE 4RNRB 1KGCE 2DQTL 1JN6A 1F4WH 3I3BA 2VXVH 3WFBL 5D93C 1E27A 4PLOB 4HK0A 2E9WA 1B0WA 4JFED 1SEBB 1U3YA 4IRZH 2EH8H 1QZ1A 3QEQA 3MCG1 4M3JA 2WP3T 1FLRH 5DDHB 3C2SA 1GIGH 3VFVA 3MACL 3JVGA 3T77B 2AK4B 3OKLB 4UTAH 1W72B 2QHLA 4LIQH 4ZUUB 3CFEA 4OD1H 3G04B 1P7HL 3UTTD 3WIIH 4CKVX 4KTDH 1RUQH 5D96C 1TLKA 1CLYL 3EHBC 4BFIA 4CVWA 4WW1A 2IPUK 4JDZB 1GOHA 3MJ9A 1S5HA 3LKPB 4KMTL 1MJUL 3Q3GB 5J12C 1NCWL 5DJ0B 2QQLH 1DVFA 4HUXA 3EDJA 3L3HB 4FFWD 4ZXBA 4HZAA 2EDQA 3L3DB 2B20A 2EKSA 4HDIB 5K9KB 5IV2B 2ID5A 3SJVD 4MDJA 1KJMB 2OS7A 5D1QB 3KYOA 4DN4H 3MRLA 1P6FA 4IRSA 1X44A 2QKIA 2DD8H 2A83B 1PY4A 2YPKA 2CXKA 2A0LD 5DURD 2QSCH 2PO6B 2VDRL 4F7PA 1IT9L 3W11D 3E6HA 3NFPA 1NKOA 2BX5A 3RVTC 1XR8B 2IQAA 1AKJA 3LKSA 5HYQB 1I1RA 4ELMA 1GGTA 4PUBH 3MLTB 3T0XA 3ARDD 5IMMA 4KK5D 3QDJA 1MCPH 4X7TB 3T65A 1CD0A 3CXDH 1C08B 1QPXA 4JY4A 5DUBA 3MNVB 5LWYL 3N50A 1PG7H 4WDIB 5C07A 4HPOH 2X41A 1I8KB 4XRCA 2OX5A 3SKUD 1CS6A 3EJYC 1GRWA 4H1LB 1KPRB 4WWKA 4OKVB 2B0SH 2AJYL 2RCSH 3WUWB 3GUTA 4C4KO 3HMWH 1EFXB 4F9LA 3GSWB 3DI2B 2R0LL 4Z7UE 5IB4A 5GJSH 1MAML 1IC4H 2F54D 4YDVB 5DVLA 3T0EC 1A14L 3OX8A 5C0GA 2Z91B 4R96B 1UWXK 2HFFA 4NQDE 1R3JB 1H8OA 3MRKB 4CNIA 1HWGB 3KJ4C 5E5MB 3ARFC 3KDMB 3HAEA 1P2CB 3L1OH 3M8OH 5JZ7C 2ADIA 3LD8B 2FO4B 1ZHKB 5IHZA 4OGXH 2E6PA 1JJUA 4RCAA 1JWUA 2BSRA 3DURA 4P46D 1WC7A 3QRFM 3CH8A 3GGWB 5GRZA 3N06B 3MLYL 4Q97A 1FDLH 1M05A 5EIIB 5BO1L 3RTQD 1V5JA 3WDJA 4P23A 4DGIH 4K7FA 3BN3B 3IJSB 3MPCA 3MRPB 3FFCE 4WHTB 2QJDA 3TEUA 4ZG1A 1NAMA 5DVOA 1KEGL 1RU9H 4I3SH 1MFNA 2NXZB 3WKNA 3TN0A 3MRIB 1ZOXA 3C5JB 1Z3GL 1IM9A 2G9HB 1KT2A 1HSAB 3IU4H 4LOUC 5I1HL 4FZ8H 2GJZB 4YHKH 5FO9A 3P9LB 1WAAF 1C12B 5AWNH 2FIKA 3L3OB 5FUOH 4OZFH 3TYGL 2BY3A 4XAKE 1TZGH 1KTDB 3T1WA 5HGAB 5C0EA 3W81A 4H25A 3GI9H 4NYLA 4EVNB 1QLRB 3ARQA 3QUKA 5E9DA 2E3VA 3BUYA 1PG7X 2PTTA 5ELIA 3QUYD 4JE4B 1NANI 1T7VA 3H42L 1PZ5B 4P99A 4KDWA 1XGPB 3GBLA 4PV8B 2QADC 3W2DL 1AXSB 2R1WA 3WNPA 2Z4QB 35C8H 5IIEA 2A6IB 1WF5A 2PKDA 4FQ2L 5DA4A 4AIXA 2H9GB 4N68A 1ERNA 3WS3B 4L5FH 5L8LB 5FK9A 4XI5C 1BOYA 3RGVB 3MOAH 5FEBA 5CSGA 1LE5B 2DYPD 2WBKA 1P5VA 3CD4A 4HJJL 5HYJE 5EB9A 4QRTB 1EO7A 5L8KB 4EDWH 2H1PL 1EJOH 4IIQB 4I48B 3TT1L 2VZ3A 5C0AD 1GOGA 1N7ML 1X5IA 4JDVA 4NP4L 3U83A 3VGGA 4PJFA 4K7PY 1HH9A 3AMLA 3WS6A 5EZLB 1RZJL 3MV9A 2IBBA 3IDJB 3X3FL 4M9PA 1S5IL 4LLYB 4PRBB 2FH6A 3G5YA 1X5ZA 1CK0H 2V2TB 2VABB 3MMEB 1ZLUH 1DFBL 4P5MB 2QLVB 1MAJA 4UT9H 5F3HA 3FRPA 3D25B 4JM4H 2XACC 2UZXB 1IAOA 1RK1A 4YHLH 4BSJA 3WFDH 3CXHK 4ZO6A 2DI8A 1R3LB 4KK8C 2VITB 1JGEA 3VXRA 2VO5A 3Q5YA 1CF8L 3EIFA 3UDWC 3P0YH 1FNAA 1HKFA 5I1EL 3OAUL 4XAWL 1G9MC 3O6KH 3V4PL 4M62H 2BNUA 3VFSB 1J1XL 1NCTA 4LP5A 1OQOA 3WIHH 4M8VA 4OLXL 2P8LB 3OKDA 1IAMA 4FQXD 4PGCB 4ZYKB 3ROLA 4PY8I 3RWJA 2EC9T 4JKPL 5DEFB 5ALCL 2IH1B 2HH0L 4Z7WB 3G5VA 3STLB 4NJAH 1EJ6A 4D0CB 4R8WL 2X4NA 3N1PC 1HHKA 2RB8A 2WANA 4DKFL 3TH2T 3OJ2C 4RDQG 2KBGA 1P7QD 5I1KL 1JRHH 1ZT4A 3D69B 4DJMA 5KVMC 5SWZA 1XIWC 2R69L 4ZUWA 2Z92B 4ISVA 4NGHL 2WP3O 3EYQC 4PJEE 3GDBA 5DC0A 2DLTA 1FNHA 2FD6L 1QFUH 2LQRA 5IJKA 4O2EA 4PJ8D 4WV1B 3SCMC 3EYUL 1BFVL 4IJ3B 4NM8H 2HLFC 2CKBB 1AIFA 3GNML 4JKKA 5E08L 2QSQA 4PYHA 4GUPA 2I9TA 3OKEA 3ZTNH 4F7MA 1H9VA 5TE7H 5GPRA 5BZWA 4D0DB 4L4VA 1J12A 1BHGA 4PJXE 3VXNB 1F4XL 2HN7A 3NZ8A 1CXIA 4XNUH 5JQ6L 4LBEA 1ZSDB 5HVWA 2RFXA 1OPGL 3OG6B 2O5YH 1SY6H 2MHAA 4ZS7H 1W0WA 1A64A 3H2WA 1EX0A 3OKOA 1J8HE 2MNUA 3GM8A 3LPWA 2PW1B 3ARGC 3DUHA 1I3GL 2DQCL 4K8RC 5DS8A 3TLRA 4HQQH 4QNPF 5C09D 3RWHB 3VXSB 3BGFB 4HKZA 4YHMH 4ZSOA 3C5ZC 3T0VA 4XCYA 2E27H 1S7XA 1KJ2H 3C6SB 3TO4B 3HMXL 1CCZA 5JA9A 2RAMA 2XKUA 2EDRA 2VLJA 3EO0B 5KN5A 4LPWA 2I27N 1DP0A 3NA9H 3VH8B 1YNTB 3T8XA 5IMOB 2A74B 2FATL 3U0TB 4UT6H 2SEBA 3V7AG 2H2SC 1DLHB 1LEGA 2B1AH 4P4RA 5IF0A 2BOCA 5IB5B 3BX7C 4JLRA 2X1WL 2DQTH 3PQYD 5C2UB 4PR5B 2R0WH 4NM4L 2B1HL 2E6QA 3FB6A 3MJ6A 4Y4FD 4EXKA 3BWAA 4LLUB 3LHPL 4UAOC 3STZA 5IW1A 2Y6SC 2C3XA 1A3LL 5F1NB 3DETD 2J5LB 1V3MA 2CLZA 5JPMA 3MACH 5D1XD 1J1OL 1GZPA 1QVOA 3TYFB 4FQLL 4YHYC 5F1SA 5T33L 1HINH 4Y4HD 1DL7L 4KDTA 3GMRB 3PGCB 4PJGE 1QSVA 2V5RA 3VDBA 1WTLA 3HR5A 3Q48A 4HC1L 1AGEB 1JYWA 1CLYH 3IJHB 4MNHB 3BXNA 1VA9A 1QTYT 5L88L 1BJMA 4KMTH 2HKHL 1MJUH 3UYRL 4KUCD 3R06B 3AREC 2X10A 5LGKA 2H32B 2V7HB 4HUNB 3CSGA 1E4KA 1JPFA 3INUL 3U6RB 3AAZB 1KLGB 4JM2D 5E8PB 3QNZA 1U3HD 5E5RB 1PKQB 3PG2A 2K7QA 3MO1A 3ARWA 3B2UC 3O3EB 2YD9A 2WK2A 1JI2A 4KKAC 3RDTB 3AS2A 4FQPA 1CE1L 1NGPL 1MRFL 2F74B 5J7CC 1AH1A 3ALWA 2A1WL 2PETA 5H37H 5JOPD 4F80A 3MRMA 3OJDA 3LKQA 4PREB 3ULVF 2ED9A 2IAMB 1QSZA 4JN2A 4KI5E 5C08D 2ICWA 4DVBA 3O4LE 1AJ7L 5EO1A 2R2HA 5JNYB 4N1CA 4OZHB 1EGJL 1I1CA 4NPYA 3RL1B 5LWYH 5DF0A 4IOSD 4JRYA 4RAVB 1GZQB 6CGTA 5IK3B 3VXUA 5I1CL 4AG4L 5H35B 3V6FA 4OFYA 5C0JA 2E8YA 1JPGB 3O3AB 3NFNA 4Y5VB 5JR1L 2VLKA 1X5JA 2BSED 1IKNC 2AJYH 1U8LA 3BZ4A 2APXA 2C3VB 4Y19A 5ISZD 1S9VB 2YS4A 4FFYH 2R0LH 5TQ0H 2GTWB 2MCPL 3SHSA 4K71B 4YFLI 1A14H 5MHSE 2J8UE 5CKGA 1PKOA 1C8PA 2B5IB 2J4WL 3KYNA 3MLSL 1ZK9A 5LKNA 2UV3A 3CH1B 3TA3B 3X13B 1BWMA 4GW5A 4PRPB 3ARRA 4FP8L 5GGSY 4AMKL 2I5YL 4JRXD 3RAJL 4HUWA 4LLDB 1FL5B 4HLJA 5EO9B 4ZPTA 5CWSB 3KPQB 2JIXD 4AQOA 4CVZB 1U8QB 1D6VL 2AS5M 1S9YA 1L9NA 5CEYA 2AGJL 2I9LB 2VL5B 43CAA 3MLYH 5KS9B 2CLVB 2ITDB 3ELAT 3UZEA 2B39A 2ZG1A 5BO1H 4OZFA 2BMKA 4E41D 3I9GL 4ELKB 5E1AB 5MEOA 3L6FA 5E4EB 4NKMB 3WDHA 1BJ1H 5MEQB 3UPCA 2R4RL 1JGLH 3PWLA 1KEGH 1LO4L 3BP4A 1A4KB 3IDYB 3LN5A 4NC2B 2CIKA 1Z3GH 4NO0A 3MLWL 3L95B 1OGAE 1AY1L 3QAZC 5I1HH 4LFHG 1QSEE 1AE6L 4HT1H 2W60B 5T1KB 3FO2B 4MNGA 4WI2A 2PYEB 4ENED 4MJ5A 1V3LA 3TYGH 4P3WA 4YDLC 5JXEC 3QI9A 4WY7H 5T1DL 1B6UA 1MHEB 2V5YA 4G8IB 4DK3A 1P1ZA 5DRNB 3RZCD 1ES0B 1K5NA 5JOFA 5T3ZD 2KQMA 5BRZE 2X4PB 2VXUL 3H42H 4U6YB 4BKLB 1A7OH 1DN0B 3W2DH 5ESAB 5MEPA 3UPAA 1CGWA 4ZUVA 5CD5C 4TSAL 1CIDA 4FQ2H 3DMMC 4AK1A 1EV2E 3QIWA 4Q9QL 1HN1A 3KPPA 2HT2C 2GTZA 1XZ0B 5D2LE 4XPBL 2CIIA 1OQXA 4HXBL 1FRGH 2N7BA 4EN3B 2EDKA 2AV7B 1ULVA 4HJJH 4WI4A 4N8CL 4RQQA 1DUZB 3MGOA 1T0MB 2GUOB 2H1PH 4AENB 3TT1H 3FHAA 5ACLA 2NY3C 1N7MH 4NP4H 3MA9L 4M61B 1NCDL 4G6FD 3HI1B 3RWCA 1BX2B 4GBXD 1YEGH 4L8CA 1RZJH 4Z7QE 3KPNB 5D1ZB 3X3FH 3BHBB 4QOKA 1S5IH 4YWGL 3SDDB 1LK2B 2P8PA 1DANU 4JPWL 3BYTA 2MCG1 3QIBA 4PRID 2P5EA 1DFBH 3EFFB 3ILPA 4WTWA 3DRQA 4Z7UB 4I18C 4RAUB 1CGVA 3C60D 4ACPA 4Q0XL 4X4XB 2ICEA 3HS0A 1I1YB 5I76B 4NN5C 1Q9WA 3KPRA 1WFTA 2FL5A 5ADPL 1G9NC 2VUOA 5DEZA 2V5TA 4NQDB 1O0VA 2EYTB 4MB5A 1JL8A 1F4AA 1D5ZA 1T6WA 3GSQB 4GG6F 2OL3L 2GSIA 3D39B 2DQHL 2VWEC 1CF8H 5A16A 2IADA 2C7UA 5I1EH 4NKOB 3OAUH 2P7TB 2R29L 1WIPA 2UYLA 3V4PH 3QDHA 4GKZB 3G08B 2G2RA 1J1XH 2JCCF 4M6NL 1FP5A 5FHAL 1HE7A 4LEOB 4OLXH 3I6LD 4UDUB 4R7NA 1VGKA 1TZIA 3WDIA 2EDNA 1WWCA 3NCMA 2OXGA 1NGQH 1OGTB 4I2XE 1T04B 2NQCA 4JKPH 4OD2B 1BQHG 2HH0H 3NOIA 3PWPD 1H15B 4MGXA 3PL6D 4S11A 5D2NC 3ROOB 4JO1H 3FFCB 1FFOB 1PGRB 4ODWB 5E8EB 1JPSL 4R8WH 3W9EA 4DKFH 5J6HA 4G8EB 1RIUL 3DHMA 5I1KH 2H3NB 4UIKL 2BNQA 1R3KB 2R69H 4UTBL 5T3ZL 1EHAA 4MHHI 4NGHH 1I9IL 3P4OA 4IRJD 4OBRA 4YZFF 3O45B 1QHOA 2JJWA 1EA9C 2I25N 5D7LE 1SY6A 1FNLA 4PGBB 2R23A 4J3VA 3EYUH 1BFVH 3HG1D 4ODXB 4QKXB 5I74C 3ZL4L 3GNMH 4V1DD 1KB5B 2X4TB 2AQ2A 4G6JH 2Z31C 1ZVSB 2F8VA 2XZQL 1KJ2A 3WXVL 4OZGF 5DHYA 1B4JL 3P2TA 3T3ME 4JY6B 4YXLL 1TTUA 1LDSA 2VLRD 2IQ9L 4XPTL 3W9DA 5JQ6H 3DX8B 4HIJA 4XPHL 5HHMB 3JV6A 1OPGH 3MODH 3IFNL 4FXGA 1UZ8A 1YEFL 2FBOJ 3IVKA 1BF2A 1ACYH 1I3GH 5BXFB 2DQCH 5HHNA 4MAYB 2EDOA 1M7IB 1ZVYA 4F9PA 2QQKL 5B8CA 3SGJC 1VADA 2VC2L 5AG8A 4ZS6D 2HA1A 3AROA 5HYJB 2CUHA 5AZ2L 1MCEA 3TCLA 3ECBB 5DA0B 5DJCA 5M7QA 3WCYA 3HMXH 3DX7B 4K3DL 5GS0D 5KSAC 4Y1AD 2OM5A 2GT9A 3GBML 2N4IA 3VW3L 4JG1H 4JZJB 1CDYA 2FATH 2DQJL 1MLBA 4N0CC 2CJUL 3OAYH 4JFDD 2WBWB 2QQNH 3BQUB 3QO0B 5I8EA 3X12A 1J8KA 4RWYH 3FQWA 4GMTL 1UYWL 1AGCA 2F9BT 3QUXB 4NM4H 4U6XB 2B1HH 1OM3H 1D5IL 4KJYA 5FGBC 3UTPE 5JMOC 3LHPH 1OSPH 5K9QI 1QRKA 1A3LH 1BD2E 1MRDH 4D0BB 1YMMD 2VQTA 2HAZA 4WJ5B 3SOBL 4FQLH 5T33H 5IW3A 3ALXA 3SDAA 4PBWD 2UZIL 1WAAE 4X98A 1U41A 4Y2OA 3C08L 3BP7B 4C56A 5TQ2L 1XH3B 1D5XB 3KXFE 1OAKL 1ED3B 5L88H 2F53A 3QQ9D 5C70A 1OAYH 1OTSC 1HHGB 2HKHH 3UYRH 1UXWB 1AO7A 4FQHA 1EEZB 1AR2A 5EZJB 3WHXB 4C83B 1IGCL 3FB7B 4GKSA 1I7RB 4CW1B 1RUPL 4OFIA 2R0ZL 3H0TB 3RVXD 3SBWA 3QUZB 1BFTA 4L4TD 4MXVF 1A1OB 1CXHA 4CN6A 5J11B 2BXZA 3V5KB 5CBAA 1QNZL 4YJZL 3K1KC 5I8OL 4G6AC 4WW2F 2Y06H 5C6TH 2A1WH 5JIPA 2X7LA 3V5DA 5I71B 1L0XA 1NDMA 3QFJA 4PJEB 3VFTB 3QCUL 2R1XB 3BIBX 4TUJA 4U6HA 5L8JB 5DJ2B 1HQRA 5AZEL 3MR9B 1AJ7H 3TIDB 1EGJH 3QNYB 3KPLB 4W81A 1FC1A 2HT4C 4KUZL 4MAUH 1T0NA 3V5HB 1A1NB 3DYMA 5E00B 5I1CH 1H8SA 3F7VB 3HZVA 1OF2B 4AG4H 1QA9B 2XIDA 5HY9A 4JY5H 3GFUA 5DJYA 2YA0A 1BBJA 1SJVA 3BKYL 3E2HB 5HHOE 5T3XL 5DMJB 1LEKA 3V95A 4PJXB 5EZOL 1I9JL 3EHBD 1KEMH 4JFEA 5F7DA 3QPQD 3KR3H 5TFSL 1CD8A 4ZO7A 3FT4A 2R2EB 2MCPH 1H5BB 2G75B 1MH5A 1QHPA 1J8HB 3ET9F 3JVGC 3VFPB 4LLQA 4E0RB 3I2CL 3QZWG 1FQ9C 5AEAA 1I8MB 1MY7A 1RIVL 2AK4D 2J4WH 1XGQB 4MQSB 2X5PA 2EICA 3MLSH 8FABB 3UTTA 4DKAA 1JNLH 4Z76B 1IGTA 2AXFA 4KK9C 5HGBB 2I5YH 2DDQL 3RY5A 3RAJH 5FECA 5C0CD 4PRHE 1U0QA 4RMRA 3P0VL 5GGRB 4NJ9L 4BM7A 2IC2A 1D6VH 3VFUA 1DVFC 1PX4A 3NPZB 4HAFA 4TVPL 1CGXA 3SJVA 3TZVB 5D1QD 1OLLA 4X7SL 3K80A 1LQSR 4KROB 4IRSC 4R4FL 4Y4KB 3MRNA 2YUVA 1DBKL 3I9GH 3REVB 2PO6D 4OD3L 3G5ZB 4HV8B 3MJ7A 1E28A 5JHDD 3REWB 5SX5H 1FFNA 1CLCA 3QJHB 3KWWB 5F1KC 5HHQA 1G7HA 1BQHA 1ZLSH 3ARDA 1LO4H 3SDXE 1CN4A 2MKLC 2EDWA 3MLWH 3BIKB 2WLZA 1ZLWH 1AY1H 4XX1G 5KSUA 1MLCB 1AE6H 1F3JA 4ERSL 3V7AE 1CFNA 1JPTL 3UZQA 1JF6A 4PJGB 4XB7A 3NMEA 5C0IB 4G8GE 1FNGA 2QR0B 3UBXG 4KGLA 5EC1B 5T1DH 2MPAL 2YZ1A 1T22B 4CL7A 5IFJA 1CDHA 1ZA6A 3NN8B 3KHOA 3BMVA 1WBZA 3T2PA 4MVBC 4OM1H 4J1UA 1U92A 4JFPB 5EFIA 3VXQB 4MCZB 3CDGB 4DKEL 1NFKA 4W4OA 5JZ7D 1EFXD 4XBGB 4F9LC 1FFPA 4IS6B 3QEUA 5GRWA 4HPYL 4MDIB 4DEPC 2F54A 3QT2A 2VXUH 3GSUB 1X5FA 4QHMA 1T1XB 3IKCB 1LNUA 3U79A 2WIMA 5GGSA 4R9HA 1VEMA 4TTDC 4CADB 4TSAH 1XGRB 5EOQL 2W0FA 5CLWA 3QCVL 4B5EA 3OR7A 4R2GC 4DK6A 3E1F1 5JDSA 4HIHA 4LPVA 3QDGE 3D5OF 4XPBH 3ILQC 4HXBH 5GRVK 4QNPE 4WHYG 1WVZA 4N8CH 4P46A 3O4LB 3LAFA 4HWZA 1B88A 3SO5A 4JG0L 4HULB 5ESVB 3MA9H 3RTQA 4M8QA 4LOUD 5KAQF 1W72L 4MB3A 1L6ZA 4QT5A 3B8SA 3S97C 1HEZA 4P23C 1J0YA 1GSMA 3CFDA 5C0RL 4JPWH 3BEWA 3VFRB 2NXZD 4OQTL 3JWDL 2AJZB 5I1DB 5CP3H 3TN0C 4YR6B 3NA4A 3VXPB 4U1KB 5M94B 3NZHL 3QSKB 1AD0A 3RRQA 3FCTB 1SEQL 3ZO0A 4CVXB 2J8UB 1HHJB 2OMBA 5IEKA 4NQCD 1NCCL 1NDGA 4IOFC 4AIZA 3MROB 4RFNB 1IZKA 2D0FA 5FV1L 2OL3H 5CJQL 1OB1B 4JGUA 5CBEA 5IMLA 5E8NB 5KOVC 2R29H 4HF5L 5IEHA 3VXMB 2W65B 5DK0A 4M6NH 5DZLA 5B4MD 5FHAH 3QUYA 3OKYA 1RHHB 4LVHC 2FO1A 1FG2B 1CD1B 1RAMA 3LSOA 4NNXA 1JWSA 5CEZD 2RHEA 4YHIA 1XR9B 3MCKB 1ORSA 4RX4D 5B39G 5GGVL 1T2QL 2X4OA 1RUML 1AXIB 3NPSC 5HTSA 4OUOA 5E2VL 2VDPH 4FTVE 5KW9L 2YPLD 4GXUN 1DDHB 1LE9B 2R8SL 1JPSH 3DTXA 1RIUH 3RGVD 2DYPA 4YHNB 5D5MA 3LKOB 4HX1A 4GQ9H 4O2FA 4UIKH 5IVNA 4N0YH 4G7VL 4ZUSA 3OAYK 4UTBH 1CE6A 5T3ZH 3WIFB 4ONHB 1I9IH 2X42A 1F42A 4LVOC 4LL9A 5C0AA 1B3JA 3FT3A 1QSEB 4B7LA 5FB8A 3IAGC 3WHE0 3T2NL 3EOYG 1N2RB 3WS6C 4R4ND 3ZL4H 1UC6A 3HB3C 4LASH 5A2IH 1LO5A 4TOYH 1LP9F 2X4RB 3DUUB 5C0FB 2X4UB 2CRIA 1CR9L 3WXVH 1B4JH 3TC9A 2AJXL 2W38A 1I75A 5BRZB 3O3BB 2IQ9H 4XPTH 5EIQA 4NUGL 4XXDA 4F37F 4HUUA 4OLUL 4CGTA 3IFNH 3EKCA 5A2LH 2W91A 1YEFH 4EI6B 5I9QB 2PN5A 3BPLB 4RMVA 2Y7QA 3U4BL 2VXQH 5D2LB 5J1AB 1NLDL 4FG6C 2QQKH 4J23A 5BV7C 2VERN 2HYMA 1YZZA 3C8KB 2VC2H 2CLRA 5AZ2H 5CIPB 3RWFB 3RWDA 4PRNA 2D7NA 3U46A 5C1MB 3RI5K 4BELD 7CGTA 4FQXA 1DE4A 2EDHA 3OHXB 4K3DH 1XIWD 2DWDA 1MRCL 1A4JB 3FQXA 1XF5A 1BBDL 1R5IA 1XF3B 4JDTH 3GBMH 3VW3H 5ETUA 2RIKA 3QUMB 4Y5YC 1KXTB 2DQJH 3SCMD 1JYXA 2CJUH 3BW9A 1I1FA 1VGEH 4HC1A 2H26B 1P7QA 5HXMA 4GMTH 1UYWH 5DRWB 2EDYA 4XHJD 2VAAA 4EBQL 1D5IH 3IFOB 1S7VB 5C0BB 1KXQE 4PJHA 2CUIA 3ZHDA 3RVWD 4OAWA 4JAMA 4PJ8A 4Z5RB 3ZDYF 3HRZB 5IJKC 3PHSA 3CGTA 4UQ3B 2JJVA 3SOBH 3QULB 5D70H 2OMNA 1EEQA 2NX5B 2ICWI 2UZIH 4M7LT 3P9MA 2Z35A 4XVSL 3I6GB 1F8TH 2P43B 3C08H 2OI9C 1TETL 3C09B 3O41B 3DGGB 3O9WC 3RIFK 5DSCA 5HYEA 1VCAA 3IGAA 1JNNL 2RJMA 3UBXA 3FQUA 4PJCA 1CVSC 3VFNB 4I2XB 1GGIH 3O4OB 1IGCH 4HKJA 4CMMB 3O8XB 3JTTA 1BZQK 1CYGA 1REIA 2IAND 4A6YB 1RUPH 1EGJA 4JFYB 4ZPVA 2CDFB 2KDGA 2R0ZH 5DFVC 3H3PL 1MCHA 3S96A 1G7IA 2APWA 3LQZB 5GS1B 2X89D 2H2SD 1U8PA 4WU7A 1MFAL 1Q9OB 4QY8B 3QXAA 1QNZH 5I8OH 2DBLL 3BSZL 1YQVL 4Q6IB 3HUJA 1U8HA 5IW6B 1G9ML 4WHCA 1Y18A 2FYYB 5A1AA 3QCUH 3MRRA 4U1NB 3WNOA 5I1LA 5SX5K 1FL6A 4XC3L 5EOCJ 1MIML 1LD9B 4JO3L 2XZCL 1NGZB 3VDCA 4Z8FH 4OI7A 5LVEA 1PW3A 3UEZA 4KUZH 2NR6D 4YX2L 1U3ZA 5EU4B 4KK6C 5ICXB 3F7YB 4YUEL 3PQYA 1KIPB 1OSZB 4H5SB 3L3KA 2WLYA 3KPTA 5T3XH 3BKYH 5FKPA 2FGZA 1A7BA 5EZOH 4Y4FA 4X5WA 3RWEB 1I9JH 3F8UB 1GGCL 1NSNH 4F33A 4J3OC 2FEEI 3SE8L 1HHIB 5F7KC 3D9AL 5TFSH 3H9SE 4YAQA 5D1XA 5JHLL 4NHCL 5DC9B 4HWBL 4Y4HA 3I2CH 5TGBA 2C5DC 1QEWA 4NZJA 1RIVH 1WEJH 4ZFGL 4CU8A 4HCRL 3PWUB 1X4ZA 4XNQA 1NQBA 3GIVA 5F9AC 1BOGB 5DRZA 4DOHE 3FOLA 3P0VH 2WUBH 3FZUC 4NJ9H 4YFDB 3MFGB 5H2BB 5IB3B 3GJFH 3LRSA 4TVPH 4OIAA 1I1AC 3DUSB 2V9TA 1PD6A 2PR4L 4EQ2A 5JLZA 4IMKA 4QRRD 3OB8A 4KTYA 4JM2A 3TNMB 5JIIA 2VN4A 3VWKB 1NJ9A 4HJ0D 4X7SH 1U3HA 5CZKA 1K4DB 5DJXB 3WHE1 4O9HL 3DNKA 4R0LA 4N5EC 4R4FH 3QH3A 5I17A 3P4NA 4K8RL 2IH3B 4M93C 3RDTD 3T3PF 3E6FB 5MERA 1U58B 5E94A 1ZLVH 4P57B 4ZODA 1SYVA 3AY4A 4M1DH 5IB2A 5B39A 4CVUA 3GMLA 3QG7L 1DQDL 2IAMD 1MJ7L 5C08A 4K2UL 1BD2B 3GO1L 1JWMA 2MTPA 5CSZB 3IXAA 3Q5OA 2WUCL 4N8PA 1J0KA 5FGCE 4ERSH 2EE2A 3GB7A 4ZOAA 4MX7A 4PJIA 3H3KA 1H3XA 3SQBA 5JPNA 1QFPA 4PB0L 2MPAH 3RWGB 3KXFB 4JCMA 1JMZA 5B38B 4PG9B 3O2VH 5F44A 3WKMH 2HT3C 3CVIL 4GOSA 4L3CB 2XXMB 5ISZA 4KRPC 2BCKA 4DKEH 4P59L 4OZGE 5E2UL 5I16B 3FRUA 2GJ6B 4HPYH 4LHUG 1MCWM 3GSVB 1NGYA 1P9MA 3GRWL 2Q87A 5FHBL 3TBTA 4X83A 1HXYB 4XVJL 2VSDA 5DJ8B 5E99L 3ETBF 4PD4K 3S36L 3RU8H 4NN6C 3D18B 5EC2B 1H3VA 4TVSa 1UB6B 4PRPD 4JRXA 3MX0A 3GSRA 2DQUL 4K3EH 1F11A 4G9FE 2JIXA 3WV0A 3HI5H 2ZOLB 1WBYA 3WNLA 3RNQB 1NCAL 5CP3A 4R3SA 4R6UA 1KC5L 1JRHI 4HFWB 5BW7A 3QDJE 4MD4A 1LEIA 1CDUA 1JZ8A 2A2QT 4O51B 1TZHA 4GW1A 1CG9B 2GY7B 2ZCLL 3QWOB 1TQCB 4E41A 2HMIC 1W72H 3UTSD 1QKZH 3OB0H 1KGCD 1FYTE 3BZEA 4LCYB 4Y16B 3P73B 5C0RH 4U0RB 3RKPA 4PS4L 1R3HB 2E5EA 3CFKB 5F7EL 2YD4A 4YPJA 4ZD3H 4OQTH 4UBDC 5J57B 3BMWA 1QSFE 3FO0L 1DUYA 3NZHH 1J7VR 1SEQH 3RHWF 2BXYA 4XGZA 2Z8RA 5LGJA 3MNZB 3T4AB 5T1KD 3MLZL 1NCCH 4MA1C 4P5KB 2UWEF 4NNPL 5HGDA 3QI9C 4M5ZL 4NKIL 5TF1L 5CHNB 5CJQH 1D5MB 4PRHB 3OPZH 1I9RL 1AD9A 4K07A 2XI9A 3RZCA 1K9TA 2YKLL 4HF5H 2YHGA 4K23L 5FYKE 2FZ3B 1FBIL 4AEHL 2D7TL 5EUOF 2XQBL 1ORQA 1TVBB 4NCC1 5BZDB 4XB8A 1KPUA 1ZT1B 1N3NA 5I2IB 3BDYL 1RUMH 4U1SB 1MVUA 4PV9B 3LKRA 3QIWC 5KW9H 3BVNA 4HS3A 4PJ7F 2NY7L 2XXCB 4X5LA 3U30B 4S1SL 2R8SH 1D9KC 5EBWA 2XWJA 2YR3A 4MXVE 5E5UB 5HI4D 1A7PL 4PG2C 4JFZL 4EN3D 2CDEB 1U93A 1FV1A 25C8L 3LN9A 2Q76A 3S98A 3VE0B 2GFBB 2CR3A 1OTTC 4G7VH 5BQ7A 1NC4B 2VZ1A 4WUUE 3C6LC 5JXAL 2NY0C 4JHWH 5ENWB 1TIUA 4Y2DB 2A6DB 2ZNWA 5DZNA 5DFWH 3CSPA 1QO3B 3JSSA 1P4BL 3T2NH 4GBXA 4AQ1B 1NLBL 4BQCA 4QHLA 2EEBA 4LCUA 2XPGB 2NY1C 1NBVL 1SBBA 4N9OB 3D2UB 2O93L 5HGHA 4IDLA 3MLXL 1D6EB 4HMCA 3SDDD 4S1RL 5CJOL 3BZFA 3BJ91 4PRIA 4N0UA 1CGSL 1CR9H 2V5SA 1KLUB 2AJXH 4OIIL 3C60A 3FFDB 3FL7A 3HTLX 3LEXB 1FIGL 4NO3B 1I3UA 2CGRL 5I8KL 5IWLA 4NUGH 2A73B 2VXSL 3RKDD 3TBVA 1FLTX 1UA6L 5JW4N 3AC0A 3IETB 3VGEA 1T2XA 4OLUH 32C2B 1JZ3A 2EZ0C 4NQDD 1CICB 4RIRB 1JVKA 3TBWB 3U4BH 1PY9A 3QDGB 1NLDH 3BRGC 2DJ4A 5DRXA 3ARYA 3D0LA 4PJBA 3BPCB 4UUJA 2IBGA 3SDCB 4HFUL 3DVNA 1MHHA 3V4VL 5DXWA 4EIGB 1U8JA 1U42A 3NFSL 5HHPB 1MRCH 1HI6A 1OP3H 1BBDH 2LTQC 2VLME 3PWPA 3FB8A 3PL6A 4MCYA 3GIZL 1FL3A 3HCVB 3IT8D 3FFCD 4U2YA 4NO2A 3ZTJG 3N1FC 1MFEH 2ZKHL 4LNRB 4AT6A 4IHOA 4PJ5E 5ICYB 5FCUL 2HTKD 3RA7L 4JFOB 4IRJA 3DX9A 3HPLA 3X3GL 4H1LG 3WL9A 5CSBA 3AXLB 3WUWG 2FJGB 3BPOC 1NPUA 4JFXA 2VMFA 4JO4L 2JF1A 5F9WB 1BAFL 1ZA3B 2VSCA 3HG1A 4RFOL 4XAKD 3HPJA 3UC0H 3X11A 3PHQB 5A2FA 2EIZB 1RJLB 4V1DA 2X6MA 5T5NG 4XVSH 4DCQB 2FRGP 4X6FA 5KTEL 1TETH 4XBEL 4N90E 4NZTL 1ETZB 2EXYC 1BMGA 1JYNA 2VLRA 3MRFA 4XWOD 2ESVE 4BA8A 1GAFL 1JNNH 4WIQA 3LKNB 4YHOL 3B9VA 4WFEE 1E6JH 2PXYB 5F9WC 1D7FA 1F45A 5IVZA 1G84A 1G9NL 4LQFL 4FTVB 4PRDB 3H3PH 4Z0XB 4AEEA 3QG6A 3HLAA 3GJFK 1KIQB 5J3HD 4XBPA 4F9PC 3CFJB 1MFAH 5B8CC 5HYJD 2BVOA 3U2SB 1ZXQA 2DBLH 3BSZH 1SJHA 1T1ZB 1G9MH 3H9HB 4QHUB 2VQ1A 2PXYC 3NVQA 4RMWA 4Y1AA 2YD3A 4YXKL 4KY1L 3OKMA 1NEZA 1ZLVK 3AS1A 1MIMH 1PQZA 4KTEH 3ZKXB 2XZCH 4FFZL 4F7CA 3MOBL 1RZFH 4RGNE 4K9EC 5EUKA 1VDGA 3U4EA 5DHVA 3O3DB 1MCIA 4JFDA 1JGVL 4YX2H 1YNKL 3W39A 3BQUD 3MRQB 3VFMB 1ZKAA 2R4SL 4YUEH 3ZYJA 1HDMA 3CCHB 2VE6A 5ID1A 1LO0L 3A6BL 3SE8H 3K4DA 1AGFB 3D9AH 4KZEL 4PRAA 5GGTL 3GJFA 1YMMA 4UV7H 4NHCH 5FFLA 4RFEB 1X5HA 1QRNE 2ZOKB 1MWAB 5GJTL 1K3ZA 4HWBH 3TJEH 1M71B 1IILE 2XZAH 4Y7MA 4HUVA 1JF5A 3SDAC 3LPGA 5I73B 1I7TA 1PG7W 3MJ8B 4HCRH 1QLFA 1FVCB 4JHAL 2Y72A 1B0GA 1NANH 4UDTA 4G6AD 3U48A 4XT1C 4PP2B 1VB9A 3IDGB 3CVHL 2ARJQ 1BGXL 2CK0L 2DQIL 2F58L 5C92A 4G6ML 5K9OB 5FUZL 1CXFA 4EI5B 2O5XL 1NBYA 4L4TA 3SBWC 4O9HH 3QUZD 1KB5L 4X0KB 3B6SA 2DQDH 3CPLA 1OARL 5EBLB 4K8RH 3LIZL 2IPTL 4RMUA 2F5AL 2HFEA 2EDLA 2AVGA 2ATKA 4YC2C 3UO1L 3M1BA 2KPNA 1YUHA 3OB0K 4OUUB 2H6PA 3QG7H 1DQDH 4S10A 1MJ7H 5DD6A 4ODUB 3BT2L 3GO1H 4Q9RL 3OKNA 3TBYB 3VI4F 2WUCH 3PNWA 1MEXL 3RPIA 4S1DC 4RZCA 1NL0L 4R90L 4U1JA 2VR9A 3FQNA 4RBPH 1RK0B 3LEVL 4RNRA 4PB0H 3WLBB 3DXAB 3HC4H 1JK8B 4PJDE 5CINH 3O2WH 3BD5A 5T1MB 1IFHL 4M7JH 5DQ9A 4KK9D 1K6QL 5F1IB 3N85L 5F6IB 3CVIH 1LP9E 4UILH 4P59H 3MGTB 5ID0A 2VR4A 4B0MM 1EEYA 5DDHA 1ACZA 2E9BA 3GRWH 3VD9A 1U8NB 5D7JC 1G6VK 4PJAF 1OAQL 3NIFF 1J8HD 3KLSA 4PLKD 5FHBH 1A7QH 4XVJH 2AK4A 2VZSA 4Y89A 2XQYG 5E99H 4EUPB 3OKLA 1W72A 3S36H 4ZUUA 4BK5A 3V79C 3G04A 3CC5B 2XTJE 1MFDL 1DQJB 5C0CA 4JDZA 1WBXA 2D0HA 3LKPA 3Q3GA 5IBTL 3R4DA 4ZFZB 4OQTA 1NCAH 4H88L 3L3HA 4FFWC 3L3DA 1KJMA 3N1MC 3TZVD 3WFEL 5D1QA 1JF1B 2DQFB 4D9QE 2ZCLH 4UQ2B 1LK3L 4KROD 3MV7E 4I5BB 2PO6A 4BH7A 1HYSD 3W11C 3S3SA 5JHDA 1XMWA 4HGWB 1S7QB 4CU7A 1I8IB 1NCUA 4PS4H 5HYQA 4YFEA 4GRLB 3DRTB 5F7EH 1RZ7L 5I19H 2ZUYA 3H9SB 3ARDC 1ZE3C 1BECA 3FO0H 5ABDE 2H32H 2JK5A 2DTSA 3Q6FB 4X7TA 2Q7NA 3L3JB 1IQWH 1C08A 4WWID 3MNVA 4WDIA 3SKNB 3MLZH 1A6UH 1I8KA 4NNPH 3ZDYE 5ADOL 2ZJSH 4X8JB 4XVTL 1CL7I 4M5ZH 5TF1H 1KPRA 4GG6B 4ODVL 5HSFA 4QF1B 4X7CC 4DOHB 1I9RH 4QTIL 4MJ6A 3O0RL 1EFXA 3I75B 3ILQD 4YNYA 2YKLH 5K9JL 4W4OC 2XWTA 2JCCB 4AEHH 2D7TH 1E4JA 1WZ1L 3IDMB 5GISL 3LQMA 4HZLB 2Z91A 3BDYH 1R3JA 3TH3T 1IKFL 1YEIL 3MRKA 2GYSA 5E5MA 1OP3K 1XGUB 3KDMA 1P2CA 2NY7H 4S1SH 4KJQD 5F7WC 1T3FB 2EIEA 3LH2L 1OTUD 3S34L 3VH8G 1A6WL 1ZGLB 3GHEH 1F4YL 1SJEB 4MXWL 2FO4A 1Z9OA 1ZHKA 2AEQL 4RGOL 25C8H 3BISA 2W9LA 4J8RA 3CU1A 3MJ9L 4MD5B 1MCRA 1AI1L 4KI5D 4PJHF 4P46C 3O4LD 5JXAH 4HWUA 3S36X 4P2OB 5FGCB 4HKBA 2R56L 5EIIA 4RMQA 1YN7B 1TCMA 1PSKH 3RTQC 1P4BH 2C1OB 1NLBH 4EDXA 1UWGL 2DMCA 1KSRA 3NIGF 1NBVH 3CFIC 3IJSA 3MRPA 4WHTA 3CFEB 3MLXH 2YK1L 2BHUA 1NGWB 1DQTA 3OQ3B 1CGSH 5DT1L 5MENE 4WW1B 1QFWL 2OQJB 4OZGB 3MRIA 1S5HB 1HSBA 4OIIH 4M4PA 3QQNA 1FIGH 1HSAA 2V7NB 4HIEB 2CGRH 4JFFE 1OL0A 2GJZA 5MHSD 2VXSH 3ARUA 4G8FB 4ZXBB 1UA6H 4NQCA 2EKSB 3P9LA 3GMNB 1FVDB 3SO3C 2PF6A 1KTDA 3KYOB 4M4RA 2L7UA 4QHKI 3MRLB 1Q94B 3CXHJ 3E3QE 4G9FB 1JGDB 2DKUA 1RQ5A 4EVNA 1MCNA 1J1PL 4FNLL 4Z7VE 1N5YL 4NQSB 1RZ8A 1JBJA 4HFUH 3NCEB 4XZUA 4LMQE 4AJ0A 3QUYC 3V4VH 1PZ5A 1Q72L 3QDJB 2D31A 1XGPA 3NFSH 4PV8A 5GRYA 1AXSA 4RMSA 2Z4QA 4RX4A 2A6IA 1YPZA 3UBXI 1WZLA 3WEXA 1FYTB 2H9GA 1T66D 3WS3A 2YPLA 3RIFF 1SYSA 3HI6L 1EAPA 3VXOB 3IXTA 4XRCB 1BFOB 1ZAGA 2ZKHH 3RGVA 1LE5A 4DGYL 4NFCA 1NFDA 4WWKB 5FCUH 1QSFB 1S78C 2AJ3B 3RA7H 3T3PE 3ZYIA 5CP7A 4JCLA 5LJYH 1MF2L 4IIQA 5J13C 3NAAH 1OGAD 2VAJA 5D7KE 3X3GH 1QSED 4FOMA 5IB4B 1JTTA 3ZKND 4HK3N 4JO4H 4RFOH 2HVKB 5EZLA 4O00A 5DD5L 3U9UB 1CT8B 3IDJA 2OTUB 4E42B 3V6BR 1QBML 4LLYA 4APQB 4GKNB 4CNIB 4OT1L 5KTEH 2VABA 3MMEA 4XBEH 2OJEB 1A5FL 4P5MA 3QIUB 5HD8C 4XHQA 5BRZD 5IHZB 2B8OT 2X9XA 3QXVA 1J11A 1GAFH 1D5BB 3R1GL 1BQUA 1L0YA 2I07A 3QFDB 4NIKB 1AGBA 4JM2F 1MCOH 1R3LA 2GAZA 1G9NH 3VXTB 2EKJA 4X6DE 3HA0A 5EU7E 5ECJE 1EO5A 4LQFH 5CJ5A 4WFFE 5CEXB 3PWJB 1WWAX 3R0NA 4K7FB 1K8IB 4ODSL 2M2DA 3PWVA 3CK0L 4OZ4A 4EOWL 4WW2B 3B83A 2VDNL 2P8LA 4L8SB 1XIWA 2XYCA 4FQXC 3ZKMD 5DYOB 1BFSA 5E8OA 4PGCA 4ZYKA 5KG9A 1IM9B 5BS0E 1KT2B 1JFQL 1G0DA 2G5BB 5B3NA 3WE6B 2IH1A 3PP4H 1KTKE 4RGMC 4OV5B 1VFBB 4Z7WA 2AEWA 3BH8B 5ESQB 1A7NL 4FFZH 3STLA 3N1GC 1XF4B 3SCMA 1IM3B 1JGVH 1YNKH 3NH7H 4LP4A 1T89A 2R4SH 4KGJA 2BVQB 2ZPKL 4RBPK 4WVRA 2P46B 1LO0H 5BVJB 1RJZB 5K33A 3WLWD 3O9WD 1WWWX 3QUKB 5E9DB 4KZEH 2YD1A