5F93C

Blood group antigen binding adhesin baba of helicobacter pylori strain a730 in complex with blood group h lewis b hexasaccharide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Cell adhesion
total genus 27
structure length 114
sequence length 114
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f93C00
5KANG 4L29B 5IFAL 5D7LA 1IGYB 4U1MB 3RWCB 1KIRA 1MCSA 2AJYH 4JRXE 1GIGH 1W0WA 25C8L 4HKXB 4MAYB 5HDOA 2FH8A 4X5WA 4KXZH 5F21B 2OCFD 3KPRD 4ZSOA 1C12B 3V5HA 2V2TA 4JGUA 4M6ML 4JFOB 1DP0A 4FQXA 3C08H 5DS8B 4OZHB 4B50A 1L6XA 3U1SL 2EDKA 4WWID 5LXGH 1KELL 5DR5L 4X98B 1C08A 4Y1AD 3BZEA 1CD8A 5DFVC 3SDCA 3HTLX 1OAKL 5D5MF 1S7UB 4IRJD 4JQIL 4Y5YB 4F7CA 1A0QL 3IDUA 2J2ZA 1A3RL 4N0UA 5DDHA 2A73A 3K4ZA 3I50H 3C2SA 2D4DA 4Z78B 1EEQA 2X9XA 3N06B 4X6FA 2Q3AA 1HCFX 4PRDB 2I9TA 4PJGB 4OV5A 5ICXB 1F3JB 2YBRB 4OZIB 3DXAA 2PYEE 4P2YA 3NGBB 5I76A 1P9MC 3W0WA 1YMME 1YNLH 1DBAH 4P9ML 1BGXH 1S9XB 3Q6GH 3RAJL 4OSUH 4PB0H 4PYGA 4WO4D 5JUEH 3P30H 3VRJB 1KCKA 4ZOAA 3GSOB 3ARWA 4P2QA 4X80H 3IXAA 4YDIH 4OAWB 3FT2A 5A43C 1I1YA 2J8UF 2Q7YB 4KRLB 3BISA 1RZJL 2E7HA 5D72L 4PLNC 3M17B 5T1KD 5ITBL 1CFSB 1WFTA 4LMQI 3BDXA 1W2KT 1HINL 1QSFD 4NM8L 2OJEB 4PY7A 1A21A 2PYFA 4D0CA 2RAMA 2MJWA 3HG1E 3H3PH 4Y16C 4X4YA 2KQMA 4G6FD 3QAZC 3H9HB 3RWHB 3B5GA 2BNRE 1YY8B 5EU6A 3J8F7 2VZ3A 3D3VA 1KYOJ 4POYA 1BFOB 1JUFB 1ETZB 1EEZB 2Z93A 1GHFL 2HFFB 4K3GA 1JZ5A 2OYPA 5DQ9B 1G7QB 2R56H 4OM0H 3IFOB 1Y0LB 2BVOB 1MRDL 3I2CL 3WJLC 1ADQL 1H3PL 1YPZE 2V6HA 3CZJA 4OLEA 1MCNA 3MRDA 4H20L 1JGUL 3VH8B 2AV1B 4POZD 3U7YL 5B38G 1QPXA 3LKSA 5SV3A 1OQOA 2BY0A 4PLOB 4OTXH 1KTDA 1S7RB 5IFJB 5C0AB 2ZNWA 1L7TH 5SX4I 5IJVB 1T2QL 1F42A 4GLRH 1AI1L 3AMKA 5EBLB 3NIFF 3EO9L 1NC2B 2G60H 2VISB 2BY3A 4TQEL 3ZDYE 4ZFOL 3Q2CA 2D31A 5D7SH 1IEBB 1KENL 1LP9A 1WWWX 2F9BT 4YBLB 1D5MA 2YEZA 1FL3A 5JXEC 2FHFA 3GKWH 1BVLB 2FIRT 4Q9RH 3BP6A 3CPLB 5AZ2H 4U1JA 4U1IB 5FYLE 1BF2A 3NCYS 2F5AH 2BSRA 4GMTL 3RGHA 1X4XA 3F7QA 4EDXB 1OF2A 4WW2C 3N1FC 5GQBA 2QADC 1JF1A 3V5KA 5HHQA 1JRHL 2NY5L 2WNGA 5D1ZD 1SYSA 4K23H 2XACC 2XQBL 5HGAA 4YK4B 5JPNA 3S3JA 2UWEA 5GS1C 2E9IA 3BMWA 4LQFH 1C5DA 4IIQC 5EO0A 3WEXA 2K7PA 3PNWB 2AQ1A 3HPJB 2WWKT 1JNLL 4OCSL 4C56D 5CJXA 4R4FL 4TPRH 3ARBB 3WS6C 3J7HA 2JB6A 4PJAF 2VDNL 4YHML 1GGBH 3I6KA 4XXDA 1KT2A 3C60B 2NZIA 3HRZB 2QSTA 3F5WA 4KPHH 1NGPH 2ADJA 4ZQKB 2EIZA 3O4OB 3KLSA 2HVKB 2P42B 4JGMA 1MI5B 5E6IB 1K8DB 1UM5H 4JZOA 2JJUA 3PQYE 4XMLL 3ZYZA 4NDMB 1XF4B 4DZBA 2BCKB 25C8H 2A9NL 4RA3A 3TNNB 3VXOB 1SY6H 1YEJH 4LSRL 4PJDB 1KLGB 4KTDL 4NZDA 4EN3B 3LQMA 1IQWH 3PWPE 3IDYB 4YLQT 1LEKB 2OTUA 3GM8A 1R0AL 4M6MH 2ILLA 2H8PA 1CGYA 3OKOA 2HT3D 5FAAA 2QBWA 4TNWF 5SWZB 1F4YH 4LNRB 3BO8A 3QUXA 3O3DA 5DR5H 4HJGB 5D6CB 5I0ZA 4RISL 2PNDA 1LK3L 5C07E 1MCCA 3HI1A 1OAKH 5B4MD 2ICEB 3CVHA 1ZS8A 2WP3T 4X7DC 2ZUTA 5DA4A 3OPZH 1A0QH 3ZYJA 1MCFA 4TSCL 4WUUD 1FNSH 1A3RH 4X6EB 1FSKB 1CGTA 1BZ9A 1HSAA 4N0FA 3MUGB 3DVNB 5HGDB 4BZ2L 4MD4A 4HUVB 1T7WA 1QRNE 4YFLF 4KKCD 4Y4FD 4M93C 4QTHA 5E2TH 2X40A 4ZFGL 3ROOB 2YKLL 3HC0A 1OD7A 2NY0C 3VD3A 4WI5A 3T2QA 3P4NA 3VGHA 1CN4A 1JPFB 3LKNA 3P4LA 1AGCA 3O2DL 3RAJH 3IFPA 3RWJA 4QRPA 4ZUTB 4MQXC 1HYSC 4LCYA 2XQYK 1JZ4A 3BPOB 3T0EC 5E1AB 2V7NB 4HJJH 4H8WH 3JV4A 3UAJC 2APFA 4WEBH 2C4FU 5I73C 2MQ0A 2FR4B 1OCWL 4RBPH 2VR4A 4JY4A 7FABL 2DM7A 3HCVB 4AY0A 1OTUC 2Z4QA 1MWAL 3FRUB 4UOW1 4KJQC 4K3DH 1G9NL 4LHUA 4Q6IC 3E8UL 4EI5C 3OWEA 4ODTL 4RFOH 4ELME 3BXNA 4N0RA 3CK0L 4KJPC 4FTVA 2ZSVA 1YEGL 5DD6B 3G9AB 4I48A 3TPKA 3LH2L 3MFFA 3QUYB 3GBMH 4K7FA 5LGJA 1OSPH 3SEPA 5IK3B 2F53B 4LVNC 4JFQA 3IJHB 5J6HA 1EO8L 2C1PA 5F9WB 3SKUD 2CJUL 3UTOA 5BRZB 4GW1A 4H20H 4PJ8D 4H25B 5D5MB 1XGQA 4U2ZA 1BREA 1U8LA 4JRYD 5KS9A 3L95A 3VXRA 3OR6B 5CEZH 3KPLB 3X13A 1MCEA 5CP7A 1WT5C 5I15L 3FQWA 1K4CA 4CW1B 1HHJB 2DQJL 2AVGA 1DVFB 2Z91A 3EO9H 5J4MA 3UTTA 1NDMA 3P11H 4UNUA 4G5ZH 4TQEH 4X5XA 1MNUL 5E70A 1VACB 4J3SA 2YPLE 3CSGA 2EDDA 4P2OD 3RKDC 2BNQA 3Q5OA 3L7FB 1LEIA 1NFIA 4QRTB 5D2NA 1CE6A 1LE9B 1EFXD 1FVCA 1IQDA 1R3LA 2DQFA 2FCBA 1IILE 2OJZL 2A6IB 3TT1L 4ZMAT 2AJ3B 5LAXB 1KB5H 3C6SA 3MCLH 4WW2F 4LHUD 5KSVA 3HI5L 3O2WL 4XBPA 1MUJA 4OD2A 1RJYA 2IWGA 5I71C 4LRIC 2X1OA 1E27B 2OL3B 4XHJD 1P7QD 2VTFA 4NQUA 5ICYA 1PG7L 3WIIL 5CJOH 4P2RB 3UBXG 1LO5B 4GS7B 3FRPA 3O9WB 1YQVL 4HWBA 5TDOA 1FZOA 2CIIA 4ODSL 5K33A 3TH3T 5F6IC 4F9PA 2VLKB 4OCSH 4R4FH 5ENWB 1LO2L 4KK6D 5EIIA 3SY0A 1Y6KR 4C83A 5GGVH 3X11A 3E1F1 1N0LA 4XMLH 1UWXK 3U82B 4P5TA 3V6ZA 4OKVB 2A9NH 5T3ZH 3MRRB 2LQRA 4MD0B 1BQLL 4OZGA 1ZVHA 5F7EL 4NQTA 4F3FA 4PGDB 4CNIA 2ADFL 3SDAD 1JGDB 4TVSa 5CINL 4CDGC 1HQ4B 1FLRL 3RUGE 5HPMA 3V9FA 1A4JB 1NCAH 3EZJB 3K2UH 5CEYA 4FFWC 4RISH 1U8QB 3QDMA 4GBXB 3WKML 5CZXD 3KYAA 2VZ1A 4JZJC 1E28A 1RIUL 1UB6B 5F72S 1P4IL 3GSXA 2NR6D 1EGJA 1I3VA 4HMEA 4EI6A 4GKSA 3SJVD 2VXQL 4H0HB 4HJ0D 4C57C 5E8EB 3H9SA 2JB5H 2DQEH 4HBQA 4NO2A 4RGOL 3DV6A 2NY4D 2ATPB 5JPMB 1MCOL 2HN7A 2BK8A 3DI2B 4UIMA 2FEDC 2BC4B 4QOKE 4NWTH 4F7TB 3TBSA 4R90L 4QHLB 4HPOH 1AFVL 1ACYL 3CMOL 3KPOA 4M7ZB 2YKLH 4ZFGH 1U8OA 3QUMA 4L3EE 2M26A 1KN4L 4M8VA 4U1SB 3SQOL 3MRCB 2IGFH 1T80A 1M71B 2XFXA 3P0VL 4UTBL 3U4EB 3EYSH 3O2DH 4OI7A 1IZJA 5FUOL 4YUEL 5IHUL 4O00A 3SPVB 1YZZA 5CGYC 3G6JE 4EXPX 3BPLC 4JPIA 1ZVSA 2ZCLH 4HIEA 4K9EL 3ZDYF 4MGXA 2NY1D 12E8L 1CQKA 3B2UC 4KDWA 4P23C 4OGAD 4XVTL 1E6OH 5H94B 4PJAB 1AQDB 1HDMB 2FJFA 4TVPD 5GRUL 1OCWH 2A2QT 1UENA 4JPKH 1WCBA 4KROD 4QHUB 3BWAB 5F89A 4W6YB 1MWAH 1OVZA 3LRSA 3U36B 3MRBB 3FAXA 3WO3B 4APQC 5IROA 1YEIH 5E9DA 4Y2OA 3TLRA 4D9QE 3FFCE 1IGIL 4OB5H 4J8RB 4YWGH 3E8UH 1OOAA 4GAJL 2RFXA 4EVNB 5TFSL 5IVXF 4S1SH 1CICB 5E5RB 4HLJA 2VLMD 1MCWM 5EBGA 4MNQB 5IVZA 3H7BB 4ZNEE 2HG5B 3MNVB 4PGBA 3VWKC 3RVXC 3D25A 5MP6L 3WMSA 4ERSL 4XBEL 3MJ7A 5FA3B 3QCUL 4U6HA 1XH3B 3NIGF 3KYOB 4PJ9C 5FDWA 1YEKL 3LEVH 5GGVY 5FV1L 3S35X 4EUPG 5E99H 4ODXA 1WAAF 3H9SD 5E8OA 4PP2B 2LE9A 3MRFA 5TE7L 4NHUB 3PDOB 1R24A 8FABB 5I1GL 1YUHA 5CBAA 3K2MC 2PXYA 2DQIL 1NAMB 5I15H 3JUYA 4XAKE 4CVUA 1BX2B 3QDJB 3UYOD 3S88H 4WV1B 2FJHA 1HXMA 2EC9U 1RZKC 1CU4L 5HSFA 1MNUH 5E2JA 1H5BC 4HKZA 1BZ7A 2CD0A 3JTSB 3RFZC 1GSMA 5E5UB 2QSQA 3VFPA 1I3GL 4FZEL 4EIZC 1ACZA 3MRMB 1T83A 4UV7H 4WFFE 1A3QA 2EEDA 2AJSH 1CDYA 2DKSA 3AXLA 4NO5A 1QBBA 1W72A 1DBML 3VRIA 3LOWA 3NCEB 5FV2A 3VG0H 3WS3B 2R0WH 2FIKA 2OJZH 5JR1L 3WD5L 2VQTA 4I3SH 3TT1H 3RGVB 1NFDA 3KG5A 4X99B 5FA4A 4X4ZA 3RPIB 1OAYL 5HYJD 1FJ1A 4HKBB 3D0VB 2GK0B 4JN1L 1NGZB 3CX2A 3JWDC 4YNYA 1XR8A 2DYPB 3SE9L 4RGNE 3TJEL 3LKPA 4LLWA 5ESQB 1W8NA 3KXFD 2M8XA 1CQYA 1MAMH 4FXKB 4UNVA 4RAVA 2X4SA 3UC0H 4KRPC 4OGZA 5DJAA 2VUOA 5BXFA 1IC1A 4NOBA 3ESUF 2NTFB 2R23B 3PL6C 3FB5A 5D8JH 4ZOCA 3NCMA 5F3BA 5HI3D 4Y16B 2Q76B 4YJZL 3LPWA 4Z95L 3P9MB 3N1MC 4WWKC 4U3XA 5IB1B 4WTWA 3PWJB 3VFWB 1HH6A 3TH4T 5DRZA 2IADA 3GUTB 1HWHB 4G7YH 3WUWA 4WDIA 1FNHA 3SGJA 2ADFH 5D93C 1JVKA 2XT1B 3B9AA 3MRQB 5FECA 1KPUB 1KULA 4I8DA 5I16A 1FLRH 4XGZA 3RIFK 1I4FB 4PJXE 1RUKL 4G8GA 2YZ1A 3PWNB 4MX7B 3TYGH 3SOBH 1SJEA 3WLWC 2FSEA 1XF5B 1A7OH 3SGDI 3BKMH 1J0JA 4KK5D 4PBXA 4KH2A 4UAOB 2CXKA 3GK8H 1IC5H 5HHMB 2VXQH 3KPPA 3RNKB 1EAPB 2EDBA 4NQDA 2HAZA 3QXAA 2GJ6B 2WQ8A 2FO4B 2JCCA 4PREA 1J0IA 3CFEB 4RGOH 4W4NA 1P5UA 5E24E 1JL8A 4YHOL 5CEZD 1IM9B 4R4NC 4HUMB 1CCZA 4LCWA 4NKOB 4ZUUA 2DLEA 5ADPL 3QEQD 4NFBA 2B2XH 2XZCL 5IB4B 3PWVA 2ZUSA 5E8PB 3MA7B 1AFVH 3OKEA 4WW2B 3FONA 4P3CL 4HMDA 5F70A 5J06A 5ETUA 4NUJB 1KN4H 1PW3A 4YUEH 5IHUH 3IYLW 2YA2A 3S5LA 2PCPA 1ROWA 2Z8SA 3KYKH 5FCUL 5EU4B 4LCIH 5T33H 3VXUD 1RZIB 1K5NA 4K9EH 4KDTC 4ZS6D 4CMMA 3X14B 4MCZA 1DDHA 4KUCD 4IIQB 3QIBC 1LK2B 1JNNL 1A14L 2MNUA 2VRAA 4Q6YA 4XVTH 3GSQA 1Q72L 1RMFL 4PJ7F 1DANT 1GAFH 1VADB 3SHSA 4HH9A 5GRUH 3RKPA 2A6DB 3TBTB 2VXTH 3PWUA 2JJTC 5ILTL 5EZOL 5KOMC 4QCIA 3HZMB 5D96C 1N59A 4NRXB 2CDFA 4XPAH 3MV7D 4QXTB 1ED3A 1GPOH 1IGIH 2P47B 1NLBL 5L6YH 2DN7A 3ULUD 4NC2B 3CVHL 4OKDA 1EHAA 4XXCA 4ZPVA 3TIEA 1MJJA 1A1NB 4CRPA 1LE5B 1UVQB 2FZ3A 4ZAKD 1GCFA 3DVGA 1MCBA 3OKKA 4D9LL 1G7LA 4JLRA 1MQKH 5MP6H 2BVEA 2Y5TB 3EYOB 4ZYKB 3GSWB 1P84K 4Z5RB 2HTLD 4K3EL 1Y6NR 4ONOA 2CK0H 1CLYH 2ZSWA 4LLVA 4M1CC 5L7XH 1IAII 1UKTA 3KPRE 2KUTA 1Q94A 2X4NB 3O2VL 2QR0A 1A6AA 2HRLA 3WN5B 5T3ZD 1T66D 3OR7A 2V7HB 1J12A 4YXHH 4XMKL 5EPMA 5DMJB 3O11A 1DQML 3TVMA 2ZUUA 1R3HA 3DWTA 4NGHL 4QRUB 3M1BA 4XWOC 4Y7MA 4Y1AE 5DUPL 1LGVA 1CU4H 4ONFL 3ZKQD 3FN0L 4Q58C 1HK6A 4A6YB 3P0YH 2OSLB 4NQVB 5C0DA 4M93B 4QLRA 3ZE2E 1DBMH 2NY0B 3ZDZE 5JR1H 2A83A 4S1QL 4KK8C 5EU3B 4XWGL 5F1SA 5A3IC 4CL7A 4UUJB 3GZKA 3VE0A 1OAYH 5IT2L 4P5MB 4NPYA 4KDVA 4L9LC 3ME0A 3SE9H 3TJEH 5MEPA 3T0EB 2ICWJ 3KWWA 2BJMH 1S9VA 1JN6B 3T3PE 2UZXB 5C2BL 5T1LD 3AB0B 4HFUL 3T4YA 1I7RA 3HMWH 1X5LA 2GT9B 4D3CL 1FE8L 1KBGL 5EO9A 4I3RL 2VDRL 4WU7B 1DBKH 1A6VH 3H7LA 2JLLA 3QJFA 2XA8L 1P4BL 5IVXB 4QGYA 5LBSL 4Q6IB 4EI5B 5ICZB 5BQ7B 5HYFA 1QSFE 2IBGA 2UUDH 3KNBA 3MGTB 1JWMA 2NW2A 5ECJE 3U2SA 4JM4H 4RWYH 1WGOA 1JFQH 4JFZL 2NXZD 1BBDL 3TVMD 3VFUA 1A1MA 1JF5A 3EOYG 3WUZA 3QNYB 1BBJB 3NZ8A 4E42A 3GSUA 4Y4HA 1AE6L 4L5FL 4FHBD 1EBAA 1VFBA 2H3NB 2EYTA 1V3JA 1LEGA 3FZUD 2CUMA 1RUKH 4N0UE 1IAKA 2IAND 2N7AA 2UY7A 3EGSB 4LARL 2Q8BL 3IDGA 3MC0A 4Z0BH 2H6PA 2P8MB 2LAAA 1S3KL 4AL8H 4ZPTB 3B4NA 1UZ6E 3SKNA 3PE9A 2L4OA 4I77H 1KCVL 5ITFB 3C5ZA 5CMAA 2P8LB 5DO2C 3DSFL 3RL1A 3UZEA 5JORB 4ORGA 5HHXL 1OTTC 2F5BL 4HWBL 1MCPH 1G0DA 1M4KA 4YHOH 3QIWA 2EDRA 1A6TB 5J12C 4OFIA 4N0CD 3HE7B 4O2EB 4U7SA 3L3IA 3LRHA 4GKNA 1CVSC 4V1DA 4WHDA 3LSOA 4LCUA 3K8MA 3O81A 3ZDXE 3R8QA 4P3CH 3SE3C 3WNKA 2VZOA 4OFPA 2D03L 4FRWA 4IEFB 1G9MC 2ICCA 4RFNC 3JV5A 4L8SA 1H8OA 3NCCB 3BP5B 4JB9L 4JJ5B 5E6YA 1IT9H 5IIEB 1NDGB 4D0BB 1TZIB 4JHAH 5CJQH 3BN9C 3X17A 1H3XA 3GHEL 1JNNH 1A14H 3K7UA 1TVBA 1Q72H 1P84J 1RMFH 5F6IB 1UXSA 4O9HL 1D9KB 4F57H 3ARGD 2BVPB 1MIML 4Y4HD 5JOPD 3AREC 2F19L 5B39G 4NZRH 1CFTA 1FVDA 4OD1L 2PO6D 2IPTL 4PR5A 3TA3B 3QULB 4XBGA 1NC4A 2JJVA 4UZGA 3O3AB 4C56E 1QLFB 5GS2D 1FNGA 1H0DB 4JAMA 2VYRE 1EJOL 1ZT4A 3B9KB 1FZMA 1A6WL 3PIQA 3CVHH 2W60A 1N8ZA 5BW7A 1EGJL 3B2VL 3EBAA 4PY8J 1LNUB 4WO4C 3IKCB 1CF8L 5C1MB 4FQ2H 5DHYA 5L0QC 4D9LH 1FBIH 5E5MA 2GSIB 5HYSA 1U93B 4K3EH 4MAYA 2E6JA 2X4QA 4F2MA 1C12A 4QT5B 4HUXA 2DLHA 4HWNA 3O2VH 2HT4C 2VXVL 3CX5K 5T5FL 1MFDH 2HLFD 3SBWA 4F7EA 3QUML 4KWUA 3QIUB 2QSCH 1JJUA 1T04A 5ISZA 3V52L 2DOCA 5EWIH 4DN3H 3EDDA 5EBWB 1R5WA 1LP9E 2W91A 4JZJB 4NCC2 1T21A 3DUHA 1F4AA 1T89C 4TUKH 4NGHH 1A6ZA 4X98A 5K9OA 1VGKA 1X7QB 1VESA 5DUML 1J5OH 3RU8L 5DUPH 4PJHE 4M7KL 4PG2C 4KRNA 4KRMB 5IQ7H 3CDCA 4PRBA 2HP4A 3JV6A 2X89A 2LV4A 1O0VA 5D1QA 4WHYG 4Z6AT 4AK1A 2QV2A 3BAEL 1OP3H 4WUUE 5HYQB 3C6LB 4HT1L 5B38B 1IGTB 3A6BH 4RMVA 4X7FC 5K9KA 4U1NA 3TZVC 1M1SA 5MEOA 3VFNB 1RU9L 5ALBH 3BT2H 4AIOA 2UZYB 1B2WH 5DGQA 3MRNB 4S1QH 4XWGH 3MRIB 1NLDH 1FIGH 1NC4D 5E6ZA 2ESVB 4YDKH 15C8L 2NYYD 3P77B 3BPLB 5ID0B 3QDGB 4HS6A 4ZO9A 2CDEB 4PJ7B 5HI4D 3RWDB 4KGLA 4U1KB 3QQNA 1XGTA 1QP1A 3N9GL 3QHZH 5C2BH 1VERA 2ZJSH 4XCFL 4UINH 3STZA 2BVYA 1OM3H 2YC1A 5TQ0L 4D3CH 4F7MA 4ZTOH 4I3RH 2P49B 4R26L 4PGCB 4MAYD 1AJ7H 3IETA 1XEDA 1WTGT 5I1DB 4JKPH 5HHNB 3GDBA 5AG8A 1KJ2L 2ORBL 5IMOB 2AS5M 5DHVA 4LRNL 1X5YA 3DIFB 4LSUL 4NRZA 3OB0H 5TH2A 2A74B 3HNVH 1I3RB 5D1ZC 3Q5TA 2W0FA 4JFZH 3CU1A 3LEXB 3O3BB 3LS5H 1MF2L 1RUML 1E4XI 5FYJL 2P4AB 2WIMA 3LN9A 5SX5H 3HZVA 4PJ9B 4OCWH 3ZYOA 4L5FH 5CCKL 4YHZL 1SBBA 1OP5H 1CXKA 3HPLA 1DQLL 4YO0B 5D1QD 1G7QA 4JM2C 2VSDA 3BI9X 1W72L 3S3SA 5B22A 3NN8A 4H26A 3U0WH 1NUDA 3LPFA 2XY1A 1S3KH 4O58L 3FQTA 1I8MB 2LAGB 4JRYE 4NJAL 4GRMA 4HIXL 1VPOH 3B6SB 3MR9A 2X4UB 3OKMB 5F7DA 2HKHL 2DMBA 5C71A 3BUTA 3JWOC 1AD0B 2GYSA 1A1OB 4Y5VA 4H1LA 5C0RL 5DD5L 4KY1L 4ZNCD 1XR9B 4YHNB 3CGTA 4D94A 4BH8A 5D2LB 5BV7L 2J8OA 4U0RC 3L5WA 2EDWA 2B1HH 4N0YL 4HV8B 1S7TB 4KFZC 2P1YA 3CLFL 5EZLB 2QQNL 4JFDB 4MSWA 3G6DL 3VG9C 4X7CC 4U1IA 5E2VL 1ZWIB 3VFMA 2GCYB 2CLVB 5B4MC 4HWZA 2JJWA 2J6EH 2X7LB 3MOBH 4EDWL 2OMBA 4PBWD 5HHOA 4OJFL 1MLBA 4MJ5B 4X6CE 3FTGB 3GJFK 4J4PA 4QXUL 1EUUA 3B9EA 1R5IA 1WVZA 4FQQB 4KRPB 5KSBF 1G9EA 3WHXB 3FO0L 4O9HH 1UQSA 1JNHA 1HQRB 1MIMH 2OQJB 2F19H 1ZA6A 4ZFZB 3MV8B 2WQRA 1DQTA 3DX6B 4P9HC 3QNZA 2APXA 3HPJA 3NFNA 5J11B 2A0LC 2I27N 3TGXA 3CX5J 4RMUA 3ULUL 2QHRH 4Y4FC 2V2WA 4WWKB 3BD4A 2HJLA 3U30B 3MROB 4P59H 3OXSA 2OZ4A 4IOFD 1EJOH 3FFDB 5EORL 5H37H 5GIRA 3C60A 5C0BB 3RHWK 4MAUL 2FATH 2XI9A 1CDUA 4NKMB 1JI1A 2MOVA 4HUWB 1NBZA 2OK0L 5E6IA 1CF8H 2AI0H 3SE8L 1KJ3L 2Q8AH 3T3PF 1YMHA 5C0AD 1WBYB 3CFBB 2Z92B 1EDQA 4X5LA 4F33B 1BAFL 4ODVL 4PJIE 1NC2D 1BHGA 1KTLA 1S7VB 4NP4H 5T5FH 2YK1L 1OARL 3DRTA 1BMGA 4O2CB 2YSSB 1RFDH 4RAUB 3TFKD 3TBYA 2V9RA 1SVZA 1MY5A 3DLQR 3V52H 3BD5A 4U6XB 5SWZA 3ZKXB 3X3FL 4WFHD 5I18H 4HJGA 1FN4B 1FC2D 4HUUB 3MX0A 4WI3A 1M7DA 2AEQL 5LVEA 4JFHD 4FFZL 4GW5B 3DMMA 1U8NB 1PKQB 2R0KH 4NO3A 3VW3H 5DVMA 2B7DT 5IB5B 1RIVL 3HAEB 1IAOB 1BVKB 4LLUB 4LGRB 3SJVE 2NX5A 1I9JH 4HT1H 3QWRD 1BJ1H 5I2IA 1AHWB 1GZPA 5HJ3B 4DKEH 2DQDL 1RUPL 3WFHA 1VGEL 4PJ8C 2JK5A 1F4HA 1CT8B 3ZE1F 4RFEA 3IDJB 4LSPL 4HK0A 4MDIB 3ARBD 3N85H 2VXSH 43CAA 1AKJB 2GTWA 3UTZB 5EOCL 5MENA 2R0LL 3FCTB 1T20A 1XZ0B 3C60D 1B4RA 3QIBB 4JFEB 4LLAA 2EIBA 4XVUC 5E2WL 2C26A 4JO2L 3N9GH 1ZHKB 1MI5D 4ZDHB 5CZVL 2QEJA 5E6ID 5F9OL 5L2KB 3SN6N 1NMAH 4YBQD 5EZIL 3O45B 4M6NL 3MBXH 4P2OC 5IJKA 2EYSA 1FG2B 4R26H 3U46B 4HKJA 5D96B 1GZQB 3OB0K 2FR4A 4HBCL 1A4KB 3I85A 3NPZB 4EN3D 4TVPE 4QXGL 1Z3GL 3QQ3A 4LEXL 3HCVA 1DBJL 1CFNA 1QBLH 4Z7WA 2R1XB 2HTKD 1HNGA 3RTQB 4LSUH 3MQIA 4LFHG 5I1IL 5SWZD 4JE4B 3UBXB 2AKRB 5C0CB 4P46A 4AG4L 5FOJA 5FYJH 2VLME 1TMCB 4PJEE 4TSBL 3DMMD 1FRGL 3BEWA 4WI4A 4YHZH 4F37F 2MHAA 4C59B 4HS3A 4XX1E 1DQLH 4ORZC 3GMPB 35C8L 4Q97A 5IK3A 1W72H 2CLRA 4KJWD 1AR2A 2CDGB 4MNHA 1D7FA 4JM2F 5C0ND 4QRRB 1DUYB 2A38A 5TDPA 1NCDH 4H88L 3RL2B 3H9SE 3F7RA 2OLDA 1JZ3A 2R4RL 3AS3A 4FZ8L 3DURB 4PJBF 4LCCC 4NJAH 3V5DB 1BD2B 4FFYL 5J6GA 2A6KA 2XG5A 5I1CH 4HIXH 1HHJA 5C0GB 2HKHH 3GBLA 1AD9B 1T03L 3LN5B 1BOGB 4QO1A 5C0RH 5HYIA 2P7TB 3A0OA 2ZG2A 4KY1H 4LQ1A 3QUZA 4MS8D 3MNZB 4WTZG 2AXFB 2X10A 4KI5F 5C86A 3P4OA 4N0YH 3H0TB 2X4PB 3D39B 4PJCF 5C09A 1GYAA 2QQNH 3CDFA 5J8OA 3TO4A 1FHGA 3DRQB 5E2VH 5F88A 3BPNC 2YRLA 5CZXC 1TZHB 5D70L 4L9LB 3BZ4B 1AO7B 1F58L 2IQAB 2DQCL 2WMPA 2NR6C 3FO9A 4OJFH 1J18A 3H2WA 2W9LA 3TN0C 4DKAA 3BHBB 4QXUH 2PTVA 1H3UA 2IPKB 5HYJE 1FO0B 4YZFF 2J8UA 4GRLC 3FO0H 1JTOA 5IF0B 4DGIH 2FJGB 2NY4C 5J56B 3KXFE 1YJDL 3AM8A 2EDNA 3QWQB 4CN4A 1YDPA 5CILH 3QUYD 2X1PA 1QVOB 2VLKA 4OIAA 3MLTB 3HUJE 3VFOA 2F53D 3QEHA 4NNXB 2VKXA 1SMAA 4O2FA 2FYYB 1KPRA 5IMMA 4MHHI 3GIZL 4GG6B 3KHQA 1X6LA 5BRZD 1LMKA 1A64A 4X8JB 1R3KB 4FQJL 5ACZA 1F11B 1TCRB 3MLZL 2OK0H 9CGTA 2W38A 3SE8H 2WWKO 1UCTA 5B3NA 2AK4A 3N0PB 1XIWA 1DVFD 5BS0A 3DX9B 3IS1X 1QEWA 4Y2DC 5IESL 3K8KA 5KVMC 2RQ8A 4ZUWA 2W07A 1UH3A 4IDJL 5KJRH 3Q1SL 4XNZC 4XPHH 2UZIL 3DBXB 4GW4B 2QKIB 1GC1L 1SEBA 2DWDB 3B83A 1F2QA 5D7JA 4HWUA 3WLBA 3KPSB 4R97C 2DF3A 1OAZL 3O6MH 5CEXA 4M5YH 1OGAA 5EA0L 4DW2H 3NCBB 5KSAA 1S9YB 1IKFH 5GGRY 1QHOA 1ZGLA 3BH9B 4EUPB 2GFBA 5H2BB 4X6DE 1JPTH 3BW9A 1B9ZA 1I1FA 1RIVH 3LEYL 5T5NG 1E4KC 1W0VB 1JHLH 3GMMA 4BSJA 1WZLA 3MJ8B 3NABL 3DETD 1RZ8B 3MRGB 3RQ3A 3GMOB 3G04B 2AGJH 2CKBA 3D18B 1J0YA 2DQDH 3QYCA 4ZD3L 5CP3A 4DKFH 4P2RD 5CEZE 1PEWA 5F1IB 3O6FC 3O9WD 2WP3O 1HWGB 1T22B 2ZKHL 4IMLB 2D3VA 2EXYD 3QEQE 5CJ8A 1OP9A 2VLKD 2W9DL 4LDOB 5FUCC 3CSYA 4HGWB 1L4IA 1RUAH 4MNGA 4EOWL 3MRCA 5EOCH 4MJ4A 5KSBB 1U41A 1I7ZA 3RWGB 1PLGH 3A6CL 5B8CA 5CKGA 4GAYA 3VI3E 4URTB 5E2WH 5GZNC 5C9KA 1MHEB 4AQOA 4HWEH 1OLZA 4Z7OE 5CZVH 3VXUE 2O26U 1NANI 1U8PB 5EZIH 3AREB 4KVNL 3LKOB 4M6NH 4E5XB 2MSPA 1CYGA 2GY7B 1FZJB 1OAXH 3JTTB 5IGXH 1UZ8B 3TPUA 2HFEB 4IRSC 5SX4H 3BQUA 1U8KA 2E7LC 3FB7A 2VLLB 3ARSA 3EZ8A 3MRBA 3QZWA 1FV1A 2V5RA 1A3LL 4P99A 4AIZA 2AAVA 4Y19B 3MV7E 4LAJH 4OGYH 1X5ZA 5I1IH 3K4DA 1U58A 4P5KB 1PKOA 1ZA3A 3BP7B 1I8LC 5L0QB 3BRDA 2DQTL 2ZCHL 1ZANH 4D2NA 2YXMA 3ULUE 4GBXD 4MNQA 5C0FB 3PGDA 4TSBH 3RY6C 4Q0XL 2Y06L 1OAQH 3GSRA 4OT1L 5FA3A 2I5YL 4RRPG 35C8H 1U91B 2BNUA 3CFJB 4CN1A 3BDYL 1UJ3C 3RVTD 4N1HB 5HI3C 5D1XA 4H88H 3OV6A 3RWEA 3MZTA 4PPTA 4UB0H 1Y18A 4H8WC 5FHAH 2G9HB 2R4RH 4X6BB 5T3ZE 5FO8A 2K7QA 1OGTA 4FXLA 3GSNB 2HWZH 2EDQA 3DX7B 3QI9A 3ZE0F 4KVCL 5JMRA 1BFVL 4H5SA 1TITA 1ODAA 2B1AL 2P24B 1UB5B 3TZVB 1BIIA 5KSUB 5DRNB 4PGJA 5K9QI 3BMVA 4K3JH 4QYOA 1R3JA 5I0DA 1HKLL 2YRPA 4MXWH 3UJJL 1D6EA 4JZNA 1HH9B 5DJ8A 2EO9A 2R2EB 3V4UH 5CIPB 3E2HC 2IFGA 4MA1B 3NMEA 1DSFL 1QSEA 5D9SB 1F58H 5CD5C 4IHOA 2D2OA 4G3YH 1P2CB 5IV2A 1B0GB 4BQBA 1QFUL 1RJZB 4MDJB 1IKNC 2APTA 2VLJA 4X0KA 4ETQA 4HIJA 1CBVL 1CICD 3CFCH 5ESQA 2V5SA 5F96L 1RK0A 1T1WB 1C5CH 4MNQD 4AM0A 3C5JA 1YJDH 3R1GL 5DJZB 2R39A 3OHXA 5DJDA 4P4KA 3B3IB 3RZCA 2DLGA 1B0RA 2R2BB 2CGRH 1JV5B 5KVEH 2ZCKH 4Y16A 3W11D 2VITB 3E6HA 1OLLA 2VZVA 3CFDB 3BEVA 4FQJH 4QRSB 1PAMA 1QQDB 5I1EL 2XZZA 3GUTA 1BJ1J 4N90D 4G9DB 2X4TB 3UBXI 4FOMA 2R0ZH 3QDJD 5JIPA 4JM2B 3BKYH 5C08B 3WHE1 1UA6L 5IESH 1KCUL 2JJSA 5IW1A 1WBXA 4LSVL 4LBEB 2I07B 3S35H 1CXHA 1FL6B 3RIAK 3Q1SH 5IFHL 2VAJA 4PJBB 2ITCB 1ND0B 1KLUA 3DHJA 3X3GL 5BJTA 2IANE 1I85C 3H6JA 3D85B 1YA5A 2R1WA 1CVRA 3D69B 1WC7A 4JRXA 1Q9OA 2NZ9D 3UMTA 3E6FB 2EE9A 2FGWL 5FUZH 3SDDA 1A47A 1R6VA 4ODHH 3NFPB 2BMKA 4NKIH 1KPVA 2VDML 3QPXL 4PJCB 5DMKA 3DV4B 2FO4A 5ADOH 4OZFA 1K2DA 2B39A 2DYPD 4NO0B 4IS6B 5JXEA 2OR9L 3VG9B 4XNQA 1Q9WA 4J2XA 1NCBL 1XCQA 3UPRA 3ALPA 4XP1L 5I9QC 2NNAB 3GI9H 5I1HH 4PTTA 4Z9KB 3QQ4A 1T66C 5DTFB 3IAQA 4JDZB 4GMSH 1NEZA 2W9DH 1HNFA 4MA3A 4WW2A 5DD0L 1HXYA 5IOPA 1Q0XH 4I0PC 3BOVA 4L4JA 4EOWH 4G43A 2HVJA 2ZUVA 2XICA 3NACL 5KVGH 4KZDH 4Y16D 3BH8A 3O0RH 4UV4L 3GBNH 2ID5A 3A6CH 2PW2B 1L0QA 3U0PB 2CR3A 4PS4L 5GS1A 2BSTB 1WTLA 2Y25A 1YY9C 4Z0XB 3SE4C 2FGZA 2OR8A 4NCC1 1IEAB 2KKQA 5GS0H 4QWWD 3QUKA 3IJYA 2P5WB 2YR3A 4XP4L 3I6GB 1IC7H 3PV6A 3WSQH 4ESKA 2PYEA 4XVJH 4LSQL 1U95A 1N64L 2J88L 5JOPE 1YMMA 3HZMA 1ZLWH 2OS7A 1A3LH 1A02N 1JGEA 1HOCB 1UEMA 4BH7A 2GQHA 3HE6C 4NZJA 1EUTA 4TSAL 1AY1H 3IFNL 4NRYA 3ARTA 2DQTH 1RPQA 2X4OB 5F1NB 3TIDB 1CXEA 4HFWB 1UVQA 4P3DA 4R96B 2O5XL 4W4OC 1X5KA 5IB2B 2Y06H 3GSWA 4DUWA 3K46A 3DGCR 5HHMD 1MREL 4MD5A 1QTYT 3ULVH 3RA7H 1UM6H 3V0WL 3HG1A 2XA3A 3BDYH 2GJ6D 1ZHBA 2IG2H 1DE4B 4HUNB 4ZUVA 1FG9C 2BNRA 3HR5B 2W59A 5JXED 3QPQC 1IM9D 1MEXH 4Z7QF 3T77A 1I8KA 3PV7A 2D7QA 3KGRA 2YUZA 2VLRB 2DKMA 5I1JL 3BRGC 4G9FB 4X7TB 1XF1A 1DEDA 1QA9B 1WISA 3H42L 3JVGA 5IMKB 1QFWM 1NAKL 2YMXL 4NQXB 4RZCA 5F9JA 4WJ5B 1QR1B 1Q1JL 4LKXA 3S37X 2CO7B 3VD5A 1ZHNB 2XPGA 1BLNB 1YPZA 1PVHA 5IEHA 5JLZA 1EERB 2F8OA 1ZT1B 5HI5D 5GGTA 1P7KA 3FZUC 1I7TB 3LIZL 4NQEB 2OSLA 5ID1B 1BJ8A 1TVHB 3MV11 3P9LA 5DHVH 1RJLB 1XGPB 1ZHLB 5IMLA 2AV7B 2X44D 3S96A 2UVFA 1FFPA 4K7PL 2JIXA 5FYKU 1PFCA 3QCVL 5DJ0A 4UUJA 2VSCA 2LVCA 3REWB 2G5BA 3GGWA 3PHQA 1S8DB 2FLRT 3ARDC 1J1PH 3B9DA 3QG6A 3IVKA 4QHMA 5F96H 2B4CL 5C8JA 2BHZA 2X70B 2WBJB 3ULSB 3I3DA 3R1GH 4QNPE 1I9EA 4OCRL 3TNMB 3P40A 4LIQL 3WIFA 4NUGL 1B6UA 4GXVH 4Z7VF 1B4JL 4R2GC 1BOYA 3MLYL 3PP4H 1FFOB 4JG1H 1S9WA 2C3VB 1IM3A 5F7NC 1T5WA 5HHPB 4EI5A 5ICZA 2VC2H 3EOBB 2ED7A 1AXSA 2YPKA 4OZHE 4N9GB 3TJHD 4K55A 3VFVA 4Z7OF 5B39B 4PJFF 4AMKL 2GUOB 3R06A 1KF9B 3W9EA 1TJGL 4Z7UB 4BUHA 2XWTB 5D7IF 4K8RH 1Z0MA 2D4FA 5FKAB 1T1ZB 4HX1A 4YPGA 3MO1B 5HHVH 3MRKB 5EOCJ 1FP5A 4I1NB 1XF2B 3GNML 4O02L 2VR9A 1WIUA 1RHHA 3X3GH 3PQYA 5KZCB 4LCCB 4OUUB 5TPWL 1XGUB 2AXGA 4OFKA 5AWNH 2NY0D 3F62A 4RQQB 3FQNA 2ARJB 2G2RB 4ISVB 4ZPTA 3DYPA 5BCAA 3BIAX 3PWPA 3UTSB 1H15B 4PJGE 4DUXA 3PDDA 2XNAB 2NY6B 2AJUL 2VDMH 4MQXD 5A40E 4OZIE 4R7NB 2HKFL 3V6OC 3SCMC 2VABB 1OQXA 4NN6B 3LPGA 3T0ED 4UQ3B 3LQZA 4BUGA 3P4MB 1NCBH 4FQPA 1M7IA 4KU1A 1MHCB 5C07A 2OZ4H 3BPNB 3I3EA 4JREC 3EO0A 5MI0C 5DD0H 5DHXB 5BOPA 2NMSA 2XKNA 2ARWA 1NMBH 4WHTB 5I1KH 4WVRA 4KJQD 3TN0B 1EXUB 4P2CG 3ILPB 4EI5D 2FHBA 4M1GL 3BP5A 4JJ5A 4LRIA 1PX3A 4GRLB 2J12B 1AGEA 1IAIL 1YEEL 4KJPD 4MJIB 4QY8B 3RDTB 4CDHA 2JE8A 1TZIA 5J9PA 5BVJA 2X1WL 4QHKI 5I1AA 1QRNA 1CGXA 4OCYH 4N8CL 3EFDH 3TM6A 3Q6FB 5DYOB 4XP9H 4B41A 3RIFF 1KCSL 4GAFB 5I8EA 1NBYB 1N64H 2J88H 3TCLB 5HGHB 3W39B 4NN5C 2E27L 3EDJA 4LK4A 2FHCA 4YDVA 1U8MA 3MBEC 4JDTH 3TWCH 2F74B 2NYYC 2WM0A 3IFNH 3HAEH 4L8DA 3RNQA 1X4ZA 1TTGA 2QQLL 4DFHA 4YAQB 5HI4C 2UYLB 2R8SL 5FK9B 4PRPB 3VXMB 4I5BB 2O5XH 4XTRC 3V4PL 3VGEA 3G5YB 5C0AE 1MREH 1CIDA 1XGRB 4WCYL 3WFZA 5FGCB 3V0WH 4R0LA 3UJIL 3D1MC 4XNZB 5EC1B 3RKDD 4K9EC 5DJ6B 1N6VA 1NUFA 5JO5A 4R97B 4ELMA 4NQCB 1CE1H 2LU4A 3OKLA 3K1DA 3HE7D 2NCMA 1GVIA 4JO1H 4FQXC 1ZK9A 2VOTA 5HVHC 1K3ZA 1FFNB 1A9BB 4WFHE 2VDLL 2IPUG 1OTSC 4XCCL 1U3JA 3QXWA 3HRPA 5GJTL 3ES6A 3OXRB 3EDEA 3QO0B 1RK1A 1DEEB 1RULL 3QO1B 3BGMA 4JFHE 4N1EA 2NW3B 3EOAA 1QG3A 1TJHL 2VNCA 3HLAB 4XNYL 2EE6A 4B53A 4BQ9A 3SDCC 1G84A 1RZFH 3IDMB 4JY6A 3HKFA 4C55A 2CH8A 1I9IH 5JZ7D 3O6FB 3LIZH 2ZOKA 4L1DA 2XWBA 1C5BH 3VFNA 1JPGA 2Z8RA 5ESAB 1D9KD 2L0DA 4LPYA 2I9LB 4JY5L 1AXTL 1DUZB 1FFQA 1ES0B 3KAAA 4UT7H 4E0RB 3SDXF 5DJ2B 3TA3D 3KYNB 3QCVH 3ARXA 3GMLB 3FRPG 2F8XC 4NNYA 3OF6D 3BKCL 5ABDE 1HSBB 4G8IB 1NGYB 1ZTXL 2YPLA 1LO0H 3B9KD 3L3KB 5T5NF 4UI2A 3WXVL 2N4IA 3FQUB 5FKPA 4PJ7A 5JW4R 4JN2B 1PG7X 1RIHL 4P23A 1S5HA 3ZZ1A 3MLUL 4HCRA 2EC9T 5HY9B 4OCRH 5SWSB 3EJYC 1MI5E 2O5YH 3T4AA 4IRSB 4CU8A 4NUGH 1N5AB 1L0XA 3VFTB 4APQA 1EEYA 3MLYH 4GUPB 3V2AR 4PJDE 1CD1A 2FO1A 2GHWB 3D87B 5IMOA 4FFWD 1KB9K 5HDBF 2O5ZL 3QIUD 1O5DT 1KIQB 3GMQA 4EQ3A 4KJYA 1DLHA 3KPMB 1UM4L 3VWKA 1BIHA 5SWZE 4KZEH 4X9FA 2FX7L 3L3OB 3MUY1 3ECBB 1MJ7H 3OJDB 3GSVB 1I3UA 1MIEL 1TCMA 2ENYA 4Q74A 4XNUL 1A7RL 4H0IA 5KOVC 5H37G 4LVHB 1D6VL 4L8BB 5E00A 5EUKB 5IM7B 3S34H 4WUKH 4OIIL 3C6LD 3GNMH 2FEDD 2YXFA 3K1KC 3D0LB 4IOFC 1A7QH 3AAZA 5ALCL 4YDJB 4GRWH 4PLKC 2IBBA 5C0IA 2A1WL 1FO0H 1XCTA 1P6FA 4PJ5B 2VWEC 3BZFA 3LS4H 2ESVD 1J8HB 4TRPL 5CGYD 5GGUB 1H5BA 3B6SA 2AJUH 3PWLA 2PR4L 3QDGD 2ADIA 3RUGA 3MYZA 1IL1B 4JVWA 1T2JA 3FO1A 4BJLA 2F54B 1T1YB 5F97E 4KQ3L 3TFKC 3KJ6L 3CDGB 3RWFA 1CD0A 3E2HB 3LKQA 2BFVH 3QDAA 4OGXH 2BDNL 3MV9B 4BQ6A 1V7MH 2Q6WA 1QFOA 4KAQL 4PV8B 1IGCL 3CUPB 4IRZL 3U9PL 1GGCL 2AXHA 4KXZI 4R4BA 5CD3A 5HYEA 2GCYA 1E4WH 2X7LA 4PTUB 2X09A 1DQQB 4IJ3C 4PRHB 1JYVA 1DCLA 3QP3A 3FQRB 4MVBC 3OKDA 3VWKD 1BM3H 4Z76A 4Z7VB 3VD4A 4QOKA 4N8CH 4WI8A 3QEGH 5CGMA 4ZFOA 3EYUH 1HQRA 1KCSH 1LO3H 3PL6A 4Y0GA 4X7SL 4PJ9D 3MLWL 2N56A 4JR9L 4L3EA 5DJXB 4M8QB 4JANB 3MV8A 5JDSA 3D2UB 1I75A 3P73B 4YGVB 2E27H 5JW4Q 4O51A 1BF8A 5AZEL 1INQA 3G6JA 3Q48A 3MRJB 1MFEL 1WUNT 4EUPH 3ARBC 4PJFB 4LIQE 2F53E 1S7SB 1PZ5B 3G5XA 1JBJA 3O41A 2QQLH 3CLEH 4JGJA 1VFOA 5BRZE 5D7IB 1CS6A 5FOBB 5D5ME 2VH5L 3V4PH 1KB5B 4M7LL 5JW5B 1HHIB 2CKBH 4WCYH 3UCRA 5C7XH 2I26N 5EO1B 1UWGH 2WBWB 4CBPA 1N5YL 5CP3H 1K8IB 3UJIH 1S7VA 4WU5B 4UIKL 5EUOF 1U3HB 4WNQB 1YN6A 3QA3B 4ZXBB 2L7JA 4EN3C 2FECI 5J1AA 3S8WA 2RIKA 2DBJA 1CWVA 1IBGH 2IEPA 1EIBA 1TQCC 5C0JA 1ZT7A 4C58B 4WY7L 5KW9H 1J05B 1XMWA 3AVEA 4U6XA 4F58H 4Z8FL 2XXMB 5F3HA 4ZNEA 4FA8A 4JFDD 3VWJA 4DTGL 1JPSH 4HUUA 2VDLH 1WV7T 1S7WA 3A6OA 2M2DA 4TTDC 5L2JB 3VXQB 1RULH 4YHPB 2Z31A 1F90H 1NJ9B 4XNYH 4YHYC 4XCEB 1NSNL 2Z35B 4D0DA 3PHOB 3F58H 3R4DA 1KN2L 5ACLA 4DEPC 5I9QB 1A5FL 2AERT 4JKLA 4KRPD 5DEGB 5SWQA 1PYWA 1NGQH 4L4TB 4I2XB 1RD6A 4HXBL 2ICWA 5HGBA 3AS1A 3FT4B 4LNVA 4U31A 4ZUSB 2DBLH 4P2RE 3MV8D 2IC2A 2Z0BA 1F97A 5GGSB 4U1HA 4N8VA 1WWCA 1SJHA 4WWKD 3QFJB 1KB9J 2VLKE 1AKJA 2VB5A 3BKCH 1MVUA 5E94B 4K2UL 4L9DA 5DUBB 4KDTA 4YR6B 4AENA 3HZKB 5C0BD 3QIBA 4OZIF 2IAMA 3ZKMD 3GRWH 3HZYA 4WW1A 2P5EB 4HEME 3VXSB 3OAUL 2COQA 1D5XA 1F4WL 4PRIB 3TYFA 1KJMB 3QCTH 4JDVA 3U4BL 4HZAA 3BWUC 3O45A 2J3SA 1ORSB 2Y7QB 4UU9A 2AK1H 5F93C 4DGVL 3MXWL 4GLRI 4F9LA 1YEHL 1F6FB 5DJCA 1EMTH 1MHHB 2OTWB 4U6YA 3V8OA 1J9CT 2E6QA 3KDMB 5TE6L 5LCVL 2C1OB 2O5ZH 3OL2A 3PJSB 5D71H 3L3DB 1WBZA 1UM4H 3K80A 1HI6B 2FX7H 2DAVA 1TJIL 2XRAL 4RNRA 3NIFE 4NM4L 2ZOLA 1F8TL 5GGTL 5T1MB 1DJSA 4JFFB 4XRCB 1ZLUH 5JOFA 2RB8A 1MIEH 1U36A 4XNUH 1A7RH 1P1ZA 3QUYC 3OGCB 4U6VL 4XVSL 5CIPH 3GMPA 5CLWA 3OZ9L 1PY4A 4YHKL 5DFTA 4JO4H 4LAQH 5DEFB 5T1DH 4LKCB 1HILB 5TDNB 1KCLA 1DUYA 2HYMA 2XXCB 2CMRL 1EZVY 3THMH 4M7JH 2DM3A 4L1HA 1FDLH 1JP5A 3CNKA 3F12B 4XAKD 2A1WH 1LO4L 1J1OH 2WIIB 1MWAB 2GAZB 1KOAA 1PJ9A 5I19L 1II4E 2CRIA 1AGBB 2HJKA 2P8PA 5L9DL 1AKJD 3G6AB 2C9AA 3LVEA 2GJJA 4E41B 1G0XA 5E4IA 5EBMB 1DVFC 5FYLL 3QIBD 4JFED 4GOSA 2XZAL 4PIRF 1INDH 4PG9A 4NQSB 5L2KD 4UDUB 1AGFB 1F45A 4LLQA 3S5LG 3SDXB 4BSVA 3GIVB 5I8CB 5IR1B 4BFIB 4G6KL 2DQUH 1ZVYA 4EBQL 5I8KL 1ITBB 2CRYA 4PJAE 4M6OL 5D2NC 1WZMA 3FQXB 3BZ4A 1AO7A 1HHKA 1YECL 2PTUA 4UTAH 1G1CA 3RTQD 5DSCB 4AH2B 1IFHL 4M9OA 3ZT5A 3UZQA 4LVOB 3I02A 1A9EA 2M1KA 3DETC 3G5ZB 1Q9KA 1ZSDB 4AEHL 5IF0A 3FO2B 3V6FA 1YYLL 1WIPA 4HIHA 2YD2A 3MLWH 1C7TA 4MNQE 4PRAB 1M6OB 2IJ0C 4GS7C 4M1CD 3MOQA 4C4KT 3O9WC 1JF6A 1KCRL 1FAIL 2UWEF 4GSDL 1AP2B 5GJSL 3MLTA 2KQNA 3DO3A 1CDHA 3U0TB 2FYYA 3VA6A 2D0GA 1WWAX 3EJJX 4W6XB 3UP1A 3RWIA 2CIKB 5INCA 4M43H 2Q86B 2FDBP 5JIHA 3MRPB 1JWUA 5EG6C 4XWOD 5DI8A 4FABL 3W2DH 4UT6H 4XH2A 4M7LH 4DWHA 4OZFH 1VFAA 4DN4L 4DOHB 1KEML 1ZEAL 1BD2D 2XKUA 4N90E 3WHE0 5ERWB 1KG0B 5I17B 3QDJE 1CIUA 3I75B 4WY7H 2H32A 3HR6A 3KR3H 4NT6A 3D39D 1T3FA 1UWEL 4Z8FH 2GSGA 2ADGB 4XCNA 3RZWA 1CGUA 3CVIL 3VGAC 5H35B 4QTIL 3CFKB 4YQXH 2F58L 3T1FB 1FYTB 4MWFA 5E8DH 1MJUL 3FMGL 3CH1B 1N6QH 3SCMB 5IKCB 1AO7D 3OX8B 3KPRA 2BRQA 3LQAH 1DFBL 1C16B 2BRRL 4P4RA 5DMIL 2O61A 3MMEB 1A7NH 1RI8A 3R0MA 2BP3A 3KLDA 1A5FH 1R5VB 5A16A 3FJTA 3LV3B 4FP8H 1T0NA 1VHPA 3KYMA 3VCLB 1CLCA 2B8OT 1T0MB 3G04A 3RVTC 2RCSH 5MI0B 4HGMA 4I18A 4YPJA 5F1IA 1BQUA 2R1YB 4RSVA 5DGRA 4Y1AA 4LLYA 1FL5A 1E4XH 3FB8A 3VFGL 4G80B 1WF5A 3K0WA 2R69L 2A9MH 4IRJA 5DT1L 1FFRA 2OMNA 4TNWK 5KSBA 4YIQA 1YYMH 1YNKH 3F6IA 2DM2A 4DKDC 2DTSA 1S7QA 4ODUA 3TO2B 3UPCA 3O3EA 3U4BH 3TBWB 1FNEA 5F44A 3LKOA 4BELD 1FZJA 5DQDL 5DRXB 1D3CA 2VDPH 5CHNA 4S0TD 3SKMA 1MCWW 1JK8B 4EZMA 1KC5L 3F7VA 3MBEB 5DVNA 1JZ7A 2DI7A 5TE6H 1K4DB 3NTCL 2LVEA 3ARFB 5HBBA 3NPSB 5FGBC 4Y19A 2IALB 3UDWC 2H26B 4PV9B 4WO4A 4E9LA 3MLRH 1ZLUK 4DCQA 3KPSD 2DTML 1HCVA 3REVB 3SKOB 1VENA 1MH5B 3ROLA 3QNXA 1CICC 2HLAB 4QRQB 5CJBA 3RBSA 2VDOL 4CVXB 4PB9L 5EUOB 1NCWL 1RVFH 4LF3A 4NM4H 5GGTH 2FL5B 5DO2D 5JIIA 5D7LB 1G7JA 1OTTD 4I4WA 3QG7L 1KIRB 1MFAH 1W0WB 2W0PA 5T1KA 3L9RA 4U6VH 1QSFA 2W0LA 3CFJA 4ZSOB 5HHME 1MRFH 3V5HB 3VMNA 3V7AG 2D0FA 2V2TB 2D7NA 2GJ6E 3VXTA 3W11C 3DHMA 4FQXB 5HVHB 2FX8L 2FWOA 3LCYA 4HIIA 3L6FB 4OBRA 1Z2KA 3GMRA 4PG2A 1C08B 3ZMRA 1UCBL 3BZEB 2PXYC 1AXIB 3SDCB 4HCRL 4F8TA 5JW4N 4XAWL 1EEUA 3IRPX 3IDNA 5DQJB 4WV1C 5FYLH 3BN9D 5KS9F 1BEYH 2EDFA 3QHFL 4O4YL 4F7CB 3SKJL 1G7HB 1QSZA 3TZVA 5FYKD 2E9WA 2EH7L 5DDHB 3WIHH 3HI6L 3ARED 5JQHC 1WEJH 1X5GA 4EBQH 5I8KH 1E6JL 4X6FB 2X1XR 4M6OH 4L8CA 2IFFH 2I9TB 2NY2B 2NZ9C 1EV2E 3L5XL 4JHZA 4YE4H 5J7CC 5LWYH 1RURL 1YECH 4OCNC 1KXQE 3BD3A 1KEGL 3DXAB 5F7FA 3RGVC 1CL7I 1P2CA 1H9VA 1B0GA 4Y19D 3W0WB 4BSWA 3UYRL 2IBZX 5I76B 4M61A 3EYFA 1GH7A 1JTTA 2AQ3A 3MFGB 4HDIA 2FBOJ 4AEHH 1T1WA 2Y72A 4U1GB 1YYLH 3MGAA 4P2QB 3IXAB 5IUSA 3FT2B 3RP1A 1OSZA 2V5YA 4CU7A 5FO9A 3B3IA 1I1YB 1HHHA 4KKBD 2HT4D 5GJSH 3K81A 4X4XA 5HYSG 5D1ZA 3QHTC 4LPXA 4D0CB 4X4YB 4QRSA 5CUSH 5F8RC 1QYGL 4BZYA 5EU6B 3TF7C 5C92A 4ONHB 2GITA 3VFRA 4G8FA 5DZLA 1G6RA 1S5IH 3D3VB 4QHNA 4QWWC 1I8IA 2HH0H 1DBBL 4JM2A 4C56A 3VXNA 4ODBD 4PUBL 1OB1B 3EHBC 1KXTB 1TIUA 4OLVL 4WHYH 3TZVD 3F65A 3ZTNH 3VJ6A 1IRAY 1IJ9A 5DLML 4M48L 3G5VA 3CSPA 3MRDB 4S1RL 4RA0C 1QBML 5CJ5A 3JWDL 3QISA 5EULV 2F58H 3LKSB 5E2UH 1L7IL 1MJUH 3O8XC 2H2PD 2OM5A 4R3SA 1KTDB 4JHWL 5IEKB 1DFBH 1I7UA 2BRRH 2ZPKH 1OW0C 3IDXL 4UAOC 5DMIH 3VMPA 5KBNC 4K94H 2Z8WC 4OQTL 3S37L 2JF1A 3BUYA 2Y4SA 5EZJA 2PTTA 1YEFL 3WE6A 2EZ0C 5IQ9A 3MLXH 2D31B 3T0EE 1ZLVH 1VA9A 1B0WA 5IW6A 1NEUA 1D5MB 2YEZB 1FH5H 1FL3B 4FNLL 4PJHA 1CGVA 3BP6B 5I6XC 2R69H 4LSSH 1FGVH 2NLJA 2BSRB 4ZO7A 4IJ3B 3NAAH 1OF2B 4XT1C 2EC8A 2YOCA 3WV0A 1IC4H 5IVXE 2FX9H 4WUUA 1JF1B 3V5KB 3U0PA 1MFCH 2CO6B 4RX4A 2MPAH 1SYSB 1IMHC 5FHBH 4KKNA 4WEMB 5HGAB 5JPNB 1IEAA 5HI5C 4AEEA 2UWEB 4JPVH 5I74B 3S36L 5A2IH 5DQDH 5DURB 1C5DB 3QT2A 3NIGE 4DZ8B 4Y4FA 5EO0B 3GB7A 3WEXB 4JM2D 4YXKL 5C08D 4NYLA 1QFWH 1WAAE 3T2NH 5C9JA 1WFUA 5F7HA 3ARYA 3NTCH 3DROA 4LLDA 1EVTC 3RVWC 2FLBT 3WXWL 2JB6B 5L8JB 5BVPH 1SEQL 4NSKA 5DK2B 3RY5A 3I6KB 4XXDB 3OKNA 1KT2B 5C3TA 4DQOH 3F5WB 2B5IB 2DTMH 2ADJB 2EIZB 2X1QA 3D85D 5IFAH 1J7VR 2VDOH 4PB9H 3TIDA 1U8HA 1NCWH 2BSED 4JZOB 4ZOBA 3LN4A 3QG7H 4XXCC 3C8DA 4KI5D 5AUMA 1UWXH 1WFNA 3NA9L 1TQCB 3OAYH 2A77L 1NPUA 2OTUB 1DE4A 4JKMA 4L3AA 2H8PB 3GJFA 1TENA 4NO0D 3HR5A 3OKOB 3U1SH 3DUSA 1KELH 5BZWA 2BVUA 3WN5C 3BO8B 3QUXB 3O3DB 2VLRA 1F6AA 4OZ4A 3TJHC 4PP1D 2DMKA 1EX0A 1CFQA 4YHLL 4JQIH 4HCRH 4YHYB 3HI1B 4WJ5A 5HVGB 3CVHB 4DEPB 1ZS8B 3OMZA 1BLNA 3MJ9A 4A2LA 5CBEB 5KVDL 4ELKB 4RX4D 4B7LA 2C4XA 5GRJL 2YUVA 4M4PA 3VDBA 1I7TA 4PJ8A 3WKNA 3PGCA 4K71C 5DF0A 3BGFB 4N0FB 2A0LD 4KUZL 4QEGA 4TTGA 1RJLA 2BSSA 1XGPA 2P5WD 4JRYA 4WRLA 3EOTL 4MD4B 2AV7A 2EDLA 5MEQA 4QTHB 1NGWB 3L5XH 2Y23A 4Y5XC 3HC0B 1KEGH 4P9MH 4TULL 3P4NB 3LKNB 1AGCB 1Z0NA 3IFPB 3RWJB 4QRPB 5FF6B 3ILQC 3CH8A 4GG8A 4P2OA 3VFSA 4LCYB 1TNMA 4OFYD 1PDKA 1L6ZA 3WFEL 3AB0C 1EFXA 1RZJH 3LKRA 3JV4B 5D72H 3RY4A 5FB8A 5ITBH 5ESVB 3RX8A 1HINH 4NM8H 3WFBL 4JY4B 2VUYA 3HB3C 1CDJA 4X6CA 3EOBA 4KK9C 4HW6A 3L5JA 2R2HB 3HS0A 4ODWA 4LHUB 5DWUL 1P7QA 1MFBL 4NNPL 5C0EA 2VLRD 4YHIA 1QLEL 3BXNB 4G9FD 5DD3L 5T3XD 3QB7C 1A6PA 4FTVB 2ZSVB 1DR9A 1GHFH 1J11A 4DUVA 2R15A 3FT3A 4I48B 3MFFB 2XYCA 3N1PC 5FKAA 5F1KC 1B90A 4K7FB 5LGJB 1MRDH 3I2CH 1ADQH 1H3PH 3QXVA 4LASL 5DRWA 1QNZL 3HAEG 3U7AA 4X8XA 5J6HB 1JGUH 2C1PB 3L3GB 4NQED 5DLMH 1A7PL 1HZHL 4S1RH 3U7YH 1QBMH 3JUZA 1YJDC 4GW1B 4OLXL 5GSVA 1NANH 1OAUL 1XGQB 2P44B 5CGTA 2H45A 3OJ2C 1T2QH 5KS9B 4ISVA 2APWA 3VXRB 4UBDC 4PJIA 1AI1H 4JHWH 4OLWL 3X13B 1JMXA 5CP7B 3IDXH 3FQWB 1K4CB 4WGVB 4XVUD 4O5LL 3C87A 2ESVE 3KS0J 5IBLC 1ZLVK 2Z91B 3SDAA 3S37H 4IDLA 3UTTB 2DM4A 4G6ML 2E6PA 3MRHA 3QDGE 3IJSB 4X5XB 3EO1A 1KENH 3WO4C 4TUOA 3ORJA 4PJ7E 3L3HA 5DK0A 5IVOA 1T7XA 3MNWA 3P4MA 2WBJD 1N7ML 2DD8L 3LB6C 2BNQB 1LEIB 2AEPL 5D2NB 1CE6B 2JCCF 3HE7C 1JZ8A 3HNSL 4GMTH 1A2YB 4YXLL 1FVCB 1IQDB 1R3LB 3RVUD 2DQFB 1X5IA 1JRHH 3QH3A 4XP5L 2NY5H 3SJVA 1MRCL 5JXAL 2EXWC 3IU3A 2WK2A 1WK0A 1N2RA 2XQBH 3JWNC 5KSVB 2IH3B 4XBPB 1MUJB 1IGJA 4OD2B 1RJYB 3GI8L 1NL0L 4F8QA 2YS4A 3B5HA 2YN5A 2CKNA 5JZ7C 3I6LD 4OF0A 4CMHC 1JNLH 1T4KB 4YXKH 1F13A 5TDOB 3RVVC 1D9KC 1FZOB 2CIIB 1NBYA 1PY9A 1QKZL 3TCLA 4HG4K 5M7QA 4FQHA 2VDNH 4YHMH 5MERA 3TA3C 3ET9F 3C5SA 1MCKA 5I8OL 5E56A 1PGRB 5EIIB 3SY0B 4XI5C 3KPQA 3VI4F 3B9KC 5KZCD 4BQ8A 3X11B 3BE1L 1N4XL 3OAYK 4P5TB 3DJ9A 3QWOA 2IMMA 3VRLF 4LSRH 2LU7A 4Y2DA 5F9AC 3UTSD 2W0KA 2ZNXA 4KTDH 4XZUA 2NY6D 2G75A 2YD3A 1R0AH 4OZGB 3NA9H 2D7OA 2A77H 4F3FB 3P9WB 2I60L 1G9ML 3BYTA 5DJ6A 2C3HA 3MXVL 3VGAB 4MA8L 5HPMB 5GS0C 5D2LE 3MACL 3QIUC 5CEYB 1FPTL 1LK3H 4HEPG 4PJEA 3OAZK 1I1RA 1TZGL 1A9BA 4JFDE 5TE4L 3QDMB 3TN0D 1E28B 1WZ1L 3GSXB 1ORQA 4TSCH 3RPKA 1MY7A 1GOGA 4GRLD 2BVQA 4EI6B 5GISL 4MJID 1N3NA 3RDTD 5BOZG 5GRJH 5B21A 4UQ2B 3BVNA 4NO2B 4U1LB 3DV6B 1WLHA 4AYFA 1LILA 3BPCA 4BZ2H 1BQHA 3C6LC 5J13B 1UC6A 2HN7B 1SY6A 4F80A 4UIMB 1MOEA 1Y6MR 1ES0A 4YEFA 1BZQK 3ARRA 3TBSB 3ULVC 3EFFB 5DJ2A 3HFML 3MV8E 1CXFA 1U8OB 3GMLA 3QFDA 4OD3L 3CZFA 5J3HD 1HSBA 1CDGA 3NCJL 3L3KA 1CLZL 4HMCA 3S3PA 2OI9B 5C0BE 4JPIB 1ZVSB 3T09A 4HIEB 3DNKA 4PRPD 3VXMD 3WFEH 1QO3A 1CLOL 2R29L 4M3KB 4JFPA 4IRSA 4Y2DD 2ATKA 1N5AA 1VFMA 2AJZA 2FJFB 7FABH 1NBVL 4Y89A 5DMYA 1TETL 2GY5A 1URLA 1UKQA 2W92A 2X9WA 1WCBB 3TT3L 5F89B 5TF1L 3LRSB 1G9NH 4M62L 4OLYL 5HYJA 1DQJB 5E9DB 1I8LA 1XF3B 3GSNL 4NQCD 3DGGA 4ODTH 5DWUH 4HXAL 3TBVA 1YN7A 3CK0H 3KXFA 1KJVA 1YEGH 3RY6A 3CXHK 1OHQA 1T7VA 3LH2H 3T65A 4S1DD 1N6UA 3D9AL 3D25B 3O6LL 3HUJA 5IHBA 4HULB 5CLTA 3RI5K 2BOCA 1UJ3A 1V8HA 3MJ7B 4U6HB 4XPGL 4XPBL 1EO8H 3BZDA 1PKQE 5FDWB 1UYWL 2CJUH 3PUCA 4FFVC 4ODXB 5I75C 3O6FD 1UT9A 5E8OB 1A7PH 1F3DJ 2SEBA 4HC1A 3ARZA 1K3IA 1DN2A 4HK3N 2GJZA 1R24B 1KJ2A 3BGAA 5EOQL 2MCG1 4PGEA 2PXYB 3IU4L 5TJWK 5GGSY 1P4LA 2DQJH 3FHQA 3C8HA 3ZSTA 1RAMA 1KIPA 1FVEA 2CUHA 5GZND 43C9A 2VQUA 1LDPL 2FJHB 4G6MH 1HXMB 1IL1A 4HKZB 3MGOA 4JFEE 4Y5VC 3VFPB 2R4SL 2DDQL 3VU2A 1D5BB 3IS0X 2DD8H 3QJHA 5SWSD 5DC0A 3VMOA 3UROR 2H2SD 1SJVA 5L2KE 4IRSD 3HNSH 4HG4J 5TGBA 4NO5B 1GJIA 4X6DA 1W72B 1MPAL 4GQ9L 4K8RC 5GGRB 3U4AA 3VRIB 1Q9LB 4YX2L 2VJXA 3CUPA 3T0BA 2FIKB 2OP4L 1MRCH 3ZL4L 5JXAH 3JSSA 1DL7L 1NFDB 2XG4A 3HI5H 3O2WH 3F6LA 5FA4B 4QXWA 1G6RL 1FJ1B 3GI8H 2H9GA 4RCAA 1PG7H 4BYHA 2YZ8A 3BSZL 3QZWG 4YNYB 1XR8B 2YPVL 3WIIH 2OXGA 3LKPB 4LLWB 4RGMB 5C0CE 2ZG1A 1YQVH 3QEQA 4ODSH 3T0WA 3K74B 4JFXA 4J4PC 4RAVB 2W65B 3I9GL 5DJXA 5DJAB 4J3XA 2H32H 4M8QA 5LJYH 1LO2H 2J4WL 1QKZH 5BXFB 4RIRA 3D2UA 1CGSL 5BV7B 2E7CA 5J11C 4FQ1L 4HZLA 3U9UA 3FB5B 4DVRL 5F3BB 5DMGC 4PJFA 3U30C 3VXUA 1S7SA 3JWOL 4JRWA 1AGDA 5B3JF 2Y07L 3T8XA 1ZXQA 1J1XL 1EAJA 1S9KC 3ZKMC 1HH6B 5FM5O 4XCYA 3OQ3B 5DRZB 3F7YB 4PJ5D 1F4XL 1KB5A 1BQLH 1AIFA 1BP3B 1J8HD 5F7EH 2X9YA 3L3JA 5JOEA 1BD2E 3MOAL 2ICES 3QEUA 4KTEL 5CINH 1K8IA 5LQBL 1L9MA 2XTLA 3LMJL 1SJXA 3MV7A 5FECB 3WNMA 2YUXA 3H3BC 5EFIA 1HEZA 4Q9QL 3MXVH 5I16B 3MCKA 2F54D 4XGZB 2AJVL 1I85A 3UTQA 3SO5A 1RZ7L 4G8GB 5I66A 1CTNA 3O8XB 3WKMH 3FB6A 3D39E 3MV9D 4XP6L 3ZKXC 4ZAKA 1MCDA 1SJEB 2NXYC 2FSEB 1RIUH 1P4IH 1V3LA 5CD5D 2HJFA 1UXWA 1T1XB 3C09C 4OCXL 1AO7E 3LD8C 4P9HL 3U6RA 2A6JA 4PRHD 2DJ4A 3W82A 5JHLL 4NQDB 3QXAB 4YGAB 1JGLL 1QR4A 5LGKA 3V0AC 4JPWL 1MCOH 2JCCB 4PREB 1U8JA 1P53A 5DEGA 1ZV5A 4WIQA 5E4EC 3VA2C 3NIDF 4L4TA 1JHKL 5DVOA 1PSKL 1AHWC 3DYMA 3UX9B 4LCWB 4R90H 4ZUUB 5I6XB 4I0PA 1ACYH 3CMOH 3PWVB 3SQOH 3D2UD 1MJ8L 3L7EA 3OKEB 3P0VH 4UTBH 4YBHA 3BP4A 3FONB 3CCHA 2CXGA 5ETUB 5FUOH 4FQIL 3ULVF 5E94A 4J6RL 3OBAA 3SE4A 1FZKA 1CLZH 3S5LB 2PCPB 5A1AA 2ARJQ 2LABA 3O4LB 3GJEA 4GG6E 3CXHJ 4ZO6A 2UV3A 12E8H 3WDIA 4CMMB 4LPTA 2AJXL 1DDHB 4MCZB 3VXSA 2R29H 2XIDA 5C6TL 5IG7A 5J89A 3GSQB 3WFDL 4Q2ZA 3HC3L 4Y4KC 1NUGA 4HH9B 4CU6A 5KTEL 3IXTB 3KPNA 2VE6A 4F7PA 1JTPA 5IJKC 4LFHD 3TT3H 1U3HD 2HRPL 5TF1H 3BX7C 4QCIB 4ZXBD 4OLUL 3KLHC 1N59B 3HE6A 4BKLB 2CDFB 4GAJH 5T3XL 4MQ7A 1ED3B 1ONQA 5TFSH 4HXAH 3RTQC 2BOBA 2P48B 2K1MA 3QDHA 5BO1L 3GMNA 5T1LA 3ZT7A 4W4OA 2VL5A 5J57B 4ZPVB 3KPSE 3MJ9L 3TIEB 4D8PA 1CZ8L 1MJJB 4KMLB 3D9AH 4ERSH 2FZ3B 2DIBA 4XBEH 3O6LH 1TNNA 3OKKB 5CSZA 1G7LB 3ELAT 3QCUH 4JLRB 1YEKH 3MLVL 4GXUM 5INDA 3Q3GA 4XPBH 2EEBA 2ZSWB 1UJTA 4LLVB 5TE7H 5DEFA 1G7MA 1Q94B 1HILA 1NUNB 5I1GH 2CLZA 4YDLC 2QR0B 1OWRM 1A6AB 3P0GB 4L4TD 4U4BA 4V2CB 1U8IB 3C08L 2DQIH 3OR7B 4I0PD 4OZFG 3IU4H 3ABZA 1QUNA 3QFJD 1QLRA 1WFOA 3M1BB 2W9EL 2DWEA 3S4SG 1LDPH 1YY9D 4E41A 1I3GH 4FZEH 3WBDA 5KSBE 4K71B 4GO6B 1SYVA 2IANA 4NQSA 2P5ED 4U3CA 3VXSD 4YFDB 4PRID 4UDUA 5HTSA 3QUZC 5FYKE 3SDXA 1IEHA 3DPBA 3I50L 1PBYA 5C0DB 5D2LF 5CZKA 4BFIA 2HT2C 2Q7NA 4Y5XB 4ZODA 3WD5H 3AU1A 3KLAB 4LL9A 4GQ9H 2OP4H 2A83B 3C9NA 3ZL4H 3B5TA 3ARDA 3HE6D 3S9DB 4JN1H 3VE0B 4AH2A 3O6KL 2XTJB 5IBUG 4NPYB 8CGTA 2FECL 2IH1A 1YNLL 1DBAL 4Y19E 1BGXL 3U7WL 5L8LB 3Q6GL 2YPVH 5MEPB 3STBA 3KWWB 4PB0L 2K3TA 2C3XA 4NIKB 4MJ6A 5JUEL 4KV5F 3VD9A 3P30L 3T4YB 4JFYA 1I7RB 1QZ1A 4GT7A 4X80L 4YDIL 1OL0A 4NC1E 2J4WH 4JFFD 1MVFA 5EO9B 4DK6A 3FN3A 1U42A 5LG1A 1NQBA 5J1SC 2WINA 4JCLA 4Z95H 3QPQD 4DVRH 3QJFB 4MCYA 3U0TA 5I1LB 2PF6A 3MYJA 1RZGB 5E8NB 2NW2B 5DC4B 3H3PL 1UGNA 4NBZB 2OXHA 4M3JA 1FIEA 4ALAL 1AR1C 1F4XH 4S2SA 3ARGA 3VFUB 1A1MB 4OF8A 3NZ8B 4E42B 4LGSB 3EAKA 2PO6A 3GSUB 3MOAH 3WDHA 4E41D 2DQGL 5JNYA 3PXHA 3LMJH 1VFBB 1VDGA 1XIWC 4Y8DC 3TC9A 2DB8A 1LEGB 2AJVH 3PXJA 2EEAA 2YD9A 1RZ7H 1IAKB 3ZE1E 1G7PA 4G8EA 2HMIC 3CC5B 4XP6H 1NGXB 1C8PA 3IDGB 5H35A 2X42A 3CFKA 2H6PB 3T1FA 1ITCA 5FYJU 4LHQB 2BHUA 3CH1A 4OTXL 3SCMA 5IKCA 4TUJA 3ARDD 1L7TL 1BWMA 4OCXH 3C5ZB 5CMAB 3WO4B 3MMEA 3RL1B 5JHLH 4ORGB 1JGLH 4RMQA 4JPWH 3ZO0A 3DI3B 3PABA 3FOLA 2G60L 1CG9B 4I13B 3IFLL 4FQCL 5ADPH 2EDYA 3QIWB 1JHKH 1PSKH 2XZCH 1F3RB 1WSST 5AG9A 4HK3J 4R2GD 4YFLI 4CJ0A 4K7PX 3L3IB 4GKNB 4V1DB 5C6PB 5GRZA 4PRNB 3LSOB 4LCUB 2C7UA 1MJ8H 4CVZA 1VCAA 2E8YA 2EYRA 4Q9RL 3SGEH 5KN5A 5AZ2L 4RMSA 4J6RH 5FCUH 4NCDA 5EC2A 4L8SB 1T5XB 1YNTB 5FM5M 4TVPL 2PW1A 1WWBX 1MLCA 4UDTA 4HLZH 2AJXH 4CMHB 1PQZA 3BIBX 5JMOC 5GXBB 3GJFH 1UXSB 5ILTH 5EZOH 3HC3H 4LQFL 4GKZA 1HKFA 5KTEH 4LLMB 2N7BA 2AABL 1CFTB 1FVDB 2Z9TA 3MBEA 4PR5B 4R7DB 4XBGB 3CAFA 5C08E 4OFVA 2ENSA 2GTZA 1AH1A 1NLBH 1K4DA 3BQUC 1FNGB 3UPAA 4JAMB 2YWYA 1GGBL 1ZT4B 5BO1H 1FZMB 4PJBE 3PIQB 4KPHL 1N8ZB 1NGPL 2HA1A 3WL9A 4L29A 3MJ9H 1CZ8H 1FYTD 1IGYA 4U1MA 1KXVC 3RWCA 2XQYG 2Y36L 5DHYB 2FL5A 4HKXA 1UM5L 4NC1C 5E5MB 3SCMD 3MLVH 5HYSB 4MXVE 4M9PA 2X4QB 4L3CB 4F2MB 4KI5E 1UH2A 1SY6L 1YEJL 4KKBC 4JFOA 3WCYA 1IQWL 4HUXB 1PEZA 4PJCE 5DS8A 4OZHA 1IARB 4BFGA 4XMKH 4F7EB 3F8UB 1DQMH 1T04B 5ISZB 4OF3A 5D1XC 3L6FA 1F4YL 1R5WB 3AFLA 1CXIA 1RV6X 1T21B 3ALWA 1A6ZB 5JHDB 5K9OB 4Z18A 1VGKB 2NY3B 1S7UA 2W9EH 4Y5YA 4WI7A 4ONFH 1Z6JT 5DQJA 4YZFE 3FN0H 1CDIA 4PRBB 3JV6B 3OPZL 1G7HA 5D1QB 3QI9C 1FNSL 4OV6F 1XGYL 4P0DA 4Z78A 4F37K 5D7KD 5GSRB 5K9KB 4U1NB 5MEOB 4PRDA 4PJGA 1RY7B 5ICXA 2P5WE 2VDKL 5I30L 1F3JA 2YBRA 4OZIA 3MBED 5E2TL 5IT2H 2H2PC 3B8YA 4MA1C 5CSBA 4IMKA 4N5EC 1VEMA 3ARFD 1S9XA 3O6KH 1FLTX 1JWSB 2Y1VA 2YD6A 4HS6B 3U7WH 3VRJA 4XTRD 4HFUH 1GOFA 3GSOA 4HD9A 1XGTB 4GRWF 4OAWA 1GRWA 1FE8H 1KBGH 3STZB 2Q7YA 2YC1B 2VDRH 5D7LD 4F7MB 4HJJL 1UEYA 4H8WL 4N68A 1VFUA 1DZBA 3M17A 1CFSA 2XA8H 1P4BH 4HC1L 1QRKA 3IETB 4LPWA 4WEBL 5LBSH 1OT2A 2EDHA 2OJEA 5C6WH 4UOW0 4P4KC 3RZCC 5DHVB 3H9HA 3INUL 4FQXD 3RWHA 3DO7B 4NRZB 1BBDH 1YY8A 4K3DL 5TH2B 1OTSD 2W0FB 4GG6F 4ALAH 3C8KB 4C4KO 3P3YA 4RFOL 4ONHA 1BFOA 1JUFA 1ETZA 3DECA 1EEZA 2VLRE 1AE6H 4G9FE 5T3XE 2Y6SD 5FGRA 3SDCD 3HZVB 2DQGH 2HFFA 5DQ9A 1OB1A 5I75B 3GBML 3IFOA 1Y0LA 2BVOA 3HPLB 1OSPL 4LARH 2Q8BH 2JJSC 3ALXA 4M5ZL 3VH8A 4OIBA 2AV1A 3EJZC 3NN8B 2AEWA 4H26B 4NQEE 1S7RA 5IFJA 2YHGA 5C0AA 1KCVH 5IJVA 3FQTB 4LHJB 2NY2D 5CEZL 5IEKA 3DSFH 5EBLA 2V9QA 3ZHKA 4CKVX 5HHXH 5MHSD 1NC2A 3DXAD 4GRMB 2F5BH 1X4YA 3MR9B 2VISA 4HWBH 1LQSR 4KI5C 5F7DB 3W0WD 4Y5VB 4H1LB 2DLFL 3SDDC 3P11L 3EJYD 4G5ZL 3IFLH 4FQCH 4JQXC 1IEBA 4BH8B 3L5WB 4P2QD 1BVLA 5DJYB 4U6TA 4LOUC 3CPLA 2D03H 4MSWB 4YC2B 3NBNA 3LHPL 4L4VB 1CDCA 4EDXA 4PP1C 3T0DA 5AD0B 2YD4A 5HGGS 3IRZA 3RX7A 3VFMB 4JB9H 4MHHG 4HWZB 1KB5L 4TVPH 5HHOB 3MCLL 1MLBB 3GHEH 3QWRA 3SO3B 2D7TL 3NCYP 1R5IB 5EU6D 1O7VA 5F8QC 2EKSB 3HN3A 1UQSB 2D0HA 3D3VD 4U7MA 1JNHB 3PNWA 4GJTB 4OD1H 2IPTH 4NFDA 5CJOL 1HIML 3I6LE 4DZ8A 2AABH 4QHKJ 1ZA6B 5CAYB 3LQAC 4Z7UE 1TQBC 3QNZB 3ARBA 1S7XB 3NFNB 4FG6C 2V2WB 2HJLB 3HRZA 3PHSA 1A6WH 4PLKD 3OXSB 5F6HI 4ZQKA 5DK2A 1EGJH 3B2VH 5GIRB 4MB4A 2HVKA 3VDAA 1MI5A 1VEPA 2D7PA 1K8DA 4RAHA 3MUHL 4XNMB 5GGVL 1NBZB 4NDMA 4ENED 1XF4A 2Y36H 1DN0B 2BCKA 4MMZC 3MLSL 3ZE0E 3B43A 2VDQL 1YMHB 3TNNA 2WZPD 1NCTA 3VXOA 4PJDA 1KLGA 4RMRA 5T3ZL 4EN3A 1FGNL 3FL7A 3UTSE 1LEKA 2VXVH 1IAIM 1KTLB 2V17L 3QUMH 3DRTB 5C2UB 1CL7L 4F15C 3HHRB 5ANMB 4U33A 3TBYB 3WNNA 4LNRA 2NXYB 3S7GA 3MSPA 3K2UL 1NCAL 5D6CA 1VKXB 5DUMH 3RU8H 5KANI 1H8NA 1NKRA 3NZHL 1M7DB 4M7KH 2ICEA 3C09B 3LD8B 3DMMB 3WYRA 3CDYA 4MVBD 4X6EA 4CUCA 3BAEH 3GEWB 4NO3B 3JVGC 1A8JH 1ZGLM 5CBEA 4ELKA 5E4EB 4X7EC 1XGYH 3TCXA 2NX5B 4MJIE 1RU9H 5I2IB 2JB5L 2DQEL 3MUGA 3DVNA 5HGDA 1GZPB 4MQSB 4HUVA 5DURD 3WFHB 5H8DA 1NMCC 1GL4B 2VDKH 3CIQA 2JK5B 3ROOA 5I30H 2EO1A 4NWTL 15C8H 1NGWA 4GAGL 3JV0A 4HPOL 4RFEB 1JPFA 3V0VB 1TTUA 2XKSA 4HK0B 43CAB 2BHYA 1I1AC 2GTWB 5D6DA 2IGFL 1FQ9C 5MENB 5K59F 3EYSL 1T20B 2XN9B 4ZUTA 5EOTB 2B0SL 4XCFH 5FF6A 3MLPA 4HAFA 5TQ0H 5E1AA 2V7NA 1FNAA 2ZCLL 5JQ6L 4Y4KB 2WBJC 4PRPE 3VXME 2KDGA 2EYSB 1E6OL 4HKJB 4HC1H 5ESVA 1BWWA 2IBZY 1KJ2H 5HVFB 2ORBH 4KKLC 3QQ3B 4JPKL 3FRUA 4LRNH 5FGCE 3RVUC 4PD4K 3DX8B 1CFNB 5CWSB 1TPXB 1X5HA 2C3WA 5CKAA 2VL4A 4Z7WB 1F5WA 3INUH 1YEIL 2R2HA 3KJ4C 4OB5L 4NQCE 4YWGL 1MF2H 4TTDD 3QUXD 4Z7NF 1RUMH 5FM8A 1U0QA 4S1SL 5DD6A 4P46B 2Q1EA 1X9QA 4IBLT 5CCKH 3QUYA 5FO7B 5FCSH 5E7BA 1D5IL 3BEWB 4DJMA 4UOJA 5EH1A 2MHAB 2QLVB 4HS3B 2F53A 4YDLB 3IJHA 2BZDA 2F15A 3LEVL 2CLRB 5K9QG 2ZUQC 5E99L 5BRZA 4MNHB 1UFUA 4D9RD 1BJMA 5TDPB 3L3GA 4M5ZH 4H25A 5D5MA 4BFBD 1MCHA 2ZWLT 4O58H 3SGKC 2RJMA 3OR6A 4LU5L 5FUCE 3KPLA 4AIXA 4CW1A 1DVFA 5J6GB 2A6KB 5DD5H 3S88L 2NY6C 4MXVF 2DLFH 5BV7H 1VACA 4N8VG 3QUZB 3IJSA 4QRPD 4NN6C 3CLFH 3L7FA 4QRTA 3P4OB 4HAGA 3G6DH 1LE9A 4UV7L 3HA0A 5C09B 5SWSE 3H9ZA 2AJSL 2ZP0T 3TO4B 5FM4A 1A2YA 4WFGD 3LHPH 3IDIB 2A6IA 2WWMC 5F88B 3VG0L 2R0WL 2AJ3A 5LAXA 4EDWH 4I3SL 4GRWB 3S6CA 3MZGB 3FO9B 4HUKB 1E27A 2IH3A 2OL3A 2D7TH 3QXDB 3RDTC 3V95A 2J8UB 2CRMA 5K9JL 4P2RA 3LAFA 1LO5A 4FTVD 3O9WA 1MAML 1HIMH 3UC0L 1T4KA 5DVLA 3ULUH 5ENWA 1YDPB 4EIGB 4K94C 1SMOA 3DTXB 1ULVA 5EORH 3UJTL 1XAUA