5ABAA

Structure of the p53 cancer mutant y220c with bound small-molecule stabilizer phikan5149
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5abaA00
3US0A 3D05A 4QO1B 2BIQA 2IOMA 2FEJA 1HJCA 2BIMA 2PCXA 2AC0A 3WTSA 2J1WA 1GZHA 3WU1A 3VD0A 3WTWA 3Q01A 2WGXA 3WTVA 3WTYA 2ATAA 4IJTA 4AGMA 4G83A 1H9DA 2YBGA 1YCSA 4IBWA 5AOIA 1E50A 3KZ8A 3KMDA 1T4WA 4L0ZA 2RMNA 3IGLA 4IBYA 5LGYA 1KZYA 3IGKA 5G4NA 1TUPA 2XWCA 3QYNA 4AGLA 1LJMA 4KVPA 2BIOA 4IBZA 2IOOA 5ABAA 3WTTA 2J6WA 1HU8A 5AOMA 4IBVA 1CO1A 2J20A 4XR8C 3WTXA 4AGOA 4G82A 2X0UA 4MZIA 4IBUA 2XWRA 2X0VA 1UOLA 4LO9A 2H1LM 2IOIA 5AOLA 5BUAA 5AOKA 3D09A 2VUKA 2GEQA 1EANA 3D08A 3EXLA 4L0YA 1GZHC 4AGQA 5AB9A 2BINA 1EAOA 3VD2A 4HJEA 3ZMEA 2P52A 4IBQA 4LOFA 4AGPA 3EXJA 2J1ZA 3D07A 1TSRA 2MEJB 4AGNA 2ADYA 3VD1A 5KBDA 2OCJA 4GUQA 3D0AA 4IBTA 1CMOA 5G4MA 3QYMA 2J21A 2AHIA 2BIPA 4LOEA 4L18A 5A7BA 5AOJA 3US1A 3Q06A 3TS8A 1HJBC 4GUOA 1EAQA 5ECGA 4A63A 3WTUA 2J1XA 2J1YA 3D06A 1IO4C 2X0WA 5LAPA 3Q05A 5G4OA 4MZRA 4IBSA
chains in the Genus database with same CATH superfamily
5E1HB 5J1AB 4X7TB 4D9RE 3SKOB 4EZJA 1G87A 1ZTXL 4JPIB 4HIEA 3ZTJG 1GOFA 3BEWB 3UCQA 4QDGA 2X87A 3ZDXF 5E8PB 3FO0L 5DQJA 2YSTA 2G60L 5DRNB 1SXSA 3FL7A 4JFDD 1PCXA 4ESKA 1DQML 3FOMA 4KV5F 2ZSWB 5D72H 3MCYA 3TONA 3MV7B 3GTNA 4AUUA 4F1ZA 1WC7B 3HHMA 4IOSD 4KNUA 5DRZA 3NJGA 3DUSA 1OGAE 3MBED 2Q2LA 4D9RD 2DWEA 2CGRH 3RYMA 3FUDA 3HMWH 3W9EA 1G9NC 1NEZG 1KB5H 2BWIA 2IH1A 3FS9A 5G5DA 2XVLA 2NSMA 2O5ZL 3FQXB 3UROR 5CJ5A 5D4HA 1P0SE 4LIQH 1H5BB 1RH8A 3LY6A 1AIFA 1I1RA 4MZIA 1WK0A 4UIMA 2J73A 4IMKA 5FF6A 4C83A 1CBVL 2D7MA 2J72A 2NY4C 5AOLA 3O6MH 3VGBA 2XN9E 3E6HB 3GWJA 4PSRA 1OGAD 2XOTA 15C8H 3SDYL 1MFEL 1NCBL 1I82A 4B41A 3MRBB 3HBQA 2TSAA 1P7QD 3WHE0 4Z7WB 4L8SA 1XF3B 3VD2A 5E5RB 1AVAA 5JOPD 1D5RA 3UEZA 2P80D 3VRLE 4O00A 3ZMEA 5ESQA 2BNQA 2XV0A 3N42F 3P73B 4WJ5A 3SDAB 1LLAA 2O5YL 2VLRB 4LOFA 2F18A 3DK2A 3QEHB 5E2VL 2OTUA 1CLCA 4MHHG 1RZ8B 2PR9A 4LP4A 3QHFL 5BCAA 3GMMA 4X6FA 2JXMB 4MCYA 4KO6A 4CU6A 4GAGH 5I1KH 4F2FA 2IBBA 3PV6A 2VL4A 5KVEH 1XBDA 3RX7A 4G72B 1XIWC 1WFJA 3CXDL 4JZNA 3SDXE 1MF2H 2WXHA 2OSLA 1FLRL 4DGVH 4LGSB 4EE2A 1BJMA 3MHZA 2ENQA 2DQ6A 3GIVB 2B59B 2Z91B 1MAJA 5GRYA 5H35B 1OF0A 4P5TC 3E2HC 4UM9D 2GABA 3QG6B 1QNZH 4RMWA 5LO7A 4GUOA 3FTXA 1OK8A 2WANA 2WSPA 4MRCA 2AF2A 1MFUA 2DEXX 2V7HA 1ODAA 3QJUB 4YHNA 3WE6A 2WWOA 3BWSA 3KG5A 3T2NL 3O45A 5A2KH 2Y1AA 1RJZA 3K72A 4YEFA 5GS0H 4A66A 2EDHA 3K1DA 3EH3B 4PV9B 3TTSA 5ETUB 2Y4SA 2YD5A 4LOUC 4OF7A 5GS1B 1J9SA 3CLWA 4JG0H 3DGDA 4Z7OF 5D96C 1CE6A 4YHYB 1ID5I 3V4LA 3C9NB 4GP4B 3H55A 4DGYH 3WGUB 5CHNB 1FIGL 1N59A 1ZE3C 4M8VA 2BSEA 4HKJA 1W9XA 3ARSA 4P2OB 2AJYH 2DQMA 3V9CA 3NRPA 5LB1A 3ROLA 3VFTA 4A6YA 5J13B 1TZAA 5KWYC 2NYZA 5DZ9A 3KMDA 4DTGL 3HS9A 2R8SH 4WTZG 4OZIE 4AIOA 4WWKC 1JGVH 3CN4A 4Z7QB 4AUJA 2EYTB 3QIBC 5D2NB 1NCTA 3ZOAA 5IESL 4M7LH 1WBXB 3BP5A 3BPCB 5DJ0A 1UKQA 4IBVA 7TAAA 2HA1A 4J3TA 4OGQC 3Q1EA 5IJBC 3LZLA 4AKQA 3GSNH 4I85A 1T5XB 5C8JA 3QJTB 1NOAA 4FLSA 2WZ6A 3IDIA 2BVOB 1CLYL 5JIMA 3EO9L 3IVKB 1O6VA 1L9MA 3VXSB 1T1XA 2HJFA 2EZ0C 3TZVC 1XF2B 4L2LA 2HRPH 3GSWA 4EN3C 3AWGA 4NDMB 1RD6A 5IVZA 4ZUUA 3W5MA 1IFGA 4QRUB 2FL5B 1DO5A 4FRWA 1U91A 4XPAH 4BK8A 3WEMA 3ECBA 2XV2A 4PTUA 2AQ1A 5I76A 1XX9C 1CFMA 1CFVH 4C55A 1RZFH 1PLGL 4Y2DB 5I73B 4I89A 1DVYA 3DGCR 1FORL 3IRPX 4V33A 2ZKHL 1P2CA 3SGJC 4U6HA 3ZKSD 4I87A 1CCZA 2RBLA 4YSTA 4JO5A 3LEVL 2GG1A 3S88L 4J28A 1U2CA 4PJ5A 1UWGH 4LLQB 1KIUB 2BZDA 5IQ7H 1FE8H 2ZXWB 2HT4D 2UX7A 4JREC 4HUWB 2IMMA 2Z1KA 3MLXH 3NT0A 1IGTB 2D0GA 3WFHA 5EULV 2EIBA 1E5AA 3DGGB 3DLQR 5DLML 5I66B 2CUIA 1DVUA 3SEPA 3IKCB 2FNWA 2GTZA 3D06A 3NEOA 3QQDB 1R3IH 3IF1A 3GBEA 4N6RA 4Z9KB 3BMWA 5F6IC 3EJUA 2NXYD 2AJ3B 3KPNB 4PEEA 4HXAH 5C07A 3BUIA 4EI5A 1EMTH 2BRQA 3EYVB 2XA8L 5EC1A 1DJXA 3ARDA 1E42A 1A7OL 2A9CA 2WBJA 5CCKH 5LXVA 3SE3A 1MJ7L 3ZKXB 1NMAL 4XX5A 3MZGB 3MLVH 1PG7H 4FI7A 5EC2A 2B4CH 3CE1A 2HJKA 3QUHA 1A4CA 2DLTA 5IROD 4WHTB 1SXZA 3BPNB 3HE6C 2C3VA 5D1ZC 3RVVC 2CUHA 3L8QA 4LF3B 3CFNA 3MRNB 4DGIL 1I1AC 1RZGB 4NB7A 4TMPA 1S9YA 3QDGD 1MCOL 3KWXA 1H8NA 2GUOB 3L08A 3SGEH 4FQXA 2XZQL 3K2KA 3ULUE 3GRWL 5GGSY 2CR3A 3TYGH 5DURB 3MNWB 2OP4H 1PDKA 4XODA 1SFDA 5FYLD 2BVUA 1UGNA 1UA7A 2NQDA 3FNKA 1Z1WA 4G5ZH 1EZVY 4E9SA 2NZ1A 3PFUA 4L4TD 5SX5H 1EVUA 1N2RA 2IPKA 4Y5YB 4FQ1H 4GSUA 4R4FH 2XCMC 2HFEB 3X13B 5JZ7C 4N0CD 4JFYA 2F8XC 1QA9A 4FMKA 5EU6B 1AP2B 1NUGA 1NCDL 1N5AB 1F4XL 4NUJA 3A67L 3NH7L 5C0BA 3QUZB 4H5SB 1Z7JA 2OR8A 2X1WL 4ZNEE 3LKSB 2HMID 3LRSB 4F37K 3BN3B 4Y8AA 1WICA 1YMME 2HLAB 3BAXA 3CX5K 4LARL 1QI3A 5IVNA 2XZZA 4R4BA 1JHLH 1BZOA 5FA3B 5KAQF 2ZXBA 2FBOJ 1LP9B 1KPVA 3O4LE 1BFTA 3QO0B 3MROA 1OF2A 3TO2A 1XF4B 1KGIA 1J9QA 4QTIH 2IAMD 5SWSE 3GB7A 3IKKA 3PHQB 4PU2A 3GSXB 3EOAB 3QS2A 4IIQC 5C3IA 5D7JA 4XVJL 3T1FB 1UVQA 2A5UA 4MNQE 4FXGC 4HOWA 2Y7LA 4PJ8B 2DDQH 1IFRA 2RR3A 3CCHA 3I9GL 3MJ6A 4B5EA 4HIHB 3RIAF 5DTFA 1NA8A 3BPLB 3KE0A 3QHTC 3U46A 5T33L 4IYKA 3WEXB 3VX0A 4NZRH 2J44A 3P77A 4OZ4B 3WFZA 1SOQA 5D8JL 5HHQA 1P7KA 2WLNA 2VZOA 3BDYH 3QWNA 1A6PA 1G5AA 3DUHA 1G9MH 5AVYB 1WJ3A 5HHMB 2ZOLA 5JMOC 4G43A 1M7IA 5EG6C 3HZYA 3JVFC 3SQOL 5KVFH 4O5LH 4P59L 1C7TA 4KY1L 1BZQK 3I85A 3BWAA 5ENWB 1QFWM 5DRWA 4M6AA 5C6WH 2YD2A 3W0WD 3NCCB 5TPWL 1S8DB 4DEPC 5C1MB 3ZMNA 1AHWC 1RU9L 3O11A 3IRZA 1X7QB 2P8LA 5IG7A 5KYWA 3MRFB 2E46A 2VUOA 4N2FA 5IMMA 3I3BA 3HI5L 1X6LA 1SVZA 4HMEA 1N3NB 3CLFL 3WDHA 5E7BA 2PW2A 3SPHA 2YUVA 2XN1A 3LIZL 4HETA 1U8HA 1GKEA 5E5UB 2VB5A 1HHGB 5CZKA 2WKGA 3PUCA 3O3DA 5E9AA 3DX7A 2G3XA 5F89B 3BVWA 4TN9A 2APVA 5IB5B 4EDXB 3JWOL 3D4YA 1UFUA 1GCFA 3HMXL 3VXUA 1EDHA 5E8NA 3TN0C 5E7FA 5GJSL 4ADJA 4U1NB 2IANB 3C87A 3WLWC 2YAOA 2BP8A 1BX2A 3CDFA 1CF8H 3QR2A 3M1BB 4C57C 1JZ3A 1PCSA 3HB3B 1AZRA 3II1A 4JRWA 5TH2B 4Q0XH 5IJKC 2P3YA 2V2TB 1NINA 2C1OB 2PXYC 3TBVB 5K9QI 1E8YA 3QAZC 4Z78A 4YIQA 2ICWA 3HG2A 4BSVB 1PGRB 2YC1A 2Y22A 4BFOA 4Z7UE 3UMNA 2A7BA 3ZDYF 1N4XH 3F2LA 3EJTA 1KTDB 2EC8A 4NJAH 2FX7L 2E4FA 4WKZB 3AM8C 5D1QB 1JGEA 2DMKA 3GJEA 5DA0B 2NY4D 4GW1A 5F3BB 3IMTA 4URKA 1BHGA 2OMTB 4LSTL 2C3XA 4F7CB 2E6PA 4NQEA 4LDOB 2W9EL 4XNZB 1ZA3B 2JK5A 3GM0A 4PV8A 5HJGA 4E9XA 2MQ3A 4H4NA 3QXVA 2WWKT 5D7EA 4HEPG 5I74B 4OIAA 5IFJA 4IRJA 1CDCA 4FLQA 4CC4C 4X9YA 2NQCA 3FUIA 2DQFB 3APFA 3JSSA 2DMCA 2R56H 1T89C 2ZCKH 3CBRA 3PGCA 3SCMB 5AENA 5ALBH 3ZO9A 5AVSB 4U6YB 1SEBA 2ZOTA 3OX8B 2HYMA 4DQOH 3FTUA 4PY7A 1CPUA 3VRJA 2GT9A 1XH3A 2H3NA 1IGYB 5KAQG 3NIGE 3AY4C 3ROOB 4CC1A 1UUNA 4ONFL 4M9PA 4QO1B 3QDJE 4K7PX 2H8PA 4TUKL 4XNYL 5BZZA 2VLLA 2UY6B 1CE1L 1QEWB 5IB2B 3SE8L 3TIDA 2HRHA 4J3XA 1JDCA 1UYWH 1NQBA 3D69A 4AJYV 4KKPA 3MV01 1Y07A 1MJ8L 1KCUL 4I18B 1Z66A 2CO6A 5F6HJ 1OAQH 2B3IA 3PCYA 5FGBA 1E7VA 1VB9A 4XP6L 5FKAB 4G42A 3I9IA 1VGKA 1VGEH 1MFCL 5FYJH 1T83C 3EGXB 4ZT1A 1R5WA 5DJ6A 4BD4A 2IDSA 2G0KA 4Y2NA 1CYGA 5CILH 1T0MB 3S7GA 3NTCH 4JFFA 2DQUH 1VENA 1YUHB 2AXJA 3C2SA 3QSKB 3UJJL 3DSNA 3GKZA 3IFPA 4B96A 1G9NL 4BWTA 1D5BB 4LASL 4W4OC 4WWKD 1WAAE 4WAFA 1MQKL 4R83A 2EICA 3TFBA 3DMMB 2CBMA 1ZY9A 3QIBD 3QUMB 4AE1A 2IQ9L 2BNRD 3HUJA 2YPLD 3GMPA 1Q9LA 4FG4A 2MSPA 4YNYB 1U8OB 3QDHA 2MOGA 4JGUA 2MCAA 4LNRA 1PVHA 1XGYL 4CMMA 2YOAA 4CKQA 5LG6A 4JQVC 3OAUH 3EXJA 4X99B 5IVXE 2YMOA 2SEBB 1AMXA 2FH8A 1X4YA 3HG1A 1MCRA 3BSZL 4O58H 4WU7B 3U7AA 1YEFL 1VKXA 2FH6A 2EZ0D 3TZVD 1MCPL 5CU9A 5HHNB 2EH8L 5F7KC 5CD3A 3MPCA 3PLYA 35C8L 4J3OH 4X5WA 3WS3B 3HG5A 1T2XA 4EZMA 3BAYA 1YYCA 5DZAA 3ZX1A 1C5DA 4LLVB 4AQ1C 2VXVL 1JDAA 4F7EB 1LO3H 2R4SH 1B6DA 2Y7OA 5EBWB 2E74C 1N6UA 3HEIB 1VACA 4PRPA 3FO9B 1RLWA 3MUY1 5H37G 4YXHH 5C2BL 4NN5C 1KBKA 5LAXA 3X1FA 2FEEI 4JY4B 4PWJA 2YWYA 2YD4A 1I7ZA 3RY6A 3CN3A 1EJ6A 1Z5YD 2Q8BL 1JZHA 3NCFB 4X5XA 3ORJA 2X88A 1RLBA 3PWVB 4AQ8C 5HHVL 4AQZA 1GTFA 1U92B 1UB5B 2UX6A 1I8LA 3U4KA 4MAYA 1LWRA 3FSVA 2X4SB 1CQYA 3EBIA 3VXTA 4F3FB 3BUPA 1UOKA 1YPZB 1K4CB 1A6UL 3N2JA 4P23B 4IGBC 3UOAB 5C7XH 4ONGH 4PPTA 3QWRD 1P9MA 4QXVA 2VDMB 1BAGA 2R39A 3MRDA 1KIRB 2Z0UA 4LEOA 4JRLA 2OMNA 1CIDA 4D9QD 1X5IA 4AVJA 3RDTC 3FT0A 3VQLA 3JWNE 1WITA 2DD8L 2VERA 4DAGL 4BFGA 1JXJA 5IB4B 5J3HD 2ZKYA 3ERXA 3B43A 1IBFA 3QWOA 5CCGE 5IFHL 3DRQB 5IZ7A 2VC2H 3K0WA 3N1PC 3BYTA 5J1AA 4TSAH 3ETTA 4LCWB 4ODXB 4HBCL 3LX9A 1I1AD 4JPIA 3LOWA 5JYLA 1A7NL 3BEWA 5ID1B 2BRRL 2VMEA 5I2IB 5E8PA 1PAZA 1I8UA 4RMQA 5DRNA 4Y4HC 1KPUB 3HNSH 4M1DH 1CGXA 2ZSWA 4R96B 4BA0A 5T3ZL 1J5OH 3MV7A 4L8CB 3LB6C 4OUOA 3BSGA 2ZAHA 1XTLA 3GLZA 4AJ0A 4U1HB 3ZE0F 2Y5TB 1GH7A 4GRLC 4ANKA 2Y0SA 3UTPE 2YUZA 2OZNA 1NDGA 5CGYD 4BKSC 1Y0LB 5H4YA 4ZO6A 5AYUH 4EN2A 2BY1A 1H3GA 1UQSB 2RALA 2WUBL 3U36A 3FQXA 5EA0H 1EHXA 3TM6A 1H5BA 1EFQA 4RRPA 4XBEL 1F11B 2GEEA 5D5MB 2EQDA 3AT0A 5K59F 2LVCA 4G6MH 5B1JC 1CL7L 4JO2H 5J1SC 1JPST 3N43F 4XMWA 4QXUH 2AV7B 4G3YL 2HLFC 4TVPH 5A3IC 3IXAB 3E6HA 5FW8A 1UEMA 3KWWA 2NX5D 5J6HA 4TF4A 2WXMA 3MRBA 2J1XA 4Z7WA 5IVOA 1J05B 1JNLH 3PAYA 4YE0A 4W9LC 4ENZA 1A65A 2F8OA 2X6UA 1TZ8A 2CXKA 3IDYC 5CZVH 3P73A 3SDAA 1S7RB 2W0LA 5AVXB 4G1EB 3BESR 1NICA 1VHPA 2VLRA 3QEHA 1E6JL 1V3LA 4GH7B 2Y7MA 1MCNA 1RZ8A 4G11A 1P69B 4FLHA 1F6LL 2WQRA 5EUOE 2Q10A 4YLCA 4WSJA 2JXMA 3DPBB 2YA2A 1XH2A 2BSBA 1UXMA 5AZEH 2VMCA 3LH2H 3G08A 2K3TA 1KBGL 3AGWA 4GXVH 3C09C 4GRWE 2IADA 1RZKH 1F8TH 3GIVA 1ZTMA 3IN0A 1YEEH 2FJGB 5H35A 5D4IA 2ENYA 3QG6A 5C71A 3THML 4FQJH 1HT6A 3ULSB 5L2KE 3F3HA 1PU0A 1TJIL 5IUCA 4V2CB 1AQKH 2QQLL 5L7XL 3SPJA 2DBLH 2OI9C 5CAYB 1TQVA 1A9BA 3ZUCA 4UTAA 4HKBB 2J5LB 3G7TA 2ZOWA 3BC9A 4AGOA 1MHEB 4NQVB 1E6OL 4HA1A 3VGHA 3H2WA 4BRJA 5T3XH 5ETUA 3RPBA 3FPXA 4O2FA 4Y4KC 2JKXA 2LAAA 4WW2C 5BV7C 1RIVH 3DYOA 3I84A 1AKPA 2DYSB 2WTRA 4PRHE 3RAJH 1NFIB 3P4LA 3C9NA 1RZ7L 3PV7A 4UUJB 3EFOB 3ZHLA 5BQ7B 3AT8A 2QR0A 3TN0D 1E4WL 4P2OA 1QLEH 3MYZA 2XWDA 2JV6A 2F8VA 5I71C 3NA9H 2A9ML 1HXYB 2EDKA 3VI3F 2QELA 4Y9GA 4BKLB 4IBQA 3LNDA 4XCFH 2AI0H 3B4NA 2EYTA 5C0ND 2PXYD 3LRHA 1A7QL 2CGYA 1KCVL 1XGTA 2DMGA 3BPCA 3TBTB 2WB7A 3IPEA 3KPRE 4UT9H 5JW3L 2OCJA 1FL5B 3KYNB 2B8OT 1QLFB 3IMWA 5FGCE 5CFAA 1DSWA 1JZ8A 2VR6A 1FWXA 2KUTA 1T5XA 4GEJA 3LSOA 4ZXBB 4PJFF 3TNNB 2HP4A 5A16B 2BVOA 4F2ME 1OSEA 2F68X 3U1PA 2F2HA 3IVKA 1M9WA 4EPSA 5AVTB 2DQTL 2QDVA 2QSTA 3VXSA 3I6LE 2NSXA 3KLKA 1HEHC 1XF2A 1VLXA 1QX1A 3AW5A 1JVLA 4HH8A 4D9LL 1ZLSH 3FQRB 4EDWL 1HZLA 3K4DA 4F7PA 1WUNT 5SV3A 2WVVA 5TQ0H 4BXSV 3D34A 1IAKB 4HWNA 3ZE2B 1QSVA 4PJXB 3ULVC 4HPYH 5DJCB 4XNDA 2TSBA 3CQPA 1XCWA 2BSCA 5L9DL 1NGXB 3ZTCC 4PRNB 2YO3A 3QUYC 4NKMB 3FB6B 4DP2X 2WGXA 4JRYB 3STZA 2VLKA 3ZKQD 1DE4B 1KIUA 2RCSL 1CT8A 1S4IA 4HUWA 4AENB 5I1GL 2AAVA 2FDBP 3HA0A 1UWEL 3SD2A 1O7SA 1IGTA 2AK4D 3FRUB 4HKZB 2HT2D 3DGGA 2X05A 3QCUH 1TEYA 5A6LA 5DHVH 1G1KA 1IBGH 3IKCA 4W9JC 2XICA 4MMYB 3KGRA 4G7VH 3KM1A 3ZL2A 4KITB 4ELKA 1IM3D 4UV7L 1YAIA 2QJDA 3LN4A 3QQDA 1A7PL 4KXBA 2I69A 5F96H 1UKSA 2F58H 1E30A 3KPNA 3L3GB 2AJ3A 1TEGA 4KOBA 4WI6A 3SYQA 1T1WB 3ABLB 5F7WC 3EYVA 4Z18A 4PMFA 3D4GA 1DJYA 1H3UA 1VADB 2EE3A 1E9PB 4KH9A 5GZOC 2MQCA 2AQ3A 3LMJL 4OZGF 3GPSA 3V7AE 5EZLA 3D8MA 1T2QL 3CZJA 1CFNB 4WHTA 4DZBA 3ETBF 3IU3B 5MP6H 3L3IB 1JXKA 4Q6KA 4LF3A 1UWFA 2R2BA 3MRNA 3S97C 1RZGA 1N5YH 4PM1A 5B7MA 4P49A 1FDLL 2GUOA 2CDEB 3NOIA 1GL4B 1TQBB 4MB5A 4AGPA 2JJTA 4W68A 4WV1C 3GC3A 5CGMA 2FATH 3MNWA 2ED8A 3E9TA 3J27A 1PYWB 2VXSL 4HW6A 1IGFL 5F7YC 4RGMC 2IFGA 4PRID 4CGTA 3GSUB 3EZ8A 3I75B 5D7SH 2O5XL 1OP3K 2IF7A 4BCZA 2HFEA 3X13A 3OB8A 4QGTA 3RWJB 1YC8A 2EDYA 3S36X 5JHDA 4NUMA 4N2IA 5E9DE 1AP2A 5EU6A 5I75C 2EUVA 3KVPA 3WFEL 1N5AA 3S96B 4LCUB 1K6QL 3CMOL 3A4DA 3QUZA 4GMSH 4H5SA 4F5CE 3LKSA 3L17A 3LRSA 2OJEB 4B9CA 3MRIB 2HLAA 1ZGLA 4DETA 5FA3A 1UUSA 1VCBC 2YD9A 1LP9A 3PIQB 4KJYA 2LTQC 3AXHA 3Q05A 4N8UA 3QO0A 3QT2A 4Y9CA 5A6MA 1XF4A 3V8OA 4ENEC 2O61B 5LBGA 1AFVL 3PHQA 1G6VK 4M7KL 4QNPF 3TFKC 1KULA 3RE0A 1EZLA 4ERSH 2DLGA 3T1FA 3HTLX 2NCEA 3GXDA 5KZCB 4ODHL 2F0CA 1NGQH 1ZHKB 2XQBH 1QHQA 3CVBA 4K3HA 3CSFA 4P0DA 3GO1L 4D94A 1ROCA 4FG2A 2FWOA 4TNVF 2C7FA 3ZDZE 1AOZA 3MRKB 4G8AC 5F0PB 4A04A 2YAMA 3QB7C 5E5LA 3RRQA 4MMXC 5ESAB 4HQQL 4JFXB 4YDVB 3WEXA 5I19H 1L7TH 3B37A 1YC7A 2PO6C 3POHA 4HUMB 4D7PA 4X6CE 3VQ1C 2OULB 4OZ4A 4XBMA 1DBBH 4CVWA 2O6CA 1H3WM 4JFUA 4M7JH 2DIJA 5D1XD 2Z34A 1YEIH 3NFNB 1GZQB 4R5TA 3V0HA 2ENSA 4PWGA 3O2WH 2R59A 1CICA 4XZUB 1XR8B 5ENWA 5IWLC 4BWWA 4CSTA 5I8OH 2MOQA 4HIQA 4IGBD 5FWRA 1KJ2B 2F61A 5E4IA 1NH6A 1SHMA 3NCYS 2D31B 3MV9D 1S8DA 1Q0EA 3DX6B 1OHZA 5IIEB 1A66A 1F1GA 1YY9C 1EEZB 2N0MA 2V6HA 1C5BH 1X7QA 4N0UB 2HTKC 3MRFA 4LPVA 4UTAH 3I6SA 5JIIA 4XB8A 3RDTD 2JQAA 2EDMA 3FUFA 4UYQA 3OC8A 1HH9B 4MAUL 3ZK0A 1NJ9B 3U7YL 1N3NA 2NY7L 2KL6A 4BDVB 4EXPX 1ODUA 4AGQA 3Q8CA 4LPTA 4NYLB 4XX1E 1L6ZA 1OARH 3PNWB 2AABL 2W9LA 3IPBA 3TJHC 1HHGA 4P46B 2AXGA 4IMKC 3V4UL 5TK4A 4EDXA 3EYSL 5IW1B 5IB5A 2QPDB 1P4IL 2JI2A 2G2PA 5GRUL 1NMCB 3CPUA 5JPMB 4OZHE 4Q6IC 4G7YL 1A3RH 3HG0A 5BXFB 3GS7A 4YHKL 5HJDA 4JY5H 3VD1A 3N04A 4U1NA 1O9WA 1GOHA 1MHCA 5SWZA 1PTZA 2RD0A 2G2RB 3GUFA 1KACB 4KY2A 4N20A 3CVDA 3M1BA 3SYOA 2WXOA 3AMLA 3VFMB 1YYLL 5A7BA 3L5IA 3ARTA 5CN3A 5TH2A 4ODTH 5HYQA 1EO5A 4GRLD 5JTWA 4FFZL 5HXMA 5EOCJ 2C1OA 2XTJB 1BOYA 3C12A 5DUJA 2Z8WC 2AV1B 2VIRA 4HUKB 3P9MB 4A63A 1IZJA 4DNLA 4P3WA 4BSVA 4ZS7H 4KKLC 1J0HA 3BQVA 2LU3A 1F4HA 4BINA 1QWNA 3NCMA 3Q44A 1KTDA 1NC4B 3V5KB 4HPHA 2NOYA 5I1AB 4PJHE 3MAWA 2VDRH 2HVKA 3LN9A 4WKZA 5D1QA 5GGVL 3V7MA 3W1ZA 1IM9B 1FNEB 1U8LB 3C75A 4H88L 3WNLA 5F3BA 5EDXA 2ZUTA 1B2WL 2DWDB 2HLFD 3QISA 3A21A 2OMTA 3PWPE 4NHCL 5DC9B 4PP2B 1M6OA 4XCYB 5AAMA 3SDDC 3ZMRA 5DFWH 4NIYE 3VSQA 1ZA3A 1U8KB 1EH9A 1JZ6A 3PJLA 5FWQA 1Z9SB 3LS4L 4JO1H 2YK1H 3FJTA 4M5TA 5F88B 2PUQT 3WG7B 1XWVA 2H41A 1AHMA 2Y3AA 2DQFA 5DDHB 2OL3L 4OLYL 5IW3A 2YD8A 3V4PB 3DJZA 3SCMA 4JPQA 2KC0A 3L4CA 4U6YA 4FXLA 3OX8A 2DQEL 3TBYA 1IZKA 2W95A 1IGYA 5DJ8B 4R7DB 3QK0A 3ZYOA 3HI1A 2BXYA 5IB3B 3PQYB 1HSAB 2BC4B 5LGHL 3ROOA 5EEVA 1ZTXE 5DJZA 4QO1A 4P2QB 2UY6A 1QEWA 5T1LD 5IB2A 2XWBB 1ZS2A 2A4EA 4GQRA 4RMUA 2I5YL 4UTBL 2DQGH 3KDPB 4NQQA 5I5IA 1K2DA 4HV8B 3RU8L 5F9JB 3QZWA 4I18A 3VI4E 3BUTA 1Q1JH 1BPVA 4YPJA 5GSRB 5DMKB 1UD8A 1IT9H 4JQIA 4P3CL 1NIFA 1YUKB 4L1SA 4Y5VB 4P2AA 4WWPA 3UBFA 1KCSL 5I26A 3U6XS 2B77A 1X5ZA 4KTDH 3L3HB 4Y4KD 5FKAA 2AKRB 4BQCA 1RUKL 4M3KB 3VM5A 4RETB 2ADJB 2GJ6B 4OJFH 5C09E 5FPIA 3UBHA 2NY6C 2N7AA 2G9HA 3EGXA 4KRPB 1K8DB 1R3JB 3GMQB 5E1IA 1BF8A 4LU5H 3RGVB 1T0MA 1A8JH 4ELMB 1VESA 3GBML 3NP4A 3UX9B 4FTVE 1DVFA 5F6HI 3MRPA 2CMRL 4YHOH 1D5BA 2RIKA 2YLHA 1E40A 3MOBH 3TH2T 1RULH 4XN4A 3VGAC 4PJDE 1IE5A 3DMMA 1GS6X 3P0VL 3KEDA 3HI6H 4QHKJ 4HS6B 3UBXG 4IDJH 1UD6A 2Z7YA 1ZCRA 4HC1A 3B3BA 3H9SE 3NIDE 4YNYA 4A55A 4DN3H 1J8HE 2XT1B 1RMFL 3DXAB 4YGAB 2K1MA 1D3CA 4FTVD 2X40A 4UT7L 3V2AR 4X99A 1G9HA 3QDMD 4M56A 4A2FA 2SEBA 2FEDC 2A1WH 1JTOA 2R4RL 3FCUB 2PCXA 2CDGB 3LKOB 4XHJC 4WU7A 4LP8A 4PS4H 5AZUA 1QSZA 2VDNB 3NK3A 3I6GB 4G9FE 4HD9A 4NKDB 2XZAL 3VXNB 1R0AH 4JFDB 2AFNA 3AAZB 3CVHL 4LRNL 4RSVA 3WTYA 2BP3A 1LO2L 1MXGA 1NBQA 3TT3L 3WS3A 3U7WH 1I85A 3S37L 1ZLWK 1KCWA 4W70A 3ESVF 2YPKA 4L4VA 3IETA 5KVGL 3MBEB 3MJ9L 4F7EA 2J7LA 2X7LA 3P3SA 1WGVA 3ARDC 4YSSA 4GKNB 2WBJC 5EBWA 3SE3C 5L8KB 3QUYD 4K07A 3FO9A 4AGLA 5BVPL 1H15B 1S7UB 4JY4A 3QEQD 5E6YA 4FXKB 1KV3A 3FT2B 5AAWC 3QFGA 2CK0H 1UH2A 4MXVE 3PWVA 4KKCD 3FFCD 2NSQA 2UVEA 1U92A 1UB5A 3H42L 2OXGB 5TQ2L 5MENA 3V5DB 4JZJB 4I1PA 1AQDB 1OGAB 3VWKB 3N41F 2X4SA 4G6JH 3QJRB 4W9DC 4YO0B 4L05A 2Y2TA 1B4JH 3VFOA 1WTGT 4F3FA 1KB5L 1LO0H 3APDA 4ETQB 5J8OA 1TJHH 1YPZA 1K4CA 4P23A 4L5FE 1D9KA 4JL1A 4J5VA 5BV7L 4LIQL 5D7IF 2B2XH 1KIRA 2VDLB 5E8OB 5BRZE 1CG9B 2EDQA 3FUJA 3GHBL 3GTVA 4S1RL 3A4AA 4LCYB 4P9HC 3U82B 3TPKA 3LZOA 1IAIH 3TPUB 5FGSA 4OLZL 5D55A 4RFOH 4UQAA 2O1AA 1SYSB 4LVOC 4AGNA 1HQRB 2XJKA 5IB4A 3WIFB 3V6OA 15C8L 3J7HA 5FIEA 3DRQA 1ZJAA 2F19L 2X9XA 3CV5A 5A2IH 4LCWA 1GYVA 4ODXA 4U6XB 2ZD0A 4JDVB 1TTUA 4JUTA 3N55A 3R1GL 2XRAH 4UM9B 1BLIA 2H5UA 3F7VB 1QQDB 1KPUA 3LH8A 4Y9FA 4N0YL 4S1SH 3U4EA 4TQHA 1MN4A 5GXBB 1VFBB 3BFWA 5DS8B 4LVHB 4R96A 4EIBA 3UC0H 3GMNB 4GAGL 2O6DA 4HS8L 4L8CA 4DW2L 1MCWW 3D51A 4F57L 1WAEA 4ZMZA 4ADGA 4P5MB 2YGQA 5HYJA 4YBLC 5KVEL 4EUPB 4OW6A 3WKMH 2Y5TA 4M5SA 1A25A 4XXCA 3MGTA 3RVWD 5KN5B 1NAKL 4FADA 2CBPA 1Y0LA 1QFPA 4YDJB 1X9UA 2MIZA 2Q76A 1UQSA 2ZZUT 3C5ZC 3KPSE 1G4RA 3HNTH 2WM0A 2JCCB 3L5WB 3LCYA 4M8QB 3S5LB 1NDMB 2NTSP 1IVLA 1V8HA 1PLAA 2OMUB 4HF5H 2WXNA 1F11A 4KK8C 4MJID 5D5MA 4JHAH 3DIDA 3ULVL 2WLYA 3IDXL 3C6LC 1SLWA 4DP5X 3PGFH 4ENED 3L3OC 1ZVNA 4HIXL 4FE9A 2ZCLH 3BKML 1U8QB 2AV7A 2L8AA 1T4WA 1TLMA 5KG9A 3L5XH 3HAEB 3MLSH 1CYXA 1QMUA 2WWKO 3Q43A 2ZWZA 2KZWA 4UINH 1LJMA 2JJUA 1J05A 1TTCA 4JBSA 4X4YB 1MJJA 3TGXA 3SPCA 3ZDXE 4DGYL 1SHXA 2QKIC 1S7RA 1I8AA 3MO1B 1S7WB 4G1EA 4HWZB 4N24A 4M8RA 3L3DB 2A74C 3AS2A 4TNGA 4KV5E 4QRRD 2AQPA 3CX2A 5KSUB 3GXFA 4WNSA 1ZT4B 3DPBA 5TTRA 4EZKA 5JORA 4B60A 1KDIA 1R47A 3PWLB 2C9SA 2XX0A 3BPOC 1RZJH 4DP1X 5GS2H 5HHXL 5ICXB 4OZFB 4YHZL 3TL5A 1OP5H 4M7LL 1QVOB 1FNGB 3UTTD 3BZDA 1CB4A 1WIUA 2H1PL 3FUKA 5CCJA 2N7BA 1B88A 3I02B 4PBDA 2FJGA 3OKMB 4U3SA 3TCLA 4XPFH 4ZFOB 4NQXA 3ZL4L 2YGVA 1A4JB 4RGND 4AMKH 2YAQA 5AW3B 3GFUA 4WI3A 2PWGA 3M1OA 4E5XG 3ULSA 4HX1B 2MQ0A 1W2KT 2QHRL 1FNFA 3LNIA 3H0TA 3FF7A 4HKBA 4MCZB 4WK2B 4WI4A 1IEBA 4NQVA 3BW9B 1MREL 1XO8A 1XV8A 5MERB 4DCQA 6PAZA 2MPAL 5CUSL 2P5ED 3MLTB 2ARJQ 3QJFB 4MJHA 1JV2A 4EIGB 1F4YH 1NFIA 3T3PB 4CJ0A 5I1CL 4ORGA 25C8H 1KIQB 1RZFL 2F53D 3EFOA 4UUJA 4PP1C 2FECL 3EUDA 4H20H 3TVMC 4AIEA 5BQ7A 4K3EL 1XAKA 5DVLA 4J12A 3ALXA 5D2LF 4LL9A 3DWTA 4DH2A 5L4JA 4R4ND 1HXYA 2NXYB 1UWGL 1M3JA 3BDBA 4GBXB 2Q86B 4IRJC 4JGJA 2H47C 4MB1A 4XPTH 4BKLA 1FE8L 5IQ7L 5E0FA 4J39A 4QHLA 4IKIA 4OCYH 1IFHH 3VD5A 5T5NF 2XFXB 2WVSA 1OM9A 4XB7A 2B16A 3DECA 1KXQA 1GZHA 3UABA 3LYRA 1QG3A 2Q3AA 3WTWA 4EZLA 1FL5A 3KYNA 1YZZA 1QLFA 4KKLD 5C0AD 4OLVH 1TZHB 1J1XH 1B0RB 3F58L 2EE0A 2CHWA 2NY3D 2BOLA 2R0WL 3KS0J 2VJXA 1UM6H 3J2PA 5TE4H 3TNNA 4ZXBA 5CR1A 5A16A 3QDGB 1QPPA 4GXUN 5EU5A 1FNLA 3FN9A 4RQQB 4HXAL 1U4FA 4X4XB 3BP6A 3WMQA 3SDDD 4K7PH 2EDWA 5F7DB 1IC4L 1ORQA 3HC2A 3AACA 4UU9B 1MIMH 3MLVL 1DJGA 4QRPE 5DFAA 1GY2A 4L4TB 1HU8A 1SY6A 4W9HC 1FYTD 3FQWB 2NW3B 5TF1L 1ED3B 2AW2A 4HZLB 2VZVA 4FQ2L 4PJXA 3F7YB 4HJTA 3GMRB 3SO3C 1NGXA 5IJDC 2A0LD 2HKFH 3ESNA 4PRNA 4LLMB 4OU3A 2VYRE 4NKMA 3FB6A 3TLRA 3BUYB 2VUKA 3C6SA 4JRYA 1ADWA 1U6AL 3RJOA 4QKXB 3QFJD 4E36A 2GBTA 4V2BA 4X4MA 4AENA 1JK8B 5DI8B 3GUTB 4FCAA 2IAMB 5EBMA 2NNCA 4XHQA 3FRUA 4FQ1L 5C0DB 4HKZA 4TL5A 2GVYA 3P3RA 4FQLH 1EERB 5F8QC 4NLAA 3QJXA 3ZGIA 1YNTB 4WDIB 2VDMH 3X1BA 3UZVB 2J6EA 5J6SA 5HPOA 4RFNB 4HS3B 3X17A 1UD5A 2YGPA 3L3GA 1JHLL 4MMZB 3HNVL 2DMBA 1T1WA 5MI0C 2PYFB 2VLJA 2A6DB 1NIDA 4LCVA 1VADA 2ESVD 2UV3A 3EHBC 1E9PA 1R4XA 3GBNL 2CCWA 1FFNB 1VEOA 5FHAH 4JQXC 4PJ9C 1U3ZA 2QVMA 2FJHA 2P42B 2WSKA 3OKKA 2NY6D 2K4AA 1AGBA 4MFHA 4PHXA 1PLCA 2EP6A 4JHWH 3HC0B 4D0BB 2DIAA 1RV6X 3EIFA 2CKBB 3L3IA 2DDQL 2FUQA 5LAPA 1OHQA 3JBG7 2YQ3A 5B39G 3W0WB 1OTTC 1J10A 1ZT7B 2YMXH 3G5ZB 3QUGA 4X80L 1IC1A 2H9GB 4NZRL 2VWEE 2X89A 4J3OF 3KL0A 4FNRA 2VH5H 1PYWA 1AO7E 5BJTB 3BDYL 4O2EB 3M17B 3X1NA 2G3ZA 1G9ML 2JCWA 3GSUA 3RB7A 1L9RA 3I75A 4U2YA 3WIAA 5IMKA 4Y1TA 1IUZA 3TT1H 1EFXB 1BZEA 1RJYB 4KAQL 3QHZH 3RWJA 5ESVB 1MEXL 1EV2E 2I9LB 4U1IB 4LCUA 3VWJC 3RY6C 4U3CA 5IP4A 2P5WE 4QOKE 4XHJD 2OJEA 4JE4B 4LMQE 2Y1ZA 4XPBH 3BFQG 3MRIA 1JE6A 5HHOE 4MVBC 5L8JB 3QUXA 3CVCA 4XPHH 3U48A 2DKMA 4WO4B 4YK4B 1KTKE 1W0VB 5K1NA 2BIOA 2BVPB 5JHLA 4XBPB 1RURH 4GRWH 4DSYA 5AOMA 4POZC 1UHVA 2EEFA 3INOA 1NCGA 4K8RC 3NJFA 5HVHC 2O61A 3IDMB 5DSCB 3G04A 3GJFA 1P9MC 3QQNA 3QZMA 4F24A 1KXHA 4LSVL 4MZ3A 3UGXA 5CM1A 1ZHKA 3SOBH 2IMNA 3QPKA 3BE1H 2E56A 4H8VA 4LESA 5T5NG 2NUTB 5E1AB 2ADGB 4N3TA 1HDMB 4FXTA 3RWGB 5CR8A 3MRKA 1Q9WB 4A6YL 2V2WB 5ESAA 4I4WB 4JFXA 4HWEH 2CQVA 3P3TA 5KS9B 4HWBL 2FBRA 4JO4L 3V0DA 2NY4B 4JFZH 2PTVA 4I3RL 1RHFA 3UTQB 4ZX4A 1XL4A 1OTSC 3NFNA 2XIIA 1GZQA 1MCFA 3Q6GH 2VN5A 3ZRSA 4JM2B 4XZUA 1XR8A 1YY8B 4BGDA 1UXWB 3BZ4B 4OY9A 1KJ2A 2F54E 5CINH 5CS7A 2D31A 5IIEA 1S5IH 3BWUC 3KPOB 3QPXH 3WD5H 5I1JL 3A6BH 5DMIH 3P40A 1EEZA 3SYCA 4N0UA 4K5LA 4K3DL 1PZ2A 3OVUB 1FH5L 3NJIA 3WFCH 3WELA 4Q9QH 3F5WB 1NJ9A 2JELH 2JVUA 3FQUB 4FFYA 4M1GL 3VXOB 4NYLA 3PNWA 1F2QA 2DIEA 4XMXA 1J9CT 3VB8A 1ASPA 4OIIL 4G70B 4P46A 1C8PA 1O7DC 4XGZB 4MXWL 2ADIB 5F1IB 4DKFL 5I18L 2JKLA 4Y4FB 3U1SH 4FQCH 3I3EA 5DFVC 3QI9A 3N91A 3OKDB 4YMPA 3F65A 4X0NA 5JPMA 2ZCKL 5DD6B 4RWHA 5BXFA 2BOBB 2R15A 2E7LC 1HEZB 2IWEA 1NDTA 1V5JA 1FO0L 3ZKMC 1WT5C 1HNGA 2YPVA 3DVFA 3VFMA 1QR1B 4PVBA 1BF5A 1NANI 4LLYB 2EDEA 3NIGB 1Y6NR 1NCAH 2WB1A 4R3SA 2N3JA 3NCBB 3TTYA 3KXFD 4AEEA 4ZD3H 1UM4L 2YEQA 4X4KA 3SDAC 1FNSL 1BFOB 2VDPB 5DVOA 3VQMA 5TE7L 5C0RH 1H9VA 2RMNA 3NPZB 3QDJB 2TRHA 12E8H 4PJ7F 2DL2A 2HVBA 1A0QH 5D96B 1BQLL 2AV1A 2VDKB 3C5ZD 4KRMB 2LFEA 3P9MA 3V0GA 2UWEB 5F71A 1OCWL 1UYWL 4JDZB 1FRGL 5CFHA 1X5XA 1F18A 4KK8D 3HE7C 3BLKA 2K8MA 3FKUS 4U31A 3C6LD 3MV8E 5I1AA 1JZ5A 2PYEA 1CS6A 4BGLA 3GKWH 1FNEA 1U8LA 3L5HA 4L29B 4WWKB 1QABA 1CC3A 2DWDA 1Z9MA 1M57B 1D6EB 2D4FA 4PP2A 5EWIL 4GT0A 4UQCA 4XCYA 3QIBB 3NZ8B 3VG0H 3QA3B 2BNRB 2DQHH 2QVFB 1OAYH 1U8KA 4J3OG 1IGMH 1OSYA 4ZAKA 2R23B 4IS6B 4YDKL 3EOTL 1REIA 1HWWA 3RGHA 3PAVA 1Z9SA 5FYJL 3F00A 4I13B 1ZEAH 2WCSA 3MJGX 5CILL 3RX8A 2FX9H 5DDHA 2Y06L 3MYJB 1GSMA 2OW7A 5E2UL 2IGLA 4XB3A 3V4PA 2YZ8A 2B5IC 4Q4EA 1GKOA 2DWTA 3NRQA 5GS1C 2HPTA 3DK0A 3TZVB 1KSRA 4M93B 5DJ8A 2J8UE 4R7DA 4DOHE 5CP7B 1DQLL 5IB3A 2G5UA 3PQYA 2BC4A 4JFVA 4P2OC 1KCBA 4JFOB 4P9HL 4P2QA 5J13C 1G7PB 2IIJA 4RFEB 2XWBA 3QEGL 1RQ5A 5MHSD 4NRZA 3VGDA 5DQ9B 2J6EH 4Q74A 4Z3FA 4PUBH 1OWWA 3GIZH 4JFHE 4ZMPA 4XMUA 4HV8A 4OIBA 5D2NC 5ILTL 2BJMH 2ZYIA 4K5MA 5T3ZE 1FNHA 1F00I 2PWDA 2W07B 1QFWH 2F74B 3T04D 5DMKA 3DVGB 5GSRA 3SGKC 2AANA 4O02L 2GY7B 3EKCA 4KNQA 1Q8MA 4Y5VA 5I1DB 5AVRB 1P1ZB 4JREB 1BD2D 4U1KB 2I07B 1V3JA 3L3HA 5I8KL 2AKRA 5FV2A 1JXDA 4Q58C 4OJYA 4GG6B 4XAWL 2ADJA 2GJ6A 2MHAB 3JTBA 3P30H 1HXMB 2FD6H 1K8DA 3CQFA 1R3JA 3GMQA 4PP1D 3TVMD 3RGVA 1LE9A 4ELMA 4PJBA 3WAKA 2B1HH 4RMBA 3S3PA 4YXHL 3D18B 1JF6A 2D3LA 2E6JA 5DHDA 4N9OB 2ZJSL 4LLUB 4JPKL 1QTPA 1JNJA 4WRLA 3DJRA 1JYVA 2H3KA 4JVPA 5GGQH 1ZLWH 4GIOA 5GRJH 1D2OA 4IHBA 4HS6A 4Y2DC 3KW8A 3B7YA 4IU2B 4XMZA 2Y1YA 3DXAA 3FONB 2MKLC 5CN1A 4BFFA 1EBPA 3ZZ1A 3O3UN 1CD8A 4YHMH 1T1ZB 1I1AB 4F33B 2Q5BA 1WFTA 4ONGL 3Q3GB 1KDJA 5FA4B 2N0KA 3LKOA 1SJHB 3BGMA 3DHJA 1A9VA 3QW9A 2F5AH 3L1FA 1E5BA 4HHAB 3VXNA 4OT1L 4NKDA 4JFDA 5F7UA 2YS4A 3AAZA 1GYUA 4N85A 3EH2A 2NYYD 1HHHA 4JRXD 1CD9B 3GJFH 1RUAH 2YIHA 4IOSA 1DJIA 4EIZC 2ZPKL 2H1XA 3KCPB 3EF4A 3ISYA 3LZNA 5GISL 1ADQA 1WIOA 3MBEA 1EJOL 4TSAL 2O93L 1ACZA 2IWGA 3OLGA 5DO2C 4GKNA 4WUUD 4B0MM 4J8RB 4OGYH 2C26A 3ZKXC 2ZNXA 2BSSB 3D9AL 1U0QA 3QG7H 4N68A 4TNWK 5BO1L 3NUKA 4NN6C 2V2XB 1S7UA 1U58B 2O72A 4FXKA 3BPNC 3FT2A 3HNSL 3ILPB 4M1DL 4PV1C 4NQCD 4JFPB 5AB0A 1MXDA 1ZSDB 1N6QH 2FX8H 1E8XA 4IIQB 3W2DL 2OXGA 3IK2A 3QORD 4XE0A 2X4PB 4JZJA 1AQDA 3GLDA 1OGAA 4HUXA 4J2XA 1S9XA 2NX5B 3VUAA 4YUEL 5HYSB 4I7ZC 4RMTA 1P7QA 5INCB 2VN3A 2F7IA 4ETQA 3BRFA 2P80A 2GSIB 3OGCB 4UNUA 5E8EB 2J1YA 3P69A 1IGCH 1BEXA 1NGPL 2HX7A 3MLWH 4Y5YC 4PS3A 4R0LB 4U3XA 3FSAA 1BZ8A 4OD1L 4JFQB 5E8OA 3EHBD 1CG9A 3ZSTA 3QP3A 1CDIA 4HAGA 4XRCA 1FBIL 1MCQA 2OJZL 4JO2L 5F3FA 3TPUA 4QXUL 4WEEA 4FFYH 4PJ9D 3S36H 5JHMA 4L3FA 1SYSA 4TVPL 3QCVL 4GW5B 3DOIA 3H8NA 1HQRA 2KDYA 1MFNA 3WIFA 1NZRA 3VXMD 4F9PC 2D3NA 2XNAB 2E8ZA 4R26H 4NQDD 3NAAL 5C92A 1E4XI 1DLHA 2IVFC 5JIHA 4U6XA 2YBGA 1JNLL 4XO4A 3VXRD 4JDVA 5F44A 2Z92B 4UM9A 2P44B 3F7VA 1LK3H 4X8JB 3S98A 4IBYA 1ES0B 1QQDA 2AJVL 2Y36H 2AJUH 3SDXF 1RVFL 1YNLL 5EUOB 4ES8A 5JW5B 4XWOD 2YPVH 2AS5M 3KR3L 1VFBA 5DS8A 4PJ8C 2LU5A 4ETYA 1M6UA 1QHPA 4JKNA 3K91A 4KNSA 4P5MA 5HSFA 2E0PA 4YGVB 3LH2L 5ALCH 1OVZA 2O6FA 1RZKL 4R8WL 4HJ0C 2B08A 3VWJD 5H94B 5KN5A 3K81A 1OV8A 4AEIL 1YEEL 5D93C 4YDJA 3KHOA 2HKHH 3UO1H 2C34A 3BRDA 4O2CB 2ITFA 3GZKA 3L5WA 2JCCA 1JGUL 4M8QA 2ZQKA 3NG5A 3TN0B 1WE5A 2OMUA 5IFAL 1I53A 4KJPC 5CZXC 2IDFA 1KBVA 2DAVA 4POZD 2DIBA 2DBLL 1ZTXH 2QSCL 4K8RD 1HH6B 1BYNA 4GSXA 3EJCA 4PGJA 3D85D 1U8QA 1X4XA 3BX7C 3FO0H 5HGAB 1AS6A 1D5MB 3HAEA 4UQBA 1CIUA 4AG4H 4YHIB 3FCBA 5BOPA 3QAZB 3ZRCC 3LPWA 1OOAA 1DQMH 4ZMWA 3GRWA 3GMOB 3RAJL 4X4YA 3IJYB 4OZIF 3Q2CA 3OJDB 1OE2A 3FBQA 3K6DA 1SN2A 4HPOL 3D39D 3V4PH 4MNHB 2HJLB 1DSFL 4HEMA 2DYPD 3L3DA 1QLEL 3SZKC 4G8GD 2WLKA 4TNFA 3ECWA 5KSUA 1ZT4A 1F6FB 4XPGL 1P5VA 1EAJA 3PWLA 4XCFL 3TH3T 1OTSD 2O5ZH 5GIRB 1ND0B 5TFSH 5ICXA 2R29A 3MJWA 3NJNA 2H26B 1QVOA 2X2JA 2OCCB 1I9IL 5K9OB 1QSED 3I02A 3UBGA 3OKMA 1I9EA 2HUHA 3F6LA 1MI5E 4HIPA 3LVEA 1A4JA 3HB3C 2P8PB 5EEYA 1GZPB 4C59B 1CWVA 1NEUA 3SDYH 1MFEH 4UDTB 4HX1A 3ZTJH 2BVYA 2G2NA 2OBGA 3FH8A 4JMNA 4FNLL 4P57B 3R8BB 2PCYA 3SY0B 4MCZA 4PJAA 3T4YB 3MX0B 2QGEA 3ML9A 4AH2B 2NRDA 2E4TA 3HJ0A 3HLKA 1YCSA 2O5YH 3BW9A 1ZLSL 2C9QA 5E2VH 1I9JH 5MERA 4TTGA 2VMFA 2AK4B 3MLTA 3QJFA 4FA6A 5D1QC 3M1CA 4HPYL 3MBXL 2FLBT 5FAAA 1KIQA 1AD9A 5G4NA 1RUMH 2VRQA 3PABA 1AJ7H 1IM3B 4A7QA 5AL0A 1A1OB 2OTPA 4XNZC 1FAIL 3K2UH 4Z77B 2X4QB 3NSCA 1FLRH 1WLHA 3ZKMD 1MNUL 5IQMA 2GHZA 3QS3A 2B14A 3KCWA 2Q86A 2XKUA 4G6AC 3LPGA 3VGFA 3SQRA 4F8TA 2XFXA 4ZMLA 4RIRB 1UOLA 2AQNA 1H0DB 2H1LM 1PKQB 3RVTC 3LRMA 3QCUL 5IROA 1HHJA 4P8QA 4K3JH 4Z7VE 3S3DB 5AFAA 1B0RA 3T2NH 3HE7D 1WFMA 3W38A 5AB9A 4QY8B 2P5PA 4RWYL 3QDGA 4PB9H 2VSKB 2VDNH 4JANB 1H3TA 4JJ5A 4RQQA 1KN4L 4RRPG 4X4XA 1TTGA 2DS4A 2YEZB 2ICES 2PKDA 1U3NA 3LIZA 4WWID 2HUEA 4MJ5A 3ELQA 2QPFA 3CZNA 4HJGB 3RUGB 5F7DA 2OTWB 3FBKA 4K9EC 1NCOA 1FIGH 4UU9A 5CEXB 1W72B 3OPUA 5AG8A 3L4TA 3WEOA 4L4TA 4MDIB 3FQWA 4I18C 2NW3A 5F9AC 5EO1B 1ED3A 3ULUF 4I0CC 4HZLA 5ANMB 4C56E 3QYMA 5DD3H 3F7YA 4PFEA 5I6OA 3EGDB 3ASNB 3GMRA 3SKJL 1N5YL 4LLMA 2BHYA 1QRND 4KMTL 4MD5A 3CZSA 2WIIB 2D7QA 4UQDA 4Y7MA 3IE4A 2FT8A 3BUYA 4G5AA 4WFED 3VI3E 1TQTA 2R7EB 4D0CB 5KANI 1EXUA 3V6BR 2XTLA 3OC5A 2BFVL 3NN8B 3ATBA 1JK8A 1UXLA 1DQKA 4PJEB 3GUTA 3TJEL 3NVQA 2OZ4A 4CNIA 2IAMA 1BBDL 5D7SL 4UANA 5DMGC 3MRLA 5C0DA 2P1YA 2ZXDA 3WLBB 4F80A 3EO9H 3FN3A 3ILQC 1TYJA 5E9DB 2JKSA 1A4BA 1DJWA 1I8KB 1YNTA 4WDIA 3DMMC 3UZVA 4GMSL 4PJFE 2C5DC 4ZUWB 2V5MA 3Q9QA 4O9HL 3UXFA 2I25N 2Z35B 4MMZA 2C7UB 1EXHA 4ODWA 4PGZA 2PYFA 4BFBD 5E24E 4DT2A 4ORZC 4KZEL 1FFNA 2WQ8A 1NL0H 1TVHA 1FORH 3AS1A 2ZKHH 5CN2A 3C08L 4V11A 4LAQL 3ZYJA 1S7XB 1AYOA 5D1XB 1A7RL 3LEVH 4ERSL 3S88H 1A4AA 3V6FA 5BZDB 1NBVH 3HC0A 3SB3A 1OPOA 2HFFB 2XQBL 2CKBA 4NKOB 2XI9A 5FLUA 2CK2A 4N8VB 3EOBB 4IGBB 3LJ3A 3W0WA 5I9QB 1OAXL 1ZT7A 3K74B 3G5ZA 3LZPA 3MV9B 2YUWA 1L7TL 3QNZB 4F7MB 3KGSA 3PWNB 2H9GA 4YSUA 2V8LA 4LO9A 3V0WL 3S37X 4Y2DD 3RDTB 4O2EA 3M17A 4Q2ZB 2MCG1 3T3MB 2X2HA 4EVNB 2QTVA 2EO1A 2YRZA 1RJYA 1I3RA 2QQQA 3O2WL 1ZLVH 2W65B 5ESVA 2VLMD 2CPCA 2KBGA 4KI5C 2XA8H 4XCEB 1SJEB 5I8OL 3QJHA 1A7OH 4U1IA 2EVHA 4GJTB 2WUCL 1RFDL 4K73A 2XBTA 4RAHA 3GGWB 4JG9A 4JX0A 4JB9L 3PRZA 1NAMB 1C5BL 1RIUL 3GSRB 1VEMA 1W0VA 4UTAL 4R90L 3GI8L 4XBPA 2E7BA 4DGIH 3B2XA 1OXYA 5IEKB 4WFFD 3IDMA 5DSCA 4TYUA 1L4IA 1UG9A 1E8ZA 2IV8A 2CJTA 2P9RA 4RAUB 2XZQH 1CLZH 3CN0A 2D3JA 3GRWH 3BO8A 1Z5LB 4GRLB 5ISZD 3RIFF 1G1OA 5EEWA 3NMEA 1R6VA 3PDDA 4X83A 3WXWH 5D7LD 4FFTA 2NUTA 1C8QA 2ADGA 1HDMA 3NIFB 3RWGA 5LNDA 5DK2B 1Q9WA 3AUVA 4C58B 4I4WA 3PP3K 5I1IL 1A3RL 1CXFA 3FO1B 3V6OC 5KS9A 1W91A 5BMFH 1E2WA 1NCDH 5DHMC 1HILA 4IBSA 4JM2F 1F4XH 1KENL 2W59A 5D71L 3NH7H 2IO5A 2KZKA 4ODTL 1FVEB 3BI9X 5TD4A 4Z7UF 4LARH 3RVXC 4ONOA 5DURD 1L5GA 2PP9A 3CFTA 1VFUA 1YY8A 1KTJA 3TF4A 1UXWA 1CZ8H 3BZ4A 3DYMA 4BA8A 3IDYB 3IRCA 2GCYB 3MFFB 3OKEA 2JQMA 2VKWA 1HFUA 5D7KE 3B5TA 1CDBA 1HE8A 3KPOA 3BRGC 4PJHB 4XVJH 3A0OA 4DPAX 1XSKA 4UZSA 1YDPB 3CLEL 3D48R 3S34H 2OAAA 2FJSA 3EJPA 1ZDQA 2D7TH 1XSIA 3F5WA 3FQUA 4WGWB 2UXTA 3FSZA 4DEUA 5C0CD 3VXOA 5H2BB 4X0KB 5T33H 1JRHI 1TNNA 4GMTH 3W5NA 2HG5B 1HQ4B 1EIBA 4UYPA 3MRHB 4XGZA 4LBEB 3NGBC 2ADIA 5F1IA 5D8JH 2NZIA 5T1LB 2H6PA 5CXPA 3OKDA 3NZUA 3PNRB 3SQOH 4S0SD 5DD6A 3CZKA 1DSYA 1E4HA 2BOBA 3JXAA 2IBZY 4P59H 2WQXA 1ZHNA 4PJ8D 1NFDB 3CHPA 1HEZA 2OI9B 4AYID 4WJKB 3M8OL 1QR1A 4LLYA 1IIIA 1AMYA 5F70A 3PUUA 5I1LB 5TPWH 4KJWD 5KVGE 5DZOA 4U7MA 4L9LC 4HJ0D 1RU9H 3A6CH 3T09A 4Y4KB 2BW5A 1Z0NA 2ZICA 5EOCH 3HI5H 3EH1A 2UWEA 4X7SL 3VYOA 3AY2A 3IMVA 1TJMA 5IHBA 3CLFH 4JDZA 3TWCL 4IOIB 2EJ1A 5KOVC 4IKKA 3A22A 1U8JB 2FO4B 3LIZH 1Q1JL 3OZKA 2ZOUA 3T6XA 2DWYA 4Z3IA 2G9KA 1N26A 1RK0B 4L29A 4WWKA 4HUNB 3BAEL 5FDYA 1D6EA 1GJWA 5DUPL 5FYLH 3QIBA 3NZ8A 2BNRA 1E65A 2YPLA 3HMXH 4J3BA 5BNXD 2C9XA 2R23A 4IS6A 3L54A 3LV3B 3R18A 1CI3M 1CGYA 5C09B 1DDTA 2WTPA 4YSPA 4FA7B 1WAAF 4ODVL 5ECGA 4XAKE 1LM8V 4WNJA 4I8DA 4LIQE 1MW3A 4F8NA 4LU5L 1S3KH 2J5LC 2WO4A 1HIML 3S0PA 2ED9A 4FTVB 4YSDA 3MYJA 5FECB 3WMSA 2C3HA 3QDMB 4TVUA 4DK5A 3QXDB 4ALAC 4YHOL 1D6VH 5IREA 2ZAIA 3TZVA 4HXBH 3OXRB 3KLSA 3U6RB 4AZUA 3F7PC 4B0MB 2OZ4H 2D73A 1EPFA 4IDJL 5CP7A 3K46A 1T66C 5HDBE 5IVXF 3BCDA 3NIDB 3D50A 4JFOA 5DS2A 1G7PA 1KEML 2E76C 2FX7H 1H9DA 2IAND 4RFEA 3RX9A 1FNAA 3HZKB 3ME0B 3WY1A 3HB3D 4LSTH 2WHVA 3SGJA 1TO4A 3PAUA 2X44D 2WO2B 2W9EH 3QUYB 1I8IA 4WFGE 4XWGL 4Y1AE 4YQXH 2J43A 2APSA 2W07A 2F74A 1LGVA 3DVGA 1J88A 5I6XC 5KVEE 4G9FB 3QEQB 5I1DA 1R0AL 1P1ZA 1L3NA 5HJBA 3AG3B 5IMOB 2M83A 3RWFA 4U1KA 1NEZB 1QSFD 3D33A 2I07A 5F2FA 4D8OA 2FEEL 1IQDB 3FFCB 4U33A 1RL1A 1DN0B 4ZXBC 4GG6A 2GYSA 2ROYA 1EGJL 1TJXA 3V4VB 3DTUB 5DD0H 4WSGA 2BWQA 2E5EA 5LDUA 3CDZA 3OGOE 1UASA 2A4CA 4BQ6A 3ULVE 2EUZA 1UZ6E 2JB6B 1LO5B 4PGBB 5E00B 3MUJA 3D18A 3QWRA 1H6EA 3HW7A 4TUKH 4XNYH 2P43B 3H9HB 1XGPA 4LLUA 3PXLA 1CE1H 4G6AD 1ROWA 4L3AA 1JUFB 2UZYA 3P0GB 2AXFB 4E68A 2V17H 2ATKB 5JW4N 1JS4A 2CK0L 3C5JB 2ZUUA 3D25B 1HHKA 4PJIB 4IU2A 5HI3C 1KCUH 1OCOB 5F0MB 2GTWB 2ZF9A 2OMWA 4JO8A 3FU7B 1N8ZB 3B8SA 3FONA 2AJZB 2ETWA 4EIUA 2BY3A 4AITA 4ODSL 1I1AA 1LO0L 3WUZA 4F33A 1CMOA 2KPWA 1HI6B 4MDRA 3UTSE 3Q3GA 5FA4A 1SJHA 4ZMNA 5GS0D 1DJZA 4H0IA 3W81A 4UQ3B 2X9ZA 1MFCH 4WV1B 5HI5C 3NZHL 4HHAA 4I48B 4YH6A 1SEQH 1E5UI 2Q3ZA 4LSQL 4F91B 4RFOL 1HL5A 3DKHA 3EO0B 1IBYA 1G9NH 2P7TB 3KCPA 3IJHB 5I75B 3ESPA 1MQKH 2VDQB 4JM4L 2VL5B 4U7KA 5EU4B 4A7SA 4NNXB 3RL1A 2CPUA 5C97A 1HSBA 3BVNB 2IQ9H 4Y16C 3F12B 4OSUH 2EDOA 4J8RA 2DJSA 2BSSA 1OOWA 3MXVH 4KVCL 4YHPB 1M7XA 5C0EB 5DCCA 3QIWC 3ETSA 2YAEA 1JPTH 4QYOB 3HR6A 2AC0A 3IJ8A 1U58A 4MJIB 3T6WA 3FZUC 4V1DD 3RTLA 4S1SL 3NBNA 3M7FB 2J4WL 1XGYH 1WS8A 3WBDA 1CI5A 4JFPA 4YVUA 1QI5A 2X4RB 4FLOA 2X6VA 1ZSDA 5DMGD 3US9A 1A22B 4IIQA 4W9GC 1IAMA 3U9PH 2RFXB 2X4PA 3ILQD 4E41E 3DETC 3T1WA 4RNRB 3WKML 1LWHA 3FOLB 1ZANH 4FXGA 4HJ1A 5ANHA 1TQBC 2FQEA 2NX5A 4NP4H 2XX1A 1J86A 5A2CA 5HYSA 1I7UB 1MCPH 4NLHA 5AOZA 35C8H 1I1YA 5E8EA 4N2GA 3KWTA 3AFLA 4MMXB 5LCVA 1S6NA 4R0LA 1WIPA 3QZWG 4JFQA 4LLAA 2VXVH 5ERWA 4QRRB 3PGFL 4QXWA 4P2RE 4K94C 2ZCLL 1YAZA 2OMYA 1KT2A 2Y7QB 4LHUD 2AP2A 2KLTA 4WNQB 3G6JA 2CJUH 2DRUA 4GW5A 2BZCA 4KRLB 3MLSL 5C2BH 3STLB 3EYFB 5J57B 3P3UA 1DYZA 2JKTM 3ARZA 3UTTB 2FQDA 4BSWB 4LEXH 4L3ED 4RA3A 3ZDXB 3FHAA 1RHHB 2Z92A 3CVIL 4RGNB 1AHWA 1PL3A 4X8JA 3TEWA 1ES0A 2A99A 1CUOA 4GRWF 4OFKA 3E8UL 2VKXA 1IQWH 4DVBA 1INEH 4LDCA 2K8QA 1A6UH 4NZFA 4YGVA 2XWXA 5GGUB 5HGDB 5E2JA 4ZZFA 1UTDA 4NGHH 1J9RA 1IKFH 3U30B 4BSJA 2XZCL 2I27N 2P5EB 4H1LB 5H94A 4OFYD 4P3DB 1ZE3H 2MMXA 1AZVA 3NSJA 3VFRB 5JXEC 5SX4H 4O2CA 1EDYA 2N01B 5KYUB 1A6ZB 2F53B 3QJQB 4Q6IB 1UENA 5D7IE 4LQFL 3TN0A 2E7MA 1AXSA 3NJXA 2DQDH 4JQIL 5IFHH 3O81A 3NFPB 1U2HA 3KYAA 3KVDD 2FZ3B 4HBCH 2IXQB 1T3FB 4QRQB 1TMQA 2BRRH 3RQ3A 3FU9A 1BQHB 5E4AA 2EXWC 5HGAA 1D5MA 5IJKA 2PXYA 3B2MA 4YHIA 2A6JB 1UADC 2FEJA 2YA0A 4ZMQA 5KUKA 4IDLA 2NUPB 3GMOA 4B9FA 2AK1H 3IJYA 3OJDA 2CSPA 25C8L 3N42B 4OI9A 5C0AB 4H20L 3D87B 4MNHA 1Z9NA 1CGUA 2HJLA 1FSKB 2NY3B 3D2TA 5DUBA 3UPRB 4URTB 2F6AA 3ULAB 3GXTA 3QUML 1QTYT 1JD7A 2CLZB 2NCMA 4X6DA 1MVUB 3SDDB 1YEHL 1BWWA 1ETB1 4HC1L 1PJWA 4OCYL 1G94A 1ND0A 5GIRA 3RVXD 5KW9L 2VAAB 1NMCC 1RERA 2K7PA 4JNXA 1AKJD 4EJ1C 3EADA 2BNQE 1OY3B 2WY3B 4QHNA 1FYTB 3WAJA 4N3UA 5C9JB 2ARWA 4CC4A 2IPTL 3OR7B 2BH0A 2BS9A 2H0JA 4JFED 3VFVB 3JV0A 4RX4D 3WI9A 2P8PA 1GZPA 1T89A 3IJSB 2FAUA 5TE4L 5D6CB 4UDTA 3N9GL 4KO7A 2XTJC 4HH9B 4P57A 4ZZKA 1GGYA 1S5HB 1EVTC 1DCEA 1OD7A 3T4YA 4K7PL 3MX0A 3RHWF 5BUAA 3AY4A 3BD5A 5KVFE 3FUMA 2WQAA 5AEAA 1HX0A 4LFHG 3QAQA 1MIML 1ETJA 1BQUA 2G5BB 3UO8B 1B4LA 4HZAA 2XG4A 2AK4A 4Z7OB 2IDQA 1PZSA 4U7SA 2VTFA 4PJGA 3UDWC 1T2JA 4ATTA 2EEAA 1W16A 5KTEL 3P9WB 2ZXEB 3A6OA 3PHOB 1V7ML 4NSKB 3DJSA 1SLVA 1IM3A 1KGCD 4YDNA 4ZDHB 3RLSA 3TEYA 5EUKB 5AW2B 2X4QA 3G6AB 4ZW6A 4Z77A 2D7NA 5I1EL 2YXWA 3ZL1A 3Q8AA 4I3SH 2ESVB 1GC1C 1KEGL 2ARJB 4RIRA 1H0DA 1PSKH 1PKQA 3FHEA 2CUAA 5JUEH 1TJIH 4FQLL 2QQLH 3IWUA 2NY6B 5DWPA 1T83A 4BFIB 1TPXB 5GPRA 5CSZB 5F1KC 1BIIB 3ARGC 2GHWB 2PF6A 2VDML 1E6OH 4NWUH 4QY8A 4Q9RL 2R69A 2NY0C 5HGGS 4BK5C 1NOFA 3R4DA 4JANA 4W4OA 1R46A 4X6EB 5DD1H 1BP3B 5B1KA 1KY7A 2YEZA 5C0FB 1X6NA 5DUMH 4MHHI 4HJGA 3MI6A 4H13C 4LSRH 2ZTBA 3RUGA 4A2LA 2OTWA 5CEXA 4WWOA 3DV6A 3OV6A 5LKNA 4PBVC 1E4WH 3FTGB 1N0XL 5CCHE 5IOKA 4PRIA 4FD0A 4MDIA 3WU1A 4OCWL 5EO1A 2B0SL 1UA6L 2MWCA 2A9MH 5ANMA 5E95B 1I8MB 2W92A 4Z7AA 1M2VB 1MCSA 3EGDA 4JQVA 1BZ7B 2CE6A 4NNYA 1U8PB 3W11C 3GXNA 3BAIA 2NY1D 2WIIA 4RVBA 2X1QA 3ZHKA 1Q94B 2E27L 5JW3H 2R7EA 2GJRA 2P48B 2GKIA 1HINL 4D0CA 3FCSB 4KRPC 2E9BA 3DVIA 4UTCA 5DJDB 5HP5A 1AAJA 3K6SB 4PJEA 1JPGB 4M7ZC 5ICZB 3G5YB 5C3LD 3TT1L 4M6OL 1BBJA 2HPOA 4MAZA 3WDIA 4AQ1A 3AWEA 5HYFA 1RPUA 1BM3H 1XBRA 2WWNA 1GJIA 1KFAL 2P5WB 1P6WA 1CGTA 4PJ5E 5LCVH 4ZUWA 1I3GL 5C0IB 4D9LH 1U93A 1WHPA 5K1VA 3C2AH 2Z35A 4NJ9L 3B2PA 4XPHL 3D3VD 4WENB 2XY2A 3U0WH 1CU4H 1RURL 5E6RB 2FIRT 1HCVA 3EW3B 4AQ8A 3CSYB 4FKHA 5L9DH 1LMIA 4DFHA 2BFGA 3ZDZF 1GGTA 5HI4C 1S7XA 2BSDA 4Q14A 4UM8B 1KB9J 5D1XA 2OL3A 2XWJA 3SBQA 3DTXB 3O0RL 5EIIB 5BZDA 1E9QB 5HHPB 3ARRA 2DLHA 4X6CF 3SOBL 3WO4C 5C08D 2RCSH 1RP9A 2FRGP 4NKOA 4NQSA 5KBMA 1YHPA 2ZXCA 4KI1A 4N8VA 5C07E 4DO4A 3EOBA 1R3LB 4IGBA 4NKQB 2HLEB 2HN7B 2IWFA 3IBEA 3UAFA 3U4AA 4WTXA 1XGQB 5FUZH 3MV9A 5G4MA 1T5KA 4OLUL 3QNZA 4F7MA 3OKLB 5DA4A 3PWNA 5LNGA 3CDGB 2DB8A 3TA4D 3CFBB 4WCYL 1AR1C 3RDTA 2OPCA 4H2CA 4Y5XB 3FULA 4Q2ZA 5HI3D 2CHNA 4EVNA 1SLXA 2F5BL 3KPLB 1NLDL 1MCBA 5FYJE 1KJMB 3DX3A 1A7PH 4P4KD 4PI0A 1MQ8A 1BZ9B 1ZD6A 1MKFA 5T1MB 1LVEA 3Q6GL 2CNYA 3WYRA 4PGEB 2W65A 2XVGA 4FXKC 4XCEA 1JYXA 1SJEA 5ADPL 3KAAA 1FFPB 1XHHA 4F8OA 3GGWA 5CINL 1T2QH 1S5IL 3QRLA 3MRGB 3P3YA 4JZJC 5HI5D 5E6ZA 3UERA 1NAMA 3VWKC 3UYPB 4BCYA 3QZOA 1PX8A 5KSVB 1NM4A 3DJTA 3HC3H 2GQHA 1MOEA 1W8EA 4YBLB 2JELL 5IEKA 3F05A 4JM0A 1MCHA 4FZ8L 1N68A 4QJ4B 1J7VR 1JVOA 3KXFB 4RAUA 4OZHF 4GRLA 5C0BE 4W1TA 1KIPB 4FZEL 4Y16D 2A9BA 2GAZB 2COVD 3W9DA 4N9GB 3C5ZB 2VXSH 4HUUB 3U1SL 3QIWD 3OZLA 4FQCL 2H0FA 4QTHB 1UH3A 5DK2A 5EB9A 2CHXA 4M6MH 5A2FA 2O5XH 1P7HL 3P4OB 3FO1A 2VZUA 3QC6X 4KKBC 1UM5L 5FO2A 5J11C 3AG1B 3C6LB 5CSGA 5B1JA 4HSAC 4B9KC 4U1SB 3WFEH 1KY6A 3T08A 4MNGA 3V7AG 1ITCA 3BZEB 5HGBB 1FPTL 3L4YA 4AVIA 4ZFGH 1MLCB 3DETD 4CVZB 2UZIL 4ZD3L 1FVEA 4MLIA 4A7GF 5I5JA 1VEPA 3LD8B 4A7UA 3SE9L 3UIYA 1T03L 2X10A 1NGWB 3CSPA 1A0QL 1AGEB 1U8IA 1OLLA 4FG6D 4LVHC 3AZUA 4FQPA 2GCYA 3MFFA 4G71B 3DHMA 4JUSA 2QKIB 5I5RA 4FKEA 4ZSOA 1AFVH 4M7KH 1DFXA 4APXB 1DQDL 4BCXA 3H9ZA 3GDBA 4J3OD 1IC7L 4B7IA 1PNDA 4ODHH 1YDPA 3I9PA 2J88L 3GKWL 2D7PA 4GUPB 3GO1H 1USQA 5E5MB 5CEYB 5EU7C 3BPOB 3SQBB 2A3TA 1T5WA 2DQHL 1SY6L 1Z6JT 4HK3N 2YEVB 5H2BA 4X0KA 1P4BL 4RH4A 2HG5A 3ZY7A 1HQ4A 3IS0X 3H56A 3MRHA 1OB0A 4JPVH 5T1LA 3VTAA 3ZTNH 4JKLA 2ZX8A 1S3RA 2MKWA 2F7QA 4GI8A 3EGSB 1ZEAL 2XHNA 4DPRA 1F4AA 4EEEA 1XZWA 1G84A 4Y19D 1NFDA 3OAZK 1XFPA 1H3XA 1L3WA 2YHGA 3MREB 2YN5A 4I88A 1EHLH 2BSTA 1JNHA 4YE4L 3EDKA 1BD2B 1B2YA 3GS0A 1LILA 4Y9BA 3HPLB 2RQ8A 3OQ3B 4TQIA 4DOHB 1TLKA 5I1LA 5LWYL 5DHYB 1TKWB 1R5VB 1NLBH 4Y4KA 4WW2A 4IOFD 3VI4F 3IU4L 3BLBA 3IAPA 2I7SA 4N2OA 2GB2A 1MWAL 3WFDL 2XXCB 5JXED 1DUYB 4FEIA 3VXUE 3JWDC 4ZW3A 1VJSA 4MAUH 5BS0E 2J6EL 3U7YH 1JZIA 3LEYL 2NY7H 3ZDYB 1GTNA 1JPFA 4B9YA 3NCYP 4IOIA 4ZUTB 2YFOA 2GY5A 2V3EA 1NBZB 2EIKB 1U8JA 2FO4A 1WVZA 43C9B 3WTVA 4A2DA 3EJZD 5F1NA 4FNPA 1RK0A 3OAYK 4J4PD 1WWBX 3OJVC 3PDGA 3LKPA 4KTEL 2EXWD 1MW2A 1KXTB 1P4IH 1E3ZA 2EC9T 1SMOA 4G7YH 4ZMVA 3DHPA 1V55B 4ZX5A 5EF2A 2M8XA 5HBBA 3AREC 3K8LA 2QFRA 5BS0D 4PJDF 2QPEB 1YEGH 4GB9A 1YYLH 1QOKA 2IOOA 3FQ4A 3KBHE 2NDFA 2GK0B 4B50A 4FTVA 3O4OC 5CJOH 5IBUG 5FECA 1WEJL 3QDMA 3QXDA 4PMEA 5JYMA 1YYML 3W82A 5ELIA 4NQEE 5DJYB 5F3HB 1TVDA 4TVPE 1WBZB 2ITEA 3OXRA 3U6RA 5GGQL 4FA8A 5CEZD 1RJLB 8CGTA 5GRJL 2E7HA 1NWOA 4HKXB 1LDPL 3FT4B 4JRXB 1JV5B 2WVTA 4XVSL 3BCFA 5CJXC 4YSAA 3KLHC 2GEQA 2WXKA 5CP3A 4MJ4A 4TLSA 1MAML 3HZKA 3ME0A 4H88H 1PD1A 1Y6MR 2NXYC 1UB6B 1Y1UA 1B2WH 4XNXL 3SO3B 4GBXC 3DBXB 4YHML 1RP8A 1NBYA 5E08L 4AEHH 5EF3A 2P52A 3C8HA 3GRGA 3PDOB 3QUYA 5CGBA 2XTJD 3DURB 3ARFC 4HJJH 1RZPA 3S3JA 5JHLL 4AM0Q 3D07A 3PHSA 3LS4H 4MCMA 5BUPA 3QEQA 1T0NA 4TUOB 5GGSB 1B0GB 5IMOA 1G7IB 1NEZA 3ETBJ 1BYPA 5KBDA 2CHDA 3NACL 1NC4D 2OL3H 3FFCA 4GO6B 3SPIA 4X50A 1BDYA 4LMQI 5IHLB 1DN0A 3QORB 1UA3A 3B9VA 2IDTA 4OQTL 1CN4A 4BELD 3V4VA 2YSSB 4E9RA 5KJ4A 4HVBA 1XMWA 1NCWL 1SXAA 2OSXA 5EN2B 3BKYL 1Z2KA 4NT6A 3ATEA 4MXVF 2VM3A 3L13A 1UATA 4WTQA 5CGTA 1W8NA 3QG7L 1LO5A 4PGBA 5E00A 4I2XE 5LGHH 3E80A 4CBPA 5CBEB 3H9HA 3NCXA 5MI0B 4CMHC 4NCC1 3PXHA 4HCRL 4KTGA 3C6EA 3EHBB 4DN4H 2AXFA 4MRBA 3SPVA 4N1CA 4UIKL 2ATKA 2I5YH 2YRPA 3C8KB 1U33A 3C5JA 4JDTL 5T3XE 3BYYA 2PWEA 4N0FB 1JXFA 4OBRA 4PJ9B 4HGKC 3D25A 1MRFL 4PJIA 1N6QL 5EU3B 4U1JB 2VMDA 4KQ0A 2GTWA 1HJCA 4RMVA 3LN5A 3FU7A 1N8ZA 3GSQB 3VXMB 4JFFE 3VCLB 3ULUC 1A21A 1QD0A 2AJZA 3AU0A 4P3CH 4FMVA 3ARGD 1KJ2L 5HDRA 1R24B 4BFNA 2GIXA 4N2MA 1IMHC 3ES6B 1KCSH 5FYKD 3T0ED 2NY0D 3VXRB 1A47A 1YJDC 2W0KA 4BFJA 1IGCL 3D12B 2FWSA 3SJVD 1RUKH 1OT4A 2X2YA 3CPLA 3D4ZA 3HUJE 3NSYA 8FABB 4Y1SA 1ETA1 4WV1A 4CBZA 3KZ8A 4I48A 4W9EC 5T3XD 4WF7A 3S36L 3WNKA 4UF7C 2WKOF 3SD5A 2DEYX 4S1DD 4RFNC 3TYFB 3EO0A 2CMRH 1JZGA 3EJQA 5LGJB 2P7TA 3BISA 4DPBX 2F7RA 3IJHA 5EU4A 3I50H 2VL5A 3HG1E 3VWJB 4NNXA 3CSGA 5CEZL 1SM3H 3BVNA 3P0VH 4HK0B 2YA1A 3W11D 5J1TC 5HDOA 4YHPA 4MB3A 5C0EA 3S5ZA 2APXA 5EIQA 2MQGA 1LK3L 4N90E 1OSPH 4QYOA 5KEZA 1RMFH 1FZKA 1G1CA 2A6IA 2XLLA 4MJIA 1KXVC 1TZOA 2YPVL 4BM7A 1GGCL 5AL8A 5FUCC 3L7EB 3CC5B 1OK0A 4RMRA 5DJAB 2O30A 5HVHB 1PZBA 4YAQB 4UT7H 3BD4A 4U0RB 3D85B 1W80A 2RFXA 4AK1A 1RI8A 5ALCL 4RNRA 3FOLA 4XO3A 4D7BA 4PRPE 1I7UA 2XZAH 1EA9C 3FMGH 4OF5A 3E1ZA 1IKNC 1N6VA 1P4LB 4LRNH 3UO1L 1XXFC 4WTZA 3D0VB 2KQMA 5E70A 2X4NB 3OMZA 1M71B 2VM9A 3RIAK 3TJPA 3D39B 4MMXA 4XH2B 1MHPL 2VZ1A 4KXDA 1HXKA 2DYPB 3N0PB 4G8GB 4IBTA 4K23L 5KVGH 3MJ9H 4QRRA 5J9PB 4ZO7A 2J21A 1R9FA 3LTVA 4HOXA 2ZCHH 5HI4D 1O5DT 4WNQA 5CJBA 5BVPH 1PZAA 4AG4L 3HZVB 4UDUA 1YEKH 3L5JA 3UTTA 5IWLA 3KBEA 4WO4C 4YK4C 3G5VA 3O9WD 1QSEB 4NENB 2JLPA 1SVBA 5GSVB 4I9WE 2WAQA 3S48A 4AW4A 5IV2B 2HFTA 1RHHA 3LKQB 4H8QA 5EPMB 3SBWC 4A7VA 3JZYA 3H42H 5TQ2H 3V4PL 3G9VA 1KBPA 5C6TH 4OFDA 3T65B 4NBYB 1AR1D 1P5UB 2CRYA 1KELL 2K70A 4QTFA 3VFPB 2P45B 5FYKL 3L9RB 1ORSB 5GGUA 3II2A 2F8IA 5HGDA 5TFSL 3ZE0B 5BV7H 4OM1H 4LXFA 3DC0A 3NCJL 1J8KA 3GHBH 4S1RH 2P5EA 4H1LA 4TS6A 1G7HB 3OQRA 1DJSA 2EYSB 3MUZ1 4OLZH 3VFRA 1G6RB 1AQ8A 1A6ZA 4ZX6A 2DZEA 4FERA 2F53A 3O3BB 1XD0A 4Q6IA 4YEEA 3MV7E 3VWKD 3MGOB 1O6SB 1BVZA 2XPYA 4M48L 2F19H 3SN6N 2N59A 2FZ3A 4MSWB 3N43B 1WV7T 2ITDB 4JM2C 4HIJB 2IXQA 5CKGA 4G8IB 5J6GB 1T3FA 4QRQA 1LNUA 2CBQA 2J6WA 4WI9A 1QPXA 3EJRA 1BQHA 1JNNH 4KO9A 1TCRB 3R1GH 1UEYA 1TR7A 3RI5F 3RVUC 1DLFH 5ADOL 3WTXA 1I9JL 2Q7YB 3NCWA 3QNXB 2A6JA 5A2AA 2GIMA 4N0YH 3II3A 2P46B 1SDDB 1KGJA 4HS8H 3UYRL 3WXVH 4DW2H 2XN9D 4F57H 4LCCB 1BFVL 1JVKA 5C0AA 4LHJB 3VD3A 1NCHA 3HE7B 1RUML 4KKBD 1AJ7L 3AXIA 1WYJA 1DHKA 4RGOH 2X4UB 4UAOB 3UPRA 5FHBL 3K2UL 4I0PC 1ZA6B 1OSZB 3EFDH 4LT7A 1NAKH 4YDIL 3V9EA 2CLZA 5DWUH 2F9BT 4Y4FC 3SDDA 4QR7A 2CR6A 4Z7WE 4DFIA 2VAAA 3C5SB 1CL7I 3ULVH 3IDXH 1FYTA 2DQIL 1CLVA 2GK2A 2VLRE 5C9JA 4K3JL 4HIXH 2ZIDA 1G5GA 1ZK9A 3OR7A 4E9WA 3VD4A 3BKMH 4LK4A 1QASA 4P2CG 1Z3GL 2QHLA 5DT1L 1XGZA 1UT2A 3IJSA 4U6TA 2B5IB 1XF1A 1QRNB 4PB9L 5D6CA 2VDNL 5FDWA 1GPOL 2UUDK 4HH9A 3AJ7A 4HP5A 3GBLA 3QFJA 2ISDA 2FLRT 1KGXA 4ZMAT 3PXJA 4YBQC 2DI8A 5B38G 1KGUA 1OCRB 3FTYA 5KSBA 2H0PA 2G5BA 4KDTA 3OLIA 1NUFA 3V4VH 1ADQL 3JTTB 4NC2B 3IDUA 3ARVA 1SVCP 5AQ0A 3KPTA 4YDLC 4HWBA 4KDVA 5DD3L 1U95B 4JN2A 1MWOA 1F6AB 4NSKA 4Q7DA 3LHPH 5HHXH 4YHZH 5FO8B 2VR5A 4ZDHA 1SOSA 4WTWA 4M43H 5EUKA 2ZKMX 3LZFL 5A40E 5BRPA 4KK5C 2H1PH 3VI3B 2P4AB 1KLGB 2CA4A 4GOSA 4WFHE 3VD0A 3RPKA 3VJ6A 1YEDB 2ESVA 2L7EA 3ZL4H 2EVFA 4Z5RB 4MQTB 5AUMB 2HH0L 4PRDB 2ARJA 2OKMA 3FN0L 5BOZG 5BPPA