5ABAA

Structure of the p53 cancer mutant y220c with bound small-molecule stabilizer phikan5149
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5abaA00
3US0A 2MEJB 1HU8A 2OCJA 3QYNA 4IBYA 5G4MA 4G82A 2X0WA 4IBTA 3ZMEA 2YBGA 5BUAA 4IBVA 3WTWA 2GEQA 4L18A 2J20A 3EXLA 2WGXA 3WTSA 1GZHA 4AGPA 1CMOA 1TUPA 2XWRA 1UOLA 1GZHC 5AOMA 2PCXA 4XR8C 1T4WA 1H9DA 3EXJA 4IBZA 3WTXA 4AGMA 3IGLA 3WU1A 3VD2A 1TSRA 5LAPA 4G83A 4L0ZA 4GUQA 4KVPA 2J1XA 2IOOA 3WTYA 4AGNA 4QO1B 3KMDA 3KZ8A 3QYMA 3D06A 5ABAA 2J1YA 2XWCA 5KBDA 2AC0A 1EAQA 2X0UA 5AOIA 5AOJA 2BIQA 3IGKA 2BINA 3Q05A 1CO1A 2J1ZA 2VUKA 3D0AA 3D08A 4HJEA 4AGLA 2BIMA 1EAOA 3TS8A 3Q06A 4A63A 5LGYA 4IBSA 3US1A 4IBWA 2AHIA 4IJTA 2P52A 2X0VA 3Q01A 3D09A 5AOLA 4MZIA 2H1LM 5ECGA 1YCSA 4IBUA 3VD0A 3WTUA 4MZRA 4AGQA 1IO4C 4AGOA 4L0YA 1KZYA 1HJBC 2FEJA 2BIPA 3VD1A 2J21A 2IOIA 4LO9A 5AOKA 2IOMA 4LOEA 3WTTA 2BIOA 3D05A 5A7BA 5G4NA 4LOFA 4GUOA 4IBQA 2J6WA 1LJMA 1EANA 1E50A 3D07A 5G4OA 3WTVA 1HJCA 2RMNA 2ATAA 2J1WA 2ADYA 5AB9A
chains in the Genus database with same CATH superfamily
4EKXA 3GHBL 1MFDL 4NQSB 4DIXA 1YEHL 3D51A 4ODXA 2FGWH 3ZRCC 4BZ2A 2FO4B 3VXUE 1E5CA 5MENA 3SE6A 3C60A 5IMLA 1QUPA 1D6EB 4HIIA 3DETD 2FWOB 1UB5B 3L45A 3QFJB 6PAZA 3D4CA 4GG8B 5G5DB 4IBVA 4XP1H 3NRQA 5AAMA 1PG7X 3HLAA 5IVXA 4FQ1H 4OCLC 5IQ7H 5C0CD 4Q9QL 3B5GA 4FQHA 4RDQG 1AR1D 3WUWB 4AQOA 2JF1A 1P4BL 3H7BA 4WFGE 4OFPA 3JWNE 1KBGL 4P3DA 4KK9D 5DWUL 3VFNB 3OKKA 2D03L 3WSQH 4B9KC 5I5JA 5EZLB 2NY1D 3QG6A 5TF0A 2WLIA 2I25N 5IW6A 2R4RH 3C87A 3NCCB 5F2FA 1CB4A 1OKEA 1T83C 2HT4C 1QR1A 4OLZH 2G5RA 4XWOC 4LLVA 2ZP9A 2W9EL 4NN7C 5T1JA 2GSIA 1YEIL 4HUMB 2ADJB 4HG4K 3L4XA 2JJUA 1MJJB 1YECH 4P2RE 3RA7L 4GSDL 4TSCL 5GGSB 3I50H 4CVZB 5CGMA 1XR8B 3AXLB 5E8NB 2PCFB 5SWQA 3ZHLA 5ABZA 5ABAA 2KYIA 3TURA 1ZA6B 2XN2A 4NAMA 4WCYH 4NHCH 1IGJB 4P2OC 3U46B 1CXHA 2DL9A 4EN3A 2XG4A 3ZX1A 3QZNA 1PYWB 2ICWI 2JJWA 4LEBA 4Y19E 1N5YL 3QR2A 5E6ID 4IKNA 5SWSD 3FTGA 2JKXA 2NY3C 2ICWA 1T03L 2HLFD 2VDKH 5SX4H 3M46A 4M3HA 1HVXA 2ENPA 3O6FA 4P4KC 4OFIA 3H2QA 4LVNB 5DQJB 2H1LM 3W56A 3MOAH 1B4JL 4TNWF 3I6GB 2RH0A 1BQHG 2FR4B 1NAML 1JF1B 4YSRA 1QWNA 1RULL 4NUPA 2XN9B 4UV7H 2XTLA 2APVA 2BOBA 2VABB 4Z78A 3DX6B 5K59F 3MLYH 3CSYB 2JK5B 3BEVA 2O5XH 1B9KA 4I0PC 2L04A 1K72A 4XP4H 1OLZA 4PJBA 1T7ZA 1IC0A 3LKNA 1UATA 3CVHB 3SKJH 1U8CB 1LTXA 1VF5C 2QSVA 1G9MC 2RALA 1GVIA 3EJZD 1A4JB 2PN5A 3BAJA 4JDZB 3ZZQA 1DVFC 1XHHA 3TVMD 5CUSL 3LY6A 3LKPB 3UCRA 5IKCA 1DTUA 4LSDA 5T1KD 2ZUWA 1IUZA 3FOMB 5B1KA 4Z7NF 2VN4A 3QPXL 2R2EB 1D5IH 1Q4NX 1MFEH 3QI9C 4Y5VC 1ZLSL 1KJ2A 4JG1H 1W72A 1R0AL 5AW3B 4DZ8A 3D25B 5EU6E 1AP2B 2W80C 2RQEA 3EH1A 1HEHC 2QQQA 4J3OG 5KSAB 4QHNA 1GHFH 2DWDA 2G4EA 5GXBB 5LVEA 1TVBB 3LSOB 5I9QB 3M45A 3MVSA 5B1JA 4FL4B 1WUNT 3MRQB 2ZX8A 3CXHJ 5F21B 5CJOL 3WTXA 3U79A 2I5YH 1M7IA 4RDBA 2DMCA 1MJ7L 3AREB 2LLNA 3NT0A 2EIMB 4K8RD 4KITB 3I02A 2GSGB 5IHUH 1QD0A 4KRPC 4OF7A 5E4EB 4F37K 4OCRL 3O2WL 3V0WL 3ZKND 3FC8A 5CD3B 1SBSL 2XG5A 2MHAB 2R83A 3WLBB 5AVZB 1PVHA 4U05A 4YHOH 1VESA 2KH2B 1YAIA 2ITCA 4JPVH 4X9YA 1OOWA 5CFHA 1EAQA 2QBWA 2PO6B 3FQXA 2XN1A 2EYRA 3H9SB 1R3KA 4H25B 4JFXA 3ZL4L 4JY5L 1UG9A 3EFFA 3Q13A 3EYFB 4X6CE 1CBVL 2J8UB 4M8QB 5HDBB 3S96B 1RUQH 2JKJA 2HRLA 3U6XA 4OZFG 4APQD 4EOWH 4RFOL 4A04A 4R7XA 3PP3H 4GS7C 1L9PA 4G7SB 5IB5A 4KK8D 1U4EA 1TOXA 5BNXD 4A39A 3O3EA 1SOKA 3UAEA 5IW1A 3H1ZA 3U9UA 4F24A 4AQEB 5F96L 4ZFOL 2JLPA 3GINA 4IBUA 4OTXH 4PJCA 2BHYA 3TNNA 2EO1A 1C16A 3OSVA 2DKSA 3AQZA 5IV2B 1ULVA 3MRGA 4YO0B 5IR1B 3FU3A 4R2GC 3MROB 4YOKA 4ISVB 1DJHA 2DQJL 3T8XB 2OV0A 5L7XL 1MIEH 3NJIA 1AXSB 4YZWA 3S5LG 4KZEH 3BPLC 1Z3GH 4LO9A 4XNDA 2OS7A 1C5BL 2YHGA 25C8L 2VH5H 3RTLA 1YDPA 1I3UA 1U3YA 5CP3H 2R27A 3C5JA 3T0ED 3QAQA 5G4OA 2OSWA 4TSBH 1P5UB 1G43A 3GJEB 1DE4B 4OM0L 5BXFA 5LQBL 3HR5B 3MRIA 3KYOB 2GY7B 1U8PB 4YDKH 4AQAA 2DQHH 2R39A 1EMTH 2ICWJ 2ADGB 1NCWL 2YA2A 3G5XB 1MFMA 3OKNB 4FHKA 1J0IA 4DP7X 2WSPA 3MRCA 1IGML 3RWHA 1R24A 4XP5L 4L3CB 3T3PE 4AM0B 4CSSA 4Q6IC 5BUAA 3MI6A 1MF2H 4NRXB 4JDTL 3EYOB 1OAXH 2PR4L 3JWDL 3KS0H 2PETA 4Z95H 1QVOA 5E6RB 5HPMA 1YYLL 2FBRA 1LO2H 4LT7A 3RWCA 3HAEH 5F7YC 4M4RA 3QCUL 2DQFB 3O4OC 5D5ME 2G2RA 3QXTA 4KH2A 5GS0C 4JFDA 2DQTL 1ZD6A 3ZT5A 5C0CB 2YAMA 5CCKH 1J9CT 3H0TB 4I77H 1XO8A 2HJKA 5JHLA 4PWIA 3PGCB 4NO5B 4PV1C 4AH2B 3IMSA 5E8EB 5EIQA 2YXMA 3LH9A 1AGEA 4LEOB 1AIFB 3A3YB 2Z8VC 3HNSL 1Z9PA 2OZ4L 2FQGA 3FUEA 2F1AA 4I48A 2NY1B 1ZVYA 3FQYA 2GB2A 3L3OB 3KGTA 2CCWA 3EGDA 3GLEA 4XN4A 1NEZA 4PCKA 3D85D 3CFEB 3BZEA 3DBXB 1Z9LA 1KTJA 5ILTH 2OMBA 2VNCA 2JXMB 3FT1A 4PGDB 4WU5B 2BPBA 5IQLA 4JN1L 2BDNL 1KELH 4IGBB 1OTUC 3OPZL 2PTTA 3QDHA 3QHZH 2A4EA 3PP4H 3DXAE 1MJ8L 4FQCH 1MPAL 3MJ9A 1ACZA 1KJ3L 3NQIA 3CVIL 1VRSA 4N0YH 4UV4L 2WYTA 5DS1A 3VFTA 3V52L 2DW5A 4WFFE 1PFOA 1R3HA 1FP5A 2OMVA 2ATPA 5FW6A 1N70A 5FV1L 1VKXB 4OD2B 3FO1A 1WAAF 4N8CL 4D3CL 1ITBB 5MERB 1DQML 4KGLA 1RZFH 4F2MA 2DV6A 3HG3A 2Z93A 5E6IB 4G6FD 5SWSB 1S9XA 3WTUA 3GS7A 2MCAA 4AGQA 1Z5YD 3RZCC 3A23A 3BHBB 5LHDA 5DTFB 3ELQA 4R0LA 1DR9A 3CG8A 4N8UA 5DFAA 2OL3L 2VLJB 4JPIA 4XNAA 4F9LC 1E42A 3N3EA 4XN5A 2YAQA 4HCIA 4I9XA 1XCWA 1KCRL 5INCA 4RMBA 1HX0A 3DX8B 3M88A 3MBWB 4MD5A 2PCYA 3ZPDA 1CU4L 2CDEB 3SZ6A 1KPRA 4I3RH 2BO0A 2NT1A 2VUYA 5IBTH 4N2NA 1SHWA 4XNYH 2RMNA 3RDTA 3QQ9C 1M6OB 3E8VA 1KN4H 4OLVH 3DYOA 3CDYA 4I1NB 4P5MB 3VFMA 1MJUL 3SYQA 4ADIA 1VJSA 2WBJC 4I4WB 4IKLA 4Z0XB 3H6AA 3QUMH 4RZKA 1UXMA 4Q7DA 1D3CA 2OK0H 2C9PA 3E3QC 1FVDB 3TVMB 1KBBA 2XACC 5I1CL 1KLGA 4QTIH 5ALBH 1BFVH 4DPRA 1UJ3B 2PYED 3ABGA 5H37A 2GK0B 5FWRA 3S97C 4GRMA 5JW4R 1IBGL 4JANB 4JZJC 2GBUA 1GS8A 3L3KA 4RAVA 4XXDA 3W57A 4WW1A 2AABL 4I18A 2Y6SD 2HVKB 1BMGA 1IZKA 4WHYG 3G6AB 2EVHA 3TV3H 4HHAA 3BP7A 4K9EL 5D1QD 1F90H 1Z7JA 4L0PB 5AW0B 5D7JC 4FNRA 5EBGA 2ICEA 1P6AB 2M83A 4IYKA 5GS1C 2ZAHA 4BV1A 4FFWD 2B1HH 2Z1KA 4U7MA 1XAKA 2ZYHA 4XVUD 2JKTM 2WQRA 2VL5B 3SD2A 1JZJA 4NO2B 4CVWA 4JL2A 3FZUC 5CLTA 1JHTB 4QXUH 2V5MA 4F57H 4TMPA 2GCYB 1DN0A 2CPCA 2A7BA 3QNXA 5LXVA 1S3KL 2F19L 5LBSL 1TMCB 1FZMA 2Y72A 2YBRB 2R1YA 2AXFB 5HVGB 2D7TL 4FZEH 1FFOB 1GYCA 2Q0ZX 4AGLA 2J8UF 4DKEL 4FABL 3ZDWA 3OAZK 3EKCA 1MWAB 3E6FB 2ZG1A 2EE6A 4J3BA 3RNQB 5FB8A 3O4LD 2EXYD 3RX5A 4GBXD 4YSDA 1PKQE 1N10A 3SQOH 4APQB 4FA6A 4PTUB 4WK2B 3IU3B 4PREB 4N8PA 4QRPA 5J9PB 1JZEA 3VGAB 4ZXBD 3VRJB 5IHHA 3A6OA 1GPOL 3CDZB 4YHZL 1RQ5A 4OGXH 2WXQA 4HS6B 3SGJA 3D2TA 1SRDA 4U3SB 2WUCL 5C0RL 4WDIA 1TENA 3HC0A 1V7MH 3WO4C 2YIHA 4IBLT 1UH2A 1ZS8A 3OPUA 4MJIE 4RQQB 1JGVH 3FBKA 3LS5L 5E5UB 3SDDD 3A47A 2P44B 4Z6AT 3ENEA 3WN5B 3QWOB 4FD0A 1A6TB 3QUZC 4U1GC 1H8NA 2JIXD 3NFSL 1BOGB 2NUTA 1AYRA 2XA8H 1HHIB 3LIUA 2W0FA 2DQUL 3NCEB 3W0WD 4MDRA 5C9JA 5HGHA 5FFLA 4X5XB 3T0EB 3ZMEA 1KYFA 1EEZA 1IEBB 4FA8A 4ESKA 5TGBB 2UZIH 4WV1C 3C6SA 2WN2A 1HZHL 4D9LL 3ZW3A 1U8QB 4U1KA 1MHPH 3CN0A 5FS5A 3TIEA 4NP9A 2G2NA 3OZ9L 1NCBL 5I8EA 3MO1B 5I75B 1YC8A 1SVCP 4A55A 4W9EC 5JQ6L 1FNGA 7FABL 3C08H 4UAHA 1GGUA 3MRDB 3SPGA 2NY4C 4U3HA 2WLMA 1ED3B 2R8SH 3SDAD 3C6LA 4U3CA 1JV5B 2WXNA 2ZCHL 2EIKB 5IQ9B 1TLMA 5I73C 1JZDC 5FV2A 4DPAX 1JZ3A 3DC0A 3IGLA 3BGAA 5IM7A 3DJTA 4M7LL 1RIHL 3QQXA 4LRNL 4QCIA 3MBEA 1J05A 3Q8AA 5CO1A 4UMSA 5EUKB 5J06A 3BUIA 4LKXB 2FSEA 3CX2A 4Z7UF 3DYMA 2H2SD 2DB8A 4IRSD 5KAQF 2P46B 1UXLA 1I8LC 2CLZB 4ODWA 3FF7A 2YGOA 3ECWA 4EDWL 2YWYA 2WCSA 4AQ8A 1FGNL 1C1EL 2F7RA 3B1TA 3VFVB 2AC0A 4WEUD 5IMKB 2FAUA 5HPOA 3VM7A 1SMOA 5HJ3A 4YX2L 3FO2B 1N6QH 4K2UH 1ICTA 3HRPA 5HYJE 1ZSDA 3D85B 5C0AB 4H7VA 1F58H 5CLZA 2VN6A 1L9QA 1SDYA 4LRIA 1DBBL 1WSST 4WUUA 1D5XA 4C58B 3VQLA 4NPKA 5EH1A 2KL6A 3QIWC 5BRQA 2YZ1A 1GIGH 1JSYA 3IM1A 4PG2A 5CLYA 5MHSE 1IQDA 2QQLH 4HK0B 4GI6A 3SCMC 1CFSB 3GMMB 4HU8A 4JO2L 1ZPUA 3ZKMC 3VD0A 4QHUA 1A7OL 1XXDC 1WHPA 5ICXA 4QY8B 3DMMC 3TWCH 3E8UL 5BOPA 5MEND 4S0HA 3C60D 4PIRF 3SQBA 2ILLA 4XNQB 3HUJA 3LJ3A 2WAHA 2Y36H 3F7VB 5GIRA 3ZSTA 1Y18B 1ET8A 2Z35B 3RUGA 3TN0A 4Z0BL 4OV5A 4PP2B 3TFKD 1U58B 2HJLB 1L5GA 5LGJB 1K4CB 1JMXA 2HWZH 1FVCB 4MJJA 3WTVA 4QD2E 4UWQB 4G2AA 5C07E 5A2LH 1SNRA 1CURA 3PXLA 1HAWA 1PZ5A 1ZSHA 1BREA 1VA9A 3O3BB 1TJIL 1KTKE 5A6LA 1G7MA 3KL5A 1DVUA 1FNLA 5AQ0A 1R17A 2ZPKH 2Y4SA 4TLTA 1NJ9A 2W9DL 4LPCA 3OHXB 5HYQA 4ILDA 4FAAB 1HNYA 1N6UA 2GITB 4M62L 4NNYB 1BFOB 4RISL 5CBAA 2Y7QA 4HWZA 2OJEA 5CZKA 4XMZA 5DHVH 3NH7H 4U3XA 3B34A 3TBVB 1G6VK 2GTZA 3HG0A 1LEKA 3FUJA 3IGAB 3AITA 5MP6H 4RETB 1EXUB 1ET5A 4KMLB 4NN5B 4RRPG 5IK3A 3ZDZF 4TQIA 5BOJA 5GGQH 3II1A 5E4AA 1UT1A 5AW2B 5E2VL 1XGRB 1ES0A 4FGMA 1NAKH 1UADC 2IPTL 1UT9A 2FQEA 3H2PA 4KTDH 2NY0B 2ZICA 4OCSH 2EINB 2X1PA 5DUBB 5D71H 1CT8A 4DP1X 1J8KA 3IT8D 4ZS6C 5C08D 1QYGH 4KRNA 3UYRH 3QZOA 5JPMA 1OTTD 2ZUYA 3D0VB 5EO9A 3O6FD 2Z7UA 4J1UB 3MBXH 5MEQA 3E38A 3C2SA 5IGXL 1ZV2A 4YBLC 4CMMA 3VRLF 4JGMA 4NX0A 2FD6L 1CZ8H 1V3LA 1BLIA 3FH7A 3MNZB 1U8HA 3OR6B 4F93B 2OMWA 2XXGA 1SYVB 4Q56A 3IDNA 2X0UA 1G4MA 3I2CH 4IKKA 2X4RA 1JHLL 1KXTA 2D9QB 3V6BR 4IM8A 2ITEA 3D87B 1NFKA 3S35H 2WUBL 1IC1A 3OGCA 2VXUH 2V7NA 3NESA 2BSSA 5BJTB 3KDMB 1YEWA 4AQ1A 3MA9H 3GXFA 4FDWA 2X4OA 5D2LB 1FCCA 3K0YA 3PWVB 4KDTA 4X98B 2ITDA 2KLSA 4OIBA 4AEEA 2C1PB 2QDWA 4GMSL 5B8CC 1FZOB 4WUKL 2MOVA 2GBAA 4ELME 5BW7C 4EQ2A 2BP0B 4DKDC 2RCSL 2XWTB 3O4LB 3CN1A 1KXQA 4LP4A 4NZTH 4GBXB 1XF5B 4ELKA 3X17A 1DQVA 3O2VH 1T5WB 4OI7A 1WBXA 2YKKA 3DVGA 1MVYA 1PLCA 3VWKA 4P5RA 3KYNB 1QFHA 4GUOA 1HOEA 1ZVHA 3L5HA 1WE5A 4HJGB 4ZXBB 3CFNA 3LB6D 3V0AC 4B3VA 2Q10A 1KCUH 4G8AC 3QDGE 3O9WA 2BVOA 3H3PL 3CAFA 4JLRB 1GGCL 4XOCA 3EBGA 5FC9A 3BPNB 5F9JB 4X6FA 1ZANL 5BO0D 2EIEA 4YDMA 4FQQB 4W9ZA 4A2GA 4CBPA 4JQIL 1N0XL 5FM4A 4H8UA 4ABWA 4WGWB 4G6MH 4OZIF 4AYBA 1I9JH 1S7QA 4TRPL 2JIXB 4M7LT 3FSAA 3V6FB 4OLYL 3T0XA 3T65A 3UTPD 1GZPA 4M6MH 3BKJL 5EIIA 1JPEA 2XTJC 2XWXA 4QI3A 5HJGA 3WGUB 5IQOA 5FWQA 3AADB 4RBPH 4AV0A 2DJUA 3NABH 2FL5B 2QKIC 1XBRA 1GZHC 1ZLVH 5IUSA 4AKQA 1LEIA 3B2PA 1FL5B 4B9PA 4NZRH 5KSBE 3DX9A 3RGHA 1CGSH 2I9TA 4X8GA 1SJEB 1RUAH 2Z3FA 4S1DC 2Q20A 1AQ8A 3T0WA 3QNZB 1EWHA 4YDVA 5J8OA 5E2UL 2R4SL 1RZIB 4OR1A 4AV5A 1M1SA 1QI5A 1LWRA 1QR4A 2EVFA 3SDAB 1L9MA 1A6ZB 3V5KA 1TQCC 4FG2A 5I76B 4JNXA 3WTYA 1E4XH 3NIDE 4W68A 3SOBL 3OKDA 4HULB 3KZ8A 2R23B 3PUUA 1N4XL 1I9RL 3WIAA 5H94B 5JIIA 2VDRL 1IMHC 1CBJA 1NBZA 2G3XA 4Q4EA 2NZ1A 1ZHLB 4IRSB 4KHXL 3GSQB 4B3EA 1OL0A 4YZFE 4FERA 4XWGL 4GW4A 2AV7B 4J3SA 3QISA 2FEDD 4DN4H 43CAA 2HLAB 1E6JH 1QSZA 4GAGH 2Z91B 1FF5A 4MNGE 4OFKA 5DJ2A 5F89B 1UWYA 1F4XH 1NOLA 2WTRA 4UU9B 4Z7VA 3FT3B 1PZBA 2BX5A 3T04D 3JWNG 1BLNB 3NAAL 2UY6B 3GMPB 3MA7B 4GXVL 4PRPA 3UYPB 4E5XG 4MQXD 5F7FA 4XRCA 1MFVA 4TSAL 5IESL 3IFNL 2X38A 3IJSB 2NY5H 1I4FA 3LHPL 1MCWM 1K6QL 2Y23A 1SF3A 1MI5E 1MCPH 5I17A 1MLBA 3DO7A 5ADPL 4R4ND 4HXBL 5EBMB 5HVHB 1T20A 1XSJA 3Q43A 4MHHI 4TN9A 4UANA 4OLWH 1VGEL 2DPKA 4Z3EA 2E4TA 2OMZA 5HI3D 3C60B 5IMLB 1E4JA 3QYCA 3QXAA 2ZG2A 4LBAA 4S1SH 4NQCD 4PGBA 2XU9A 4FFYH 3T4YA 5DMGC 4XPGL 5ESQA 1FL6A 1C5CH 3HLAB 4JFDD 5IVXB 3US0A 1UWEL 1WFTA 4BUGA 4YDLB 2YUXA 4R97C 4FQHB 4FRWA 2R0KL 3COOA 2YA0A 3H7BB 2X42A 4P3DB 3R8BB 1Q0YL 3OKKB 3BT2H 1IAIL 3M8OL 3EXLA 3QG6B 4BSVA 4P05A 4KVNH 1Y6KR 2NR6C 4JS7A 2VUOA 1MCCA 5IW6B 5D4JA 2MOQA 4LHJB 5E6UB 2P28B 5FYLL 1QR1B 2JJTA 2YOCA 1QUNA 2QVIA 1N59A 3BD5A 4XXWA 3B9AA 4LLVB 5AOMA 3LZLA 1AHWA 1N2RA 2VM3A 2F18A 2Y7LA 2F1BA 2GSIB 5D7IB 4IDJH 5T3XL 1EK3A 1LO3L 2E7HA 3TBBA 1SY6A 1EO5A 2C9VA 2NX5A 5F9WC 4KUCD 3OLDA 3AACA 2EDFA 4GXFA 2ZNWA 1HHJA 4YK4B 3GBML 3P0VL 3C2AH 3K6DA 4HFUL 3UG5A 4P9ML 3QZWG 3KXFB 1OAUL 3BZ4A 1IILE 1NICA 2JKNA 1E9QA 1TJHL 4EN3B 3KYAA 2XG4B 3ML9A 4GRLA 3VUAA 3SDXA 1DLFL 3FTGB 3BDYH 3MUGA 2ICWB 4JRLA 1TQTA 3N40P 2F8XC 3O6FB 4N4YB 2AXJA 5I1LA 2H1XA 1MCOH 4EZLA 5JQHC 2X2HA 2XWEA 4G8GA 4C59B 1CDYA 4WO4A 3RWJB 4YGVA 4P3CL 4R3SA 1P6FA 1V05A 2BOBB 4Z1PA 4Z78B 5EU7C 3BEVB 4PQXA 4XCFL 4UIKH 2ZQKA 5D2LF 4RGMC 1NWPA 4PJBB 3U7AA 4H88H 3RDTD 4G6JL 5C86A 2ARJA 3LKNB 3Q0HA 4RSYA 1CDHA 2PWFA 5IJVA 1RU9H 1BFTA 1A2YA 1CF8L 3BSZL 2UV3A 1I53A 2K7PA 5IF0A 1ZT1B 5AW8B 4GW5A 1BMZA 1Z9SA 1TTCA 5IKCB 5JOPE 1LO5B 1MAJA 2X6AA 2BVQA 4PJGA 1CFTA 5FO8A 2BM3A 2P4AB 5F6HI 5G2NA 4UIMA 1RCYA 4L1BA 1NBCA 1E6OH 4P2YA 1KJ2B 3VRIA 2D7MA 1W72B 4W4NA 5AW7B 1J5CA 4QIRA 4XVTL 4DZ8B 1W15A 2P24B 3UP6A 2XTJE 4KY2A 1HU8A 3X3FH 2QFRA 5FXCH 4GUCA 5GQBA 4FNTA 1O75A 3GTVA 4LSQH 3SE9H 3EJRA 3GHPA 5I66A 4XX5A 4QHNB 2DYPD 2DWDB 2FT6A 3UBXI 1DL7H 4NWUH 2JQZA 3WAJA 4Y5YB 1BQKA 1CGTA 3NYKA 4AI7A 3UBXA 1YN6A 2B7DT 2BXYA 3AUWB 4P5SA 2VDQL 4IEFB 4UOQA 3UP1A 2VXSL 1M7IB 3R1GH 3U2JA 2F5BL 2JNZA 2Z8SA 1FO0L 1MRFH 1DLHA 2LW3A 4PJ9C 1TZAA 5FUCC 5L9DH 1F6AA 3I02B 3MCLL 2QL1A 4FNUA 5AW5B 3MLVL 2F5AH 3U7WL 2XG5B 1XH1A 4LZKA 1ECYA 1G9NL 3IXTA 3GRWL 1L7IL 2DWXA 5F44A 3HNVL 4MSWA 1SXNA 3OX8A 2HXAA 2X3BA 4PCYA 5I6MA 2EDHA 4KKAC 1GC1H 3FQXB 4JFXB 2EYRB 1R3KB 3K8KA 2RACA 4GP8B 3RY6A 4KAQH 2BWIA 3ARBA 2I07A 3E9UA 2CLRA 2B4CH 2QHLA 5FYJL 4QRPD 3GHEL 3SO3B 3WS6A 2NY5C 2X4TA 3UJIL 5IB5B 2OTWA 2VOTA 3OC5A 3MRFA 2C4FT 3VU1A 1ETZA 2IWGA 5E6SB 5CJQH 1TCRA 1X5JA 5IW1B 3U9UB 1JVOA 2FJFA 4L9LC 2P49B 1PX8A 4W6XB 1ODAA 4PJCB 1MLCA 3Q06A 1JN6A 1C16B 4RSVA 4PVNA 2CUIA 3MRGB 5D1XC 1NCIA 4HVBA 3HBGA 1O5DT 4FQLH 4Z7QB 2K6ZA 1NCAL 5B3NA 3MOQA 4NM8L 2LV4A 3HZ3A 3F85A 2XBZA 3LQAC 5DD1H 1NCDH 1A7PL 4XPFL 2NYKA 4J6RH 1YDPB 1HI6A 1P84K 4N5EC 4QRUA 3C5JB 5J6GB 1G7JA 5KUMA 3F6IA 3R06A 3V0VA 2O30A 4HC1L 4NJAL 3SYAA 3LNEA 3L13A 3HVDA 5BXFB 1QTYT 5DZVA 3V0GA 3MRIB 2R59A 3KWWB 4JKMA 5HJBA 1VFBA 1QKZL 3H9ZA 4AQAB 1R6VA 3B4NA 1NPUA 5FW8A 5GS2D 1JGUH 3MRCB 1MHEA 4AIOA 1GZQA 1R24B 4JM2C 4OUUA 3RWHB 5DYOA 3KCWA 3I6SA 1OCCB 4K3EH 3E7JA 2EC9U 1OPOA 2ZZUT 5AZUA 1OCOB 1QVOB 5HPMB 1U8IA 1T3FA 3C6LD 5IVXF 1LMIA 3MJGX 3W5MA 1LL1A 4MMXA 3RWCB 2QLYA 3JWOL 1NLDH 4Y8AA 5KVEE 2F7PA 1BAFL 4WJG3 4JFSA 2G2RB 3CBRA 3MBED 3QJUB 4JFDB 3KVDD 3BMWA 5I6XB 4BXSV 3F01A 4OI9A 2HJKB 3CFMA 2ALAA 1FCGA 5JDJA 3PWPD 2OI9B 1AGEB 3MRJA 1G7PA 3PU7A 1A25A 1YPZE 2E9GA 4I48B 3P3UA 4UT9L 3FU7A 1FFRA 3EZ8A 3NSDA 4V2CB 3EGDB 3P0GB 4UILH 3VW3H 3RWIA 3ATBA 3WELA 1RZPA 1NEZB 5D7IF 4TNEA 5F97E 5GRZA 2QVMA 1M7UA 5B7EA 1WZMA 3BZEB 3HC3L 4HISA 4WUUD 1W8OA 3I9IA 5TFSL 5F6HJ 1IM3D 1E9PA 3NJFA 2R56L 4K07A 3SYCA 3CHQA 2FO8A 1CICC 2PTTB 4IJ3B 4ZZKA 4WF7A 1QFWH 2OXHA 2B9AA 1P69B 4CGTA 1BECA 2CMRH 2KLTA 3IS1X 4KNTA 3VFTB 5DK2A 1IAKA 1M4KA 1R3HB 2OMVB 2ATPB 2E56A 4ECNA 5FHAL 3FO1B 1ZDSA 2IQAA 1JI1A 4P23C 3LRKA 4Q74A 4F2MB 2XZAL 2V2WA 5IB3B 2Z93B 4JZNA 2ZOUA 2WMPA 3ARQA 3AG4B 3TN0D 1UURA 2BIMA 3AM8C 4KX9A 4QJ5B 1S9XB 5C92A 3EH4B 4IBSA 3RFZC 4PRAA 3RQ3A 3LRMA 4R0LB 2YPLE 5GGRY 5DVKA 2L7JA 4KKBD 2R51A 4R84A 4JPIB 4TTGA 3A5VA 4YC2C 4ZMLA 1TJGL 3BIAX 5INCB 1FNSL 3PXHA 4L1LA 4MD5B 2Y1VA 3FQNA 4ZD3H 1AHMA 2QR0A 1KPRB 2GJ6A 3U83A 5IOPA 4IHBA 5BRZE 3RDTB 4ZODA 3FH5A 5EZOH 3A4EA 3BVWA 4AY0A 1M05B 2BSBA 3VFMB 4TUUA 2HMIC 3QXDA 2XWBA 4E9RA 4JEGB 5EOCJ 2KZ1B 4CMHC 3QJFA 1QRNA 2LHAA 3QUXC 5EWIL 2I26N 2IAMA 3IMWA 3PDOA 2Y5EA 1PZCA 1PS3A 1FPTH 1OK0A 4MMZC 4QRSB 4Y5XC 1F3DJ 1KLGB 3QIBA 4M8UA 3RU8L 2GPZA 2X9WA 5BPPA 5I1GH 1OAZL 2OCJA 3CPUA 1F6LL 4GRMB 4YFDB 4WK4B 3UIYA 1DJYA 4JZOA 4XNZB 2VLMD 1A1MB 1OCWL 3L3KB 4RAVB 1QNZL 5D5MA 1FV1A 2H3NA 5K69A 3IDXL 3ESVF 3RVTD 4WW1B 4I18B 4ONHA 3WMQA 1GC1C 1E7UA 1Z2KA 4HHAB 3LQMA 3PAUA 4LAJH 1MWOA 4PW4A 2VQ1A 2VDPL 2B4CC 3UMNA 5DJCA 2ICEB 4UCFA 1A9VA 4ANXA 1HS6A 3AQYA 4UDUA 1ZIBA 1T4WA 1KGIA 1LQSR 3UAJA 1XXFC 3JZ7A 4DGIL 1DN0B 1H0DA 1QSEA 5CSZA 3QNXB 1FBIH 3OBAA 4OLUH 4WWOA 3DXAA 1FZMB 3QDMD 4GQ9L 4W9GC 1J1XL 2R1YB 4JR9H 4GUQA 3VYOA 3ZQXA 3PWNA 5GGTA 3DJ9A 4UQ2A 1V7NL 4Y4HA 5D1XE 4JDEA 1RHHA 1TTRA 3ABZA 35C8H 3KNBA 4JCMA 1XB8A 3PUCA 4WKZA 4G80A 5AOJA 3QO0A 4AUJA 4NS0A 4AMXA 1YMHA 3SPHA 1TCMA 4HIXH 1HHGA 3MV11 4Q8BA 4I3SL 1WZ1H 1KEML 2XKNA 3CXDH 3MU3A 4QAWA 5GSRA 4QRPB 3VWKD 4ZMOA 4PJCF 4BH8A 3LZQA 2CALA 4XAWH 1A3RL 4PJ8A 3O9WD 1RXLA 3SPCA 4HJJH 3WJLA 3GHBH 1MFDH 1NGXA 1OE2A 2CO1A 1JRHL 3LRLA 2YGVA 2WV3A 4WDIB 3TONA 3K74B 3FTZA 4WWPA 3HC0B 1QLRA 5AVYB 1ZS8B 4ANUA 2VSKB 2BIPA 3HE7A 3QRBA 3TYFA 4KX7A 4KK6C 3EJYD 1KB5B 2WO3B 4JRYE 5K59E 1ADQL 1PAMA 4AVIA 4JHAL 2EE2A 2NUTB 3MYZA 3CMGA 3VTTA 2P7TA 4Q9QH 2PLTA 1HWHB 1HEJC 1DN2A 2E47A 2W0FB 5HTSA 5C9JB 1P4BH 3AS1A 1PPIA 3MN8A 4LVNC 5HGHB 2OCFD 5DWUH 3ARFC 4JFHD 3QARA 2D03H 1EEZB 3C6SB 4PB9L 1NCJA 4UYQA 4O51A 4U1KB 1IQWL 5FYKD 3IAPA 3RAJL 5JHDE 1NEUA 1MCRA 3QVAA 4MQTB 5IB2A 3OG4B 3TIEB 1K8DB 2YQ2A 1YEDA 3LS4H 4LCUA 4LU5L 4R90H 3NZ8A 2HH0L 5I8EB 4GSQA 5IG7A 5IHZA 1ZV5A 2DBJA 3BJ91 3LN5A 3QDJE 2EUZA 2J12B 1A6UL 1CGVA 2W9EH 1FNGB 1U6AL 4OQTA 3RFRA 1YEIH 3KHQA 4F8QA 1S78D 2LVEA 2WK2A 3QORC 2FYYA 1HQRA 3RA7H 2W1NA 1D5MA 1LNUA 2ZOLA 3BZFA 1IGIL 3CVBA 3L9RA 5E23A 3NDYE 3S5YA 2H8PB 3KEDA 4HQQL 5I5MA 4EQ3A 5IM7B 2ZX9A 2VQUA 4FMFA 1EGJA 4QCIB 3FQ1A 1M56B 3MBEB 1J05B 4BDVA 4LSRL 4NUQA 4HX1A 2FSEB 4OAWB 4X9IA 1TYEB 3HS0A 4X7EC 4ODWB 3OJDA 1T03H 2ESVE 3F7PC 4DTGL 1FUNA 4DP0X 2BNRE 3N41B 1GCFA 1B4JH 3WV0A 2H6OA 5DU7A 4WK0B 4Y7OC 4PRPD 1NAMH 5HJ3B 5KSAC 1AKJA 4G83A 2HTKD 3Q1SL 2AQ1A 1ZSDB 3HI1A 3KLQA 1TETH 2XV0A 3PHSA 4WUUB 5D96B 5I9QC 5ICZA 1D5XB 1I3RA 4FL4C 3A0OA 2D4DA 4NQVA 5KVFL 5IROC 2Y1ZA 4UTBL 3D6GA 3KCPA 4NPYA 5B7FA 3NIFF 4HWBL 1IQDB 1UCTA 4M48L 1JFHA 2WIIA 4DVRL 1N5AA 2XJKA 2CBQA 3AREC 1X4XA 3F83A 3D34A 4NI6A 4QHUB 5ICXB 3L1OL 3FT0A 5E4EC 2X0VA 3PHAA 2GIXA 4ZYKA 4LCCA 3SQBB 4YHLH 3N9GL 3HUJB 1YQ2A 5CUSH 4W9IC 1XF4A 3LN9A 4CU8A 1H8OA 1QZ1A 4X2UA 4EI5C 3RUGB 3DWTA 1Y1DA 4KTYA 5DQDH 3QJZA 2Q1EA 3DI2B 4MJIA 3TN0B 4OV5B 5GZNC 3Q9PA 3QRGL 4DW2L 3K2KA 1ZLSH 4MD4A 3KPRE 1L5GB 3QA3A 1R0AH 4N22A 1JE6A 5D1ZC 2I7SA 3ZE0B 3QEQD 3CQQA 4IOSA 1C9SA 4YSSA 3HG1E 3IBOA 5HI5C 3FU9A 2VW4A 3FQWA 1PZ5B 3GEWB 1OHZA 1H3GA 2AQNA 3UOAB 3VQ1C 5DMKA 3ZXAC 5I16A 1D5ZA 1G7MB 3N43F 3RKPA 1HE8A 1WPCA 1KGJA 3MFFA 1NJ9B 3P3RA 3GTTA 4G3YL 1EHLL 5HYQB 5FO2A 5EDXA 3UADA 5CBAB 3AG2B 4M1CC 3FFCE 5DMIL 2Y7QB 4HWZB 4JCWA 2OJEB 4X0KA 5DJ0A 4YQXL 4A6YA 2UYLA 2UWEE 1XTLA 2NX5D 1MJ7H 4GAAA 1NUFA 3T4AC 4QR7A 5DGQA 2GTZB 2HT2C 1LEKB 2DOCA 3QHFL 5IK3B 4OCRH 3O2WH 3V0WH 4TVPE 4PH8A 2EEFA 1SBSH 1ES0B 1F02I 1INEL 2ZYSA 3DDFA 2YD2A 3I6LD 3DURA 3QFJE 4GRLD 4XVOA 5IVOA 3R7QA 3T6ZA 1CT8B 1ASOA 2DKUA 5C0BA 3UGUA 3ZL4H 5JPMB 4OLXL 5F0JB 1OIOA 5JW3L 4JY5H 5EO9B 3BRFA 1RUKL 2MCMA 2X2JA 3VB9A 4ODVL 3BFWA 5MEQB 1CBVH 5I1JL 5T1DL 1YAZA 4CMMB 4RFOH 3HNTL 2B8OT 5GRXG 1TZIA 4G8GD 1G7HA 3ULUL 3ZHDA 4WO4D 1U8HB 2ITFA 2OMWB 4OGYH 1AFVL 4F7EA 2FGZA 1JOIA 1KGCD 1BQRA 4L3FA 4X9FA 4WNJA 2X4RB 5HYJA 3D50A 1KXTB 3QCVL 2EDXA 5F96H 1EA9C 3DETC 1R75A 4TYUA 2V7NB 4J8RA 3DUUA 4WNQA 3VSTA 4AQ1B 2DQJH 3WGVB 4J2XA 5L7XH 2X4OB 5L88L 1BBJA 1BXXA 1U8MA 3CHPA 4KNUA 1AR1C 3WMPA 2ITDB 5BZXA 4ZO6A 3V4UL 3HI5L 1C5BH 4HEPG 4GKLA 1ZOXA 2CWRA 4KK9C 1UASA 4IMLA 1BQHA 3U4AA 1BZDA 1X5YA 3L3OC 2BS9A 2D9CA 4XPBH 3RX8A 1GKOA 5IZ7A 3HPLA 3LEXA 3OL2A 1WAAE 4OM0H 4WI3A 3AWFA 3TTYA 1OB0A 4ELKB 1X5IA 4BHUI 1QX1A 1MFUA 1NCWH 1WBXB 2CR6A 3DVGB 3VWKB 4WFGD 1IGMH 3HHRB 4BHUA 2XT1B 3CZEA 5IVZA 4X8JA 2WWNA 3O9WB 4OGQC 2XN9E 4AJWA 2BVOB 5C6WH 4D0CA 5J1SC 4JDTH 2AK4B 3BW9A 4N2DA 3JWDH 1CG9B 4X6FB 5ANHA 3NEEA 1YYLH 4HUVA 3NCFB 3ZHKA 2VYRE 5CN3A 2OP4L 5FO9A 2P43B 5FGBA 1ORSA 5IFAL 5DLMH 4N90E 5CEYA 4YXHL 4PLNC 3QPQD 5E1HB 1DVTA 3O2DL 3LN4A 4KUZH 1RPUA 1S7QB 2DQTH 3VXTA 1F2QA 1N6VA 2HLFC 2K7QA 3T65B 2IWFA 1GZPB 2MEJB 3WNKA 4EAEA 3CSTA 4I89A 5EIIB 3OVUB 4A7VA 1Y0LB 2OZ4H 4FMKA 3Q8EA 1M53A 3O45A 4YHNA 2XJLA 1LEIB 1EHAA 1ZLEA 4XN7A 3FJTA 3DX9B 4PRBA 1X5ZA 4FI6A 4K0OA 3EF4A 5D93B 5LWYL 2EVIA 3ARBD 2RB8A 2YXWA 2ADIA 1I8UA 3D48R 3PIQA 2V3DA 3VH8A 2FTAA 2HX7A 3Q2WA 4PMEA 4CDGC 3IWVA 4OCXH 4YDVB 1QPKA 4JN1H 2BDNH 3NZHL 1KGUA 2VXQA 4GPVA 1CQYA 1MJ8H 4MQ7A 1KJ3H 3EJZC 3CVIH 3V5KB 4UV4H 3V52H 4IU2B 4FQJL 4PJDA 4N6RA 3TVMC 4YXKL 3OKDB 2CLVA 3VQ2C 1G6RL 4N8CH 3BH9A 3N41F 4D3CH 1DQMH 1UJ3C 1BVNP 1WTGT 3K2MC 4HSAC 2D73A 1NBZB 5FM5O 4ELDA 4WTQA 3QR1A 1IEAA 2ERJC 3RHWF 1OF2A 4H1LG 1KIPA 3WY3A 3H9HA 3WDIA 43CAB 5DJ2B 2B0SL 4MCMA 1QFUL 2WTRB 4G8IA 4Z7VB 4BQ8A 3NFPA 5T3ZD 2RJMA 3QEGL 3UACA 5FUZH 4W4OC 4ZAKA 3MMEA 3KH4A 1KCRH 1H3WM 1BWMA 4PRPB 2X9XA 3K0WA 4XHJD 4XRCB 5BV7B 1KG0A 3H9SE 2VJ8A 3DOSA 3JT0A 4KROD 4WI0A 5E9NA 2R2HA 1I4FB 4HGKC 4BRJA 3CIAA 4NHUA 1DJGA 3G5ZA 2WVVA 1OSZA 2J8UE 3BP6A 5HDBE 5I17B 4BCXA 1MLBB 5ALCL 1AC0A 4M8VA 3HUJF 3BCFA 2BFGA 1T20B 1CLOL 1MUJA 3GIZL 5DVLA 4K8RC 1HCFX 4A2FA 5IFJA 5EN2A 4MFHA 1IO4C 3RUGF 5FR3A 2X3AA 1MDTA 4L1SA 3EBHA 5D7LA 2OMZB 2RIKA 4JMXA 2IIJA 3QXAB 4TF4A 5DWPA 5I1CH 4PGBB 3X12A 5ESQB 4UQEA 1FL6B 1WGOA 3OAZH 3ZE0F 1PQZA 1KY6A 5DFTA 3V6ZA 3NPZB 3EGXA 1IBGH 1OW0C 3QUKB 2FH6A 1CD9B 4CADB 4JO5A 1OZTG 4YHML 2AABH 2V5YA 3GMRA 2FHBA 1OSEA 3VGAC 4BSVB 4CUCA 4K9EH 1S7SA 1AE6L 1UQSA 4KK8C 1RUML 4KQ4L 3QFGA 4ZFZA 1UKTA 5EOTA 4XN8A 4W6YB 1CLZH 1QUNB 1F00I 1N59B 4H8QA 1FO0A 5KSBA 1AHWB 1N2RB 3DV4A 3GGWA 1DZBA 5DDHA 1AACA 4UQDA 5IBUG 3V4LA 3TEUA 1BVOA 2MCG1 2NX5B 4PUBL 2F19H 5AKRA 4UF7C 4UM8A 1HHJB 4HGMA 5LBSH 4ZMXA 3RVXC 4N2HA 3WFEL 2Z64C 1MCQA 1WEJL 2XZQL 3BZ4B 5TQ0H 3VFOA 3FUIA 1E9QB 3GZQA 4GRLB 3T0EC 4DKEH 1CDUA 3SDXB 4NRZA 4KWUA 2MNUA 5DA4A 4XBPA 4ZUTA 3LKQA 4NKIL 5B1BB 2OMUA 1BZ7A 3MUGB 5C0CE 4CSZA 4CVXB 4XXCC 4NSKA 3VFUB 1LD9A 5I1LB 3UX9B 2N56A 3TO4C 1I8MA 4HMDA 2HUHA 3TTSA 5BZWA 1AY1H 1JS4A 2MPAL 4MNGA 4G8GB 4Z7UE 5I6KA 2QVTA 5I75C 4WO4B 1DDTA 4YGVB 3RZWA 4DQOL 4R3SB 3PQYB 1GPOH 3CFUA 4YHZH 4YE4L 1E7VA 2VISA 2GJ6D 3S8FB 5TDPB 1FFQA 5C0RH 1BM7A 1T04A 1A6VL 5J11B 1OGSA 1TMQA 3DPBA 4E0RA 3FULA 1UD3A 2ARJB 1NZRA 1CXKA 3L4TA 3LS5H 1XZWA 2G0KA 1T2JA 1OAQL 1E5BA 5IJVB 1A2YB 3DLQR 4CW1A 2JV6A 3NFSH 1FRGH 1PNDA 1QRND 5IF0B 5AB2A 2IAMD 2P5EB 4GW5B 3GK8L 2JI3A 1Z9SB 3BVXA 4HC1A 1AZRA 2DQUH 2XXFA 2NY2D 5I8CA 3BX7C 2BVQB 3ES6A 3FL7A 3QIBD 4PJGB 4K55A 1OHQA 1CFTB 4TQ8A 5FO8B 1T2QL 4JAMA 1IX2A 5H4YA 4UIMB 1GW0A 1JVKA 4WSKA 5SWSE 4JGNA 4L48A 3RWFA 1HZHH 4D9LH 5E0FA 2QGEA 5TE4L 1HHKA 2VLJE 4HP5A 3WFDL 3WY4A 3OZ9H 5I66B 2V2XB 1YLBB 1DQJA 1U2CA 4HS3A 1OCRB 4KMQA 4Y8DC 1UACL 2BS71 4PJAF 4YWGL 4GB9A 5JQ6H 4ZW5A 7FABH 1GJWA 3GI8L 3Q3GA 1IC4L 2ATAA 4X6DA 2DL2A 3B5TA 5C3LD 3UBXB 1YN6B 2IANA 2FX8L 1KYUA 2ZCHH 2VRKA 3T0DA 3RIKA 5E6YA 3UAJD 1KEGH 3N42B 1QSED 1RIHH 3EBAA 5FYJU 1ETJA 2VQTA 1DLHB 1AR2A 5DRNA 1F6AB 4Y2DA 4B0MM 3FSZA 1U8NA 3DXAD 4JRFA 1PSKH 5DEFA 5B4MC 5DZNA 4EDWH 1G9ML 1LMKA 4XZUA 3IXTB 4Y4HD 3G7TA 3P9LA 4HCRL 4MSWB 3OX8B 5IHWA 1CE1L 1XH0A 1HSBA 4YX2H 4WSJA 4XR8C 5DSCA 4MA1B 2M1KA 2O5NA 3ARBB 1DBBH 2I07B 4F8PA 2CLRB 4IRZA 1QQDA 4F3FA 3DGDA 4NWTL 4F58H 2CXKA 2Y1YA 2X4TB 3US9A 2J1KA 2OTWB 1FG9C 3KLHD 4LP8A 5A40E 3MRFB 2P9RA 4PJ8D 1HZLA 1ETZB 4G6AD 4MMYA 1TCRB 4HDIA 4L0ZA 3MRBA 1I85C 2XQYA 4X0NA 3PWLA 2FJFB 1A7OH 2XV6B 1MLCB 3EADA 1JN6B 3VRLE 3E8UH 2EDNA 1G5AA 5E56A 4LSPL 5EMYA 1RZGB 4Z7VF 2ZKHL 4J4PA 4G71B 3SY0A 2OL3B 4XCYA 1UZ8A 4AKPA 4Z0BH 4TUKL 5DEZA 3MNWA 1WFJA 1CD1B 1T0MA 2YPKA 4OZGA 5IJKA 1HAUA 2F8IA 1HI6B 2Y6SC 2WYZA 4JO1L 4QRUB 4OGAD 5T8IA 4JFZL 1INDL 1E5ZA 1NKGA 2X41A 3JT2A 5L6YH 1HC1A 3R06B 4PJFA 5D1QC 5D7SL 3ATDA 4G43A 3V0VB 2AJYL 4P07A 1DJZA 2ZUUA 2XZZA 3SE4A 2H0EA 2YXFA 4FJZA 4H8VA 1TJIH 3MLXL 4XVUC 1VFBB 3SBPA 4Z3JA 4U1IA 1GRWA 4XN2A 1E28A 2QT6A 1MHEB 2CAKA 1WGVA 2W9DH 1GZQB 4H8HA 5EPMB 4OUUB 3RWDA 4A2HA 3MNVA 4M62H 4RISH 2AQSA 2QSCL 1NFIA 1TFPA 1U8IB 1T3FB 1M6UA 1SZNA 2VXVL 3MSPA 3O3DA 1CXLA 3T09A 2YQGA 1KWGA 2W91A 3NIGB 4OCWH 4MMXB 1EHNA 1D7CA 4N2KA 1OXYA 3CX5J 2WLJA 4JQXC 5E94A 1NOAA 2GJPA 5E2VH 1S7RA 4C47A 3U6XS 2FLMA 3I84A 5KYNA 2FT8A 3P0YL 3ZBMA 2Y22A 1JF5A 2EXYC 2AEIT 3MRJB 3ZU8A 1FL3A 1G7PB 2BVEA 1ND0A 4XOAA 2J73A 5IGXH 3FU7B 1IJ9A 3PJLA 4ZXBC 4PS4L 3SBWC 1AKJD 4FCAA 5I26A 3RWIB 2FD6H 4JUTA 3VACA 3L6FA 4FF9A 3BPNC 4EUPG 1WG3A 2OSLA 3A6BL 3WFZA 2EE9A 1E9PB 2E7LC 1JXDA 1DEEA 4G9FE 1JHLH 2L0DA 2BZDA 3PDGA 2XFXA 2OXHB 3SDDC 1SJMA 4KO9A 1II4E 3JTBA 2C26A 1PTZA 2DLEA 1ZDQA 1IAKB 4PJXA 1MAML 6TAAA 1A66A 2D31A 3GSNA 1DQIA 4J3VA 2IQAB 4PN6A 4KOCA 4OLZL 4WEMB 2VKWA 3IJYA 5I5RA 4GMSH 2V2WB 1DJSA 4JZNB 4KVPA 4KY1L 3H4FA 1G7QA 3W2DL 4WUKH 4MJID 4TUOA 4PRAB 4KU1A 1TKWB 2RCSH 2NDFA 1O5PA 3IDJA 4ZPTB 1T21A 5GS0L 2CG9X 3PABA 3GXTA 3N91A 5F7MC 4WCYL 2F53A 3OAUL 4F1ZA 3ZUNC 5F1IA 5EEXA 2E8YA 4N1CA 3FQNB 2R1XA 5F7AA 5EF2A 1GH7A 3T71A 5C0AE 2GJ6B 3N44B 5FGCE 2YS4A 3SDAC 5IOPB 2FUQA 2LU4A 2FX7L 3K6IA 1N0XH 4JQIH 4F27A 4JRXA 2ZYRA 3PFUA 2JVUA 3ZSSA 3QXDB 4CC4A 2DIJA 2H2SC 2XWBB 3ME0A 4IRSC 3S0PA 4TRPH 4QLWA 3VQMA 1U41A 3QJFB 1QRNB 1C12A 2IAMB 3VXPA 3PDOB 2DJSA 4OLYH 3CQPA 3BKJH 5IY5B 2NY2B 4F80A 3QIBB 4YSPA 2WKOA 1T5XA 3GM8A 1UD5A 2FWUA 4JZOB 5D5MB 1U91A 5C0BD 1FV1B 2H3NB 3OWRA 2VDOL 4QLRA 1IAOA 5K9KA 1CN4A 4ONHB 4KGJA 1KNOA 2CJUH 1S9KC 2JJSC 3IDUA 4PY8I 4X4KA 1I7UA 5E2UH 1I7RA 2VQ1B 2ED6A 1BZ8A 3N42F 2R4SH 5DJCB 3QYNA 1ZEAL 3NCWA 1BDYA 1F5WA 1JGDA 3FK3A 4HUXA 4UDUB 4N2LA 5HYJD 4JG1L 1EBPA 4K94C 3SOBH 1H0DB 1PD0A 1QSEB 3ZRFC 2DDQL 3B8YA 3IMRA 4DO5A 5J13C 1N4XH 1I9RH 1RZQA 5CSZB 4U1HA 2VDRH 4KJWD 5MHSD 1KF9B 1LE5A 4MYWB 4U6TA 4HJSA 4YDLC 2LAGB 3B1UA 4KHXH 4NZDA 1VEMA 5F8RC 3TFKC 4K4KA 1H9DA 3KBPA 4M7KH 1O9VA 2GT9A 2X6UA 3PWNB 2PPDA 4UQ2B 3RY4A 1A1OA 4Y4HB 3S5ZA 1RHHB 1MFBL 1Q9OA 3MV7E 3QG7L 4WKZB 2I5YL 4GXVH 3K5RA 2CBMA 4G80B 4N25A 3QO0B 4HFWA 4RMSA 3ULVD 1YMHB 4OJAA 1I9IL 1HHGB 1XH3A 4TSAH 4WNSA 7CGTA 4J23A 5IESH 5DJAA 4HWBA 4L4TA 2XKNB 3LHPH 5DMYA 1K6QH 5I19H 2YPLA 3PL6A 5GSRB 5AD0A 3S36L 2YD9A 1QBLL 1QEWA 3GSUA 2COVD 3BQUA 4HALA 4PJ8B 2Z4TA 4L3AA 1YC7A 4W9KC 2CRYA 4F2EA 2YK1L 2WQAA 1NGXB 2FHCA 4Z3IA 4YK4C 2QADD 1VPOH 4AWJC 2WXMA 1QLRB 1HH6A 4I5BB 1RUQL 4ZOBA 5HHMB 3PY9A 3HE7B 1NGQL 5ACZA 3TYFB 4MXQD 2IDCA 4DEPB 3K1DA 2GAZA 4N2IA 4XPGH 3T2QA 4DP2X 2YO3A 5GGVY 1ZHKA 5GJSL 1UWEH 4JGJA 1DZ0A 5D2LE 2P7TB 1G7LA 4XTRD 2R0KH 3LTVA 3EHBB 4OUOA 2BNQA 2ICES 3L7FA 3MX0A 3O6FC 4J12A 5JLZA 3HIZA 2Q7YA 3JYBA 3UBHA 2AJ3A 2CHXA 5KTEL 1Q0YH 4J8QA 2AJSL 1KBVA 4QKXB 4W70A 3M8OH 3RKDD 1ZAGA 2FLRT 1MCDA 4LIQE 1JXFA 1KLFA 1SVZA 5AOKA 3KM1A 1ZTXH 4O51B 4BELD 1XGZA 1TQBB 3O4LE 4F7KA 5IB2B 2XZCL 4J3OH 4LCUB 1YEDB 4LOFA 3BD3A 3NZ8B 2VMFA 4HUCA 2EICA 2C9XA 2R0ZL 5FYLH 1USQA 3HB3D 3QNFA 1NTDA 3SDCA 3U1QA 2W60A 3LN5B 3NIGF 4X9GA 3UMTA 3GPEA 4P04A 5IJDC 5F70A 5T3XH 4AT6B 1O7DC 2J5WA 1BA9A 1KGWA 4KFMA 3B2XA 5CWSA 1E67A 1LO3H 1NLBL 2FYYB 1HQRB 4OQ1A 4TSBL 4XBMA 2R69L 1LNUB 2MIZA 2ZOLB 3BZFB 3L9RB 2HKFL 4L3EA 3VFPA 3WXVL 2EDEA 3GBMH 3P0VH 4YDKL 2DQHL 1EMTL 4P9MH 3SGEI 2NNRA 4BDVB 1TJHH 4LK4A 1RIVL 1WFNA 2IALB 4HX1B 1E5YA 2Z65C 3HS0B 3LDBC 1WZAA 4JJHA 4MBRA 1DLFH 2YN3A 2R1WA 3OJDB 4PGZA 4GAFB 4LVOB 2GHWB 5E5MA 5ETUA 2GTQA 2GI7A 4ZAKD 3ECQA 2E6QA 5FDWA 1AKJB 3IK2A 5JXEA 2J43A 3D33A 3V0HA 4P3CH 3HI1B 4OZFH 3NP3A 3EOBA 5B1JC 1OT1A 1I3RB 4AIEA 2FEEL 2VDNL 4NQVB 4OFVA 1KIRA 5E1IA 3KCPB 4NPYB 1SOQA 4NKDA 3D7PA 2EDDA 1OD9A 1RJYA 2WIIB 4N1HB 2OYKA 1N5AB 3G5VA 1E90A 2B3IA 3F7YA 2V33A 2KDGA 4YFLF 3GDBA 4PY8J 2VJXA 4NN6B 1CF8H 3BSZH 3OKOA 2Y9RT 5D7LD 4ZYKB 1H6UA 2EXTA 4LCCB 1AGDA 5ILTL 4PJIA 1D7BA 3W9DA 2X4QA 5K9OA 5KJ7E 2VMJA 1CD0A 3E6HA 1DP0A 1XF4B 3ETSA 4MASA 1KELL 1JPFA 5TQ2L 2PW1A 1GMEA 5FM8A 3PP4L 3IFPA 4MJIB 1QLEH 1NMAH 3FHQA 3SZKC 4MD4B 3CCHB 3IWUA 3QA3B 3WUWG 3N44F 2R29A 5ECGA 4BFIA 3WNMA 5IEHA 3CE1A 1BIIA 4YEEA 2XVKA 4GW1A 3FQWB 1AQDB 2IH9A 1KC5L 1J9QA 4RFEA 3IPFA 3RILA 5C2BH 1MAKA 5DMKB 4B95C 3NJMA 2DY2A 1CDGA 2CDFA 4ALAL 4JK0D 3H3BC 4PTTA 1ZGLP 1LYQA 3MFFB 3CK0L 2XVBA 5L0QB 1WT5A 1JHKL 4NLHA 1RFDL 2VXSH 2NXZD 4ICWA 4X0KB 5DJ0B 5K93A 1OTSD 5JIQA 4A6YB 2UYLB 4Z7OB 2QELA 2B2XH 4ZUSA 1OE3A 3FRPA 2J6EL 3F5WA 3MCLH 4KKNA 1RI8A 3MLVH 4LMQI 2FEDC 3I9PA 1RL1A 4RMRA 4I3RL 4N2EA 5K9QG 3HLKA 1JK8B 4N2FA 4MLIA 4XNYL 3DURB 3OXRA 1G9NH 2E9WA 3GRWH 3SB3A 2I32A 1L7IH 4MQXC 4LVHB 4PJ7F 5IVXE 3BPOB 3SODB 5C0BB 1OARL 4W9DC 3AG1B 3ALXA 4QGTA 4LFHG 3RB5A 2WLKA 3VGEA 1LWHA 3H42L 3DSNA 1EZVY 2X10A 4MS8C 2N1KA 3LZOA 1TZIB 1G7HB 2JKWA 3GHEH 4NKMA 4AE1A 5KVMC 4MTMA 1WWWX 3VI4F 2X6BA 1U33A 2CR0A 4MCYA 3S88L 4F7EB 4M43L 2OJZH 3D39A 5DUJA 3RVWC 2VZ1A 2EDOA 1FNFA 3BN9D 2WIMA 3FN3A 4AJYV 5HI3C 1P7HL 1WCBA 1V10A 3BAEH 3MREA 3QC6X 2VZUA 5D7IE 1BJ8A 3DUUB 1EZSA 4J8RB 4WNQB 5I18L 4ZOAA 5ESAA 1NCAH 5I6XC 4I13B 1BBJB 1U8MB 2CBPA 3VNZA 4ZX6A 4NM8H 4JQVC 2O72A 3UCQA 3UTTE 1B6UA 4A7QA 1A7PH 4XPFH 2UY7A 3KXFE 1KTRL 2KC0A 3MJ8A 4XP9L 1AD9A 4D8PA 1AOHA 3BP4A 4IMLB 1BQHB 5D72L 2CO3A 4NJAH 3QIUA 2A9DA 4UQ9A 3RWEA 4AVKA 1ZIAA 1YYCA 3HPLB 3LEXB 4ZMPA 4WI4A 5HBBA 1PW3A 3BFQG 2I27N 5EHFA 1EAOA 1S5HA 1J12A 4PB0L 2O6CA 4X6EA 2WOBA 2YQBA 5IVZB 3T2OA 4X8JB 2P52A 4C56A 4IJ3C 4HJUA 4Z23A 2YEVB 4NDMA 2QMJA 4D0CB 1NFAA 3HG1A 1T6BX 4G11A 3BW9B 4NFDA 4TM9A 1TTFA 3S3PA 5E99H 1E8XA 2QADB 4RNRA 4HUVB 2IAND 5CM1A 4NBZB 3F6JA 5FO9B 1KB9K 1ORSB 3JWOH 2ZAGA 3Q7JA 3NSFA 4I7ZC 5CEYB 3HKZA 2WVTA 1BAFH 5C8JA 1O7DE 3ARSA 4MB1A 3LN4B 3RTQA 5KVGH 3FFCA 2J4WL 4Y2DD 1XSIA 3VXTB 3FCUB 4NUJA 4PS8A 3FN9A 4R0LC 1VCBC 4XNXL 1NMBL 3NJNA 1NANH 3KWXA 4TV3A 5C3IA 4Z8FL 3WE6A 1BJ1H 1AZNA 2C3VA 2DZEA 4UT9H 2GK2A 4LAQL 3V6OA 3WDJA 3O45B 4YHNB 1DSYA 4UZUA 4WHYH 2J57A 1Y07A 2OTPA 4PRBB 4IK7A 3PJNA 4O02A 4JMNA 2K8QA 3HC3H 2ADIB 3PIQB 1IBDA 5JIHA 3VH8B 1P7KA 5TFSH 1ZCRA 1X5AA 1GJIA 2R56H 4X99A 1BEYH 4IBTA 3IRPX 4X8CA 1O6VA 2V5SA 2Q7NA 3L3GA 4MQ7B 5GISL 3UL4A 3WIHA 5K1VA 1E9OA 1IFRA 5DC2A 4PWFA 2PPCA 2OMTA 4LSUL 4PJDB 4N6RB 5FHAH 1MIMH 3QCTL 2JCWA 4DQAA 1SN5A 3H56A 4KO5A 3BH9B 3FU5A 1VSCA 4MWFA 2EDRA 3BKCH 2UXGA 2XZAH 3BUDA 4C83A 1KN2H 4J4PD 3C08L 1IEAB 1F13A 1JP5A 2AGJL 1KJVA 1GYVA 1OF2B 2Q2LA 1KIPB 3BD4A 3H9HB 4QT5A 4XNZC 5J0BA 4YBHA 3UTPE 2GG1A 3WN6A 3J07A 4G8IB 3K81A 4I18C 5F93C 1XIWA 4F9PA 2YRZA 4ZAKB 3MMEB 3CZUB 4XPHL 1T7YA 1TJGH 2DJMA 5CD5D 2OAAA 3RGVC 4QTHA 1NSNL 3H54A 4AYEC 5JOPD 2TAAA 3TEXA 2C8NA 3I75A 1C7TA 4Y2OA 1KG0B 4WI0B 3DOSB 3MGTA 2R2HB 4NHUB 3VCLA 3G5ZB 2WVVB 3BP6B 2FUTA 2H32A 4F7PA 4FTVA 1WAAA 2WWMC 3B2VL 1X9RA 4PWEA 3S3CB 1BQUA 3NCJL 4BCYA 1RZ7L 1UXWA 5F7WC 5DZJA 3ML8A 5E4OA 4K9JA 4ANKA 3KH3A 2K45A 3LNIA 1MUJB 3LQZA 4R26L 5IFJB 2FR4A 4K7PX 3S5LB 5EN2B 2A77H 4M7JL 4DPBX 4WI6A 5D7LB 2P5WA 5C97A 2WANA 1E8ZA 4PJCE 5EWIH 3UDWA 4MNQA 5CNHA 4YVUA 1DANT 3JTSA 4JX0A 3KJ4B 5A3ID 3X12B 2CUMA 1NUDA 4Z7QE 3V6ZB 3GMOA 1BVZA 2DI7A 4H0HB 1T0NA 4MZRA 1SJHA 3EGXB 1UJTA 1PZSA 1OCWH 3B9KC 3DYPA 1QNZH 3UPCA 3B83A 4D94A 3OLEA 3TEZA 3IDXH 4P2QA 3DK0A 3GMRB 4UT7H 3HW7A 2QLVB 1S7SB 4NC0B 4ZUVA 1JK9A 4OF8A 5T5FL 1BPLB 5KAQG 4DFIA 2VDPH 1QZNA 4PJ5B 4ZFZB 1MXDA 4WWID 5EOTB 3SGJC 2VDQB 5IMMA 3RIFF 2GBVA 3RPKA 5BS0E 5E5LA 3Q2LA 2E3VA 5AYTA 3TXAA 4N3TA 1FO0B 5DK0A 4G7VL 3G04A 5GRJL 5KSBB 3D3VA 4RDQF 1GS6X 3DV4B 4X7SL 3GGWB 4I0PA 2CUAA 3VM5A 1BZQK 2NXZB 2O26U 3D25A 5A2CA 5SX5K 4HS8L 5E9DA 5ABDE 1JPTL 5J1AA 4JO8A 4MA8L 4P4RA 4UM8B 2CUHA 1NPJA 4FKEA 3S48A 1J1XH 2ZPKL 3TBWA 3L5XL 3MHZA 2DLIA 4POZD 5F3BA 3VFOB 5HYFA 2G3NA 1A8JH 1CR9L 1VERA 1LLAA 3MRQA 3R18A 4AGPA 4WWKA 1V7NH 2VT0A 2XXMB 4JFDE 4A68A 2L7UA 2QVFB 4XBPB 4ZUTB 3LKQB 4HT1H 2OMUB 1BZ7B 4N2CA 5C0JA 3VJ6B 4NSKB 3GNML 3K6NA 1LD9B 2F58H 2BFVL 3QI9A 4Y5VA 1I8MB 2HX8A 2VERA 1KEMH 5BZWB 2CJ3A 3H4HA 2F53D 1XEUA 3F2LA 5HDLA 2PP7A 1A3RH 2HFGL 3L48A 2EH7H 1FH2A 2VISB 3C6LC 5D71L 3LMJL 3MRMA 2PO6A 1JRHH 3ARDA 4PJHA 2OULB 5TDOA 2OM5A 1T04B 2VMCA 4E0RB 3DPBB 3BN3B 4OIFA 5BCAA 2UXTA 3FT9A 3MBEC 2NT0A 4JRXD 1QA9A 2HFEA 5D55A 4KJQD 2Q7AA 1R3LA 1ADQH 4CW1B 3JWOC 1Z0NA 4JHAH 5F3HA 3A6CL 3ULVF 5KVEL 3GLZA 4B41A 2VUKA 3VD9A 3APMA 3D08A 5I8CB 1IC7L 3ES6B 5FYKH 1V3JA 2O5ZL 3K7UA 4F2ME 3OHMB 4JAMB 1PLBA 1NMCB 1E4WH 2WQWA 2RFXA 3BUBA 1AS8A 4KI1A 3RWFB 5JTWA 1SEBA 2ED9A 3MDJA 2C9AA 1HH9A 4I3GA 4LRIC 1IQWH 4PB9H 4YHPA 5D96C 3FCBA 1HHKB 5JMRA 2PXYC 3V4VH 4B5EA 4FFTA 4LU5H 4WTZA 3CPLA 2G75A 5I8OL 3V4PL 1DQJB 2NQ3A 4HS3B 4PG2C 4F15B 3ZHNA 4YDJA 1J1OL 1A6UH 4A2DA 1U6AH 3FN0H 3GKZA 2EEBA 5DFVC 1E8YA 1UKQA 3Q3GB 3BWUF 4X6DB 3GUTA 5KOMC 5C09E 1DE4A 2VDML 2IANB 1ID5I 2XRAL 5FKAA 1IGIH 2PR9A 3FONA 4HQQH 1LJMA 3OKNA 1IKOP 4XO9A 3T3MF 3GJFK 1MZZA 1HXMA 3AU0A 4POYA 4LOVA 5DRNB 4LSRH 1KCUL 3FMGL 1U8NB 3UTZB 4J3OF 1JYWA 3GTNA 3OF6A 3RVUD 3VTMA 4ONOA 1AJ7L 2X12A 5B3JE 4KKBC 5DEFB 2VE6A 2JQMA 4MJ4A 2E9IA 4LPTA 3T08A 3MXVL 1AKPA 1AGFA 4XZUB 3S8GB 4C8XA 3OQRA 2WKLA 3OV6A 3P9LB 4LLWA 2VGLM 4CILA 1HSBB 1X5FA 2C9UA 1F3JA 3Q1SH 2P8PA 1CGUA 2IAAC 1G9EA 5DSCB 4BXVA 4L4TD 4F3FB 1QQDB 3V10A 3UXFA 4A7UA 4ATWA 2YPLD 2ZWKA 1IGYA 3PL6D 4CSPA 5KVFH 4UTBH 1KBKA 1JJUA 2DBLL 3FTWA 4X9BA 3X3GL 1OM9A 4JFUA 3BQUD 3HE6C 4M9PA 1U93A 2B59A 4M48H 3TPUA 3APCA 4Z7UA 4MMYB 4DVRH 4HDIB 2MOGA 5AVWB 3MRBB 1KDIA 3MNDA 3PWLB 3L1OH 1PLGL 1CGSL 3CFEA 4BZ1L 2HSIA 2X28A 1JIBA 4LCYA 3N9GH 2JXMA 3M1CA 1E4KA 1K5WA 2LTQB 3SY0B 4XCYB 1UZ8B 4IGBA 5C0DA 2R7EA 3MNWB 4RIRA 3ARGA 3NFNA 3QRGH 3P9WB 1T0MB 2YPKB 4M29A 4DW2H 3RVTC 4OZGB 2BNQD 1QATA 4CJ1A 2J1YA 1E4XL 5AKSA 4PJFB 1A0QH 4E9WA 3IGKA 4R7NA 5F7DA 4XVJL 2MNJB 3FT4A 4GP4B 2PWEA 1EZLA 3BT0A 3ILPA 4P99A 2VRAA 4AM0Q 1YJDC 4LF3A 4U1IB 4QO1A 4DN4L 1AZCA 1OO2A 3BHBA 1E28B 5KS9F 4O2FA 4JHVA 3SDCD 1EHLH 3MNVB 2YEQA 3LXCA 5KZCD 3TF7C 1R3IL 2EKJA 3N55A 1A4CA 1NFIB 4L8BA 3HCVA 4APXA 1RIUL 4YQXH 3LOWA 3O3DB 3LPOA 4L3ED 4IRJC 3QHFH 5FGSA 3AAZA 3G3LA 5E94B 5D6CA 2Q9OA 4IW4C 5KBMA 1S7RB 1UFUA 1INEH 1HHHA 3L4YA 3IFOA 4Z3FA 3X11A 1VFMA 5I1KL 2FE0A 3KLSA 3DPDA 1E0OB 3KBEA 1PEWA 5I1AA 5JW3H 4KO7A 1FL3B 3UO8B 3C5ZA 3GSXA 4ODVH 3EJQA 4I4WA 5H8DA 5T1DH 3VWKC 2G9HA 5FLVA 1ZLWK 3EO0A 1DJXA 3QQ3A 3ULUH 3LQAL 3KPOA 1CL7L 5JXED 3O9WC 3L6FB 4YSTA 4I9WD 2OSLB 3P3YA 3Q5TA 5ACLA 3F58H 1DEEB 3D12B 3QCVH 4X7TA 5KVDL 1PFCA 4GUPA 5CGTA 2XFXB 3HR6A 3BT2L 1QABA 4BWTA 5JNYB 1E65A 2HT3D 3ZL1A 4DK5A 2WKGA 5I74B 3K8MA 2VC2L 3EYVA 4WKXA 4F8NA 4AYSA 4PJXB 5LG6A 5I6LA 4GMTL 3KYMA 3GSNB 3LPGA 3DVIA 4LARH 2W5PA 3V4UH 5E95B 3HI5H 4L05A 3IJYB 4LLMA 2D0GA 4JKPL 4XI5D 1G7QB 3CFJA 4U1SA 2NZ9D 4TUOB 1J7VR 2BOCB 2V0AA 4M5TA 3ZTDC 1BZ9A 2GKIA 2IH3A 3KD4A 3JWNH 1SQMA 5D93C 5AW6B 5GGSY 3IDJB 3QBTB 1T21B 4WW2C 2FECL 3ZHFA 4HZ1A 4CNIA 2AXFA 4P48A 2F53B 5KBKA 4IHOA 2AXWA 4IMKC 5F1IB 1IZJA 2R1XB 3Q6FA 1S78C 1MWAA 1XCQA 5I28A 1VENA 5D7JA 4WUUE 3UJJL 3BDYL 1KXVC 3RNQA 1L9RA 2HUEA 1NGWA 4WSGA 3U0PA 1J9SA 1KOAA 2D0HA 5GSVA 4N8VA 4XMKL 1MCOL 2OP4H 3J27A 1RK0A 3MNMA 5IFAH 5LGYA 4FFVD 3QZPA 4TNWK 4JRXB 4WFHD 2Z7ZA 2AANA 3O2DH 1H3TA 3M1BA 3KGRA 3HG4A 4XAKD 5J3HD 1C12B 3VXPB 2APFA 3HRZA 4QRTA 3WKNA 1CIDA 3U6RA 3HUJE 4HF5L 2A9AA 3NJKA 5F9OL 4PY7A 4K5NA 4H88L 3ESMA 4N2MA 1T5XB 3LNHA 1Z32X 4JDVA 3RUGE 1GR7A 3ZKQD 4RWYL 2HTKC 5BV7C 3MUZ1 4OF5A 1U91B 1U3NA 4ZS7L 3WBDA 1RU9L 4LSTL 1A6TA 3PNWA 4PGEA 1IAOB 5K9KB 2Y24A 5CP3A 3RI5F 1L9TA 5M94B 4KJPD 3K71A 2WC7A 1KNOB 4GKOA 1T1YA 3NPSB 4X6DF 2AMGA 2EE0A 2ESVD 3ZE0E 1S7WA 2AEOA 1I7UB 3CC1A 2H26A 1LK3L 1I7RB 3NZHH 4EIZC 4OZIA 3TA4D 1E5UI 5I0DA 3FB5A 1UA3A 1JGDB 1R4XA 3BIKB 4HUXB 4Z5RA 4RFNB 4OCMC 2KUTA 4UB0H 4YXKH 4ETYA 3X3FL 1G6RH 4G9FA 3SE9L 4U1HB 4PWKA 1LE5B 3LAFA 4X50A 4E36A 1G0DA 3HAEA 5L2KB 4GEIA 3MRDA 3SPVA 4AMKH 1HCYA 2DRUA 2XPZA 2GT9B 3HVNA 3VI3F 3D52A 1QFUH 2BHZA 1A1OB 3CSPA 1UD6A 3GXDA 1Q9OB 1RZKH 3KWUA 2CKBL 1XB6A 3F62A 1IV8A 3R1GL 4NO0A 4AV4A 3QIUD 4HFWB 4ZT1A 1XH3B 1AGCA 3ZLQC 1OGAA 2HTLD 5DJAB 2F5AL 2Y06L 4L4TB 4AYFA 2PPAA 2X40A 3NCXA 3QPKA 2YPLB 3PL6B 4XXWC 5J57B 5AD0B 2GC4C 5DO2C 1Z3RA 2D7PA 2VERN 4JPSA 4YH6A 5ALCH 1AHWC 2DM7A 4D2NA 1QEWB 1D5BA 3GSUB 4UNIA 3BQUB 3UJTL 3VFVA 2Y3AA 2V8MA 3BWZA 3HG1D 1VGKA 3AWGA 5I30L 4HKZA 1CLOH 4MB5A 3GIZH 1GC1L 3UZEA 3FO2A 3F00A 4KAQL 1FNHA 1KFGA 3AVEA 4AC4A 1HH6B 5F71A 2B4CL 3D06A 3WO3B 5ACZB 2QPUA 1M7DA 1UD2A 3AC0A 1AO7E 2GAZB 4UDTA 5FCUL 1JGLL 3FQ4A 3FFCD 4ZQTA 2ZF9A 4PJFF 1IC5H 1ZHKB 3AXIA 1CGWA 1CFSA 1M1XA 1G7LB 4TVPL 4X8XA 1J0HA 1PGRB 2BNQB 2EXWC 3MX0B 5JLZB 3T0BA 1Y6NR 1ZT4A 2Q7YB 2AJ3B 4W9FC 2IBBA 4AW7A 5CSBA 1XVSA 5CEZL 5C1MB 1HESA 2B08A 4ES8A 1KLFB 1AE6H 1O7SA 1CLVA 1RUMH 4KQ4H 1KXQE 4FX5A 5IMOA 4K5MA 5DD1L 1AIZA 2W60B 5J11C 1MHHA 4DVBA 3B7RL 1ZLDA 4N28A 5KSVA 4LGPB 3TYGL 2Y0SA 1DBAL 3GMNA 5CCHE 3BQVA 1RURL 5CWSB 2IBZX 1A3LL 3DSFL 2AK4E 3FYEB 3S9DB 2X3CA 4PUBH 2W88A 5KOVC 2IVFC 4L3EB 1KENL 3VFPB 1DVZA 3DMMA 3WFEH 4DN3L 1JGUL 5DEJA 1WEJH 2XZQH 2C3XA 2AI0L 3OHXA 2C5DC 2CK0L 3W82A 2DWEA 3L1FA 5HGBA 2HKAA 3QUMA 1I8AA 2R1WB 4NKIH 5GGUA 3WL9A 4BGDA 3GSVA 5ETUB 5GZOC 2UZPA 1XIWD 3JTTA 4LLQA 4JFHE 1NLDL 2BRRL 2MPAH 3JWNC 3L7EA 3WXWH 4LHUA 5FDWB 1CDBA 4DQOH 3STZA 1RPQA 2F7QA 3MV7A 3EOBB 4YE4H 5D6DA 1BWWA 4U6VL 3PREA 2VR5A 5JOFB 1PD6A 4FTVD 1KIRB 1T5KA 5KG9A 4PJXF 4NKDB 2EACA 1WCQA 1FNEA 4J1UA 3DO3A 3Q8CA 1HK6A 1RJYB 4UTCA 2Z7YA 3G5VB 4FQIH 4KOBA 3F7YB 4GAJL 4UILL 3VW3L 4IDLA 1OAQH 5F88A 4N26A 1QG3A 4FFZL 1KYOK 3OKOB 2YSSA 5K5YA 2P5WD 3B7UX 2AITA 1AGDB 1T1WA 1OY3B 3GK8H 4MNQD 2X4QB 3CVHL 4PJIB 3W9DB 3IGFA 4LSVL 2XNAA 5K9OB 1YZZA 1U8OA 3E6HB 5B39A 2DICA 3KEHA 1T2XA 1FFTB 7PAZA 4F33A 1JPFB 2PW1B 1TZOA 2APBA 1T2QH 4DH2A 1QFWL 3IFPB 4RGND 1H6EA 3KS0J 3B56A 5J12B 3OKEA 3ZKXB 3KDMA 5KBDA 2CH8A 1OALA 4MA1C 1DANU 4MVBC 4XMPH 3TO2A 2NMSA 5GRYA 3ARBC 4Z7VE 5LAXB 5TE4H 4P2QD 4BFIB 5IEHB 3RL2A 3WFDH 1BIIB 2V7HA 3WS6C 2A6DA 4GW1B 4KV5F 4PRPE 4RFEB 43C9A 5DRWA 1MFCL 1UACH 4ZOEA 1B4RA 4O58L 1OP9A 1CTOA 2CDFB 1ZXQA 4PTTB 3BGFB 1CF1A 1IC4H 4PP1D 1ACXA 3EZJB 4U0QB 3RIAK 3V7AE 4BUQA 1BVNT 5FLUA 1L6ZA 2FX8H 3SN6N 3D3VD 3QUGA 2D3NA 4FXKA 3WNJA 1EDHA 4EBQL 5EF3A 4Z7NB 3DHPA 5CF3A 1U8LA 5E9DD 1F3RB 1JNHA 4G42A 4D8OA 1HJBC 4S1QL 1GXEA 3FRPB 4E9XA 3F5WB 2WKOF 4LCWA 1HYSC 3BWAB 4POUB 1MCJA 5DVPA 3V8CA 4FI8A 5FA4A 4TOYH 1NIEA 4JW3A 5ANMA 5JIPA 4QOKE 4CJ0A 1G9MH 3OXRB 4HOMA 1KCKA 1N0LB 4WWKD 3GD1C 5B8CA 1B0RA 5HHNA 1F56A 2YUZA 1J10A 4HCRH 4XHJC 2PYFA 4KROC 3BCDA 3DBSA 1RZKC 3W3BA 5JPNC 1F4HA 1E27A 2J56A 3DSNB 1IBFA 2WJ5A 3PCYA 4K7PL 1FPTL 5EOQL 1JCKA 4NKMB 4R8WL 1VACA 1L0QA 4UTAL 4MCYB 1BJMA 2DQEH 4YNYA 4GQQA 3D39B 3QAZB 3WTWA 3GXNA 4QGYA 4XC3L 2PO6D 3ARDD 3G5YA 4MMXC 3BAKA 1WCBB 4G7QB 4KXZH 4PBDA 3MREB 5BVJA 4BRVA 2J72A 1SJEA 5B21A 4LSPH 1U3ZA 4KI5F 5JHBA 5AKVA 2PPFA 2ZKHH 2B5IC 4HPHA 5IEKB 5ESAB 4ETQA 1JDCA 3OAWA 2NX5E 1S2EA 2IPUG 3KLKA 1RZIA 4TUKH 3VVVA 2FX9L 1ETB1 4P5KA 2B77A 3VVWA 3ZE1B 2UY7B 4HKBA 3MJ8B 1FAKT 2ZT9C 1OP3K 1AD9B 3PHOA 4D8PB 3BP4B 4JO1H 3HFML 1G7IA 5DJYA 3I6LE 4JFZH 2NPLX 1INDH 4EZJA 2NYYD 3SJVB 5AALA 3SDXE 5D7SH 4YR6A 3IF1A 3QIUB 2YEZA 2AJYH 3RWEB 1A6AB 2MQGA 4RCAA 5GPRA 1ZHLA 1JUFA 3MLXH 5EEVA 3RB7A 4B7LA 1S7UA 1S5HB 4H5SA 3OZKA 5F89A 4C56B 3FH8A 1XCXA 2H6UA 3AXHA 3P40A 1JXKA 4NDMB 4JFVA 2QSCH 3PQYE 35C8L 4IIQA 1AZZC 2VXVH 2GJZA 3CZKA 2EE3A 3BLKA 4RNRB 4LLDA 4G1MB 2X1QA 1VFUA 4OW6A 2V5TA 4WO0A 1P7BA 4TL4A 5C8JB 4R4FL 1M71A 3RTQB 1A22B 4A2MA 3FFCB 2O5YL 4PLJD 2WW8A 1BXVA 4NUJB 2WLLA 1L3WA 3OF6D 3KW8A 5FW7A 4NM4L 4Y9EA 2IEPA 4JO3L 2P5EE 3EDKA 1IRAY 2WYHA 1RPKA 4B5ZA 3B2DC 4Y16A 4PJGE 3WE6B 2C3VB 3WCYA 2QPSA 1X6NA 4PS4H 1M2OA 4LQFL 1T4KA 1N26A 2VZTA 4NC1E 4QF1A 4O02B 5HHXL 2EEDA 3WOVA 1RSFA 1YY8A 5IFHL 1P7KB 3A6BH 3ET9F 4X99B 4FJYA 3IJ9A 2I7OA 5CLWA 3VDCA 3L3GB 1BF8A 2Z7WA 3T6VA 1E9OB 1OCZB 2KBGA 2OMTB 1MAMH 1ZJBA 4LCIL 5DZAA 1GTFA 3DK2A 3LS4L 4R90L 2ALWA 3CU7A 5LNDA 3ULUF 2NY2C 4W9JC 1EO8L 3QIBC 5DHVA 1SLVA 2O6DA 1G1YA 5KN5A 4MWFB 5EZJA 3T9WA 4C83B 4ZMYA 4KY1H 1TFHA 4PS7A 1UXSA 4IGBD 5D7IA 3V0EA 3W2DH 4M5SA 1KJVB 3AY2A 3ARGD 4MZ3A 4QT5B 2X9ZA 4X9HA 4PV8A 4ZW8A 3AS2A 1XIWB 4LDEB 2MKLC 5GS0H 3UTTA 3NP4A 5KBLA 4QTHB 3KXFA 3OAUH 2VAJA 3I75B 4Y2OB 2Q8AH 3MGTB 5B1AB 2WXIA 3BO8A 4Z3HA 3VCLB 2NR6A 5HP5A 1JNNL 5KWYC 3WU1A 3IVKA 2H32B 4F7PB 4YFEA 4FTVB 2XHNA 4NQQA 3M86A 4N0FB 3UAJC 4H2CA 1I7TA 2X4PA 3W38A 3CUPA 3ZDYF 2VLJD 1UXWB 2GC7C 1FHGA 4PJIF 1MDAA 1P1VA 3GZOA 4ONGH 3S2CA 2FX7H 4NN7B 1OTUD 3LQZB 1NGPH 4R6UA 4YHYB 3BEWA 3N1GC 4OJYA 3RWJA 3WG7B 2VSDA 4GFXA 4AGNA 5JO5A 1TETL 2P5WB 4W9CC 1OSPL 2E5EA 1R5IA 2IO5A 2YFNA 5HHOA 4MNQB 3TT1H 5B38A 3JTSB 2WNKA 1EEQA 4QHPA 4KK5D 1YSOA 4Y4HC 2EDKA 4P2OB 4X4ME 4RGNB 3GMOB 4Z7AA 1ZLUK 5GRWA 1T0NB 2FZ3B 1SJHB 4N68A 1YMMA 2BK8A 1JFQL 4P49A 2NY3B 4BIKA 2VDOH 5T3ZE 4P2QB 3C5ZD 4ANWA 3GBEA 3TIDA 4PV9A 1ZT1A 4KNSA 4YHLL 4R7VA 4ZUVB 1J48A 1JK9B 3ILQD 5J89A 1LO5A 4PJ8C 4FHBD 2LABA 4G6AC 5DQDL 1PIFA 3WJLC 5IMMB 1BBDL 1ZEAH 1NEZG 4X5WA 1QSFB 3B7YA 4U6HA 5DK0B 3G04B 4YSEA 3D3VB 1DQLL 4I0PB 4QHMA 1H3PL 2P24A 3MZTA 4NXSA 4N0CD 3CN4A 1HXKA 2YPVL 2DDQH 5E9DB 1CJYA 3AWEA 1FH5L 3M7OA 3MAWA 5AVQB 5J1AB 2IF7A 2X6MA 4P4RB 1UM4H 1WWAX 3NIGE 3TBWB 1HKLL 1NM4A 4Y5YA 5F3BB 3GLDA 4OJFL 3ZQWA 5E1QA 5EEUA 2QVKA 4OGAC 3CZSA 4K8RL 4LDCA 2DIEA 4WWKB 1QAWA 3EDEA 3TESA 2P1YA 1MFBH 2OKMA 3LEVL 4IEFA 3QG7H 5AUMA 5C0JB 3V9EA 1GSKA 2OW7A 1TTGA 3GF8A 1I9IH 2NY6D 1TQBC 4ZMWA 2B15A 1U2HA 3KJ6L 3QI9B 4Y5VB 2UZYB 5IG7B 4I87A 2ZYIA 3S36H 1H3VA