5ABAA

Structure of the p53 cancer mutant y220c with bound small-molecule stabilizer phikan5149
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Transcription
source organism Homo sapiens
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5abaA00
4LOEA 2XWRA 4AGOA 4IBYA 3US0A 1E50A 2J1WA 3Q06A 1EAQA 5AOJA 3Q01A 2RMNA 1LJMA 2J1YA 5KBDA 4LO9A 2GEQA 3D05A 4L18A 2IOOA 1GZHC 4IBVA 3EXJA 1HJCA 2MEJB 4IBQA 3QYNA 4AGMA 3VD1A 4GUQA 2J1ZA 3Q05A 1TUPA 3WTYA 3IGLA 1EANA 2ATAA 2BINA 1HU8A 4LOFA 5BUAA 3US1A 4AGQA 3D0AA 3TS8A 3D06A 1KZYA 4L0YA 4MZRA 1T4WA 2WGXA 5G4MA 1GZHA 2P52A 4IBWA 2OCJA 3EXLA 4HJEA 5AOIA 2X0VA 5ECGA 3WTWA 4KVPA 4QO1B 4IBTA 4XR8C 3VD2A 4L0ZA 3IGKA 4AGNA 5ABAA 2PCXA 1CO1A 3WTUA 1IO4C 2BIMA 5AOLA 3WTXA 4IJTA 2X0UA 5LGYA 5LAPA 4GUOA 4MZIA 2FEJA 2YBGA 5A7BA 2AHIA 5G4OA 1TSRA 5AB9A 4IBSA 4G82A 1HJBC 2H1LM 4IBZA 1UOLA 2J20A 4A63A 2BIPA 2J1XA 3QYMA 2IOIA 3VD0A 3D08A 4G83A 3KMDA 5AOKA 1EAOA 2AC0A 3D09A 4IBUA 3WTVA 1YCSA 3ZMEA 5AOMA 3WTSA 2J21A 2J6WA 2X0WA 3WU1A 4AGPA 4AGLA 2BIQA 1H9DA 2XWCA 2VUKA 2IOMA 3D07A 2BIOA 5G4NA 1CMOA 2ADYA 3WTTA 3KZ8A
chains in the Genus database with same CATH superfamily
4IRZA 3QEQD 5ESAB 4TRPL 3OR7A 2OMBA 3KLKA 4BDVA 2V5TA 3GMPA 4AYFA 1XH3B 3OAZH 5I15L 2WKLA 4JDTH 1NC2B 1DBKL 3EO9H 1DZBA 3HPJA 1H9VA 2FCBA 4F8NA 1X4ZA 4YIQA 1EEYB 3U6XS 4ZMNA 4X4KA 1R24B 4HUCA 1QSFD 1XGQA 1CIDA 4HWZA 2D3VA 4JG0H 2R39A 3NTCH 1GZPA 4H0GA 4M61B 5C6TL 2QR0B 4EUPA 5DT1L 4XNDA 1C7SA 1UG9A 3K71B 2W0LA 1DSWA 3RL1A 1EEZA 2AEOA 3RJQB 3MACH 2X70B 2EXYC 5D1ZA 5J8OA 4XNAA 4PGBB 2FEEI 5DWUL 3BRGC 4JFPB 4NC1E 1IQWH 5TH2A 2OXGB 5I1IL 2NY7L 3S7GA 3SBRA 5CJXC 2Z91B 4LSPL 1CL7I 4R26L 3TH4T 1VA9A 3FQXB 2VL4A 4LEOA 4V1DB 1KGIA 3ARGA 5A43C 3T6ZA 1LTXA 1TVHA 4YHZH 5CEZD 3OZKA 3T0EE 3L3KA 5GRVK 3DOSB 3QZWA 3UH8A 4HJEA 2CBPA 4UWQB 1TJIL 2Z92A 2UZYB 1FZKA 4U1KB 4UQCA 5CBAA 3Q2VA 4G1EB 3TTYA 4HIPA 4GLRI 1KULA 3LCYA 3BP4A 1EDQA 4M1GL 1YNLL 1NGXA 4L9LB 3BD4A 2AAVA 4AENA 2X9ZA 3KEDA 2IPKA 1JF5A 1FL6A 4WW2A 3ZDYF 3UMNA 5EUOE 4KUCD 1BEYH 1NFDE 4UV7H 3X3FH 1RVFH 3X11A 5I0ZA 1J8RA 2YOCA 3QQ4B 4L3CB 3V7AE 4PJEA 3V4PL 2QVTA 1N64H 1OP3K 4QY8A 1N70A 4KV5F 4X9BA 3RWHB 2X4QA 2BM3A 3T3PB 4A2FA 1BYPA 2YHGA 3E1F1 5HDOA 1NCIA 1QBBA 1U3HB 4HV8B 1EGJA 2NXZB 1TZHB 5GHWH 5I8EB 3W81A 5EN2A 2C7FA 4OKVB 2DQTH 4XN5A 2WZPA 4HKXA 1KDIA 4IOSA 4DN4L 4BHUI 3NJFA 2RQ8A 3IXTB 1E30A 4FXKB 1IGML 2NR6A 4X0KA 2FUQA 3BPLC 4Z76B 4NGHL 5A7EA 3BAEH 3PUCA 3PPEA 1XMWA 5JA8B 1CFQA 4BFBD 1EWHA 4LK4A 4YUEH 5T1DL 1DL7L 3SSGA 5DHXB 2HKHL 3L9RA 4DK6A 5F7UA 4MBRA 3U7YL 3HI6H 2VQUA 4YDKH 3NVQA 2FBJL 3U9UA 2AK1H 4KZEH 3TEWA 3TYGL 1R3IL 4M1CD 4PWJA 5F7DA 3VXPB 5GGUB 1J48A 4GIOA 1BVNP 3DRQA 2ATPB 4H1LH 4WENB 4C56D 1A3LH 4MMYB 2EEDA 2GABA 3QI9B 1FRGH 5GRWA 3F7LA 1J05A 1J1OH 4A6YA 4HIXL 4MB4A 4NJAL 5E0FA 4BQ6A 4IKKA 2AQPA 1IAIL 3O8XD 2VDRH 4IBVA 2OK0H 5D55A 1EHLH 3INOA 4R4BA 1B6UA 5JYLA 3G5YA 3PAYA 3TIEB 2DMBA 4Y1AB 2EIDA 3M86A 3IXAA 2ZJSL 4P4RB 2HRHA 43C9A 4QDGA 4AI7A 2EUVA 2WV3A 3G9VA 1CPUA 1Q1PA 4GKNA 5EU6D 1ACYL 2JJUA 1AO7E 1ZHKB 1XV8A 3MA7B 4JPVL 4RMBA 4UT6L 2X4UA 3UTQA 2IPUG 1F3DH 5DRNB 1F13A 3MLVL 5DO2D 4WW2B 4FYRA 4KH2A 3EDFA 4LNRA 4YDZA 4HBQA 5L88L 1U8KA 1WWCA 3J7HA 2IBZY 4UNVA 3DWTA 3KPLA 4H25A 5FS5A 5GIRA 2NNAB 4WHYH 4KDTC 2Q3AA 3W57A 5HHOB 1HZHH 1AHMA 3LXUX 1NCDL 4LRNL 3ZZ1A 4NM4H 1BMWA 4KK5C 1EDHA 1P84K 3G5XB 3K6FA 3E80A 3MRCB 2HLFC 4J3OC 2DQJH 3RX7A 4HZ1A 5HYIA 4UTAL 3VGEA 1EX0A 1XGRA 2BCKA 3L4YA 4YHIA 2DBLL 5AVRB 1WT5A 1ZANH 3AWGA 3KJ4C 4MQXC 4KJQC 2OW6A 1CFTB 3AAZB 3QFJD 1NSNH 2GFBB 5FUOL 4TVPL 1EEYA 4U4BA 3DJSA 5L6YL 1S46A 3BVXA 4YGVA 5AD0B 3DI3B 4HWBL 2DS4A 4U1LA 3UADA 5DMJB 1MHPL 2F0CA 3C08H 3ZE0B 4K5LA 3QG7H 4JN2A 3C9NB 1HSAB 4PWFA 4UB0L 2H6UA 3CXFA 2VB5A 5T5NF 3ZMEA 3IDNB 3UAJC 2OL3A 1H3WM 1OB1A 5K33A 1V54B 4FFWD 3VI3A 5B39G 4HG4K 4NO3A 2WVTA 3VSVA 3RIKA 1YNKL 2C9QA 4G7RB 3VI4E 4U6YB 5ESAA 2WNXA 1QFPA 1MHEA 1N19A 1QW9A 4DHLA 4NRZB 3QC5X 5ESQA 2HG5B 3CMOL 4MSWB 1CTMA 4IIQA 4BH8B 1JRHL 4G8EB 4EVNA 1GJUA 3AY2A 1PZCA 2YFOA 1P4IL 4BCYA 1AHWA 3R19A 3II3A 5AOJA 2WSKA 4JJ5A 2YPKA 3CC5B 4XN9A 4D9LH 2CIKA 3FUFA 5FM5O 1K72A 2FJFA 1TQTA 3GBMH 1L7IH 1T7XA 2IDUA 2X9YA 1A6UH 4LL4A 2V3EA 2Z8RA 3ARGD 2R56H 2JFCA 2VLRE 5L0QC 2WP3T 5D1QB 4HPYH 1S9KC 1U8KB 1RIUH 2NQ3A 2P43B 4YMPA 4JFFB 3RVXC 4XMWA 4ZOAA 4CSSA 2IPKB 1FL6B 2X41A 3KPLB 2VQ4A 4Q0XH 3QNZB 2G5BA 4UTAA 2VQTA 3DTXB 5KSBA 1LK3L 2WYZA 2AGJH 4K8RD 4WHDA 1UD8A 1V7NL 4HLEA 3T2PA 2PXYC 3DGGB 3DK0A 5DJZA 4NJ9H 1UWEH 3GS0A 5I1EH 4WRLA 3L3IB 3QZWB 4NZRH 4QJ5B 1TZHA 3ZGHA 1NFDB 3UG3A 1MPAH 3ZE2E 1ES0A 4U7MA 3MLVH 3VXSE 1MDAA 2ARJB 4UILH 4MQXD 1CU4H 3HTLX 4AQ1A 2CR0A 3ZW3A 4M93B 1YEWA 3BYTA 1HNYA 4HYTB 3UTSD 3TEXA 2MSPA 5GS0C 1CE6B 4X0KB 1PLBA 4W81A 4FNLL 3KPSD 4XZ4A 3SZKC 2I9TA 5I6MA 3ESMA 3FSZA 1T6VN 4NS0A 3SO5A 5CR1A 4IRSD 3WJJA 3PHQA 5E2UL 3A22A 4WI4A 2Q10A 1EZVX 1KB5B 4HUXB 1HHKB 3PY9A 2V9UA 3LIZL 4N8VB 4OB5L 5JR1H 3ESUF 1GCFA 2ZCZA 1P1ZB 1U41A 2EXWD 4LVNB 4KJPC 1KBBA 3ZHFA 2VH5L 4XCFH 1BQHB 4QIRA 4FXKC 4NO3B 1QPPA 4KI5C 1RI8A 1R1CA 1BZ7A 5F3HA 4CGTA 4HWBA 1EO8L 1J9SA 3HS9A 2JKRM 4FQJL 4N28A 5JIKA 1A6ZA 4ANUA 3S3BB 4N0UA 3PGCA 4OM0H 2P80A 5KVGL 1F56A 1G0YR 4FGMA 3EYUH 1A8JH 4FQIH 5JHLH 5GZOA 5IIEB 2ZNXA 1V27A 2Y1YA 4RIRB 3ARBA 2VR3A 1KZQA 3DI2B 5GGRB 3Q0HA 1J5HA 4OQ1A 3SCMA 3IU3A 5F9AC 2XWZA 4YHKL 1T7YA 4I89A 3KZ8A 5ANMB 2QPEB 5IGXH 2ZWSA 1VZHA 3IK2A 4XNUH 2VJ8A 5AVVB 4JFFA 2R15A 3E38A 4KKZA 2V5MA 2V4LA 3MREB 5JHMA 2Y6SD 2FGZA 1THAA 2HH0H 5IV2B 1KSRA 3QNZA 1FFTB 1PD0A 4DEWA 1T0PB 3F62A 4PBXA 4BQBA 1KXQA 2R9HD 3F00A 3SCMD 2GUYA 2ZOLA 4NNPH 3WNIA 3RPIA 2HRPH 1BPLB 1FNAA 4Y5VC 4Z7IA 5LNGA 2IGTA 3TWCL 5HYEA 1JVKA 2EVFA 3AMLA 1BJMA 4OCLC 4L4VD 2OV0A 3SIKA 1FFOB 3I9AA 3G5ZB 3KCPA 1WBYB 1P7QB 2ZUVA 2VITA 4M1GH 5M7QA 5C9KA 1KTDA 1JCVA 2L7QA 4XNUL 3GB7A 3SJVD 4FJ6A 4QLWA 4JLRA 5IFAH 2QKIB 1EEQA 4TQPA 4FQXC 4NN6C 3N9GL 4FULA 5C1MB 1QI4A 1YY9D 3TXAA 5INDB 3CXDH 4AL8C 3US1A 1JHLH 3ENEA 4WLCA 2A0LC 2XN9B 3EOAA 3H56A 2X1PA 3KXFE 2B39A 4NQXA 2Z9TA 3T1FB 2RACA 4NQCA 3VXOB 2ADFH 1OAUH 1O0VA 1ZHBB 4ODVL 4ZUVA 3FZUD 5BNXD 5JHLL 1FORL 4XBPA 1PU0A 1CG9A 2GTZA 5CGTA 1GCYA 4BHUA 3STBA 3C5SB 3QUYC 3RX8A 4XRCA 3SHSA 4GP5B 4PGZA 1WFMA 2BNRA 1INDL 3TTSA 4QOKA 5JOEA 1VACB 4R7DA 5MEND 4FLHA 2YAHA 4NUJA 5A2IH 4MDIB 1B4JL 2DD8H 1FH5H 1OGAB 1XGRB 4F93B 5E1HB 3UDWC 3POCA 4MA8L 1XF1A 2KDYA 4P4KA 1A7QL 3QGVA 4IM8A 4E9TA 5FR3A 1ZVSB 4GUPA 1XZ0A 4CBPA 4HUUA 5DUJA 1OP5H 4OVUA 2H1LM 4BELD 4WEUD 3BKJL 3GI9L 2YPKB 3CC5A 3U83A 3S35H 5ETUB 2F7PA 1RZKL 1UJ3A 4XTRC 5IHLB 1UM6L 4PVNA 4HUWA 3FTGA 5B7MA 4KVNH 1LQSR 2FQDA 2AQRA 3LZPA 3VD3A 2HLAA 4A04A 4WI7A 1P7HL 2OCFD 5MERA 5KN5A 4RFNB 2D3LA 3W9DA 3VUAA 4PJBE 5I5IA 4GP8B 1V7NH 4PM1A 3SDXF 4S0SD 1RZJL 4AL8H 1IAOB 1WRFA 2VLRB 4GSUA 4L4VE 2X6BA 3CFDB 4JQXC 1DO6A 2JCWA 4JJ5B 5D1QC 3MV8A 4PCYA 3RGBA 4P2RD 2QPSA 1KCRL 2A74C 1ES0B 3GSWB 3I02A 5CGBA 5KBKA 1TQCB 1NPUA 2J5LC 1XT5A 4E68A 1MFNA 1EDYA 3WFBL 4H1LB 3ZSSA 3GBML 5T33H 4QHMA 2HCZX 2WKGA 3K46A 4KK5D 3ZL1A 4A2HA 5JXAL 2AV1B 2Y07H 1JN6B 2GI0A 2XLLA 5AKRA 1P4IH 3VXOA 1EAPA 5SWSB 4PJXE 3MJ8B 1ET7A 1KFAL 1JRHH 4XBPB 2RBLA 2W8CA 5ECJE 1YYCA 4PY7B 5IB1A 4PJ7B 2FQEA 4CA4A 3LKQA 3GMNB 4WHTA 1RZ7L 3T0BA 3FN3A 5MENE 2DMHA 3LEXB 2UY6B 1AHKA 3MRIA 5JHAA 3NFSL 5HHVL 3NCJL 4E9SA 2X42A 3CDFA 3B83A 4HHWA 1BF5A 3ZSTA 5AOIA 4WWID 4FMFA 2VLKE 8FABA 1NKOA 2MQCA 5BMFL 3ULVF 1WAAE 1AQKL 2CKNA 4LF3B 2HMIC 2CUHA 4YPJA 2QR0A 2BVYA 1BSIA 2K6WA 5KSVB 1NBZA 2XN1A 1I82A 1Z9SB 3BP6A 1Z9PA 4PJ5A 4PRPE 3U82B 3V4VL 1T6WA 1GHFL 3L5XL 2A4ZA 3KLQA 1DBMH 2DBLH 4U2ZA 3CFBA 3IGUA 1QPXA 2XFXB 5K93A 2HMID 1G9MH 1JFQL 2Z65C 3BKMH 3OAZK 4PUBH 2FEEL 4KTYA 3DOIA 1HZLA 4LASH 4LMQI 1R33A 4PHXA 1ITBB 3SQRA 3WXWH 1FHNA 2VO8A 5IESL 1FO0A 1DSFL 1RK0A 3UPRA 2IFFH 3RTQD 4DO4A 2OTUB 1A4JA 2CDGB 3LN9A 2BIPA 1HXMB 5DA0B 2PYFB 2CO1A 3DO7B 3MFFB 4IBLT 1G7JB 3QWQB 5I1HL 3IJHA 1IU1A 3V0WL 4B41A 5SX4H 5CBAB 3GRBA 4X4MA 5FO2A 1J5DA 3L5JA 4AMKH 2Q1EA 4FA7B 3H1ZA 1P7QA 2Z7YA 1IL1A 3EH4B 4M48L 2UXVA 1O75A 4CUCA 4P2QD 1XEUA 3D30A 1Z32X 2DDQH 1PG7X 1PIFA 3JV5A 3OWEA 3QHFH 4G43B 1EFXB 4ICXA 3SGDI 4EF3A 2CDFA 2ZWZA 4L3CA 3IMWA 4LHUG 3UTZA 2UYLB 1WK0A 2CJSA 3MREA 4TUKH 5D6CA 3VXRD 4EUPH 3PGDA 4MD0B 5K9OB 4N2HA 2GY7B 2NNFA 2IBZX 3ALXA 3DX9B 4RAUB 4GRLA 5I8EA 3VFOA 1O7VA 1UZ6E 3BH9B 3SKOB 3KYMB 1ODUA 1RZIA 5I76B 3WGUB 5KYWB 4LCWE 3REWB 1E9OB 2Z31A 2VN3A 2CUIA 1T2XA 3TT3H 1SPDA 4PJFA 1CLYL 1B2YA 2D9CA 3GSRA 4XAKE 5CP3H 3WKNA 3JWOC 4F8TA 2XN9E 3KXFB 5I16A 4X8JA 3QYNA 2VDOH 3BZ5A 1SQ2N 1PPIA 4OIAA 3A23A 5JMOC 4I0PB 3P0VL 4KZEL 4GRLD 3D48R 1G9MC 2DV6A 2YAOA 1KCSL 5I1CH 2DDQL 4KOBA 3GK8L 4RA0C 1S8DA 1KG0B 3B5HA 3SDCC 3BP6B 4YUEL 1S9VA 1T21A 2QQQA 3P3SA 1JE6A 1NLBL 1PGRB 2F1AA 2PR4L 1MCRA 4OLZL 5CUSH 3DURB 4UUJA 4TNEA 2X4RA 5CHNA 1OGAE 1G43A 2J71A 1AD0B 3H9SA 4BFJA 5EU7C 2GIXA 3ABKB 4JPWL 2H5UA 3MV7D 4RZCB 2F54A 1FO0B 1RK0B 4HT1L 4BWWA 4BH7A 3QR1A 1P53A 3MKGA 3WXWL 4TOYL 1BXUA 1GW6A 1MVYA 4B5EA 1FNSH 1VERA 4NQVB 3F65A 3L3OA 3KLDA 4H8WL 2A5UA 5DZAA 4E0RA 3DDGA 1S9YA 4O2EA 5C0AD 5SWZB 1A4KA 3GIZL 3PABA 5A2FA 1K9TA 1ZGLP 3HE6B 1TFHA 3SDYL 2QVFB 2AHIA 1UCTA 4PRBA 1GOFA 4OFYD 5FO9A 2JKNA 1JZFA 3VFTA 3WN5B 1GHFH 4ONHB 1V3JA 4LL9A 4U1GB 4FZ8L 3MVSA 4KY1H 4YL4A 3HUJB 2C4FT 4B60A 2ZXWB 5TDPA 3C6LC 3DBXA 1EHAA 1AG0A 2MJWA 2NX5E 3L4UA 5L4IA 1OL0A 4YE4L 3RKPA 1NMCB 1D7CA 2AJ3A 4PRIA 5DF0A 3PGDB 4MD0A 3Q43A 1AXSA 3VQMA 1AGBA 3QPQD 4JKNA 1N7MH 1RMFL 2AEWA 5LBSA 1OE2A 4RGOH 3AITA 4M7ZC 2J21A 3LZOA 3BZEA 3BVWA 3NRPA 2Z31B 4JN1H 4GMTH 3WNNA 2LU4A 3CFMA 4PY7A 3KAAA 4PJFB 5T1KA 4XAKD 4AYEC 1K8IA 2E9IA 2IWEA 3DX8A 4LIQE 1IQWL 2NQCA 2BCKB 3VFRB 1FNGB 4AH2B 1N3NB 5D7IF 3VSUA 1OSPL 4NWTL 2O93L 4N8CH 1SXNA 1EERB 4EPSA 5LBVA 2OTPA 1MAML 2WMPA 1BQSA 4PJ7E 1EV2E 2WYHA 5A2KH 4W68A 1QUNA 1RD6A 2YWZA 5IT2L 3M6DA 3L8QA 3OB0K 2IPUK 3VFSA 1GZHC 5AYTA 3GBNH 2IFGA 1T20B 3BAWA 4ELDA 3HI5H 1UH2A 2GCYB 2IANA 3UYPA 2WLJA 4X83A 2O4EA 5AW3B 1YECL 3MLZH 3B2UC 4G8IB 5HGHB 3VD1A 1CDUA 4ZX4A 2X2YA 4AL8L 2F08A 1UT1A 2WAHA 4HOZA 3PWPD 5CEXA 1T0NB 2XY1A 1JTTA 3C8DA 3D25B 3V5KB 2X4SB 4W4OA 1SDAB 5DJXB 5ESQB 1TZGH 1XCQA 4JW3A 3RKDD 3SO3C 1COBA 4IHOB 4CMMA 3DHUA 3LQZA 4OF5A 4WDIA 5CMAB 3Q1SL 3W2DL 1ASOA 4JAMA 4GRWH 1X5MA 4XH2A 2CGYA 4HALA 5DQDH 3Q9PA 3QQ9C 1SMOA 5FF6B 4KVNL 3ZL4L 1A4KB 1D5IH 2DI8A 4JFDE 3U6XA 3LEYH 1FUNA 3IKKA 7CGTA 4ODXA 1WAPA 1XH0A 3C60D 4NHUB 1WVZA 3UBHA 2AXWA 2YKLH 3DVFA 3K0WA 3U36B 3TESA 1UKQA 4CC1A 3PP3K 4LSSH 1AS7A 2QPDB 3WS6A 1IIIA 3IB4A 1G1OA 4ACPA 2ICEC 1FCGA 4QWWD 1I1YB 3T0DA 3F7KA 4GQ9L 3J27A 1G0XA 5I8CA 2FE0A 4I1NB 4S11A 4UV4H 4BGDA 2AQ2A 1FH5L 2D3JA 1X5IA 3IS1X 1U8OB 1JJUA 3BZ4A 1YPZA 3K1DA 3NJVA 3A4DA 2XZCL 1X7SA 4P2RB 2FWOA 5L2JA 2RA1A 2WWKT 4D9RD 5HHNB 1Z7JA 3PNWA 1HHJB 3RZCA 3BQUA 4MJIE 5T3XD 2ZXQA 1VGKB 3ISYA 4K3EH 2BSDA 1M2VA 5FYJD 4LCIL 3AWEA 5D7KD 1OB0A 1KCVL 3EO1B 3CGTA 5DRZA 3EHBC 3OKYA 4PP2B 2NZIA 3DETD 1X5LA 3QUZD 1L5GA 4ZAKA 1WF5A 3LH9A 1G7MB 5IB4B 2EIEA 3QJZA 4MNGB 4NIKB 4TLUA 1U3YA 1ZLDA 3LH2L 2N59A 4WJ5A 1F4AA 3D18B 5D7SH 4IRZL 3IDGB 5DVPA 2IALB 3W39B 3WDHA 1S7TA 5DJDA 5EDSA 1T2JA 2A77H 4C57C 4CC0A 5BJTB 1WD9A 4JZJB 1C5CH 5F9WB 1E6OH 1YO4A 2WLIA 1VSCA 4QRPE 3QDGD 2VXVH 4GY4A 5ANHA 3P3UA 1ZXQA 5FB8B 3ATEA 5JXED 2C1PB 3UG4A 2X40A 5IMMB 5CBEB 4O2CA 1UB6B 2G9HB 3NSDA 4UDUA 2C9AA 2FJGA 1MJ7L 1HCVA 1LVEA 1SBBA 1BLNA 2NMSA 1YC8A 2R1WA 4NUGH 2R2EB 2IAMB 4NQED 3MA9L 4JANA 1KUMA 3E6HA 5DXWA 3AT8A 4XC1H 4WDIB 5CMAA 2F54B 4ODWB 3OKNB 4IS6B 2WVVB 5FGBC 3SDCB 1VGEH 4A7UA 1AI1H 2Q7YB 4WFGD 4KMQA 4L3EB 1S5HA 1ZV2A 4FG0A 5JXEC 2YQBA 4AGMA 4XO8A 3WY3A 1EPFA 2BPBA 4XP1L 1JFHA 3JZ7A 3BFOA 2V8LA 5JW5B 2UZYA 3MOBL 4U1KA 3DIFB 1YEKL 1HHIB 1Y6NR 2EDDA 3TFKC 4FNUA 4UM9D 4D94A 1JBJA 4NP4L 2OMYA 1KJVB 1SM3L 1RP8A 4QYOB 2A9ML 5IUSA 4X0NA 1IGYB 3H54A 4PJ7F 1MI5B 3N0AA 1Z0MA 1ZHLB 1GYAA 3QUMB 1M1XA 2H1PH 3KS0J 1GZHA 1E4WL 4U31A 3V5HB 5SWZE 6FABH 2P26A 4RZCA 1ZJBA 4HKJA 4OT1L 3UZEC 1UYWH 1X7QB 3HFML 3M1CA 2H4EA 2BVQB 4FQJH 2V9RA 5EHFA 3HE6C 1ETZA 5DLML 5I6XC 1N0LA 4HV8A 2LV4A 2P5WD 2GJZA 2IAND 4MJID 3G5ZA 5ABAA 3B5TA 2GITB 1XXFC 2BRQA 5B3JE 2ED6A 1IKNA 4KFZC 3LPGA 1JMXA 3OZLA 1CFBA 1D6EA 2CO7A 4OGQC 4Y2DC 3RWDB 5A2CA 5C0FB 2OR9L 3TZVD 4RFEA 1DJGA 1QWNA 2CA3A 5EU4B 1HXKA 1MF2L 2J6EA 3C12A 3MRBA 4JMNA 3K4DA 3VFUB 3H55A 3IFNH 3OR6A 3QCUL 3S9DB 1BD2B 1PL3A 5EIIG 3RGVA 4G82A 4I18C 2YD5A 3HZVB 5DHVA 2V2XB 4JUTA 4BEIA 1HVXA 4B0MB 2RAMA 5AALA 3OL2A 1Z9LA 4P3CL 2N0MA 3C6LD 4PJFE 5E5RB 5BJTA 1AXSB 5B38B 4JRXE 1MFCL 4OFQA 1YJDL 4M29A 1LP9B 2HTKD 1LO4H 2YN5A 4DERA 5ITBH 5K9KB 2OMWA 1BXXA 1UWYA 5F3BB 1TTBA 3O6KL 3P11L 4UQ3A 4BFIA 4F7EA 2R0KL 1BZ8A 3H7BA 3L3HA 2ITEA 2F1BA 1JUFB 4G8IA 2O5ZL 5DEJA 1N4XH 1N5YH 5DEGB 2Y2TA 1H9DA 4OCWL 3FULA 4FNQA 1OM9A 1T80A 3P9LB 1L3NA 3H4FA 2XTSA 3OKNA 3MLYL 3MBXL 4ZPVB 3EJPA 4HPHA 1RFDL 1GAFH 1NC2A 2JKWA 4XPFL 3IEAA 4ZPTB 2EE9A 4G5AA 2WQSA 2I69A 4HPYL 5E2TH 1MQ8A 4CC4A 1ULVA 2JI3A 2R29H 4JEGB 4IMKC 4P5SA 1KEML 4L8BB 2XPZA 2NUPA 2R2BB 4U6HA 4EZKA 3TJHC 1GZPB 5K59E 4GLRH 2EIMB 2O61A 4EIBA 4TVPD 4D9LL 3KLLA 1L6ZA 3ROLB 5BZWB 4FAAB 2W88A 4FLSA 3NEXA 1DANT 4G80A 3T9WA 3H2QA 4FNPA 4KY2A 4XP5L 4JFDB 5SWZD 1LWJA 1NEPA 3GF8A 3QPKA 4RVBA 5D96C 5DUML 4BZ1L 3RDTB 3NQIA 3FUDA 4LARH 4MJ5B 3T2NH 4Y8DC 2CO6B 3FQYA 1SOKA 5FAAA 1WZAA 3FUMA 4O4YH 4OV5A 1MW2A 4F80A 5C0NC 1UT2A 1SOQA 1JWUB 4X4YB 4P2RA 2QADC 2NX5A 1WZLA 4Y2DD 1JZIA 2X1QA 1BXVA 4X6CF 1HHJA 1HWGB 2QELA 5AENA 1QEWB 2V33A 1QG3A 3BH8A 3VFPB 1FSKC 4XNMA 2Z92B 4HW6A 4L1HA 5IVXA 3CBJB 4GUCA 1CF8H 1I31A 2FO1A 5JXEA 3RWFA 4LCUB 5JPMA 4DKEH 1ET8A 2GFBA 1KIRA 3MMEA 1T03H 1E6JL 4KNUA 3S88L 5H35A 2BIMA 4K07A 1BFTA 4LKCB 3Q9QA 4N0FA 1GZQA 3D34A 4RH4A 1H3UA 1HQRB 1TVBA 3WKML 2X0UA 4KMTL 4ERSL 1HSAA 4MHHG 1J9QA 4AQ1C 1CDBA 2O5ZH 3ECVA 2WXIA 2K0RA 4MCZB 4PJ8A 1AXIB 3VRIB 4ZW5A 5SWQA 2DMGA 2WLIB 3CVBA 3B4NA 1NCDH 3RZCB 4UTBA 1EMTL 4PJXF 3DGDA 4Y4HB 3T4AC 1WAAF 3QZNA 5HPMB 5ITBL 3QWRD 4ZFOB 2PW1A 2X10A 5LB1A 3FN9A 4I9XA 3UMTA 2XJKA 4NWUH 3MUHL 1N8ZB 5LHDA 1MG2C 3D09A 3KJ6H 2I32A 4ZAKB 1TITA 3BSZL 2WVVA 1G7MA 1WG3A 1K8DB 1DJYA 4MA3A 1E4HA 3CDZB 3NJJA 2PTVA 5SV3A 5TE4L 1J8HD 2K8MA 4ZOEA 3K2KA 2C26A 4TVPE 2IOMA 1Q9OB 3KDMA 1YMMA 2HVJA 2ZAIA 2ZCLH 4X4XB 2LFGA 4KQ3L 2WO3B 4QYOA 3T0EC 4IDLA 2HUHA 2NY3D 5IY5B 1BQHG 3ARYA 4O2CB 1FVDA 2EIJB 3K6DA 2BP0B 4LBAA 3J2PA 4MMYA 4P23A 3QI9A 3C60A 3QORC 1BG1A 4JG1L 1XX9C 4Z7AA 4XOEA 1GRWA 2ZKHL 3NK3A 1IGFL 4LP5A 3V6OE 4M8UA 5F71A 1FC1A 1AYRA 1JVOA 4IS6A 4JZOB 1A3LL 4AQAB 4CKQA 4MZ3A 5DR5L 2ATAA 1S78D 4CN1A 3IM1A 5HP5A 2CLZB 3SQOH 4N25A 5F0JB 4N6QA 1UM5L 2F7QA 1X5KA 2VM9A 3NCCB 5E8PA 3GHEL 5B3NA 5I0WA 5GGSY 5E1QA 4GXUN 1T1YA 4NPJA 1LQBC 4UQ9A 4YHOH 2B1AH 4XN1A 2YIHA 4F24A 5B1AB 3U4EA 4L05A 3U46A 3PG2A 4E42B 1WV7T 2UWEE 2Y5TB 5I6XB 3MA9H 2HJKA 1NC2D 2QMKA 1INEL 3VRIA 2ZXCA 3NESA 3FQ4A 4Z3HA 4HH9B 4GFTB 5IHUH 3BSZA 1BHGA 1PFOA 2VXVL 2W0PA 5F3BA 4C56E 4G6AD 1K6QL 1YMHA 2H3NA 5FYLD 1NL0L 1JTOA 3D52A 1O7SA 2Z8SA 3SDAC 3FT9A 2D4FA 5I2IA 4ISVB 3P9LA 3LRGA 2FH6A 5IQMA 2YAEA 3VNYA 2QV4A 1BEYL 1TVDA 3LZQA 1Q90A 1UATA 3MXWH 1YG9A 1VKXB 1JAEA 4MYWB 2XKSA 1E7UA 4KMTH 1YNLH 5IR1A 2W9EH 2HWZH 1HAUA 5F1SA 3SCMB 4NQUA 3NYKA 3A4AA 2R69A 3DURA 2IAMD 5CZXD 5B7FA 1KYOK 2A9BA 4POZD 3SDDB 3QQDA 4JKPL 4EOWL 2D2OA 2O61B 2WBJC 4LSTL 3CZNA 1ZVNA 4ODUA 3RFZC 1M3IA 3WBDA 1ORQB 2MPVA 2H32B 2A6JB 2WXNA 4TXVB 2W1NA 5DURD 1A6WH 1QKZL 3TM6A 1P84J 3T5WA 1QTPA 5DFVD 4ODHL 3QRBA 2WWMD 2Y36H 3H85A 4FTDA 1IKNC 3D07A 2UZPA 3NJMA 4M1DH 2BW4A 2P8MB 4M5YH 4NSKA 4R90H 2GTWB 2ZP8A 1XO8A 4JPKH 4WY7L 3WN5A 1WBYA 3PFUA 4EVNB 3DUUA 4L48A 4YVNA 4BZ1H 2XQ0A 2RJMA 3N43B 4ONHA 4WFFD 1MIMH 5BQ7A 1FCCA 4L1BA 1YYLL 1FPTH 3HJEA 4OZFA 4PLJC 1GS8A 5DT1H 4QHUA 4PB9H 3EJUA 4WTWA 5C6TH 3BH8B 3VFPA 5GZOC 3IGFA 5KUMA 5D7JC 1ZLEA 2YPVH 3TBVA 1QA9A 4IYKA 3OAYH 2DI7A 5E08L 4MLSA 5INDA 5AL0A 1LXMA 4PI0A 3W2DH 4NC1C 3ZQWA 1N26A 1U8PB 2WGNB 4Y2DA 2I5YH 2WXFA 1S7WA 1G1CA 2Y7SA 4JDTL 3PWLA 3KH3A 4R2GB 3VGAB 3TONA 4A68A 5I71C 1KTKE 3AXLA 4MAZA 3NCEB 2WQXA 4OJYA 1KJ2H 4M8QA 4Z7UF 5ISZA 4TQEL 1JYWA 5LAXA 1OW0C 2PLTA 3KNBB 4UANA 5B1KA 1E3XA 2R9HC 3FTYA 3INUH 4XRCB 3DGGA 1Q4NX 3CD4A 2BINA 3LS4L 4XBEH 1PAMA 5SWQB 1CICD 1Y1UA 1EHNA 4OCWH 2OSLA 1ZDQA 1JPFA 1VFBB 4YNYB 2VE6A 4CMHB 4CU6A 4OGXL 2G5RA 5IT2H 5J1SC 3V8OA 4EZLA 4HOWA 3CFJA 4YSUA 4D7PA 1D6VL 5CZVH 4CL7A 1KTBA 1CQYA 4PJEE 2RB8A 3NQKA 4F7CA 2C7UB 4IKIA 4LKCA 2WVUA 2A9NH 3GRGA 4HJUA 1NGPL 4I77L 3BGMA 3L7FB 3DXAB 1A6VL 1JD9A 2WQVA 3HPLA 1JNLH 3NIGB 3PWNB 1ZGLB 4DW2H 2VLRD 3IFNL 3QCUH 5F0MB 2OZ4H 2A1WL 3IFLL 1MF2H 4PVMA 2VR7A 3O6ML 5EF0A 1FYTB 4GPVA 4HCIA 4UNIA 4G72B 4ONFH 4PRHA 5FLUA 2FRGP 1LK2A 3P9MA 1UXMA 1RMFH 2ZCHL 4EDWL 1TZAA 2WP3O 4YWGH 1E4XL 3IWVA 4DNLA 2AS5M 1W72H 4NZUL 1TPXC 1MCEA 5CU5A 4OZIE 5DLMH 4FP8H 1FG9C 3FQWA 4P23D 5CD5D 3ULVD 1XMEB 4ODXB 1WS8A 4IU2B 4U1JB 4G83A 2VDKH 2C9UA 1KTLB 3L16A 1O9ZA 3CTTA 1C08A 1ZS8B 1WO2A 1RJYB 5KW9L 1R3LB 4JY4B 1TLMA 1U8HA 4LVEA 5D2NC 1KGWA 3KBPA 2KMWA 1BLIA 4G6FB 3CDCA 1R9FA 4YDNA 5AAMA 1F11A 3T3MF 4UIMB 4MJ4A 3JWOL 2ITDA 1DQQB 3HMWL 4LLDA 3KPSE 1OAZH 5KVEE 2Q76B 3IDMB 3MLSL 4JM2B 2B9BA 1I8AA 1FVDB 3U4EB 1G87A 4RWYL 3CQQA 2CJ3A 5DHYB 3CG8A 5FEBA 4TTDC 5JHBA 4ALAH 1IC0A 3OJDA 5IB1B 4L2LA 5J1AB 4BK5C 1VGKA 1YJDC 3GJEB 4AQAA 4WU5A 1A0QH 2DMCA 5C71A 1INQA 1M2VB 1WYJA 3IMTA 5IKCB 1UJTA 2VDML 3D2UA 4OLZH 5GS2H 3NOIA 3SGDH 1NCBL 4PH8A 3C5ZB 3DUHA 5K39B 1DQVA 3UC0L 3TO4C 1CIUA 1I9EA 3QDMD 3T6XA 1UJ3C 4OCNC 3CZKA 2XG4A 1Z5LA 4Z0BL 5KSAB 3KLHC 3EZ8A 4TULL 2Y5TA 2WWNA 4IEFB 4Y4HD 2XWTA 2XXGA 1KWGA 3UO1H 3DXAA 3ARFB 3CH1B 4U1MB 5JO5A 1QO3A 4NQCB 5D9SB 1O9VA 2PXYD 4H8VA 1F90L 2P52A 4OD1L 1X9LA 3MOAH 4PIRF 1UWGH 1TQBB 3P0GB 3QQDB 1LO3H 1AR1D 3RZWA 3SQBA 3UTSA 3ECWA 4NP9A 4QHKI 4R97B 4H5SB 5IG7A 4PJIB 1W72L 4NZUH 4U3CA 4L8CB 2BNRB 2FVNA 5K9JH 4PVLA 3KD4A 4G5ZH 1YPZF 4JM0A 4X8CA 4NKQB 3FONA 5F6HJ 2X89D 2XBDA 1I8KB 3NSXA 4OCYH 5I1DB 2JMRA 1E3ZA 5GSRB 4Z78A 1R3KB 2DQDH 5CILL 3WIFB 5L2KE 1ZGLM 5ERWB 2PKDA 2NY3C 4U1IB 1JZHA 2ODIA 5C09A 4ZBJA 3PUUA 4BSWA 1Q8MA 3FH7A 2B4CH 5BQDA 1A5FH 4FJZA 3SDDA 3UEZA 4EKXA 4IGBB 4Y2OB 3IDMA 4ZUUB 3WFDL 5CZXC 2I27N 2Y72A 4N2IA 1NJ9A 4S2SB 2P42B 2YKLL 3AGWA 3B2MA 4K8RL 2BP3A 3FCTB 3UPAA 4QRUA 3FO2B 1PZSA 3HAEH 3LEVL 4LASL 2Y1ZA 2WLYA 3VWKD 3BIKA 4P5TB 4QCIA 3ZL4H 4M7KH 3MLPA 2GSIB 4HJSA 3T2LA 3ES6B 1F1GA 4GG8B 3ZUCA 2XACC 3F01A 4ELKB 4JO4H 2DQIL 1TG8A 3DVNA 5E2WH 3VFWA 2VN6A 3D85A 3DTUB 4DGWC 1OAYL 1UUSA 3TVMA 4IBYA 1BBDH 2KLSA 3DJRA 5TDOB 1PZ3A 4UT9A 4Y0GA 3SYOA 2I5YL 5KJ7E 1YECH 2X1OA 3MLZL 2V2TB 1E5CA 2CR3A 4FABH 4X80L 2IAAC 5ABZA 2CRIA 3EAKA 4XMKL 3SB3A 1BIIA 3D1MC 3NMEA 3BVNA 4CU7A 5C08A 1D5ZA 2OSXA 1SUJA 4PGCA 3FFCE 5FKPA 3D3VA 4F7EB 4HEMA 4JDZA 3IPEA 4AEHH 5I19H 2GBAA 3FYIB 4FYTA 3P4LA 1MKFA 2EEXA 4MDJA 2H26A 4QHLA 3QC6X 4XNZC 5L7XH 3HPLB 1ZGLA 3JV4B 4CVXA 2DWDB 5AZEH 1MREL 1S9XA 1WD8A 3L5WB 3QEGL 3QO0A 4H0IA 3SD2A 4PJEB 5TE7L 1QSFA 4ALAC 1MCIA 3QCVH 3N40F 1XB6A 1JNNH 3LS5L 3BX7C 4LSUH 3IT8D 1V3KA 5IK3A 4PJ9C 5IM7B 1LO5B 3V0VB 4LPCA 4F58H 2V3DA 4S0HA 4LSTH 4JFTA 1YEJH 4X7FC 3CX5K 4LBEB 2DEWX 4HK0A 1C08B 1ZS8A 4EIUA 4QAWA 3EFOB 4OJFL 2ZQKA 3QFDB 5EIQA 4OZIB 2WCPA 5IJVB 3CSFA 4HJIA 4FZ8H 3TH2T 1ZA3A 3WDJA 3OKEA 3STZA 4F2EA 1CXKA 3R8BB 2CO6A 3P9MB 4KU1A 3GIZH 4A39A 2XA3A 1PZUB 3G08A 5AW4B 4FABL 3RFRA 1MCWM 2NY4C 4LHUA 2AQ3A 5E99L 4ICWA 5LDUA 2MNJB 3VWJC 1QI5A 5KWYC 2A4CA 4X6CA 5DFTA 5CGYD 3MFFA 1CFSA 1K8IB 4FNRA 1REIA 2J7LA 4Z7UE 3WEAA 5IVXB 2DQIH 5E2WL 2FB4L 1BZDA 2J8UF 3QUML 4KNTA 5E1IA 1J11A 4OJDH 4ZSOB 4C4KO 1SGKA 4U05A 5EA0H 1S7UA 3JVGC 4JPWH 2MCPH 4R0LB 3C5ZA 1U8HB 3UX9B 3GINA 1QFWL 2DWXA 4FQCH 2P24A 2CDEA 3UJIH 3VE0A 4JFEE 2VLKD 3AADB 3LEVH 3QFJE 4HSAC 5IBLC 5BRZD 2A4EA 4DP8X 4PG9A 4YHOL 1Q0YH 5GISL 4C47A 2PWFA 2Y6TE 4ZUTB 4KI5F 4LOEA 4OTXL 1G5GA 4IEFA 2NR6C 3IAGC 4MDJB 3PF2A 3VFOB 1JWMB 1EJ6A 4KK8D 1WAAA 3LKPB 1OAUL 1E9OA 1JYNA 2X4SA 4GKOA 4HIHB 4G9DB 4ZTEA 2QHRH 3WENA 4ESKA 4L8CA 4OCSL 1ZSDB 1WSST 4DZBA 5KSAC 3B37A 4LGSB 3BGFC 1XCWA 4FD0A 3X3GL 4I0PA 2AZAA 2XYBA 5LGJA 1WZMA 3VGFA 1TTUA 3AS2A 4BIKA 4EIGB 3WKYA 3UGXA 5IFAL 1NEUA 2J56A 1G7HA 4UOW0 4F8LA 1X5HA 2X3CA 2FNWA 4ODSH 4J3SA 5ESVA 4FADA 5JPNA 2MHAB 4I7ZC 4Y4FA 1ZT1B 3CFKA 4OZIA 4WI8A 3U1SH 4CAGA 2WY3B 2R0LH 3BWAA 5C09D 1A8ZA 4UNUA 4P23B 4QXUL 3NBNA 4MHHI 5I23A 1MXDA 4W9IC 5MHSD 4JNXA 4DIXA 4S2SA 3V0WH 3PXJA 1N0XH 1C7TA 5DMGC 2X4OB 5IROC 2WQUA 4QRUB 5EORL 2PWGA 4JKMA 3HS8A 5KBLA 2PCFB 4WK2B 1NAMB 1IBFA 3DX0A 4Z7VB 1Z9OA 1R3KA 1E8WA 4OLYL 1NCAL 4HCGA 1CD9B 5E8PB 4CVUA 1KV7A 2KH2B 4HAFA 3WO4B 4PP1D 1JFQH 3BKML 2F7IA 3IMSA 4OGZA 4PRDA 5D4IA 2DJUA 5IROD 1QVOA 4MCMA 2ED9A 4M7LH 4RGNB 1LD9A 2EECA 2NY6B 3U46B 5TDPB 1N6VA 4PMFA 2G60H 1JXKA 5C0GA 4P9HC 4ZXBD 2CO4A 2A6KA 2FH8A 2Z8VC 1ANUA 1U91B 1EXUA 3IJEA 1NBVL 3KWXA 1XWVA 5AL8A 1OTSD 4FC3E 4N3UA 4KXZI 1T2QL 3K3QA 3JWOH 5CEYB 4BSJA 1E8YA 4P06A 3L7EB 3NJKA 2HTLD 2WUBH 4PV1C 4L4VA 3LKRB 3ZZLA 1S6NA 2YD6A 3EOBB 5CBEA 4EZMA 1UB6A 2G9HA 3R1GL 1PJ9A 3NCJH 2BZ7A 3BZEB 3ZZQA 5ENWB 2BH0A 4AGPA 4E5XA 2F53B 3V0FA 5GS3A 3V5DA 4WHYG 3T0AA 4G8AC 5I0VA 4I2XB 1BZ9A 4XX1G 1NDMB 4R4FL 1I3UA 2B1OA 2Y69B 2ZF8A 2ZUXA 2WXMA 3FFCB 2LLLA 5LN4A 1CE1H 4CN4A 2N7SA 4L3EA 1UQSB 3R8QA 3NPSC 1IC4L 3US0A 5EC1B 4I85A 3VACA 1I9RL 5D7LB 1TQSA 1Q9LA 3QXUA 1RZ8A 3F12B 1W16A 1G7HB 4WF7A 2VLLB 3EH5B 1ASQA 1NUFA 4G8FA 1UOKA 5GRJH 2PWHA 3AXIA 3CJJA 3VFSB 5EOTA 2MHAA 4DETA 4Z8FL 4APQB 3I3BA 4NZRL 1OGTA 3SPHA 3AVEA 1T20A 1FAKT 1GPOL 2IOOA 1UWEL 2GCYA 2IANB 4ACTA 2DAVA 2E0PA 1QLEL 2ZUSA 5I1EL 5MEOB 1NDGA 3S4SB 5EPMB 1OOWA 3LNGA 3HMXL 4MAYD 2VUOA 2ZKMX 1ORSA 2X6CA 1L3WA 2CQVA 3CDGB 4NO0A 4PV9A 5JW4R 5EOQH 4F5CA 5CZVL 4DF9A 4EQ2A 4OD3H 1N10A 4OJCA 3D0VA 1OEZW 1VFAB 4OF8A 4BFKA 2VIRB 3S96B 5CIPA 3FCSA 3W9EB 2XVLA 1YDPA 4FTVA 4JL2A 3S5LA 3QDJD 4AYGA 1SLUA 3BPOC 3C8HA 4WKZB 1GYUA 4PJ5E 2AJUL 3D12B 5PCYA 3H9SD 1OARH 3A47A 1OZTG 2RIKA 1YJDH 4JHBA 5FOBB 3WSQL 5C8JB 2R1YA 1H8SA 1GGIL 1KJ2L 3EGDA 5CKGA 5J6GB 4RZKA 3VD2A 4XR8C 3W5MA 3HZVA 1RZKH 2X6VA 1F18A 1CE1L 2UX6A 1EXUB 1OANA 1V05A 5T1KD 3TU6A 3LRHA 1DEEA 4R4FH 3KXFD 2HT3C 3WFHA 3CQFA 2G75A 2QQNH 1MZYA 2EUZA 3HAEG 2JKSA 4LOUD 3HNVH 2VR8A 4TNWK 5GGTA 2Q8AH 4WQOA 4WW2F 4D8PA 3TCTA 4X6CB 1KXTA 1L0PA 2I7SA 3GSVB 4XMLL 1HXYA 4HK3J 1KYAA 5L8LB 4A63A 3CZEA 1H0DA 4N0CD 4Q6YA 2CIIA 3RPIB 4G9DA 4ZPTA 3MCKA 2WLLA 1NLDH 2OJZH 3VG0H 4K3DL 3DPBB 4M8RA 1RZ8B 3F12A 1CK0L 3OPUA 2V17H 4IRJB 3B9KC 3MU3A 2ENYA 4JBSA 3VGBA 3CV5A 4HKZA 4UTAH 3CVHL 5ISZD 1PYWA 3X13A 4AYBA 3Q3GA 4HZLA 3ZHKA 5A16A 5EO9A 3N40P 2RTTA 4AQZA 4GRWE 4JLRB 3ROLA 1WQVT 4HXAL 3BVTA 3B6SA 1O6SB 5HJ3A 1F0LA 1KLUA 4PV8A 3MN8A 5DC4B 3AT0A 4LRNH 3APDA 4S1DC 1XD0A 1XL6A 2ZWKA 3KWWA 1U95A 4ORGA 1GXEA 1XD1A 2HWZL 2XN9A 1JPST 3EOAB 2CGRH 4NQXB 4GAJH 2YA1A 1M53A 2D03L 3KVDD 3RDTA 3MRGB 3COOA 3IDUA 5LGHH 4JANB 1A6PA 5G2NA 2WZAA 6PAZA 4JO2H 5K69A 3BIBX 3QDJE 3MV9D 4QXUH 1Q9WA 2HRPL 2BNQB 3RKDC 5IQ7L 2V5SA 3TNNA 2QQKH 2A83B 1UH4A 3NZ8B 3LN4A 4YSQA 3JBG7 4W6YB 2QSQA 4K3JH 1SLXA 3PQYE 4QRQB 4JFOA 5J12B 1WCQA 4I0KA 4K0OA 1INEH 4X99A 5IGXL 3B2XA 1JL8A 2ZG1A 4NNYA 2APSA 2C8NA 5GPRA 2VNCA 3W0WA 1D7DA 3QEQA 1ZHLA 3HG2A 3F04A 4MNQD 3TEZA 4XN8A 4N0FB 4IU3A 4F7PB 2I7OA 3L3OC 1PF3A 1TKWA 1KPVA 4JO3H 4ONGH 5LCVA 3BQVA 3FT4B 5G4MA 1OGPA 2Z3FA 4N5EC 1WCBA 2H9GA 3FO9B 5E6IC 1Q9KA 3ZX1A 2W9LA 2BS71 4PJDE 1HEJC 4QO1B 4LGRB 1MCQA 5EF1A 4PWHA 2GJZB 3F7PC 3BPNB 1CTOA 2D31A 1J8HB 2IWGA 4JKKA 1TJXA 1YA5A 4X5LA 2UXTA 2KERA 2OMTB 2OI9C 3QP3A 4RFNC 1Q0YL 4BJLA 4XP6L 5HYSA 1P9MC 1I8IA 3ROOA 2ITCA 3PXHA 4R7LA 4W6WB 4WFGE 5TQ0H 3LPPA 4LP8A 1BD2A 5KOVC 4IRJA 3TJEL 4XVSH 1UURA 4XN7A 2V2XA 4BZ2H 3VGDA 1Q1JL 3FNKA 4U7KA 3VG9B 3AW5A 2PTTA 4PRPD 3FQRA 3ARZA 3HB3C 3HRZA 5IFHH 2ZCLL 5HJ3B 3U4KA 4I48A 1AGFA 1UZ8A 3AS1A 4DUWA 4KQ0A 1AGDB 4UQ3B 1OGTB 5GHWL 5GRZA 3SKMB 2YXMA 2E76C 4OV6F 1E9PB 1P69B 2DQUH 5EIIB 4GI8A 5CD3B 1IJNA 4HBCL 2FIKB 2IDSA 3UAEA 5ID0B 4MJ2A 2EEAA 1G7QA 2X7LA 2LLNA 2PYED 5ICXA 2XN2A 1OM3L 4Q7DA 1RVFL 2P28B 3D0VB 3MV9E 5G4NA 3WY1A 2P5WE 5BS0B 2HFTA 3MJGX 5JOPE 5C09B 4APQC 2X9XA 1Q0XL 3A6CH 3AS3A 3P0YH 1HI6B 4KRPD 5D5ME 1EMTH 4A7TA 2CCWA 4HIEA 4F3FB 4G8FB 3M46A 1I7TA 3ILEA 4YOKA 3K4AA 1YEJL 4J3WA 5IFJA 4MD4B 3W56A 1TZIA 1QBLH 2OULB 4NQEA 1DE4A 3MRKA 4KVCL 4LXFA 4ZUSA 1A6UL 4DQOL 2F9BT 2NXZC 3TEUA 3JWNG 5KBNC 4KHTH 1DVFD 1MWAH 3T4AA 1Z9SA 4PJ5B 1OWWA 3S88H 1NLDL 2CH8A 4PV9B 1BM3L 4DTGL 2YSTA 3BSHA 4JPSA 1ZVYA 5AZEL 3EDKA 5E70A 1YYMH 1YNTA 3K6OA 1MSPA 1WC7B 1YN7A 4OZ4A 4QKXB 4WNSA 2YXWA 3VFWB 3OJVC 1YMHB 1F3JB 5C0RL 2XKNB 3DSFL 1HYSD 3FU6A 4NKOB 1TT6A 1XAKA 1U8JB 2OMXB 3LNFA 3LJ3A 4ZXBB 3ZHNA 4Z7OF 1MRCL 2EKSB 1MFMA 1UACL 1XFPA 4ZUWB 3UTOA 3SDDD 4UTBL 5CCGE 4KQ4L 3MRMA 2PYFA 5E5LA 4X80H 3P2DA 5BZDA 1RZKC 2F6AA 4RDQG 1K2DB 2WTRB 3L81A 5D4QA 3V6BR 1KTJA 1NPNA 2ADGA 3QI9C 3QORA 3QQNA 4TRPH 2WBXA 4YFEA 3EJYD 4HAGA 5I1LA 3NFPB 4LVHC 2CU9A 2VWEC 4I48B 1TVBB 1RHHA 5CNHA 3RFZB 1RUPL 2YAFA 4NCC2 3LH8A 5AW6B 3UROR 1I8MB 4QTFA 2EYSA 4K2UH 3SE6A 1A1NA 2AJUH 4GOSA 4ZZFA 1WGVA 4GNKB 3WHE1 1JPGB 2DI9A 1W0WA 5E2TL 3IVKB 1JK9B 2PYEE 2LAAA 3IN2A 1KGYE 5HDQH 1S7SB 2BVPA 3GNML 5HGBA 3B9KB 2IC2A 2X6UA 2IH1B 2B2XL 4BSVA 3QDHA 3FHEA 4YLQT 1OALA 4UDTB 4WWNA 4FXGB 4WI0B 4EN3C 2N01B 2X4NA 4HOXA 4MFHA 5FPIA 1CL7L 4ZMWA 5D7JB 2R0KH 3NJXA 4G1MA 3OAWA 3TJHD 1GMEA 4RISH 3SYPA 5GRJL 3AUWB 4DKTA 3L1EA 3LQMA 1ACYH 3REVA 3O3AA 2RALA 3HE7C 1CDIA 4Q52A 2I07B 1GYWA 1QSVA 2YD9A 4WCYH 2AABL 1A7BA 5CLXA 5GGVY 1EEZB 4BXVA 5IJKC 3WS3A 3MJ7B 5FC9A 5H8DA 35C8H 1MQKH 4FKHA 5ITFA 1BD2D 1U8QB 3CH8A 5HHQA 1CFSB 3V2AR 4YLBA 3TT3L 5EBGA 1F90H 1IAIH 1Q9WB 4OD1H 1FL3B 5D1XA 3MSPA 4ZSOA 2ITFA 4QO1A 5JPNC 3NPZB 3LN4B 4WO4A 2TRYA 2VKXA 1N2RA 4Y1SA 5ANME 3N41F 1UENA 1NAKL 4D8OA 2WSPA 3IJSA 5E51A 4YR6A 5DEFA 4TNGA 3L3OB 2YK1L 2WQAA 4BK5A 1QHPA 3TBYA 1D5MB 3FW6A 3PJNA 2KI6A 3LXBA 1NC4D 1DUZA 4UAOC 5E6IB 3IMVA 5IF0B 5I66A 1KLFB 4F7PA 1SZNA 2ICWJ 3PHAA 2P8LA 1A4CA 4O9HH 2NCMA 3BPNC 1CLVA 1I85A 2GC4C 3LY6A 1URZA 4W4OC 3O9WA 4OJEH 4OLWL 2R69L 1FAIH 4TVSa 4ENEC 4L1LA 1PKQB 2NYYD 4AE1A 2D31B 3QNFA 5DK2A 3RWIA 1UD3A 3UZVB 3ME0B 3MJ9H 2E7HA 2IF7A 2G3NA 2DQTL 5DK0B 3RILA 4CN6A 1E2VA 2FR4A 5EORH 4AV4A 5KUKA 1WA0X 1I8IB 3ROOB 3KPQB 5ADOH 1E4KA 4K8RC 3U0WL 3MJ6A 3HMWH 1SOXA 2FL5B 4MX7B 2O1AA 4FXKA 5A2JH 3AQXA 1Q72L 1DVQA 4GIAA 3RDTD 1CFMA 3GSNH 3U1SL 4UV7L 1MFBH 2O30A 3V4VH 3V4PA 3GTNA 1E6OL 1M3JA 2P5EB 1USQA 3MO1A 1WDAA 2EDNA 3K5SA 1RJLB 2PETA 1M2OA 1Y07A 3GKWL 2KZKA 1CICA 3RVTC 5IB2A 1HE7A 3APMA 3QH3A 2XXCB 1EAOA 4GSDH 3C87A 5IBUG 2DLHA 2V8MA 4DKFH 3GI8H 1JZ6A 2VL5B 5FO8A 2Q7AA 4JQVC 3RL1B 1WFTA 5JHDD 1NMAL 2VW7A 1J05B 1KENL 1MQKL 2R4RH 3BMWA 1E8XA 4NBZB 3X1EA 4D9RE 5J13B 4MA7H 3RL2A 1G4RA 2EO7A 3WY2A 1P6FA 1N2RB 1IARB 4I77H 4LAJH 4ABVA 3E0GA 4ZNCD 2AABH 1KFAH 1N18A 4L29B 1E27B 2OBGA 2YPLD 1BYOA 3VTAA 2X53A 4JCWA 3AY4C 4M4RB 3F6IA 4MCYA 4JHWL 1QBMH 5B3JF 1SYSA 2J8OA 4L3AA 4O58H 1BPVA 2DLTA 1QRNA 1E0OB 3MRMB 4X7CC 5KBDA 3FFDB 5TGBB 1FGNH 1ZHKA 5AKTA 3SPVB 4NPKA 1S7WB 3ESVF 4JG0L 3UTTD 5JO5B 5DMYA 4FQCL 3MTXA 4DGUA 3LZLA 3EOBA 5CSZB 7FABH 1MY5A 2HUEA 5I1LB 1NCUA 1ZLUK 5EA0L 5DGQA 3SDXE 3FB6A 1J8SA 1MOEA 4POZC 4KNQA 1K4DB 4H25B 3PRZA 5JOFB 2DQEH 4BKSC 5FM4A 4UCFA 4IJ3B 4Y1TA 4R7VA 4TSBH 7PCYA 1X6NA 3C6EA 1UQSA 2ARWA 3LKNB 1TVHB 4HS8H 3HC4H 1CWVA 2YGNA 3PWJA 1TZGL 1S7SA 1SN2A 2AXJA 5SWSE 4Z7NE 4Q9BA 3PJSB 5F9DC 4ABUA 5D70L 1XHHA 1PVHA 3BP4B 3ZE0F 4NO0D 3CVDA 2QV2A 1KCKA 4IGBC 2NNXA 1JD7A 1RURH 3RFZA 3ECUA 4G1MB 4YGVB 2VMFA 3LKOA 4HWUA 1A7QH 3L4XA 3KWVA 4D0DB 3FAWA 2YGVA 1FYTA 4I5BA 1KJ3L 1K4CA 2HT2C 3FCTA 4G3YH 2DM3A 3NJIA 4YDVA 5C0JB 2Q86A 1ZIAA 2A0LD 3D39B 4LSUL 2X4QB 5FYJH 1JK9A 3SE3C 2OFQA 5C0RH 4XXCA 5FW6A 2QKIC 2NTFB 3K2UL 1YYML 4UZSA 4B0MM 2FLMA 4YHPB 3SGJC 4JKPH 3D85B 4YSOA 5CZKA 1JWSB 4O5LL 3RUGE 1R5IB 2BS9A 2R2EA 1XF2A 3OG4B 1PIGA 1ZMYA 2P8PA 3EFFA 3FUHA 3NUKA 2JJTA 4MXQD 5AKSA 3S3DB 1NMAH 4AEHL 5I19L 4P2AA 3CSYB 1AMYA 1WFOA 4F33A 2WKOA 4LLDB 5DS1A 1T4KB 2DQ6A 4J1UA 4Q9CA 1JGLH 3HRPA 2VN7A 1HYSC 1SF3A 4BA0A 2VUKA 2OMNA 4BRVA 4FYQA 4JHUA 1BF2A 3P0YL 4R7XA 4JRXD 4QRRE 2AQTA 1C12B 2L0DA 1X5AA 3FB6B 4KY1L 1HFUA 4Y5YC 2CPUA 1OAYH 3HHSA 3GT6A 1FQ9C 2WZPD 1L0XA 4CVXB 3LPOA 2WIMA 4HFUH 1A21A 3FU0A 3FT3A 4AZ8A 4W6XB 5IOPA 1BM7A 1ZXKA 2OMVA 3AXHA 1HHGA 4NO5A 4POYA 1PKQA 1IGCH 1U3ZA 2GPZA 4H8WH 1AQMA 5GIRB 2Z1PA 1FNSL 2WWKO 5FCUH 1AFVH 2EYRB 3P3YA 4XP9L 4QR7A 4TOYH 1TSHA 1HJCA 2BHFA 5EUKA 3ULVE 1N6QH 1B3IA 1KY7A 4DN3H 2B1AL 3NN8B 1H6TA 2XG4B 1Z5LB 1Y6KR 3Q3GB 2AJXL 4CKVX 5T1MA 4XP4H 5E6IA 3AY4A 4HUVA 3MA7A 4HGMA 1DLFH 1A5FL 1WFJA 4JPQA 4BGLA 3VD0A 1UD2A 1N68A 1HILA 4NPYA 2NXZD 3LKOB 1BEXA 3WKQA 3Q8FA 3QXTA 5DR5H 3B8YA 1JGEA 5DI8A 4KXCA 2LGNA 4J12A 4CW1B 2V7HA 2VN5A 1X9RA 2OYKA 1I7ZA 5MP6L 5HHPA 3W11D 3PAUA 1H8NA 3RWIB 1CGVA 2X0VA 3QH3B 3QO1A 2FLRT 3GZQA 5IROA 4JY5H 2NY5C 4YSDA 3L95A 3P0VH 2A9AA 1OQOA 2J5LB 2K45A 4RX4D 3FONB 4KQ3H 1A4AA 4GSQA 1JUFA 2CMRH 4KDVA 1BQUA 1UWGL 4QRQA 4JO3L 5TE4H 4JCMA 5IIEA 1CVRA 2DY2A 3RWGA 4ZFFB 2B4CC 4MLIA 4N90D 35C8L 3PWPB 3QXAA 5T1JA 4QRSA 2UX7A 1T22B 2ADIA 2J55A 3BSZH 3MRQB 4KK9D 3GXMA 2NTSP 4HJGB 1BV8A 4HKBB 4M43L 4LB8A 5KVDL 4U1LB 4Y5VB 3P02A 5F1NA 1U6AL 5GGSA 5IB2B 1QRNB 3VI4B 1N5AA 5T3ZL 5DS8B 5ANMA 4PJBA 3X1NA 5JIIA 4LLWB 1DVYA 2XA8L 1TEFA 4M6NH 4JO1H 3DNKA 1KJ2A 3A6BH 3BCFA 4JVWA 3LKPA 4FERA 4GO9A 4JO2L 1KXHA 1WICA 3DGCR 3U30C 2G2RB 3ARWA 3RL2B 4NUQA 4OKDA 4JK0D 1E8ZA 3V8CA 2YJQA 5FO7A 3O6FC 1LK3H 3CU7A 2E7DA 2JKTM 2VDKB 4FQLL 1WIUA 2YPVA 5F6IB 3BE1L 4J3UA 1BXAA 3N55A 3C6SB 4OV5B 5LGJB 4RMTA 2GBTA 4NAMA 4PMEA 3PWJB 2VZVA 3L3IA 1CDYA 2FGWL 2CIKB 2W95A 1CXLA 1NGYB 2NY0D 2WZ0A 2YUXA 3M1BA 2Z93A 1L0QA 5DRXB 1AGDA 1DBML 2OJZL 1CD8A 4KKPA 4YC2C 4DESA 2BVOB 4YSTA 5JIMA 2CBOA 3ZDWA 1RL1A 4UQBA 3ARGC 4O4YL 3TCLA 5DWPA 4PJDF 4XODA 3FU7B 3VJ6B 4ZFZA 3ZE2B 4JJHA 1PNCA 3ZTNL 1LP9F 4WUUE 4OIIH 2F58L 2VJ0A 1MFAH 15C8L 2AFNA 5DUMH 2CKBB 4AYSA 4AKOA 3KCWA 1EXGA 2NY6D 1NGZB 4XP5H 2V7NA 1FZMA 4Y5YA 4KJQD 2Q8AL 5E1GA 1JPSH 2NZ1A 1ILSA 3X17A 2E6PA 2PWEA 4K4KA 2B59B 4UF7C 5GGQH 3SPIA 4N2LA 4DVRL 1PZDA 1BX2B 2EDQA 3LQAL 4PJXA 2ARJA 3WO4C 3T6VA 1N67A 3BWUF 1T5WB 4Y4HC 5EZLA 2YGPA 1NPJA 2P9RA 3RWGB 4P05A 1QABA 4K9EL 1MHPH 1GGTA 2XWJB 4Y19B 1A6VH 4HK0B 2NY6C 4N90E 4HWBH 3BAXA 4R3SB 2Q6WB 1RLWA 2VAAA 3TIDA 3ZL2A 3D69B 5FA3B 3WUZA 4HS3B 3KYOA 1KIUB 1EZSA 3NSFA 4FFWC 4MQTB 2I9TB 1W91A 2R8SL 2G9KA 3S34L 2APTA 4TNWF 2VQ1B 1ZD6A 4N85A 4PR5B 3DA0A 3WSQH 3EF4A 4EMZA 5CCKL 1MWAL 1EHXA 1EUUA 3OKEB 3SDCD 3RU8L 3RBGA 4U0RB 4XX5A 3OLIA 2YPLB 1XGTA 3NACH 3RNKB 2GYSA 3KVQA 1BQHA 3CFEB 5DDHA 2ICCA 2YD7A 2X70A 4I87A 2NYYC 2ZNWA 4Z0XB 5C0DA 1XDTT 1A47A 4YHPA 3OVUB 1JGIA 3HHSB 3OJMB 1FNFA 1LEGB 2Y7QA 2VXTH 4HIQA 4P2OC 2LQRA 1FGVL 2BJML 1C5DB 1ZK5A 3FFCA 3OGCA 1SJHB 3I9PA 3NH7H 1KFGA 4JZOA 4LEBA 2GK0A 1MCSA 3LOWA 2MQGA 3BDYL 5CEZE 1XSJA 3L1OH 3QXDA 5JQIB 2KPWA 4MJHA 4PFEA 3N85L 4M02A 1UB5A 4UU9B 4NKMB 2CLRA 5E08H 2OR9H 2DQUL 3L13A 4P2OD 4WV1C 4APQA 4AUUA 4KXAA 1UM6H 3SODB 1FVEA 5I24A 5DVMA 2VRAA 3QUGA 2O26U 5IUCA 4PJAE 3GM8A 1UD5A 3UYRL 1FPTL 4XCEB 2OYPA 32C2B 3FU7A 3VJ6A 5SWSA 1EHLL 2FHBA 3UOAB 3GZOA 3L2NA 5I6KA 1JZDC 1X4YA 2A2QT 1CYXA 1GGCL 1JV2A 5HBBA 2XETA 4WW1B 3KS0H 2R27A 3FQUA 6FABL 4M6AA 4HIXH 3FCSB 1E4WH 1YDPB 2UWEF 1TJGH 1FRGL 2PO6B 3KPOB 2WUBL 1NBCA 3C6LB 3QIBA 4XPGH 3BPLB 2CUMA 4XBMA 5MEPB 3DMMD 3K72A 1L9SA 4IRSC 4MNHA 1CI3M 2QHLA 2AJYH 4FXLA 3FT0A 2YBRB 3BUDA 1A02N 5I9QC 3E8UH 3VWKA 3I6KA 2E4TA 3QUHA 4L37B 3CSBA 5JMRA 4XP1H 3HR5B 1S4IA 5D4JA 1N12A 2R2HA 4JO5A 3LIUA 1AI1L 3SKNA 4KKAD 4M5ZH 4IKJA 1UKSA 1BA9A 5IR1B 2F54E 4HCRH 3PWUB 3RYMA 3ZTEA 3X1FA 2F8IA 3VDCA 3KM1A 3F5WA 3KPTA 2ARJQ 2D0HA 4PS3A 5HD8C 4YZFE 3II1A 1KBGL 5KS9F 3FPXA 1CG9B 2QZ5A 4N5ED 1OF2A 2WHVA 3ATFA 3MUUA 4PJ9D 1NL0H 2A6JA 4NB7A 4MB3A 3QIUD 1LEGA 1ITCA 5DJ0A 4KK8C 1CVSC 1OGAA 3AROA 2MPAL 5CSBA 4F9LC 3VXTB 1G94A 1KBGH 4EUPG 3ETSA 3S6CA 2ZWNA 4R4BB 3GS7A 4OZHA 3Q2LA 5LGHL 4IRJC 9PCYA 1AJ7L 2VC2L 3N42B 4MB1A 1Q94B 4LHQB 4N6RA 3O2VL 1GW0A 2HH0L 4KJWD 3CCHA 4PTUB 4RAVA 3X13B 4E5XG 3NIDB 5IBLD 3NJNA 5ES4B 4PJBB 2P47B 3GSWA 3I02B 5AW1B 1NINA 3L4VA 3LRSB 4NM8H 3Q1EA 3C2AL 2GW5A 3MCYA 3SO3B 2WB7A 3X3GH 2LW3A 4G9FD 3D08A 4L4VB 4HSQA 2J57A 4Q4EA 3ASNB 4YHZL 2O5XL 3OMZA 3BKYH 4LOUC 2NY2B 1AD9A 1PZ5B 4X4ZA 1EAPB 1TJGL 1BZQK 4LSPH 4D3CH 4FFZL 2XWCA 1TLKA 3QCTL 2ED8A 3KPPB 2X3BA 3I9GL 2ZKHH 3HCVA 2QDVA 3C6LA 4Y5XA 3WL9A 1M71A 3RVUC 2ICEB 1TDQA 2F19H 2XT1B 4A55A 2BOCB 5ICZA 1A9VA 5LUMA 2ZF9A 4OGAC 1IVTA 3DOSA 4MAYA 3LEXA 1HOCA 4PJHF 4PJXB 1NGYA 3I6KB 4JFOB 2KL6A 3HNVL 4BFNA 3I50H 1IMHC 4JJOA 4G59C 2J1YA 3QZBA 4Z3GA 3V10A 3HN5A 1HH6A 5CJOL 4AQ8C 2YD4A 4NHCH 5FWQA 4WO0A 1JZ3A 2N7BA 1U2HA 5FGSA 1E42A 5T5FH 4NFDA 3L1OL 4P4KC 2OL3H 1AD0A 1MCOH 2P49B 1RH8A 4JHZA 3ILQC 2VLKB 3BUPA 1HIMH 3BUYA 5F9JA 2VDQH 5ICYA 4UILL 4GQZA 1U3HA 3N43F 1E27A 4GBXB 5EN2B 5C0DB 2VCOA 5EEXA 2DQCH 4NQVA 5HVWA 1IE5A 4DGVH 1IAIM 4E0RB 1ZV5A 4D2NA 1FH2A 3RJDA 4KO7A 1BMGA 1T1WA 3FQWB 3M1OA 1E2WA 3I75B 3B2VL 3E6FA 4NZDA 4Q0XL 5E8EA 1F5WA 5DZNA 4HHGA 3MI6A 1HTYA 3MLTA 3EOTH 2VRKA 3V6FB 2FJFB 1YY9C 2PPAA 3ZOAA 5BS0D 1CT8B 4YDJB 3MC0A 3W38A 2PP8A 4K9EH 1RIVH 3CVHA 3FSVA 2VR9A 4G9FE 3MZTA 4JN1L 4LLYB 5CWSB 3SKMA 4J28A 1U21A 1XSKA 2WW8A 2BSTA 2Q76A 2VZTA 4Z0XA 3LQAH 3N1GC 3DRQB 2UYLA 4RGOL 3FU9A 5FYKH 3D7PA 1X5XA 2DH2A 1LMIA 2PP9A 3EW3B 3Q6GL 1A3ZA 3Q7JA 4JM2C 1JXDA 5TE7H 1I9RH 3QEGH 1JI1A 3IAQA 4KWUA 3OMIB 3VWJA 2OTWB 1LEKA 1MG3C 1ZIBA 1DQMH 2BY3A 4LCCA 2YQ2A 3PJSA 4U3HA 4PJAB 1UTDA 2CRMA 4M93C 2WLLB 5AVYB 5FUZL 5L2KD 5ICUA 4AYFB 2VLME 3MV01 5C0EB 1OD9A 3PWVB 1ED3A 3O81A 4OF0A 3TPKA 4GI6A 2IBGA 1H6EA 3VXSD 4GXFA 4WSJA 5GGVL 1QFOA 3WY4A 3BKCL 3WEXB 1JXFA 2IXQB 5EO9B 4FRWA 4UB0H 3ZKQD 2ZZUT 1P0SE 1D2OA 2BMKB 1NM9A 5HY9A 1KLUB 4PV8B 4ZNEA 4R4NC 3UTZB 3L4ZA 5FFLA 3QIBD 2NSXA 3KVPA 4LVNC 3TN0A 4DH2A 5K9OA 3JTSA 5L6YH 2V9QA 1ZY9A 3BUQA 1EK3A 2DQMA 4Y5XC 5HGHA 1FYHB 3RUGF 3FN0L 3RY4A 3MBXH 1A7PL 3KPNB 4PQXA 3ETBJ 3H2PA 4NKOA 1BZ7B 3D4CA 1AOZA 2BXZA 1SJEB 3Q8CA 3VM7A 2DIEA 3OHXB 4MNHB 3VB8A 3MLRH 4AC4A 3O6KH 1QLFA 1SF5A 2OXHB 2FATH 4X9IA 3VB9A 2DBJA 2BSEA 4XWGL 2KZWA 3F58L 3GK8H 2PXYA 3A3YB 3RDJA 4J1UB 4TNVK 2NW3A 3LQAC 4L1DA 1U6AH 3VA6A 5SWZA 2KKQA 3ZU8A 4M43H 3UP6A 5AW2B 1ID2A 3B3IB 1HU8A 2D4DA 3G7TA 1SXCA 3P4NB 3FFCD 3SGKC 2X2JA 5KG9A 1MJ8L 4DEUA 2C9RA 3FO9A 3QK0A 3FT3B 4AZ8B 2I60H 4FCAA 3JT2A 4PRIB 3TA3C 5KYYA 3ZTCC 4LCVA 4JFVA 4HDIA 2HFGL 3FQTA 3H6AA 2GSIA 4TUKL 2PCXA 3MOAL 4NRZA 4BSVB 4R8WH 1NCWL 1J9RA 4ZMYA 1J86A 2LE9A 3K8KA 1XB8A 1LMKA 4GKSA 3EO1A 4R2GD 1E65A 2VLMD 4RA3A 1NGWB 1LHZA 5B38G 2ICEA 2WXLA 4JRXA 2DB8A 3L6FB 3KW8A 4R6UA 1SHWA 3TVMB 1NANI 2JNZA 1L5GB 3ZN6A 4X5WB 3V52L 1AS8A 3PQYD 1HILB 1KGCE 4N2KA 4NPYB 4C56B 3I6SA 5DVKA 1TZOA 3FQRB 1A9BB 5IMLB 4K7PX 1MIEH 3X1GA 1AOHA 4CW1A 2XG5B 3IPBA 4KKQA 5JDSA 2IIJA 4OTXH 2HKHH 4QF1A 4XNQA 4DGYH 4GH7B 4KITB 4P04A 4AIZB 5EIIA 3BD3A 3QZOA 3MJWA 4MA1B 4R7NA 1FSKB 4R5XA 2HFFA 3TT1H 2DQFA 1VDGA 2ESVA 2NLJA 1A0QL 1SXZA 3O4LE 4PHZA 3WJLA 1MAJA 5KYUA 2YZ1A 1IGCL 1MY7A 5EEZA 3NIGF 1VADA 1JGDB 2A73B 3ARXA 3L9EA 5JUEH 1TO5A 2PUQT 2PN5A 3DX8B 3NZHL 4BQ9A 3TA4D 4PJGB 3O2DA 2YEVB 4RWYH 3U25A 4AXWB 1F4XL 1XH3A 3WNOA 4CVWA 1KNOA 1FHGA 1BAFL 1DEDA 5I1KL 3WIHH 3TIEA 4OUOA 5K9QI 1OAZL 4LCCC 4X5RA 3JV6A 2GSMB 4G11A 1DQLL 4XH2B 1B3JA 2WMPB 4P4KB 4V33A 3NGBB 2HN7A 4PJ9B 4UAOB 4IRZH 3FQ2A 3KEHA 3OXRA 5BRZE 2ZCKL 5KW9H 3EJQA 5EOCL 1RJZB 3LTVA 2F15A 3I2CL 4WU7A 4DKAA 3T4AB 5FGCB 2P8LB 3WD5H 3GBLA 5ETUA 2KDGA 2HP4A 4OJFH 3ZR5A 3BP5B 2VW6A 2APFA 4PJCB 2Z8WC 3VVVA 2WO4A 3OKLB 5DZLA 1V3MA 4UM9A 4LVOC 3FRPB 3M8OL 1HHHA 2DYPA 2W07B 3U2IA 4RSVA 3QORD 4XCNA 1B4RA 4LLAA 4JAMB 3N5AA 1BG9A 4TLTA 4NO2B 2VDPB 5HHNA 3EYSL 2XTJC 3Q5OA 1DVUA 1T1WB 4GKSB 4HLZG 4JB9L 3VWJB 4LAQH 1WPCA 4DSYA 2OR7A 3P3TA 5C0FA 1EXHA 1IEHA 3V4VB 3A67L 5BW7C 2XTJE 1KCRH 1SFHA 2BY2A 2DYPD 3EOTL 4YHIB 1FO0H 1SUHA 2GKIA 5C0IB 3MV8B 2OJ1A 1TETH 3MACL 4R0LA 1UEMA 2BVOA 4J2XA 4P2RE 4FI8A 3UBFA 3CAFA 3ZTJG 1UM4L 5EG6C 1BCIA 2HVKB 2HRGA 4EI6B 2UY7A 5AAMC 2IXQA 2GAZB 2JF1A 4JFZL 3PPSA 2CE6A 5D70H 1U92B 3LVTA 3JWNC 3GSUB 3NTCL 3OHMB 1XIWD 3LEYL 3WLWD 3HKZA 3MAWA 1SJVA 2V7NB 4ZUTA 3HI1A 3JTSB 4OLEA 2PPFA 4W9FC 3O4LD 1A64A 4V2BA 1KPRA 3ZIMA 3UABA 4CSTA 3IPFA 5GS1A 3QUZA 1GJWA 1ACXA 2ICWB 3MYJA 3OSKA 5I15H 3UDWA 5GGUA 2XIDA 5KBPA 4XCCL 1B0RB 4L4TE 3T4YB 1MCOL 1WWWX 1MDTA 4Y19A 4JO4L 5F7WC 4M3KB 3KCPB 5EEWA 3TFBA 1PDKA 4G8EA 5I8KL 3OMNB 7FABL 3ZRSA 3WEXA 4JX0A 4R96B 4XWOD 1YCSA 1QFWM 3GBNL 3O4OC 1GH7A 2GTQA 4WGVB 5CS7A 3QUZC 2BNRD 3GDCA 1ADQA 3LMJL 2YMTA 5CP3A 1QZ1A 4UT7L 5JZ7C 1QNIA 1OOAA 3L9RB 1GGUA 1PLCA 4AVHA 3MBWB 4FJYA 4GAGH 4I18A 1ZS2A 4XMZA 3QDJA 3CN0A 1JZEA 4JPKL 5FB8A 2F19L 2C9SA 4R90L 4JFYA 3V4UL 3I6GB 1AACA 2Y36L 3MRDB 1O5PA 2VJXA 5FKAB 4I9WD 4XNXH 4D3CL 4LKXA 1E5BA 1QZNA 3LSOA 3HG0A 4HC1L 4Q56A 1IFHL 4MA7L 5CM1A 1KC5H 4E9QA 3OTTA 2FT6A 2VWEE 3SDCA 3KPSB 4KGLA 2BVQA 3BJLA 3DUSB 2X1WL 2CBQA 2OTUA 1FLTX 1CF1A 1WLHA 4PD4J 5DVOA 4G5ZL 4LPYA 3K5RA 1KN4L 2DW5A 3M8OH 4AX3A 4ANVA 2W5PA 2DM2A 2YARA 3KBHE 2CCLA 3RZCC 4RFEB 1KIRB 3EDDA 1EANA 3FYEB 1IAII 3E9TA 3H9HA 3OR6B 2F61A 4LSQH 5EU3A 4KZCA 1VCBC 4LOFA 2GAZA 3ZQ9A 4P2QE 3O2DL 4HWEL 3IETB 1T1XA 3K8MA 3SDYH 2VDPL 5T3XH 3T65B 5C0GB 3MNZB 4HUXA 2J25A 4EJ1C 2Q86B 4ZAKC 2H8PB 5HDRA 4KXDA 4Z0BH 4EI0A 3VXRE 4ETQA 1RULL 2J1KA 4HX1A 3RQ3A 2XXMB 3DX9A 5GS1B 4EDXA 2HPOA 1OE3A 2PF6A 2R0ZH 4NN5C 4Q9QH 2E8YA 1BD2E 1CURA 3WCYA 3PGFL 4HT1H 1MHHB 3RIAF 4BFFA 4YEEA 6TAAA 5D93B 1I9JH 2WAQA 2WQRA 5GQBA 1DVFB 1IO4C 4KXZH 3EYVB 3DROA 1FAIL 4K71C 3LDBB 4FXTA 3Q2WA 5E00A 1K85A 3L2MA 3BP7A 4R2GC 2E47A 1DJIA 3QDGB 4M5ZL 2DQHL 1P5VB 4TS6A 5I71B 3OKKA 2ZXGA 2QSTA 4ZK8A 1QHOA 2BNRE 2DLIA 3ELAT 3PWUA 4DP5X 4KK6C 3SPCA 1KG0A 4ZS6D 5B39B 5B38A 3MLSH 2J4WL 3WNMA 4Q2ZB 4DVBA 1BWMA 5KS9A 2CG9X 3QR2A 5IQ9B 1BVLA 3VDBA 3BN3B 3IDNA 3X14B 1OB1B 1VPOH 4MASA 4Z7VF 3BHBB 2WNGA 4AIOA 4RGMC 5FUCC 3BN9D 4RWHA 2OP4H 2L7EA 1RUML 3DUSA 2CLZA 1QEXA 4LESA 4OZHF 1AKJA 5AYUH 2ZYSA 2X2UA 1EA9C 1TZ8A 3MRNA 2VDLB 5FGRA 3S5LB 4Z3JA 3DPDA 5IBUB 4JFXB 3B56A 4RAVB 5FW8A 5IJCC 4F57L 4NO2A 2ZCHH 5I30L 1T1YB 4BZ1A 4EKJA 3P54A 3O6MH 4RISL 4XNMB 5ISZE 3ZE1F 2Z6FA 2WJ5A 3R18A 2BLFA 4Q14A 4YO0A 5C7XH 1D9KC 5J3HD 1NUNB 2XFGB 5CSZA 4N0UE 1P2CA 4Y4KA 4X98A 3NH7L 3OKLA 4EI6A 3CFBB 2ZX6A 3K0YA 2Y4SA 3N50A 5D1ZI 5TF1L 3DTXA 2XTJB 1H3PL 2WTOA 3F58H 5E7BA 3CSPA 1GGBL 4XI5C 2G75B 3FK3A 3UPRB 1MELA 3CFCL 3MLRL 3CXHK 4XBGA 1QACA 3OGOE 2LVEA 5HPOA 4R7DB 2X5PA 2R7EB 3GYRA 1G9ML 3IGAA 4Y4HA 5HPMA 3WNJA 5E00B 3ULVL 4GEJA 1XGUA 1TEGA 3U4AA 3PWPA 1FFNB 3QXAB 3RHWF 1HH6B 4ZX6A 5D5MF 2LAGB 1X5YA 2A3TA 3MLUL 1KCWA 3FBKA 1QNZH 4L0ZA 4Z7WA 4S1SL 4MA3B 1GZQB 3BFQG 4A2MA 4HOMA 2AJVL 4Q2ZA 4DVBB 1OAQL 2G4EA 1OPOA 1P5UB 4L4TB 1AQDA 2FT7A 2YUWA 1P1ZA 2W0FA 1PEWA 3GHBL 4XOBA 4ZT1A 3CFNA 3QXVA 5A6IA 3BH9A 4QHNA 4YVUA 1KT2B 1ZPLA 1YYLH 3DX1A 4LARL 4JFYB 2WYTA 2YAPA 1MRDH 3IAPA 1T89A 4P2OA 1DQML 3MX0A 3C08L 4ODTL 1Y0LA 1R5IA 4OFPA 2CHDA 2PW2A 2FJSA 4XMVA 5AB0A 3ARFC 3I75A 4EN3D 2HSIA 1AE6H 2GEEA 1MNNA 3VQLA 4PRNB 5FF6A 3VYNA 1ETB1 4UOJA 4JFDD 1F2QA 4HETA 4J6RL 5KJ4A 3PP4L 2FO4A 3FT2B 3UBGA 3APNA 2K3HA 3IU3B 3QJQB 4DGIH 3IDIA 5DRXA 5IQLA 5BZZA 1KTRL 3H2WA 5CWSA 3FCBA 4Z7UB 4BFOA 1TYJA 3ARVA 5FYJU 3WFEH 1LEIB 3HE7A 5I1GH 3BE1H 3HB3D 3JUZA 3MLYH 5I8CB 2CKBH 3TO4A 4FQLH 3TBBA 1EO7A 5CSGA 1RZJH 1TKWB 3UIYA 1R19A 2CKBA 1CXEA 1JTPA 2OTWA 3KR3L 1YEFH 3B5GA 3QFJB 3MXWL 4TKWA 2AQ1A 3SOTA 1LGVA 4DPAX 3KPSA 4E36A 2P5ED 1EBAA 2XVKA 5L2JB 4TTGA 2UVEA 2DKSA 4K5OA 3T8XB 5I82A 2EC8A 3EHBB 3O0RH 1DDTA 2Y1VA 5BUPA 5T3XE 4LDOB 3EFDL 2ORBH 5C08D 1XSOA 4JPVH 3DMMC 2V2WB 5T3ZH 1I1AC 2BDNL 4LLQB 5D7KE 2BIIA 3FTWA 1IGIH 2OMTA 1NIFA 3VFTB 4Z76A 4XB7A 1VF5C 2OL3L 3WYRA 2CBMA 5EOCJ 2B0SH 3BP7B 1JXGA 5EU3B 1VKXA 1NFIA 2EDMA 2FSEA 4BZ2L 1MCPH 4JREC 2OK0L 3BGMB 4J8QA 5BO1L 3CSTA 4L4TA 3CIQA 3RUGA 4LHJB 5EV7A 4UOQA 4PYGA 4NJAH 3SKJL 1Y7VA 3RNKA 1AGBB 1MCKA 4QNPE 2DYSB 2OZNA 4XPBL 1QLRB 3ATDA 5EULV 4QRPD 3QDGE 4N2FA 3QQ9D 1KT2A 5FOJA 1INDH 3TYGH 3HFFA 3HFMH 1OV8A 4P2OB 3DIDA 1QQDA 4TVUA 2ODHA 2FIKA 3U7YH 3F2LA 4PJHE 1HXMA 5I2IB 1SDDA 1S7QA 3CNKA 1OAJA 3E2HC 2WN2A 2ADFL 3CE1A 2WNKA 1IV8A 2B1HL 3AM8A 3BKYL 2GTWA 5KTEL 4PREA 3VTTA 3IXAB 4P4RA 3VTMA 1PD6A 1YN6A 5AB9A 4Y5VA 5F1NB 5GGSB 1KIPB 3SPJA 4X6DF 1J5OL 1JPTL 4BKTC 2OMZA 3UGEA 4RGMB 5E8NB 4F9LA 3A4EA 4KUZL 2CDFB 4URTB 4EBQL 5KVEL 4ZDHB 3CLEL 4AG4L 2ZSVB 3OC8A