3D87B

Crystal structure of interleukin-23
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
306
structure length
298
Chain Sequence
b'IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-23 subunit p19
publication title Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 55
structure length 298
sequence length 306
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B03
1JWMA 3BW9A 4L3EB 1KTRL 3N1FC 4TNVK 4P5KA 1JBJA 5HXMA 4Z7WF 1TCMA 5J9PB 5LQBL 4MAUL 2YA0A 4S1QL 3UTSD 4Z0BH 1PG7W 5FO8A 4KJWD 1ROWA 4Z78A 5JOFA 1DN2A 4Z95H 2OI9C 2ITDA 3D3VB 3EYOA 1TFHA 1FC1A 3BGFC 3QRGH 5F96L 2UUDK 1E4XI 4HDIB 4NM8L 4NOBA 1IAIM 5CGYC 5GGQH 5JO5A 3VXMD 4PJGA 5L9DL 4L9LC 4MMXC 4XXCA 2NY2C 1IM9D 3GUTA 5DA0B 1C5DA 3RHWF 3SKJL 4U1LB 4UDUA 4XPGL 5D7JC 2NTSP 4DAGL 4E42B 1KLFA 1MI5D 1HOCB 4YWGL 4YK4C 1YYML 1AI1H 4ODTH 4RGNB 1KIRA 3T3ME 2P5EB 3RWGA 3CX5J 3QCVH 1YUHA 4Z7QF 3L3GA 5FYLH 5IFAL 4PJ7A 3S37X 3VFPA 4H8WL 4LEXL 4AEIL 1EIBA 4M8QB 2MWCA 3JV4B 2UWEA 3SKUD 4NQCB 5LAXA 4DW2H 1IM9A 2X1OA 4NC1C 4Y1AB 3L3JB 3MRPA 3TP4A 1E27B 3F65A 1RMFH 1ZT7A 3V0WH 1P2CB 2CQVA 4NZRH 5IBTL 2YUZA 2AV7A 3FAWA 5E9DA 2GTZB 2FSEA 4HWBL 2VZ1A 5CP3A 5DRXB 1XGPA 1S7XA 2G2RA 2VL5B 4XP1H 4F9LA 1HZHH 5CINL 3GDBA 1G7MA 2XTJD 3V4VL 1V7NL 3BQUD 3V95A 3TJHC 2H8PB 2JIXB 3KAAA 3K2UH 3OKMA 4TUKH 2J8UA 1B0RA 1QYGL 3QQ3A 4YXLH 4Q6IB 3FQNA 4M6AA 5TQ2L 3UJJL 5D7KD 4YHKH 2HT2C 3AU1B 4BFEA 4JHAL 4HK0A 1NGPH 2R2EA 1JHLH 4OD2B 1F4WH 1HQ4A 5BO1H 5IHBA 5KS9B 3WHXB 4UQ3B 5F44A 5CILL 1MIEH 3SY0A 3CPLB 1KENH 2XQYG 3RFZC 1L7IL 1NBYB 1H3VA 2P4AB 3KPRE 3BPLB 3BO8A 3U48A 4TPRH 2EDDA 1PG7H 5I1GL 2AJUL 4UNVA 4PLNC 1TVHB 4Y19B 3BZEB 4P2OD 3BQUA 1J0JA 1QFPA 4EIGB 5IESL 1OQOA 3MRBB 3WD5H 1I1CA 1L9MA 1WWBX 4HD9A 2YD5A 4FFYL 1E28A 1FO0H 2B1HH 5J1AB 1FNEB 3EYQC 3WFDL 5IWLA 1NAMB 2AEQH 5AD0A 1QVOB 4R0LC 1R5VB 1MOEA 2HRPL 2ICEB 4ZUUB 3V2AR 4BQBA 1N5AA 2A74A 3OKNB 2ARJB 5IB3B 4XCCL 4UV4H 5AWNL 4P2OA 4HT1H 5DD3H 3VWKB 3FQXA 1MFBH 2F74B 1WFOA 3CDGB 4D0DA 2PUQT 1MAKA 4HX1B 4NJAL 3L1OL 1DJSA 2APFA 1A6VL 4OI7A 2F8OA 3RBGA 3M17A 1GGCL 3CFCL 2R0WL 2KL6A 5BMFL 4YHML 2CRIA 2VITA 3ZE0E 4ALAH 3L3OB 3BEVA 1P84J 2GK0A 1BVLA 3OKYA 3CC5B 3BGMB 3D3VE 1G7JB 1IGML 1JGEB 1BD2D 1NAKL 2OBGA 5HYQB 4M61A 3MBEC 2ZUTA 5FGBC 4OUUA 1A3RL 1JIBA 4LRNL 1V8HA 4LPYA 3LQAH 2W9DL 3UTOA 3DRQA 2YBRB 3MV11 4YNYB 1L6XA 3S35H 5D93C 4PD4J 3TYGL 4U1IB 2F5BL 4NCC2 3V5HA 5HHOE 1XCQA 3P4NB 4OGAC 4Y2OA 4XI5C 5DSCB 2HJKA 2IPKB 5IMMB 1XF2A 3BPCB 3RWFA 3BP6A 1U8HA 1YA5A 3FT2A 3IKCA 1BLNA 1QSFE 4HC1H 4X6DA 4QLRA 5BOPA 3OKLA 4M3KB 2HYMA 4PJGF 4WI6A 5E8NB 2MCPL 5EUKA 4XMKL 4Z0BL 1P7QD 5JW5A 5CGYD 2VKXA 1LDSA 3Q5OA 1GPOH 3BI9X 4JN2B 4Z95L 3QXVA 2X9XA 1O0VA 4XAWL 5GGQL 1J0ZA 4O2EA 2HWZL 3DBXB 4X5XA 4R7NB 5D7JD 3TGXA 3MUHL 3QFJD 2AK4E 4LLUA 3FFDB 3NIGF 3ET9F 3RIAF 3PWPE 1HSBB 4MLSA 1C08B 5J11B 3QO1A 2FJHB 2NX5D 4QXUH 1KEGH 5ICXA 4PJ7F 1I3RA 1AI1L 1MQ8A 4ODTL 5DJ0A 1MVUB 1HSAB 4X7DC 3GSNH 1YEEH 4Z9KB 5KS9E 2UWEF 2VQUA 2BOBA 5B3JE 2YD4A 3MR9A 4S1DC 1KEMH 1P7QA 2YMXH 4NKMA 5F3HB 1UB6B 5FYLL 4GG6B 3IAPA 4L9LA 4JY4B 1DUYA 1S9KC 4P99A 3GSOB 1JTPA 2CRYA 1TENA 1A4JA 2RJMA 2MSPA 4ZUVA 2F58L 3DX6B 3G5VA 2G75A 4TVSa 4OZHE 5D7JA 1KFAH 2QQLH 4DW2L 3MFGB 4Y19E 1S9VB 1W72B 1J05B 4OFPA 5KOVC 3IETA 1RMFL 1Q8MA 2XKNB 3V0WL 3MJ7A 4LLWB 2IQAA 3PE9A 5EC1B 1IGCH 3NFSL 1T7WA 3V7AG 1EBAA 3HN3A 5K9QI 2J8UF 4PRPA 2VLMD 32C2A 3TJHD 1HZHL 3WSQH 5J12B 3MLUH 3NAAH 4ZFFA 4MXVE 4PUBL 1NPUA 2CO7B 2A2QT 3K2UL 2W91A 1CFVH 4V2CB 4TUKL 3QNZB 1A7PH 4YXLL 1TETH 1MCOH 1G7QA 1R5WA 5L2KB 3JWDL 1KBGH 3IF1B 1OHQA 3EO1A 1JHLL 1F4WL 5MEOB 4ELMA 4HS8H 1CGVA 4I0PC 4NKOB 4MZ2A 3TJEH 1MIEL 1A4KB 1FL3A 2GJZB 4UU9B 3FQWB 2Y7QB 1MHPH 1HXYA 1HCVA 1F6AA 2B2XL 5FO7A 5B8CC 3B2VH 4TPRL 4AEHL 1PG7L 2YZ1A 5C0IB 5SX4I 4JM2B 2F53D 2O61B 1VENA 3B3IB 4LDLB 4YDVB 4PJXE 3ZKSD 5B39G 4FQJH 5K9OA 3EYQD 3BEWA 5IVXA 1L0QA 4Y4HB 1RVFL 2PXYB 1FO0L 2B1HL 4GUPB 3DMMB 2NTFA 4IOIB 2HJLB 4HLZG 1F02I 4MXWH 3CVIH 4GKNB 2AEQL 4X4YB 1A6ZB 1KJVB 1FL6A 5CIPH 1ZANH 2J5LC 1YEFH 1BQSA 4J8RA 3QDJB 4BM7A 1AGDB 4U1KB 2GTWB 1T3FB 2YK1L 2A77H 2X9YA 2P48B 3F12A 4RISH 3MGAA 3W9EA 2Q86A 3CZFB 2F53A 1WGOA 1WBZA 4UV4L 4RMWA 3KYMA 1FAIL 4HT1L 4NBZB 2ZOLB 3WNLA 1MFBL 3BKYL 2MNUA 3RWCA 3PWNB 1NGWA 4R0LA 5ITFA 4X4MA 3K80A 4OIIH 4RGOL 1RFDH 1MHCB 3VXNA 1N5YL 3P3YA 2CXKA 4MNQD 1CD1B 2Y25A 1UM4H 3P9MB 4JFFE 1CGWA 4ALAL 1AXTH 3WHE0 5GS0L 4DKAA 2YXFA 3SGDI 3UTZA 5IV2A 2WUCH 5GS1C 3F7YB 3KWWB 3MBED 3IT8D 5HGDA 1OVZA 3IDGA 3VG0L 5GGTL 1K8DA 2SEBA 3B6SA 3K0WA 2YPVL 3JV5A 3ARYA 4KVCH 2N4IA 1MRDH 2DQTL 4TUOB 1LGVA 3GSQB 4NT6B 2P24B 2LVEA 4M8VA 3FOMA 5HYEA 4YO0A 4L8BB 4QGYA 2A1WL 1ED3A 1FQ9C 3KPSD 4Q9QL 4D2NA 1GGTA 1IBGL 1P7KB 1OGAA 5E24E 3HS0B 1YEHH 4HIEA 4JY5L 2XTLA 1J8HB 4OGAD 5FOBA 1AC6A 5FYKE 3U0PA 1FLTX 4X6DF 2HVJA 5ICYA 2YEZB 4JFZL 3T0WA 2EH7L 2KZ1B 1JZ8A 3MBEA 2LTQC 3D2UD 2BSTA 4F7PA 5FGBA 1N4XH 4R4FL 4F7TA 5TDNA 1XF5B 1DVFB 1NCWL 1LO0H 1ZS8A 2R2CA 4PGBB 2VQTA 5C0GB 1IM3B 2BNRE 3KPSA 5M7QA 1J5OL 1R3JB 4P2QB 4KUZH 5F6IC 4R9HA 2CRMA 1PBYA 3U0TA 4YH6A 1EH9A 3O11B 4OF5A 4NWTH 2ZUUA 1TQBB 3SPVB 1LO5B 3MRMB 2EIBA 4KQ3H 3B9KD 4HK3N 1KG0A 3MRDB 4RWYH 4M9PA 3JUYA 5JZ7C 3D2UA 2YRLA 3L9RB 3VFMB 1TJHL 5HHQB 1KEGL 1U8MB 4S1DD 1FFNA 4FTVD 4XHJD 1NUDA 1HINH 1XH3B 3GSNL 4N0UA 5D7IA 1MAMH 2GJ6E 1KEML 1T0MB 1MHHB 4BYHA 3S34L 1MFCH 1FBIL 1QFWL 1T22A 5JNYA 4U6XA 5FKAA 5FGCB 3RL1A 2Z31B 2NLJB 4PJBE 2QQLL 3KPMA 4RRPG 2GFBB 3FQRA 3DROA 4NM4L 4UIKH 1FSKB 4H1LH 4PRBA 2WV3A 4GXUN 4OSUL 2NY6C 1EVTC 1U8QB 1A14H 4NQXB 4AY0A 5L88H 5DTFA 2C4XA 1I1AD 1LK2A 2H41A 1NKOA 4FTVA 3WSQL 3HR5B 5IOPB 4C83B 5F7KC 1HH6A 3QDJE 3C6LC 3ZT7A 3DOSA 3VFNB 3GZKA 2X44D 5H37G 2BVEA 4WU5A 5D2NB 1SBSL 1WITA 1T21A 3DV6A 4F8TA 1A7PL 4JR9H 1TETL 1MCOL 3BHBB 3DX7B 1KBGL 3P4MB 1JYVA 5CZKA 3BUYA 3L3KA 3OPZH 1J1OL 1FORH 4HS8L 1YQVH 12E8L 5E0QA 3GM0A 3TJEL 4NKIH 3VCLB 3G5YB 4FMKA 4JZJB 4RBPK 4LPXA 5IVXF 1W8OA 2VIRB 1Q9LA 4MJIE 4YGVB 1A64A 1UCTA 2VN7A 4X99A 5CCKH 1G7IB 2J12B 2W9EH 4OZHF 3V6OC 2I24N 2ICWA 3MCG1 4HJGB 4FQJL 5IEKA 4FABH 1W0VA 2JK5A 4YHLH 4UTBH 3WS3B 2Z91B 5C09B 2Z35B 2PYFB 3DXAB 5F71A 3E3QC 3OHXB 4XNUL 3CZJA 1KIPA 4I0PA 4MXWL 4OLYL 4ZUTB 1D5BA 5C07D 4YC2B 3D0LB 2R0ZL 1WBXB 1ZANL 5J06A 1SM3L 1YEFL 1FG9C 5B8CA 2ADFH 4NUJB 5I1LB 4W68A 2BRQA 3DGCR 4WCYH 2A77L 4CADB 3NCJH 4RISL 2X10A 1GC1L 2APTA 2X4TA 3NFNA 3EO0A 3KPOB 4L9DA 5T3XH 3VXUE 2NY4C 1G7PB 2WSKA 4HS3B 3Q6FA 2DMCA 3VGFA 1KPRB 1JNHB 4XMLH 3VXRE 3KLHC 3D48R 4OIIL 2P8PB 1RFDL 3CU1A 2DD8L 4MS8D 5C07A 5T5NF 5DQDH 4WEBL 1MQKH 5EUOA 3Q1SH 4LSRH 1CS6A 3L6FA 1DCLA 4HJJL 3TN0B 3V0VB 1XR9B 1AXTL 4LKXB 1KTDA 2WUCL 2AV1B 5ACZB 3WFHB 1FO0B 4NRZB 4KVCL 1I1FA 3EFDH 3S96A 4BQCA 2ADIA 4N0YL 4PGEB 3VE0A 2ZCLH 3AXLA 4MB3A 3MGOA 3AS0A 3BWAA 5D1QB 4PY8J 2DJSA 3VRIA 3QULA 4CN6A 5KTEH 4LLYB 4HK3J 3NIDE 2QEJA 3E0GA 4LNRA 1CT8B 1YEHL 5DVNA 5GS1A 2ED7A 3CFKB 4G9DA 3GBMH 2FX7H 1WT5C 4KI5E 5DXWA 3DYPA 3REWB 2VLLA 4NQSB 4XVUC 1I8MA 4TUJA 4XCNA 2VDMH 1HXMA 1N4XL 5FGCE 2VSCA 5IF0B 3D85B 2IFGA 2X70A 2ZCHH 3O4OB 3OGCA 3ZYJA 2FJGA 2R2BB 3NCYS 4HGWA 2F8XC 4NWUH 3C5JB 3VXTB 3T65A 3L3IA 1EO7A 1FYTD 5HVFB 4JRYE 1OARH 3UX9B 1ZV5A 2P49B 1KPUA 1MCWW 5GJSH 1UKQA 3SDCD 2M1KA 4NWTL 3H6JA 3MLRH 1JRHH 3GFUA 4NO0B 3TYFA 3QIUC 1JFQL 1P6AB 2YXMA 5JR1H 4KQ3L 1CD8A 3TBVB 4RWYL 3B4NA 1CGSL 1BM3H 4LKCA 4N9GB 4N8VB 3MRFA 1K4CA 4YXKH 5DD6A 4R96A 1UA6H 3CH1B 4WU7A 5D7LD 1F4HA 2NY1D 5INCA 5HVHB 4JCMA 4ZXBB 1XF4A 1QSEB 2WW8A 4V2BA 1MAML 4XCFH 3MMEA 3OAUH 3DTXB 1FYTA 5DD0H 1T2QH 4QTHB 1MFCL 4LSTH 4JM4H 4MWFB 3T4YA 3I3DA 3PHQB 2YPLD 4OLXH 3VXOA 1DQLH 1LO3H 2PW1A 1FGNH 3DGGA 5FO9B 1UCBH 5DJ6B 5C7XH 1QHOA 4UIKL 1D5XB 4MDJA 4NO5B 1A7QL 2FEEI 5EB9A 4PG2C 4FQQB 3UBXB 1A14L 3K8LA 4I18C 3FRUA 5DC4B 3CVHA 3MACH 1NEZG 3CMOL 4JQXC 1IC7H 2F19H 4KGLA 4D0BA 1CWVA 5CBAA 1A2YA 3DX8B 3LKQA 4JR9L 2BC4A 4NN5B 2YPLA 3R1GH 3P77A 1JJUA 5FA4B 5J7CC 2XFXB 5CD3B 3BP5A 1Q9KA 4X8JB 1YQVL 1DQMH 3UXFA 5DMKA 2Q8AH 4I9WE 1NJ9B 4ZO9A 5LCVH 1FPTH 1L6ZA 4XP9L 1MSPA 3C6LA 4GRLB 1UM5H 2ARJQ 3ETBF 5DHVA 2OJEA 4U6YB 5DYOB 1S9XB 1EK3A 2DBLH 4HUWA 2J8OA 1YN6B 1NLBL 3KYAA 4FABL 4OLVH 1HHHA 1AD9B 1VSCA 4LVOC 1CQYA 3RBSA 2R4SL 1OAKH 3MV8A 3PG2A 4MD0B 1MRFH 4HULB 3JXAA 1AD0B 4BZYA 4LL9A 3HNTL 5C08B 1HHKB 5GSRA 1JF1B 1ES0A 1PKQE 3FN9A 2ADFL 5IFHH 1X5JA 3U46A 1QRND 4TSBH 4UOW0 2VUYA 4WCYL 5J3HD 2NY4D 4OF7A 1LD9B 3V6OA 2APVA 1DLHB 3MJ9A 1I9RL 1CXLA 4BFIB 2OZ4H 5DZOA 3WV0A 4HFWA 1NCBL 1HIMH 1CCZA 3CFIC 1NCNA 4LLMB 3FT4B 1C12B 5D9SB 2CH8A 2VLJE 5EUOF 3P0YH 4XMLL 2VLRA 1NH6A 4ZNEE 4LSVH 4L8DA 5TDPB 2RAMA 5M94B 1RZKL 4JN1H 4PLKC 1U8KA 1DUZB 4K9EH 5DQDL 2X4NB 3LD8C 5I18L 1MQKL 4GW5B 4M62H 2I9TA 4LSRL 1Y6MR 2YR3A 1QRNA 1OAUH 2JB6B 1NANI 3BN9D 3V5DA 4O51B 3BP7A 4WUUD 5C0NC 3S5LB 3R4DA 3UPRA 4QTIH 2XZAH 1VESA 4G7YH 4LP5A 1ADQH 2VABA 1XIWB 3RTQC 4LSPH 3KNBB 2C1PA 4RIRA 4JDZB 4ODUA 3RL2A 1VGKB 2FATL 3WKMH 5AG8A 4W70A 4NKQB 1ZLUH 1BFOB 3U83A 1Q9OB 3KLAB 4E41E 2ZUVA 2AJZA 5C0DA 3WIHA 5KTEL 1W0YT 1MCRA 4YQXH 4KU1A 3O3BA 1LP9B 3HRZA 1U8NB 1FG2A 4FFWC 4YFLI 1KTLA 1A5FH 5HDLA 4UDTB 1SVCP 3TT3L 4XVUD 5MERA 3MRKA 2HJFB 3CIQA 1H0DB 4PP1C 1ORSB 2FX7L 5H35A 3R0MA 1O5DT 5C0AE 1CFNA 2VDML 3MLTB 1I8IB 2A9NH 3S88L 1MHEB 1EFQA 4CVXA 2VLJA 1Q94B 1LEIA 4FHBD 4R8WL 2Y5TB 4MD4A 4E0RA 4NWUL 4OZIE 4ODHH 3DX9B 5CD5C 3IFLH 1ZHNA 1SJHA 5FGSA 1OARL 2GSIB 3H9HA 1PLGH 3CFBA 5GJSL 3GSRB 4YHZH 1WT5A 1ZVSA 3MLRL 2LE9A 1T0NB 3TPUA 2IEPA 4IHOB 5JR1L 3O3EA 4K71B 3L7FB 1T1WA 2PKDA 1OQXA 5IEHB 1DBMH 4Y4FB 2NY7H 3EOAB 5EDXA 1G7HA 1UA6L 5HI3D 2DLTA 3QUYC 5CJOH 2IAMB 5ETUB 4PYHA 1JZ7A 1IQDB 1YNKH 1KB5B 5HYJB 5HHXH 4YDKL 5DD0L 1T2QL 4HUXB 1EAPA 2PNDA 4LSTL 4JM4L 4Y4KC 3OXRA 2L7UA 1X5GA 1UZ8A 1A6AA 3QIUA 3LMJL 2EC8A 4IS6B 4OLXL 1Z0MA 5SWZB 5D2LB 1LO3L 3VGAB 1FGNL 3W82A 5KBNC 4CVZB 1UCBL 5JHLH 1IAIH 5C7XL 2KUTA 4P46D 1RY7B 3O6FC 4QNPE 1NBZA 1RZGB 3C9NA 1KJ3L 2NXZC 3VI4E 2CR3A 3C09C 3D39B 1B0GA 3MACL 1K8IA 4PY7B 4YIQB 1IC7L 4N0RA 4Y5XC 4OZIA 1T5WA 3V7MA 2VAAA 1FNHA 4PJDB 3V8CA 3ZSTA 2FWOA 2GUOB 2YSSB 4WGWB 3BPOB 1FV1A 3IDYB 2W0FA 3R1GL 2EECA 3NA4A 4F57H 4PG2A 2EDTA 1G7LB 4B7IA 3DVGB 2DQCL 4I18A 3PGCA 4PJ5B 1REIA 3JUZA 5FGRA 1KJ2A 3ARQA 1FVDA 4JQXA 5GGUB 5KVGH 1AR1C 1OTTC 1Q1JH 1R3LB 4P59H 4MVBC 4KROC 4S10A 3O9WB 4JQVC 2DBLL 3GMMA 1HDMB 4M5ZH 4BK4A 1CL7I 1A9EB 3F5WB 4TQEH 4OLVL 4XBEH 3QUMA 4PTTB 2NW3B 1OAKL 4AT6A 4CN1A 5FA3A 5ICZA 1MRFL 2ED8A 1N3NA 3MRNA 1NUFA 2H2PC 4YXHL 3VD5A 2Y72A 2CLZA 4JY6A 5FUOH 1UB5B 4K7PL 4PJCB 1OSZA 3MNZB 4TSBL 4X6FA 1A7NL 4HBQA 3ARGB 3FONB 2QSTA 2X42A 1YN7B 2A0LC 3DIFB 4JZNB 3MV9D 3MZTA 3IB4A 4R3SA 5KAQG 3CCHB 2OZ4L 4YGAB 4U1JB 4MA7L 4AM0A 3H7LA 5BZWB 5C8JB 1WZKA 3BDBA 1ZKAA 1A7RH 1P69B 2QHRL 5CEXA 5DJDB 3NH7H 4OQ1A 1EJOL 2E9WA 4LSVL 2CDEA 4JN1L 2DOCA 2QQKH 3FN0L 4XCEB 4K9EL 4OLUL 3HC0A 5F9OL 4R90L 4M62L 5CP7B 5C0ND 1ZSDA 1NC4B 5DJ8A 3NFPB 2JCCE 1NDMB 4GQPH 2IADA 3TBSA 4MJ6A 3LOWA 4RGNC 2LVCA 3MV9A 4J4PC 3RTQD 4QTIL 1UWXK 4JFDB 2VMFA 4WFGD 4G7YL 4RMUA 3K8MA 1ZLVH 4O5LH 1ADQL 1OSPL 4RRPA 3P40A 4LSPL 4M7KH 3FB6B 1YMHB 3WKML 3GSUA 1YNTA 3WE6A 2A6KA 1UH3A 5HGHA 3DVIA 3DRTB 4YQXL 2KPNA 2FZ3B 3ROLB 5A2JH 2HLAA 2WINA 5EBWB 1A5FL 1I3GH 5C92A 4L4VD 3T4AB 4V1DE 4M1DH 1XGUA 3ORJA 1T1YA 5MENB 4OZGE 2A6IA 3RTQA 3M1BB 1MFEL 2V7NA 5C9JB 4QHMA 2A9NL 1Q72H 1T03H 1TZGH 4X6EA 2HFTA 3KPNB 1LVEA 2CLVA 4ZYKB 5CD5D 3CFEB 3UYOD 4XNQB 5I19H 1KF9B 4Z7OF 4ODHL 5C2BL 1FJ1B 3WN5B 3IFLL 3MXWH 4OFDA 1YEGH 3MUY1 4P2RD 2ICES 1UWEH 1PLGL 2Y4SA 3LPWA 4GJTB 3D39E 2DS4A 3BPLC 4L4VA 2FNBA 5GIRA 3S3SA 1WQVT 3O41A 3WNOA 1KCUL 2E9BA 1OP5K 1KIQB 1HYSC 3LKRB 5L6YH 4JVPA 3BOVA 5IBUG 5HD8D 4BK5A 2H26B 2YHGA 2DQEH 3HPLA 4I2XB 4HZLA 1DBML 3PWVB 2NY7L 5C0JB 1LILA 4G8EB 3TBWA 5DZNA 3MYJA 3P0VH 3NIFF 3WMSA 1DBJH 2GT9A 2LABA 4KI1A 5EOQH 1A9BB 3ZSSA 4ODWA 5E8PA 1YNKL 3CDCA 4QYOA 5J6GB 3G9VA 1JYNA 3ZHDA 3BP4A 1EEZB 5HHXL 5GRJH 4G43B 4P2RA 4QHNB 4G8GD 3MBXH 3IJYB 3FHQA 3O6FD 2MQ0A 1CDBA 3G6DH 5JHLL 4XAKE 1IAIL 2NXZD 1KELL 1TCRB 3VWKC 3QUYA 3VFSB 1FN4A 4OZIF 3GB7A 3KPRD 3RVUD 1EEYA 4JPVL 1WIPA 2F54A 4OV6F 5IHLB 4S0SD 4W6XB 1A22B 1PFCA 1I3UA 4Y4KA 2LAAA 4WHDA 4J6RH 4FFVC 4ACPA 1NCUA 4G8GA 2P8LA 5E4EC 1K2DA 3U9UA 2FJFB 5I6XB 3ULUC 1I7RA 4U7KA 3O6FA 1JGDB 5EIIA 4F57L 2YRPA 3S8WA 2FEDC 1AR1D 5KOMC 1AQKH 4JFED 5J4MA 3WKNA 2VXUH 4LEOA 3DHJA 4JVUA 4M6OH 4XPHH 3RWJB 2XWTB 5KVGL 4Y5XA 1Q1JL 4P59L 3EUUA 2D7QA 2NY3D 4TOYH 4LDEB 4PJHE 2BNQB 4H0IA 3S36X 2MKLC 4H5SB 4UT7L 4YDIH 4LCUA 4M5ZL 1U91A 1E4WH 4A6YB 3F6LA 5FF6A 1ZK9A 2WLZA 2H2PD 1FZMB 2FYYA 4JKKA 3T0BA 2EE6A 4L3ED 5ERWA 1II4E 3X12B 2FLRT 3MRLB 5FUOL 2A0LD 4U1NB 3TCLB 4P57A 3EBAA 4JFEA 2W60B 4HLJA 4NKDA 3FQUA 15C8L 4JQVA 3D3VD 1S5IH 4ETQB 3C5SB 3EKCA 2HVKB 2RFXB 1TLKA 4E5XA 2D0FA 3ZDZF 3H3PL 2OS7A 4WFFD 2PW2A 2C3HA 1S3KH 4OQTA 4P3CH 1A7RL 4OKVB 3IDIB 1CIDA 1AE6H 3IFNH 5DJZA 5F9JB 3NH7L 3BVNB 1T7ZA 1I4FB 3OKEB 2VXSH 4L3EA 1MEXH 4M48H 2QQKL 3TIEA 2OK0L 2D4FA 4HQQH 1R3HB 2GY7B 2E5EA 4RGND 5J11C 5J9PA 3FO1B 2P5ED 4J4PD 3U4EB 5DGRA 3MRHB 3MLPA 2C3VB 1XEDA 2CJUH 5ADPH 4BSWB 1WZLA 4HDIA 2V2TA 4NBXB 5IMOB 1I7ZB 3ZKMD 4NQCD 4O5LL 1QSFD 4M7KL 5FM4A 4OKDA 3VDBA 4Z7NE 5M95B 4U1LA 3UAJC 4QRRB 1QSZA 1OCWH 4MCZB 3S6CA 4Q0XH 2FIKB 4E42A 3ZDYF 2BDNL 3QHFH 4YDJB 4WJ5B 1HOCA 1WVZA 2CIKB 3BYTA 4LQ1A 2R0LH 4GKZB 2X4SB 4LCCB 4G6AC 3S35X 2P5EA 4J4PA 4M6NH 2JIXD 1BQHB 5J12C 4FN0A 4XWOC 4WNQB 4M8QA 2H2SC 4LASH 3U4BH 3MLYL 2ESVE 1XCTB 3JV4A 4NQCA 1Q72L 1QNZH 4Y1AA 5K9JH 2XNAB 3L3JA 1E27A 3LRHA 4ZPTB 4HUKB 3LZFH 1P2CA 5F7UA 4WHYG 3O81A 5I19L 2GTZA 5KSAB 1VPOH 5IMLB 5DRXA 4JB9H 1UWEL 2B8OT 4FXGB 1G6RB 3T77B 3TEUA 5FM5O 1VB9A 4TSAL 1F13A 1QBLH 4Y19D 5EO0B 3TNNB 4P5TC 4F7EA 1MREH 1N7ML 4JM2C 3D0VB 4P9ML 3BZFB 4JDTH 2ATPA 2OR8A 1P4BL 2DQEL 2ZSVA 3DSFH 3AU1A 4Y4HC 2PXYC 3H3KA 4AQ1B 4RGMB 3P0VL 3KXFE 4OD2A 3DMMC 1DBJL 1F4XH 4UQ3A 5EOQL 1RJZB 4ZAKB 2WLYA 2XWBB 3ZTJH 2WBJD 3CPLA 3FO2B 3TVMB 1NBYA 1ZGLP 5GRJL 2R56H 4ODXA 2Q8BH 5IHZB 4PS4L 4WTXA 5ADOH 2ZG2A 2AXHA 7FABH 5HDBE 1FZKB 1TVHA 3QUXB 3BZEA 3OSKA 1UJ3B 3UTTE 3MRBA 4CVUA 3RA7H 5T33H 3SDDB 4UNTA 5J1AA 4NHUB 3VFGH 2X89A 5DUBA 5C3TA 2B4CH 1NAMA 4N8VG 5EH1A 4BH8B 1F5WA 3BXNB 1FAKT 3SDXE 4OCYH 4BZ1H 2XN9E 1FNSH 1R5VA 5I30H 4NQEE 1OB1B 5IQ9A 1ZLWK 3LY6A 3GMNA 3F6IA 4J6RL 3ARDB 3HNVH 1ZA6B 2VERN 3OKNA 4ERSH 4I3RH 4F58L 1MIML 2ARJA 1JV5B 2FEDD 5IB3A 3PP4H 1KULA 5A40E 2DQIH 3BAEH 3VWKA 4ZTOH 1PX4A 2F74A 3CDGA 1LEKB 1AQKL 2BMKB 4HX1A 4IRJC 1CYGA 2VXUL 4XPHL 43C9B 3MCLH 5C0FB 1T7YA 2IMNA 3NCCB 5CHNB 2AJYH 3LKNB 3PWLB 4LBEB 4YDIL 1JGLH 3L3OA 3Q5YA 3QUZB 5LG1A 3CC5A 1JWSB 3BGMA 4NHCH 4UI2A 1G7JA 1JGEA 2IG2H 4J3VA 3PL6B 3G6AB 4BUGA 2ZSWB 1HHIB 2NZ9D 3K8KA 3QDMB 1URLA 5HYQA 4M93B 2I60H 3UTTA 4EOWH 3QCTL 1TITA 1BVKB 1DVFC 5FYJE 4JKWA 4L5FL 3CDYA 1PSKH 3IDNB 3AROA 1S5IL 2KQMA 1D6EB 2YBRA 2AP2A 1SYVA 2I26N 3QXDA 4YNYA 1YNLH 1GOHA 5EO1A 1S3KL 3DYOA 5CSGA 4P3CL 5JMOC 1YDPB 3ZDXE 4HIJB 3P4NA 3DWTA 1TQBC 5DSCA 2YPKB 2AGJL 2IPKA 2VXSL 1O7SA 4KQ4H 5IMMA 3BPCA 1MEXL 5DEGB 3MRCB 3W81A 3S97C 4PJHF 1F3JA 2C7UA 2ZUYA 5EN2A 2IBBA 4UUJA 3CDFA 4YHOH 3EHBC 4H26A 4TNVF 1EUUA 4YHPB 2CJUL 4GXVH 2FH8A 4JN2A 2Q7NA 3RGVB 4KTDH 4XPBH 3GSWA 2WUBH 3DBXA 3OB8A 4R7NA 3UAJD 5AZ2H 3GRWA 3IFPB 5LGJB 3ULSB 3VFRB 4R4NC 3FFDA 2D7NA 3VG9C 2Z31C 4XVTL 5JDSB 5ALBH 2DI7A 1HSBA 2PR4L 4K3GA 1JTOA 4Q0XL 1QP1A 4DEPC 5BS0E 1C08A 2P7TB 4KDVA 1OPGH 1ZMYA 1FSKC 5GISL 3Q0HA 1AC0A 4KKNA 1MVUA 2R0LL 4U3XA 3FRPG 4XWOD 5L2JB 4LAJH 3T04D 1C1EH 3ARSA 1UB6A 3AM8C 5EOTA 2DL2A 3S4SA 4GG6A 3ZL4H 5DK0A 4ZOEA 3S5LG 4JY4A 5A43C 4O58H 3GSOA 2W0KA 4U1GC 4ZOAA 3MRGB 3U4BL 2BY2A 1CXKA 2R15A 5L2KD 2DLIA 5D2NC 1QNZL 1A7OH 1S9VA 5K9JL 1W72A 1J05A 3BH9B 4EBQH 1ZHLA 1X4ZA 2Q87A 3LZFL 2XKNA 4Z7UE 4LLWA 4XC1H 5HPMB 5EC1A 2D31B 4C56B 2VQ1B 1BMGA 1VPOL 4DFHA 2WIMA 2X5PA 4JB9L 2BERA 4MDIB 1TJGH 4JZJC 1FFPB 4JM2D 4WI5A 4GKSA 4IOSD 1DSFL 3MC0A 4P49A 1QBLL 3ULVE 3I6GB 1MREL 5C71A 4NSKB 2PXYD 3SDAB 4CMHB 4JDTL 4K3DH 3DMMD 3GHEH 3DSFL 2D03H 4PY8I 3CVHH 2P43B 3UDWC 1GJIA 1F4XL 1P5VA 3KYKH 3QDJD 4NKOA 2GJZA 4UU9A 1TTUA 2X1QA 5KANG 4YC2C 3LV3B 3STBA 3VFWB 3IGAB 2R56L 1NGZA 1FNAA 5B21A 1I85C 4G6FB 4P5TA 2Q8BL 1PJ9A 5TE7H 4N5EC 1M71A 5C0IA 5ADOL 1A21A 1YPZB 5EU4B 4JM2A 3ARZA 1ERNA 5CLWA 1FGVL 4ODVH 1PAMA 1OWRM 3DVFA 1QFOA 4Y4HA 1DDHB 2PXYA 3RA7L 2Z4QA 3KR3L 5A2LH 1RZFH 3SE3C 5T33L 1I7TB 4GUPA 3DMMA 4IOIA 3VFGL 3JWDC 4HIXH 4MJID 2B4CL 1S9YB 4Y89A 4GKNA 2XYCA 4X4YA 1A6ZA 1KJVA 5ACMA 4HWBA 5DHVH 4I48B 4GRWB 4OCYL 4BZ1L 5ITBH 1NGYB 4G9FA 4U1KA 5ID0B 2GTWA 2R23B 3EO9H 4OGYH 1T3FA 2A9ML 2OR9H 2YD1A 1BJ8A 2UY7A 4ERSL 4MZ3A 1MWAB 1S7TA 1N2RB 5IB2B 1MLBB 4J12A 4KMLB 4EN3B 2Z8SA 4JHZA 3CZFA 3TN0C 1OAZH 4W81A 3IDXH 1A6TA 2DQIL 3MROB 3BAEL 4NJ9H 2ZOLA 4ONGL 4LLVA 4ZTOL 3FFCB 4D3CH 1UM6H 2W59A 1RJYB 3PWNA 3PGDB 1QEWB 4HZAA 5BQ7B 1B2WH 1MHCA 3RZWA 3ULUF 5EU5B 3MCLL 1HEZB 5I1JH 4F3FA 5D1QC 1CD1A 2AJYL 1WICA 3GKWL 4I1NB 3V4UL 1AY1H 5HDBF 5T1MB 4NNYB 1J8HD 1JGLL 4XVJH 2E8ZA 3HG1E 3GJFH 5E2UL 3FT3B 1RUPL 5TF1H 1MPAH 3M45A 2VZSA 2VDLH 4NHCL 3F7YA 3KWWA 4IJ3C 3WNPA 2IG2L 4M7LH 1NCDL 4IRJA 1UGNA 1DVFD 2I60L 4DGIH 4M7JH 2P24A 3SGKC 4L8BA 3WNNA 2ZPKL 1V05A 2ZWLT 3O4OC 3MV7E 1NLDH 1PQZB 4BH7B 1PSKL 4TTGA 4P2QD 3ARWA 4O4YH 2PCPB 1P7KA 2R29H 4BUHA 1HHJB 1EXUB 1DANT 2XQBH 1YNLL 3C8KA 1J8HA 3RWEB 4GOSA 3BRGC 3E6FB 2YUWA 2EDXA 2Z93A 3RI5K 2LFGA 5GS0C 3HNSH 3QXWA 1WTLA 1FCCA 2YEZA 4PRIB 5D1XB 2YN3A 2Q76A 1RIVL 3MODH 2C26A 4UOJA 3JWOC 1NGXB 4PJIB 5AUMB 5SWQB 3WIHH 2I5YH 3W0WB 2P5WA 4KQ4L 1DVFA 1I1RA 2A6DB 4WW2B 2QLVB 4PGBA 1ULVA 3J7HA 3QNXB 4YHOL 1CXFA 2ZG1A 1FVEB 3CLFH 1T83C 5C0GA 4LPTA 4HHAB 3W9DB 4KI5D 5HVHC 4ZXBC 4CUCA 4GXVL 3O2DH 1EVUA 1R3JA 4P2QA 1J18A 3TA3B 1VACA 5E5MB 4MX7B 4XPBL 2Z31D 3T0EE 2WUBL 2IPTH 3O11A 4Q74A 1GHFH 5AZ2L 2WP3T 3SPVA 1LO5A 2FBJH 3MRMA 1V3LA 4AIOA 2HRLA 3WFZA 4OZ4B 3MRDA 1NDGB 4RA3A 4R7DB 5I76B 5GS2D 3L9RA 3TESA 1OPGL 2BY3A 4GG6F 4OD1L 4BQ9A 2VLKE 1U8MA 3A6BH 5FYLE 1XH3A 2KZWA 3L95B 4HMEA 4DQOL 1B6DA 4QRSB 5FYKU 1C1EL 1T0MA 1MHHA 5CSZB 1MH5A 1OD7A 3HFMH 5EU6E 4LPWA 4O58L 3WIFB 3OTTA 3D6GA 4GLRI 2DQFB 2Z31A 4HLZH 2NLJA 1YPZE 3GJEB 2G60L 1JPGB 5KN5B 2GFBA 3GMOB 1A7OL 2E8YA 1I9IH 4NN5C 4MNQB 4HMCA 4ELKB 4XC1L 3LDBB 2MHAA 3SO3B 3VW3H 1U8QA 4NQXA 1EPFA 4K2UH 3GO1H 5C3LD 3AM8A 3SE8H 3HA0A 5HPOA 2BHZA 5IOPA 1AXSB 4GRLC 2VR4A 3VFNA 4MCYB 4JO1H 5C09D 5D2NA 5JUEH 3DXAD 4K3DL 4Z0XA 2FB4H 2NNAB 4NGHH 3GHEL 3BHBA 3QQ4A 4OCMC 3DX7A 1LNUB 3P4MA 4PGDA 3FZUC 3VRJA 3AFLA 4WV1B 3CVHL 1CLYH 1UKTA 2R2HB 4JM2F 4MNHB 1ZEAH 2A6JA 2GW5A 3FFCE 5DC0A 3SCMB 1V7MH 3G5YA 4N5ED 2Y6SD 4JZJA 5L8JB 5KW9L 3LPGA 3WJLC 4YGVA 4U49A 4J3TA 5TE7L 2XIDA 3RRQA 2FECL 4LSQH 4GXUM 3QSKB 2DM7A 4ODVL 5J8OA 2EDBA 3OMZA 3J8F7 1GGBH 1A7BA 3RIFK 35C8H 3WS3A 4Z7UF 2Z91A 5C09A 2Z35A 2PYFA 2BRRL 3DXAA 3RQ3A 4I9WD 1RZFL 1WIUA 1KJ2H 4HJ0C 5HHNB 2C3WA 3KGRA 4HUNB 3UDWA 3U4AA 1N6VA 3EYVB 1DQQB 1M6OB 2PYEB 3OB0K 4NRYB 4EDWL 3QIWB 4ZUTA 5HTSA 1KN4H 2PO6C 1A8JH 1IAKB 5ITBL 1I85A 1M05B 4NUJA 4YX2H 1DP0A 3D25A 3EO9L 4OGYL 2OR9L 3TN0D 4D9QE 4C59B 4CADA 3QUMH 1CI5A 4I13B 5D6CB 5ISZB 3GI8H 3KPOA 4CGTA 1F4YH 3B9KB 5HVWA 1CZ8H 5F7FA 3IDXL 1G7PA 1OW0C 3SE3A 1MNUH 4HS3A 4PR5A 4FFZL 1R5IA 3Q6GH 4ZMAT 2C9AA 5MEQB 4D3CL 1JNHA 5C0BA 1X5HA 1XIWC 1KN2H 5D1QD 1XGYH 1U8JA 4MSWB 5DURB 3H9SB 2P8PA 1B2WL 3OGOE 2OQJB 2AEPH 5I1JL 2G5BB 3HZMB 4JKMA 5I1KH 2O5ZL 4JFOA 3KJ6H 4LVNB 1GZPB 1BP3B 4NQVB 1QFHA 4HFUL 1B3JA 3TN0A 1G9EA 3V0VA 1XR9A 2BFVH 1MPAL 1GC1C 2F8VA 2X40A 1P5UA 3D85D 4M7LL 1FO0A 2X2YA 5D96B 1DLFL 4PGEA 1HNGA 2HKFH 4EI6B 4HUVB 1EUTA 3QT2A 5D1QA 1RZ7H 4Z6AT 1JHKH 4K3JH 4H25B 3HI1B 4QOKE 2HG5B 1NLDL 4LLYA 4Y0GA 5C0CE 4O4YL 3ZHLA 2R29L 3O4LE 3LCYA 3BDXA 4RMRA 5GS0D 5EBGA 2CUIA 2XQBL 3P2TA 4PJAB 4WO4B 5SWSE 3K4AA 5D7SL 3DURB 4GS7B 3CFKA 1YEKL 3BD3A 4OTXH 5B38B 2DKSA 3MODL 3REWA 2BVOB 4NQSA 1CR9L 3BIKB 3SGKA 4K71C 5IF0A 1CE6B 4PJ9B 3U1SH 5I74C 4QCIB 1DFBH 3GIZH 4ZXBD 1QSED 2YRZA 4Y4FC 2R2BA 2DM4A 5GRUL 3C5JA 3VXTA 2IAMC 5H37H 1WWAX 3O2DL 3L5XH 1AO7E 1JI1A 4PREA 3ILQC 1J9CT 1U3HB 1WAAE 2B5IB 4M9OA 4D0CB 5FK9B 3RVTC 3UTPE 1GHFL 4NO0A 5D8JL 2ICWJ 2FBJL 3C60B 1XGTB 3PJSB 5GGTA 4I5BB 3ZT6A 4TNWK 2VDOH 4N9GA 1QFWM 3FTGB 4N8VA 2WM0A 3EYFB 1T83A 1IQWH 1NMCC 4ZTPL 1X5ZA 4ZXBA 3RVWD 1QSEA 4XP5H 2WWKT 1BZ7B 2AJ3B 4GMSH 1SJXA 3DTXA 1OLZA 4KTEH 4QTHA 3HFML 5JA9A 3O4LA 4MWFA 5HGBB 3NMEA 2BVYA 2NCMA 5GGRB 4QRPB 5EZJB 5FO9A 4IOFC 5HYIA 3P73A 3BPOC 5DJ6A 1I9IL 3HZKA 5IHUH 3IDYC 1NMBL 4NO5A 3JTTB 1OAQH 3BPNB 4Z7VE 3VW3L 3UBXA 1RULH 2EKSA 4EUPB 4K2UL 2PYEE 4GRLD 1LEGB 1Y18B 3GO1L 3DV4B 3LKPB 3SE8L 3GI9L 1S5HA 2V6HA 2W0PA 1C5CH 5JXAL 2EDLA 5TE4H 1R0AH 1BQHG 2YS4A 4OF0A 1AO7A 5JUEL 4LCWB 3DX8A 2AQ1A 5DD5L 1WAAA 3L7EA 4NGHL 4LIQH 4CL7A 1CE1H 3T2NH 4J2XA 4NNPH 5FA4A 1CLYL 4ZFOB 1LHZA 2QSQA 1QQDB 5CD3A 3QDGB 5E5RB 1V7ML 4DN3L 1NJ9A 1T1XB 4D9LH 3ECBB 3N06B 3H9SE 2GY5A 4GRLA 2IBZX 5KVFL 5CZXC 5E8EA 4APQC 4U6YA 5DYOA 4LSQL 1S9XA 4KRPB 2FHCA 1KCSH 4HJ0D 1YN6A 4HF5H 4DGYH 1ZGLM 5D5MB 4KRMB 4JGMA 1KJ2L 4MD0A 4KUCD 1AD0A 1KACB 3VA2C 4HAFA 5C08A 1MLCB 1HHKA 5FECB 1JF1A 5BV7L 4K7PY 3WJLA 4NCDA 4Q7DA 4U2YA 4KDTC 4FA8A 3LN4B 4YX2L 3SDCB 1YQ2A 3NPZB 1LD9A 1DLHA 2XA8H 4BFIA 1GZQB 4MXQD 3CNKA 4X6BB 5MHSD 1F4YL 3BWUC 3QCUH 1CZ8L 2C5DC 3SJVE 2Y9RT 3B9VA 1MJ8H 1XIWD 2AQ2A 4LLMA 1MNUL 3FT4A 4PB9H 3Q6GL 5D9SA 4U7SA 1HCFX 4ODSH 4P4RB 4X4XB 4U6VL 3DPBA 4PRHB 2PO6A 1DZBA 5IJVB 5DUPH 1FE8L 5TDPA 1JK8B 5F7EH 2AEPL 1DUZA 1QOKA 5I1KL 2X4NA 3KJ6L 2DLGA 4HKXB 4GW5A 4NOFA 1CXHA 3QB7C 4IM8A 4L4JA 5KSVB 3V9FA 4OQTH 2P45B 4L4TA 4HWEL 2BFVL 4O51A 2IH1B 5DEFB 2BNUB 3CFDB 5EG6C 1D5MB 1OW0A 1QG3A 4R26H 4KMTL 3HI6H 4KKLD 5GZNC 1XIWA 3VFOA 1IC5L 3KNBA 4G8IA 1VGKA 1WCBB 2R1WB 2HKFL 3SEPA 1K4DB 4UV7H 1RZ7L 3Q2CA 1Q9OA 3B9AA 3BZ4B 1JHKL 3IJHB 4O00A 4IRZH 3P30H 1ZGLA 1RZKC 4DZ8B 1H3TA 1NMAH 2GSGB 1R3KB 4TVPE 2EYRB 4HG4J 1LP9A 2J2ZA 3LHPH 3WN5C 1LWRA 4UDTA 4WDIB 3WL9B 4S11A 1ZOXA 5D70H 4N1HB 1OD9A 4KWUA 2HJFA 4KKBC 4P2YA 1ORSA 4EXPX 1P6FA 3RZCB 5C6TH 1ODAA 1N0XL 3MLTA 3ZKNC 4Y4FD 1SQ2N 1CICB 1I8IA 4YHNB 4RFEA 4Y2DC 5KSBB 2UUDH 5IW3A 1MHEA 2IAMD 3U1SL 3LAFA 1DFBL 2ADJB 4MNGE 2W92A 2Y5TA 3B43A 3ILQD 3RUGB 5IGXH 1GGIH 1FZJB 3DX9A 5HYJD 3RVTD 1X7QA 3MUZ1 1L7TH 4G6MH 1IRAY 4BSVB 4DVBB 3DECA 2HFEB 4JEGB 5GGSB 3WXVH 2P42B 1NFDE 5D1ZC 5SWZD 1F6FB 3PIQB 4OD3H 4IHOA 1F97A 3BFOA 1JRHI 4OLZH 3L7FA 3RHWK 2VDOL 3MA9L 2DQHH 4LCWE 1ZT1B 5I71B 4Y4FA 3EOAA 4NQDB 4ONFH 5DJYB 1VADB 2YD7A 3VGHA 5ETUA 5EZOH 2IAMA 3D39D 2R4RH 4YPJA 1IQDA 4X80L 1NFIB 4XP5L 3UC0L 1BJ1J 4GMSL 1YEDB 2BVQB 4K23H 5E1AB 5LXGH 4C55A 5HYJA 2OJZL 4KTEL 2V2WA 4IBLT 4HUXA 4HS6B 3PQYB 1BZQK 4JANB 1PZUB 4IS6A 5CEZD 5DJXA 1EHLH 5SWZA 4RFNB 5D2LA 3AMKA 4WY7L 4CVZA 3REVB 1VFBB 5I6XC 4YEFA 1VFAB 4LCIL 4PJ5D 2AEIT 2A73B 1OAQL 5BRZB 4M1CC 1JUFB 1RULL 1NC2B 1F4AA 5FDWB 4XPAL 4JRXE 1WAAF 3DUUB 2B0SL 3O9WD 4YIQA 5E2WH 2BVTA 2OXHA 5DRZB 1IGFL 3GMRB 4PJDA 5DHYB 5TE4L 1R0AL 3Q3GB 1YMMB 1JPTL 2I07A 2EE2A 3EYUH 3FO9B 4JG0H 2YSSA 1ZA3B 4GQ9H 1LDPH 1CLCA 3H7BB 5DMGD 4HXAL 1IAMA 1EEQA 4X98B 5DO2C 3T2NL 4NNPL 2A83B 1G7LA 4D9RE 3DVGA 4EVNB 2FX9L 3CGTA 4PJ5A 5H2BA 1FFOB 4PRHE 5IQ7H 5E8DH 3ARGD 5CZXD 4D9LL 1GYAA 1BZ9B 5HDOA 3EJYC 3G6JE 4RAVB 1UACH 5F1IA 3KVQA 1HDMA 1KCSL 3MYZA 1W0WB 5DI8B 4HF5L 4DGYL 2VSDA 4XPFH 1BVZA 3F5WA 4QRTB 4N8PA 3TCXA 5D72L 2CR6A 1XF3B 2ADGB 4RSVA 4U4BA 1UB5A 1OT2A 1JI2A 4PJCA 3OG4B 5CGTA 1NC4D 4LF3B 2UVFA 3MNZA 4JRWA 4NC0B 5T3XE 3FONA 5EOCH 4APQA 4QHLB 1YN7A 3DIFA 4JZNA 4W6WB 4PJEE 1FLRH 3CCHA 1WFNA 3INUH 4JFDD 3SKMB 4KUCF 3WDHA 2VH5H 1I1YB 5BZWA 3U6RB 5C8JA 3KLDA 3I3EA 2N56A 4PB9L 3D18B 2JJWA 1JWUA 3K46A 4ODSL 5DJDA 3MOAH 5DUPL 4I3SH 4UQ2B 4KDTA 4AH2B 3TBYB 5LWYH 4XCEA 1YYLH 3TBTB 5FB8B 5CP7A 5JW3H 5TH2B 1NC4A 2VL4A 1U58A 4OQTL 3NFPA 3T8XB 3GBNH 3RUGE 2QKIB 4LCCC 1XGRA 4NO3A 5MEND 5GZND 3G6JA 2M8XA 2FL5B 4RDQG 4JFDA 4LDOB 5CZVH 4P46B 1NSNH 1MFAH 4JG1H 2LU3A 1LP9F 3NZHH 5CMAB 5JXEC 1ETZB 1D9KB 5JHDB 5BV7B 3MRRA 4O2CA 4YUEH 4UV7L 5DRNB 4Z7WE 1QUNA 5CJBA 1H8OA 3P30L 4LLQB 3K1DA 2FZ3A 3OF6D 4X6CB 5SV4A 3ROLA 4KKBD 3LHPL 2C1OB 5KSAC 3G08B 3MREB 3QEGH 5EBWA 3GRWH 3T4AA 5D70L 4Y5VC 3MCKB 3KPLB 5CGMA 1JCKA 1GGUA 3ZKND 5MENA 3AS1A 1OP3K 4U3HA 3F58H 3QFDB 1VDGA 5C9JA 2Y1VA 2JELL 2BOCB 1NUNB 1CFTB 5HHMB 5DVMA 5F1NA 4ZYKA 4P4KC 1BFSA 3CFEA 2ICCA 2XWJB 5TFSH 1JWMB 1BIHA 5IGXL 4RGMC 4AJ0A 3HMXA 1GGIL 1FJ1A 3WN5A 2H1PH 4HWUA 1M1SA 5BRZE 1L7TL 2ED9A 4P5KB 4Z7QE 4G6ML 3OF6A 2KKQA 3C5ZC 3TVMC 3WXVL 4Z78B 1PVHA 1E4XL 1W72H 2WWMC 4OD3L 3SDYH 4GW4B 1KIQA 1EFXB 5F89B 5C86A 4YDLC 4OLZL 3QUXC 4LQFH 4QO1A 4Y2DA 4PJGB 2H26A 2DQHL 3EGSB 3GMLB 5EA0L 4I2XA 3PWVA 4ONFL 3HUJA 4DWHA 4PGCB 4RMTA 5EZOL 2R4RL 4C54A 3ZTNL 5JW4Q 1A9BA 4LAQL 4IDLA 2IANB 5D2LF 4K23L 5DK2B 2W9LA 5LXGL 1EEZA 4G43A 5D1ZA 1JE6A 4OZFB 4QHNA 4OF3A 1KIRB 1H3PL 3QDAA 3ARDC 1SY6A 1YUHB 4S2SB 4M4RA 5HJ3B 1EHLL 3K4DA 3QEQE 5DT1H 4DAGH 5I8KH 3KXFD 2GJJA 2V5RA 3CH8A 1VA9A 4PJ7B 4KK6C 2ITCB 3OAYK 3LS5H 1TCRA 3VFSA 1IAII 2PTVA 4PJDF 1KJMA 4BZ2H 5K9KB 2YWZA 1UVQA 3MRPB 3O6MH 5IFAH 1FIEA 2GAZB 3QXUA 1N8ZB 1FIGL 4YBHA 2BNQD 5E9DB 4LEXH 4AEIH 4KHXL 2VJXA 3UZEA 2ENYA 2RHEA 4OCWH 5E2WL 3ZKXB 1XGPB 1S7XB 2JTDA 1WZMA 3EYUL 5I1DB 4JG0L 4GQ9L 1UKSA 5HBBA 2XT1B 2FJFA 3QUZC 3CXDH 1JGDA 4PRAB 3LH2L 3PL6C 2WANA 1NCAH 3EJYD 3FQNB 1MCWM 5CINH 25C8L 5IQ7L 4M93C 4HK0B 2R2EB 1V7NH 3RWJA 2BSRB 1HQ4B 5BVPH 2D7OA 1AR2A 1Z9SA 2XTJC 2BNQA 4NUGH 4H5SA 3MA7B 4LRIC 4A6YA 1FVCB 4JHAH 3IU3B 4XPFL 1FZMA 3X17A 1QLEH 3SKOB 1Z2KA 5FOJA 1YC8A 1INQB 3STZB 3EJZC 3N50A 3X12A 1L7IH 3DSNA 2EDWA 3I6LD 3MRLA 4U1NA 4N0FB 4BQ6A 3TCLA 2WAHA 3IAGC 5I1GH 4PV8B 2AJUH 4EQ2A 3K2MC 2W60A 5GRVL 3THMH 4X9IA 2D0HA 2XKUA 3C2AH 1RK1B 4JREB 4ETQA 5IESH 3INUL 2HVKA 4PPTA 5GRYA 2VH5L 1BBDH 5E6YA 1HQRB 5FHBL 5I0ZA 4FFYH 2A74B 2VISB 4P5MA 3H9YA 1IFHH 5F97E 4PGZA 3RGVC 2AAVA 3WFDH 3IDIA 4QRRD 5F9JA 2OCFD 3VXSE 3BVNA 4NRXB 1I4FA 4PP2A 3MOAL 1KT2B 3TWCH 1YY8A 3G6JF 5LWYL 5FHAL 3BJLA 1R3HA 1YYLL 5EWIH 1IZJA 3U4EA 5JW3L 5JPMB 3R0NA 1A6PA 4XCCH 3MRHA 2C3VA 3D69B 4OM0L 2NMSA 1EEUA 4Q2ZB 1BQLH 4BSWA 3M17B 5JXED 5IMOA 3RX7A 1SBBA 1NSNL 1I7ZA 1MFAL 3DHMA 2Z8RA 1YEIL 1BVLB 3L1OH 2VZ3A 3KPPB 3O45B 4PJFA 4QRRA 1A6VH 3K81A 4MCZA 2VDQH 3QJHA 5I66B 2FIKA 3IU4H 4PJGE 5KSAD 3CFCH 2R0WH 4S1RL 3KJ4B 4YDJA 4M61B 4YHMH 2ORBL 4PJEF 5J0BA 3NN8B 2X4SA 4LCCA 2EDQA 3QEGL 1YJDH 2B20A 5K93A 5HGAB 2OZ4A 5F6HJ 1NAKH 1BQHA 1KCKA 5I8OL 4Q97A 3NIGE 4CU8A 5JXEA 3M8OH 4F15B 1IGYB 1XCTA 3UTSE 3SDAC 4LRNH 3V5HB 2XNAA 4ZPTA 4PJ7E 4ZAKD 5FYKL 3GK8L 3S37H 5TFSL 1CD0A 2J7LA 3RWFB 3VXME 5KSAA 2UWEE 2H1PL 5IMLA 1BLNB 4X6DB 3LPFA 2WWMD 2MJWA 4Y5VA 3T77A 3H2WA 5CAYB 2GCYA 5EUKB 1KPVB 1WWCA 4URTB 1IEBB 5DJCA 3TNNA 5E9DE 1QBAA 3HUJF 1MI5E 4OV5B 5HY9B 3SDYL 1ADQA 3D0VA 4LQFL 5B38G 3SDDD 4P4KA 3ROOA 5GS2H 2VXTH 4LLUB 2MCPH 2EDHA 4X7EC 4XMKH 3GM8A 3HPJA 3ULVD 3UMTA 1ND0B 1RJZA 1T6WA 2J8UE 4XAWH 4ZSOA 2HWZH 2HAZA 3C5ZA 5ICXB 3ARDD 3TVMA 1MY5A 2W1NA 2UY6A 1RZ8A 3LKOB 5IHZA 2OI9B 5DQ9A 1DBKL 3BGFB 4KK6D 4UTAH 1MY7A 5EFIB 1FZKA 3QUXA 5DT1L 5I8KL 3FN3A 4EN3C 4L9LB 2AXGB 5T5FH 1JPST 2NY2B 4ONOA 3DO7B 3LS5L 1NEZB 1JNLH 3G5VB 4NHUA 1KXVC 3GBLA 4BZ2L 2FX8H 2EIDA 1H9VA 3O6ML 3IETB 3UTSA 5HHOB 4BH8A 4EI5D 4TN9A 4YK4B 3BXNA 5E94B 1CDUA 1J0IA 2DWDB 1OB1A 4LARH 4OCWL 3S3JA 1GAFL 3SQBA 2F58H 3VXMA 5D7KE 3IVKA 3ARDA 4K8RC 1AP2B 4PRPB 2NW2B 32C2B 3QUZD 3U36B 5JLZB 1QSFB 2Z9TA 5IR1A 4RBPH 5F9WB 5FCSH 5EO9B 3NCEB 3PL6D 4BA8A 4P23B 3IXTA 2X05A 3QDMD 3CXDL 3NFSH 1MI5A 1VEOA 1NCAL 2Q7YB 3U0WH 2Z92B 2BMKA 2E6PA 3H42H 2AK4B 4KJYB 3RKPA 2LQRA 3HC3L 43C9A 5BVPL 4PUBH 5C0FA 1T5XB 4EUPG 3PNWB 3PWPB 5CHNA 4KVNH 1MCBA 5EPMB 1CTOA 3LKNA 1MCIA 1HXYB 4NUGL 4JFYB 1F6AB 3T1FB 3EYSH 4F33B 3JWDH 4L3CB 3EJZD 3QUZA 4JJHA 2Y36H 1QLEL 3PL6A 3G6AA 5KJRH 4LHUG 1E6OL 5K9OB 2A38A 3TNMA 2V7HA 3QDMA 2G9HB 2B2XH 4GRMB 3UZQA 4AEHH 4OZHB 3THML 5K59F 1BVKA 5F88B 4WW2C 2IALB 4KDWA 1FL6B 3C2AL 3QDHA 1IAOB 3IDNA 4LRIA 4TRPH 3RGVD 4HIIA 1D6EA 1QLFB 3Q48A 1ZVYA 4H1LG 4XP6L 1RVFH 1I7UA 1BBDL 1WK0A 1IFHL 2LU7A 3TA3C 4YFDB 2FHBA 4WHYH 1A3LH 4PV9B 2HLFD 2UV3A 5GGRY 4HIJA 2B1AL 4XBPB 2E9JA 2YPKA 3BKJL 1KNOB 2WBJB 3TWCL 2YK1H 5DEGA 3MRCA 2XA3A 2D9QB 2EO9A 3QI9B 3RWCB 1WWWX 1AGFA 5EWIL 4OI9A 5DVLA 2X4OB 3WXWL 5IFJB 2E3VA 4YHPA 3U79A 1FAIH 4PJFF 5GXBB 1KB9J 1BQLL 4JFHD 3BKYH 5GRVK 2DICA 3RGVA 1G6VK 4X6DE 5L8LB 2PTTA 1T4KB 1X5LA 1JZ2A 3QG7H 5LGJA 3ULSA 3VFRA 4RGOH 2R8SH 5HYFA 1N5YH 3WUWG 2O93L 3QZWB 4J7RA 4WGVB 4JE4B 5BXFA 3VD7A 3QJFB 2HTLD 4JGJA 2VDQL 4C56D 3IU4L 2P7TA 4PJXB 5FYJU 4F7CA 3SOBH 4MMZC 1AIFB 1ONQA 4N1EA 3SO3C 5GS0H 3HKFA 3EFFA 1YJDL 5L2JA 4IMLB 2EE9A 3QEHB 4DVRH 3JWOH 3VG0H 1TPXB 5GGTH 2YPVH 2ZKHL 1OGAB 3SDAD 1A6UH 2DQTH 4HCRL 3MRGA 3M8OL 1UADC 2EYTB 2VLKD 4FQXB 3U0PB 1PX3A 2A1WH 2HVJB 4MQ7B 4LFHG 4Q9QH 3BH9A 4YHIA 1A3QA 2CRZA 5T3ZD 1ACYL 1IBGH 1U3JA 5HPMA 3S37L 2D31A 4C56A 4MYWB 2VQ1A 5DEZA 4F7TB 5I1AA 4JY5H 1DEEA 4G6FD 3SCMC 3ZE2F 4JFZH 2EH7H 3IXAB 2V9RA 3I6GA 1BD2A 4W4OC 5EBLB 4R4FH 5EOCJ 5FUCC 2NY0B 3SDAA 4PRPE 1B4RA 3C2SA 1NCWH 1R24B 4JFFB 3T0XA 2VXTL 1CVRA 4J1UA 3T09A 4KV5F 1J5OH 3MNWA 2WQRA 4NC1E 4XWGL 3QIWC 3LV3A 5T1LB 3VFWA 4AG4H 2CKBL 2JLLA 1ZLSL 2OSLB 3OXSA 4EN3D 1F8TL 4ELME 3PHOB 3HCVA 2N1KA 1MVFA 3KG5A 4UTAL 2HKHH 1OAXL 3EDKA 5T5FL 1TJHH 2DJ4A 1T22B 3B9KC 3FFCD 4D94A 5JNYB 1DDHA 3RL1B 1RJLB 2VLME 2CD0A 4M1GL 1JNLL 1I7TA 2DMBA 4NNXB 2NZIA 1NCTA 1S9YA 2FX8L 4JJ5B 3VFUA 4XHJC 3S34H 5CJ5A 5IVXE 1FBIH 4K8RD 1QFWH 1NGYA 1S78C 4GO6B 1WF5A 2O5XL 2H6PA 2ZJSL 4LARL 3QR2A 2R23A 4OF6A 2CXGA 1VFMA 1Z9LA 1MWAA 2ICWI 3QFJA 4LOUC 5IB5B 1N2RA 5IB2A 5BCAA 3VH8A 1MLBA 1SMAA 4EN3A 4NM4H 3VGGA 4KC3B 1G0XA 4ORGB 4XXDB 2VR5A 4YZFF 3MROA 4OSUH 2BNRB 3ZYZA 5F3BB 2NX5A 2YKLH 4WU5B 1K85A 5I8CA 1RJYA 2RCSL 3NACH 3U0WL 5HVGB 2F53E 3H42L 3PGDA 2B4CC 1QPPA 1I1AC 4MB5A 5BQ7A 1CBVL 5EU5A 1AGEB 1HEZA 2XZCH 4KVNL 4PRDB 1SBSH 5T1MA 4NNYA 1WEJH 3VWJB 5DRWB 4X4ME 5I1HH 3EYSL 3LSOB 3FT3A 5GGSY 1KSRA 4PRID 2Y36L 5D1XD 1J1OH 4WO4C 4OAWA 4HWZB 12E8H 2GJ6B 4S1SL 4GS7C 5KJRL 3W0WD 1CDHA 5GZOC 1W0VB 3UYPA 1WC7B 3DETC 2VWEC 4M5YH 4I0PB 1U0QA 4PJBB 1D5BB 1PQZA 3MQIA 4TRPL 3TA3D 2PCPA 5B8CB 3B83A 1TQCB 4HV8B 1HHJA 1EXUA 4GKOA 4XNUH 4XMPL 5GQBA 3E6FA 2DMKA 5ID1B 2B5IC 4OLYH 1A3LL 3OKDB 5CJQL 2X4TB 2R0ZH 4M43H 1OGAE 1SM3H 5JW4M 4HAGA 1FNGB 1NGXA 4PJIA 4P3DB 5SWQA 3U2SB 3W0WA 3GSVA 3B8SA 2V5YA 4WW2A 3QNXA 1GC1H 1U8PA 4JO4H 1FVEA 1W8NA 5EIVA 4HHAA 1RHHA 5JQ6L 5EUOB 2OL3B 3TA3A 5E5MA 1SEQH 2VDKL 4KTYA 3SGEH 3L6FB 3QG7L 1K5NA 1LE9B 2EDRA 2DQUL 1KTDB 4MJIB 1KUMA 5KVEH 3KPSE 4LVHB 2R8SL 5SV3A 1U3ZA 2DD8H 3LEXA 3K3QA 4OZ4A 1NDGA 4K7FB 4R7DA 4WEBH 5TGBA 4MS8C 4YJZL 3RP1A 4G42A 4HJJH 3SOBL 3X13B 3BPNC 4NN6B 3VE0B 3L95A 1BAFL 3QULB 4QRSA 1B4JH 3LQMA 4DVRL 3JWOL 4WFHD 5CSZA 4DFIA 4NFBA 1A6UL 3WIFA 1UT9A 4N0YH 2DQFA 1TVDA 1T1ZB 4N0UE 5D7IE 3GJEA 3HC4L 4HWNA 3GMOA 1DANU 5ANMA 2VLLB 4MNQA 5INDB 1WFUA 3SCMD 1RUMH 3VXUB 1KB5H 2B39A 3LEVL 4QXGL 3WBDA 3GSXA 4KKCC 4WI8A 1M4KA 1WJ3A 4OLWL 3OGCB 1MCLA 3HAEB 4O2FA 4PB0H 2FJGB 3KYNB 4QRUB 3EDDA 5IBUB 4HGWB 3VXRB 5B3NA 1AXSA 4MCYA 2HT4C 3IRZA 4KRPC 4FTVE 2X4QB 2NNAA 3MRJB 2O26U 1LNUA 2PYED 3QIWD 3UTQB 4G8FB 2R2HA 5GPRA 1BOGB 3SCMA 4K94H 2RGSA 4ZFGL 1TTGA 5CS7A 1K4CB 4AG4L 1MCDA 4R96B 4TTDC 5INCB 3QG6A 3WFCH 2XACC 1JFQH 1MJ7H 4W4OA 5ISZD 3SDCC 5CEZH 1M7XA 2HKHL 1CGSH 2UZIH 5I1EH 2XV6B 2FECI 1INEL 3MFFB 3T4YB 3MLVL 5GRXG 5HHNA 5DURD 3H9SD 2PW1B 4DK6A 1S78D 3EYVA 1T2XA 2FEEL 4NRYA 1PY9A 3QIWA 1U93B 2NY1C 4MDJB 4WWKB 1IAKA 3K1KC 1IE5A 4G80B 4LOUD 1M05A 3VXPB 1G0DA 3FRUB 4N8CH 3RGHA 1BIIB 4LGRB 4B53A 1JTTA 2Y23A 4OZFG 5ISZA 2E27H 3B9KA 1A7QH 2MOVA 1K3ZA 5CBAB 4JRYB 3QO0A 4XNMB 2YKLL 4YR6B 5MEQA 1B6UA 1U2CA 3NACL 3CMOH 4MSWA 1TZHB 2NY6B 4F37F 2OQJA 2XZCL 3ZO0A 4F2MB 3HZMA 1PY4A 4ELMF 4UINL 2CKBB 4RX4D 1GZPA 4NQVA 5DMKB 1WEJL 3FKUS 4WO4D 2AJSL 4WTZA 4ENED 5I1HL 2OM5A 2IPUK 5GZOD 5C07E 1CL7H 3T2OA 3DETD 6FABH 3ZE1F 5EUOE 3ALWA 3FAXA 5ESAB 3BSZL 4PJ9D 5FXCH 1HHHB 1I1AA 5ESQB 1OP9A 4M5YL 3MV8B 4XP9H 4HUVA 4EI6A 4Q6YA 5BZDB 4R4BB 1BX2A 2XXCB 3QISA 4H25A 3HI1A 5IROC 3MNVB 3T08A 1NLBH 4LLAA 1U3HD 4XNZC 2DQDH 3CFJB 4RX4A 4PJIF 1TZIB 3TH2T 2R4SH 5DJAB 3W11D 3NOIA 4PJAA 4WO4A 4LPCA 4A2MA 4U0QB 3C60D 3HNTH 3DURA 2X4PB 4WW2F 2VYRE 2RQ8A 4M43L 5B38A 2L0DA 3OKKB 4UBDC 1UXWA 3I85A 4TVPD 1UWXH 1RV6X 1CE6A 4UT6H 5MI0C 3CSYB 1UG9A 2VLRB 5I71C 1I9RH 3QXAB 3VU2A 1F11B 1IC1A 1SYSB 5GRWA 4JO4L 5KSUA 1NCBH 4XB7A 1U8KB 5J3HC 1AHWB 1IC4L 4N90D 1AJ7L 1SEQL 1CQKA 1SJEB 1VCAA 1ZE3C 3E6HB 4QRPD 4U31A 5KVEL 1RJCA 5FKPA 1XGTA 1RZKH 3PJSA 4KRNA 4AIXA 5C1MB 3MUGB 2AQ3A 4RFNC 2BSSB 3MOBH 5I18H 3HMXH 1G1CA 3B2UC 4XBGB 2EIEA 4OFIA 3FTGA 5BJTA 5DUMH 4XB8A 4FS0A 3EYFA 2ZUQB 1HNFA 2IBZY 4HIHB 2M26A 1IZKA 4XCYB 3S3PA 2FH6A 2WBWB 1BZ7A 2AJ3A 5C0DB 1B4JL 3BN9C 3LKSA 1KLGB 4LP4A 1PKQB 3O3BB 1QO3B 3RAJH 4LCWD 2FATH 3PHSA 1MCCA 5GGRA 2K7QA 4QRPA 1FYTE 4KKCD 1F90H 1K9TA 3QDGD 4POUB 3JTTA 1RUML 4NN7B 1KB5L 1Z5LB 3H3BC 1OP5H 4NP4H 4EJ1C 5JTWA 2H32B 3TT3H 1IT9L 2VLJB 4PB0L 1Y18A 3LKPA 4RMVA 5A2IH 1SY6H 2HT4D 5IM7B 2Q6WB 4E0RB 4Q9BA 1WZ1L 3ARBB 4KRPD 3D87B 3AS3A 4CW1A 3S88H 1A0QL 5EC2B 2ZOKB 3CFBB 3I84A 1IARB 3ARXA 4A2LA 1RZIB 2AJVL 3GIVB 4R8WH 3LQZA 1SHMA 4P2CG 1FFRA 5DK3A 3NCMA 4JRXD 1CLZL 1T1WB 1JGUH 1GOGA 3VMPA 1QQDA 4TTDD 3QDGA 4K94L 4KHTH 4HH9B 2YPLE 1T1XA 1T04B 1Y6KR 3ECBA 1G7HB 4X5WB 1UC6A 1AKJB 3WFCL 1MJ7L 2MMXA 3L3HB 2DQGH 5L8KB 5AYQA 5CEZL 5D7IF 4D8PB 4E41B 4JPKL 4M02A 2UZIL 3U7WL 5I1EL 3ESUF 3UJIH 3FO0H 5D5MA 1A6AB 5F7NC 4PRHD 4OLEA 2R9HD 3QQNA 3WUZA 3TZVD 1MLCA 1VFUA 2ARWA 2X7LB 5HI3C 4YDKH 5IVNA 3LIZL 4LSUL 5C0AB 4ORZC 3MV8E 3U7YL 1FP5A 3LN4A 4A6YH 3LMJH 3SDCA 4N1CA 4N8CL 4ZQKB 2K7PA 2EDJA 5DHXB 1GZQA 4X6BA 2E27L 4OZIB 5E6IB 3GEWB 2D3VA 2VAAB 4AENB 4FXKB 3BUTA 1KJ3H 1IL1B 3V6OE 4P46C 5JPNB 4P4RA 3OR7B 4X4XA 5D7LA 4UIMB 4KRLB 4M7LT 2NY5L 1J10A 2HP4A 3WLWC 5IJVA 2XI9A 1JK8A 4XPTL 1D9KC 2DTMH 3F7RA 5BV7C 3E3QE 3QEUB 3E2HB 5CJ8A 3PGCB 3OBAA 4QHKI 4HGKC 4HKXA 4U6TA 2F9BT 2VLRE 3BIBX 3ARFB 1CDCA 5DQJB 4I8DA 3VI3F 1IEAA 3HTLX 2IH1A 4LHJB 5DEFA 3CFDA 1D5MA 4JFXB 3RZCD 1CL7L 3AMLA 6FABL 1N59B 2DQCH 3T3PF 4QHUB 3L5JA 3RPKA 1CICD 5I9QB 1QRNE 3OZ9L 4ISVB 1F45A 2OTUB 2CDFB 3UYRH 4AT6B 4PBXA 1WCBA 2R1WA 1K4DA 4PJAF 3UO1L 3BZ4A 3IJHA 4DZ8A 5E00B 1GH7A 3B5GA 2GSGA 1R3KA 4EDXB 2DQDL 5DFWH 4BFGA 2VR9A 1S7QA 1VKXB 5F7HA 1P9MC 4WDIA 3WL9A 1Q38A 1U8OB 5LVEA 4UBDD 5AYUH 4YXHH 5IG7B 4XT1C 4AZ8A 1DE4B 4AM0B 2QR0B 3AB0B 1M7IA 3LEYH 4K7PH 4YHNA 4NQDD 1A7NH 4NZDA 5KSBA 3O2VH 4UT6L 2ADJA 5IROA 3G5XB 3D9AH 3PF2A 4U05A 3KYOB 4UB0H 2NYYC 4MA7H 4Z5RB 4M4PA 4NZTL 5DZLA 3B8YA 4BSVA 4DVBA 3GJFA 2HFEA 3QIBB 1B0WA 2XG4A 3PQYD 3VD3A 2CUHA 5GGSA 2QHRH 2W0LA 4U0RC 4EIZC 2IADB 3TBSB 1UH4A 1EERB 4MJ6B 1EJOH 1VEMA 3PIQA 3W39B 4LU5L 3B2UD 1X5YA 3FN0H 3QHTC 4QRQA 4OLUH 3CSGA 3MOBL 1U41A 1ZT1A 2BJML 5F9OH 3HMXL 4R90H 5JORB 5BRZD 1JYWA 4X0KB 4JQIH 1NC2D 5DUML 1FCGA 4JKPL 4NQDA 4Z7OE 5DJYA 5IB1B 1G6RH 1VADA 1J0KA 1NBQA 4NQUA 43CAA 3IJSB 1NFIA 4HXBH 1YEDA 2BVQA 4Y16B 5E1AA 1OSPH 1YMMD 3RAJL 4U3CA 3L3DA 2WINB 2EYSA 3PQYA 3ZKXC 4WI4A 4OFYD 2J3SA 5IVZB 2EDFA 4Y5YB 1XGUB 3CU7A 1T1YB 5FM5M 5HYSB 3REVA 1VFBA 5T5NG 3QZWG 1F90L 4YLQT 1VFAA 3NIFE 1DL7L 2A73A 3MJ8A 4F7MB 4X6EB 4EQ3A 4NP4L 4MJ5B 1JUFA 1NC2A 2APBA 5FDWA 3ALPA 4PIRF 4F8QA 3OV6A 4WUUA 1SY6L 3O2DA 3ARRA 3DUUA 1A1MB 1MFEH 5H94B 4DZBB 2WWKO 5SX5K 1U92B 2BVUA 3NCFB 5DRZA 3Q3GA 1YMMA 4NIKB 2YD2A 3FO9A 1QACA 3IYLW 4OFYA 3H7BA 2JCCB 1HHGB 3O41B 1MFNA 5F1SA 4EXKA 3QWOA 1KCRL 1G1YA 4X98A 5C2BH 4X8XA 2VZUA 5DWUL 3LVEA 2AVGA 2IFFL 1JGUL 2A83A 3ULVH 4OGXH 4EVNA 1I8LC 1AQDA 4JAMB 4KHTL 1FFOA 3R06B 4WFEE 3V0AC 3C6SB 1BZ9A 5B39A 4OF8A 5F6HI 1ORQB 1KCUH 2DQGL 4RAVA 4QYOB 2HT3D 3C8HA 4P3WA 1QFUH 4JREC 1W0WA 5DI8A 1R6VA 3UJIL 3FO0L 4QRTA 5HD8C 4JLRB 2KQNA 5T1KB 1EZVY 5I16B 4V1DB 4OFKA 3EOTL 5E95B 4GG8B 3FL7A 4LNVA 1TTFA 4NYLB 4JFQB 4OZGB 3ILPB 4AK1A 4YPGA 3QUYB 1L9NA 2EEAA 3STLB 3U9PL 1QLRB 4LF3A 4A6YL 2F54B 4QHLA 4HUMB 1RAMA 4G3YH 4HEME 1Z9MA 3SKMA 1KELH 1I1YA 3U6RA 5JOEA 5KVMC 5KVDH 3D18A 4JPVH 3WLWD 3BRFA 2P8LB 1LE5B 1D9KD 1CLOH 1S8DB 5JHDD 4TSCH 5KG9B 3RVUC 1OTUC 2OX5A 2DTML 4AH2A 4ZUSB 1HI6B 2DIAA 3TBTA 5FB8A 3I75B 1BOYA 5TH2A 5F7WC 4N0CD 4UAOB 1XR8A 1XZ0B 3T8XA 3G04A 4WW1B 3ZDZE 4Y5XB 2QKIA 2AABL 2W65B 2FL5A 4KPHH 1BFVH 4R2GB 4RNRB 4P46A 1U91B 5FF6B 1YC7A 5HHMD 4KK8C 2E7LC 1BFTA 5CMAA 3MV9E 3UYRL 4F15C 3G5ZA 1ETZA 1D9KA 4WI7A 5JHDA 3M07A 2DLHA 5DRNA 5ERWB 4OCRL 2DBJA 4UT7H 4LLQA 4B41A 2NY3C 1T20B 3RWDB 4X6CA 4P57B 4XRCB 2D7MA 4FQCH 4XP4H 3G08A 4Y8AA 4NKDB 3PDOB 3IKKA 5KSBF 3NABH 5FDYA 1JMZA 3CX5K 3MCKA 3NCBB 3KPLA 5AYUL 1EFXD 5E5UB 4E5XB 1TVBB 3QFDA 5B4MC 5D71H 2R1YA 3UPAA 4JFPB 3LEYL 2IQ9H 4NPYA 2BOCA 3TO2B 1CDIA 1CFTA 4KGJA 2GKIA 3ZDYE 2NYYD 3O2VL 15C8H 4AEEA 1HWGB 4RWHA 2IAND 3VFVA 2XWJA 3D9AL 4WFGE 4UB0L 3H3PH 1ZAGA 3TIEB 1QBMH 1D5IH 5K9QG 1P9MA 1P7HL 4AYFA 3KDMA 3O0RH 3UEZA 4L29B 2QQQA 5E7FA 4DN4L 2CDGB 1KOAA 4DOHE 4GW4A 4PJHB 5F89A 1EFXA 2V2TB 5CFHA 2OK0H 3E1F1 3RPIB 3EGSA 3GMLA 4L4VE 1KXQE 4JQIL 3V6ZB 2AW2A 4XH2B 3VFTA 1G6RL 4PGCA 5E9DD 2IANA 4JO3L 3RX5A 1DR9A 4HXBL 4RZCB 2MKWA 5DK2A 3TFKD 1CDYA 1QKZH 3V6FA 3A6CL 1A1OB 1MCKA 4OZFA 3BE1H 1N0LA 3BMVA 4S2SA 3ZKMC 5HJ3A 3N0PB 4G7VH 2BDNH 5F9WC 1OM3H 2LU4A 4P2RE 4GH7B 2ITCA 5T3ZH 2FLBT 4P23C 3OAZK 1DQJA 3GNMH 1JHTB 4ZNCD 3S9DB 3FQTB 5K9KA 5CUSL 5DGQA 1ZT4B 2GAZA 3A67H 4QXWA 1N8ZA 4I4WA 1V5JA 1D5ZB 5GGVY 5I75B 1Y0LB 3MLYH 1P4IH 5JMRA 4KFZC 5JQHC 4X7FC 4LIQE 2BVPA 2F54E 5CKGA 5I1DA 4IIQB 4Q6IC 4X9BA 4XZUB 3V79C 4F7EB 4CMMB 1G9MH 2MFNA 4PRAA 2N7BA 2V2XA 4GRWH 4FNLL 3ULVL 2ATPB 1KB9K 2Q20A 5C2UB 1J0HA 4OGXL 4G8GE 2ZSVB 4LHQB 1OAYL 1ZXQA 4PFEA 4NZJA 4FQLH 4TSAH 1MWAH 2BSRA 3HAEG 1N7MH 4I77L 1FFQA 1E4JA 4P9MH 3S7GA 2EEBA 1P4BH 4NDMA 1QFUL 3MA7A 4ODXB 3TH3T 1FVCA 3IU3A 5ENWA 5DFVC 1P84K 3SKOA 2X09A 1INQA 3S36H 3STZA 1I8LA 2X1WL 3NA9L 3CMGA 4K8RH 1ZHBB 4N0FA 2WBJC 3EDFA 4PS4H 5DUBB 4PV8A 2ESVB 1KCVH 2QL1A 3QI9C 5FAAA 1MJJB 1RK1A 1U6AH 4G3YL 5DF0A 4HKBB 1EX0A 5IQ9B 2EC9T 1HQRA 3GMNB 4JFEE 3MV01 2VISA 5KVDL 4MD5A 1OTUD 1F00I 3F7QA 1DBBH 4PD4K 5C6WH 1CLOL 4NZUL 1RUQH 4TSCL 4PGJA 4DCQB 4NRXA 2QQNH 1KT2A 3X14B 1OL0A 3EZJB 4WI9A 1UYWL 4F58H 1MIMH 5JPMA 3QWRD 1BGXH 4L3EE 3D69A 3KXFB 2MPAL 5TPWH 4FQHB 4Q2ZA 4KK8D 4KPHL 1C8PA 2DM3A 1BFVL 5TDOB 1MAJA 3EOBB 1TPXC 4RFOH 3DUSB 5E4EB 3I6KB 4I3GA 3KPRA 2DKMA 1G9NC 4X6CF 1PG7X 3KPPA 2JJTC 3HE6B 1IGJB 3O45A 3SKNB 5A16B 4FQXC 4Z77B 3WEXB 5I66A 4ZPVA 3ARUA 4WFFE 1PKOA 4JPIA 3UTTB 5D4QA 5GHWH 4PTUB 3NN8A 4FQCL 4XP4L 2IGFL 3QWRA 5B4MD 5HGAA 3NABL 4M00A 3SDXB 1DEDA 4QY8B 1SYVB 2XN9B 3QXDB 2E7LA 3HR6A 5D71L 4RGNE 4NQEB 5EO1B 3QCTH 2E7HA 3MJGX 2XZQH 2NZ9C 2P5EE 2IQ9L 1IGYA 2NY0C 4L5FH 4Y88A 2WIIB 3BKMH 4LK4A 3RKDC 1N6QH 4X7SH 1QBML 1D5IL 4NQCE 2IPUG 1F3JB 4Y1AE 2HN7B 2C7UB 2QV2A 3ARPA 5EN2B 1GXEA 4UUJB 3P4OB 4F80A 3O0RL 1KPVA 4H26B 3RWIB 5E08H 1IEBA 2FBOJ 2AGJH 1CFQB 2NY2D 4OV5A 5HY9A 3QRGL 1RUAH 2KBGA 3GSWB 4GW1B 1UWGH 3VD4A 4F9PC 4QWWC 1J87A 3P0GB 2G5RA 1J12A 1HKFA 5HHOD 3D3VA 1ND0A 1U3YA 1A1NB 4PRPD 1AFVH 1QKZL 4G6KH 3LKOA 5ESVB 4J23A 3QPXH 3BE1L 1PYWB 4ZD3H 4XVTH 3QCVL 2VE6B 4P23D 2PR4H 5EFIA 5TF0A 4GLRH 5EOTB 3S4SB 4G7VL 2AXGA 5DK0B 1OM3L 5GISH 5T3ZL 1KYOJ 2OP4H 3DO7A 2V5TA 3GNML 1NEZA 5DFTA 3G9AB 5J57B 2AK4D 4U7MA 5HGGS 5K33A 3L5IA 1ZHLB 5C6PB 2YN5A 5HHOA 3PWPD 3VMOA 3A67L 4NZRL 5E94A 3IS0X 2DWDA 3QWQB 1P4IL 4XP1L 1AP2A 2NW2A 3U36A 5JLZA 1QSFA 3RWHB 4GKSB 3VWJC 4JHBA 1JMXA 5EO9A 4P23A 1G9ML 1F42A 2HT2D 5EU3B 3TO4B 1EGJH 2VL5A 3OJ2C 1WLHA 2Q7YA 1S7SB 4YHKL 2Z92A 3FOLB 1DSFH 4FQLL 1NGPL 1CTNA 2UZXB 2AK4A 1DN0B 1RZJH 4KJYA 4MB4A 1MWAL 5BO1L 5AEAA 1T5XA 2H8PA 1AGBB 3PNWA 2JIXA 3PWPA 3T3MF 2N7AA 4CJ1A 5EPMA 1TMCB 2AKRB 3OB0H 5BS0B 5DFVD 1KENL 3V5KB 4ONHB 2CSPA 4Q6IA 4JFYA 3RVVC 3P9WB 4OM1H 3T1FA 1NGZB 3VGDA 4F33A 4P5TB 1PDKA 1TQCC 4L3CA 1M71B 2HMIC 3FMGH 5KS9A 3WHXA 7CGTA 3S36L 2EDNA 1HK6A 2G9HA 1OTSC 3WD5L 3QI9D 4GRMA 2Z4QB 4K8RL 5IK3B 3ULUE 3D1MC 1KCVL 3HLAB 2MQ3A 1IILE 1T6VN 4OZHA 3TF7C 3SE9H 2VN4A 4Y19A 5F88A 1FGVH 2IALA 4KJPC 1U6AL 1IAOA 3U30B 3QXTA 4Z7UB 1QLFA 4G9FB 1FNFA 3AS2A 3KR3H 1FNEA 4W4NA 1S7TB 3QA3B 1H3UA 1NQBA 1DBBL 1QVOA 4PV9A 4RMSA 1RUQL 3ZLQC 4XBPA 1A6TB 1RIUH 4LVHC 2QQNL 5DD3L 1KNOA 2ICEA 2WBJA 4ZUUA 4LLVB 2A9MH 4HMDA 1MCNA 3H0TB 3QI9A 4DTGH 4I0CC 4ZODA 2X4OA 1IGTB 1BEYH 4P9HH 1BGXL 5IFJA 4NN6C 3WCYA 4F3FB 1OGAD 2VDNH 5TPWL 4ONGH 4U33A 1OT1A 3NPSB 1T4KA 4RFOL 2BP3A 2BHUA 4FQXD 4YE4H 3MOQA 1MELA 3QZWA 3EAKA 4J3OC 2V9TA 5I8EB 2UYLB 4EI5B 3QJFA 3GKWH 4YBQC 3V4UH 3WYRA 4PJXA 4IRJB 5E2UH