3D87B

Crystal structure of interleukin-23
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
306
structure length
298
Chain Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Interleukin-23 subunit p19
publication title Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 298
sequence length 306
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B03
4Q9QL 5CP7B 2N56A 3G6AA 4MGXA 2FL5A 4IRJB 3QDGE 3NIDE 1AQDB 4K3DL 3FT3A 5L9DH 3G04B 4XX1G 4JFZL 4HS6A 4AEIL 1GAFH 1HCVA 1XGPA 3MODL 4JO1L 3WNMA 1ZV5A 1KN2L 5C6PB 1DANT 1SYSA 1T83A 1AIFB 4CRPA 1O0VA 1JBJA 1X5FA 2SEBB 1YMHA 3GSOA 5HYSB 3NBNA 1LEIA 1L6XA 1YY8B 1WISA 1GOGA 5E2TL 5DSCA 4XAWL 4JLRB 4MQXC 1KBGH 1T2JA 1LE9B 2DDQH 1A6ZA 3WUWG 3GBNH 2O5YL 1YNLL 1S9YA 2GW5A 1MHCB 1J05B 3TZVC 4P2OB 2GJ6D 2P5WD 2JLLA 2F58L 3C60C 2YZ1A 3BP7A 4I8DA 5I75B 3X14A 1D5XA 2I60L 4NZRL 1ITBB 2ZKHH 3BW9A 1IGMH 5ADOH 2AK1L 3TO2A 3AC0A 2EXYD 4PG9A 1H0DA 2FO4B 1PZ5A 3RBGA 4ZAKA 5INDA 5ACZB 1N6QH 3GSNL 3KPNB 4XPGL 3LRHA 3NAAH 3MBED 2OTUA 4I2XA 3MRPA 5IB5B 2DQGH 4U1IB 4C83B 1I8MA 2YK1L 5HGBA 4MXQC 3TZVB 1P5VA 4M43H 2XOTA 3SDAC 4P46C 3DYMA 3C60B 5E00B 3S34H 1JP5A 1UEYA 5IJVA 5HVHC 5C6TL 2PYEA 1HZHH 2DQIL 3UPRA 3B9VA 2CKBL 5IHZA 4QRRE 1U8LB 1BHGA 4K7PH 1FFRA 4QXWA 1QFWH 5DJ0A 5DGRA 5L2KB 1VKXA 2H3NA 3EYQD 5KVMC 1OAKL 2IBBA 4X6DA 2DTML 1BIIA 1DN0A 3IDNB 1MPAH 5JDSA 3SDAB 3ARSA 4PJAA 4XPTH 1TJHH 1FP5A 2AEQL 3M1BA 4PRHA 3MXVH 5IV2B 1DL7H 1C1EL 2IQAA 1I7ZB 4NKMA 5HVHB 1L7IL 4XCCL 5DMYA 4P9ML 4K3EH 4NJAH 3OAUH 4YXHH 4I3RL 1A3LH 5IVOA 3QFJA 1RZKC 5F7WC 4X6CA 1R5IA 2E8ZA 4OI8A 1UWEL 4IMKA 2P24B 1U8QA 4ENED 4KJPD 1I1AD 3BSZL 3S3PA 3VI4F 3JXAA 4ZPVA 5GRJH 3GSWA 3N1GC 4U33A 1W72B 1AXSA 2BDNL 3EOAA 5HYIA 1FN4A 1KFAL 4HH9B 2H2PC 4XCFH 1IVLA 5FM4A 1U95A 4C4KT 1NFIA 3OGOE 4OF6A 3W0WE 4KJQD 5D7IB 4AL8L 3BZ4A 5FHAL 3ZLQC 4OIBA 1ZSDA 3QXAA 2JIXB 3MRBB 1MLCA 1MY7A 5EFIB 4G8GE 1LO4L 5KSAC 1E6OH 5L2JB 3HC4L 2Z31A 4WDIA 1F90L 2V5YA 3GRWA 3QR2A 4MNQA 2EIZB 4X7SL 4FZ8H 4ORGB 5EZLB 1B90A 1OAZL 1JZ6A 1E4XH 2D0GA 5HGAA 2GK0B 4RWYH 2XWBA 4EN3D 1BD2E 3NACL 5FDYA 1JPSH 2X70A 3U0PB 3K2UH 5EDXA 4MHHI 4PY7B 3ARTA 3QULA 1ZLWK 3FKUS 4LRNH 2VXSL 4YHKH 4GG6B 4OTXH 5KSAB 5D1XB 3K80A 2XKNB 3SDDA 5ISZD 2VDOL 3BXNA 1A1NA 1A4JA 1YEGL 1TZIB 1BPVA 3G5VB 4XVSH 2YRPA 1ZVHA 1I8KB 4JEGB 1HHGB 2R69H 3MRIB 5J3HC 2AJSH 3T1WA 1RU9H 1JPST 3OJVC 2NY5L 5FYLE 2VIRA 5ABDE 4AEFA 4XP5H 2AK4E 2F8VA 4ONHB 4PRIE 4L3EE 5TE7H 1FH5H 1A21A 4KMQA 3OKDA 3BJLA 1V3JA 4AK1A 5FO7A 5F7FA 3QEQB 1HXYB 4JQXC 2IPUG 1C5CH 2X4UB 2XTJE 1HHIA 3SGDI 1R24B 3EYQC 4N0UE 1J5OH 1F4XL 2ZUUA 2VQUA 4NBXB 5DURD 4H88L 1YEIL 4OZIA 4LBEB 3AS1A 4CADB 1NUFA 3SKUD 5IW6B 1CDCA 5F9OH 4GUPB 4ODSH 4Y1AA 4MD0B 4X7DC 1OGAE 4FP8H 5DT1L 1MJ8H 4Y4HD 4BSWB 3UTQA 1T2QH 3Q6GL 4GSDL 5CEZL 1J88A 5TDPB 4TOYL 3VFNB 3RDTB 1F8TH 2FX8L 3HG1A 1CTNA 1DQDH 3WO4C 4XNUH 3RL2B 5K9JL 2G75B 4Y5YA 2PUQT 1I1AC 4J7RA 1HN1A 1RZ7H 2BFVL 1N0XL 4U6TA 2OSLA 3O4LD 5FIEA 5C7XH 1D9KC 5IMLA 4JFPA 3QEGL 3CLFH 2WNGA 2BNQD 2I24N 1KJ2B 2C1PB 4KHTH 2E9WA 4OZFB 1XCTA 4LIQL 4KJQC 4S0TD 4G43B 4U1KB 1YQ2A 4OGXL 5EIVA 3KPLA 4JB9H 1UVQA 5DJ6A 2CO7B 1OAYH 1AHWA 3DUUA 5AWNH 4NQCE 2LFGA 3ARXA 4YHZL 1D9KB 4RFOH 5J11C 4CN1A 1I3GL 5IT2L 3VWJA 1JUFB 3LEXA 2V5TA 4FQXD 3PWPD 1F2XK 3PGFL 1OVZA 1CXEA 1E4KA 1EERB 1HIML 3EO9L 4YGVB 3D9AH 4OGYL 5KZCD 5D7SH 4OZHA 4L1DA 1U8IA 2R0WL 3U7WL 1IL1A 1CLZH 4M7KL 3QDGD 4QT5A 3TA3D 2J5LC 3P0VH 1JHKL 4OV5A 1ZS8A 1FL3A 5KVDH 5INCB 4LP4A 4IIQC 3G5XA 4YAQB 1CL7H 3O2DA 5CSBA 5EWIL 1G9MC 4PJ8A 1ZGLB 2EYSB 2VZTA 1N7ML 4J3SA 1FGVH 2BX5A 2C3HA 4LLUB 3VH8A 4CN4A 1JPTL 5I17A 4H1LA 2MTPA 1QO3A 4FQJL 3DX6A 2R9HC 3H9HB 2FECL 2QV2A 3MC0A 5FFLA 2I27N 2QQNL 4IIQB 5FYKU 3L7FB 3NIGE 1UKSA 4F2MA 1OCWL 2YD5A 4X4MA 5K9QG 1H8NA 2WAHA 5DK2A 5KSVA 1Q38A 1V5JA 3DURA 4Z8FL 1R5VA 1GPOH 1EZVY 5F8RC 4J4PA 4QHUB 1RJLA 2A77H 5FCUH 5K93A 2N7BA 2ADGA 1BBJA 4U6HA 3GMMA 4TRPL 1S7SA 5E8PA 5D5ME 4MXWH 3P4MB 5JMRA 1NCCL 5BXFB 4PJBB 1UXSB 1ZT1A 1YDPB 1W2KT 5JORB 2W9DH 2MSPA 4KKBD 2FIKA 1AGDB 4LLWA 4OI7A 1AD9B 3DVNB 4KTDH 5KG9B 4U6XA 3BT2H 1D5ZB 5D6DA 4B7IA 1FSKC 4HS8H 1A7NH 4NOFA 3KPSE 4PJIA 5I66A 1BVKA 5C0RL 3GNMH 1LK2B 4Z0BH 3WLWD 2YMXH 1L9NA 2ZCHL 3S88H 5ICXA 5DR5L 5DJCB 3EO0A 3GRWL 1MRCH 4UT7L 3SQOH 3QQ9C 4Z7OF 2KBGA 2AXJA 3VRJA 4FXLA 4PGBA 1WBZA 1YECH 4TUOA 2EC8A 1FNAA 4LCUA 1YA5A 4MAUL 4UV7H 4XP9L 1RMFL 2CGRL 3LS4L 2J7LA 1FSKB 4L4VE 2JCCA 3C09B 5T5NF 4ZTPL 2ZPKH 4OZGE 6FABH 1JYVA 3U9PL 3GMPB 4HUVB 2DIJA 1VEMA 4CVWA 4FQQB 3KR3H 1T89C 3UO1L 1NCAH 1IEBB 4FQXC 3V7AE 4BQ6A 3LPWA 4OBRA 3H9SD 2CRMA 3GUTA 4Q2ZB 5CD3A 4XT1C 4YWGL 1X4ZA 4BFIB 4K3JL 4GRWB 4LCWD 3O45A 1MCCA 5MP6H 4WO4D 3ZDXF 4LSDA 5C9JA 5JOFA 3O8XB 3PGCB 3ARFD 4FQHA 4EEEA 2R2HA 1A7BA 1K5NA 5AG8A 1CT8B 2Y06L 3BKCL 4G8GD 1KNOA 3WS6C 5DUPL 1KLUA 1FIGH 3MA7B 5ADPL 3GSVA 5HHME 3T2NL 1T5WB 3VFTA 4ELMF 3I6KA 1J1OH 5D8JH 1LO2H 3VXOA 1R3KA 1FO0B 1WITA 4XBEL 3VXMB 1ZT7A 2CIKB 1JPGA 4FTVB 4ZO8A 4Z7NE 4TNVF 5CD5D 2YPKA 3AM8A 4PRAB 1K2DA 1Y18A 3QUZA 3I84A 3D3VD 1A4KA 5F7HA 1ACYH 4DTGH 1HHKA 5HHPB 4OT1L 2NXZB 4Q9BA 5EUOA 2IMNA 3IFPA 4LGRB 5C0BE 2HKHH 1UKQA 2GFBB 3BPOB 4OKDA 2EDEA 3IXAB 1XGUA 5EZIL 4MA1C 5E8EA 5EORL 1JNJA 2OP4L 3RPIB 5JW3H 1PKQE 5MEQA 1IBGH 5KVEL 2W60B 4R3SB 4D0DA 2WV3A 2R1WB 4L4TA 4RMQA 3IAPA 3VRIA 1FVCA 3QXUA 3R1GL 2J12B 4Z7UF 2DICA 3MOBL 3KS0J 3TNMB 3WNPA 5FYLD 5BZDA 3GMQA 4GMTL 3VGAC 4WFHD 3F5WA 3MLUL 3C8KA 1MFBL 1ZE3C 3DVGB 4LCIL 1FZKA 1JTPA 2NY7H 4KKBC 3HNTL 3ILPA 4YO0B 2XY2A 5C71A 4C58B 1T1YA 4AH2A 2NMSA 5IESL 3OKLB 1MIML 5DMKA 3SE8L 2XTJD 1XGTB 43CAB 2C3GA 5LJYH 1VFAB 5ILTL 3K46A 4WW2F 1TFHA 1KT2A 1FV1B 5BQ7A 3VFVA 1HI6A 4MJIE 3EYFA 5HYQA 3ILQD 5E2UL 5TGBA 2DS4A 1OGAD 4WTZA 3CK0L 3ROLA 2CR6A 4PJ7F 4GBXA 5D72H 2AJVL 5I16B 4QRRB 1XCQB 1IZJA 1MH5B 3S6CA 4FFWC 3D2UD 4PRPA 2VL5B 1FC1A 1M7IA 8CGTA 4D8PA 3QIWA 2YD8A 5JA8B 1U8NA 4TNVK 5EIQA 3O2DL 4U4BA 4LEOB 4AENA 3FQXB 2W0LA 2YSSB 2W9EL 2WUBL 4PJHB 1GC1H 1M71B 2ZJSL 2ZUSA 5DVMA 1UT9A 4N0YH 2DM3A 4RBPK 1OHQA 1S5HA 5DYOB 1BOYA 3O2VH 5JW4Q 1I1FA 3HPJA 2OK0L 4UV4H 4JQIH 5B21A 4NQCD 1OW0A 3RI5F 3SDYL 4YFLF 5E56A 2WBJB 1U8JA 4NCDA 2UUDK 3CSPA 2IADB 4OM0L 3UTSB 3KYKL 3N1QC 5FYJL 2EYRB 2H2SD 3QPXL 3W0WB 1QR4A 2YUXA 3EJZC 3QWOB 1JWUB 4JJ5A 1MCBA 2I9LB 1KCSH 1GGTA 2WBWB 5B3JE 4FS0A 1P4BL 3T1FA 3G5YA 5I2IA 2V2XA 4HS3A 3QYCA 4OGAC 1U6AL 3VFUB 5SV3A 4ONGH 4YR6B 3IDJA 2C4XA 3TO4A 1P7HL 2APTA 2F53A 1BD2B 3CXDH 3M07A 4JY4B 3RWIA 2BXYA 1AQKH 3ROOB 4OCSL 2H8PB 2FB4L 2A2QT 4P23A 1SM3L 2F54D 3QNXA 1S7VB 1I9JL 3BP4A 4HIXH 4D3CH 5IBLD 3NZHL 4JO4H 3IU4H 4M61A 3S96B 3STBA 3U6RA 2CRYA 4FABL 1PVHA 4TSBL 2B4CH 4DGIH 4PJFF 2EIBA 4JPVH 2Q1EA 2XTJC 1I8IB 1MJ7H 2FECI 5GS2D 5GISL 3QUKA 3T0AA 3TBVB 4UQ3B 3FO2A 2Y7QA 4HCRA 2HT2D 4KUZH 1SYVB 5DC4B 4Q9QH 4EOWL 4LSVL 4BZ1L 2LTQC 1DVFC 4PREA 4DW2L 4UUJA 2FGWL 1BOGA 3X13A 2AK4B 4PRIB 4PG2C 4JFZH 2FH8A 3ARGA 4L3EB 3ILQC 4PJEA 2ID5A 3G5ZA 3QZWB 3MODH 4JO1H 1S9XA 3UJTL 4M1CC 3PHSA 3FO9B 5E0QA 4YHLL 1K4CB 3MOAL 4WUKH 1Q9KB 2VDLH 3H3PL 1EPFA 3H3BC 4LNRA 4S1SH 5DD0H 3HS0A 4LU5H 1PG7X 3EZJB 5JR1L 3MNWA 4U0RC 5I8CB 4N0UB 2CK0H 5DD3L 1GCFA 1RQ5A 3NN8B 3AVEA 5J0BA 2IBGA 1I7UB 2LTQB 2WUCH 1DVFB 3IF1B 1VACB 4MDIA 4LNVA 1FBIL 1YNLH 4IMLB 5GGSY 5HDLA 3M8OL 3LEYH 4YFEA 4E42B 4YDJA 5F9DC 2F58H 5F1NB 3V0WH 4BH8A 2Y9RT 2GUOB 2D3VA 5J12B 2I60H 1NGQH 3HE6A 5HD8D 2DM7A 2ZUXA 3STLB 3LS5H 7CGTA 1KTKE 2GTWB 2Q6WA 1JGVH 1ZHBA 2WINA 3I9GL 4L4VD 1RK0A 4PUBL 1DR9A 1F4HA 4YPGB 4ZXBD 1CICA 1Z3GH 2BY3A 1BZ9A 5JQ6L 2GY7B 5E5MB 1ZVYA 3EYOA 3B6SA 4JFEA 1G1YA 4Q74A 2VXVL 5C6TH 1V3LA 5JW4N 4QY8A 4ODXB 4NQUA 5I1DB 1XR8B 1MCPL 2EEDA 4E0RA 3MJGX 3PL6D 1VCAA 1HOCA 3U2SA 5DD6B 4Y5XC 3BAEH 5KN5B 1WC7B 1GZQA 3D0LA 4XVTH 4NUJB 4YNYB 3O3AA 4N8VB 1NBYA 5HPMA 3O9WA 2DTMH 3VGHA 3IAQA 3OKOA 4JFOA 1MUJB 4LSTH 5GS1A 1BF8A 1FNSH 3CUPB 3HE7B 3SPVB 1ADQA 4ODWA 1GGUA 4DKFL 4LKCB 2CK2A 2Q20A 2RFXA 3B4NA 5BMFL 4PGJA 5CAYB 1NMAH 4XCCH 1RULL 1I9EA 3QRGL 4U0QB 1OAXH 4AM0B 4P9MH 2GTZA 4JRYA 5ACLA 4KV5F 4WHYG 3RIAF 2GIYA 4Y5XB 4JY5H 1C12A 2XIDA 5J7CC 1NGYB 4J23A 3PHQB 1UZ6F 2XWJA 3MV9D 2IQ9L 1T1XA 4YHOL 5IBLC 3CFKB 1MHHB 3HZMB 1RIVL 4I9WD 4WUUE 3HUJF 3RVVC 4KWUA 1ORSB 1K8IA 2JELH 3QI9D 3BD3A 3QNYA 5I8EA 1CFSB 4HKZB 1JMXA 1DQLH 2BHYA 5E95B 3RHWF 1F3JA 2JF1A 3VD9A 1T1WA 4XXCC 3VG0H 5BRZA 1YYMH 3KPMA 2A9NH 2HT2C 3C2AL 2CLRA 1WZMA 5IVZB 1GRWA 1R3IL 2DRUA 5KS9A 3FCTB 1TETL 1XH3B 3LQZA 5DJ8A 1YMME 1X5IA 4RQQA 3PDGA 4OCWL 4X5XB 4H20H 2XI9A 2ZOKA 1F90H 1TCMA 5DJYA 8FABB 2HT4D 5C0JA 3ULUL 4X6FA 4XCYA 3T0XA 5F3BA 3RKDD 3V2AR 3WJJA 4GRLA 1P5UA 5GQBA 3ARUA 1LO0L 5DMIH 4HPYH 2VXSH 4JFXB 1QNZH 4PJ5E 1NJ9A 5D5MB 5DHVB 3OAYH 1T03L 4PTUA 5GIRA 1BGXH 4KROB 3BEVB 1I8LC 1SEQL 5D7LB 1UGNA 2GK2A 1CYGA 4YXLH 5L7XH 5HD8C 1A1OB 4JKMA 4HGWA 3QAZC 3QNZA 1LD9A 1KJ2H 4ODBD 1OSZB 3MLTA 1RZGB 4UTBL 4LKXB 1OWWA 4K8RH 4DUXA 3TT1L 4OZFH 3WHXB 1ZTXH 3KPSB 5CEZE 2F8OA 5GS0L 3ULSB 5JO5A 3GSUB 5TFSL 1IAIH 2NY5H 1CDIA 2C1OA 5E8OA 3ZE0F 3RY4A 5HDBE 4YDLB 1P7QA 5HGHA 5IVXF 1ROWA 5DA0B 4H26A 1GH7A 3S5LB 1KF9B 4MLSA 5I19L 4TQEL 1WT5C 4P5KA 2IG2H 5DQJB 1OD7A 4XWOC 3TF7C 1SY6A 1FDLH 3OX8B 4JFQB 4LIQE 3HC3L 5GRWA 4JHZA 1YEJL 3FN0H 2VABB 1H9VA 4TUJA 1NBZA 3JWOL 4H88H 3RHWK 1AE6H 2PW2B 3CFIC 3VJ6B 4UT6H 3OKEA 4U2ZA 1TVDA 1G9NL 5B38A 1CDJA 2KQMA 3K8MA 1F00I 1YQVL 4OD2A 4PB0H 2FEDD 1IEAB 3ME0A 3Q6GH 3LOWA 3QXDA 2YPLA 1QQDA 4HMDA 3CMOH 2DM2A 1VEPA 2PTVA 5F88B 4HCRL 2MCPH 2A6KA 5I6XC 3UJJL 3VU2A 1CDUA 1XF4A 3W82A 4JZJA 1QSEB 3BDBA 2X4TA 5FO8A 5ICZB 5HHMB 1IC7L 3QI9C 4M7ZB 1YN6B 3QEGH 5ID1B 3RWJA 2KQNA 4QHLA 5EBMB 1LO3L 2H32A 2ATPA 5I15H 1FGNH 3TYGL 2D7MA 5TJWK 4EBQH 3FB8B 4YPJA 3WFEL 1E4JA 5I6XB 1WZ1L 5HVGB 3DIFB 4NO0A 2DLTA 4X6DE 1MCQA 5I73B 5C0BB 1MQKH 4PJAE 4PJDF 2DI9A 3L3KA 5IT2H 4ZUSB 3MRFA 4PRHE 1KIRB 5IP4A 5ITBH 2HT4C 3QUXA 4HXAL 1PKQB 1S5IL 3TEUA 4QOKD 3EO9H 3RKDC 3NA9L 4BQ9A 3V6OA 3MLPA 4UU9A 4U1NB 5I8KL 1FFPA 1RV6X 4OCXH 2DQEL 1KLGA 4X6CE 3PWNA 4HXBH 5A16A 5GS3A 1QA9B 2HJKA 5FB8B 2VISA 3BYYA 4M7KH 1X5JA 4WI2A 5D2LF 1UXWB 1AO7D 1YZZA 1CIDA 3BP5B 4X5WA 2HJLA 3QO0A 4V2CB 2CUHA 1CIUA 4Y8DC 3OF6A 1CR9L 1DLHA 5FM5O 3MUJA 5A40E 1NLDL 3D87B 1FE8L 5SWQB 4PLJD 2ZUWA 3C6LD 4YDKL 1R5WB 5HI5D 5DMJB 4RMTA 1QACA 1N7MH 3C5SB 3ETBF 1XF2A 1RPQA 5CINL 3WLBA 5C0CB 4XHQA 3KGRA 3TJEL 1XGYL 3P9MB 3L3OB 3QDMA 4MJIB 1ADQL 4KTEH 2PCPA 3CFJA 3U7YL 2CUMA 3G6JA 5LXGL 1MI5E 4MNQE 3SGKC 5IMOB 2I26N 1PG7H 1QRND 4P5TC 4CVXA 3GBMH 1I75A 3FFCD 3T3PE 3T2PA 2YA0A 4V1DD 1FCCA 3FZUC 3IRPX 1RSFA 3ZMRA 3P9LA 2IGFH 4KXZH 2OLDA 1NDGA 2B1HL 4LLMA 3U4EB 2NTFA 4N9GB 4NSKA 3GI9L 4PJXB 4ZSOA 2VDRL 1I9IL 2OJZL 5IQ9A 2B4CC 2HFEA 4G9FA 1QBLL 3NFPB 1C5DA 4P5TB 2P42B 1IGJB 4S1RL 2HLFD 4NCC2 4GMSH 3QEUA 1JNHA 4R8WL 3CX5K 5A2JH 1A7RL 2HJFB 3RY5A 1U8OA 2C5DC 3CLEH 1B0RA 3L3GA 2HWZL 1G1CA 3PWJB 3SJVA 3DBXA 4JM2C 4D94A 4B7LA 3B3IA 3QHZL 4R26L 4I18C 1EFXB 4N5EC 4OCRL 4PRBB 4NZTL 4Q6IC 5HHVH 3TN0C 2D9CA 1UADC 4JVUA 1OOAA 4UINL 1HSBB 1HH6A 4F3FB 5B4MD 1MJJB 3MRQB 4MAYD 5LGKA 4KVNH 3QIBD 4XPAH 1YNTB 1IE5A 2AXFB 5I1EL 2AV1B 1IGFH 3MYZA 3TLRA 2E27H 4GQPH 3OR6B 2XRAH 4G9DB 1OGTA 1RJZA 4YHIB 1JZ8A 4ZFGH 5DK0A 5BCAA 3EDFA 4ORZC 2GSIA 1ZGLP 4JM2B 4GKOA 1VEOA 4WFEE 2IAMC 3QDJA 1GJIA 2P8LB 1FFOB 1QSZA 4Y1AE 5TH2A 4ZTOH 3UO1H 3CPLA 4B50A 4FHBD 3TN0B 2D03H 3P30L 3IFNH 2NY0D 4ZYKB 4Y4KA 2A6IB 4K8RD 3TPUB 4LVNC 1VPOH 1KCUL 4MWFA 4QRQA 5D70L 1U36A 1I3RA 2VR9A 5IM7B 2PKDA 3VFWB 3HG1E 1YN7B 1IM9D 4BFGA 3H8NA 3O2WL 2Y06H 4JFFD 3O6MH 5C0ND 2Z8SA 5DUPH 2IAMB 2DJUA 4XGZB 5E1HB 4ZPTA 5CKGA 5ICYB 4HWUA 3MCKB 4JN2A 1ETZB 1HH9B 2Z35B 4PLJC 3C6LC 3BDXA 3VXSB 4CU8A 1SY6L 1TTUA 4LVNB 5HI5C 3ZKND 5CBEB 3RWHA 5ALCH 1RZJL 4O00A 3S97C 3N85L 5H2BA 3V7AG 4O58L 4P2RD 3GSNB 4UNUA 5EZJB 5D7JA 2EKSB 2R23A 2P8PA 4OT1H 5BVJA 3U36B 4LQ1A 1HNFA 5DD1L 1NANH 1RIHL 3L3JA 5CILL 5EC1B 4X8JB 3CFDB 4LSRH 4P59L 2CKBB 1DZBA 2R1YB 2CDFB 5CEZD 3HLAB 4NNYB 4JHBA 2X5PA 4OZHE 4QRTA 3T8XB 5K59E 5HHQB 3TH2T 1RUKL 2VSCA 5DHYA 3MOBH 4MHHG 4IEFB 5BOPA 3I02B 9CGTA 1A14L 3F58L 2RJMA 1NLBH 1SJHA 2AI0L 2GJZA 5IKCB 4I13B 3WJLC 4TSAH 5ESAB 2ITDA 4HH8A 4LCIH 2Y25A 2NY3D 3MNZB 3FO1A 2Z93A 3MV7A 5F96L 4Z78A 3O11A 5KSBF 5ILTH 1NGWB 3BEWB 4XRCB 2FCBA 1SJXA 1DSFL 1HDMA 1ZLSH 3GHBH 3G08B 2X4NB 1MREH 4HUWB 5DRWB 4YX2L 1EV2E 2I9TB 3WS3A 4A6YB 4BQ8A 3BO8A 3VFPA 3ZT6A 3JWDH 1J0YA 4X4YA 4RZCB 2OZ4H 4HIEA 5BOZG 4X4ME 3WIHA 4Y4FB 2AJVH 3QIBC 2B1AH 2EE2A 4Y16B 4K3GA 1BZ7A 3OKNB 4ELKA 3TVMA 5I1AA 3KXFA 3M17A 2FLBT 5CGYC 4JO3H 4FMKA 2R0ZL 3TV3H 4QWWD 3ZE2F 1A7OL 4PGCA 4Y88A 1Q94A 4S1QL 1V3MA 2OQJA 3OSKA 4R7DB 5D96C 1KJ3L 4BA8A 3KYMA 3F6LA 3O2DH 3LN5B 2MFNA 1F4WL 2R4RH 4LEXH 3QXTA 4Z0XB 2W9EH 2NY4D 1G7MB 4OI9A 2ZCKH 1I9RL 2PYED 2A74A 1OM3H 5HHXL 4ODHL 4WTXA 2UVFA 4CVZA 3GHEL 2VSDA 4CMHC 4N0FB 3U7AA 4EZMA 1HEZB 1M7DB 4ZNCD 1AGFB 4PJIE 2NY5C 1AC0A 3ZKMD 3SDCA 3BHBA 5C0NC 3SDYH 5H94B 1BQHA 5J6GA 1F42A 3VFGH 3MQIA 3I6LD 2IALB 2D31B 3LN9A 4HBQA 4PRHD 3VFSB 1RK1B 5C07A 1DBAL 3F12B 5EA0L 4NKIH 4O02H 4OFIA 5FYJH 4L9LB 5DGQA 1CG9A 1N64L 3ZKNC 4EQ3A 2PW1B 4CMHB 4PD4J 4M3JA 1X5ZA 4WCYL 5HGDA 1VADA 3QFJD 4HK3J 4XPBH 3E6HA 5C0DA 2HTKC 4ZQKA 4MQTB 1KPRB 2V9TA 2JCCE 1YMMB 3IETA 4EUPH 4NYLA 5IR1A 1X44A 4LVEA 1Z6JT 2MPAL 2R1XA 1MCJA 1YNKL 2BRRL 3QFDB 1CD1B 2AGJH 1RVFH 3ELAT 2KUTA 4PYHA 2DMCA 1UACL 2B8OT 2XV6B 1A5FL 4XB7A 4F7CA 1MHPL 2VLKA 4W4OC 1AP2B 2FB4H 5EU6A 5EPMA 4LAQH 1G7JB 3INUL 2YZ8A 4PJ5B 1IGTB 4U1LB 2Y4SA 3SKMB 1MAJA 3MXWL 1UG9A 5E99H 5CS7A 3NZHH 5DEFA 2ESVD 4KZDL 5CEYA 1DQTA 4WNQA 5EUKB 1T83C 3DV4A 4MNQD 2NY3C 1EHNA 1GIGL 4EXPX 3QIUA 2HA1A 1JNNL 1R3LB 4X7CC 3AROA 4TPRL 4BSVB 2Z92A 2NX5A 5DD5L 4G5ZL 4KKCC 4WIQA 3T77B 4UOW1 3TCXA 5DTFA 1SQ2N 4DCQA 3FT3B 4HK0B 5A2KH 4HDIB 3QH3B 1NEZB 1WWCA 4QKXB 4PP1D 4HS6B 3RNKA 1UB6A 2EKJA 3IJYA 4TSCH 1I7RA 2LV4A 5I71B 3UTTD 4HQQL 2WLZA 4P2YA 4YH6A 1OAQH 1WEJL 3QUMB 5IB1A 3GSOB 2BMKA 4GW5A 1ITCA 2Y1VA 4LCCB 3H3PH 4JREC 5CJOL 4ZAKC 2PO6A 1DQMH 2D4FA 3SE3A 5JR1H 3VGFA 4I77H 4L4TE 4MA3B 3OPZH 1A6ZB 5GPRA 4QWWC 4QNPE 5IROA 5D7KE 4QO1A 5DMGD 1WAAF 1Z2KA 4ELMA 1JGLL 1F4YL 1LP9E 3VXRA 1U2CA 2PXYB 1BM3L 1S78D 1N3NA 4MSWA 3JTSB 1FPTH 2NY4C 4DVRH 4HC1A 5C0IB 3MYJA 4DWHA 2G60L 4ZAKB 3C6SA 4I0PD 5GGQH 5INDB 3S35X 1UENA 1P2CB 4QTHB 3MBXH 3DSFL 2OTUB 3HMWL 4YBHA 5MHSE 1JRHL 1CBVL 1KENH 3UAJD 1AI1L 3BIKA 4L8SA 2W0PA 4WFED 4X4XB 5T3XH 5I8OH 5L88L 5IJVB 4AT6A 4O4YH 4NGHH 3RAJL 4AMKH 2HFFA 3DV6A 4Z7UA 1H8SA 1MF2L 3DRQB 2ATKB 5IHLB 3VXPA 5I1KH 4G80B 3PQYB 2DQJH 5DJ0B 4G7VL 1VKXB 2H3NB 3HG1D 4IMKC 3V52H 1DN0B 4P9HL 1CDBA 4F9LA 5CMAA 3GFUA 5DHVH 1PBYA 3M1BB 1ZHKB 2FYYB 1NL0L 4DKFH 5TF1H 3MBEA 4NKMB 4JR9H 3VD4A 4MJ5A 5F71A 5E8DH 3REVA 1G7HA 3GB7B 1RULH 4NO5B 1WCBA 3ULUE 1OD9A 4ZD3H 3MLRL 5B39A 2BSTB 4LPTA 3UTOA 4GKSA 1U8MB 3P11L 4YIQB 3MA9L 1EEYA 3DROB 3L5HA 4RAVB 1IFHL 4YHOH 5DJXB 3QO1A 4LCYA 4PJ7A 3HZKB 4I1NB 1SVZA 4YFDB 5DRZA 3RZCA 2Z31C 4DK3A 4GFTB 3HAEB 3MROB 3VWJD 1LVEA 1NAMA 3FTGA 5DVKA 3GMRB 4UDTA 4HFWB 3WIHL 1AD0A 1UWGL 2A0LC 1RZFH 3UBXA 1MFEL 4OB5L 1QFUL 4QHNA 4Z95L 3HI1A 4YHMH 3MLXL 5EO0A 1Q72L 2HVJA 3LQMA 1ZEAL 4PP1C 1R3IH 3P73A 3PV6A 3TC9A 3VXUD 1NH6A 3GSQB 2Z31B 1DEEA 1TCRB 4WDIB 5ALBH 3PGDA 1MI5B 4G6KL 2F8XC 3SDDC 5SX4I 1RIUH 4LLVB 4OAWA 3BKYL 2UYLB 4N68A 1X7QA 4PJ8D 3NGBC 3D25B 3O6FB 3CDCA 2X70B 1WK0A 3IFLH 3QULB 2YR3A 1HYSD 3MCLH 4X5LA 1D5BA 3BN9D 4PP2B 4HKJB 2EICA 3KDMB 1S78C 4J2XA 4RISL 4L8DA 3RPKA 2NR6C 4JJHA 5DS8A 3JTTA 1A1NB 4U1SA 5GGVL 3SDDB 3NCJL 2WW8A 5FYJD 1G7IA 5F9JA 3IVKA 1NFKA 5HGGS 1Q9WB 2D0FA 1IQWL 3TT1H 4XNZB 4HD9A 1RZIB 2BJMH 4KDVA 1NGXA 2HRPH 1VB9A 4J4PD 2IANB 5HPOA 5AZEH 1TJIL 4F7MB 1BVZA 1J8KA 4HUUB 4EN3A 3Q0HA 4QF1A 4ODTH 3N1PC 3G6DL 2G9HA 4UIKL 1EMTH 3FQRA 4YXKH 5I1HH 5HHNA 3I2CH 5HXMA 4JDTL 4N0CC 3WFHB 5C09B 2XZQL 3KNBA 5FGCE 3DO7B 3J8F7 1HHIB 1S7RA 1I1YA 3BVNB 4FFYL 2DBLH 4XWGL 3SKJL 4Y5YC 4HF5L 5E03A 3FL7A 3E6FA 4KUCD 4PJFA 2K7QA 4W70A 1RJYA 2ITCB 1LO5B 3FB6A 3WSQL 4Y1AB 5J06A 3KPRA 1BEYH 1U3HD 1G9NH 3FQWB 1QPPA 4HUXA 2F19H 3LZFL 3S37X 1CFQA 1MCOL 3KYOA 3NA4A 1BBDL 3UC0L 1FAKT 1LDSA 1FG2B 1NBVL 2WWKO 1O7SA 2VLJA 3D39D 4Y5YB 4BH7B 2EE6A 2YN5A 4OLVH 1DBMH 1RZ8B 5E2WH 1AHWC 3ZSTA 2QR0A 4XTRD 3MLSL 2W9LA 2H26A 4KK5D 5E7FA 3KPPA 4LLAA 5ENWB 1LEKA 3VWJC 1KCRL 4P2QA 5SWZD 1N5YL 3O3DA 3MUHL 4JFEE 1X5GA 1EEZA 1E4KC 1JGUH 1LO3H 2FX9H 3NH7L 3AXLA 5EN2B 1ES0B 4XMLL 1MFCL 4M48H 1U93B 2VLLA 5AUMB 1XF1A 1OSPH 3KPLB 4Y4HA 3SCMB 5DJ6B 1WZLA 3F65A 1I85C 5IFAH 2DQHL 2DQUH 4IRSA 4NO3B 3LEXB 1HHHA 3MRRA 3GMOA 1FJ1A 2VKXA 4HXAH 3O4LA 1S5IH 1T0MA 4PJ8C 5IBUB 2AABL 4YEFA 3BE1L 2X4SA 2I07B 4XPFL 5EOCL 3ARBB 4JRYE 5FUCE 2CQVA 2UZYB 3LRSB 5ECJE 1HYSC 1IL1B 4QT5B 2UV3A 5F1IA 4G6AD 1T21B 4E9LA 4Q9RH 2X41A 3G5XB 4HWBA 3GKZA 5T3XD 2HRLA 3RX7A 1JYXA 1KGCD 1MCIA 1NLDH 1UZ8B 3OAYK 1FE8H 4MX7A 1HKLH 4KHXH 4YDKH 1TPXC 4NFCA 4G6MH 2CLVA 5LCVL 4J4PC 4L4TD 3EDKA 5M7QA 4NN7B 1K4DA 5GGRA 1UM5L 4MS8D 3FRUB 5ERWA 5D7KD 2PTUA 5C0AE 1AKJB 2ICWB 4JDZA 2R4SH 4KJYA 5KS9E 1XGYH 2HKFH 3STZB 3CXHJ 2D7NA 4K71C 1ZA3B 2D7TL 2AKRA 4S2SB 4WI9A 1WFTA 3RWCB 3C9NB 2R29H 3OR7B 3TA3A 1JN6B 4P5MA 4XMPL 5H37H 5FK9B 2GCYB 5FF6B 1F58H 1TQBC 1NEUA 4L29A 3VXTB 5D6DC 1FVDA 3HUJA 2ZZUT 1KB5H 1A0QH 3VMPA 1GGIH 4OLXL 4WEMB 2ADGB 1XF5A 3MV8A 3GMMB 2Q76B 5JA9A 4LLYA 3MLYL 1S7SB 1N2RB 3GI9H 5E8PB 3WHE0 3GSRA 4K71B 3RNQB 1SVCP 2IC2A 2BSSB 2FR4B 1EVUA 4HW6A 1NAML 4BKLA 3OKMB 5IEHA 2FIKB 5DVOA 4C56A 1OTUC 4GBXD 4RGOL 3EYSL 3S35H 4XPHH 5FECA 5LKNA 2VITB 4YZFE 4M8QB 3LQAH 4AG4H 1UCTA 5JIHA 5K9OA 3CDFA 3EFDH 3NCFB 5I66B 5CHNA 3IDGA 1JVKA 5F7EL 1EO8H 4XTRC 2YD7A 4QGYA 5E8NA 4W68A 4PRPD 3L5XH 3VCLA 1K6QL 4KK5C 3FFDA 2QADD 4XNXL 5HHOA 3QIWD 4XVJL 3LB6D 2HFTA 3K3QA 1LDPL 3I75B 5D1ZC 4HWNA 2NY6B 5I1JL 4NZTH 2VZVA 3UTPE 5T3ZE 1FRGL 1BQLL 2BOCA 3MRKA 4P48A 4UINH 1VGKA 3ULUD 4AEHL 1SMOA 4M93C 2V5MA 4LLDB 3GIVB 2JCCB 5I1GH 1N59B 4HJJL 1NMCB 4MJ6B 4R4ND 3BZEA 4QXGL 1YEDA 5C2BL 5D1ZB 3TT3L 2J6EH 1DUYB 1OAUH 3FT2B 5FA3A 2XXMB 4KRPC 3GBLA 1L9MA 1B2WL 5JHLH 2XA8H 1UH4A 1KG0B 1Y6NR 1ZXQA 4XMKL 1OB1A 2HG5A 4LSQH 2YPLE 3QUYA 3AM8C 4YHNB 3C5ZA 3QUZC 4ODUA 4XCEB 5IVXA 5C9JB 5JOFB 3P40A 3NFNB 2IWGA 5GS0D 4W6WB 2B20A 1ZHNA 4JANA 1KNOB 4U1JB 5DFWH 5IB4A 3U4BL 2BCKA 3SDXF 3MGOA 1T7VA 5T1LB 1KCKA 3W2DL 3GGWB 4X8XA 1UH2A 1P9MA 2F74B 3FT4A 1MFAH 3HI5H 2C3WA 3I50L 3TO4D 3CCHA 4IHOA 4HZAA 4KRPB 5FOBB 4P99A 1CI5A 2F53D 3VXOB 1R3KB 4FQLH 1KB9J 2OX5A 3MRHB 2C26A 1JPGB 1MAML 3QUZB 1QSFE 3VFRA 4L8CA 3H9SA 1A4KB 1F45A 5HYEA 2AEPH 1YEKL 5AZ2H 1WV7T 4ESKA 4LCWA 5IIEA 3BGMA 3TPKA 5BJTA 2IFFL 3FQNA 4WO4A 4HJGB 3CSGA 2RQ8A 3DHJA 2VZUA 5ID0A 3ARFA 4NWUL 4NWTH 4MA8L 5DD1H 2R2EA 3F7VB 4L8BA 5GGUB 2ZUTA 4P4RA 1PX4A 4CU7A 5I18L 3LV3B 4ZS6D 3TYFA 1MNUH 3V6OE 1FVCB 4UDUA 1NC4A 2FBJL 4YGAB 5FEBA 5IHUL 2EH7H 2AS5M 4FQ2L 5GJTL 4G6JH 2MNUA 5BZDB 5JHDD 4TVPL 1LP9B 1NMBH 1FFNA 3GMLB 3F5WB 2AI0H 5KSUB 1J8HE 2FSEA 3ARGD 1JYNA 1FZKB 1SJEA 1F3DJ 3V5KB 3T4YB 1YY9C 4L9DA 1FLTX 4F7PB 4GBXC 4AH2B 2H32H 5DMKB 3V5DA 3KAAA 1KLFA 3EFFB 4XNYH 4PJDA 5BZWA 5JUEL 1M05A 2NNAA 4KZEL 4K23L 1ORQA 4NHUB 4OZIF 3VFVB 2P5EB 1DSFH 1FIEA 3WFZA 5IBUG 4GAGL 3RU8L 1YEEH 3ZYOA 2CMRL 3PUCA 3IKCA 3QDME 3EYFB 4J1UB 4PTTB 5HYQB 1CGSL 1T04A 5TGBB 3T65A 3QQ3A 5BV7B 4FXKB 3ROLB 1P4LA 2LQRA 4LLQA 5L9DL 4PJHF 4HIHB 3HE6D 2HFGH 2OS7A 5E6ZA 3ULUC 4QRPA 5K9KA 1NCTA 1EIBA 4GRMB 4S1DC 5D2LA 1EA9C 4BSJA 4J12A 3VFMA 5B8CA 2V17L 3GJFB 3K7UA 3LH2L 3K1KC 5DJZB 5IEKB 1T7ZA 3MO1A 1OW0C 2R0ZH 5HDQH 1ZT4B 1ZLWH 1A7OH 1CXFA 2JB5L 2QSVA 1U8NB 3WDIA 2FJGB 4S1QH 3G9VA 3VWKA 4ZSOE 4WY7H 4CW1A 4OKVB 1KBGL 3S37H 1KJ3H 2DDQL 1U92A 2NZIA 2X42A 4H25B 4LHUB 3GBNL 3VH8G 3X11A 4HAGA 4OIIH 4H1LG 2YBRA 2VN7A 2ZP0T 2LAAA 3HNSH 3MRNA 2IBZY 3LIZH 4APQB 1F5WA 1L4IA 4ODHH 3W5NA 4LRIA 5GS0C 1IGML 1U8HA 1W0VB 2D9QB 1FNEA 2AXGB 3S9DB 1T20B 1F97A 3O9WD 1U8JB 3MRCA 4IDJH 1N6QL 1S9VA 4HUNB 5CZVL 3W9DB 3TO4C 2EDDA 3QUMH 2DQGL 3FB7B 2QLVB 4LAJH 4M43L 2R56H 4HPOL 3MR9A 3OHXB 4BQCA 3TJHD 3S34L 2DL9A 3B9KD 4JJ5B 4P23C 5DJDA 1IAMA 5FDWA 1HZHL 3G5YB 2W38A 1KIUA 3JWOC 1GYAA 2K7PA 4HAFA 1F6FB 4MCZA 4HS3B 4RX4A 3CFEB 1CFVL 4ZODA 1MCLA 4K7PL 1QFWL 3IDJB 1D6EA 1G9NC 2VH5L 4V2BA 4NQXA 4XAKE 1U41A 3U9UA 1MWAH 5GGTH 1CFNA 2OTPA 1MPAL 5LGHH 4GXVH 4JZOA 4WHTA 4XPTL 3UPAA 2XFXB 1A9BB 5JW5A 1I7TB 2AJUL 5JDJA 3MXVL 1AXTH 1DL7L 5BRZD 4P23B 1MHPH 3RTQA 4DN4H 5CIPH 3DX9A 3QNXB 4K07A 4K3EL 1W0WA 4XNQA 4NJAL 5F3HA 3OAUL 4YXHL 1PW3A 4TTDC 3ARGC 4MLIA 4KQ4H 1UCBL 2DLEA 1KJVB 3ALXA 1Z9LA 1AY1H 2BHUA 1LHZA 5DEGB 5HJ3B 3L9RB 3PJSB 4DEPB 2ARJA 3SGJA 4JDVA 1HQRA 1B6DA 5GRJL 4XH2B 3CU7A 4O9HH 1BLNB 4L1HA 4U1GB 5DD5H 4G5ZH 4WTWA 4G8IB 5DJ2B 4O51A 4UUJB 2FX7L 4MXVF 4XCFL 3X13B 4DGVL 1I4FB 3CD4A 1JF5A 3MRDB 2J8UF 2HN7A 5F21B 5HI3D 3G5ZB 2L7JA 1JYWA 1S9XB 1BWWA 3O3BA 3WE6B 4Y7MA 3MFFA 1PD6A 3LKQB 4F9PA 2WQRA 2G5RA 3V4VH 1LK3H 4LNRB 4UNVA 1E6OL 3HS0B 2CLZA 4ZUWA 3MNWB 3W5MA 3K4DA 3CAFA 2H6PA 4GW4B 4JN1H 4FZ8L 2YS4A 1E4XL 4GXUM 3VXQB 4CAGA 4KUCF 1JL8A 3MSPA 5E08H 1YJDL 3UBXI 4RWYL 1CICC 5AD0B 3IDMA 4E41E 1JGLH 1S8DA 4DN3H 3N9GH 4NO2B 3BPLC 1JPSL 4YDJB 1P7QD 4JFDB 5EIIB 3K2UL 1BM3H 3HAEH 1BJMA 2YRLA 4YHKL 3OXRB 2V7NA 1KIQB 2L0DA 2BVUA 4OTXL 3ULVH 2VQTA 1CK0H 3MV7E 5JLZB 1PFCA 3HCVB 2YA2A 4F7EA 4ONFH 1Z9MA 4NUGL 5I9QC 3UXFA 1BJ1J 4XVSL 1YC7A 1CICB 4ZFFA 4YFLI 5GS1C 2R69L 4JKWA 4B53A 4HWEH 4NBZB 3SKOB 3VDBA 2AJSL 1RU9L 3EYOB 2G5BA 3T4AA 4JFEB 2HTLD 3EOBB 3L3IB 1U3YA 1KPUB 4DFHA 4QY8B 5ITFB 4WRLA 3TJHC 4X99A 2FZ3B 4E0RB 4XP5L 2CDGA 5GSVB 2AJZA 5FUCC 2A83A 2QQKH 1FH5L 5TE7L 3D0LB 5MERA 1G7QA 5I9QB 1LGVA 2X4RA 3O3AB 1ZAGA 5HPMB 2BOBA 5HBBA 2P47B 5CJQH 5DRNB 3OKOB 2NTSP 1MRFH 4P9HH 1C5CL 2HVKB 1QLEL 2K1MA 3OV6A 4ODWB 4WU5B 1JJUA 5ELIA 2P45B 3HC0B 1J5OL 4ZS7H 5KSBA 4IS6A 4LOUD 4ZXBA 1E4WH 4G42A 1I3VA 5E6ID 2GTZB 4JRYB 4MNHA 3UTZB 1BAFH 4P3CH 5MEPB 1P4IH 4X0KA 4FP8L 4JRXB 1MJ8L 4WTZG 2EDFA 1KXQE 1T1XB 1T2QL 1KEMH 3P11H 3MNVB 3FQUA 4NO0D 5EUOF 1YUHB 2NY2D 2H9GB 4FFZH 1J87A 1F8TL 4PRNA 2NLJB 3NIGF 1DQDL 4ZO6A 5IW1B 4NQDA 2X09A 2DBJA 2X4PA 3QUXD 5C07E 1RZ7L 4L3AA 3HB3C 5C7XL 2R2CA 3WIHH 2VQ1B 1UWGH 4OZ4A 4NNXB 4OF8A 4F37F 1MFEH 2EDYA 3WJJC 1QFUH 4GRLC 3K2MC 5EU4A 1S7UB 4PLKD 4KHTL 4WFGD 3MLXH 5C0AB 3PABA 1ND0B 3DMMA 2P1YA 3ECBA 1ZVSA 1JK8A 4EIGB 5KS9B 2FH6A 5CWSB 1U8KB 2DLHA 5HI3C 3I6GA 1Z0NA 1NGZB 2A73A 2E7CA 4WI5A 4F58L 3OF6D 3ES6A 4M4RA 2OM5A 5TDNB 1N8ZA 3MV9A 4JB9L 2R8SH 1OAYL 5AWNL 2V2WA 15C8H 5J9PA 1NUDA 2XN9D 4RFOL 3BKYH 4D9RD 3EOYG 2ICES 5F3BB 2WSKA 4GRLB 2ICWJ 4WFFE 2VLKE 3D0VA 4RRPA 5EU6E 3CDGA 3DXAB 5EU5B 1KXTB 3NPSB 3QG6A 4Z7OE 1QLFB 5TE6L 3D9AL 5D7SL 3FB5B 4PTUB 5IB2A 1A3QA 1D6VH 4LVOC 4YHYB 4EI6A 3I3DA 1CLZL 1CGUA 3P0VL 1XR9A 3HR5A 2CSPA 3VFOA 5MEOB 4Y8AA 3QBTB 5KVDL 2PETA 1IQWH 3S36X 4EI5C 2IH3B 1CL7L 5F1SA 4J8RB 1RZJC 4RFEA 2NX5E 5JO5B 4U6YB 2KKQA 1RHFA 5E8OB 2Y23A 1JCKA 4PGZA 3SOBH 3HZYA 3MMEA 4NC2B 5HGHB 2XY1A 3AMLA 3HZVB 4H26B 4QLRA 5GSRA 3CC5A 4IM8A 4KKNA 1DDHB 4JPIA 1Z5LB 2VAJA 2OI9C 5CP7A 4G9FD 3ZDXE 1AGEB 4IRJA 4UBDC 4ZO9A 5JXED 3PP4H 3G04A 4FFVC 4F33B 4EI5B 3PE9A 4POZD 2E7BA 4QXTA 4ISVB 4MD5B 4AIZA 4Y19D 4FFYH 3FAXA 1KV3A 1SBBA 4NHCH 1NBZB 1AIFA 3HMXH 5JOEA 4HF5H 4JZJC 3QJFB 5F6IB 2SEBA 5IFJB 5HYSA 4KKAD 4ELME 2GJJA 1YY8A 3SJVD 5EU7C 1GPOL 3VXRE 3ZT5A 2OMNA 5MI0B 1KELL 1QFPA 4JLRA 3SQBA 2E8YA 2A77L 4LQFH 5FCUL 3CGTA 5DUMH 1WBXB 4PJ9D 1V7MH 5EO1B 1MHCA 2YPLB 3QXDB 4JHAH 4NQEB 1J05A 4P2OA 4MXWL 2IPKA 1C16B 4OGZA 1QPXA 4LHJB 4ZOAA 3SE9H 2ICEA 2W9DL 5BS0D 5GHWH 3BH9B 2NXYB 2BVEA 2GY5A 4KTDL 5FO8B 4AIXA 4O2FB 1B4RA 2VLRB 5T1KB 25C8H 4HS8L 1A7NL 2HT3D 3QDJD 1OY3B 3GK8H 5ACZA 2ADJB 3KPNA 3QJHB 4HV8B 1WZKA 3GNML 4Z0BL 5D93B 5LBSL 1N5YH 1S7TB 3RGVC 2YMXL 4QXUH 2ATPB 4Z7UE 5IB5A 4U1IA 4C83A 2E7LA 1WAAA 3NH7H 2GJ6E 3V6OC 2P5WE 1QFWI 1QSFB 1MRCL 5I30H 1YECL 4OD1H 5E6YA 4UV7L 1S7XB 2ADFH 3L3KB 1U8LA 5L2KA 3IYLW 3PF2A 1G84A 3RGVB 2QJDA 2ORBL 4HC1H 2OL3B 1EAPB 3IDNA 3ULVD 3KR3L 4UU9B 5J1SC 3H7BB 3HFMH 4MDJB 1FFPB 2P7TB 1KLGB 5A16B 4CJ1A 5IV2A 4D0BB 4EXKA 2VISB 5D7JD 4UB0H 4WV1C 4U31A 1J8HB 1T5XA 3QO0B 5MEND 4PJ7E 5MP6L 2A1WL 3MRMB 3OG4B 4PGEA 3DHMA 2UUDH 1HXMB 3P4NB 3WEXB 5F7MC 2P24A 4JZNB 3OAZH 2DIBA 4LPCA 4N1EA 3GDBA 4WWID 1FIGL 1QOKA 43C9B 3RZWA 3WUWB 3PWUA 5D8JL 3SKNB 1JPFB 1VENA 4QOKA 1LO2L 4Z5RA 4WV1B 4PJXF 3QDMB 5JPMB 1DQJA 2NZ9D 7FABH 1VFBB 3VGBA 1EHLL 5FYKL 1ACYL 4DTGL 5DUBB 2JIXA 1AO7A 5SWSB 1TXKA 4POZC 1OP5H 3MRGA 5EFIA 2AJ3B 1A6AA 2HKHL 4HGMA 5L2JA 4YK4C 4OFVA 2CKNA 2EIZA 4ORGA 5EZLA 5JW3L 4KKAC 4ZSOB 5GZOD 4MQ7A 5F1KC 5IQ9B 2HFEB 2JK5B 3U0PA 3O6LH 5IFHL 4PY7A 4YHPB 4JFYA 5C92A 5HSFA 4X9HA 3W39B 3QEUB 5E2VL 4GS7C 5GGVY 5GRXG 5D1XA 2NY7L 3TVMD 2XKNA 3KXFD 3WXVH 4LPVA 3X12B 1IGIH 1QRNA 3KJ4C 3FFCA 1TZIA 1DN2A 1H3VA 3G5VA 1KJMB 1HHGA 1TZGH 3MRIA 4U7SA 5GRUH 3ARDB 1DTUA 4H5SB 4Y4KC 4LARH 1HH6B 1FRGH 1HQ4B 2BNRB 1IAKA 3CSYB 4ONHA 5FA4A 5ISZE 3NOIA 1OGTB 3TCLB 1RJZB 3KJ4B 4HJJH 5D72L 2Y5TB 5DK0B 3SDCD 3OKKB 3QEQA 4OF3A 4S0SD 4PJFE 1HXYA 2BVYA 2X4UA 5C2BH 1R24A 3KPRE 2OMBA 4UAOC 3CIQA 2ZOLA 5DC9B 1JZ5A 12E8H 4LBEA 4G6FB 3MGTA 4KY1L 4WW1B 1C7SA 4ERSH 5IW6A 1I3RB 4M7JH 4GUPA 4X6EB 4MD0A 2CIIB 5D7JC 2BP3A 3T0DA 4NRYB 4BSWA 1GC1L 4MAYA 3V5HB 4N0YL 4WU7B 2J3SA 3O3EB 5TDPA 5EOTB 3V8OA 3RDTA 3O2VL 3WO3B 3W11D 4UV4L 3RL2A 5BV7H 4UAOB 2G75A 1XIWB 3I50H 3LKNA 4OQ1A 4XBPB 1JWSB 1L7TH 1NUGA 5AEAA 1H3GA 2VDPL 3RWHB 4WVRA 1MAMH 5B38G 5J8OA 2NY1D 5LAXB 5EU6D 5DA4A 2ENYA 2WZPD 4TVSa 1KJ2A 2C1PA 3BUYB 1PYWB 4P9HC 4LSSH 4OZFA 3LHPH 4Q97A 1EJ6A 4G43A 1AR1D 1JWMB 1KCSL 1IM9A 4U1KA 2VXTH 4JFFA 4NT6B 4Z7WF 2NW2B 3O4LE 2PTTB 4AEEA 1YC8A 5I18H 3BYTA 1JUFA 5IHUH 3X3GH 2KL6A 4RIRB 4N0RA 4E41B 4RAUB 1U8PB 4TVPH 1SJHB 3SE4A 1AQKL 1CDHA 3VA2C 1FYTD 4LGPB 1FLRH 5LG1A 2ZUYA 1CL7I 2Y6SC 4NBYB 2GITA 1NDMB 2XACC 1TZHB 5AAMA 4Y2DB 4HIXL 5FKPA 2Z93B 1CZ8H 4LFHD 3S36H 4JO4L 1NC2B 3IU4L 4BQBA 3ZTJG 3ZSSA 1MY5A 5F9AC 2DD8H 4XP4H 4I3SH 4KJWD 3TVMC 4CN6A 5INCA 4R4BA 4RFNC 4F7TB 3TIEB 4PB9H 4YAQA 4KZEH 3PWPE 4JPVL 1MJ7L 1ZGLA 5T33H 2EYSA 3VXRD 2DMKA 2FWOB 3DI2B 4KUZL 4KV5E 2APFA 4MA7H 1M6OB 4LLUA 4YBQD 1UZ6E 3DJ9A 2RB8A 3H9HA 4XCNB 1PSKH 5I1AB 4Z18A 3L7FA 3HUJE 1H5BA 2IFGA 4HSQA 2V17H 4FQIH 3SDCC 3LH2H 4WUKL 1CXHA 3P9WB 2VDLL 5DD0L 4S1SL 5T1MA 4LU5L 3MV8E 2JB5H 1RUPH 2CK0L 4HWBH 2LABA 5C08D 3KLHD 1AXIB 1XGQB 2OR7A 2W0KA 2WUCL 4QHUA 1T66C 2NY6D 3QEHA 1V3KA 4CMMB 4HZLB 4KPHL 3LEYL 2J88H 4I4WA 3V0WL 3P4MA 3HNVH 1NGQL 5BXFA 4PJBA 1UXSA 3CFCH 4ETYA 1YDPA 2AJYL 3BHBB 1WJ3A 2WWKT 1NPUA 3LS5L 1AGDA 3IJHA 5F7NC 3NCYS 1BQHB 1JGVL 3IRZA 3BKMH 1AD9A 3DVNA 5KG9A 4TUKH 3W11C 5C8JB 2GQHA 1TTGA 1D5ZA 2Q7NA 5CZVH 3NZ8A 3AS3A 5C07B 1DLFH 3TBWB 5F7UA 5F9WC 1LK2A 1GZPB 3H0TA 4HT1H 1Z3GL 4WWKD 5EBWB 4HPOH 1YEHH 5H35A 4OSUH 2NY1C 5DJCA 1XZ0B 3E6HB 2YEZA 3SGEH 4ZQKB 1FZJB 1RHHA 1OTTC 2V6HA 2VDML 1CFVH 3BAEL 2R1XB 1AR1C 3RZCD 4XVTL 2YN3A 3WKNA 2DYPB 1X5YA 1VFMA 2VH5H 3DTXA 4HWZB 5F9WB 2MCG1 3QIUC 3PV7A 4LSTL 4HUVA 1FNSL 1T7WA 4P46B 4FQQA 1N6UA 3GKWH 2VLKB 2ZCLH 2AJUH 3ZE0E 2QQQA 3N0PB 2EECA 5IVXE 4OBSA 1NMAL 3F7YA 4Q2ZA 5HDBF 2E6JA 1OAXL 1CD0A 1TNMA 2XQBH 1FQ9C 5DEFB 2V9RA 3TBSB 3WFBH 4JY5L 4BFIA 4FNLH 5CEYB 4RAHA 3G6JF 1UCBH 3BWUC 3O8XA 3PGCA 1P7KB 1TJGH 5J1AA 1CT8A 3SO3C 2PO6C 2W07A 3SE3C 2NX5B 1EDQA 2JELL 1T89A 4R2GC 3MA7A 1QLRB 4K94C 3H9SE 4DCQB 2VDKH 5IROC 3U0WL 1DQLL 2WWMC 3AS2A 4KGLA 2FX7H 3VG0L 2DB8A 4DGVH 4HIIB 1YYML 4LCWE 1FO0A 1I7RB 3VXMA 2A9NL 4PRAA 5DVLA 4HMEA 4GW5B 1CLOH 3W9EA 3PP3K 2JTDA 3DX8B 2ESVA 3SO3B 5HHPA 2PO6B 3LDBC 4M02A 4QRUB 3SDXA 4H20L 1EHAA 4YE4H 4R2GB 1FCGA 4IRZL 2GFBA 4LASH 4KU1A 4ELMB 3TH3T 1X4YA 1YJDH 3O81A 4L8SC 3RPIA 5E5RB 2HLAB 2W60A 5DQ9B 3UROR 3QRFM 3KLHC 3MOQA 1A3RL 2R1WA 1KB9K 1WBYB 4OLZH 3D3VE 5DMIL 4HPYL 5L6YH 3MYJB 2F5AH 1D7FA 1KN4H 1QNZL 1BGXL 4RMWA 3EYVB 3UTTA 5L7XL 4YXLL 2OTWB 4CJ0A 5I76B 4PJDE 4NUGH 1BFTA 1KJ2L 3DVGA 2EXYC 2QHLA 4YO0A 3W81A 4K8RL 4F9LC 4L8SB 3GJEB 3OKLA 4M6NH 1BVLA 3P0GB 1ZTXL 1XGTA 43CAA 3MBEC 1Q9OB 3KPRD 1SMAA 4RDQF 3DV6B 4Z7UB 1IAIL 3Q5TA 2UZXB 4WW2C 4QCIB 3DECA 4TNWF 2GJ6B 3GEWB 2P5WB 3U0TA 4QRPE 1JZ3A 4WFHE 3S7GA 4PV9A 4ZOEA 5D2LE 5F7YC 5IOPB 1OP9A 2VLJD 1E0OB 1MCDA 3V6FA 3GIZH 2VJXA 4GLRI 4TVPD 2IG2L 4I0PA 1FDLL 4QRRA 1QLEH 3RZCC 5GRYA 4LSPH 3MBEB 1T22B 1V05A 3FN0L 4P2QD 3IS0X 4WW2B 4MJ5B 1WUNT 3MUGA 3ULVF 1AE6L 2VL5A 4UT6L 1REIA 1ZWIA 2EE3A 4U1MB 1ZK9A 4GKSB 3QCVH 3RWEB 4EQ2A 4LEOA 4HLJA 3RVUD 3FQXA 3KG5A 2YSSA 1QKZH 4Y2OA 4PB0L 4XC3H 3OJMB 4PJHA 1NCDH 3UMTA 3CMOL 4O2CB 1MCEA 4IRSD 2MCPL 2BVQB 2BVPB 1NAMB 4MQSB 4ENEC 2OJEA 4KJPC 4Z76B 4NKOA 4QHKI 1C7TA 4JFHE 1IJ9A 2VERN 5KAQF 2W0FB 3LKOB 1WCQA 1B3JA 2WBJA 3WKMH 4AIOA 2HVJB 4CGTA 1G0XA 3UTSA 2EYRA 5I15L 1FGNL 3PWVA 3P73B 4EBQL 2JE8A 3MUZ1 3W0WA 1QBAA 2YUVA 4NRZA 4FQ1H 3QWOA 1T7XA 1UQSA 3UYOD 3WO4B 4F58H 1JWUA 1I1AB 2I9LA 4OF0A 1QVOB 1GGCH 2FGZA 5CP3H 5FUOH 1JZ4A 3LKPB 1H3WM 1MQKL 4EVNB 4K7PY 4X4ZA 2ED8A 3G9AB 1FG9C 1BQHG 2WK2A 3VFUA 5ITBL 2F9BT 2Q8BH 4KI1A 3LY6A 1E27A 4RSVA 5FO9B 4TNWK 2OZ4A 4L5FH 2EDNA 4EN3C 2B2XH 1X5KA 4GKNB 1D5BB 1MRDH 5TE6H 2ZG3A 3ROOA 4OCXL 2H8PA 4L8DB 4LP5A 5DS8B 4PJGF 2G2RA 3JTTB 4HXBL 4RWHA 2X7LB 1S9WA 1XF3B 4ZDHB 3HTLX 1R3HA 3ZHLA 5J13C 1KC5H 3RY6A 4WEBH 3VXUA 1I1RA 4ONOA 5J11B 2VLME 3S96A 4P4KD 1OQOA 5IBTH 2BK8A 4ZFZA 2IPTH 3H42H 4EN3B 1T1ZB 4QF1B 3OXSA 3MV8D 5D2NE 1I8IA 1MCNA 5JNYB 1BFVH 2X4OB 5T5FH 2F54E 3TBVA 4PJCF 3FQRB 4JFDD 5HHNB 1H8OA 1SYVA 2J5LB 3FRPA 1JF1B 4C56D 2OL3H 4KTEL 4EDXB 2AK4A 1S7RB 4PRIA 1B0GA 4CL7A 5ISZB 3AUVA 3ARZA 3QZWA 3R4DA 1PG7L 2O61A 3FO9A 3GBML 4XNMB 5T5NG 5CCKL 4LDLB 4PJFB 5CSZB 3WYRA 1K4CA 5HYJD 1RJYB 1Q9KA 5HHOD 4M1GH 3B83A 4DOHE 2YKLL 3EW3B 4HHAB 1EGJH 2BZDA 1QFOA 2IGFL 3TNNB 4N0UA 5I8CA 3UYRH 3CVIH 1KELH 4MNGA 3NN8A 5F70A 1I7UA 1DVFA 1VACA 2XQYG 5DDHB 3CVHB 4IMLA 3LKRB 4EUPA 1HHJB 4PG2A 5ANMB 1X6LA 2J8UA 3QCTL 4E42A 5CFHA 1G6RB 4Z77B 2DLIA 3ARED 4Y4HC 2YD3A 2ED7A 2BSRB 4LFHG 3STLA 1FO0L 4GMSL 3KPPB 1CVRA 4IRSC 4RMRA 4KAQL 5EC2A 4D0CA 2GTWA 5DURB 1JV5A 5A43C 2FATH 3CLEL 1J9CT 5LBSH 2X10A 1EAJA 1U0QA 1A1MB 2VLLB 3VMOA 1JHTB 1U3HA 5EO9B 3QUYD 4DFIA 3C5ZD 4Y4HB 5HHVL 2FJHB 3LEVH 1J12A 4B0MM 4GAFB 4DJMA 1JGEB 4ODXA 4KVNL 5I1DA 4XPAL 5DQDL 3R06A 1IGFL 4MCYB 3D39A 1HHHB 5DD6A 2E27L 4J3VA 5KN5A 1WC7A 2XRAL 4DK6A 5KSBE 4NUJA 4YNYA 4N8VA 1T0MB 4ZFGL 1T80A 2ORBH 1NFDB 5CKAA 3HE7A 5SWZA 2BNQB 3SPVA 4ZTOL 4DKEH 4OLWL 3EJYD 4LKCA 3EO1B 1OLLA 2D03L 2DQDL 3IFNL 2JJWA 4Z7VF 4X98B 1VPOL 2A1WH 5JPNB 1GHFL 1NGYA 3DGGB 4ZUUB 3TA3C 4NQDE 3VI3F 3O6ML 4MX7B 5FGSA 3ZE2E 3CFKA 1MHHA 3HZMA 1SEBB 4FQXB 1DUZB 1F02I 1NC4D 1ORSA 3PWPB 5DI8B 2QKIA 5ERWB 4MMXC 4HKZA 1DBBH 5EG6C 4JDZB 4FXGB 5KZCB 4XC1H 3WN5A 5ALCL 3T0BA 3KPOB 5B39G 4LHQB 2APXA 4HX1A 1ZANL 3UX9B 4ZNEE 3QDGB 3TA3B 1EHLH 4P5MB 3MV9E 3TIDB 4KQ3H 3Q6FA 5IVZA 1CFTB 5FYKH 3AAZB 1UFUA 5IJKA 4FA8A 5IMMA 3FCTA 3QWRA 4I9WE 1IGYA 3FOMB 3JVGA 4OCNC 1DFBH 4M5YL 2OBGA 3EIFA 3O41B 5D6CB 4X5XA 4NRXB 3ARYA 8FABA 2LVCA 1XF5B 3ESUF 3A6OA 3R0NA 5DJAA 4D9LH 3LCYA 4LLYB 3PWLB 4LSRL 3UBXG 2JJVA 4QHMB 4P3DB 2O5XH 2FHCA 5IFHH 1ED3B 1RUML 1NLBL 5FECB 3DNKA 2DL2A 4QRPD 2CPCA 4JFXA 1GXEA 3L95A 4TSAL 5DHVA 3CZFB 5E2VH 4P49A 4NC1E 3BEVA 1IGCH 5D7LA 1IAII 2DQFA 4MA1B 1A1OA 4YBLC 1Q0XH 2Z8WC 3RVXD 3VCLB 1OSZA 1RZGA 1KUMA 1MCWM 3JBG7 3KHOA 3BQUD 3WHXA 4X9IA 3VWKD 3B2UD 3GSXB 3ZDZF 5C0FB 3KPSA 1B9ZA 3WLWC 3ULSA 3GSUA 1ZLSL 3IDXL 3GHBL 5FGBA 4HBCH 2HAZA 5CZKA 1MREL 5E1AA 3BPNC 3VGAB 2Z91A 5LGJA 2OR9H 4DKAA 4PIRF 3QUYC 3D69B 1YEFH 3JWDL 3S5LA 3WNLA 5BW7C 1A2YB 3BGAA 2OZ4L 3T0ED 3BZEB 1A7PH 4YBLB 1YJDC 1VESA 3QQ4B 2H41A 2B1AL 1QD0A 1JGDB 4KDTC 4Q9CA 2XZAL 4UTAH 5DQJA 3B8YA 1P9MC 3OX8A 4JFQA 4JO3L 3TV3L 4M7LL 4JFHD 1KOAA 3BPNB 3RQ3A 3HRZB 4GLRH 3VJ6A 4O5LH 2BC4A 4KY1H 4ODUB 2R4RL 4LEXL 4CBPA 4Z7QF 2ZCKL 4NN5C 3MGOB 1OM3L 3DRTA 1IEAA 5D1QD 1WT5A 4RX4D 3P77B 4RA0C 3WIIH 4YC2C 4WO4C 3FT4B 1OT1A 2C7UA 3ARFC 5F88A 5HI4D 4RNRB 4IHOB 1TVBB 5J89A 5IF0B 2A9MH 4FZEH 4MZ2A 1QSEA 3VFGL 1WAAE 5C86A 5DK3A 3MUY1 1T3FB 2VDPH 5ICZA 1PY9A 3KS0H 3H9SB 3RTQD 2DTSA 4DZBB 4EIZC 3DETD 4NKIL 4O02L 2EIEA 1YN6A 3FHAA 5D9SB 5ID1A 1KACB 1LP9F 3OAZK 4P0DA 2AJXH 4LCWB 4NN5B 3BGMB 5CD5C 4YC2B 4WO4B 3FB8A 4XPBL 4JG1H 1WIUA 2K9UA 3ARFB 3HR6A 2J8OA 4NQSB 4G8GB 3DIFA 2ENSA 4WI7A 5A3ID 1A6TB 3Q48A 4U1HB 2VLMD 4UDUB 2AGJL 1RVFL 1DBKL 1HSAA 5BVPH 1U58A 4ZUSA 3DO3A 3THMH 2FHFA 2GAZA 4PY8J 1OP5K 1PKQA 1T4KB 1A9EB 4K2UH 3TM6A 5M94B 1YPZF 4X9BA 3D3VB 1FORH 4U1NA 4UOW0 1IQDA 1SJEB 4LAQL 4OUUB 1W0YT 1QA9A 4F57H 5FB8A 1EBAA 5E99L 3V5DB 2XWTB 2CRZA 3BP5A 5AG9A 3K74B 5B8CC 1QEWB 2ADIA 3N06B 3REWA 5E7BA 2DJ4A 3BDYH 4QOKE 2AQ2A 4GT7A 1QYGH 3LD8C 3VWKC 1CE6B 3B2UC 5LVEA 4N8CL 3TBTB 2RHEA 4KK6D 3F6IA 3IJSB 5JHDA 3C5SA 5EOCJ 4JG0H 4R4FL 1KCVL 5C0CA 5K9KB 32C2B 4TSCL 1AO7E 1S3KH 1C5BH 3P9MA 3L3OA 3VFMB 4HLZH 4PS4H 1OAQL 4KXZI 4LRIC 5FM8A 3MO1B 3AU1A 3H7LA 2XTJB 5IMOA 5HYFA 1SHMA 3LD8B 1DQML 4H0HB 5EU3B 4CW1B 2X1XR 2V2TB 4I77L 1EXUA 2BVOB 3OPZL 2EEAA 3E3QE 3FQTA 1PX3A 2XNAB 5D71H 1EO7A 4KI5D 5ESQB 1PZUB 3U4EA 4N9GA 2MQCA 1OTSD 4KPHH 4PJXA 1OGAB 1W72H 1XGRB 1FPTL 1JMZA 4DVRL 1FC2D 1KYOJ 1FNEB 3NFPA 1J0HA 5C0EB 1QRNE 2AJYH 3FFCE 1IGJA 4KRLB 2CXKA 5GGQL 2XKUA 3WL9B 4NM8H 1K85A 4U0RB 3D2UB 4V1DE 3WNNA 1S9VB 3IU3A 1RZKH 3MBXL 3Q3GB 3WDHA 1KENL 4CNIB 3U83A 2HJFA 5IGXL 3IXTB 3SY0B 4NNPH 4XXDB 2V9QA 1X3DA 4M6MH 2YD6A 3PWJA 5FYKD 2XZCH 5T3XL 4DVBB 5I8OL 2JKXA 2A6JA 3RTQC 3CZJA 3DETC 4O4YL 4NGHL 4AMKL 2O26U 1EFXA 2HH0H 4GW1B 1KTLB 1PQZB 4J3UA 5F7KC 1INDH 2H2SC 1WF5A 5KANI 5I1KL 4FOMA 1NCBH 1F11B 2VDMH 4F3FA 2DQJL 3QEQE 4JY6A 1MJJA 2DQCL 3MRQA 2VC2H 3D85B 1D6EB 3GJFK 4NQXB 3V52L 2AV1A 4NQDD 1CFNB 4NQCB 1MEXL 3OR6A 4G9DA 1BREA 3S4SB 4JZOB 3SGJC 4YHIA 3K4ZA 4JM2A 5TF1L 4R96A 1NCNA 4WJ5B 4JR9L 5E8DL 3TN0A 3AB0C 3DMMD 4JGJA 4PRDB 1W0WB 3C87A 5D2NC 1XT5A 2A6IA 4ZD3L 2EDWA 5KOMC 3TESA 5ETUA 3B9KA 3TPUA 3MRLB 5CUSL 2UY7A 4RGND 5IB3B 4JKPH 1KB5A 4F9PC 5E9DD 2ED9A 2GKIA 3VFWA 1YN7A 3B9AA 3ZHKA 2ARJB 4DQOH 5L8KB 1HQRB 5E94A 3NVQA 5SX5H 3DUSB 4XP6H 1WFOA 2IAMA 3RIFF 5ICYA 3MCKA 3NCCB 3AB0B 5E4IA 5FCSH 1DE4B 4M62H 1RZFL 3CH1B 1ETZA 5D2NB 1HH9A 2Z35A 1VA9A 1AFVH 3U0WH 5FV2A 5E70A 3VXSA 3OB8A 3V4PH 2X4QB 4ZUVB 1IT9H 4UOJA 2F54B 4YHML 4KK6C 5CBEA 3O3BB 1NANI 3MFFB 3HHRB 1EK3A 5EZJA 2Y07H 1HKFA 3ZL4H 2CLZB 4JFFE 2ZSVB 2ZG2A 1FNGB 1NC2D 5ALBL 2D0HA 3H9ZA 3U36A 1RIUL 5TDOA 3KLSA 3MZTA 4ZFOB 4IRZH 4OLYH 5T1DH 5EC1A 1EZVX 4LPXA 3JV6B 3IB4A 1EO5A 1Q9LB 3CFDA 4NP4H 3PXJA 4OJFH 4J6RH 2R1YA 2CDFA 3IFLL 3HLAA 4NNYA 4P2RE 1A3RH 3T8XA 1K8DB 2V7NB 2VXUH 3MCLL 4P57B 4IRJD 1AGBB 4S10A 3I02A 3LKSB 1IZKA 3DARA 4MMZC 5IKCA 4I48B 1CU4L 3NABH 5DF0A 3RRQA 1R0AL 2J6EA 2O5ZL 1UB5A 4JRWA 1WSST 2QSQA 2WBKA 2PNDA 3T08A 1MCWW 3HPLB 3MNZA 4Z7WA 3Q5YA 2BJML 4ETQB 1FZOB 1IARB 2HRPL 4Z6AT 2G5BB 3T4AB 2DF3A 3RX5A 5AZEL 2C9AA 1QP1A 3BEWA 4XRCA 4ZXBC 2W59A 1NGPH 4BUHA 1GGBH 1ZHLB 3FOLB 4A2LA 4ODTL 4X99B 2X4NA 2YPVH 5DRWA 4HUWA 4P2OD 2I9TA 1MQ8A 4A6YA 1G7QB 2X4RB 4UIMB 4YXKL 1EMTL 5I1HL 3I2CL 3QAZB 2FJFA 2BOBB 4RZCA 3ET9F 1FAIH 1JTOA 4OFDA 3PL6C 4Y4FA 2DBLL 4Y16A 4L4VB 4ZUTB 2ZSWB 3OKNA 3RIFK 4OZGB 4E5XA 3U82B 4MQXD 3QPQD 3N50A 4ZXBB 4NKDB 3U46A 5EZOL 3TZVD 1BEYL 3VE0B 4R7DA 4X0KB 3C60D 4CKVX 2F19L 4K55A 3IDYC 4I5BA 3LN5A 1BX2B 3DMMC 3WXWH 2PYFB 4Z0XA 3PL6B 1G7MA 5GGSB 4RGNC 3O4OC 4N0FA 4OLVL 1DBML 5E2WL 1HEZA 1M7DA 5L2KD 2X4PB 4K7FB 1TMCB 2IH1B 3MJ7B 3K0WA 4I2XE 4FQCH 4OZ4B 3JSSA 4MXQD 2EXWD 3SDAD 2X6MA 1J0ZA 2NYYD 5H94A 4N90E 2D31A 4ZMAT 3IDYB 3PABB 3VFSA 4JPWH 1RK1A 3F12A 1ZVSB 4PR5A 1JGUL 1JK8B 2FX9L 3DLQR 3GO1H 4L9LA 5E6IA 4M48L 1G9MH 2PYEE 3GI8L 4QRSA 3AY4C 1QR1B 2A73B 1OSPL 3HN3A 2IMMA 1V7NH 4HULB 5DWUH 3MV9B 5J9PB 5DZLA 1KPRA 4GO6B 4HUMB 5IFAL 2DQUL 1BF2A 4GKZA 3FHQA 2AW2A 3CVHH 4NC1C 3QI9B 3I6LE 3VRLF 3T0VA 2UWEF 3D0VB 1NKOA 1G6RH 3QFDA 1CD1A 3V6ZB 2W65A 3DOSA 1UA6H 2BNUB 5H8DA 3QCUH 2Z4QB 1GC1C 3PDOA 3E2HC 3TH4T 3QFJE 3ZTNL 4EI6B 1AP2A 4O2EB 1OF2A 4OLUH 1IKFL 4L3CB 1KTRL 4IRJC 1G7JA 3ARRA 4U1LA 4PJ5A 1IGTA 2JIXD 4Q9RL 3BH8B 3ARWA 2APBA 3MJ8B 4G8FB 5F44A 2VNCA 2H45A 1P1ZB 1RUQH 5EUKA 5IMKA 2R2BA 2P8MB 2X89A 2XN9A 1HKLL 4KHXL 3S4SG 1ZOXA 4NPYA 5FXCH 1SJVA 3E2HB 1R3LA 1T0NB 1CGWA 3TWCH 4G6ML 3CC5B 3FONB 4BSVA 4Q7DA 3T77A 3EGSB 2R4SL 4HK0A 3LSOA 4HDIA 4MVBD 3PNWB 3QH3A 1IKNA 1NEZA 2HKFL 4P2OC 4QXTB 2ESVE 4WHCA 5KSAD 2AVGA 3WFDH 3SDXE 4AIZB 1KIPB 2R29L 5I75C 1VFUA 2QQLL 5D1XD 3QUMA 4DGYH 5CGTA 2Z8VC 1A7QH 1ERNA 1HYRC 1WWWX 1F58L 1SBSL 3N1MC 5CCKH 3EDJA 4GRWH 4LCCA 4UI2A 2YKLH 1KB5L 4XI5D 3OJDB 1A0QL 3QPQC 1GGIL 4MA3A 2JJSA 3L6FB 1U3ZA 5EB9A 2E7LC 2R0KL 1ODAA 2K3TA 2IPKB 5CLTA 3V6BR 4MJ4A 4DZ8A 5CBAB 3QCTH 2PXYA 3UTTE 2ICEB 5HVFB 3AMKA 1MWAA 3HI6H 3DUHA 5GGTA 1ZLVK 3S8WA 3JTSA 3OGCA 1C8PA 5JXEA 1E6JL 2FEDC 4HKBB 4IOFD 3S35L 4XPHL 5C0IA 3QEQD 1FO0H 4BZ2L 3LQAL 4AG4L 4KAQH 4Y19A 3EFDL 4LDEB 1P2CA 1EO8L 5CIPA 4QTHA 5J3HD 2BY2A 4UQ2B 3L5XL 1IMHC 4NDMB 2MHAA 3ZKXC 2EXWC 1R3JB 4NZJA 2NYYC 1MLBB 1P6FA 3L7EB 4X4XA 2XYCA 3IGAB 3BZFA 4ALAL 3GMNB 4DAGH 4PJ9A 4HG4J 2B5IC 3DRQA 4LF3B 2ATKA 4TYUA 3E8UH 4G80A 4I0CC 3PQYA 5DQDH 3RDTD 3ARPA 2UVEA 5F89B 5BS0A 5I1GL 1RUAL 2EDBA 4KK8D 3ZKXB 4OZIE 1MJUH 2QHRL 5CJXA 4MJ2A 1AJ7L 2J6EL 4I18B 35C8H 1OAUL 1ZHKA 2FYYA 4JAMB 1PEWA 4Q6IB 3SBWA 4OLWH 2DQDH 2A6DB 2B5IB 5JHLL 3CU1A 2XA8L 2GT9B 3VXNB 1HINH 2IF7A 5LQBH 1T5XB 4LSQL 3GB7A 4PJHE 3LPFA 4NO5A 4PGEB 3VW3H 2BSTA 1GHFH 4XP1H 1U8MA 1UM4L 3GM8A 4WGWB 2ZNWA 3RUGF 4YIQA 4OV6F 2DWDA 3DROA 2GSGB 4RAVA 5DJXA 5F7DB 4YQXH 3HZKA 2CDEB 4WHYH 4A6YL 1D9KD 1MFAL 5FKAA 3HI5L 5KW9L 3HAEA 3MROA 1X5XA 1JFQH 3MLWH 3PWUB 2YA1A 5IG7B 3KLAA 4QOKB 4Z5RB 3EDDA 3UTSE 4FQLL 3GMRA 4HFWA 3MJ9A 1DQJB 2LU4A 2P49B 5C1MB 4K9EL 1HILB 3E3QC 5TQ0H 1ZANH 3IDIB 3FJTA 4NM4H 2AEPL 3D18B 5CSGA 5AZ2L 1N5AB 4MVBC 4UNTA 1AO7B 1J0JA 3NPZB 3MLZH 5F6HI 5MENA 3MRGB 3CX5J 2J1KA 1A6AB 3GSQA 1TCRA 4M5YH 5D1XC 4NWTL 1MI5A 2C4FU 4U3XA 3C6LB 4LLVA 3H6JA 2UYLA 4R9HA 4MQ7B 4QYOB 1MNUL 3VDCA 4XI5C 3D25A 3O6FA 2EH7L 4KI5F 1QBMH 1INQB 4G6JL 1YYLH 1F6AB 1NMBL 4JFYB 1RUMH 4XZUB 3EOTL 5DRXA 3BRGC 4X80H 4PP2A 3VXUE 4EDWH 4HKJA 3A6BL 3KDMA 1INEL 2X2YA 4IOFC 1QRNB 1L0YA 3FFCB 1G0DA 5IWLA 2HLFC 4V1DB 5FHBH 3JV4B 1Q9WA 4XNYL 2V7HA 2XPGB 2VR5A 3DGCR 1RZIA 2B0SH 4RRPG 1DQQB 2IANA 5DHXB 1QFWM 4F7MA 1CF8H 4HUUA 3IDXH 1YEEL 1IAKB 2R9HD 4G3YH 5FA4B 1JZ7A 5CEXA 4PJGA 1A6VH 2HFGL 3RKPA 5TPWH 5B4MC 5FYJE 1CGYA 4MAYC 3WFHA 4NJ9H 5C09A 3MV11 5EBLB 3B9EA 3MX0A 3DO7A 2XZAH 3RDTC 4R7NB 3BVNA 4M9PA 2RAMA 4KK8C 2ZOLB 3JZ7A 1UM6L 4MNGE 5HDQL 3OBAA 3TBYB 1I1CA 4M7LH 3MGTB 2EDKA 4WY7L 4MXVE 2ITCA 3S37L 1LO5A 4N90D 2J8UE 2Q86B 1U91B 2NY0C 3FQWA 1AH1A 4PJCA 4NZDA 4OIIL 4PBVC 3OZ9H 3S3SA 4MAYB 3HNSL 4K8RC 3LIZL 3QIBB 4EKXA 2AV7B 5TQ2H 1FG2A 3MCG1 2WP3O 5TE4H 1IRAY 1VSCA 3LKNB 4KMLB 4BH7A 1E28B 5FYLH 1L0XA 1RZ8A 3A0OA 2WIIB 3SN6N 4GAYA 1LE5B 3L5WB 4WUUB 5HYSG 1FL6A 5KJRL 4IDJL 5D96B 4M7LT 3A67H 4YDVA 1C08A 5ENWA 3QUML 2NY0B 1RD6A 1Y0LB 3QQ9D 2R56L 4JQVA 3SE4C 2RBLA 5EN2A 1ES0A 2YC1B 2WM0A 3OKYA 1MHEA 1U93A 5AUMA 3WDJA 3DI3B 1IM9B 1QZ1A 3D39E 4XBGA 4BFBD 3MGAA 4D9QD 5JW4R 2OXGA 3SCMA 5JW4M 3MLVL 1A6PA 3DX7B 3O8XD 4JFFB 3UJIL 3L3HB 5BO1H 3EYUH 4JO2H 4NO3A 5SWZE 3U48A 1MWAL 5GGTL 1DBKH 4MD4B 5LGHL 5J1TC 4GXVL 2APVA 4HEPG 2EDRA 1AXTL 2I07A 4DN4L 2R15A 4P2RB 3VXMD 3KWWB 3ARBA 2GITB 4N8PA 2UZIH 1CCZA 2C3VA 4FTVD 4KC3B 3LRSA 3S3JA 4GG8B 3HMXA 1FZMB 1G7LB 5FKPB 1MCRA 1I85A 4UT9H 3ALWA 5LWYH 2P48B 1T21A 1JE6A 4KQ4L 4G8EB 2NXZD 2RIKA 1IC4H 4R4BB 1H5BC 1AY1L 2C4FT 4IOIA 1IEHA 2EDXA 1UZ8A 4OFYA 4EJ1C 1LNUA 1IM3A 3BI9X 3LMJH 4O9HL 1M4KA 1S7WB 4HLZG 4WGVB 2YD9A 4N8CH 4JGUA 1XEDA 2YD1A 3G6AB 2FL5B 4Z7VA 3FRUA 2PR4H 4R4FH 1FYTA 1AKJA 1KCVH 2ICWA 5EUOE 2F5BH 3STZA 1XGPB 2X1QA 1ZA3A 2ZG1A 5T3XE 1SYSB 1H5BB 4S2SA 2NY3B 1KGCE 3RWCA 3V4VL 3C9NA 3OR7A 1YMHB 1JN6A 3EKCA 3T3MF 1LEIB 1LK3L 5T1MB 5J4MA 5FK9A 2GCYA 5FF6A 2DAVA 5I74C 1LEGA 5DSCB 4GAJH 2YXFA 4JN1L 4CDGC 1N4XH 3VXTA 2QBWA 3BPCA 2I5YH 5A2IH 5E08L 3NFSL 5A2FA 3QEHB 1S9YB 4DN3L 3N9GL 2Q76A 5KVFL 1N2RA 3BP7B 4I4WB 3RNQA 1CXIA 4D2NA 3X14B 1D5XB 2BSSA 2FR4A 5F7LB 3BW9B 5D7LE 4IDLA 1BFSA 3TO2B 3OKMA 3ULVL 4PG9B 4WI8A 1K3IA 3MJ9L 1CK0L 1H0DB 2IPUK 3IJHB 1WFUA 1PZ5B 1G6VK 5I74B 4JREB 4M03A 1J0KA 4QRRD 4ONFL 2VITA 3DYOA 3NZ8B 4M8QA 4OM1H 1A6UH 2M2DA 5DC0A 5F72S 4I2XB 3ZKMC 3MRPB 1KTDA 3C09C 3L1OH 2VXQL 5IGXH 1I8MB 3H0TB 5HGBB 3RWGA 1RURL 3B43A 1JHLH 4HWEL 3K81A 5H35B 4J3TA 3P0YL 4JHWH 5C08A 2YEZB 3I75A 1RHHB 2NY4B 4OD3L 3V7MA 2PYEB 3Q1SH 3UPRB 3UZQA 4M5ZH 3JV0A 5EULV 1J18A 5GS2H 5IHZB 3LRGA 2QQKL 2KZ1B 2IJ0C 2DQCH 3DTXB 4FFWD 4LLDA 3GIVA 3E1F1 4X6DB 3O8XC 5CJQL