3D87B

Crystal structure of interleukin-23
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
306
structure length
298
Chain Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-23 subunit p19
publication title Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 55
structure length 298
sequence length 306
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B03
4M3KB 1DBAH 2DQEL 4E42B 2OSLA 5TQ2H 1E28A 2DKMA 3BIBX 3C2AH 4PJDE 1CGUA 5LQBH 1ZAGA 1X5GA 3I85A 1ZT7A 4HCRL 4MQXD 1UKQA 1LDSA 3FHAA 4FQCH 4WHYH 4LSDA 5CKGA 2BOBA 3RVXC 4UU9B 1NC4D 4QT5B 2UYLB 5DJXB 2P8PA 1H9VA 3TO4C 2VITA 2HKHL 5HHQB 5DLML 3HMWH 4WUKL 5HYSB 3LV3B 1RK0B 2DYPA 5ID1B 2P7TA 1UXSA 4FQXA 4MDIA 2XACC 3MLUH 4U1KA 1LD9A 2Z91A 4OZ4B 4PJEA 4Y1AD 3QP3A 5D7LA 5ECJE 3GK8L 2VLJB 4P2RA 1H8NA 4Z0XB 1HNFA 2H6PA 2J8HA 2Q20A 1FVCB 4WUUD 3FQRB 4P2OC 1WIOA 4ONGL 4MXWL 3RKDD 5B8CC 5A2FA 3NZ8B 4AEFA 4GRWH 5IB4B 1KGCE 1HI6B 3L5HA 1KOAA 3BKCH 5JIIA 4HWEL 1KTKE 4OLXL 3ULUD 5T3XL 3HFMH 4PJ8C 4QHNB 3MLWL 4HC1A 2EIDA 4YDKH 5HHOA 5FA3A 4KKBD 2BNQB 3OXRB 5GIRB 3NTCL 1T20A 2AV1B 1XGPA 3OWEA 1MUJB 4EQ3A 1DBJH 3C87A 3OKMA 2I5YH 3CFKA 5I15L 3WFBH 2IBGA 2ED7A 3MXVL 5GS0D 2AEPH 1WITA 2X9XA 4I18B 3VRJA 1MIMH 4Y5YB 4X6DF 3UTSE 3IXAA 4RA3A 5CWSA 3W39B 5FYLE 2WUBL 3KYOA 1BX2A 1B0WA 4P9HC 4UV4H 5DJCB 5IWLC 2A74B 5KS9B 1IC1A 1ETZA 4E42A 1H3GA 2EEAA 4OB5L 4UBDC 5DD6B 1A7NL 4H88L 1E6OH 1ULVA 1MWAB 4PRNB 2OMNA 2XA3A 5J8OA 4UU9A 5C09E 3Q3GB 2UYLA 5DJXA 4X7DC 4DKEH 5KVEL 2HT2D 3B2VH 3ULUL 4JN1L 4BQCA 5HHQA 5MEOB 5CFHA 3J8F7 2A77H 5HYSA 3LV3A 3SY0B 4Z7VE 4GAGH 4YQXH 1RK0A 2PCPB 5ID1A 2XRAL 1NGXB 4OZ4A 3L7FB 3V79C 2V7HB 2R0KH 4JFDE 2VLJA 4Z0XA 1J1XL 1FVCA 1PEWA 2WBKA 1QPPA 3GSNA 3NZ8A 3KPRE 5IB4A 1R3JB 1MJUH 1S7TB 1HI6A 3E2HC 1MLBB 5GS0L 4ENED 1HYSC 4QHNA 5TDNB 4L9LB 5LAXB 3V4VL 1NGPL 1J8KA 3JUZA 2BNQA 5GPRA 2J6EH 3OXRA 5GIRA 2EICA 4LPXA 4JPKL 5DJZB 4HXAH 2AV1A 3CXHK 1MUJA 1X4ZA 3OXSB 3WV0A 5GQBA 3BAEH 2NY3C 4UNUA 2E6PA 3BXNB 2LV4A 2VDNH 3P9LB 5T1DH 3TBVB 4BSWB 2EDBA 3GHBH 1QBBA 4PLJD 2PTVA 4EUPB 1GGBL 4I18A 3ZDYE 2BDNL 3I6LD 3UTSD 2VXVH 1KXTB 3BQUB 5E6ID 4Y5YA 2ORBH 1NBYB 4S11A 2F53D 2GKIA 2YKLL 5FYLD 5TPWH 3W39A 5JDSB 5DO2C 3T1WA 3BDYH 3NA4A 2A74A 5ETUB 3SPVB 2M2DA 5KS9A 1A0QH 4LCWB 5HHVH 5DD6A 4NC2B 2YUVA 2VDPH 4HHAB 2WM0A 1S7RB 3EBAA 4GXUM 1MWAA 4PRNA 4H1LG 5CZXD 4JFZH 2W92A 5C09D 4JCMA 3Q3GA 3LS4L 4L4VE 5EZLB 1PVHA 5MEOA 2BSRB 3C6LC 2C4FT 3SY0A 4K3HA 3RX5A 2D4DA 1A1MB 2PCPA 4NFBA 15C8L 3SDYH 1NGXA 3JWNC 4YHYB 3L7FA 4HG4K 2V7HA 1L7IL 1CL7H 4JFDD 2XY1A 4GW5B 4OF7A 1K5NB 2HN7B 4XPTL 3I6KB 1D7FA 3GBNH 5BRZB 1IBGH 3DI3B 3QH3B 4CU8A 3KPRD 1U93B 4ZO8A 2NY4B 1R3JA 1S7TA 3DUUB 2XV6B 1MLBA 3KR3L 5C0GB 5KTEL 4RWHA 2O5ZH 3MROB 4MS8D 5TDNA 1R0AH 4L9LA 5LAXA 1MRDL 1PLGH 4X7TB 1X44A 2ZKHH 4MJIB 4OF5A 4Z7QF 4MNGE 4JY5H 2E5EA 1BREA 5DJZA 3MBEC 1OGAB 1JGUL 3OXSA 4CN1A 1JWUB 3QPXH 3BXNA 3JXAA 3P9LA 4NZUH 1UJTA 3TBVA 4BSWA 3KJ4C 3SEPA 3EJYC 3GIZL 4EUPA 4ODTL 4L3EB 4GUPB 1XH3B 5E0QA 3BQUA 1NBYA 5JDSA 2IQ9L 5KVFL 4D3CH 1MFDH 4PLKD 1LHZA 5DFWH 2FBJH 1TFHA 4J3UA 5ETUA 3SPVA 3TPKA 3GM8A 5HXMA 3V5KB 3IFNH 4P9ML 4LCWA 4PRHB 4PJBE 5KAQF 5SV3A 4HHAA 1S7RA 4Q97A 2R8SL 4MNQE 5I30L 4JM2D 4GS7B 4NQCE 1MIEH 3O9WA 1PAMA 1FGVL 4G6KH 3TM6A 4OM1L 4RGNE 1U8KB 4L4VD 4M43H 3U0TB 4MJ2A 5EZLA 1QLFB 2BSRA 3E3QE 1LO2L 4N68A 4K3EL 3HR6A 3BPNC 2WIIB 1A1MA 5FGBC 4JQVA 3IDGB 1QA9B 4U6YB 1JI2A 1AHWB 1JN6B 2VLME 1KN2H 4GW5A 3BWAB 2HJLB 1K5NA 2HN7A 3I6KA 1U3HB 3H42L 3P0VL 4MYWB 5BRZA 3QH3A 3RP1A 1U93A 3WFEL 3DUUA 4JVPA 3GKWH 5C0GA 1M7IB 2Q7NA 2MPAL 4OCWL 1P7QB 1GGTA 2PUQT 2XNAB 3MROA 3QYCA 4F7CB 2BP3A 1BGXH 4NWTH 3UJTH 3PXJA 1Q0XH 4WTZA 4JKWA 1JRHH 4ODHL 5HDBF 4PJ9C 4X7TA 2UVEA 1OLLA 5E4IA 5E8EB 4MJIA 4XNYH 4Q7DA 5DHYB 2H9GB 1OGAA 2FSEA 4NHUB 5HD8D 1JWUA 5DWUL 1ACZA 1CFTB 3RA7L 1OTTC 4L3EA 1XH3A 1DVFB 3OG4B 4MLIA 3OAZK 4LPCA 1HIMH 1JWMA 5J06A 4LEOB 3ILPB 2LFGA 1RZFH 3QWRA 3V5KA 1QYGL 2M26A 4PRHA 2DMBA 1DQDL 4NNYB 1JGDB 1XGTB 3A6OA 4Y5XB 3F65A 3ARGB 5F1IB 5FIEA 3W11D 2J7LA 1BZ9B 4YXHL 4RGND 1IMHC 1M71B 1U8KA 2NY2C 3L3IB 2PW1B 4MNHB 5MP6H 3D6GA 3U0TA 2AABL 1JHLH 2QTEA 2BNRE 4H25B 1EXUB 1QLFA 3VWKC 1G1YA 1OW0A 2L4OA 3O8XD 5E99H 3P4MB 1YY8B 3ORJA 4XCFH 2WIIA 5HI3D 3EUUA 1C16B 2OR9L 5E6YA 1AI1L 1FPTH 4PY8I 1JYNA 2W0KA 3IDGA 1QA9A 4U6YA 2VLMD 1AHWA 4PJCF 1JN6A 1Z5LB 3BWAA 1TITA 2HJLA 2VDKH 4ORGB 1I3GL 1U3HA 3SBWC 1RIVH 3WS6C 1PKOA 1MFBL 2AJZB 4JQXA 1JGVH 2NY5H 5MEPB 2Z9TA 1M7IA 3EHBC 5EZJB 1P7QA 2XNAA 3O6LL 4F7CA 3RUGF 1XIWC 1TCMA 1MCWM 1DDHA 2X1WL 4NOFA 5DMKB 5E8EA 4Q9BA 1AKJB 5DHYA 1NKOA 2H9GA 4U1GB 4RFOL 4NHUA 2NZIA 5KSBF 5E00B 5IESL 5F8RC 1OAYH 2DIAA 5KW9H 3BRGC 5I1AB 3UAJD 1CFTA 2EZ0D 2FX8H 1DVFA 1FO0B 4L5FL 4WO4D 1OP5K 3LKSB 3LEXB 4O2CB 1B3JA 1XCQB 35C8L 4ZUSB 1TDQA 3V6BR 3FQUB 3V4UL 4LEOA 3ILPA 4IRSB 4OIBA 4C4KO 2VDRH 3DARA 5E24E 1H8OA 4I2XE 3OJDB 1PG7L 5GGQH 3OMZA 1KULA 1F90L 3EYOB 4D94A 2K7QA 4NNYA 1JGDA 1YNKL 2AERT 1XGTA 3LQAH 4Y5XA 3ARGA 5F1IA 3EJZD 3CGTA 3GNML 2HRPH 5CD5D 3TEUA 3ZYJA 1WWCA 1MQKH 1BZ9A 4J6RL 1IGIH 1HHGB 2XKNB 3L3IA 1P5UA 2JJUA 2PW1A 2XTJE 4MNHA 4JPVH 4KWUA 4H25A 1EXUA 3EJJX 4N0FB 3HCVB 3AMKA 2DWDB 1RMFL 1YY8A 4UAOB 2OM5A 3OTTA 1C16A 2DLFL 4TYUA 3QIWD 2F58H 4OM0H 2Q8BH 5I75B 1RZKH 2EH7L 1KXQE 1Z5LA 4JO2L 5E2UH 4MCYB 5GRJL 4ORGA 3O3DB 3TV3L 3FQTB 4H8WL 3DMMC 1NANH 4XNXH 2AJZA 1FAIL 4R26L 1LEIB 3RU8L 5LGJB 1U3ZA 5MEPA 3L6FB 4I8DA 5IMMB 1MI5B 5EZJA 1SY6H 2XYCA 3O2DA 1F8TH 1K6QL 4HSQA 1KPUB 3ARYA 3CLFL 3V5DB 5JTWA 3O6ML 4O2EB 1SJVA 2L7UA 5DMKA 5F1SA 2AXHA 1XCTB 3U1SL 1AKJA 4UILH 2UWEB 4IHOB 2X40A 3ILQC 2FATL 5E00A 4PJCB 4POUB 3SCMB 3G9VA 5I1AA 3VG9B 5IT2H 5J12C 1YNLH 1J0IA 5JR1L 4WRLA 3EZ8A 4R8WH 1IAOB 4MB3A 5E9DB 2P4AB 1FO0A 3LKSA 3LEXA 4YXLL 4KMTL 4O2CA 2IALB 4YDIH 1CS6A 1XCQA 4UOJA 4ZUSA 1Z9MA 1NGZB 4WI2A 4IRSA 2BVUA 2FECI 3GFUA 3OJDA 2HMID 3ARFD 5TH2B 2UY7A 3I3DA 3EYOA 5CEXB 5L88L 4M4RA 3EDJA 4YH6A 1HXYB 2WQ8A 5KSBB 3DX7B 3QXTA 4UI2A 3AUVA 4N1EA 1U3JA 5J11C 4TNVF 1X5KA 1VADB 3DYPA 2XKNA 3WSQL 2VERN 2XTJD 2UY6A 3VFVB 3TC9A 1N2RB 5LJYH 1CFQB 1JFQL 4N0FA 3HCVA 2DWDA 5CJBA 1UENA 1EFXD 1XGYH 1LILA 5FDWB 1ZSDB 2APBA 1U41A 3CFCL 4BFGA 1CL7I 1UWEL 1FBIH 2R9HC 1JYWA 4HJGB 3MX0A 4MCYA 3HC4H 3FQTA 3Q5YA 2YZ1A 3QHFH 3JWOL 4TTDD 1LEIA 1MSPA 5LGJA 1WJ3A 2HTLD 3L6FA 4HFUL 2WLYA 4K2UH 5IMMA 1MI5A 2UZYB 3OR7B 2R29L 1LK3L 4WWKC 1KPUA 2ADFL 3V5DA 4WTXA 1UWGL 4O2EA 1UH3A 1AR1C 1ZVYA 1A5FL 3LH2H 1XCTA 4HK3N 5CEZH 4U7KA 2RJMA 4M62H 4MA8H 2UWEA 4AH2B 3MRLB 5C0AE 4PJCA 3WKML 3SCMA 4NM8H 2CUHA 3BUYB 3FN0L 4WEBL 5IVNA 3H3BC 4K94H 1IAOA 2A0LD 1VPOH 5E9DA 4YZFE 2DIJA 1U6AL 2BCKB 4GRWB 5C08E 2IALA 3IDUA 4YPJA 5DEZA 1OSPH 1NGZA 5A1AA 4XRCB 1FL5B 1WV7T 3SN6N 5ESQB 4M48H 2AAVA 1NBQA 4PIRF 1UA6L 5EIIB 5TH2A 1MCOL 5ALCH 4Y4HC 4DEPC 5CEXA 5HYJB 3MFFB 4YHKL 4HUNB 4L3CB 5KSBA 4CVWA 3DX7A 3PE9A 5ADOL 5FUOL 2RHEA 1LNUB 1U8NB 4M9PA 4KRPD 4P3CH 1VADA 1BEYL 4J7RA 2MHAB 4M61B 3VFVA 1L7TL 1N2RA 2XQYK 1BLNB 1N6QL 3BGFB 1CFQA 3QUYB 2VXUL 3JWDC 1KB5B 3NFSL 5FDWA 1ZSDA 4XPAL 5J56B 4NUGL 3L5XH 1E27B 1TETH 3MJGX 1K8IB 4HJGA 4X4ME 2IPUK 3F7PC 3GEWB 1PD6A 2DD8H 5CIPH 4DGVH 1EERB 2OTPA 2DLTA 4ODBD 3NA9H 5E8DL 4N0YL 5TE4L 3OZ9H 2R69H 3MRRB 4K07A 4XC3H 5J1AB 3OR7A 3L1OH 4RMWA 1I4FB 1U92B 2X4UB 1JRHI 4M1DH 3U79A 2BMKB 2VOTA 5FM5O 2WZPD 5HHPB 1MJ7L 4I4WB 1PQZB 3GBMH 4AH2A 1S9WB 3MRLA 4L8DB 3P0YH 4OZIF 3VWJD 5C0AD 2ZCHH 4LSRH 3BUYA 3QDJB 3K7UA 1KNOB 4ZMAT 5I1GL 4JGJA 5IHUL 5FGSA 1IT9L 2B5IB 2VZ1A 5B4MD 1QR1B 2BCKA 1JCKA 1TZGH 4JGMA 3HE7C 5D1XB 2AXJA 2NXZB 1TIUA 3MO1B 4JO3L 4XRCA 1FL5A 1W8OA 1KLGB 3PGFL 2YPVL 3R1GL 4QKXB 5ESQA 4WW2F 4XVSH 4X9HA 2KL6A 5C2BL 2P47B 4PRIB 2X10A 4N1HB 3U30C 5EIIA 3EYQC 5HYJA 3MFFA 1OAUH 4H0HB 1DBAL 1VENA 4L3CA 5TQ2L 3C2AL 5LQBL 2AVGA 1LNUA 1U8NA 5KVDH 2MHAA 2X44D 1NJ9B 4M7ZC 4M61A 1Q72H 2BVEA 4FQCL 1BLNA 3QUYA 1U8IB 5HDLA 1KB5A 2EDFA 3DETD 5D2NC 4GJTB 3HMWL 1E27A 1K8IA 3L7EB 4NO0D 4DWHA 3MLUL 3MCKB 2FJGB 3MRRA 3PWPE 3RTQC 2R1XB 5J1AA 1I4FA 1R5VB 3ARVA 3BWUC 2CXKA 4MXVE 1CICB 2BMKA 2EXYC 4PGDB 5HHXH 2Q76B 3BKCL 2Y06H 5HHPA 4I4WA 3HFML 4IIQA 1YEHH 1S9WA 4YDKL 4L8DA 4F7TB 4ZD3H 4FQ1H 1JK8B 3EYUH 4EI5D 2Z93B 3LDBC 3QDJA 1KNOA 4EXPX 1M7XA 1H5BB 1NSNH 2V7NB 1DBJL 1DBKH 1QR1A 1CGVA 3D0VB 4PJGF 3KAAA 4NKDB 5LCVH 2I5YL 3WFBL 3STLB 3BT2H 5E5RB 4F37F 5D1XA 3MO1A 1KLGA 4AG4H 2AEPL 5DRWB 3TN0C 1L9MA 3FO9B 1AIFB 1UCTA 2Z4QB 4XNMB 1MIML 1FNLA 1MAJA 4PRIA 4Q6IB 5IBUG 2J6EA 2OP4H 4UV4L 1IM9B 3P77B 3ZL4H 3QRFM 3R4DA 1CT8B 5HHNA 5M95B 2BRRH 1ERNA 3VXUE 1NJ9A 4PJHF 1E6OL 4QXTB 2VN4A 4DUWA 3CFJB 1U8IA 4OF6A 4DVRH 2MSPA 4DTGH 1JPSH 4DKEL 1YPZE 3B2VL 2IAMC 2ID5A 4WW2B 1T83C 4W4NA 3DGCR 3L95B 2A77L 4BM7A 3I3EA 1BF8A 1YEGH 4GAGL 3L7EA 4YQXL 5FM4A 5IROC 2NX5E 3T0DA 1ADQA 5H37G 1NANI 3MCKA 3H9YA 1EHNA 2VLRE 2JCCE 1WAAE 2FJGA 2R0KL 3QXVA 3PWPD 1ZGLM 1KIRB 2R1XA 4DGYH 4FQLH 2QLVB 5BCAA 1R5VA 1WT5A 1N5AB 1CICA 3TNMB 4PGDA 1MJUL 1FL6B 2XA8H 5FCSH 1CFVH 2Q76A 3QULB 4FQXC 4MAYB 4BZ1H 3AXLB 1ZA6B 4OSUH 4F7TA 5HDOA 1BAFH 1JK8A 3AAZB 5I1KH 2J6EL 4FQPA 4IMLB 4PJDF 2Z93A 5L7XH 1CDIA 5L0QB 4NZJA 4HXAL 3ULVE 1WBXB 6FABH 1H5BA 2V7NA 5GSVB 3SDCB 3BAEL 4N1CA 2VDNL 3D0VA 5T1DL 5CJXC 3MCG1 4XVTH 4NKDA 3GHBL 3STLA 3JZ7A 1N7MH 5DRWA 4EIGB 2FDBP 3FO9A 1AIFA 2Z4QA 4XNMA 2VXVL 4R7DB 2ZWLT 4GT7A 2G60H 2ORBL 4I0PB 1K3ZA 5DJ0B 3LHPH 4Q6IA 5TPWL 5BVPH 1IM9A 3P77A 3BDYL 4ONFH 4TPRH 3MNZB 2VTFA 3GMQB 2FECL 3AVEA 3AU1A 4GLRH 1VEPA 1A0QL 5HHVL 1VFBB 1CT8A 4G8GD 4V1DD 3T08A 3VXUD 2VDPL 3MZTA 1X7QB 4WW1B 1BBJB 4KK8C 4QXTA 3WJLC 3CFJA 1WFUA 4PJGB 2CKBH 4JFZL 5CAYB 1NC4B 1EO7A 1FE8H 5TE7H 1F4AA 4WW2A 3L95A 4RMSA 5FFLA 1T21B 3QFJB 3SDYL 4YDJB 2YEZB 4BJLA 5DT1H 1CL7L 4BFIB 2GAZB 1KIRA 3OV6A 4Z8FH 3GBNL 1YYLH 1IBGL 2CH8A 1N5AA 3TNMA 5SWSB 4RMTA 1T0NB 3CMOH 5JNYB 4XPBH 1FL6A 1SHMA 5CSZB 5EUKB 4MAYA 1OHQA 2O5ZL 4TVPH 3H3PH 1WQVT 5K59E 3AXLA 3OKLB 1ZA6A 1R0AL 4XX1E 5ID0B 1F4YH 1PLGL 1BFOB 4G8FB 2R56H 2OYPA 3AAZA 2ZKHL 4IMLA 5HY9B 3MV11 1HINH 1EAJA 4JY5L 3ULVD 4HKZB 1WBXA 3SKMB 3SQOH 3DX6B 4GOSA 1BP3B 4GRLD 3CDGB 5GSVA 3SDCA 4KV5E 3QPXL 1MCCA 1AGCB 4NZUL 3QAZC 1A7PH 3B8YA 3WE6B 4E9LA 1I1AD 2R0ZH 3W2DH 5E4EB 4JFEE 4OLWH 4R7DA 5EZOH 4I0PA 2B1HH 5DJ0A 4Z7VF 4D3CL 3W82A 1MFDL 1FNGB 4HEME 3RZCD 2JTDA 3GI9H 2FBJL 2ZSWB 1I3UA 4M03A 3GMQA 5IQ7H 4DGIH 5JZ7C 3IFNL 3EKCA 4P59H 1A6WH 1OQOA 1VFBA 4PJDB 3TH2T 1BFVH 4OAWB 3LKNB 1X7QA 4WW1A 1RJZB 3GSRB 1BBJA 1QFPA 4K3GA 2VSCA 1I1CA 2DKSA 1PYWB 4PJGA 1MIEL 1T1YB 4G6KL 1NC4A 2BVTA 3U9UB 4M43L 1U0QA 4X83A 4KJPC 4U0RC 1T21A 3QFJA 2W9LA 5IBLD 2DM7A 2VDOH 5E5MB 2LE9A 2VKWA 4YDJA 4ZPVB 2ARJB 1XF4B 2F54E 2YRLA 3WFZA 4BFIA 1ZLWH 1UFUA 2BHUA 1KN2L 2GAZA 3H0TB 1ZMYA 4NO3B 1GOFA 4HIJB 3IS0X 5JUEH 5F7WC 3PL6D 1O0VA 4WTWA 5SWSA 4CNIB 1T0NA 1KJ2H 3OAUH 3ZDYF 5JNYA 2J12B 2C3VB 3GKWL 3JUYA 5CSZA 3TJEH 5EUKA 5GHWH 3ZTJH 1UKTA 1BGXL 4NWTL 3OKLA 3UJTL 1Q0XL 1YC8A 2YD9A 1RK1B 1JRHL 4NKQB 5ID0A 1BFOA 5F7NC 4G8FA 1GPOH 3FKUS 4XNYL 5HY9A 4Y88A 4HKZA 4FN0A 5F7MC 3SKMA 3DX6A 5D1ZC 5IHLB 3OKNB 3CDGA 1IZKA 4KXZH 5GGRY 5F7HA 1AGCA 5IUSA 4HS8H 3DVIA 1OTSC 3WE6A 5T5NG 1NEZB 3B9KD 5DK2B 1PZUB 3BW9B 1SJXA 2J5LB 5DEFB 5LBSH 4KH2A 4AQOA 2WBJD 2H45A 3UTSB 1GZQB 1HIML 1FNGA 5EA0H 3KLHC 3PDDA 2ZSWA 1ZWIB 1RZFL 4OZFG 1QFWH 3MC0A 4ZO9A 4OLVH 4PJDA 1U3YA 3DJ9A 3NCMA 5ADPH 5HVGB 4OAWA 3LKNA 1UH2A 2DS4A 3D25B 1VACB 1RJZA 3GSRA 2B20A 2DJUA 3BQUC 2NY1B 4PRAB 4TOYH 1PYWA 4G7YH 1T1YA 5C09B 2P8MB 3U9UA 5MP6L 5IHBA 3TZVB 1JHLL 2NYYD 5E99L 4UV7H 4XCFL 4Z7VB 5E5MA 1EFQA 5DJYB 5FGRA 1VDGA 4ZPVA 2ARJA 2F54D 4P5TB 1XF4A 1MCRA 5K93A 3O9WC 5ENWB 3H0TA 4NO3A 3RX7A 4YEFA 3ZE2E 2VDKL 4HIJA 4XPGH 5FK9B 4NPYB 3TLRA 4HGMA 3IYLW 1RIVL 3KPSB 1CN4A 1YY9D 3FB8B 4AQ1B 4AIOA 4HMCA 4OFDA 4CNIA 1JGVL 2NY5L 2C3VA 4P9HH 4W4OC 4JQVC 4YHYC 1A7OH 3V6OE 1RK1A 2AI0H 4I3SH 5MI0C 4Z7WE 2C3WA 4GG6E 3ALPA 4GKOA 3B4NA 4PJBF 3HMXH 4MVBC 4TVSa 3CFDB 4RX4D 1CR9H 4BZYA 4M6MH 2AJYH 3RVTC 3OKNA 3FN3A 1OAYL 3ELAT 1RZGB 5KW9L 5I8EB 5FXCH 2FNBA 5I1EH 2VO5A 5I8OH 1NEZA 5DK2A 1J0JA 4OGAD 5E5UB 2FX8L 4KK9D 3BW9A 5DEFA 1UYWH 3UTSA 4AEEA 1GZQA 2W9EH 1RFDH 2VDRL 1ZWIA 5CJ5A 4ZUWB 5GGQL 1P84J 3H9SD 4MB5A 2X4TB 4PJAE 4KY1H 4NNPH 4F7PA 3DOSA 4MWFB 5BJTB 3MUZ1 2OLDA 3LQAL 5I8CB 3D25A 1VACA 5DRXB 1QRNE 5EN2B 3VGBA 4XB7A 4PRAA 4NN6B 1UH4A 1GGCH 4JFFD 2HRPL 2X5PA 1MQKL 4JRXB 3HNSH 5C09A 2P8MA 4NQXB 3TZVA 4JPVL 4L4VB 2VN7A 3PJSB 3PP3H 2MCPH 4MJ6A 4Z7VA 2KZWA 4TUJB 3JV4B 3VH8G 4ETYA 2F58L 5DJYA 4OM0L 5FHAH 2Q8BL 4GS7C 4P5TA 1RZKL 4ZYKB 3NCCB 1JPFB 5ENWA 2NY6D 5E2UL 3TT1H 5FK9A 4JG0H 4NPYA 3GSWB 1VHPA 3KPSA 1OP3H 1A6UH 4XNXL 3FB8A 3RY6C 3KPRA 4AIXA 4WJ5B 3VDCA 2MKLC 5IHZB 1SY6L 4S1DC 1WISA 4X4YB 3H9ZA 5CP3H 2Q8AH 1F8TL 4XBEH 3RY4A 3ULSB 1AHWC 4HIIA 2OTUB 2PYEB 4ZQKB 4M8QB 4GKNB 1U3HC 3I3BA 4N9OB 1I1FB 4UILL 3CFDA 4MNGB 1AQDB 3S96B 1IGJB 1RZGA 1KB9J 5FEBA 4Z78B 4MXQC 5T1LD 4WI8A 5I8EA 5IT2L 1YNLL 4XXCA 2EC9U 3KYKH 4R8WL 1DN2A 3B9AA 1P4LB 2R4RH 4NZDA 4LCIH 4YDIL 2F8OA 3D5OF 5LXGH 4WIQA 4GMSH 4MSWB 4BK4A 2JJSC 4GLRI 4FQJH 4ZUWA 3RDTB 1PY9A 2ARWA 2X4TA 4WVRA 2JJWA 3SE9H 3A0OA 1KCKA 3VFPB 1UZ6E 5BS0E 4MHHG 4MWFA 5BJTA 1IE5A 4J3XA 5I8CA 1T3FB 1DVFC 1QRND 5DRXA 1RUMH 2GY7B 3KXFE 5EN2A 1W72H 2IC2A 4MNQB 1QBAA 3KLAB 4RMQA 1YJDH 2ITCB 3FB6B 4GBXD 4NQCB 5I17B 4JRXA 1BJ1J 3GUTB 4NQXA 4OI7A 2E9WA 4Z7UE 2FHBA 1NH6A 1ODAA 4L4VA 3PJSA 4GO6B 4U2ZA 4XAWH 4M8VA 1YN6B 3ES6B 3O8XB 3CDCA 3TA3B 4TUJA 3JV4A 5D6DC 3T65B 1XGYL 4DVBB 4ZFOL 4D9RE 5I0DA 1FBIL 4ZYKA 2DQTH 4QTIH 1BMGA 5I73B 1P7HL 1CD9B 5CJQH 3GSWA 3HC4L 4LLUB 3QHFL 4N8CH 3C08H 3FJTA 3J7HA 5DRZB 3CZFB 4K2UL 4WJ5A 4X7FC 4KQ3H 5IHZA 1HQ4A 4X4YA 2ZOKB 1VB9A 1YQ2A 4PP1D 4JREC 5F44A 4YC2B 2OTUA 2PYEA 1IL1B 2OTWB 4M8QA 4ZQKA 5IBUB 5FUCC 3LH2L 5CEZL 1I1FA 1T7VA 4M62L 4MA8L 4MNGA 3GI8H 4UOW0 4GG8B 3ZDZF 2EO1A 4ALAH 3S96A 1IGJA 4KVCH 3TBSB 3V4PH 4NM8L 4Z78A 4LSQH 3WBDA 1IZJA 1FIEA 4XTRC 5JMOC 4G6AC 4PY7B 4K94L 3S37X 1VPOL 4AMKH 2CDFB 1P4LA 1WBYA 2VZOA 4U1HB 3FMGH 4GAJH 3KGRA 1OSPL 5CSBA 1PJ9A 5DMGD 5FF6B 3V8CA 4MSWA 4Y2DB 4M48L 3LN5B 3RDTA 4LVNB 2GSIB 3U7YH 5ALCL 5C92A 4QRPE 3VFPA 2DTSA 5BS0D 4APQC 1T3FA 1A7RH 3KXFD 5DSCB 2X6MA 4MNQA 3KLAA 3AS3A 2ITCA 3FB6A 4NQCA 4P3CL 5I17A 4QXGH 3GUTA 2FZ3B 2DQJH 3WLWC 4Y16C 3MA9H 2BNRB 4D0CB 1J1PH 2ADIB 1U8LB 1MEXH 3TA3A 1YN6A 3ES6A 3O8XA 3QIUC 5GRWA 3T65A 4DVBA 5H94B 4D9RD 1VSCA 3KYNB 3B3IB 2EXWD 4KKNA 2PO6B 4P23D 4OZHB 3L5XL 1TETL 4PYHA 3D2UD 4KROC 1QLRB 4YFEA 2DD8L 5F7UA 4DGVL 4NC0B 3UDWA 4LLUA 3NA9L 3CX5K 4UTBH 3OZ9L 4UAOC 3AB0B 2R69L 4XC3L 4C55A 1AGBB 5DRZA 3CZFA 5C6TH 4F2MB 3BMWA 3OB0K 2BFVH 3L1OL 4CW1B 5I75C 4M1DL 2ZOKA 4RCAA 4OF8A 3ZMRA 1IL1A 3B8SA 2OTWA 1OAZH 1CWVA 1TZIB 3PWUB 4IMKA 2K9UA 1YEJH 4WFFE 3GBML 5JLZA 4GG8A 3P0YL 4KXZI 4I3GA 2DM4A 4KPHH 4WI6A 3TBSA 4BFBD 1QFWM 2ZCHL 4LSRL 1P84K 5DJ6B 3PXHA 4JO4H 4PY7A 1GHFH 4OCSH 2CDFA 4YLQT 5J9PB 4JKPH 3FONB 3ZLQC 4CVZB 4U1HA 3LD8B 2EKJA 1H3UA 3L3OB 2ZUQB 1TZGL 4S2SB 1AJ7H 4Y0GA 1ZLVK 1BIHA 1QFWI 3NOIA 4Y2DA 4IEFB 4XX1G 4XVSL 3LN5A 4I2XB 3T0EB 2GSIA 3SO3B 3VG9C 4QRPD 4JFPB 3ARFB 4FZEH 5GGVH 5EU7C 3L3KB 1OAUL 5DSCA 3VI3E 3ALXA 1YEDA 2R1YB 2MWCA 3BN9C 4LF3B 5FYJE 3M1BB 2FZ3A 3T4AB 3R8QA 1Q72L 2ICCA 2XTJB 4LAJH 2VXTH 2BNRA 5F6HI 4D0CA 1NCBH 3S37H 1C5DB 3RJQB 4FQIH 1J87A 5H94A 3KYNA 1EFXB 3B3IA 2IG2H 1X4YA 2PO6A 3RNQB 4OZHA 1F2XK 4K9EC 1QLRA 4PG9B 1B4JH 4RFNB 4YZFF 3LKOB 2VISB 1AGBA 5E2WH 3JVGA 1KB9K 4F2MA 4CW1A 3MJ6A 4N8PA 5AAWA 1JZ8A 3D85D 5HHXL 1SYSB 3GGWB 3SKOB 2FRGP 1U8MB 2Y06L 1TZIA 3PWUA 2A6JB 2OZ4A 3JV0A 4WFFD 2BHZA 4P4KC 1YEHL 4ZD3L 3TFKD 3GIVB 5GS1C 4FQ1L 3EYUL 4P46B 2Z31B 1WC7B 5DJ6A 4C83B 4EOWH 3P40A 1XR8B 1NSNL 2JIXB 1DBKL 3BP5B 3QPQD 3NVQA 3EDFA 1MCEA 5J9PA 4CVZA 3FONA 2MQCA 5LCVL 5JOPE 5AAMA 3L3OA 4F8TA 3BT2L 4S2SA 1IGCH 3DBXB 4X80H 4QLRA 4AG4L 1JPTH 1YMHB 3L3DB 4HV8B 1CQKA 1BZQK 4I2XA 3TIEB 3T0EA 3MJ9A 2PKDA 5EOCH 4JFPA 3ARFA 2OP4L 2NXYD 4LGRB 3L3KA 1S7SB 5F1KC 3X13B 3ZL4L 3DX9B 4OF3A 1VESA 2K1MA 3QI9B 3HZYB 1IKNA 2NW2B 2QEJA 2R1YA 2BRRL 4LF3A 4JFQB 3CAFA 3M1BA 1P53A 4G8EB 1HNGA 3T4AA 1EH9A 2WLZA 1FHGA 4KHXH 2NQCA 4PGCB 3CDYA 4TTGA 1J1OH 1C5DA 4DVRL 3LOWA 4DTGL 2VZTA 5HPOA 5SWQB 2VDMH 1JPSL 4LHJB 3D18B 4ZTPH 1NMBH 1EFXA 1FN4B 1IAKB 4BQ6A 1F3JB 3RNQA 3P4NB 4M1CD 1YEGL 4FFYH 5FV2A 1F6FB 4IRJC 4XHJD 4PG9A 1ZT1B 4KK5D 1BOGB 1MFNA 3BD4A 1PBYA 3OKKB 1D9KB 1CXKA 3LKOA 3QUXB 2VISA 3WDJA 2R2EA 4X8XA 4DGYL 4FQLL 1F2QA 3BPOB 2B8OT 4AT6B 4M6OL 3LEVH 1QRKA 5FGCE 3RWFB 1SYSA 2XKUA 3GGWA 4U49A 3SKOA 2XA8L 3G5ZB 5CGYC 1CFVL 1CLYH 1U8MA 3WIFB 1T66D 4PYGA 3RKPA 2A6JA 5A2JH 4BZ1L 3O3EB 1LE5B 5F6IC 5AWNH 4OSUL 2JB6B 2CQVA 4OZFB 3GIVA 2CO6B 3MRQB 4EN3D 1BAFL 5DFVC 4P46A 5C0AB 5I1KL 2Z31A 4JKLA 5L7XL 1MFEH 4C83A 1XR8A 3MUGA 3NAAH 1WZKA 4JY6B 6FABL 2JIXA 1MHPH 3BP5A 4DJMA 3MODH 1DQTA 4XVTL 5JOPD 5C08B 4BA8A 4GKSB 1OCWH 4IIQC 3DBXA 1OY3B 2I60H 1N7ML 4W70A 4ZOBA 4BQ8A 1YMHA 3L3DA 4HV8A 4AIZB 2QSVA 3TIEA 2MKWA 2G60L 3C8KB 3LHPL 5BVPL 4OFPA 4ZOAA 3KNBA 2B5IC 4NOBA 1V3JA 1XT5A 4ONFL 4TPRL 3X13A 1KBGH 3ARDC 4UOW1 3HPJB 1LWRA 3QI9A 3HZYA 1U36A 2NW2A 3CNKA 2AQ1A 3IETB 4JFQA 3TO4B 4G8EA 2X05A 1JUFB 2IJ0C 4OZGE 4MXVF 4PGCA 4WHCA 2CKBL 2W91A 5SWQA 4NC1C 1X5XA 3B83A 3D18A 5DQDH 2E6QA 1FE8L 2HAZA 2NZ9D 1FN4A 1IAKA 5TE7L 4OI8A 1F3JA 3P4NA 4GAFB 5BZDB 3N1QC 2Z8RA 3VFNB 4HLJA 1ZT1A 4P2OB 1YECH 1BOGA 4NNXB 3OKKA 2ZUUA 5DT1L 1CTNA 3LQMA 5E70A 5D7JD 3CD4A 1D9KA 3QUXA 2XZAH 4K7PY 4Z8FL 3ZT7A 1YYLL 4PJ8B 5F8QC 3FT3B 4AT6A 2AEQH 3PP4H 4E41B 3EOBB 3CMOL 3RWFA 4H20H 3RJDA 4XPBL 1E4JA 3E0GA 5HI4D 3G5ZA 3OL2A 1BFSA 2FIKB 5FV1L 3WIFA 1I9RH 3IAGC 4TVPL 2I26N 3H3PL 3O3EA 1LE5A 1X5ZA 1TQBC 5LGKA 4OZFA 1F4YL 1VFUA 3DHJA 3MRQA 1K4DB 9CGTA 2R56L 4FFVD 1NAMB 4KKAC 4RGMC 5C0AA 2LAGB 3SJVB 1HINL 5C0BD 4EI5B 3PWLB 3SQOL 4KZDH 3ABZA 1T1XB 3SO5A 2WAHA 1HKFA 3JWDH 8FABB 2ICEA 5C0EB 3BDBA 5C08A 3UO1H 4GKSA 5F72S 1A7PL 1KLFA 2R0ZL 3W2DL 1YPZF 3L5WB 1ROWA 3S3PA 4AIZA 5E8NB 4OLWL 1KN4H 3MUY1 3NZHH 5EZOL 2B1HL 3C8KA 3VH8B 1H5BC 2K3TA 4NKIH 3GI9L 3MRDB 3RVWC 1KV3A 5ALBH 4PY8J 5IQ7L 3HPJA 1WAAF 4DGIL 1KF9B 4PGEB 3W9DB 5KVMC 4P59L 1A6WL 2DL2A 2KH2B 1KLUB 4G6JH 5IVXE 1BFVL 3IETA 5DGQA 3TO4A 4PG2A 5A2LH 1JUFA 3RVXD 1R5IA 2BVOB 2XWJB 3FZUC 5EBMB 5GRXG 2EDYA 4QHKJ 2X70B 4CU6A 2FL5B 1T7YA 2ERJC 2A73B 1HHHB 5BZDA 2IBZY 4L4TE 3NCEB 2VDOL 1A7QH 4P2OA 3ULVF 4NNXA 5EPMB 1NUNB 1NC2D 4NCDA 4R9HA 3QDGB 3PWPB 3K2UH 4PJ8A 4WW2C 1IEBB 3P2TA 5JUEL 4YHNB 4N5ED 4E41A 1FLRH 3EOBA 3OAUL 1KJ2L 4POZC 3B2UC 1OGTB 1V3LA 3TJEL 5GHWL 3EOTH 3OBAA 2ICWI 3N85H 1K4DA 1PDKA 1GPOL 3IS1X 1NAMA 4ZTOH 3SJVA 3C5ZB 5D7IF 4EI5A 3PWLA 6CGTA 4ESKA 5GZOC 1T1XA 4ZAKD 3GJFK 4MAYC 8FABA 3Q0HA 4HS8L 5C0EA 4LHUB 3CPLB 4Z7NE 1KEMH 2X89A 3M07A 2EIZB 2NY0D 5E1AB 1RZ8B 3L5WA 5I74B 5LBSL 3WIHH 3E6FB 1FYTB 4LEXH 3CZJA 4RAVB 5EA0L 3VH8A 3HMXA 1Q9KB 1QFWL 2H32B 2GFBB 3SKUD 4PGEA 3W9DA 4OLVL 4A6YH 1KLUA 5ADPL 5KBNC 1WUNT 5F97E 3CVHH 3GRWH 2BVOA 2XWJA 2IH3B 4YBQD 4TOYL 5DD1H 4U4BA 3H2WA 5EBMA 4G7YL 2X70A 4JVUA 2PXYD 2ZG2A 1H3PH 2FL5A 4HEPG 4PP2B 1YPZB 5K59F 3VXNB 2A73A 4LVHB 4K23H 5J89A 3ARXA 1HHHA 4UV7L 3VFUB 2CIIB 4L4TD 3QUMH 1K85A 4IS6B 3FO1A 1GJIA 1GGUA 4OI9A 4MQXC 1VCAA 2NX5B 2L0DA 5KG9B 2VLRB 4YUEH 3MV01 1CFNB 5EPMA 3ZHDA 3C8HA 4KV5F 4QXWA 3RX8A 4AJ0A 1JHKH 4R90H 4DK3A 1RPQA 3PWPA 3QDGA 4XPGL 5KN5B 1IEBA 5MHSE 4YHNA 1NMCB 1MVUB 4JJ5B 4A2MA 5IJKA 1XF3B 1HYSD 3S7GA 3DGGB 1OGTA 4N9GB 3P3YA 4P9HL 1EIBA 1A7OL 1MAKA 4XZUB 1T2XA 3ARED 5C07B 2AI0L 4KGLA 1LGVA 4I3SL 3L5JA 1G7HB 3PIQB 1EBPA 3KJ4B 2NY3D 3C5ZA 3HMXL 1CR9L 1D3CA 3RKDC 4M6ML 2AJYL 1J7VR 5TDPB 1XAUA 4R6UA 4J3TA 3T0WA 2E9JA 3TVMD 1VEMA 2FO1A 3LKQB 1XF2B 4C56E 1CD1B 1MCHA 3ULUC 4LHUA 3CPLA 5I1EL 5KOMC 3DROB 3GM0A 5HPMB 5I8OL 2EIZA 1AO7E 4XPFH 1CE1H 1PEZA 1QSEB 4O51B 5E1AA 1RZ8A 1NBVH 4KKBC 1UYWL 3PQYB 2YN5A 3E6FA 1FYTA 4RAVA 2BY2A 1SMOA 4HUUB 3RZCB 2W9EL 1RFDL 1UWXK 4BZ2H 1Q9KA 2H32A 4F7EB 2GFBA 4LIQE 4R2GD 4GH7B 4KY1L 3IDXH 4NNPL 3IU3B 1TJIH 3GSQB 3WNKA 5D7IB 2FWOB 1OARH 1FCGA 1MCNA 2IH3A 1GGCL 3BPNB 5EU6E 5ILTH 1JL8A 2N1KA 2AK4B 1P5VA 3HNSL 3OX8B 4BYHA 1MJJB 3ARZA 4PP2A 1YPZA 1DQLH 3OJMB 3VXNA 2MCPL 3TF7C 3VFUA 2CIIA 3GB7B 5K9OB 2XZQH 4IS6A 1VERA 1OTUD 3SE3C 3TH4T 4NRZB 2I9LB 5FHAL 3UTTB 2NX5A 2CDGB 2V5RA 5KG9A 1J9CT 2VLRA 1WAAA 1CFNA 3MV9B 4HC1H 3TT1L 4JG0L 5MHSD 2HT2C 1A6UL 3D39E 4PTUB 3T3PE 1MVUA 4JJ5A 2QHRH 1XF3A 3MACH 4PJ9B 4RQQB 3DGGA 1Y6MR 2IGFH 4N9GA 4YFDB 1RHFA 4TSBH 1Q38A 4XZUA 3REVB 2Q8AL 2Q3AA 1TJHH 4XBEL 5C07A 5A43C 4X0KB 2VE6B 1G7HA 2AQ2A 3PIQA 3QDME 4XGZB 3RHWF 4HFWB 5TDPA 2VLLB 2AP2A 4C56D 4ENEC 3LKQA 1XF2A 1CD1A 4ZXBD 4KMLB 3KPPB 3U46B 3DROA 1F45A 1GZPA 5HPMA 2BY3A 1AO7D 3KYKL 3B9KB 2VLKE 2R4RL 4OKVB 4JFEB 4LCIL 3PQYA 2R1WB 4LLYB 4TN9A 1IFHH 5LXGL 3RZCA 1BPVA 4GMSL 5DVLA 4FQJL 5ESAB 1FH5H 3SE9L 2ICWB 4L1DA 3IU3A 4J3WA 3FQWB 5LGHH 3GSQA 5D7IA 3ZE2F 2FWOA 2NY2B 2CR6A 3O4LE 5C0ND 1RUML 3OHXB 1W72L 2YPLE 4K3DH 4PJIB 5E6IC 5EU6D 3RIAF 1RJYB 1HYRC 1YJDL 2Y07H 2AK4A 4UDTB 5KANG 1ZGLP 1HXMB 4CDGC 5B38G 4L9DA 3OX8A 3QNZB 2WIMA 4U2YA 1MJJA 1OOAA 5A3ID 2OX5A 2VAAB 2XN9B 3FFCB 4XAWL 4Z7WF 3OGCB 3GB7A 4P3DB 5K9OA 3GSNH 4GG6F 1FL3B 4UINH 4NRZA 2I9LA 2O93L 3UTTA 2CDGA 3OKYA 4HWBA 1S9XB 2P43B 2DQTL 4QTIL 5ELIA 2F54B 3IXTB 5CZXC 5C2UB 3MV9A 4NQVB 3BUTA 2RQ8A 5CJQL 1DBMH 1BZ7B 5F7KC 3VMOA 1MNUH 1UXWB 4P5KB 3D39D 1XIWB 4K71C 3C08L 4N8CL 4PTUA 4QYOB 4UZGA 4PJ9A 4RQQA 3E6HB 1D6EB 3VGAC 4KQ3L 1M7DB 4G7VH 4S0SD 2WWMD 4ODUB 3A67H 4H5SB 3REVA 5MEQB 4BQBA 1MFCH 4X0KA 1JTTA 3QDMD 3AY4C 2CXGA 1R3IH 4PJAF 4XGZA 3UPCA 1BOYA 5IGXH 3GI8L 5K9QG 4ALAL 1Q9OB 1JWSB 4HFWA 5T3ZH 2VLLA 4KVCL 3V4PL 1A6ZB 3ZKXC 4D9QE 4LSQL 2BHYA 3F7YB 3KPPA 4Y19E 1S9YB 2YBRB 4MS8C 3U46A 3LPGA 4M00A 4AMKL 3B9KA 4OKVA 4JFEA 3FMGL 4GAJL 2R1WA 4LLYA 5E8PA 1E0OB 2WBJA 4PBVC 1MWAH 4ODTH 4RDQG 5T33H 5ESAA 3U7YL 1LO5B 1T89C 4YEEA 2IADB 3FQWA 1T5WB 4LPUA 3QDHA 3O4LD 1A7RL 1WF5A 2YPLD 2WUCH 3OHXA 5F93C 3ZKMD 4PJIA 4KZEH 4OBSA 1RJYA 1MY5A 4UDTA 3F7RA 1HXMA 4QXGL 3ZYIA 2DQJL 3QNZA 4LASH 1KPRB 3MA9L 2XN9A 3OGOE 3HLAB 1MEXL 3OGCA 4PS4H 4P3DA 2FJHB 4XVUC 1OWRM 2ZUVA 3MLSH 3WS6A 3DMMB 1X5FA 1Z9OA 1S9XA 4NN6C 4JM2C 2E7CA 2F54A 3IXTA 1JZ3A 3MOAH 2FYYB 1A1OB 4NQVA 2P24B 4QRRD 4TSAH 1BZ7A 5T1KD 5ACZB 1UXWA 4P5KA 2ILLA 1IC5H 1MRCH 1XIWA 1HCVA 2HFFB 4QYOA 3EOAB 1KT2B 4UTBL 4KK6D 2EC9T 5C6TL 1D6EA 3X3FH 3ZTNH 1GC1C 1M7DA 2DIBA 2BFVL 5D1QD 4ODUA 4H5SA 5A16A 3V0AC 2DICA 5MEQA 1S5IH 3UBXI 1KSRA 3OF6D 3MSPA 1OAZL 1CIUA 5IB5B 4EUPH 1YEJL 1UZ6F 2X4RB 1NCAH 4Y89A 1HSAB 3TBTB 4XAKE 1Q9OA 1JWSA 4KPHL 4NUJA 1A6ZA 1NQBA 2GQHA 2P5WE 3F7YA 5T1LB 4Y19D 1S9YA 2YBRA 4JO4L 4LLMB 3BESR 3V2AR 1GHFL 1I7RB 2D7QA 1FV1B 4OCSL 2D3VA 3BVNA 4X5XB 4Z7UF 5TJWK 4JKPL 4YIQB 4U3HA 3MLTB 1AJ7L 1I8LC 2AS5M 3IFOB 1YZZA 3K74B 5HD8C 5HHMB 4POYA 1LO5A 4DOHE 1PX3A 2YXFA 3HHRB 4FZEL 2IADA 5GGVL 1T5WA 2NY7H 2J8UE 3MUHL 4P0DA 1LP9F 4B7IA 3DX8B 1U8OB 5F7LB 4FXLA 3DHMA 3BFOA 5C0CD 4LLQB 1C5CH 1A02N 1KPRA 2VXTL 4CVUA 2HLFD 1HEZB 1NCBL 5L2KE 4I1NB 3HLAA 3S37L 2RAMA 3QBTB 3DTXB 4NQEB 2FJHA 3DECA 4FQIL 4NIKB 2IG2L 5ISZE 3DMMA 3VXRB 5KZCB 4MAUH 3W11C 4B5EA 1I85C 4WEMB 2FYYA 1A1OA 1T2JA 2AKRB 4RGNC 4N0UE 3QEQB 1HCFX 5ACZA 4Y4KD 2RFXB 1M4KA 4WWKB 1B4JL 3E3QC 2HFFA 1T6WA 3EOAA 4Z76B 1KT2A 3TA3C 3O8XC 5HI3C 5E2WL 2ICES 2VC2H 3VRLE 3V6OA 1SVCP 4C54A 3SDAD 4AENB 5DVOA 5IB5A 4XP4H 3UDWC 4GRMB 2X4RA 4XAKD 1HSAA 1QQDB 3TBTA 5C9JB 3DV4B 5IKCB 4L1HA 1KIUA 1OM3H 4EOWL 5BMFH 3BYYA 5T1LA 5F88B 4LLMA 5IEHB 5IR1B 1BD2E 4PRDB 1V8HA 1G7PB 1I7RA 1FV1A 4AEHH 4FG6D 4YIQA 3OKDB 4IMKC 3DXAB 3WEXB 2KPNA 4OT1H 3MLTA 4Y4HB 4DEPB 4HIHB 1IGCL 3WIIL 3OPZH 1FJ1B 3H3KA 3IKKA 4X80L 5BO1H 1JPTL 4O5LH 3VXOB 4M3JA 3IFOA 1X4XA 1P9MA 3RWIB 5EOCL 1JNHB 1IGFH 2EZ0C 4GQPH 2F19H 5HVFB 5HBBA 4JZJC 4OCYH 5I2IB 3KXFB 4WO4C 4KJYB 3DX8A 1U8OA 3STZB 4Y5VB 2UZIH 1VKXB 2CIKB 4Y2DC 4LLQA 1UEYA 5JHDB 1JGEB 2X1PA 4KTDH 4LVNC 5B21A 1CU4H 4KHXL 5L2KD 1HEZA 1NGWB 3TIDB 1J1OL 1AC6A 1XF5B 3DTXA 4NQEA 2VDML 3NBNA 1DBBH 3CFEB 4ZTPL 1NMBL 1F13A 3VXRA 4JPIB 3EJZC 5EU3B 4FFYL 1C12B 5CD5C 2AKRA 1CGTA 4RA0C 1YDPB 3IFLH 3QEQA 3RBSA 2EDJA 2RFXA 4WWKA 1LP9B 4Z76A 4M6AA 2YA1A 3S3SA 4Q9RH 1F4XH 5AG8A 3LRHA 4TQEH 2PO6C 3NN8B 3LVEA 4KJWD 4D0BB 5GS2H 3LEVL 4TRPH 1CLYL 4OFYA 1XMWA 4UUJB 3VXME 5AWNL 1F6LL 4GRMA 1QQDA 2C3XA 5C9JA 3DV4A 3VI3F 3JVGC 5IKCA 1MFEL 3HE7B 5F88A 3NAAL 1JMXA 5IEHA 3DSNA 2IPUG 1BD2D 4W68A 5EO0B 1MHPL 5IR1A 1S78D 3NFNB 3MODL 1G7PA 4Q2ZB 5D2LE 5E03A 5DVMA 3OKDA 3DXAA 3WEXA 4Y4HA 1OCWL 4HIHA 3P9MB 1TZHA 1FJ1A 4LDOB 4BFEA 4ZNEE 2I60L 3ET9F 4NQDB 4DN4H 3QUKB 3VXOA 4N8VB 3IJYB 4RZCB 3RWIA 1JNHA 4JRYE 5I71B 4UQ2B 4M7ZB 2X4QB 1KBGL 3UEZA 3WN5C 1GAFH 2D2OA 3WO4C 2Y5TB 5I2IA 3KXFA 1BVLB 2ZUQC 4KJYA 4LVOB 3HRPA 3ARBD 3STZA 2FEDD 2X41A 4XCCH 4Y5VA 1VKXA 3IKCB 2CIKA 3EFDH 4HJ0D 5JHDA 1JGEA 3HE6D 2XTLA 2HMIC 1I9JH 3ARFC 1NGWA 2HVJB 3TIDA 1XF5A 2EYTB 2QL1A 3WSQH 4DK6A 3CFEA 5C70A 1IILE 5DQDL 1OVZA 3DWTA 3UYRH 4JPIA 5D5ME 5EU3A 3QQ4B 3O2DH 1J5OH 3CMGA 1YDPA 3MV8E 1YECL 3S88H 2XTJC 2D4FA 1LP9A 3C6SB 5ITBH 2DRUA 2FHFA 5IVOA 2XZAL 1FLTX 3T2QA 4U6VH 3LZFH 3JWOH 3NN8A 4HULB 1YMMB 2R39A 5CGTA 2AEQL 3PP4L 4D0BA 1CD8A 5M7QA 2KKQA 1QKZH 4H20L 4KUCD 1CIDA 3LDBB 1I9RL 3VXMD 1FVDB 4M02A 4UUJA 1FO0H 3EO0B 4TTDC 2HTLC 3SDXB 2DLHA 3VCLA 1CGSH 3F6IA 3HE7A 4NZRH 5EO0A 3PWNB 4KZDL 4U33A 3TN0B 4Q2ZA 3JWDL 2B4CC 3WFCH 1CG9B 3UO1L 2OJEB 1F4HA 5IW3A 3GSUB 1FAKT 4NQDA 3N1FC 3QUKA 4N8VA 2Z31C 1KN4L 2Q6WB 4RZCA 3NZHL 3QIBD 4XMLH 3PV7A 5GISH 2EDRA 4QRPA 4B53A 4NKIL 5F1NB 3LCYA 4UQ2A 2VNCA 4Z18A 2X4QA 5ALBL 2VQTA 2Y5TA 5T3XE 1CE6B 1BVLA 3CXHJ 2A2QT 2HYMA 4G6JL 3MYJB 3IKCA 1HHIB 2IAMB 1AGEB 2ZOLB 3WKNA 1CXEA 2H2PD 2HVJA 3D3VD 5J1SC 1X3DA 4KRNA 3B5GA 4RDQF 4G9FB 2W1NA 5CZVH 1U8QB 3QQ4A 4KRPC 1A7QL 2DQHH 5DZNA 3JSSA 3U0WH 5E7BA 1CF8H 2IH1B 3C6SA 1H3XA 1EUUA 3VU2A 4Z9KB 2Z0BA 3C5JB 3K2UL 5DMJB 1TPXB 2EXYD 3RIAK 5HGBB 1FLRL 1V3KA 3V9FA 4LL9A 1KCRH 3LEYH 2HJFB 5D7LE 4EBQH 3EOTL 4B50A 4P2RE 1FVDA 4QOKB 5JQ6H 2PNDA 3N85L 4EN3B 3VA2C 2BXZA 4ZTOL 3SDXA 4HG4J 4LDLB 3VFMB 2UZXB 2D0FA 5ICXA 2VWEE 4IDLA 3PWNA 3TN0A 4OZGF 2HP4A 1CG9A 1JVKA 5DZOA 4BSVB 2OJEA 5HHOE 2MQ3A 3WXVH 1KEML 2ENSA 5B38B 3GSUA 4LARH 5CKAA 2E9BA 3CSGA 3VWJC 2Q6WA 4K9EH 2CUIA 4KKLD 1BIIB 3WIHL 4LEXL 1FGNH 2C3GA 5F1NA 3UP1A 3I02B 3VRJB 5T3XD 4PGBB 5CWSB 4ZS6D 2A6DB 2D9CA 1CE6A 1N26A 4A6YL 2N7BA 2UVFA 3UPRB 3GSVB 4JHWH 3MYJA 2Y4SA 1JNLH 1HHIA 4NP4H 1G1CA 1ETZB 1I1YB 2IAMA 4R4BB 3CVHL 1AGEA 3GRWL 1T83A 5DD1L 2X4OB 2ZOLA 2GJZB 1JI1A 5A2IH 3N50A 4ODSH 1YQVH 5IROA 2J4WH 3VXPB 1NCNA 3SDDD 1H3PL 2LVCA 4JFYA 4G9FA 4K23L 4CJ1A 3T09A 4UMGA 1U8QA 3QUML 3GMNB 1EZVY 4PG2C 2ATKB 3QHTC 3MTRA 1CQYA 3CSYB 1ZOXA 2IH1A 4YUEL 1EEUA 3AS1A 1JHKL 4R90L 3C5JA 2DYPD 3DETC 5LKNA 3DVFA 1GRWA 1SJHB 4FQXD 5HGBA 5DTFB 3WHE0 3KJ6H 4U1NB 5D7LD 4LHQB 2UV3A 2HJFA 4IOFD 2F5AH 4P2RD 3GSNB 4P2CG 3DYMA 3TO2B 1CVRA 4QOKA 1UVQB 5CJXA 4EN3A 3QAZB 3VFMA 3VG0H 5CD3B 4PJ5B 5IVXF 3X17A 4OCRH 4HLZG 2O5XH 3C60D 5HHOD 4BSVA 5D93C 4D8PB 5IIEB 3TJHD 5B38A 4XPFL 1CE1L 1RURH 2WK2A 1NBVL 4FRWA 2VZ3A 2EEDA 2GJ6B 1U42A 1BIIA 4EI5C 2Z35B 2H3NB 4BKLB 2Q1EA 3I02A 3QJFB 3O3UN 1H3VA 2OL3B 3IAQA 3I6LE 5TQ0H 4BZ2L 3WJLA 1KB5H 4PGBA 5CSGA 5DA4A 2A6DA 3ZDXE 2F53E 2Z8VC 3IDXL 3PG2A 2XWTB 1B88A 3GSVA 1TJIL 3UPRA 2MMXA 1UB6B 4DN3H 1NCCH 1K2DB 1KCVH 1OARL 2QQNH 3MRHB 1I1YA 4R4BA 3VJ6B 5JHLH 4U0RB 3THMH 2X4OA 2GJZA 4K7FB 5ILTL 2VZVA 4RISH 3VXPA 2OQJB 1DQLL 2Z92B 1JNNH 2FGZA 3GMNA 2HTKD 2XZQL 5IB2B 3WUZA 2ATKA 3SGDH 1TXKA 1VFMA 1X9QA 4UNTA 3CSYA 1AH1A 3GDBA 4V2CB 2ATPB 2DN7A 3CU7A 3BEWB 4HC1L 4Z7NF 2LVEA 2FBOJ 3ECBB 1FZMB 5AG9A 5IOPB 1SJHA 4DZBB 2QHRL 5DTFA 3MACL 3NIGE 3UC0H 2BSTB 4QGTA 2IGFL 3Q6GH 2YSSB 4U1NA 2VXSH 3RIFK 4P2QE 1L0XA 3OG6B 4TSBL 1ZA3B 4KHTH 4O02H 5D1ZB 1TJHL 4H1LH 5HGGS 5FM5M 3TO2A 4EIZC 2KQMA 1UVQA 3X11A 4Q9CA 1SMAA 4LDEB 1HH6B 1TMCB 2CLVB 4D9LH 5CD3A 4M7JH 4PJ5A 2P5EE 5IJKC 2WWKO 4ZUTA 4WY7H 4ZAKB 1M1SA 4Z77B 4D8PA 2BNQD 5IIEA 1CTOA 1BQHG 4LLVB 3IJSB 2NY0B 2NR6D 3ZHKA 2GJ6A 3KPTA 3C5ZC 2Z35A 2H3NA 1IFHL 1RHHB 4BKLA 3G08B 1RZ7H 1S7UB 1BQSA 3QJFA 2OL3A 1CK0H 1FH5L 5F3BB 4QGYA 5IB3B 2V2WB 2H2SD 2XWTA 5LGHL 1UB6A 1K2DA 4IM8A 1B6DA 3MRHA 5I74C 3VJ6A 2V5SA 2DJ4A 4K3DL 3GMPB 4K7FA 1ADQH 1NCDH 2Y07L 2P48B 2OQJA 2PXYB 2Z92A 4JDVB 2E7LC 5GGTA 3O9WB 3PF2A 5DJ8A 4ISVB 3GSNL 3S8WA 5IB2A 3NPZB 4UINL 3RWGB 1QSZA 5KSAD 2A6IB 4UNVA 4X6DB 2ATPA 1GYAA 1T80A 3BEWA 1DBML 1P6FA 3RGVB 4B0MM 1MNUL 3ECBA 4LVHC 1FZMA 1A3LH 5IOPA 1QHOA 5I9QB 5EBGA 4DZBA 3ARWA 5MI0B 2BSTA 2YSSA 4P2QD 2J2ZA 4G7VL 5MERB 1ZA3A 3A67L 5D1ZA 3NGBC 1G9MH 1MFCL 4UIKH 1RJLB 1R3IL 1HH6A 5CGMA 2CLVA 5IGXL 3BGMA 1NMCC 2P5ED 2OR7A 5T3ZL 1Y6KR 4ZAKA 4XP9H 4Z77A 2FSEB 4MJIE 1SBSH 2AJSH 4LLVA 2YD1A 3IJSA 1KCUH 4XNZB 1OGAE 2CRIA 1NLDH 5F6HJ 1R3HB 1S7QB 4NCC1 4N0CD 1RHHA 1E4XH 2IBZX 3ULVC 5I19H 1A9BB 3G08A 1MWAL 1S7UA 3S3JA 2YUWA 1PSKH 5A40E 2HA1A 4GRLC 5T33L 1UGNA 5F3BA 4HK3J 5ANME 1JWMB 4L3EE 5IB3A 2V2WA 1T7ZA 4FTVB 5IMOB 2ESVB 3BQUD 3INUH 3U83A 1I1AC 1V5JA 2WUCL 2D03H 5GJTH 5GGRB 5AUMB 3T3PF 4NJAH 4KZEL 3GMPA 4HWNA 1GSMA 5JORB 1FC2D 3RZCC 3O2VH 4LASL 2PXYA 4M5YH 5FOBB 2IMNA 4JDVA 5H35B 3IF1A 4ISVA 1TVBB 4PS4L 4EEEA 5EOTB 3V95A 43C9A 1IGTB 3RWGA 3MLSL 4I5BB 1ITCA 5E2TH 1NBZB 1QUNA 2A6IA 4PGJA 4S10A 4X6DA 2ZP0T 4ZOEA 3MOAL 5C0DB 2YD4A 4W4OA 4TSAL 3QUZD 3RGVA 4WGVB 5DUMH 1IC5L 1MRCL 2V5MA 4ZFGH 3C09C 4K7PH 4M1GH 1JNJA 4F9PC 5SWZB 2BY1A 5IBLC 3X3FL 4NQUA 3ZTNL 5MERA 5ACMA 1RULH 3NCYS 4YXKH 5BRZD 5ITFB 1NCUA 4R7NB 1S5IL 1RJLA 2WINB 2PW2B 4I9WD 2NY4D 4Q9QH 1NCAL 2EDHA 4HH9B 3PL6C 1DDHB 2C4FU 2N7AA 1GGIH 4C56B 2ZPKH 4RBPH 1T0MB 4MJID 5DRNB 2FLRT 2VJXA 4L8BB 4XWOD 1AO7B 3PHSA 1OGAD 1R3HA 1S7QA 4OUUB 1OPGH 5ACLA 1A9BA 3MGOB 2NCMA 3QNYB 4MA1C 1P1ZB 4L3ED 3N9GH 4FTVA 3VFRA 5E08H 2NY7L 2ESVA 5IMOA 2YRZA 3B9KC 5EZIH 5JW3H 5GGRA 5AUMA 1DP0A 2WBJC 4WEUD 5JORA 3BZFA 3IU4H 2IANB 1C5CL 1YC7A 2XQBH 3AMLA 5FOBA 4AL8H 4KKCD 1CFBA 1KTDB 2C26A 3V5HB 3WNNA 5H35A 4OJFH 5EDXA 3KYAA 2V5YA 1TVBA 5EOTA 4O9HH 1MHCB 1WFTA 1IGTA 3VDBA 1KFAH 4I5BA 1NBZA 4MAUL 3W0WB 4YHLH 5IW1B 3CDFA 4HUXB 3RY6A 5C0DA 1MF2H 3OQ3B 4Y2OA 5F7DB 3N0PB 1R3LB 2AXFB 4JREB 4YDVB 5FHBH 2NYYC 4MMXC 5CLTA 2VDLH 5SWZA 4YWGL 4QXUH 2VC2L 1U95B 5GXBB 3RAJH 5ITFA 4H0IA 4R7NA 2HH0H 4R4ND 2WINA 2PW2A 3FAXA 2XZCH 3QDMB 3CU1A 4XP4L 3F6LA 4EQ2A 3UX9B 5BOPA 3MNWA 2OXHA 1YY9C 1P7QD 1XEDA 2HT4D 4HH9A 1ZLSH 4GW4B 1OM3L 4C56A 5BMFL 2IF7A 4NYLB 1T0MA 5DRNA 3MR9A 3QWOB 5TF1H 4L8BA 2JJSA 1AO7A 4CADB 4AEHL 2VLKB 4ODWB 5JXED 4ZSOB 4OT1L 4OUUA 3WXWH 5GS2D 2JJTC 3E1F1 3OPZL 4APQB 1RZKC 5BO1L 2EKSB 3MGOA 4O5LL 3QNXB 3QNYA 1P1ZA 4OCMC 4L29B 2B2XH 2AQ3A 1IGFL 2F19L 1UM4H 2DI7A 1S5HB 1W0VB 3O4LB 4OCLC 4OGAC 4OCYL 4KK9C 4Y16B 4XNUH 5DUBB 4KFZC 2XG4A 5EU6A 3QIUB 2UZIL 1JV5B 5D6DA 2IANA 1YYMH 2YHGA 1G9NH 4GFTB 4KTDL 4PFEA 4IRZH 4Q0XH 1CU4L 4WCYH 3V5HA 1KTDA 4MX7B 3ARGD 2FH6A 1PKQE 4KROB 1V7MH 1DBBL 1MHCA 3SGDI 3TCLB 4KRLB 1E6JH 3OB0H 3W0WA 5IW1A 2ZUTA 4HUXA 5CINH 1RIHH 5D9SB 1C8PA 3MRKB 2HT3C 4JB9H 3IFLL 4HQQH 4BUGA 5F7DA 1R3LA 2AXFA 4YDVA 3UTZB 5CCKH 5DJAB 4YDLB 4Q9RL 3FB5B 1F4XL 3HC3L 2RR3A 4LSVH 4TQEL 1U95A 4UB0H 1LO3H 2BJMH 2KUTA 3UPAA 4TRPL 3UJJH 3QDMA 3PV6B 1OF2B 1MLCB 1JF1B 2J8UF 4HDIB 1QVOB 4FXKB 1MI5E 5EOQH 3GZKA 3KPQB 4GW4A 3IDNB 3JTSB 5FYLH 4AEIH 1FNHA 2WP3O 3V6OC 5HYSG 4NYLA 3QWOA 2C9AA 1TJGH 1AKJD 4M6NH 4CADA 2A38A 2UWEE 3IRPX 2I27N 4LQFH 2VLKA 4ODWA 4ZSOA 2FHCA 4APQA 4DN4L 2EKSA 3QNXA 3STBA 2EYSB 4NSKB 2VAJA 5I1LB 4PRPB 2JB5H 5E9DE 2H1PH 4L29A 4WU7B 3RUGB 2PETA 4M9OA 1JPST 1S5HA 1W0VA 1GAFL 3O4LA 3QG7H 2XOTA 2OS7A 3HAEG 1T1ZB 4Y16A 4IRSD 1F6AB 5DUBA 1WICA 3QIUA 4XCCL 1JV5A 2BSED 2YN3A 3EFDL 1P9MC 2P44B 3VRLF 5INCA 1I9JL 4MX7A 3HG1B 2APXA 5FOJA 3TCLA 3UYRL 5D9SA 3O2DL 2XICA 4GBXC 1J5OL 3MRKA 4NO5B 5AZ2H 3S88L 1N59B 4XNQA 3LQZB 3BEVB 2GITB 3UTZA 3KYMB 5ITBL 5DJAA 1JIBA 4R0LC 1QFOA 1RZIB 3DPBA 3FB5A 4U6VL 5CUSH 3LZFL 4P4KB 3ZKNC 1RY7B 1L6ZA 1EDQA 4DFIA 4P49A 5GS1B 1QKZL 3FL7A 4JGUA 2CKNA 1OSZB 2EDEA 3QCVH 3OF6A 3PV6A 1OF2A 1MLCA 3LSOB 1JF1A 1FO0L 1MI5D 4HDIA 3R0NA 1QVOA 4FXKA 4NDMB 3X3GH 5IP4A 3KPQA 1IC4H 3IDNA 3JTSA 1ORSB 3JV5A 3ZYZA 1CGSL 2P5WB 1X5HA 1MCKA 5F9AC 4NZRL 3GKZA 4Y19A 3QZWG 3UZQA 1QFUH 4RMVA 4HH8A 3WFCL 1E4XI 1WBZB 2B0SH 2E27H 3SCMD 1D5MB 5F9DC 2EYSA 4NSKA 4PUBH 4BH8B 5I1LA 2GI7A 4PRPA 4XMLL 5E9DD 4CU7A 4DOHB 4KTYA 4WU7A 5GISL 3RUGA 4GRWE 1G7MB 2J8UB 2XFXB 4QCIA 3BN9D 1T1ZA 1F6AA 3GMMA 2AEIT 3TPUB 1GC1H 3PDGA 4JPWH 5DMGC 3G6AB 1B4RA 5BQ7B 3W5NA 2WW8A 5L2KB 4IRJB 3HG1A 2SEBB 4WFED 2B1AH 3SGKC 5ISZB 3NPSC 1EO8H 1G7JB 1X5LA 3KVQA 3ZHLA 5CZVL 4Y5VC 4QEGA 3MRGB 2DQHL 4NO5A 4N0UB 1N59A 4YFLF 3LQZA 3U0WL 1A9EB 1N6VA 1CF8L 3BEVA 3O4OC 2GITA 3OKOB 3KYMA 3IDYC 5I1CH 4HBCH 5D2LF 1RZIA 1GL4B 3SQBA 1EPFA 2CLRA 2YMXH 4P4KA 5F6IB 3GSXB 2EYRB 1ZE3C 4P23C 4CKVX 5GS1A 1MREH 4PJ7E 3HTLX 1OSZA 5AYUH 1KCRL 3LEYL 4EBQL 4D2NA 2GSGB 3LSOA 4J4PA 4XVJH 4OV5B 4NDMA 5HTSA 3FAWA 5JQ6L 1ORSA 3G5YB 3WCYA 1EHXA 4CDHA 1N0XH 4IIQB 2QSCH 2P5WA 4LFHD 5JOFB 1RUQH 4FMFA 1FFOB 3FQNB 1BD2B 2ZUWA 1QP1A 1I8IB 2EDTA 3KPOB 4HKXB 2XY2A 3FB7B 1WBZA 1I9IH 5EC1B 3WXVL 1KYOJ 2YC1B 1CFSB 3VXSB 1D5MA 4C59B 3QDJE 3C5SB 3ARDB 4LARL 4H1LB 3AGVA 2A9MH 5E2JA 4BH8A 1G6RB 4J1UB 4K9EL 1FGNL 5FYJU 2IMMA 3QHZH 5IMLB 2YS4A 1WCBB 1G7MA 2J8UA 5GSRB 4X4ZA 2XFXA 2X2YA 1B2WH 2EDDA 4X9GA 4YGAB 1Y6NR 3TPUA 4JHWL 1JNLL 3ME0A 3G6AA 4NP4L 4PRIE 5F9OH 5BQ7A 5J0BA 3SE8H 5HYJD 5HHNB 3MRJB 4F15C 5JW5B 3HRZB 4ODSL 5L2KA 3MCLH 4IRJA 5I71C 1GXEA 1IARB 1YQVL 1WFOA 2J4WL 2SEBA 4PJXE 5ISZA 1I7ZB 2I07B 1TQCC 4LVOC 1G7JA 4LCYB 1XF1A 3QUYD 5FB8B 3QB7C 3MRGA 4JVWA 4N0UA 1FIGH 2XG5A 3U6RB 1A9EA 3OKOA 1JTPA 4OKDA 2ZZUT 2FLBT 2EDNA 4PV8B 1U8HB 3BO8B 1FQ9C 2COQA 3ROLB 5DQJB 3GSXA 4Z95H 1TQBB 5F89B 2EYRA 3HB3C 4RGMB 3KJ6L 5DVKA 3TT3H 5JMRA 2F5AL 4XC1H 1LE9B 4S0TD 2GSGA 4G6FB 4OV5A 4I77H 4NKOB 5C7XH 1MCQA 4JEGB 4RWYH 3KPNB 1N6UA 4KDVA 1WZMA 4WI3A 3G5YA 4X9IA 1R5WB 1NFDF 1JZ2A 1P4IH 3VG0L 5JOFA 5LVEA 5IMKB 1FFOA 3FQNA 1BD2A 1A6TB 4OCRL 3QRGH 2O5XL 3VGDA 1F42A 4HBQA 5D2LB 1I8IA 3KPOA 4HKXA 5H37H 5IFHH 3FB7A 5EC1A 3O41A 2YC1A 1CFSA 3VXSA 2EECA 2HFGH 4ZOCA 3QDJD 4KDTA 1HSBB 1RURL 3V0VB 3C5SA 3ARDA 3TFKC 4H1LA 4HX1B 1G6RA 1F3DJ 1ZHBB 4J1UA 4KGJA 1LEGB 3H8NA 1FP5A 5F1OB 4JRYB 5IMLA 1WCBA 5GSRA 4X6FB 3QPQC 5D1XD 5EO1B 2NXZD 5TQ0L 4YK4C 1HHKB 1KB5L 4YNYB 4H0GA 5DD0H 1K8DA 3F62A 5HYFA 4DN3L 1NCCL 1KCVL 4PRID 3WNMA 1KCSH 4OQTH 4OZIB 2QQNL 1QHPA 3AU1B 5JHLL 2ERJB 4OBRA 4HZAA 3SOBH 3THML 4IOIB 3V0WH 4G8GE 3MRJA 3HE6A 2IBBA 3HRZA 4V1DE 3HZMA 5DFTA 5JW5A 2NXYC 4RISL 3MZGB 1VEOA 2ZSVA 1CCZA 4YR6B 1I7ZA 2I07A 1JNNL 1ND0B 4YE4H 4LCYA 1M05B 1KIPB 1QG3A 5FB8A 3ULUF 4LPYA 2GUOB 3MV8B 4HIXL 3U6RA 4WHDA 3PGDB 4WFGE 1RSFA 2OZ4H 4PV8A 4X5WB 1U8HA 3BO8A 3ROLA 3KS0H 2APTA 5I1IH 1V7NH 5DQJA 3HNTH 3LMJH 1T04B 5F89A 4GKZB 3T0XA 2JKXA 1LO4H 3QCUH 1IEHA 3QQ3B 4M1CC 3UC0L 3Q6GL 4XHJC 2VXSL 1RQ5A 4KK5C 1LE9A 1KJVB 4M6OH 2AJUH 4KHTL 4O02L 4NKOA 1FG2B 1J05B 3KPNA 4NKMB 5EG6C 1IKFH 1CICD 4K8RC 2VUOA 1S9VB 3EOYG 1TPXC 3RNKB 1R5WA 3GJEB 3V7AE 3VFTB 1JYXA 4D9LL 4M7JL 5D96B 2YD6A 5IMKA 3MJ9H 3EAKA 4OIIH 4WY7L 1A6TA 5D2LA 2DDQH 5LWYH 1A47A 1T66C 1S7WB 4DAGH 2DKUA 3I84A 1HSBA 4ZNEA 3V0VA 1I7TA 4HX1A 4EN3C 1YEIH 1YEKH 1ZHBA 4J23A 1OAQH 1LEGA 1I1RA 1J12A 3QXAA 1CXIA 1RZ7L 4JRYA 1NUDA 4X6FA 5EO1A 1CK0L 1EGJA 1HHKA 2CK2A 4FNLH 1D5BB 4YNYA 1TENA 1IM3B 3NIDE 3VD4A 3IJHB 1NFDB 5CLWA 1G6VK 3FZUD 4OZIA 4YHIB 1IM9D 1WGOA 4E0RB 4IOIA 3ESVF 5C1MB 1ADQL 1NCDL 4DCQB 3VGFA 2R0LH 1ZVHA 3UZVB 3IGAB 3G6JE 4ELME 4YR6A 3SDDB 1ND0A 1M05A 1KIPA 4MD5B 1DFBH 3D48R 1W0YT 4PJGE 2GUOA 3MV8A 3BOVA 4EZMA 4Y4FD 4O58H 5TE6H 2B4CH 3WUWG 4WFGD 3PGDA 3MLYH 4X5WA 2NPLX 4PB0H 1QD0A 1MHHB 1T04A 1A3LL 2NZ9C 3HI6H 4GKZA 4Y1AB 1KACB 2A1WH 3QQ3A 1JF5A 4HCRA 3RVUD 4U1IB 3S5LG 1UQSB 3LS5H 4WUUB 4PJHB 1U91B 1KJVA 1KYOK 4X5LA 1FG2A 3KDMB 1G9ML 1WVZA 4UIKL 1J05A 4F58H 4NKMA 2YD5A 1OP9A 3ZDXF 1S9VA 3RNKA 2AXGB 4XPHH 1RI8A 3GJEA 3VFTA 1ZHKB 1CXFA 3A6BH 5A2KH 1UWXH 5HI4C 4XP9L 3ESUF 1S7WA 2O26U 4F57H 1SBSL 2AJSL 3UMTA 3ZZ1A 1KCUL 3N1GC 2R2HB 2MNUA 1NLDL 4FFVC 4KVNH 3P9WB 3W9EB 3TWCH 3SDCD 5ERWB 4LKXB 5FUZH 1E4XL 5I19L 1Z0NA 4Q58C 1PSKL 4LLDB 1D5BA 4OCXH 1IM3A 2YUXA 3IJHA 1NFDA 4OD3H 3INUL 4OIAA 2PYFA 4I0PD 4KI5E 4U6HB 4IDJH 4WDIB 4YHIA 2D03L 5GJTL 4E0RA 3I9GH 4NJAL 4AYFA 4RAUB 3G5XB 3NIGF 4EDXB 4DCQA 3O2VL 1HKLH 4FZ8H 2GK0B 4YBLC 3FQXB 3IGAA 4M5YL 3ARUA 3SDDA 2Y1VA 3PWVB 4HMEA 5D7KE 4MD5A 5GJSH 1L0YA 1MH5A 2DLGA 5E2TL 4EI6B 1QR4A 4H26B 4KJQD 4OZFH 3QFJD 1MHHA 5DUML 1MCBA 4ZFGL 4Y1AA 3WFDH 2QSQA 4Y8DC 4K7PL 4M1GL 1P4BH 4U1IA 2W07A 1UQSA 4WUUA 4PJHA 1U91A 1RULL 3BN3B 1H3TA 4KDWA 4YXKL 3KDMA 1BJ8A 3W81A 3MRBB 1LMKA 5IM7B 4XI5C 5EORH 5SWSD 1EO5A 2AXGA 4Q9QL 1JJUA 1ZHKA 4X6CE 1NUFA 4N5EC 1RZJC 3HAEB 5E8OA 3T2OA 1GGIL 1E4KC 2IFFH 1EVUA 2QBWA 2ZPKL 3ARTA 4W6YB 3C60A 3QXWA 4DZ8B 3IVKB 4Q6YA 1DSFH 4JM2F 4CAGA 2R2HA 3W9EA 5ERWA 4LKXA 1OPGL 1X5AA 4WHYG 3BZ4B 4WV1C 1EZVX 2GEEA 4LLDA 4ZAKC 4KRMB 1XR9B 5E6IB 1Z2KA 2F53B 3N9GL 1UC6A 5E08L 3VXQB 4KI5D 4U6HA 2NY0C 4LFHG 5EZIL 4WDIA 5JW3L 1Q94B 3H9SE 3X12B 1S7VB 4RGOH 4F7PB 3UYOD 4RAUA 3G5XA 4LQ1A 4NWUH 4EDXA 5HJ3B 3Q1SH 5I18H 4DW2H 3IU4L 3SE3A 2XQBL 3OKEB 2GK0A 2R2BB 3FQXA 5C6PB 4AL8L 3PWVA 4JFFE 4OJFL 1A4KB 5D7KD 3TESA 1EA9C 1QFHA 5K33A 3HUJE 4O9HL 3N1MC 3JTTB 1MRFH 1KFAL 1TVDA 4EI6A 4YHPB 4K71B 2DL9A 4AY0A 1JZ6A 4YHLL 4MJ6B 4YBQC 5KSAB 1ZANH 4QT5A 3DRTB 2O5YH 1Y0LB 4H26A 1MF2L 3VGAB 2XIDA 1Z6JT 2PXYC 3QZWB 5I6XB 1NAMH 5FHBL 2DI8A 4JFDB 5HGDB 1OAKH 2VDLL 2HVKB 1QZ1A 4DKFH 3HNVH 4QXUL 4P2QB 5C3LD 1NKRA 3GMRB 3KPRB 3RAJL 5HDQL 1DEEB 2HH0L 3KPSE 3FQRA 3ZKXB 1J0KA 5K9KB 3MRBA 3RGVC 5AEAA 5IM7A 3BIKB 2XZCL 4PPTA 5IV2B 4XXDB 4QWWD 3T77B 1KGCD 4NHCH 1MCIA 3K8LA 5I9QC 4HIIB 2P5EB 3HAEA 1ZLSL 2DJSA 1D6VH 3BKMH 4V2BA 3CX5J 3FN9A 4DZ8A 3IVKA 1NMAH 5TF1L 2APVA 3AREC 5CJOH 1Z9SA 1REIA 2B39A 5J6GB 3WXWL 3PGCB 2EDKA 3BZ4A 2EDQA 2V9QA 4G42B 3I50H 3BRDA 3C2SA 2VH5H 2OCFD 1XR9A 3TVMC 3DUHA 5E6IA 2F53A 2JK5B 2B2XL 4JJHA 3VXQA 4JR9H 1UM4L 4XNZC 1Q94A 5CEZE 3X12A 4XNUL 1S7VA 5DJCA 4G8IB 2KDGA 4X7CC 5HJ3A 5JW4Q 5T5FH 3RI5F 3FT4B 1YYML 3OKEA 1G9NL 1Z3GH 4IRZL 2CJUH 2R2BA 4Q0XL 5EBLB 4JM2B 5HI5D 4WCYL 4R2GC 1A4KA 2NY1D 3ZO0A 4KU1A 3RVVD 1V7ML 3JTTA 4NN7C 5E56A 1E6JL 4YHPA 4JRXE 1RUAH 5KSAA 5FDYA 3TZVD 5CINL 3DRTA 1RIHL 1Y0LA 3TYFB 4JB9L 4JLRB 2NW3B 4HQQL 3EDDA 3QUZB 3QZWA 3KG5A 5CCKL 4ELKB 1G0DA 4JFDA 5HGDA 4P5TD 1NUGA 3AY4A 2HVKA 3O6FD 3H9HB 3ZT6A 1OTUC 4LSVL 4P2QA 3U2SB 4UB0L 1LO3L 2BJML 3GMRA 2I24N 4LOUD 3KPSD 1DEEA 4M93B 3REWB 5K9KA 3TGXA 1HQ4B 3UJJL 3BIKA 5IV2A 4XXDA 3T77A 5EOQL 2P5EA 3KHOA 1YJDC 5FYLL 2VDQH 4AEIL 4JHBA 2AEWA 2PYEE 2ADJB 4MD4B 1CGWA 2H32H 1TJGL 4M6NL 3PABB 4LQFL 2BZDA 2VL4A 1CGXA 1T89A 5J6GA 2D31B 4OUOA 3PGCA 4JZNB 4HUVB 4TUKH 1V05A 4G42A 1WBYB 5DMYA 4HKBB 2JB5L 3WNLA 1EV2E 5HGAB 5ANMB 3G9AB 4ZXBC 1D5IH 2H1PL 2JK5A 4NN5B 4J3VA 1AXIB 4G3YH 2P42B 3SE4C 1HWGB 3KLDA 3Q2CA 5FYKU 3QG7L 5CEZD 1Q1JH 2ZG1A 4LPVA 1SM3H 5GGVY 1NCWH 4PJBB 4G8IA 1QEWB 4LCCB 1T7XA 2H41A 5DHVB 3H7LA 3FT4A 4G9DB 3TBWB 1UM5H 5EBLA 4JM2A 4XVUD 5MENE 1WZLA 4RGNB 5DURD 3QR2A 2P1YA 5C0NC 5E1HB 4JRXD 5F21B 3MYZA 1QBLH 3TYFA 2RGSA 4D0DB 4JLRA 2NW3A 1AFVH 5AZ2L 3QUZA 3O3AB 5A3IC 4ELKA 1BVZA 3MRNB 2DQCH 3MLPA 2JELH 3VFGH 3ULVH 2VMFA 3H9HA 5CUSL 5GS3A 3U2SA 3CXDH 5J3HD 3REWA 3QCVL 3X3GL 1BM3H 1IC4L 4OD2B 1FORH 3VGEA 2D7TH 5DXWA 2PYED 3H6JA 3BP6B 4NQTA 2ADJA 4MD4A 3WNOA 4AM0B 5JLZB 2WWMC 1I8LA 3CSBA 3PABA 4GAYB 1QFUL 4UQ3B 1XFPA 1R3KB 2E27L 2B0SL 2D31A 1U2CA 4JZNA 4HUVA 4JKKA 4JZJB 4PUBL 1CXHA 4WO4B 4HKBA 5D8JH 2YD3A 5HGAA 2VR4A 3M17B 5ANMA 4GUPA 3LN4B 5HYEA 4FABH 4NM4H 5SX5H 2FX7H 3M8OH 3V7AG 5C0FB 4PJBA 3UTOA 1GC1L 3RDTD 1QEWA 4LCCA 5B22A 2APWA 4JPWL 4HWBH 5DHVA 1CD0A 4XBPB 4G9DA 1XGUB 1YEDB 5F7YC 3TBWA 3EW3B 1INEH 5MEND 2QQKH 4OFVA 1I85A 1I75A 2DI9A 4MNQD 4QHLB 3Q6FB 1QSVA 1WZ1H 2B1AL 4NQCD 1ED3B 1EO8L 3ZKMC 4ERSH 1ZLUH 1MY7A 1LEKB 4D0DA 1UB5B 5F9WB 3QIWB 5IFJB 3TA3D 1S3KH 3O3AA 3MRNA 5I1CL 1PZ5B 4HBCL 2UWEF 4OZHE 3D9AH 2YMXL 1JPGB 3DUSB 1S8DB 1BVKB 1MREL 2UUDK 2X4NB 4U6XB 5AYUL 1F3RB 2GW5A 3UJIH 1AGFB 4LSPH 5DR5H 4XVJL 2V2XB 4QHKI 4WGWB 1EK3A 4YDLC 4OD2A 4KK6C 3S34H 4L4JA 1SQ2N 3MRIB 3IRZA 4XT1C 1N0XL 3BP6A 2QSCL 4AM0A 3LB6D 1RUQL 5D1QC 2YD2A 2KBGA 4UIMB 1ZS8B 4GAYA 4UQ3A 2ZNXA 5I1JH 3RBGA 1R3KA 1I9IL 5JXEA 4FFWD 3GJFB 4NCC2 4JZJA 3WN5B 4F80A 2A9ML 4HWUA 3WO4B 4WO4A 1ZEAH 2VR9A 3M17A 1CXLA 3ISWA 3QHZL 3LN4A 4LMQI 5SX4H 2YR3A 1SVZA 2CLZB 3WUWB 1B2WL 4Y2DD 3L3HB 5C0FA 4WWID 1U8PB 1GCFA 3T0EE 4PJFE 5EIVA 4XBPA 5F9OL 3SE8L 1XGUA 1RU9H 1FC1A 4FP8H