3D87B

Crystal structure of interleukin-23
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
306
structure length
298
Chain Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-23 subunit p19
publication title Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 55
structure length 298
sequence length 306
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d87B03
4TN9A 2I24N 3IAGC 3LEXA 4UUJB 5CWSA 4MJ2A 3WUZA 5I1KH 1DLHA 3JTSA 5DO2D 4PR5A 3QXWA 1BFTA 4GW1A 1QKZL 1OP3H 3EOAB 5HY9A 4R7DA 2KUTA 1MVUA 4NCDA 1H15A 3UTTE 1T80A 4ZS6C 3DO7A 4PB0L 1OB1A 3WLWD 4QRPE 4M1DH 1Z2KA 4RGMC 4LKXA 1J86A 5L2KD 2VDNL 4PPTA 4DVBB 1EO7A 5F9OH 4JLRB 1DBKH 5TF0A 3CFDB 1GHFH 5ICZA 5DUBB 1YY9D 3E8UL 4P59H 2Y07H 2RR3A 3O6ML 3GJEB 3FJTA 1B4JL 4JAMA 4GG8A 4LVHB 3RTQA 1RAMA 2XKUA 2XZAH 1NH6A 2ZCKH 3VXNA 4RZCA 3C09C 4EZMA 4KC3B 3RWEB 3GKWH 2L7UA 3P4LA 2R0WL 3KPPA 4JJ5B 1S7TB 1T1ZB 4Z0BL 4PJDE 4D9RD 2F53D 5IHZB 2YZ1A 4PJ9C 2BVOA 3U46A 3GI8L 1JF5A 3KJ6H 1H3XA 2OX5A 1WBZA 1A4KB 3MFGB 5E00A 3TN0B 1RUAH 4OFPA 4YWGH 4H88L 3VGFA 3T65A 3B8SA 1KYOK 3MJ7B 5DD3H 4P46A 4FTVD 1AD9B 3OKKB 3KPSA 5F88B 5BZDA 5I8EA 2X4RA 1AGCA 1MCBA 1BECA 4NPYB 3PXHA 3DECA 3T2OA 3R8BB 3UZEA 4E41A 4HIJB 4ISVA 4R26L 2VQTA 3MPCA 3SKUD 2GK0A 3D85D 2JF1A 4G6MH 4HGWB 4Q97A 1OGAE 3PDDA 5DK0A 3RNKB 2VZVA 4YDJB 2F58H 1GC1C 5T3ZH 3BIKA 4GRLC 4NC2B 4DZ8B 1ZHNB 4XMLH 4GRWE 3IDYC 4JFHE 1CD1B 1XGPA 4OM0H 1T04A 2AJ3A 3QIUB 4JPIB 1WSST 4WUUB 3RWDA 3IFPA 1PEWA 1QLFB 4ZTOH 2OSLB 2ARWA 4UNUA 3TIDB 4EEEA 1JPFB 1A7RH 5E8OB 1EHLL 4NZUH 1U8KA 3H9YA 3V7MA 4G9FE 1G7LB 3IJSA 3ILPB 1N2RA 3C5JB 5CBAA 4UT9H 4WW2F 4YIQB 4K23H 1I1YA 3S34L 1HKLL 3QIBB 3RY6C 3KYNB 4UTAL 2VQUA 4K8RH 1XZ0B 4EN3A 2JK5B 3IXTB 1QYGH 5F96H 3VMNA 3FN9A 1OAUL 3ARBD 3O2VL 5DJYA 5T3XD 2C7UB 2NR6D 4R96B 5DR5L 5A2LH 3SKNA 4LLVA 3TJHC 1MRCL 1AGDB 2ZOLB 2EDBA 1UB6A 4NO3B 1OVZA 5ISZA 3BD3A 5DD1H 4UINL 2BC4B 5TE4H 1U8NB 4YEEA 2PETA 3REWA 3O3BB 2FDBP 4OV5B 2PTVA 4JFDD 4YQXL 3O3DB 1QPXA 2FECI 2OXGA 4BFIA 4Y0GA 5DF0A 4POZC 2BHUA 1I3GH 1MJUL 4N0CC 5I18H 1D6EB 5B3JF 5D1QA 2BNRE 4HV8A 1WICA 5E8NB 3DOSA 3ZKMD 5JW5B 1W0WA 1NJ9A 3VXOA 2VLKE 1BQUA 3FKUS 4CL7A 1IAKA 4Y5YC 1KJMA 2EYRA 5JW3H 3SE3A 1SJHB 4M1GL 1DQQA 4MDJB 2GJZB 5TQ0H 4MXWH 5F9JA 3GO1H 1YDPB 3N1MC 3MA9L 4CU6A 5E6IA 3ARGA 5E5UB 3PWPD 3QEUB 1YN7B 3TIEB 4XMKH 4LCUB 5FYJE 1NLDH 3N0PB 4MCZB 3RU8L 3BPLB 1NBVL 5D1ZD 3NGBB 5ALCL 1CL7I 1IGFL 4N1CA 3MRMA 2AK4E 4I0PD 1YPZA 3IKKA 4ZXBA 1DBBH 1AIFA 4TTDD 4KVNL 5I1IL 1O5DT 1JN6A 1MCDA 3HUJA 4UBDD 3BP7A 1J8HE 4WFGE 4PS4L 4LPXA 5I6XC 5GHWH 5DYOB 1EGJA 1O0VA 1KLUB 2WUCL 5T1MA 2R39A 2XKNB 4LOUD 4LMQI 1S7WA 4U1GC 3VH8B 5K59E 1LDSA 1A0QH 4PJXA 5BZWA 1X5IA 1VKXA 3NH7L 2Z31B 4XC1H 5F8QC 1NCAH 2NZIA 3RAJH 3WS3A 1XGQA 4ZFFA 2IADA 1MHPL 1CF8H 3N1PC 1UXSB 1EUUA 5GRJH 1FAKT 2Y06L 2B4CL 1DQMH 2QTEA 1A7OL 3G5XB 3UBXG 2IALA 2BVPA 2MHAB 2A38A 4PRPA 2HFTA 5B3JE 7FABH 3AREA 3MNVA 1NCDL 5AAWA 3W9DB 4KZDL 3K1KC 4DN3H 3MYJB 1ZHBB 4OLZL 4YHZH 2FR4A 2GT9B 3IAQA 3LPFA 4RNRB 5DMKA 1QRND 1PX4A 2YXFA 4KROB 4JFFE 4ELKA 5I1EH 4WEBH 4AENB 1PBYA 2ADJB 3BT2L 1LEKA 4JFQB 3OKOA 3T2NH 4JFPA 1FO0H 3V7AE 3VD3A 2FD6H 4R4BA 2PNDA 3S88L 5GRUH 3FO9B 3D25A 3L5IA 5EUOA 4FFYL 4AQ1B 2CUMA 1F6FB 4KJQC 2YS4A 3MLYL 4TPRL 2ZPKH 2J12B 3OJDA 4I4WA 2VZ1A 5EU4A 1AQDB 2SEBA 5T5FH 3UBXB 3MTRA 2IPKA 2NLJA 3PHOA 1MLCA 2P5EB 4MJ6B 4PTTA 4W6WB 5FKAA 5ID0A 4YXKH 1JHKL 4N0FA 5MEQA 2J3SA 3AXLB 3QCVL 3CXHK 4IOFC 5F7DA 5EZOL 5AEAA 2X42A 2YUXA 4JVPA 3SE9L 1YEIL 5FOBA 3REVA 2FHCA 2VIRA 5CJQL 3SKOA 4ODSL 3OPZH 4WDIB 3FQTB 1GOFA 1F4AA 4RFNC 3CFCH 5FYLD 2R8SH 4TNWK 5JHDE 1R5WB 2R1WB 3HI1A 4TULL 1I85A 3BKJL 2X41A 2F5AH 4RX4D 2AEWA 4OUUB 2R2BB 4K3EH 3MO1B 5ICYA 3DGGB 2XZCL 5KS9E 3RL1B 1YMMB 2ATKA 4HS8L 3QZWA 3VWKC 1C5DB 3LB6D 1EHXA 5C09A 3NCYS 4JO4H 5GRZA 3SE4A 5I8CB 2IMNA 3DMMB 1RHFA 3M17A 1C5CL 1J0YA 4AEFA 1N6UA 3QO1A 1RU9H 2V6HA 3U0WL 1MWAL 3LKOA 3VFTB 3VFGL 3MCKA 5GSVA 4K94H 4X7EC 1TJHL 4HQQL 3Q1SH 2ARJQ 1VFBA 1HYSD 1BJMA 1CD8A 4NO0A 4D9QD 1VGKB 4XNXH 5B38A 1Q0XL 4LVEA 3WHE0 4YX2H 3IFLH 5I1AB 3ARUA 5HI5C 4RFEA 1FVCB 4N8VA 1JHTA 3DROA 3L3GB 1BJ8A 3D6GA 3SDCD 2FYYB 5J8OA 3DNKA 1J7VR 3U2SA 3DHJA 3Q0HA 4PY7B 2LVEA 1KFAH 4QCIB 1PGRB 4EQ2A 4F7CA 5FB8B 3X14B 1IEAB 3WE6B 3GB7A 4P9HC 2ZJSH 5DVMA 4WO4C 5JW4M 3EFDH 1XIWA 3WN5C 1T6WA 4U6VH 2CDFB 2P47B 3OKYA 4LHJB 5AYQA 1V05A 4GMSL 3IT8D 1MCOH 2UWEF 1X7QB 5F1NA 5H35B 1KIQB 3GSOA 5AG8A 3QA3A 2N56A 3KR3H 1B90A 5AD0B 4M61A 3EJYC 3WO4C 5IG7B 3ZKXB 1REIA 2I9TA 1HHHB 4AT6B 1KCSL 1ACYH 1IZJA 3DRQB 3U1SL 5TE6L 1U2HA 4C55A 4JREC 5EZIH 4FOMA 2VN4A 1QO3A 5HYQA 1FL6B 4UIKH 5TQ2H 4KVCL 2OL3B 4HMDA 3T3MF 4PJHA 1FFPA 1Y6MR 4QXWA 4GXUN 3SOBL 3BW9B 4HMEA 1PKQB 4I2XE 43CAA 2AXHA 1QLRB 1UJ3A 4G3YH 3VXMD 1JWMA 5AZEL 4GOSA 2A9NH 3EOBA 1OWWA 1KT2A 5IGXH 2DWDB 4UB0H 1NFDB 2WIIB 4KDWA 4UILL 2P24B 1NCWL 4FQ2H 5IW6B 1A6WH 5F93C 4HFUH 3SDAD 3V52L 3NCCB 4XT1C 5BV7H 1A9EB 1FVEB 3CVIH 3NCJH 4Z5RA 1FG2A 5FFLA 4LCYB 4P5TB 2PYFA 4HXBH 4QHMA 3DETD 3H3PH 5D2LB 1KPVB 3O3AB 3HE7A 4OSUL 3V0AC 4PJ7A 4YO0B 1WEJH 2ZUQC 4OCYL 4UV7L 3O8XD 5EU7C 4D2NA 2AK1H 4U1LA 5EZLA 5DD5H 5KVDL 3WFHB 4ZPVA 4GBXC 1IC4L 5C07D 4OGAD 5E2VL 1SM3L 5GGSB 4RGNE 3G5VB 4YUEL 3IDMA 2VXUL 4WNQB 2VDQL 3AM8C 4CVXB 3GI9L 3CSGA 1OCWL 5D9SA 2YA0A 4F7EB 3BGFB 5IHUH 1A6AA 5C0BE 4JQXA 4JFEB 4EUPG 5IB2B 1HXMA 32C2A 4LDLB 3T77A 3TV3L 1E0OB 3VRJB 2EIZB 5I2IB 5ACLA 2Q76B 3V4VL 1RFDH 3D39D 5GS0H 4NOFA 2AVGA 3FT3B 3OZ9H 4PJAB 3OGCB 2FX8L 1BM3L 3PDOA 4ODUB 5E9DD 1Y18A 4X6DB 4GG6B 4XPGL 2V17H 3PQYA 2VISB 2BSSA 1ZLWK 2AQ1A 4JN1H 4YFDB 5C7XH 2FJHB 4KI1A 1FYTB 4LNVA 2NY7L 1MFBL 2W91A 4QLRA 4XBGB 1S9KC 2EH8L 2CR3A 5HHVH 5SWZB 4ZOAA 4NZRL 1BVZA 4MA7H 4NKDB 4X9BA 3SO3B 2O26U 3JTTA 4DFHA 1FJ1B 1U3JA 4M7LT 2P8MB 1OQXA 3MRIA 4HWBA 3SHSA 3RKDD 3KXFE 3CH1A 4XVTL 5EBWA 4F7MA 4M43L 3Q6FA 4K9EC 4U7SA 3KPRE 4JY5H 3HE6A 4FQLH 5FECA 5GISH 3O9WA 3BXNB 1QSEB 4EUPB 1A6ZB 3OHXA 1A1OB 4XC3H 3TBVA 3RIFF 5HVGB 4B7IA 5EC1B 1INDH 4GAYB 1WWAX 1NC2B 5ALBL 2E7LC 1H5BB 1UM4H 2ZUVA 3O4LD 1CFSA 1PEZA 1ZEAL 3VG0L 4S2SB 1CDCA 5DQDH 5E8DH 2ZOKB 3VD9A 4OZFG 5LBSL 3WLBA 3LIZL 1Z3GL 3INUH 3S36H 3B6SA 3FN0L 1ZLSH 1LDPH 4JPVH 5I1HL 1BEYL 3MRBB 5TGBB 2VXSH 1OAYH 1S9XB 4PJ5E 4C56D 3ZHLA 4HC1L 2AJZA 4YC2B 5AAMA 1DUZB 2AI0L 5JQ6L 1DSFH 4PJIB 4OZHA 4LP5A 1DFBH 4RMWA 5IB3A 2LQRA 4PLNC 3CLFL 3TBTA 4P23A 3QDMD 4Y19B 2W07A 1LK3L 5C2BL 1QOKA 3QQ9C 4NN6B 5DFWH 2GSGA 2H6PB 3QDJD 4LASL 2R4SH 3I50L 3MOAH 3KNBA 4R3SB 4AY0A 3EW3B 1S9WB 4CW1A 4U31A 1IQDB 1OD9A 3R1GL 3IB4A 4NQUA 4FQQB 1D3CA 1TJIH 3PIQA 4BZ2H 5D7LD 2H26B 3CX2A 5DMGD 1JZ3A 3ULUC 4K7FB 5IV2B 1U0QA 4Y4KC 3ZT5A 3FB6B 2HTKD 3NIDF 2QADD 3SPVA 1S9VB 4M6MH 5F89B 4OZFB 1NUNB 2RCSL 5T5NF 4PJ9B 2AQ3A 4D9LL 2ZG1A 3JVGC 4K7PY 1S7XA 1UQSA 4X80H 4POYA 3KPQB 2B5IC 2NX5D 3C8KB 4BQCA 1T22B 3HAEG 2XQYK 4HWUA 5KN5A 5M94B 4JM2D 1DEEB 4X7TA 2HN7A 1MNUH 3IS0X 1INEL 1A6UH 5D71L 5BW7C 3QDGD 4NWTH 3S37X 1T5WA 1EHNA 2NCMA 4OCRH 2VAAB 5IBUG 2H3NA 3TNNB 1ONQA 1ULVA 2PKDA 2HKFH 2R1XB 5BRZA 2ZSVB 3BD5A 3NIFE 5MEPA 1D5ZB 3IRZA 3O2DH 5TE7L 4NQED 1CFNA 3MV8D 3SJVB 3T0AA 4GRLB 3GMLB 3T1FB 4CVZA 3IDYB 2AJSL 3IYLW 1KC5H 3FQNA 3ESVF 3SGDH 4PRDA 5IVXB 1JTTA 3QFJB 5HGAB 2KZWA 4Y16D 2B1HL 3QI9C 2FJFA 3MACL 1IRAY 3EO0A 2UY6A 1KCRL 2YD9A 1QPPA 5KVEL 3HAEB 4NGHH 1XGTA 5DK3A 3VJ6B 2VITB 2CKBH 4G8GB 4IRSC 1EO8L 3O6FA 3QIWA 5SX4I 1MRFL 3UTOA 3NCEB 4JPKH 5FCSH 1A6PA 5IBUB 4Z7UA 2GIYA 2VXQH 4NO2B 1HI6A 3NIDE 25C8H 4WFEE 3L7EA 2VDML 3EUUA 4KJWC 2ADGA 2XQYG 4PGBA 3MRDA 1AXTH 4HIEB 1N59A 4ZTPL 4KY1H 3OR7B 3TCXA 3P0GB 4ODWB 3GMPB 1CGSH 2A83B 3EOTH 4XI5D 5EOCJ 2NW3A 2PXYD 5GJSH 4Y1AD 1FZJB 3BH9A 3IU3B 4YBLC 5FF6A 2B1AH 4P5MA 1J87A 1C12B 1CTOA 4NQDA 1M4KA 1RIUL 1T7ZA 3AROA 4HDIA 4OKVB 3C8DA 4DVRL 4ESKA 4Y4FB 3FQXB 1T21B 2BVQA 4NKQB 5ACMA 3G04A 5SWSA 2Q8BL 2EC9U 3QUZD 4BSVB 2A2QT 1CIUA 4TVPE 3ROOB 3IVKB 1MFEL 2XG4A 2FBJL 2APFA 5I71B 5C9KA 5FGSA 2YD2A 5AYUL 3GBNL 4HUWB 2W60B 4X9HA 1TZIA 4Y4HA 5JDJA 3MRRB 5KAQG 1KCLA 1DQLL 2WNGA 3JV0A 3F7YA 1ZT7A 2FGWL 2KKQA 1QKZH 1NFIA 1WF5A 4NC0B 1LP9B 1ZMYA 3NIGF 1CXHA 3TZVD 4WHYG 3B2VL 1G7HB 3GZKA 1BWMA 4PB0H 4WJ5A 3L9RA 1QZ1A 4Y88A 3BJ91 3GMQB 1MVFA 3RVTC 3EYOA 2H2SD 4JKMA 2R0KL 6FABL 2VDNH 2VR4A 3LN4B 5C0AD 1KACB 1G7IB 1KB5A 4B41A 4R8WL 3K4ZA 3E8UH 3O6MH 3RVXD 1B4JH 2YPKA 1EO5A 5MHSE 1I8KB 3MRHB 3MV9D 2BNUA 5L2KA 4L4TB 2R0WH 3GEWB 4IS6B 4JN2A 2B7DT 4Z0BH 1A9BA 4RAHA 2Y23A 3GI8H 1R3JB 1OP9A 3B8YA 1FHGA 4PY8I 1CI5A 1VEOA 3RWCA 4H88H 1IGTB 3R06B 4UIMA 1Q38A 4GKNA 1BFOB 4LSRL 2F53A 3GSXA 5IUSA 4HH9B 1R3LB 3LKNA 2VUOA 3MBEA 4IMKC 2VABA 5C6PB 2X4QB 3LS4L 2XRAL 3DGCR 2R1YB 4OIIL 4GSDL 5LGJB 5F6IB 5JZ7D 2BCKB 4R26H 1MHHB 1N6QL 5IFJB 5DZLA 1JMXA 5CGYC 2X1XR 1P4BL 1R5VB 1T1WA 3X3GL 4P9HL 4L8BB 2NNAA 3LH2L 4P46C 1YUHA 3BZEA 3UPRA 5C0EB 3V6OA 3JV4A 3D85A 1YEGL 3IJYB 2GTWB 5TDOA 4WWID 1FNGB 2QKIA 1X6NA 2O5YL 1M7DB 3ZMRA 1HYRC 2ZCHL 1EHLH 3LKQA 1IAMA 1UA6L 2NZ9D 1AGFB 5F1IB 3BPCA 4JO3L 3RPIA 1HHIA 4MQXC 1EJOL 5DRZA 1W8OA 4I48B 2NXZD 2G9HB 3S34H 1E27B 1HKLH 1AHWB 4UTAH 3GIVB 2MQ3A 1SEBA 3BEVA 1BJ1H 4OF3A 5C08D 1T2QL 2F5BL 2Q3AA 1OAUH 3BOVA 5JOPE 1VFUA 3O2VH 3OR6B 5DR5H 1MRCH 2YPLB 3MNWB 4GKSA 5DVNA 4UINH 2EXWD 5EC2A 3UTTD 4ZNEA 4LF3A 3TC9A 4J1UB 3QUXD 4EN3C 1NCTA 2VTFA 3B2UC 4MD0A 4YQXH 2EYTA 2XN9D 5E1AB 2DM2A 2IH1B 4DEPB 1MJUH 4XCNB 2UUDK 4FXKB 2N1KA 3FT2B 4ZPTB 5EOQL 5LAXA 1VENA 2GUOB 4MSWB 3WMSA 3LMJL 2PUQT 1RPQA 4NQTA 1G7JB 2HT3C 2ADIB 4M1GH 3KS0J 5EU5A 1PZ5B 2OCFD 5KBNC 3CK0L 4LFHD 1A2YB 3MA9H 3ZE0F 5IWLA 4EDWL 4Q6IA 3TFKD 2F15A 5D1QC 2I27N 4BQ8A 4MMXC 4NRXA 5T1KA 5JNYB 4Y5VA 3RU8H 4DW2L 1LE9A 1Y6NR 3U36A 1NBVH 4X4ZA 3HB3D 4G80A 4X6EA 3K74B 5EBMA 5ALCH 1IGFH 1RJLB 4ZAKA 3SE3C 3QEQD 2BRRL 1RK1A 3SDXB 1BX2A 2A0LD 4MJ5A 1T6VN 4KVNH 5I1IH 4N9GA 2P5EE 2FIKA 2VDPL 4MQ7A 5DURB 1OGAD 3IETB 1CFQA 4NWUL 2FECL 2UYLB 4JFXB 4PS4H 3ARGC 5CJ8A 4WI7A 1ZWIA 4XVSL 2NY3B 3NFNB 1H8OA 1UZ6E 4ZDHA 4I0PA 3VI3E 2WUCH 2W9LA 4EQ3A 4FQJL 3S35L 3LOWA 4I0CC 4WO4B 3AS2A 3KPNB 4XBPB 4G43A 1I7UA 3NH7H 3CMGA 1BFSA 4LCWD 4AIZA 1DQDL 5IKCB 2AJYL 5GQBA 1MHPH 3MXVL 3P77A 1Z9SA 2Y06H 2B4CH 3MLSL 3ARQA 1A7OH 3WO4B 3QWOB 1A1NB 1UVQB 5JO5B 5HD8C 4KUZL 1YMME 4WVRA 1Q9KB 4ELMA 4JREB 1NCDH 2WQ8A 4R9HA 3HZMA 4KZDH 1R24A 4K9EL 3MUGB 4JDTL 4OLZH 5T3ZD 1CL7L 1SEQL 1JMZA 2CRIA 3HRPA 1I8LA 2R23B 5KW9L 2H45A 1NUGA 5HTSA 3VDCA 3G08A 3ZE0E 4P48A 4CBPA 1LILA 4TNWF 5ITFB 2FL5A 1QRNA 3AREC 3AS0A 5F7UA 3S88H 3TT3L 4FFYH 1U95A 3S35X 1SMOA 4U7KA 3S4SG 2H32A 2HLFC 4PGEB 5DVOA 2ARJA 5IM7B 1I9EA 4A6YL 1KXQE 3KHQA 3MLYH 1FG9C 4TPRH 5BJTA 3LCYA 1NFDF 2E5EA 1U8JB 3PWJA 2Z91B 3BD4A 1S7QA 3MGOA 4UDUA 4K8RD 4ZMAT 4MYWB 4YEFA 4I2XA 2XYCA 1GSMA 1SY6A 3HNSL 3PP3K 2JJVA 1JHKH 3PJSB 5LGKA 3TP4A 3QCVH 4DGIL 1KJVB 2CLRB 5EZOH 4OD2B 3OJVC 4AM0B 4PFEA 5BVJB 3BRDA 3SE9H 1YEIH 3DI2B 3EYQC 5CJQH 2NY6C 4ODSH 3QQNA 2NY0D 2FWOA 1FE8L 1O7SA 2HTLC 3BVNA 1ETZA 4DCQA 3DSNA 5IEHB 1HHGB 3ULUL 4TULH 1XF4A 3BKJH 1DBML 2NY1C 3V0WL 3GSNL 3C2SA 4JVUA 1GGIL 4XWGL 2XZCH 2VQ1B 3QNZA 3LN5A 4QRUA 2P49B 3S4SB 3IDIA 4Z8FL 4HS8H 4DWHA 3CDGB 4MWFA 2RFXA 1GGYA 3M45A 4RX4A 1NDGB 5J11C 1CFTA 5DUML 5CIPH 1C5CH 5F97E 2OZ4L 1B2WL 3LD8B 2BZDA 1I85C 3HA0A 3U0WH 1MWAH 3RDTD 3U6RB 3VFGH 3MA7A 1PKQE 1TJHH 5C0CD 4HQQH 5KZCD 4NQXA 1K5NB 4L4VB 4K2UL 1T0PB 3UTZA 2B2XL 4YDIL 5H2BA 3OKDA 3TPUA 1FGNL 1YC8A 3GHBL 5JPMB 3MRCB 1E4XL 1Q0XH 1XF5A 5C0BA 3SE4C 4X6BA 1F4XL 4WI3A 4JRXB 5I19L 1FIEA 4KRNA 2CIIB 1NFDE 4FP8L 4D0BB 2W0FB 3HPJA 4X4ME 1RUML 5B4MC 2RB8A 3V8OA 1G1CA 2IF7A 5EU6B 1XF2A 4PJBA 4QKXB 3V9FA 4L3EB 5TDNB 4JFFD 5D2LE 1GVIA 2YD1A 3I6GB 5DJXB 5J12C 3NA4A 1RZGB 3RL2A 3X11B 1G0XA 3SDCA 3MGTA 4GMTL 4NHCL 2GITA 4GMSH 4M3JA 5I1CL 4LVNC 1ZSDA 2NMSA 2BMKB 1K2DA 2GK2A 5C0DA 3IAPA 4G8IA 4YBHA 4P4KD 3VFVA 3GSUB 1JZ8A 3WNNA 1KCSH 1AE6L 3U1SH 4OFDA 5TE6H 4WUKL 1XIWC 4JFEE 1S7VB 1WISA 5HVHC 3F7PC 1NMCB 4HIXL 4O2CA 4KVCH 2Z93B 4PP1C 2HVKA 3RJQB 3RY4A 4PJAE 4MA1B 3SOBH 2J6EA 3HR5A 3QFDA 5JR1L 4X6DE 4GG6E 4I77L 1LEIA 1NCBL 1MHCB 1RK0A 1TQBB 4OFIA 1N5AA 3D2UB 3UYPA 2Y5TA 5AZEH 4OCSL 4HKXB 2C1OB 1Q94B 3LSOA 3VXQA 3GSNB 5CKGA 3ARFC 5SWZE 2PYED 2YC1B 4UILH 1BIIB 1LEGB 4L8DA 3T4YA 1NCWH 3FOMA 1P1ZA 3V52H 3VXMA 1IAII 3WFDL 3U30C 4HIIB 4LSTL 5ELIA 3MLXL 1UJ3C 1FQ9C 3M8OL 4KRPB 4X6CB 1AKJD 1VEPA 1QSEE 2JB6A 3SDAA 3UP1A 4OSUH 5SV3A 3RWGA 3U4AA 1NCUA 2VJXA 3TBWB 2EDEA 4M00A 4PRIE 4OCYH 4H20L 4QYOB 4UV7H 5JHLL 1MHEA 4Z7WF 2YXMA 2O93L 2YMXL 1CGVA 1MFDL 5MENB 1TITA 4P2RB 3C5SB 4X98A 2I9LB 5KVDH 3ZSTA 2MQ0A 1IC4H 5IR1B 3L3HB 1A02N 1SM3H 4X5XA 1UENA 4X7FC 4YUEH 2VXUH 2VDQH 3O8XA 4LSPL 5HDLA 3GI9H 1OCWH 2AAVA 3HE7C 3FO1A 5IB1A 4PJFB 4W68A 1TIUA 4PJIE 3RPKA 2VZUA 3VE0B 3TV3H 1JGLL 5IVXF 5CD5C 5GGUA 4U1IB 3F5WA 4Q9RL 3T04D 3V4VH 2HMIC 4ORGB 2E9IA 4Y19E 1UADC 1FH5L 3JSSA 4PJ8D 1KXTB 2HT2C 5E7FA 3QJFA 5C0ND 4CU7A 2BNQD 2FX8H 5BVPL 4K71B 1BM3H 4MXQD 4KKCC 4D0CB 4XPGH 2IPUK 1WFTA 1ZLWH 1NEUA 4ZSOB 4QY8B 3D39A 4UUJA 4X4XB 1U58B 2DQUL 1OTSC 4JQXC 2NY7H 1MFBH 4APQD 3T0ED 2YK1L 2EH8H 3CSYA 4ZUSA 3HMWL 4NZRH 2BOCA 1RJZB 5F3HA 5I9QC 1JCKA 5DRXA 1RY7B 2KZ1B 3K80A 4MNHA 3GDBA 2XPGB 4XVTH 4EVNB 4M43H 3AU1B 1EEYB 1BLNB 2DWEB 3FQWB 5FM5O 1PW3A 1K8IB 1I4FB 2C3VB 5D96B 4O9HL 2AXJA 4HEME 4P5KA 1RHHB 3B83A 3GJEA 1UEMA 3IRPX 3C5ZD 3LZFL 5ALBH 4P57B 1TCRA 1Y6KR 1W72B 1ZA6B 3RWEA 1ZEAH 1I8MA 4JEGB 3VG0H 4Z7VA 4JJ5A 4NN5B 1P5UA 3S8WA 3CDFA 3FAWA 5IB5B 5LBSH 1H3VA 3LIZH 1Z3GH 1A4KA 3HE6C 3BRFA 1ZS8A 3FN0H 1WBYB 3O9WC 5I1HH 1BEYH 3O4LA 3RGVB 3SJVE 2H2PC 4EDXB 1U3HD 4LLDB 4HC1H 3VXUD 2AI0H 5JQ6H 1AD9A 3OKKA 3QPQD 4TSCL 3VFNA 5IVXE 4E5XB 1QA9A 3QFJE 3S3JA 1MH5A 2AXFB 2IPUG 1XR9A 4RIRB 2DN7A 1HHJA 3CLFH 1CZ8L 2FEDC 1SJXA 3MJ6A 4PJEB 4WU7A 5D5MA 1LK3H 5C2BH 1F5WA 2O5XL 1L0XA 5HYJB 1LD9A 1A7BA 3BX7C 4LASH 3TEUA 3I50H 5CEZL 4BQ6A 4G8GE 1CE6A 3LEXB 5D7KE 4N5UA 3RNKA 5DLML 1XCQA 1DLHB 3QDMA 3R1GH 3JTSB 4RGND 3QDJA 3BWUC 3QIUA 4WUUA 4GW1B 5HY9B 4L1DA 4R7DB 4MQTB 1MVUB 1H15B 3TIDA 2FO1A 3DO7B 4POUB 1EZVY 4JM4L 1F3DH 5LJYH 2R0ZL 3BYYA 2RCSH 1OB1B 5E8OA 5C8JA 5D7LA 1XEDA 4D9LH 4U6HA 2R29L 5DMIL 2E7HA 4LKXB 4W6XB 1HILA 3ILPA 1H3PL 1BWWA 1OLLA 1S7UA 3BPOC 3DLQR 4IIQA 5ICZB 3K8MA 3KYNA 4DZBA 3HMXL 3ILQD 1XZ0A 1IAIM 3VA6A 3OX8B 4MJID 2C3HA 1INEH 4JAMB 4EI5D 3IXTA 3RTQB 5IBLD 3VXNB 2IGFL 4RZCB 5D71H 1E4KA 3FT4B 5HHOD 2NX5A 4HGKC 4F8TA 1OARL 2J5LB 3WNLA 4XAKE 4JM2A 3BGAA 4KQ4L 2BVOB 2ZOLA 2QSVA 2XXMB 5FUZL 2OI9B 5E00B 3ZYZA 1MAKA 2MQCA 3QDGA 5L2JA 3ZE2F 2ERJC 2PW1A 4H0HB 5TE7H 3MLTB 3OAYK 4H1LH 5H37G 3WJJA 2AJSH 2HWZL 5BZDB 3KPSB 3NBNA 4FQ1L 5GS0D 5I8EB 2X4RB 2B1HH 4E41B 1CGXA 1D6EA 3RZCB 1AR1D 2JCCF 3MACH 4NQEA 3MV8A 1LP9E 2GK0B 5E8NA 1KCRH 5JW5A 3VGAC 1TZGL 5KVEH 3TM6A 5DK0B 3ZKND 4Y16A 1WBXB 3BIKB 1EO8H 4KK5C 2V2XB 4WHYH 4X83A 1MRFH 2V7HA 2BJML 2I07A 1S5HA 2X09A 1K8DB 1XGPB 3X12B 1T04B 4J4PA 3RWDB 3NAAL 3V0VB 3PL6C 4HJ0C 1HCFX 5FA4A 1MREL 2VDMH 1J1OL 1CG9A 3DHMA 1U8KB 5JA9A 1JGDA 4XWOC 3K8LA 2VLMD 4ZTPH 4DN4L 1UG9A 3IJSB 1C7SA 1HQRB 5CBAB 5CFHA 2HJFA 4L29A 4IEFB 4EN3B 2WBKA 3MRFA 4WI2A 1KLUA 5DJYB 3SKNB 1RIUH 3ALWA 3GNML 1I9RL 1X5FA 4LLVB 3QBTB 4DVRH 1ZTXL 2PXYA 5IJVA 4M03A 1UB6B 3VH8A 4QXTB 4Y1AA 5I8OL 5ISZB 2Q8BH 4YPGB 3ZE2E 1MFEH 3REWB 2FBJH 2ZUXA 3C6LD 3V5HA 5EZJA 3LDBC 2D03L 5AYUH 1ZT4B 4BFIB 1RJYA 3GBNH 2Z4QB 4F9PA 3LRGA 3QUZA 4WV1B 1DQLH 3DX9A 3C87A 2JCCE 5D1QB 3W0WD 2P43B 3NACL 4OIAA 4YDVB 3VWJD 1NJ9B 3B2VH 3VXOB 2GT9A 1IAKB 2Y5EA 1KJMB 3EAKA 4XB7A 1A8JH 1JZ4A 2EYRB 3T1WA 1DQQB 1YEDA 2R0KH 6FABH 2ADJA 3MNZA 3TZVA 3CX5J 1E6JL 1KGCD 4OGXL 1ERNA 4R8WH 5E6IB 1DQJA 3ARGB 3CFBB 4QGYA 1DEDA 4QHKJ 3ZYJA 1SJEB 1IC1A 3D48R 3KYAA 3H9HA 2Q86A 3GRWL 4OD1L 5HJ3A 3DX7A 5D93B 4RMTA 2YPLE 3MRMB 1YPZB 1GJIA 4ZXBB 3ULVL 3MV9A 1JN6B 1S5IL 3HUJB 2P5EA 4MJ6A 3BP7B 4XP4L 1KCKA 4HUMB 3MR9B 4LSRH 5CS7A 3UAJC 3AXLA 3WLWC 5B21A 5A40E 1S7WB 3LS4H 2XRAH 4OIIH 3OBAA 4GSDH 1RZIA 2ICCA 2GCYA 4Y5XB 4JZJA 4B0MM 1N6QH 3WS3B 4ZFFB 4J8RA 1ITCA 2IADB 1FLRL 3ROLA 3DURB 1P4BH 3UO1L 3X3GH 5HSFA 4P9HH 2IALB 2BVPB 2DQTL 4RMVA 3LH2H 3MBEC 1YEGH 3MNVB 4LRIA 1C5DA 1AP2A 3FCTA 5E99L 3TESA 1KIPA 1NFKA 2ICEA 3TBYA 3BMWA 3TNMA 2GYSA 4NSKB 5I8CA 2O5YH 3NPSC 2FR4B 5CJXA 2ZCHH 5DMKB 1FCCA 1UA6H 3L5JA 1ES0A 4JO3H 2D7OA 1LEKB 1EJOH 1IC7L 3HFML 3SDXE 3OKOB 1U9KA 3UTSD 1QG3A 4JFPB 1JV5A 4MLSA 3U0TB 3V6OC 5HBBA 3IU4L 3BKML 4UTBL 3D25B 5E8PA 4ZODA 2ZCLL 5EUOB 2ZUWA 1T2QH 5ACZB 2F5BH 3QZWG 2WMPA 3T0XA 1VFMA 4N0YL 2APBA 2NYYD 2VN7A 2NY6B 3BP6B 2QSTA 3OJDB 4I4WB 5I15L 5EU4B 3I6KA 3RKPA 4DUWA 2SEBB 3L3GA 4UT7L 2D7TL 4DUVA 5C08A 2IPKB 4KUCF 2NLJB 3PHOB 1MLCB 4PTTB 4M8VA 2EDJA 3PHSA 1U8IB 4FG6D 5MEQB 5ANMA 5CLTA 3F7RA 2W0PA 1TMCB 5D1XD 4PY7A 5F7DB 5E4EB 2EIBA 3ARDD 2UUDH 1FRGL 1FNFA 1IEAA 1QBML 5FOBB 5B38G 1P9MA 2B0SL 3T0BA 5EOQH 2FRGP 3QEHB 1X5ZA 5J11B 2APXA 2CDFA 3QUXA 2ZWLT 3CXDL 2LV4A 1UKQA 1LO2L 4K7PL 1NBZA 4RSVA 3VFRA 3VFMA 2XN9A 3LMJH 4N8VG 1GZQB 3UMTA 5EOCL 2BSRB 1ZA3B 3CIQA 2ATKB 2F54E 3WL9A 3QZWB 3SDDD 1J5OL 3CK0H 1VEMA 5C09B 4EDWH 3ARSA 1P2CA 3P9LA 1A47A 1QHPA 3QYCA 3DRQA 1KBGL 3C6SA 4BH7B 1C16A 1FL6A 1D5IL 3M17B 4M02A 4DW2H 2OL3A 3UTPE 3MXWL 1DBAL 3ALPA 4BH8A 3LKOB 3MCKB 3T0WA 2BRRH 3BW9A 1PKQA 1VFBB 2VDPH 4U2YA 3ZKMC 2EDQA 3UCRA 5IWLC 4NO0B 3O11A 1VESA 4NWUH 5F7LB 4Q6IC 1HH9A 5B38B 4XVSH 5B39G 5J12B 4M48L 4LGRB 3QEQA 3PP4L 4FQJH 3S35H 4Y5VC 2YZ8A 4WWKD 3WIHA 2WIIA 4N8VB 4ZOBA 4O02L 1MRDL 5BCAA 4ZAKC 4HUXA 1DQDH 2AXGA 4ODBD 1R6VA 2AJYH 2VB5A 1A9EA 4HUKB 2BY3A 4LCYA 4P5TA 3MXVH 2IFGA 2B20A 3DYPA 1OWRM 5J89A 1AO7B 3U2SB 5F7EL 1JGVL 3MLSH 2GSIA 3JXAA 3RVWC 3BE1L 4KUZH 1T1YB 4URTB 1DE4B 3WXVL 3DTXA 3OV6A 4I0PC 4LCWA 2X1WL 5H8DA 5ID1A 3GB7B 5MI0B 1CXLA 1WK0A 4DKAA 3QHFL 1L7TL 1FN4B 4K9EH 4JDTH 5KVMC 3QCTL 1MQKL 2P45B 1CL7H 1SEQH 3F58L 5F1NB 3QUYD 5DT1L 2DM4A 5KW9H 3QA3B 1MJ7L 4LOUC 1AXSA 3E6HA 1C1EL 5HDQL 4KK9C 4M61B 1WVZA 5B39B 1FSKB 3O4OB 4L4VE 4HULB 2I9TB 4BQBA 4MXVF 4QRRD 2D7NA 3IDNA 1M7XA 3VFWA 4Y2OA 2BDNL 3TT3H 3ULUF 1QO3B 2CUIA 5HYQB 4HWBL 5HI3C 4JRXE 3QP3A 5F9AC 3VRJA 2EIZA 4A6YH 4PJHB 1T5XA 2P48B 1FFPB 1NGXB 2EC8A 3BUYA 2OTUA 3H9ZA 1OPGL 1QFWI 1I8LC 3C9NB 3FT3A 5KSAD 3OGCA 1ZANL 4FXLA 43CAB 1KOAA 2CXKA 5EU6E 4X6DA 4GG6A 1UJ3B 2OS7A 3PABA 4H5SA 2VISA 3HNSH 4L3EE 1JWMB 3RX5A 4DGIH 1CR9L 1XGRB 2EDXA 4X6CF 3EOBB 4OTXL 4NQCB 1FYTA 1KT2B 3WFEL 4HKZA 3WO3B 1PKOA 1IMHC 3SGJA 4KKAC 5DFVD 4NYLA 2MPAL 5FO7A 4JY6A 3IFNL 4HXAL 4Z7QF 1L9MA 5E0QA 1FE8H 4OT1L 4U2ZA 4Z5RB 1FG2B 4KHXL 2PYFB 2NXYD 3ULUH 4LMQE 4Q9CA 1JYWA 1DBMH 4TRPL 5L6YL 3V0WH 3GSNH 1GGIH 2AV7A 4XWGH 4ENED 3BWAB 1RMFL 4Z8FH 4EUPA 1BMGA 4PJ7B 2D7MA 4Z76B 1ZHKA 4O00A 3MOBL 5D72L 4U1LB 5EZLB 4LBEB 1H5BA 3CPLB 4MLIA 4ZPVB 5DUMH 3V79C 2HFGL 4OQ1A 4S2SA 2BXYA 2OZ4H 1B2WH 4JR9L 3IDMB 5EH1A 1EHAA 2E7MA 4K2UH 5D9SB 4PRBB 2B2XH 4YDIH 1FGNH 1S9XA 3EGSA 1B4RA 3Q6GL 3DX6A 4FZEL 3ULUE 1A6AB 1DUZA 1T2JA 3GHBH 3GJFB 1E4XH 4PJGF 32C2B 3T77B 3RDTA 2HP4A 3UZQA 3CVHA 4OCXL 1F4XH 3S9DB 2DAVA 5I19H 5C0CA 4HWEL 5J4MA 1UWEL 4PIRF 4FP8H 2IAMD 1RUMH 2R9HD 3HZVA 3MUHL 3N9GL 3PDOB 3DV4B 4OCWL 1Y18B 5FV2A 5ENWA 4HWZB 1F6AA 2XTJB 4L1HA 3CZFA 4X6CE 1M05A 4FQQA 4HPYL 2H26A 4P2QD 4UU9B 3MREA 4HUNB 5IV2A 5KVFL 4NRYA 5IIEA 1BF2A 4GMTH 4NHCH 4V1DD 1DUYB 3D3VE 5MENE 3JTTB 4P2RE 4OZFA 4HK0A 3ARPA 5I1CH 3VA2C 3MRIB 9CGTA 5BOZG 3CH1B 5EBWB 1F4HA 5FECB 3HE6B 2DQDL 3OHXB 4ODHL 3TBVB 1X5LA 2ZG2A 1AE6H 4PJFE 4JKLA 1NGZA 4WUKH 1S9YA 2D3VA 3VD4A 1CFSB 5CEYA 4P4KA 4YE4L 1P4LA 1INQB 4HIXH 4HAGA 1CQKA 3ZDXF 4HD9A 4PJEF 3UXFA 2ZSVA 2L0DA 3WLBB 3OKLB 4OI7A 1LO5A 3B6SB 2Y6SD 1VSCA 5JR1H 4JANA 4XXCA 1G6RA 4I77H 1NCBH 4HS3A 4QT5A 3IFOA 4ZUVB 4ZSOE 2AJZB 2FX7L 1JTOA 1QBLL 3RNQA 4OZHB 2K7PA 1IGML 3V5KA 3TCLB 2ESVE 4OCSH 3IGAB 1FO0A 3TBTB 3DBXA 4P23B 1FFOA 2Z8RA 5GGSY 2LU4A 3L3IA 4IRJD 4JHBA 3GBLA 2GSGB 4NM4L 4MX7A 3WFDH 4LGPB 3HAEA 4FHBD 2AEIT 2XTLA 3KNBB 1BGXL 4LSTH 1UZ8A 4OZIF 2YD7A 3MLXH 4LQ1A 3M8OH 1RZ8B 2PYEA 3PIQB 1YA5A 3S5LB 1BZ9B 1QFWM 2ENYA 5F9WB 4HUUA 4NO2A 5JHLH 3SPVB 4H20H 2YMXH 1HNFA 4HZLB 1MFDH 1KLGA 3TO4D 3WNMA 4HIEA 1FFNA 1DDHA 4ORZC 1I7RA 1MJJA 4S1DD 2ERJB 5KN5B 4ODWA 3GMPA 4LSPH 4X7TB 2C4XA 5E2TL 3SDAC 2A73B 5FOJA 3VRIB 4WTXA 3IU3A 3RHWK 5KVGL 4M1CD 2WM0A 4IM8A 1CXIA 2FEEI 4MNGB 4JPWL 1T5WB 3QRFM 3U0PA 4BYHA 1JGLH 2HJLB 1ONQB 4JRYD 4Y4FA 1CICD 4Q9RH 5BRZB 2IJ0C 1T21A 4PJEE 1FH5H 1KB5L 5HYJE 2E9BA 5MEPB 1UM5L 5BVPH 4IOSD 4F3FA 4YHPA 3ROOA 1CFNB 3O8XC 2KH2B 5KSBB 4CVZB 5FYJL 3FQNB 4HEPG 1EJ6A 4PRDB 1LNUA 2DQUH 4OGAC 2VDOL 2BNQA 2X4OB 1NCCL 1U6AL 4M62L 2YK1H 2FJFB 3HMWH 1WJ3A 5JMRA 4X4YA 4D0DA 3VW3L 1YNTB 1G7HA 1PG7X 4MNQD 1XGTB 3BQUD 3IDGA 1AJ7L 4QHNA 5DJCA 4APQA 2W9DL 4S1QL 3BDBA 3GMQA 3T0EA 2PW2B 1OP5K 1F3JA 3O6FB 3QIWB 5D7JB 3MRPB 4Z7OF 1QVOB 5F3BB 1I8IA 3LN4A 2VLJD 3VXRD 4W4OA 3H7BA 1G7IA 4O9HH 2I25N 2VDLL 4FMKA 3BMVA 4HJGA 3P2TA 5GZOC 3L7EB 3LZFH 1TETL 5IT2L 5LGHL 2ADGB 3MRHA 2DI7A 2K3TA 3FTGA 8CGTA 3MRDB 4L4TA 2UVFA 2JB5L 3FFCD 1N59B 3QB7C 1RI8A 2EEBA 1BPVA 3GK8L 2NW3B 1AFVL 3MRQA 3L3KA 3GSRB 1DVFD 2YWYA 4Z0XA 4AEHL 3BH9B 1KIUA 2V5RA 2R2EB 3BP4B 4HS6A 4P5MB 5FF6B 4NKIL 4GLRI 1BFOA 3KPSE 5KOVC 2PTTB 4NQDB 4KRLB 5L9DL 3W9EA 4TSCH 1R3LA 2E6PA 2V2WA 1VPOL 4B7LA 2QQNL 3N1GC 4KI5E 4QTHA 4E41E 1V3KA 2BVQB 3G04B 1CZ8H 5SWSB 3ESUF 1U3HA 2O5XH 1NANH 1UM6L 4X9FA 4PRID 3VRLF 3VXUA 4CDGC 4LPCA 2Z92B 3TN0C 5CEZH 3H9SD 3MV7D 4L4JA 5D6DC 5DLMH 4LLMA 1I75A 4L8BA 4Y4HB 4P3DA 4R2GB 3OXRB 1FIGL 1BD2B 2NY4D 2VUYA 4I5BB 2XV6B 1ZT7B 1OLZA 1NGYA 5EIVA 1R3IL 3STZA 3KGRA 1JYXA 2UWEA 2ED7A 4YXHL 4JM4H 3RI5K 1I7ZA 2R0ZH 4WJ5B 4NP4L 3L9RB 2R29H 3EYOB 5DMIH 3KPLB 4KQ3L 4J3WA 3EYFB 1H3PH 2LVCA 4WGWB 4ZS6D 4BSWA 1KB5B 1T89A 3ZE1E 4ZFOB 3HMXH 4LP4A 4MVBC 2YPKB 3QIUC 3CSPA 4XCFL 2IGFH 1EA9C 2BNUB 5L2KB 5DC0A 1OARH 1S78D 1A9BB 1DQTA 2V5MA 3QUKB 4KQ4H 4RRPA 4PJXF 5HGGS 5ISZE 4MJIA 2MTPA 5FUZH 4WEUD 1HCVA 3RWCB 3OAYH 2QADC 5HHOA 3QIBC 4P2OA 1AI1L 3BKYL 4GKNB 2F53B 3GSXB 5ICXA 2HWZH 1JPSL 5FKPA 2FB4L 4FQ1H 2VABB 2X4UA 1E4KC 3BN9C 5E1AA 2C1PB 2IH1A 4O4YL 2IQAB 1WC7A 1E28A 3FT2A 4ZPTA 4JM2C 3NPSB 3VRLE 1G7MA 4FTVB 1TZGH 2GJ6D 1NMAL 4ZO9A 1KEGL 2AEPL 1G7JA 2A74A 4NBZB 4XPAL 4L3CB 3WJJC 1WZ1L 4K3EL 2ADIA 2NNAB 2BJMH 3R8QA 1YUHB 3UPRB 3VI4F 3D85B 3GMMA 1DANT 5TDOB 1T2XA 3NAAH 1B0GA 2JIXD 3B5HA 3SJVD 1KPUA 5EUOF 1X5KA 1MREH 3HR6A 1J1OH 4XPFL 5JNYA 2EICA 2IWGA 3LKQB 3BPCB 4WFHD 4DN4H 1HHIB 1YPZE 3TF7C 4Y16C 5DRZB 5DHVA 3SE8L 3HUJE 3KVQA 1SEBB 3BEVB 3IETA 4J4PC 1CCZA 2UYLA 4JFXA 3D1MC 4BFBD 2BSED 3Q3GA 4MZ3A 4HSQA 4EOWL 4UOW1 4WU5B 3ET9F 3GNMH 1I9RH 4AG4L 2C3GA 5DQ9A 1J1XL 1ZTXH 3LEYL 4QEGA 4XTRC 4HLJA 1JRHI 5DVLA 4XBPA 12E8L 4KGJA 5EUKA 4F9LC 5I8OH 3OAUL 4MA3A 3P40A 3NGBC 4ODXA 4OF0A 1MY5A 3ARBB 5EC2B 2J8UA 4LF3B 1ZLVK 5JORA 3TJHD 3ZKQD 3BHBA 5SX4H 1QBBA 1CXKA 5I76A 5HHMD 2WLYA 4MD0B 3F62A 4LPUA 2D03H 2DMKA 2EYTB 3QWOA 4YDLB 4JDZB 3BDYL 1HOCB 1HSAA 1VFOA 1P7HL 4HKJA 4PLOB 3ULVF 1BHGA 3NACH 2PXYC 3RIAK 3C6LA 1SY6L 4JFDB 4DGVL 4POZD 3MUGA 5CEXA 5CHNB 2WWMD 3L1OL 4N0CD 4CJ1A 4N90D 1GOHA 4J23A 2WBJD 3VWJA 5EU5B 5T1LD 4U1JA 1E6JH 4F9PC 2VXTL 3QUZC 1WWCA 4OGXH 4OI9A 4KZEL 3QXAA 4OCMC 5EUOE 2BP3A 1X5XA 1JHLL 1HKFA 1ZVSB 3ZDYF 3GRWH 4Y5VB 4DQOL 4OD1H 4UZGA 1LE9B 2HFEA 3U36B 1GCFA 5IM7A 4G80B 4X6EB 5CUSL 5EBMB 3PV7A 3PWPB 4KROC 3FHQA 4N8CL 3QWQB 5J06A 3ULVH 2FIKB 4MQ7B 1S5IH 3TZVC 4XP4H 4FQIL 4FNLL 1M6OA 1ZWIB 5D1ZB 4I0PB 1KJVA 2H2SC 4LNRA 4CADA 2DRUA 4AM0A 1I7UB 3RBGA 3MJ9A 2CH8A 2LU7A 3KDMA 4AIZB 4X5WA 3RVXC 3MV01 4C4KO 4WENB 2CRZA 1P7QD 1HHGA 1FLRH 4RISL 3P77B 3MC0A 2E9WA 1IE5A 3QQ3A 3K2UL 3EDJA 5FV1L 3UO1H 4XNZB 2YRLA 5KOMC 2DQTH 3EJZC 4J3UA 2B39A 5C09E 1A5FH 4ELMB 5E99H 3P4OB 2YBRB 2D7QA 3HZMB 5BS0A 2JKXA 4G6AC 2DD8L 4UAOB 1CGUA 1XF3B 3W11D 1R24B 1CN4A 3N1QC 5JXAL 4G7YL 1IC7H 3HFMH 4RFOL 3QJHA 3G08B 1TTGA 1X5YA 5JZ7C 1K5NA 1P69B 1SVZA 2A6KA 4L4VA 4NHUB 3WKNA 1KJ2B 4CAGA 3IU4H 1QRNB 3BKMH 4LRIC 4UTBH 1WAAE 2ZCLH 3E2HB 4KXZI 3ZDYE 1WIOA 2H32B 5SX5K 2GJJA 1W0YT 2FZ3A 1LO4L 4N0YH 4GAJL 4D0BA 5I15H 3PWJB 5IQ7L 3MGOB 1S7QB 4UDUB 4JQVA 5A43C 4UT7H 2D7TH 3ZYOA 3M1BB 5I0ZA 4KJQD 5EU6A 1G9MC 4NQVA 2DJUA 1AO7E 2GTZA 4L3EA 4LEOA 5IFAL 3STBA 2ED9A 3I6GA 3WV0A 1RZGA 4WHTB 4M5YL 1U41A 1FRGH 4PJ7F 3QG6A 1QBMH 2J6EL 2B0SH 3D18A 1CK0L 3MRLA 1MCJA 2HJKB 2FWOB 3T4AA 3CXDH 4NO5A 1LO2H 3BVNB 1ETZB 4K7PH 4HH8A 4DCQB 5D1XA 2WUBL 1XF4B 3ARDA 2BMKA 1JF1A 3MJ8A 5EOCH 3QNZB 3LN5B 4QRUB 3IDIB 3CFJB 1J5OH 4NBXB 2DS4A 4LU5L 1WT5A 3EDDA 1KBGH 1P9MC 2P8LB 2RFXB 1OAQL 1EH9A 1S7VA 1CFTB 4LARL 3QUXC 3AS1A 1D5IH 4P99A 3VWKD 4PJHE 3SQBA 3SDDA 3OKNB 3U79A 2F19L 1DBAH 1MCPL 3MXWH 1ZLUH 1CLOL 4NQXB 1C08A 5AZ2L 3GFUA 1J05A 5J7CC 4RA0C 3UTZB 1MHCA 5H2BB 3OKDB 3TPUB 2F8OA 5CJBA 4ZUTA 4XHJD 3D2UA 2OP4L 1XF5B 4AK1A 3UTQA 4NQCE 4M48H 3PP4H 1KTDA 1PDKA 1DTUA 2YC1A 1BIIA 1A1MB 1MRDH 2DIBA 4O02H 4P2YA 1PY4A 3TFKC 3DXAD 5HI5D 3QT2A 1XF2B 4PJBB 4K3GA 4R90L 4HIIA 3V6FA 5DZOA 5F7EH 1JGVH 3HB3C 3BE1H 3CX5K 5ITBL 1A7NL 3WXVH 4PJ7E 3DVNA 5J1SC 1VFAB 5FAAA 3SDCB 1JK8B 3QHFH 5IVNA 1I3RA 4XVUC 1L7TH 4OM1L 5MENA 5I73B 3HS0A 2I9LA 1GGTA 1UXWA 1ZSDB 3QCTH 1MQKH 1K2DB 5IR1A 3F58H 4ZO8A 4DK3A 5DT1H 3FB7A 5C0DB 4P5TC 4G8IB 1MJ7H 4OAWA 1EXUA 5HDQH 3P73B 1ED3A 1F97A 5HGDA 2V5TA 3VCLA 2BDNH 1EFQA 2AQ2A 3QUYA 4FQCL 1PSKL 4PJFA 4EIGB 4HWBH 3F7QA 4KTEL 2BVUA 3VE0A 3QHZL 1IGYA 4HHAB 4QRRA 1ZV5A 2QQKL 4ORGA 4I3SL 1OPGH 2NTSP 3A0OA 5A2IH 2FHBA 3HR5B 3QFDB 1ZANH 2Q20A 1LEIB 1RK0B 1N5AB 2X2YA 2XTJE 4KKBC 4WI4A 2VNCA 4QY8A 5DS8A 2Y5TB 4FFWD 1CR9H 3BGFC 3CLEL 1U58A 4LDEB 4OTXH 5KSAA 3WFEH 2F54D 3UROR 4UDTA 3TO2A 2E6JA 3BH8B 2MPAH 5DJ2A 3T4YB 5FDWA 1KXVC 1P1ZB 3D87B 3IFNH 3VXMB 4HXAH 4OT1H 4KHXH 1U8QA 1SBSL 3Q5OA 1AR2A 3P0YL 1KN2L 2XPGA 4TRPH 4YAQA 3TVMD 5L6YH 1EEYA 1GAFL 2JB6B 3SDAB 1Q9OA 3VXSD 1UH4A 2DKSA 4KDVA 1RMFH 3RWGB 3UDWA 4F80A 2VSCA 3DUUA 4K8RC 3UJIL 1I7TA 1CWVA 4TVPL 4RWHA 3SGJC 3MOBH 5D72H 4P57A 1WITA 3UEZA 4X98B 3SO3C 5JDSB 1P5VA 1W72A 3ZDZF 4JHZA 4EKXA 2UZYB 2HFGH 1OSPL 1HSBA 4JR9H 4X5XB 1U36A 1MEXL 5IB5A 3O8XB 4GBXD 4KUCD 3RGVA 2NY0C 5IB1B 4XMPL 3O3EA 1WUNT 5C07B 4LLDA 2QL1A 4ZS7L 1NMBL 3Q6GH 4FZEH 4OZHE 5K9OA 3CC5A 8FABB 3W81A 2CIKA 4OCXH 1H5BC 1AY1L 1HE7A 1YEHL 2FH6A 1PD6A 3F5WB 4R0LB 4RIRA 5DJZB 4MAUL 5ETUA 4HWEH 1UWEH 3QJFB 1J9CT 3N9GH 1NGPL 4OCWH 3I9GL 4WEMB 4X7SL 3HHRB 3AGVA 3KS0H 4IRZL 3D39B 4YC2C 2IAMA 3MUJA 4GRWF 4HPYH 4WHDA 3RDTC 3FO0L 3CSYB 5KVFH 4OI8A 5E9DB 4ZUSB 4Z7UF 4GRMA 5EWIL 4OFKA 3UX9B 4U0RB 2BOCB 5F3HB 5JIPA 3KLAB 3MLRL 2APWA 2ITCA 4NN6C 1SMAA 3FL7A 4JGMA 4KAQL 5DRXB 4P2QA 2HVJA 4MNHB 3V6ZB 1QSFD 1M7IA 3JV6A 1QFUL 2XQBL 2FATL 4V1DA 5FYKU 3D69A 2DQDH 1AXIB 4Q0XL 4ODHH 4P5KB 3PXJA 1NUDA 2VYRE 3OX8A 1VERA 1EMTL 4MNGE 1TCRB 3FT4A 4YE4H 3ZDZE 1I8MB 1MFNA 4Z7VB 5C6TL 5BRZE 4GRWH 2J88L 5I17A 1XT5A 1ZE3C 3TH2T 2BSTB 1ZS8B 1NAMB 5GGQL 3RX8A 1HEZB 4CRPA 3O4LB 4CMHC 2MSPA 5KSBE 3MLTA 5CCKL 2FX7H 4Z6AT 5HYIA 1QBLH 3I02B 1X6LA 3VFNB 1IGMH 1YEFL 1QA9B 1MH5B 1XR9B 2A9ML 4P4KC 1HHJB 3GM8A 1D9KD 5JXED 4WU7B 5D5MB 4JJHA 3RZCA 4G42A 1V7ML 4C56B 1LD9B 2QJDA 3RHWF 3RWJA 4NM4H 1KPRA 3BZ4A 3TH4T 2VR5A 3FB8A 1XFPA 4PBXA 1CE6B 4XXCC 3QR2A 1BGXH 2JTDA 3HG1D 5IMMA 1XCQB 1WBXA 3QDMB 2V2XA 2R2CA 3QQ9D 2KDGA 2LTQB 5CP3A 3QDJB 1K8DA 3X12A 2JJSA 3M07A 4Z7UE 5EPMB 3V0VA 1MCHA 2X70A 4RDQG 3ULUD 1J88A 2H9GB 4Q58C 1NC4D 5C8JB 1MJ8L 5D7LB 2V9QA 4JKKA 4Y4KD 4U6HB 3OAZK 1HILB 1HQRA 1S7UB 2YHGA 4JO1L 3C8HA 4IIQB 2QADB 4DZBB 2EEAA 1RIHL 5E2TH 1JIBA 3TO4A 3VG9B 5I1JL 5KVGH 5LG1A 2X89D 5ESAB 2CMRL 4NQDE 4JPWH 2OMBA 2NX5B 5E6ZA 2W65A 1CDJA 3O45A 3LVEA 5F21B 4M6AA 2N4IA 4JM2B 2FNBA 1BZ7B 1WV7T 5SWSE 5EA0L 4QXTA 5K59F 1KB5H 1WZKA 4XZUB 1UM5H 3QDGB 2EXYD 5CIPA 4YPGA 1UWXK 5L2JB 3D3VD 5DJ0A 2PW1B 3QXVA 3ZT7A 3FZUD 4MDIA 5FYJH 4JRYA 4G8FB 3SGDI 1FNSL 1CICA 2X4PA 1MI5D 1ZT4A 1PY9A 3H8NA 2Z4QA 2VDOH 4F7TA 2X44D 1BD2E 4MMZC 1NCCH 3TBSA 1U6AH 3F12B 4M62H 4WV1A 1MAJA 4TUKL 4NQEB 4Y4FC 3MV8B 4YDVA 4MHHI 3U7YL 1EERB 3VW3H 3TA3D 2GKIA 1U8OA 1KG0A 3VH8G 1AJ7H 3QI9D 1OP5H 4Y16B 5HI4D 2W9DH 4S1QH 5GRWA 3LPWA 2V7HB 4IHOB 5I71C 2VLRD 4OBRA 2I07B 1S5HB 2ENSA 5AWNL 4BQ9A 2VDLH 3WUWG 4MNQA 5D7IB 3CFBA 3BQUA 3VFUB 4IRSD 1F6LL 5FA4B 1SJEA 2IAND 1TETH 5LGHH 4ALAL 5L2KE 5IT2H 1JZ6A 1BQHA 1VHPA 1CG9B 4X0KA 3VXRA 2VLJA 2JB5H 1JGDB 3OB0K 2ESVD 1KLFA 2E6QA 1MCWM 3H0TA 3GK8H 3HCVA 1GRWA 1OAZL 4KJWD 3DSFL 2HJFB 4DKEL 1AFVH 4L29B 4W4OC 4AEHH 3RI5F 3B43A 4H8WC 1EX0A 4U3CA 3FFCA 5DWUL 2F53E 4NKIH 4D9RE 1I1AD 3MR9A 1CD0A 3MRFB 1X4XA 2DI9A 1H3GA 5L9DH 3L6FB 1HINL 1VPOH 2JLLA 2XWBA 2QQNH 1KEML 3K7UA 2PXYB 3T3PE 5IJVB 1DVFA 3T8XA 4XNUL 1K6QL 1Q9LA 4Y1AB 3B5GA 3MMEA 1G9ML 1T3FB 2VE6A 5H94B 3PGDA 1UM6H 4FTVE 4Y5XA 5CJOL 4XP1L 1HZHL 1VDGA 3I6LD 4GAGL 3V5HB 3DURA 5EZJB 1T4KB 1FFRA 3WUWB 4DTGL 2HA1A 1RJYB 3L5HA 3V6OE 3QUZB 5KS9F 3RWHB 4OGYL 1FIGH 3DX9B 3VXTA 1MPAL 3LQAC 1R3IH 2MOVA 2XY1A 3MV7A 4W6YB 4XNYL 2VKXA 5F6IC 4KH2A 5HHNA 4YXHH 4NSKA 1CS6A 4NP4H 3HI6L 5K9KA 4FQPA 4KQ3H 1YEDB 4OFVA 1JBJA 1BREA 1EK3A 1OF2B 1OAXL 3C60D 3MNZB 3TZVB 4BKLA 1DQJB 3U0TA 3RVTD 2VR9A 3FB5A 3RA7L 3H9HB 2Q86B 4XCFH 3KLDA 5ACZA 4ODTL 5HJ3B 3DX7B 3BP6A 2X9WA 2NQCA 4WW1B 3VGEA 3THML 3MV9B 4C57C 4ZNEE 5GGRY 1T89C 5KJRL 1T1XB 2IBGA 1AHWC 3FQUA 5FUCE 4UQ3A 1AI1H 1U8IA 3BKYH 5EBLA 1JPSH 2OL3L 3QULA 2FB4H 5A3IC 4GKZA 4S1SL 1WQVT 3AFLA 1Z6JT 2IBZY 4O4YH 4F37F 1J1PL 1RZIB 4LDOB 2GCYB 3QEHA 1FL3B 3GBML 2B8OT 4JFDE 4JZJB 2YKLL 2DMBA 4QHUB 5IBLC 4J8RB 1NMAH 3ROLB 1YYML 1KEGH 1BVKB 2AEPH 1GZQA 4P2OC 3V6BR 4XPAH 1HWHB 3U4BL 4PP2A 1WZ1H 2EIEA 1A7QL 3WIHL 2BSRA 4BFGA 1ZA3A 4QOKD 4Z7WA 1AP2B 3FCTB 3HC0B 2GJ6A 1KIPB 4DEPC 4PRHD 2ICEB 5J6HA 3TBYB 3TNMB 4OQTL 4BH7A 4P46D 3PNWA 4XPFH 4YDKL 1ES0B 1H3WM 4LSDA 3PWPE 1PLGL 1MCIA 2JIXA 3RIAF 1T0NB 1OTTC 3SE8H 1JV5B 2Y25A 2IPTL 5C92A 3H3BC 4AL8L 4M7ZB 5E8PB 3I3EA 3GKZA 3AMKA 1WAAA 4HAFA 4O5LL 5CMAA 1E4WL 2X4NA 4EOWH 2NXZB 1VGEL 4AG4H 1LWRA 2E8ZA 1J1XH 3LEYH 3I6KB 12E8H 1JGUL 1NLBL 3OAUH 4KV5F 2DJSA 4L9LB 5ECJE 5C08B 1Q9WA 1ZLVH 1IQWL 2D9CA 3P30L 4LFHG 4NT6A 2D4DA 5ANMB 2H32H 4FQXD 3KAAA 4KHTL 2WV3A 1AO7A 2Q7NA 4QWWD 5HHXL 2NY3C 4YLQT 1T1YA 1DE4A 3ALXA 4YHKL 3BDYH 5EIIA 4ELME 3UTTB 3UJTL 4HC1A 2R4RL 3B2UD 5CEZD 1FN4A 3QUXB 1SY6H 2K7QA 4NNYA 4DGVH 1NBZB 3VFRB 4FZ8L 2XN9B 3L1OH 3VFMB 3QWRA 4H0IA 3QH3B 5C1MB 1R5IA 2PF6A 3WL9B 1X4YA 4L8SA 5B39A 3EZJB 2VXTH 3NFPA 1P2CB 3P9LB 4PB9L 1QRNE 3BRGC 5I74C 2WK2A 2EKJA 4KZEH 4FN0A 1TQCB 4GQPH 3C6SB 5GSRA 4C58B 1JHLH 3MRNB 1C16B 4L8CA 1EFXD 3QCUL 1S7RA 1LQSR 4XAWL 1BFVL 2WBJA 3KYMA 4DQOH 4RMRA 5T1LA 1JRHL 3VDAA 4OD3L 4ZUWA 1NGXA 4BH8B 5CUSH 3GSQB 5DXWA 4Y5YA 5KSVA 3ARYA 3C9NA 4X9IA 5A1AA 5D6CA 5K9QI 4N8CH 3IDXL 1B6DA 5CZXD 3O11B 3X13A 2EKSB 2ZP0T 1V5JA 4FQIH 4FNLH 4Q6YA 1HH9B 4P9ML 1LMKA 2DLIA 4LHQB 1XGRA 3QEQB 4NQCA 5D8JL 4JFZL 4NKMB 1OGAB 1X5HA 4XNQA 3K4AA 4KV5E 4HUXB 2AXGB 5EO1A 2AW2A 1DZBA 5GS1A 4ODVL 4RISH 3DYOA 2UVEA 1NDMA 3K2UH 3MV11 4R4NC 2P42B 2GSIB 1KELL 3DTXB 3MRKA 4LCWB 3BWAA 5ID1B 5C0RL 5DHYB 1A3RL 1P7QA 4Z76A 2DD8H 3I3BA 1BF8A 2CLZB 4LBEA 1WWBX 4HKBA 3CPLA 3WIIL 2A6DA 5D70L 2YD3A 1KCVL 2DYPD 1XR8A 1MIEL 2RQ8A 3K1DA 1AXSB 2QQQA 3E6HB 4HMCA 5JXAH 4G7YH 4RFOH 4U1KA 3V5DA 3H6JA 3ZTJG 3IDNB 3VFWB 4PRBA 1ORSB 1BP3B 5FUOL 3GJFA 1YYLL 4A2LA 5SX5H 2R15A 3BGMA 2MKLC 3LY6A 3MFFA 1CGWA 1U8LA 3ZYIA 1LO4H 1T5XB 1UB5B 2OTUB 3BUYB 4PRPD 4GAJH 3ARED 1AGBB 1H8SA 4TUOA 4F2MA 5IQ7H 4D9QE 3LD8C 2Y36L 1EBPA 2HLFD 3DV4A 2OTPA 4ONOA 5F7HA 1X5GA 1J0HA 5L88L 4KKLC 1TVHA 3PABB 4H5SB 4Y89A 4PJBE 1FGVL 4PREB 3WNPA 4HWZA 1WWWX 2VDRL 5FDYA 4ZUUB 4UU9A 4L3AA 5IFAH 4HKZB 1ZK9A 3ZTNL 4M5YH 5FYKD 5D2NA 4U6XB 4NYLB 2J6EH 5FO7B 1NAKL 4JY6B 1G6RL 1CK0H 3WNOA 4NC1C 1GC1L 2DQGL 1DUYA 1OSZA 3HZKB 4JQVC 5EOTA 4XH2A 2WUBH 1B3JA 4L5FL 5L7XL 3EYQD 1N5YL 1EVUA 4FRWA 4PD4J 4FQHB 2AV7B 3AY4A 4N0UB 1J10A 2NY0B 2HTLD 5FGCB 5IVZA 1U8PA 1ZGLP 4CMMB 4LU5H 4ONHA 5GGTA 1ZHKB 3JUZA 1EAPB 2NY1D 4YHLL 4X99B 1MF2L 1OOAA 1EV2E 1OAQH 4LARH 1FNAA 1INQA 4WW2B 5D1XC 3KLHC 4CVWA 4IMLB 2F19H 1MCPH 3C08L 4RMSA 4YHML 3OKLA 5C0JA 1CLOH 1G7QA 3NIFF 5AZ2H 4LPTA 4FFVD 4ZUVA 2P5WD 3EGSB 4ZOEA 3DX6B 1YEJL 3QAZB 2EDDA 3MROA 2OP4H 3RDTB 1W0VA 3CVHB 3TCLA 5C0CB 3IGAA 5KZCB 1F8TL 5C9JA 3S37L 4LSVL 1NMCC 1N8ZA 1MCQA 1J0IA 3HZVB 3SDDC 3T09A 3ULVD 3VXME 1IILE 4MA1C 4C83B 4TQEL 5ENWB 1IJ9A 4MQSB 1F6AB 4R90H 1BQSA 4Z7NF 3CZFB 1TQBC 1M05B 1RZ8A 3MRJB 3RVVC 4DK6A 3S5LA 1TJGL 3MREB 5ITBH 1A7NH 1BZ9A 4I9WD 4GW4B 4NRYB 3A6CL 3DXAA 2VRAA 3QUMA 5IIEB 5I1GL 1PVHA 1QTYT 4OM1H 4HZLA 4JFFB 1OL0A 4S11A 4HK0B 1TTUA 4Z7VF 1WIUA 1WGOA 2DQIL 5F7KC 2E9JA 4M8QB 5BQ7A 1WCBA 2BVTA 4CMHB 1CQYA 2W1NA 4KRPC 1GGCL 2HRLA 2FJGB 1UEYA 5FHAL 2A73A 3BSZL 3VRIA 1NGZB 1Z9MA 4MNGA 1S9YB 4FQCH 3N1FC 1PSKH 1BBJA 3WN5A 5IBTL 4M9OA 5CEYB 4P4KB 1P4LB 4KTEH 3PF2A 1JPGB 3QHZH 2HJLA 1S8DB 4ZQKA 35C8L 2DI8A 2D0HA 1BVLA 3S3PA 2QQKH 4I3SH 4OLYL 1LO5B 4H8WL 1XIWD 4RBPK 2OTWB 4PY8J 4JANB 1IL1B 1G6RB 4HS3B 4OLEA 4QT5B 3WHXA 3IFOB 3MJGX 4PP1D 1J8KA 5KSBA 3D39E 5I16A 4P2CG 3PWVA 1YQVL 2E7CA 3RNQB 5GRXG 5EU3A 2CK2A 3V5KB 3QUYC 3CLEH 4LRNL 4YFLI 5IROA 1FC2D 1FO0B 2X4OA 3GIZL 3DBXB 1FFOB 2DLGA 3L3IB 3JWNC 4MX7B 3WFBL 2X1OA 1CT8A 4JRWA 2AV1B 2BERA 1ZT1A 1YNTA 2DTML 4K71C 1SBSH 2Y7QA 1UZ8B 3ARFD 3EYVA 4Z7NE 3P0YH 1KN2H 2PW2A 2IQ9L 2PYEB 5D7JA 3MRPA 1GAFH 1QVOA 5E03A 5F3BA 3LQAL 3A6OA 1J0KA 5CSZA 3I2CL 3RJDA 3AAZB 1V7NL 3HRZA 4HUUB 3UJIH 2C4FT 4TVPH 4NIKB 5INCA 1YEKL 3TVMA 1AKJB 1KLGB 4Z7VE 1MCWW 2AABL 2DQFB 1FFNB 4I0KA 3W5NA 1XGUB 3VXSA 1DDHB 1OSPH 4JM2F 1U2CA 3R4DA 4JDVA 1PX3A 1I7RB 1MJJB 1UCBL 1MEXH 2WWKO 4LHUD 5FM4A 1LVEA 2VDKL 3O4LE 3GSRA 1ZVHA 1J11A 1DN0B 3G6JA 5D96C 3UDWC 4HCRL 2R2EA 4XMPH 3WSQL 3BP4A 2CLVB 3HZYA 1WFUA 4ZS7H 1NMBH 2NXYC 4G8EA 1TENA 2PTTA 1AQKL 4HUVA 3U0PB 3QO0A 4RDQF 3S6CA 4M6OL 1AY1H 1YEHH 3RVUD 2GW5A 3HE7D 3NCYP 4MAUH 4GBXA 5D5ME 4ENEC 4NN5C 4UV4L 1QR4A 1JVKA 4F3FB 1NGPH 4KWUA 4YHPB 1AGEA 1YECL 2Z92A 2RBLA 3I9GH 4X7SH 2EYSB 2HMID 3RGVC 2HT2D 4IRZH 3QDME 4W81A 4PJ8B 5DJ8A 3LQMA 1LNUB 1PJ9A 4EBQL 2BNQB 3OXRA 3QDJE 3B9VA 4KKCD 1BD2A 4I5BA 3FO0H 4WUUE 1RSFA 5EWIH 5IF0A 4X4YB 1JWUB 4D0DB 3FRUA 3I75A 1OTSD 3GSVA 3MLRH 4LLYB 4I13B 5D7LE 3IDGB 4GUPA 4KAQH 4QHNB 5DJCB 4APQB 3T0EB 1F3JB 2VC2L 3KPLA 3EYFA 4WFFD 2AJVL 1L0QA 1QFUH 2XQBH 1I8IB 2FATH 1EAJA 4HGMA 3H7BB 3MYZA 3ARXA 1UJTA 4NCC2 4Q0XH 3B9KD 4ZFOA 4Y8AA 4HJGB 4U05A 1NPUA 3PQYD 3NZ8B 1R0AL 1EMTH 1JYNA 1LO3L 1QSFA 3HTLX 4LLWA 2NX5E 3FTGB 4J3OC 2FH8A 3QQ4A 5B8CB 3QHTC 3PE9A 4Y2DD 3IF1A 5C6TH 2J88H 3QUKA 1X44A 3WYRA 2D0FA 5GGQH 3MRQB 3QDGE 3L3KB 5L0QC 4Z0XB 1CXEA 1U3ZA 3MCLL 4HS6B 4EI6A 5CCKH 4ZG1A 4JO2L 5E08L 1H3TA 3RTQC 3W9EB 2V2WB 1YEFH 1URLA 3O9WD 4X8JA 2A9MH 5LWYL 1KTLA 2C1PA 4G6JL 4QTHB 4OF8A 2J5LC 2IQAA 3U48A 4NQEE 3MV8E 1U3HB 1V7MH 2XI9A 4DKFL 3VXUB 2DLEA 3NMEA 4FTVA 2OI9C 4RRPG 3ZSSA 2J8OA 3L3OA 2FEDD 4LLMB 1NEZA 1D9KA 4ETQA 4L3CA 5JXEA 4PJCA 1FDLL 4P3DB 2DICA 1FL5B 2IBBA 4NKOA 3U4EA 5HYSA 3B5TA 1TNNA 5GJTL 1NGYB 5D7IE 5IVOA 5J3HC 5DEZA 3ZZ1A 3STZB 2DDQL 4KI5C 2UWEB 3RZCC 3HG1A 4QHLB 3DVGB 4OLXL 1I7ZB 4DAGL 1MJ8H 3OAZH 1RVFL 4RGNB 4GW5A 3DWTA 1QEWB 3E1F1 4JO1H 4BSWB 5BV7B 2MNUA 2X4TA 4R6UA 4K3HA 1RIHH 5BO1L 5I1JH 4RAUA 4XPBL 5GS2H 2CMRH 3LRHA 3VFOB 1UZ6F 2YUVA 4OB5L 3L3JB 3VI3F 4WU5A 4HBCL 4Y1AE 3JVGA 4MJIB 3DRTA 5EA0H 4EI5B 1UWXH 5E95B 5DJDA 3WFZA 5HHOB 1WZLA 3NTCL 4ERSL 3ARBA 1SHMA 4P2OB 4U49A 4M6NL 4LPVA 3MUY1 3JUYA 5ICXB 1FNSH 3TO4C 4QRPD 5FKPB 1W8NA 2X4UB 4JDZA 3V95A 5C0FA 1HOCA 1WC7B 1E28B 4G5ZL 4ETYA 4TUKH 2WAHA 3U7YH 1G7MB 3L7FA 4JFDA 1QQDA 4M1CC 1MI5A 5CHNA 3PWUB 2YN5A 2A74B 2MCPL 3OL2A 5J6GB 1MCEA 1MCCA 2BXZA 2Q8AL 3ECBB 4OLVL 3GMMB 1BOYA 4OUOA 5AWNH 3MJ9L 3TA3A 1B0GB 4GJTB 4WV1C 4JCLA 2ZUTA 4KK5D 1KPUB 5E2WL 5C70A 1R3HA 3T08A 4ALAH 1ZVSA 3D0VA 1OGTB 3OB0H 5EN2B 5GZNC 3PL6D 4HJ0D 2OJEA 4PV8B 5DHVB 5J1AB 2EDRA 3PWPA 4IRSA 1OAZH 3GGWB 2AKRB 3DSFH 3MV9E 4DKEH 2OR8A 2IANA 3G9VA 3WXWL 4PJGA 4XWOD 2ZKHL 2BOBA 4PLKD 1H0DA 4OLWL 3PDGA 5DWUH 5E6IC 3ARVA 1JNLL 3BQUC 5D1ZA 3Q3GB 3SKMB 2XFXA 4N8PA 1HINH 2I5YL 4OCNC 5MERA 4PG2A 4JFHD 1OAKL 2EECA 1KEMH 5DQ9B 4HW6A 4XNUH 1K6QH 5EUKB 4MA3B 1G9MH 5D93C 4ODXB 2QHLA 1I1AA 3KHOA 4U1SA 5CJOH 4XP1H 5KG9A 1Q72L 2J8UB 4ZXBC 1HZHH 5JORB 3LKRA 1F4WL 3BHBB 2BVEA 4GAGH 1KB9J 5I76B 4KK6C 4DTGH 4G9FD 1GZPA 1N0LA 4J3XA 3S97C 4OGYH 1HSAB 4Q9BA 5I74B 4HKJB 2G5BA 1R3KA 3P4OA 2YBRA 3LRSA 4PYHA 1MPAH 3C6LB 4JKPL 4XNYH 4S0SD 2OMNA 1XF3A 3KWWA 3CDYA 3V8CA 5CEXB 3BDXA 4Y5XC 3HI6H 3OSKA 1CLZL 3W0WB 3VWJB 1OAXH 5DEFA 4U1JB 3NABL 4CJ0A 5HGBA 4NHUA 1KJ2A 4GLRH 3QXAB 3RA7H 1ADQA 1FZOA 2P8PB 1X5JA 5CGTA 3RWFA 5E1HB 3C60A 4ODTH 1QACA 2HFEB 3FMGL 1N64L 1FVDB 2YN3A 5EULV 4M7JL 4YH6A 3L3DA 3U9UA 3P9MA 1E6OL 3S3SA 4LIQL 2BNRD 2H8PB 5C08E 1XF1A 2YD6A 3DX8B 3THMH 3M1BA 4R7NB 2OLDA 4KK8C 4LCIL 5KJRH 4LQFL 5ANME 2VLKD 1M6OB 4YZFE 4MHHG 4O2FB 5DQJA 2Z9TA 2ZSWA 1MSPA 3MBXL 2FIRT 2Z0BA 2OL3H 4Y7MA 5DRWB 5D2LF 4LNRB 4S1SH 4CADB 2M26A 3BO8A 1SJVA 4WHTA 2MFNA 1J1PH 2D7PA 2YD4A 3D9AL 4EXKA 3UAJD 3KDMB 3GBMH 4PYGA 4W70A 4X5WB 5GIRB 2HJKA 4JB9L 4OZIA 2YKLH 2NTFA 3MSPA 2XN9E 5FYJD 3SCMD 2BY0A 1AH1A 5EO0A 1YYMH 3QQ3B 2J2ZA 1S78C 3U4BH 1J0ZA 4U3XA 3GUTA 4XPHL 5AUMA 3MLZL 1TLKA 1A7QH 2AK4D 3WIHH 2F74A 4IMKA 1MY7A 1RIVL 3CFJA 1GOGA 5E4EC 2VKWA 5BS0B 1IKNA 3NCBB 1XMWA 4WFGD 1J8HD 4KJPC 1CD9B 2NY2D 2P8LA 5FA3A 4OQTH 1G9NC 1UYWL 2DBJA 3MBED 2D31A 3B9DA 4YDKH 2QBWA 4QOKA 1U91A 2HT4D 3OKNA 1QUNA 3V4PL 1A4JB 1PLGH 4PJAF 4PRHA 3QJHB 3WFCL 5HPOA 4EIZC 2A6KB 2A6JA 2CKBB 2IPTH 4X6DF 4GG6F 4AL8H 4AQOA 4CUCA 1A6TB 4O5LH 3U82B 1E4WH 1JI2A 3QEQE 2FZ3B 1VGEH 2E3VA 2EDFA 3UTSB 1ODAA 5MP6L 4MB5A 3UJJL 1QSZA 1QFPA 1JGUH 1NLBH 5E8EA 5DSCB 1LE5B 5EFIB 1A1MA 3MLWL 1IQWH 3P30H 4P49A 3TJEL 2UY7A 4NQVB 2GTZB 4KHTH 5GGRA 4LEOB 5HHXH 4LCWE 4YHKH 3QG6B 1ZOXA 1K3ZA 3UJTH 1VFAA 2OQJA 3D18B 1JK8A 2R4RH 3MRLB 1DBJL 4FQXA 4YHNA 3T4AB 4NO5B 4F58L 5C0GA 5D1XB 4FZ8H 4HLZG 3AC0A 3ARDB 4NQSB 3NOIA 1JF1B 1FV1A 2WSKA 3MJ8B 3FQRA 1U42A 5E94B 2WBWB 3P73A 3E3QC 4K3DL 5DFTA 4PB9H 1Z5LB 5T3ZE 5MI0C 2F8VA 4PJIF 3QCUH 3ZTJH 2ICWB 4XAWH 1BFVH 1JRHH 2LAAA 3SDDB 4H26B 2JJTA 2R0LL 4OD3H 4HHAA 4EUPH 3FRPA 3PWLA 4QGTA 1C08B 1JNHA 1J05B 3IDXH 1EFXA 4L8SC 3O6KL 3JWDC 3P11L 4NN7C 5JHDD 1FSKC 1JPTL 3O4OC 5FM5M 4ZUTB 1AD0B 2WWMC 1W72L 4P9MH 4UQ2A 3UTQB 1FYTE 5D8JH 4FXGB 5C86A 4JFZH 1KTDB 3HMXA 2WBJC 2BVYA 4KMTL 3BH8A 5IHBA 2EE3A 5T1KD 3KG5A 4C4KT 2EDWA 4ODVH 3V6FB 4NUGL 4WWKB 3RUGA 3CVHH 5F44A 5CZKA 4KJYB 4N0UE 1KELH 4ZAKD 5FGCE 2H1PL 3DVNB 4TTGA 4NFDA 3EHBC 4GAFB 5C0RH 2FBOJ 1A3RH 2QSCL 1I3RB 4NM8L 1AC6A 3RVWD 2PO6D 4WCYL 3HS0B 2QR0A 4PGCB 5JDSA 4LVOB 15C8L 1UXWB 3BUTA 3WIIH 3BKCL 5D70H 1KCVH 5IEKA 3FB7B 2D9QB 1MIEH 5GS1C 4OAWB 3KYKL 5A16A 4DKDC 5CKAA 4UI2A 1EXUB 4R4FL 4MS8C 1ED3B 4N5EC 5HGDB 3VCLB 4B53A 4K07A 4OZFH 5C07A 4XXDA 3QUYB 2DYPA 5FUOH 1YYLH 1GPOL 4KK9D 8FABA 4HIHB 3G9AB 5C0CE 2X7LA 5IMOA 1IGYB 5DJZA 4R0LA 4JGUA 1MUJA 4QRRB 2Y36H 4U1MB 4F33B 1IM9D 5HYEA 4BFEA 5HI3D 4PV9A 4XP9L 3W11C 5L88H 1BBDL 1B0RA 2XWTB 3BEWB 1FGVH 3PWNA 1L6ZA 4YHYB 3E6FA 5DS8B 2VDRH 1XCTA 1U8HA 4HBQA 4NZJA 5KSAB 5A2FA 1IAOA 1YN6B 2HLAA 1MCLA 3ZTNH 3CD4A 5E9DA 4UDTB 3TO2B 2ZNWA 5DJ2B 1M1SA 1NAKH 5FDWB 2AEQL 5IMLA 1G6RH 4UOW0 1GC1H 3EKCA 1Q8MA 2DQGH 3KLAA 1U8QB 3HC3L 1KCUL 3V6ZA 4KKAD 4L5FH 5L7XH 4YAQB 1N5YH 2XTJC 1Q9OB 3N06B 1Z9LA 3DUUB 1T20A 2COQA 1ZGLA 3KPOA 1I7TB 2NXYB 5J56B 1U8MB 4KXZH 4B5EA 4YHLH 1JYVA 2ATPA 5D2NC 3AVEA 1MF2H 3LN9A 5EO9A 3HAEH 5K9QG 3FOLB 2Y1VA 1B9ZA 3P4MA 5TFSL 5ESVA 4JZOA 4XP5L 2AGJL 4ZYKA 4G6FD 1HSBB 2EZ0D 1NBYA 1OM3L 3C08H 4YHMH 3A6BL 1CGYA 1JZ5A 2BSTA 5I0DA 1NAMA 4G9DA 3AY4C 5BXFB 3CJJA 1HEZA 1OTUC 4DGYL 3W5MA 3O3EB 1YNLL 1E4XI 5L8JB 1YEJH 5K9OB 3EO9L 3CC5B 3ZL4L 3I02A 1DANU 2CIKB 5KTEL 3MODL 2A6IB 5ETUB 1F8TH 3S37H 4LSVH 2P5WA 3TPKA 4C56A 1FNEB 1LP9F 4JQIL 3GRWA 1HXYB 4WI6A 4TQEH 2PYEE 4U3HA 2IAMB 1AC0A 4OJFL 1G7PA 4QXUL 3VD5A 1TJGH 4PRAA 3A6CH 4GRMB 1RURL 2JJUA 5EPMA 5I1GH 1X9QA 4P23C 2XT1B 1DL7L 2GI7A 1BOGA 2GAZA 4XHJC 4CGTA 2ITCB 3QSKB 5C0BD 2V9TA 2H9GA 4Z78B 4P2QB 4QTIL 2HVJB 4J3VA 1M7IB 2DQIH 3JV6B 2CSPA 2Z8WC 3GMOA 4V1DB 5L0QB 3D5OF 3B9EA 1PQZB 3D69B 4IJ3B 4LCCB 1GGCH 5EORL 2PR4L 3C2AL 4ZFZA 3QRGL 5KAQF 4BA8A 5FHAH 5HDBF 3BSZH 3MQIA 1CDYA 5ESAA 5F9WC 3MZTA 5FM8A 4TSBL 5IBTH 1BQLL 4OLUL 4KMLB 35C8H 4QF1A 4XNMB 5I17B 1VADA 4RBPH 1BZ7A 5DJ6A 4OLYH 2VZ3A 3IS1X 4H8WH 5F7WC 4XZUA 1KNOA 4AEIL 1CU4L 1PZUB 2M8XA 5DC4B 4G8FA 1YQVH 4KFZC 4LKCB 4MAYD 2YR3A 3KXFD 4U4BA 3SGEH 2BNQE 4LRNH 3KPRD 3CU7A 5JIIA 5HXMA 3GIZH 5ERWB 3F12A 3WDHA 5FK9A 2MKWA 1K9TA 4G42B 3RWJB 2VERN 1KPRB 5JMOC 3WFBH 3BZ4B 2X9XA 2YEZB 3FB8B 2IMMA 4Y8DC 2DTMH 4EXPX 4LGSB 3T0EE 1EGJL 2Q6WA