5DO2C

Complex structure of mers-rbd bound with 4c2 antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
215
Chain Sequence
DVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRDGNDYDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords S protein
publication title A humanized neutralizing antibody against MERS-CoV targeting the receptor-binding domain of the spike protein.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
total genus 44
structure length 215
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2C01
2ZNWA 2CKBB 2NY0B 1X5ZA 4LSVL 4QXGH 3HPJA 4XWGH 1U8PB 4QOKD 3LB6D 4R8WL 3C5JA 1V5JA 5JMOC 3RWIB 4QRRB 4UV7H 2OTWA 3U46A 1A7PH 1MRFH 1WIUA 2BCKA 5E5RB 4JN2A 1YMMA 1CLZH 3GIZH 1CDHA 3KPSB 3QUML 4PIRF 3LN5B 4Y1AD 4XNXL 3DX9A 2V5YA 3GSNH 4LF3B 4NT6B 3MLZL 5E5MB 4X7CC 1A6VH 3BPCB 4QRSA 4GAJH 1CDGA 4UZGA 4LSSH 4E9LA 1GGBL 4PV8B 3B9VA 1HOCA 2GT9A 1YECL 3NCBB 3MR9A 3HC4L 4L4VD 3FQRA 4WHCA 4MSWB 1F6FB 2XY1A 4OT1H 3WDJA 4DQOH 3IDYB 4W6XB 4HGKC 4G8EA 4OZIB 3LQMA 4AQOA 2FX9H 2GK2A 4KKLD 4JM4H 3OR6A 5IVXF 4YQXL 5J06A 4WV1C 2R8SL 4M6NH 1EEYA 4KTDL 1IC4H 5DK2B 5D1ZD 3BGFC 3UJJL 3TFKC 3HZVA 4JFQA 1OSZA 3JTTB 4KRLB 3UTPD 4FZ8H 3S5LG 4HAGA 3LKQA 1Y6KR 3IETA 5HYSG 3IJYA 2A0LD 1CFTB 1BZ7A 4NJAH 1ONQA 5DD3L 3TBWA 2QR0A 5FYJD 4NBXB 1JGDB 2V17H 2R1WA 3WIFB 3GM8A 3BGAA 5E8NB 3ZSTA 4EN3B 4JQIH 3SDAB 1I4FA 3OB0H 3BX7C 3UCRA 2E5EA 4ZAKD 4WRLA 5F96H 3RDTD 3LCYA 1MHPH 3P4OB 3UO1L 1U8KB 2BY2A 3QIUD 3CXHJ 5JOFA 4N5ED 3BKCH 4F57L 3MJ9L 3SO5A 3X3GL 4FTVA 5I17A 2ZJSH 1F8TL 2EEAA 3IDXH 1MELA 3EJJX 5MHSE 4YDLC 1GYAA 1RZFL 4IS6B 2X4UB 5L7XL 1JGVL 5IW3A 2VDKH 4HBCH 4LBEA 1D5ZA 7CGTA 2CR6A 4KJPC 5DK0B 4GKZB 3LSOB 3MRDB 2WP3T 2IBZX 5E9DB 3WXVH 3OF6A 5D7KD 3WIIL 1RVFL 4Y2DD 5EO9B 4UQ2A 2HLFD 2C9AA 3FB5B 4E5XA 2X4RA 4L4JA 4X6DA 2NZ9C 5E2UH 1YPZA 1LP9F 3ZKMD 4XPAH 1A1NA 2UZIH 4JRXB 1EPFA 2Q20A 5E6ID 4AEHH 4MNGB 4NO5B 4YGVA 3W9DB 1QNZL 1A3RH 5JXAL 3O2DH 5D2LA 4BKLA 4Z8FH 1MY5A 4ZS7H 1OSPH 1XGYH 4NUJB 1D6VH 1A6AA 3TV3L 5D72H 4AIZA 3P9MA 2UVEA 2BXYA 3G6DH 3TWCL 2K9UA 1UA6L 2GHWB 1XFPA 1OGTA 1VHPA 3INUL 5IMKB 5IT2H 2VISB 3RGVB 1WBZA 4CNIB 5K59E 4X7EC 3MJGX 4TPRH 1R5WB 3RRQA 2VABB 1ZWIB 3CVHB 1PG7W 2JE8A 2G5RA 1NDGA 5D1XC 4X5XA 2A6KB 2DI7A 1WFUA 1FAKT 1MNUH 2GK0B 2UV3A 1JNHA 4G9FA 2GITB 4POZC 4Z7WB 3T09A 1K4DB 3LHPL 3VWJB 3LKSB 4DZBB 2O61B 3V52L 3JWOH 5FA4A 2RR3A 5IHLB 1WFNA 4HKBA 4FMFA 1H0DB 1RSFA 1RZJH 1P84K 5KZCB 4JO1H 1L7TH 2JIXA 2LVCA 3GMMB 4P4KD 5FCUH 3FRPG 5IV2B 1G7PA 4WO4C 3QUXB 3VRJB 4KTYA 1FL3A 2XWTB 4KY1L 2FX8L 4JFYA 2YD3A 4HJJH 5GSVA 1PX4A 4MDIB 2V7NB 2I25N 4QKXB 1KNOB 3T3PE 3HMXA 5HDBF 4N8VA 4F3FB 3QDME 1XGQA 3LEVH 4PJBE 1CR9H 1FZJA 4K9EC 1JNNL 3NPZB 5IBUG 5DRXB 4X4YA 1T0NB 4XB7A 4QF1A 3O6FA 2ZCKL 4Y2OA 1FL6B 3WIHL 2NW2A 3B2UC 1AD0B 4JDTL 3GSOA 1S7TB 2BSSA 4QHKJ 3BE1H 5EZLB 1NBZB 4OLZL 2CUIA 3VFMB 2AEQH 1E4KA 3BKJH 1I1FB 4OQTH 1A9EA 4F58H 4DZ8A 4DJMA 1S9XA 3OJDA 1T66C 5J57B 3NTCH 5CJ5A 2L7UA 5TQ2H 2QSQA 3BP6B 5CUSH 1OD7A 4GH7B 3WHE1 5BO1H 4WI3A 4M6MH 1ZMYA 1CYGA 3IAPA 5CP3H 2GUOA 5DT1H 4XNMB 3WO4B 3S37H 3ARBB 3RZCD 4HJ0D 4PP2B 4X8XA 2F15A 4J3WA 3V95A 4UU9A 3ZDXE 2B5IC 4JHAH 5DA4A 2EDYA 4PV9A 5E94A 5TE7H 3C6LC 2L0DA 3S5LB 4IRSC 1G7LA 2WANA 3VWKB 5HYSB 4BQ6A 2YD6A 3QI9D 3DRQA 3VXTA 2DMBA 4LDEB 3L7EA 2FL5A 3MLPA 3IAGC 2E7CA 1N5AB 4FQXA 4MNHB 3VFPB 4TVPL 3OWEA 2Y06H 5IMLB 1FL5B 2EICA 3FRUA 3BZEA 1T1XB 1AO7A 5CINL 4LLUB 4XWOD 2X89A 3VMOA 4PY7A 3WXWH 1F4HA 4J1UA 4ENEC 1AI1L 1AIFB 3M1BA 3LPFA 1YJDH 2PXYD 5IJVA 3ZDYE 2VXVL 2R1YA 3GUTB 2FWOB 4R7DB 4PRDA 5CLWA 4U6YA 1KGCD 4HIEA 4X0KB 3MRPA 5EH1A 4NNYA 1R0AL 2HJFB 1UVQA 5I1HH 5D96C 1ZGLP 4H25A 3SJVD 4F7PB 3N1QC 2A9MH 3WFDH 2Q76B 1IM9A 2F54A 1NKRA 3PGFH 2NXZD 3ZHLA 1L6ZA 3KPRA 1EJ6A 2RQ8A 3QIBD 1DBJL 1TZHA 4YO0B 2FEDD 3K4AA 3L3OA 3LEYL 2DQDL 3EO0A 1F2XK 2F74B 3P73B 3NCEB 4HCRA 4EDXA 4XPTL 1WT5C 3BPNB 1HHIA 4GG6E 5D2NB 3DTXB 4S1SL 1N0XH 1NEZG 2RIKA 5JOEA 5E99H 4HG4K 3ARFD 2NXYC 3FOMB 1A6TB 4FTVE 2FJHA 2FH6A 1QBML 2X4PB 4X99B 4XCFH 3BWAA 3FQNA 1RULL 1BEYL 3VFGH 1NDMA 4BFIA 3DUHA 4HGMA 5JW5A 4RGNB 2C1PB 2IMNA 2A6IB 3MRJA 4GQPH 3KDMA 4QRPB 2ZUTA 5I73C 5C9KA 5CFHA 1C7TA 3UBXB 4JZJA 2YUWA 1YN6B 4ZUTA 3MRIB 4GXUN 2O26U 1A2YA 3HR5B 3IDUA 3UDWC 3MXVH 5TE4L 3HC0B 3CDGA 3O6LH 1PD6A 4PGDB 1P7HL 5CMAA 4YHNA 3OR7A 4UAOC 3EYQC 4GRWH 4X6DE 1P7QB 4Q6IB 4LSQL 2JB5H 1JMXA 1A5FH 1TVDA 1YPZE 4U6XB 4ERSL 3KPQA 4NRZA 4OGXH 4XP4L 3RVWD 4FABH 1KIQB 2E7HA 4S1DD 4KHXL 15C8L 2W60A 5D2LE 4IJ3C 3RWDA 2PN5A 4DK3A 1YEIH 2YMXH 3KPNA 5AWNH 4G6MH 1XH3B 3BPLC 1IGTB 4S1QL 3VW3L 3L3JA 4GRLC 8CGTA 4JM2F 4FA8A 5ICZB 5JXEC 2VLJA 4MD4A 1CXKA 2IAMD 5AG8A 5JW4Q 3W9EB 2IPTL 1RIUH 1K8DB 1VDGA 1P1ZB 3EKCA 3VH8A 4JFDD 1BHGA 4P99A 2X4OA 5H35B 1A3QA 4ELKB 1Z9OA 4IRJD 2FEEI 2KQNA 4R96B 1FBIL 2VERN 1G7MB 1WITA 1ZHNA 5DUPL 2J6EL 5EU5A 4Z7NE 1OCWH 1LP9B 5KANI 2R2BA 5T3ZE 1I7TA 4G7VH 5HYJB 3D1MC 4K7FB 2WUCL 5I1EL 1FLTX 1RI8A 5HPMB 2JJVA 4H88H 3PUCA 2CLZA 4Z95H 5IB3A 4A6YB 1OAQH 3HNVL 3GM0A 5IBUB 1K2DB 3SOBH 3EYUL 1D9KC 4Q97A 3WDIA 2MQ0A 1W2KT 4HPOH 3MO1A 3H9HB 4HEPG 3U0WH 4HIIB 5AZEH 3QULA 1DBAL 2UY7A 1U92A 4QO1A 4UTAL 3BH9A 4F37K 2YPLB 4N0FA 5IOPB 3E6FA 1OW0C 3QEGL 3QQ3B 1I9IL 1MWAA 3CDYA 3ILQD 2C3XA 2HLAB 4X80H 2E7MA 3P0YH 2EYSB 5JO5A 4RAUB 3OSKA 2DDQL 2B1AH 2Q86B 4PREB 4WI7A 1DLFH 2OI9B 2VWEC 5DDHB 3W2DH 1LO4H 3OAUL 4LQFH 4K3JH 3HFMH 4FG6D 1J1XL 3PHQB 5KSAD 4ODTH 2XFXB 1GIGH 5F7HA 5FECB 2CO6B 3OJVC 1JF1A 1BQLL 4Z0XB 5I19L 3QXAA 3IRZA 1FLRH 3VU2A 2BVYA 1B9ZA 5ISZB 2XWBB 3J8F7 3RBGA 3LZFL 3U7YL 2WBJD 4OF8A 4RRPG 3DYMA 4QRTA 3ZTNL 4WHDA 2AGJL 4OV6F 1LE9B 1QZ1A 2EIDA 4HS6A 1NLBL 1KN2L 1AJ7H 4J3OC 4MJ4A 3W0WB 4GKSB 4BSVA 4QYOA 1AQKL 4XCNA 4XPBH 3BT2H 3V5DB 3WUWA 3N85L 3VXOB 5KSBF 4KJQC 3D0LA 5MENA 3NCJL 5ILTH 4LSDA 5C0CD 1IT9L 1HEZB 1P69B 3LY6A 4JEGB 5F6HI 2ICCA 1DQTA 3CDCA 4ELMA 5I1DA 1PLGL 3MACH 3LQAL 4F15C 2E27L 1C7SA 4K3EL 1NMCC 4LVHC 3TO4D 5LGJA 1AFVL 1UCBH 5IWLA 2DBLH 4UTBL 3JV6B 3SDYL 5DLML 1RZGA 3KNBA 4N68A 1MOEA 3TCLA 2DB8A 3UMTA 3VXRB 4IOFC 1YQVH 1D5IH 2W9DH 1AO7E 3KJ6H 4JCLA 4BH7A 4PS4H 1G7JA 3D69A 3WHXA 3HG1A 3SE4C 1OL0A 4Z18A 1JZ8A 1A6WH 1VACB 4FXGA 5GS1A 5FHAL 1TETL 5C0DA 3SCMA 3CMGA 1BOYA 1Z6JT 4OBRA 1CQYA 1JYNA 4X9FA 2OR9H 1NEZB 3TVMA 4PGCA 2GJJA 5LAXB 3O2WL 3TH2T 4PJHA 5SWSB 3ECBA 3W5MA 1INEH 5F7DB 5F6IC 5BZDB 4PJ8A 3BEWA 3V5KA 2XKNA 2MWCA 3UC0H 4O4YL 1I1AA 2VZSA 2LFGA 3UYRL 3HAEG 2F54E 2XXCB 1JBJA 3FQUA 3HI6H 1XGTA 5CILL 2J3SA 3KPRE 1OB1A 4PJAF 4FXKA 4I18A 4PJDB 5L88H 3UPAA 3B2VH 3SBWC 1J1PH 5FA3B 3GMPA 4WWID 1A1OB 1ODAA 1ETZA 4U3CA 5BV7L 3KYOA 3ES6A 2VR5A 1Q0XH 4LCYA 2DI9A 4DW2H 1WAAF 3MRBB 4OIAA 4LCWB 1GGCH 1FFNA 3WN5A 4J3TA 4BELD 3U2SB 1EA9C 4YPGB 4HUXB 4XHJD 1UWXH 4NKIH 5TF0A 1FO0L 3T0BA 1UZ8A 5DJ8B 5K9OA 4NQVA 4RMVA 1IGCL 1UJ3A 4MA7H 2VXQL 3HLAA 4RDQF 3RJQB 3OAYK 3IGAB 3O8XB 3CPLB 2XN9E 5EFIA 1YY8B 4TNWF 1EERB 2Y07L 1DQQA 4XBPB 1F11B 3BKMH 5I18L 4M7LH 2Q8AL 5E95B 4WWKA 1FZMA 2DQIL 3S98A 2YSSA 2OP4H 2X42A 5GS3A 2VLKD 3B5TA 2BY0A 3QDJD 4JFFA 3ZL4L 4D3CL 2H6PA 4EVNB 3VD5A 5KSVB 4X6BA 4K3GA 4U6TA 1DVFA 3CZFB 4ZPVA 4ZFGH 2C1OB 4XTRD 3K46A 4QTIH 4EI5A 1MPAH 5EC2A 4MHHG 1T21A 5DS8B 5AG9A 3RIAK 3BZFA 4ZOBA 3QO0B 1YNLL 1S7QA 4NQDE 4ISVB 3DHMA 2BVOB 4PJFB 1BQHG 1DQJA 4FQLH 4K94L 1A14L 1RZIA 4PRID 1MFBL 1I9RL 5EN2A 1WTLA 3OKDA 3HE7B 5E2WL 5AUMA 4ODSL 1Y0LA 1U8NA 2YWYA 2BC4A 1W0VA 5DVKA 4HKJB 2IQAA 5EZJA 1YEDB 2ED9A 3UJIL 3QFDB 1FGVL 3U36B 3U4EB 1VB9A 2JCCF 4PLJD 4WY7L 1X5XA 1C5BL 35C8L 1X5AA 4AQ1B 3CFCL 4UBDC 5LXGH 1AXTL 5GRJH 3C8DA 1NCAL 5EA0H 2BFVH 2FRGP 1YNKL 4JM2B 2OJEB 3BWUC 5C0JA 1B4JL 3EOAA 5F89B 1UWEL 1U3HB 4GS7B 3JUZA 1PZ5B 3MJ6A 3OL2A 2FB4L 4RCAA 5TGBA 4M8VA 4Z7OE 5DJ6B 1YMMD 4HIXL 1MVUB 1TJHH 4R7NB 4OZGB 3ULVD 3QWRA 1NAKH 4O2EB 5ALBH 1KEGL 4P2RB 4Y8AA 2LTQC 2ZSWB 4M5ZH 4CMHC 5D7SL 1QFPA 3RA7H 2GTZA 1TZIB 4PJEA 5DO2D 1CFNB 1ZHKB 1LHZA 1GC1H 3MUY1 4MXVF 4U3HA 5IMMB 4P0DA 3T0AA 5J6GB 4X8JB 3LKOA 5I8EA 3WFBL 4J8RB 5FKAB 5I2IB 1U8MA 3M17B 4IEFB 4O9HL 2YA0A 2JB6B 1MQKL 1VPOH 1LEGA 3PWPA 5L2KB 2H1PH 4PJIA 1T1WB 1AGDA 2G60H 1CU4H 3L95B 3QUMA 2B4CH 1OLZA 4FFVC 3OGCA 4CU8A 1A6PA 3RWEA 3NIFE 4HIJB 1LDSA 4YFEA 2MQ3A 2VSDA 1CGYA 1NUGA 4IMKC 3UAJC 4DGYH 5EOQH 4RFNB 1FFRA 3WDHA 1JZ6A 5IVNA 3ARDB 1DBKL 3TBYA 2YD5A 4ZUWA 5BS0B 5HHPB 4TUKH 3WJLA 1K9TA 3M8OL 3VE0A 1W72B 5E7BA 4GAYA 4UT9L 2I60H 3MNWA 4R2GB 4GBXA 4RNRB 2VDOH 1C5DB 3EHBC 5IB5B 1H15A 4EQ2A 1T6VN 4R4BB 1QQDA 5D1QB 4U33A 1JGLH 4XPHL 5IF0A 2GJZA 3SDCC 3R4DA 4RQQA 1WSST 4LFHD 4RAHA 4TSCH 5MI0B 43C9A 2R56L 3S4SB 1OTUC 2XTLA 4LSPL 3CVHL 3KLHD 1QLFB 3K2UL 4JREC 3VJ6A 4OLUL 3THML 4DFIA 2P45B 4BH8B 1WFOA 3QO1B 4KJPD 5JA8B 2KH2B 3UP1A 3HAEB 2HFEA 2WQRA 5F1NA 1T22A 1MJJB 5KSBB 1T7XA 1Y6NR 4XGZB 3ARZA 1G0XA 1PY9A 4M7ZB 4MJIB 3V4PL 4LLVB 2C3GA 2CR3A 3HG1E 4PLNC 1EVTC 2ICWB 2PR4H 3H9SD 3MUZ1 4RMWA 4U1JB 3K0WA 5AYQA 1OP5H 5I1LB 3GBLA 4NBYB 4K7PY 3B9AA 1DTUA 2NZ9D 3MUGB 2GCYB 4YDJA 3MNVA 2A9NL 4QHNB 2ADJA 4YBQD 2KL6A 3OF6D 2J7LA 4PJHE 3MJ9A 4MWFA 4G6JH 3T0EB 3AVEA 4GSDL 4KRMB 2AV1B 2BNRE 1PYWB 5GGSA 1J8HB 3BIKA 4UB0L 2DLHA 3FT2B 4Z78B 5GISL 3U0PB 1H3GA 4P5TA 1EBPA 3TA3B 2A74A 4XNYH 1IAIL 3MFGB 4XMPL 1FVDA 1MRCH 2F5AH 5CWSA 1EFXB 1LDPH 3C2AL 4XNQA 2LV4A 1T0MA 3AREC 4LKCA 2UZYB 4KAQL 1QFWI 4OAWB 4HH9A 4KJWC 3L5HA 3C2SA 4NO0D 4P9HH 3I6KA 1NBVH 3UTTA 2VXUL 1GGTA 4POZD 2UYLA 3IKCB 3MRGA 1VERA 3FT3B 1AD9B 2R9HC 3C08H 4P23C 1UG9A 1MHCA 1OAUL 4I0PA 3KLAB 1BQHB 4L1HA 4G9FD 5I74C 5CBAB 1PJ9A 4WO4D 2DTML 1KTKE 3MUHL 1ZLWH 3GSQB 4L8CA 4JHWL 1LEKA 1DDHB 1F4WH 4HK3J 4I0PC 2A1WL 4XHQA 4ZSOA 4LMQI 5D7JB 2JIXD 5DJ2B 2ZKHH 1NAMH 5DMIH 5E8DH 3QWOA 3U82B 5C09B 5C0EA 4GJTB 3LV3A 5HYFA 3OZ9H 4Q9BA 1WBYB 4UQ3B 1RJZB 4FQCH 2VNCA 5J12C 1ZSDA 4Y4KC 2NY6B 2R1XA 3P30H 4PR5B 3SKOA 4PTUA 5FGCE 4LRIA 2P46B 5I1KH 1NAMA 4X7TA 3X14A 3MOBL 3LPWA 1FVCB 1RMFH 4H0IA 5B38A 1TNNA 4E41D 5JUEH 1OY3B 2HP4A 4M1CC 5FYLL 3QG7H 5CEXB 1FIGL 1SYVA 1GSMA 3FN3A 1Q0YL 4F7TB 4PFEA 5DJCB 1YMHA 3DGGB 4N9GB 1A3LL 1T66D 3O6FD 4TQEL 3RIFK 5HBBA 4R0LC 3U4BH 1JYXA 4D8PB 5ICXA 1EEUA 3TJHD 5IBLC 1V8HA 5FOBA 2IBZY 1KELH 1J11A 3VXMB 3VXNB 1NMBH 4K8RL 1D6EB 2CK0L 5LKNA 1JGEB 2AJZB 3LEXA 2NLJA 3EDKA 3BPOC 4NO3A 4E42A 5HSFA 3OGOE 4L9LB 4LRNH 4L8DA 1GGUA 2H9GB 3NACH 2DJSA 2AEPL 4G43B 1T7WA 4UT7H 1HWHB 4P9MH 4APQC 2CPCA 4IRSD 3WIHA 2F53A 1VA9A 3RGHA 4DN4L 3D48R 4G3YL 4LLMB 2WWMC 5ADPL 3FKUS 1HDMB 2VSCA 3MCLL 5BVPL 1P53A 2Y9RT 4JZOB 1FCGA 3G5VB 5A16A 1GJIA 1IQWH 4O5LH 2JCCB 2IBBA 3HE6C 3QCUL 3ROLB 1EXUA 5D6CA 4JE4B 4HXAL 1T4KB 3BQUB 4HFUL 5IB2A 3NGBC 2DQFA 1VENA 1G6VK 1MCLA 5FDWB 1ZVHA 3PWPE 4WTZG 1J1OH 1A1MA 4PJIE 4URTB 1AO7D 4OLVH 4YHOL 1KULA 3T1FB 3ZDZF 1IJ9A 3G6JA 5GJSL 2VLLB 1BX2B 4RISH 3ZE1F 3QJFA 3WNMA 4R97B 5SX5K 5I16B 4B7LA 5E6ZA 2XACC 3NIGF 1HXYB 5HYEA 4JPWL 1N0LA 5LGKA 2HG5A 4X4MA 3HNTL 2EEBA 3GK8L 4U1GB 5CD5D 5J11C 3RNKA 3QCVH 4TUOA 5CJBA 3P4MA 4KVNL 5IJKC 4HJGB 1KLGB 1BVKB 5FUZL 5C8JB 5FGBA 5KJRH 1MHEA 5F3HA 2I24N 3DNKA 2HJLB 1X5IA 3B4NA 1MSPA 2B8OT 4W4OC 2DQCH 5JOPD 2NXYD 3WNLA 4F7MB 4YXHL 5IHZB 3WFEH 1HILB 4NCC1 4JN1H 4CDGC 4Y5VB 1YEGL 4GQ9L 4MZ2A 1S5IL 2H8PB 4P5MB 5I8OH 4JY6A 4XCCL 1FFOB 3I02B 4KUZH 1AXSB 4TN9A 3H3KA 4NKDA 3DPBA 3SDXA 2NY3B 5C0IB 3RTQC 3KXFA 1YEHH 1YDPB 1AGBB 4HUKB 4D0DA 4GKOA 1X7QB 1YUHB 1OARL 3U30B 1QO3B 4S0SD 4X5WA 2CGRH 4A6YL 5FKPA 5DD1L 1M71A 5SX4I 3G6AB 2MPAH 1CZ8L 2P8LB 5JHLL 2CLRA 3EYQD 4FHBD 2L7JA 2OYPA 2WIIA 1VFBB 4RGMC 1A7OH 2H41A 4KRPB 2Z31C 5KVGL 3HI1B 3G04B 4JQXA 1RUAH 5L9DL 3HMWL 3T77B 3MCKB 1WC7A 4HMEA 5JIKA 3VGBA 2VL4A 3VFRA 1FJ1A 4X9BA 3MFFB 4DN3H 3NFPA 3MOAL 4U1LA 2EE9A 4Y5YC 1U8HB 1VGEH 4OGAC 4Y19B 5D5MA 4XNZC 4GRLD 4N0UA 4KHTL 1ZLVH 4ZUVB 3OKOA 5JXED 3B3IB 3HKFA 1VSCA 1S7UA 3IDJA 4NZRL 3TBTA 1I3VA 4PJGF 4ZUUA 2P42B 3UTSD 1INQB 4ETQA 1KYOJ 5T3XH 1FGNL 2CKNA 3N50A 4MXWH 1P6AB 4FFYH 4QRUB 2QQLL 1I9JH 1IGJA 2VLJD 5DQJA 5B8CB 1IKNC 2X1QA 1NCNA 1DSFL 2E8ZA 1L0XA 2F5BL 2JELL 2JLLA 2Y7QA 4PRAA 5JDSA 1ND0A 1UQSA 5DJDA 3UTTE 4BUHA 5DC0A 1H9VA 4JO3H 4G42B 1ULVA 2YHGA 2MHAB 1I3UA 3EYVA 3JVGA 4N90E 3QUKA 5AZ2H 3FO9B 2NY1D 3D6GA 4E0RB 1D9KD 5C70A 1IQDA 1U95B 4YHKL 3G08B 4JPVH 4I2XA 1AKJB 3SGDH 3NCMA 1SVCP 1GGYA 2V6HA 4ZNEA 3IAQA 3QDMB 4PJBB 5D93C 1KPRB 1XF4A 4HULB 4CW1A 5GGUA 4AH2A 3A6OA 4AEIL 3TM6A 2YS4A 4ZSOE 2PO6B 3QRGH 2J6EA 2EC9T 4NQXB 4C4KO 3EBAA 4NP4H 5D71H 3AXLA 5IFAH 1TCRB 1RFDL 1SJHB 2PCPA 1KB5B 2PTTA 4C58B 1JPTL 1HHJA 2R39A 2YRZA 5DK3A 3CLFH 2DWDB 3OXRA 1HSBA 2X70A 5DTFA 3FMGH 3RKDC 5D9SB 5CP7A 5B39A 5J4MA 1QLEL 4WEMB 2CSPA 1HHHB 1MJ7L 2PW1A 2ENYA 5E0QA 2CMRH 3FAXA 4KZDH 3L1OL 3MV7A 1TQCB 3NZHH 3Q0HA 4WFFD 2BVQB 1CDYA 2IANB 4K9EH 1K4CB 3KPLB 4IRZL 5KSUA 1DQLL 3TO2A 1GXEA 3UJTH 3SY0A 1MIEL 2MSPA 2CUHA 5DRNA 1DBBH 1OGAA 1BM3H 4OFVA 2CUMA 5IKCA 4QXUH 2AS5M 1HXMA 4KJQD 1A22B 1G7HB 1JE6A 4JO2H 2RHEA 4K7PL 1IGML 1NGQH 3T04D 3PL6A 2OK0H 3CXDH 1RY7B 5FOJA 1J9CT 1SY6H 5DUBB 3GSNB 1CFVL 3GHEL 3MROB 5MEND 1PKQB 1E6JL 1TFHA 3B5GA 1KTDB 1KJ3H 3VD9A 3MRFB 2F53E 5K9JL 5CEZL 3WEXA 5IW1A 4YDKH 4M7JH 1NCWL 5HXMA 4CVZB 3PV6A 4Y7MA 4EZMA 2X4SB 5E8PA 1SBBA 2QEJA 3ZLQC 4O58H 4AENB 4AK1A 3KYAA 3EFDH 2YPVH 4EI6A 4IOFD 4DEPB 3D39E 3RAJH 3SQBA 4OD2A 3LQZA 4MLIA 1BZ7B 2AVGA 1K8IB 2VZVA 3EAKA 1U8OA 3BUYA 1HQRA 2O5XL 4YIQB 5JNYB 4ONFH 3QHZH 4UNVA 1FYTA 2EDJA 2AJXH 4N8PA 3RX8A 1JPSL 3V0VA 2DLFL 4M5YL 4YDVB 1NFIA 32C2A 4C54A 5CCKL 5ITBL 3G6JE 1SBSL 4MJ6B 3C5ZA 3VRLF 3B9KA 3BEVA 5CBEA 3BP5A 2OZ4L 2EXWC 3MXWL 5BRZA 3SCMD 2I26N 3GMOA 5BQ7A 1JZ5A 4JGUA 4GG6B 2EDOA 1AE6L 3DVIA 3QNXA 4OCRL 2AXFB 3DGCR 3BJ91 4X4ME 3TVMD 1CFSB 1T0PB 4WUUD 3L6FA 1QLRB 2YBRB 5A2IH 2Y72A 3I6GB 4GAGH 4TVPE 2PYFB 1ZHLB 3LQAC 3TT3L 1JN6B 3O4LB 2FR4B 1A7RH 2DL2A 1I1AD 1QBLH 4CJ1A 5JPMB 4GRWF 1Z3GL 1XIWA 3JV4A 3P40A 2J8UF 1A7BA 2HRPL 2P5EB 4HX1B 1RURL 2V5MA 4EUPA 5B4MC 4L3CA 3CLEH 4NUGL 4PJ9C 3EOBA 4NNPL 2E9JA 4B0MM 2DQTL 5F7WC 4NPYB 3QUZA 1UENA 2W0FB 1E4XI 1EEZB 5I71C 3SDXE 4WHTA 4ODWA 4MA8L 4WW2C 4YAQA 3KXFE 4NQSB 3L3HB 3VFTA 5F7EL 5I1IL 4BKLB 2ZOKA 2P5WB 3I75B 1WWWX 1NGZA 3GSRB 1LO0H 2WLYA 4NQEA 1DQDH 2LAGB 4D9RE 1FAIH 2A6JA 5EU6D 4NQCA 4GUPB 5TDOB 1MFCH 1X4XA 4OSUH 1RUQL 1RHHA 1FPTH 3QHFH 5JLZA 4WWKD 5JHDA 3P9WB 1A7NH 1ZA6B 3RVUD 2DQGL 5EZIL 3OKEA 1UM4H 3FTGB 3MV11 4JFFD 1XR9B 4ODXA 3AS2A 1FO0A 1IAKB 3CH1A 4Z7VF 5D5ME 2CKBA 4QHLB 4FQHB 1A4JB 4N0UE 3SKJL 4PBXA 3BIBX 1U8PA 1JNHB 1DANU 1BJMA 1P4LB 5SV4A 4EI5D 5J56B 3RWIA 1RU9H 4QRRA 5I9QC 4DUWA 4O2FB 4GKNB 2VZ3A 4NDMB 3FOLB 3KWWB 2XZQH 1I8IB 4FZEL 1FRGH 2OXHA 3S88H 3VCLA 2XWJB 3KPSA 1N6VA 2YUVA 3LN5A 3IU4L 1VCAA 2VC2L 4LF3A 4NT6A 4FQJH 4RIRA 1F97A 2VDPL 2FGWL 3TPUB 3BPCA 1LO3L 4JFYB 3OMZA 3RVXC 4PV8A 2HTLC 2VE6B 1DEEB 1MY7A 2FO4B 4ZXBB 4MSWA 4I2XE 1W72L 4JG0H 2AJUL 2WAHA 3V0WH 4PJCF 4OZIA 4ZNEE 1ACYH 1OPGH 1RZKL 2KDGA 3VFOB 2H2SC 1G1CA 3SDDB 1JYVA 3WKNA 3MLWL 3ZT6A 1OAZH 4GLRH 1MFAL 5AEAA 2VLMD 5DK2A 3F7QA 5J13B 1RV6X 3HNSL 4D2NA 5KTEH 1XCTB 1I7ZB 3IDYC 3MGOB 2SEBA 3JTTA 1ADQL 3TYGL 5FYKU 2CJUH 2BSSB 1JIBA 4QHUB 4ZTPH 1CFTA 2FCBA 3WNNA 3QWRD 4DZ8B 2GFBB 2R0WL 1CL7H 4M8QB 5JIHA 1JGDA 4NN7B 5T1LB 3WIFA 1O7SA 5E8NA 1CICC 4EN3A 2QV2A 2QADD 3MBEC 1Q8MA 3TGXA 4FFVD 2HKFL 3Q48A 1JZ2A 1MJUH 1NFDF 5GRVK 4ONOA 2HH0H 5GRUH 1TCMA 3UAJD 1A7QL 1UM5L 2IH1B 3P4OA 2YZ1A 3GRWA 1U8KA 1J05B 5H8DA 2UZXB 3SDAC 4EJ1C 2O5YH 2WUBL 2GSGB 3GNMH 3MLXH 5FUCC 1OGAE 5C2BH 1FCCA 1N7ML 5DMJB 3WSQL 4A2MA 3VDAA 4WJ5A 2GEEA 5DFVD 2ICWJ 4IS6A 2X4UA 3C6SB 3D2UB 2VIRB 2IC2A 2G9HB 3EHBD 5HVWA 1N2RB 5KANG 4JVWA 5DK0A 4B5EA 2B1HH 2XYCA 5F7LB 4GKZA 3LSOA 3IFNL 5TF1H 3MRDA 4X6FB 3MREB 3TNNB 1ZVYA 4L4TB 5E9DA 3L5WB 1B88A 1OTUD 3ZYOA 1SVZA 3LH2L 4OLWL 2F8OA 4GBXD 5EO9A 1ZLSL 2CRMA 2DBJA 3FB5A 3RL2B 4XAKE 1G9NL 1EZVX 1I9EA 5BXFA 4I3RL 3RWHB 2F19L 4H20H 2OL3H 4JRXA 4P3CH 3Q1SH 5T33H 1F5WA 4MNGA 3ILPB 4NO5A 1JL8A 3K2MC 3W9DA 1S7XB 1EGJH 1EHLL 3UXFA 4KDTC 5TQ0L 3PABB 1TJIH 2BOCB 2ERJC 4MZ3A 2DQHH 2BSED 3KYKL 4L4VB 4NUJA 1FYTE 4HC1H 1A6UH 1UM6L 3KPRB 3I6LD 3SGJC 2B0SH 3C09B 5IMKA 2VISA 3RGVA 3WUZA 2DKSA 4UINL 2YN3A 4KROD 5IFHH 1R5WA 3EO9H 2VABA 1N64L 3CVHA 3MNZB 1TJGL 1JPFB 5L6YL 5FO8B 5D1ZB 4EEEA 1N8ZB 3UZEA 5J1SC 2PUQT 2FJHB 4LSUL 3D85B 3PP4H 2NY4D 4LVOC 1KFAL 1MCNA 1WIOA 2GK0A 2WMPA 1IC5L 3H42H 3ULUH 2GITA 4Z7WA 1K4DA 2O61A 3VWJA 3LKSA 4DZBA 4KK8C 1WCBB 1YC7A 4YK4B 4NHUB 3BAEH 3ZKND 3BDBA 2VDML 3KHQA 5E1AB 1H0DA 2NY2D 3MA9L 1UWGL 2XN9B 4XP9H 3GMMA 2QQQA 2EYTB 2JK5B 1CGVA 4DKEH 1KCLA 5IV2A 2VAAB 3RDTB 4KI5C 5FYJU 5HI4C 1IGIL 3QUXA 1RUKL 3DX6B 3RPIB 2N56A 5EOCJ 1H5BB 2XWTA 3A6BH 1EO7A 4N1EA 3OR7B 3QIUB 4UDUA 2DKMA 1T5XA 4NC1E 4C83B 1TXKA 4MDIA 5HGAB 4J2XA 1DEDA 1KNOA 3SE9H 1CVSC 1RIVH 1BAFL 3P11L 4FQIH 4L5FL 4EBQH 4AMKH 3NFSH 1MCPH 1S9WB 4JQVA 4F3FA 3PHOB 4N90D 4GRWB 4JJHA 1BVZA 1YYLH 4NQDB 1V7MH 4NQEE 5L0QB 3LS4L 4I0PD 4LCIH 5DRXA 1KN4L 2BMKB 1T0NA 1ZEAL 3EDEA 4NQCE 4XC1H 1FL6A 4XC3L 1AD0A 3C60C 4YEEA 3KYMB 1H8SA 1VFOA 5EZLA 1NBZA 5JHDE 3VFMA 3E0GA 1I1FA 1QYGL 2EKJA 2OXGA 4OBSA 4LAQH 4WGVB 5KVEH 1RD6A 3CSYB 4YHZH 2P8PB 1NUDA 3ARTA 4PY8I 3BP6A 4PJ5E 3MV9D 4S1RH 3UYPA 1M05B 3GBNH 1WISA 2X4NB 4G9DB 3UTZB 4YLQT 4WTWA 4QRRE 5D7IF 5EORH 3RY6C 2YD2A 4HMCA 4XNMA 5I66B 2GTWA 3ARBA 3CFJB 4PP2A 3WD5H 4IOSD 3UEZA 3ARGC 3TIDB 5MP6L 3S7GA 1GRWA 1YQ2A 1UZ6E 4JHBA 4LPXA 1B4RA 1WEJL 4HD9A 4LHUG 1U92B 3S5LA 3A67L 3MRKB 3VWKA 5HYSA 5IBTH 3ARBC 3RUGF 3DMMB 4N0FB 3E6FB 3O41B 3OTTA 1N5AA 4MNHA 3KJ4B 3VFPA 5HHME 2MCPL 5IMLA 1FL5A 1MI5D 2Q6WB 1T1XA 3DVGA 1ZT1A 5HY9B 4OZIE 5DEZA 4YXKL 1LK2B 3SKMB 4NRYA 5I15H 2WWMD 1AIFA 3FN0H 4U1MB 5T5FL 1JF1B 2ZWLT 3GUTA 2HWZL 2FWOA 3A6CH 4OKDA 4OF7A 4R7DA 4OLYL 4P4KB 4P3WA 3WLWC 1EMTH 3NBNA 1R3JB 5B3JE 4XRCA 1S3KL 3I2CH 4X0KA 5CZXC 1FFPB 1UYWL 2P7TB 2ARJQ 2DQJL 2HJFA 3OB0K 4NM4H 4XP6H 1QD0A 5IHUH 3TBVB 4DGIH 4GMTH 1NCBL 4F7PA 3N9GH 4ZFFB 4HXBL 2Q76A 4HMDA 2AABH 4YUEL 2Z4QB 1HINH 5E08H 3GEWB 4PJCB 1G7QB 1WICA 4LU5H 4PJXE 4ZOAA 2XZAH 3GSWB 1AHWB 2K3TA 4YO0A 3VXUE 1BZ9B 1IC1A 4LEXL 3E2HC 3WFCL 4CN6A 2F74A 2ZCHH 3P73A 4RA0C 1CI5A 4Y4HB 2QQKL 5D2NA 5K9KB 3DTXA 1CGSL 2O5ZH 1EBAA 2W1NA 2X10A 3FOMA 4HLJA 5MERA 4JFHE 1A6TA 1SEQL 3RL1B 3FQXB 3F12A 3STZB 1I1YB 1LE5B 4KQ4H 1TIUA 2IBGA 2VR4A 4X99A 4HT1L 1Q72L 1MFDL 1QUNA 2YN5A 3ZHDA 2UWEF 5A3IC 1QVOB 3Q6FB 4WEUD 2A6IA 1T1YB 4QRPA 3VG9B 1ZXQA 3EYSL 3G5XA 1KG0A 3MYJB 3VMPA 4TVPD 5FUOH 1YN6A 1FH5L 3MRIA 3P4NB 3HR5A 3HG1B 3NABL 4P2OA 1NFDB 2APTA 3EOTL 3HC0A 2XKUA 1BREA 1UKQA 4PGDA 4BQCA 1S9KC 4IMLB 1XR8B 3NVQA 3RFZC 4KKNA 4HWNA 1N4XL 5HHVL 1P7QA 4Q6IA 5C0FB 4KVCL 3RTQD 4CRPA 4PGCB 3W82A 3BHBB 4JRXE 4L29B 4JG1H 5I30L 4RMUA 1CIDA 4OUOA 5DVLA 5KBNC 1KIQA 5L8KB 3VFWB 3QI9B 3QZWG 3GHBH 4AY0A 2BNRB 4JAMB 2X1PA 2HFFB 5JQ6L 1XH3A 2HVJB 1IGTA 4OFDA 1G9MC 3SE8L 3VGDA 5EC1B 1T03L 5J1TC 2DQEH 5A2JH 5ICZA 3FQUB 2Z31D 2DI8A 4WNQB 1BBJB 5F71A 3W9EA 4TULL 5LGHH 1K8DA 3FRPA 4M43L 4U0RB 5HVHB 1QKZH 5H35A 4XBEH 4ELKA 4DK6A 4D9RD 4R96A 5IROA 4RFOL 1G7MA 2A6DB 3QRFM 1LP9A 5KAQF 1NEUA 4OTXL 2FX7H 4ZYKB 4G7YH 4KZEL 3K1DA 4M93B 4TRPL 5EBMB 3EW3B 5HYJA 4LASH 2VDRH 1HZHH 4Z7WE 1QR4A 5HPOA 5HPMA 4JPKH 4H1LH 4U31A 5I76B 4A6YA 2HKHH 1K2DA 4Z7UF 3VFVB 2IFGA 5F21B 2JJSA 3QIBB 3H9HA 2GIYA 3X3GH 1VADA 3ULUE 4HIIA 5GZNC 2FECL 4NSKB 2WBWB 1Q1JH 5FV2A 4QXGL 2ZCLH 2YPLA 5IOPA 1A6ZA 4XWGL 3O3DB 2YRPA 3QQ3A 3ARFB 2LU3A 2HLAA 2EYSA 4RAUA 4UV7L 4MNQD 2Q86A 1A7PL 1MRFL 4PREA 5LWYH 1I3GH 5IVOA 5EU3B 3LS5H 5DDHA 4UNTA 5T1MB 3GIZL 2J4WH 1DFBH 3KPTA 4MMZC 4WI5A 4BQBA 2HJKB 3PHQA 4AZ8A 4HUMB 2XFXA 3SPVB 3GSNL 5FECA 4Z0XA 3S97C 4Q6YA 1A6VL 4GAJL 2XWBA 4IDJH 3D0VB 3S3JA 4LSSL 2JJTA 4LHUB 5DQDH 3F58H 4KK6D 3STBA 1FZOB 3P3YA 5IG7B 1LE9A 2YWZA 1J87A 4UUJB 4DQOL 2YC1B 3RKDD 3L3DB 3IU3B 1P4IH 4GKSA 2D4FA 1EHXA 5KAQG 1F4XH 3V5DA 2FATH 4HUUA 3TV3H 2FX9L 4U1HB 3QIWC 4FNLH 3VXOA 4JM4L 3ARWA 2V5TA 3TWCH 3H3PH 1I8KB 3D18B 4M6NL 1IC4L 3KPMB 1HEZA 1GPOH 4UV4H 1U36A 4NZUH 4OD1H 4NWTH 5IEHB 5D6DA 4FZ8L 4WUKH 4GT7A 4XBGB 3EJYC 1JWUB 4KH2A 1KB9K 4NJAL 3T2QA 3AS0A 3QFJA 3GGWB 3MV7D 4KC3B 2EYRB 2V17L 5A43C 5J0BA 4KDWA 3ULVF 3U9PH 4JQIL 3V52H 1EJOH 5D6DC 3NAAH 2V2WB 1QHOA 4XVJH 2F58H 3RQ3A 5H94B 2ATKB 5F1KC 3UX9B 3PWJB 2NY7L 4M1DH 5F96L 2CDFB 2XA8H 5DEGB 3VXRA 4NO2B 2R2HB 2H2PC 3OPZH 3P4LA 1MHPL 2X4TB 5EO1B 1KENH 3TLRA 1VACA 1R5VB 3PL6D 5GGTH 5I75C 3BKCL 5ICYB 2ZUQB 1LEGB 2ZJSL 2VDLL 3RHWK 1NEZA 3D3VA 3IDXL 1LEIB 4PJIB 1YEFH 5FFLA 5LAXA 3Q3GB 5DVOA 4C56D 1U8LB 5SWSA 2VDKL 3KAAA 4HBCL 1BWWA 4PG2A 4ZAKC 1MCIA 5F7DA 5BZDA 1X4YA 3RUGB 5KS9F 1K6QH 1JNLH 3WXVL 4ZS6C 2QJDA 5INCB 4KMLB 3T0WA 3S36H 4JHZA 4G6AC 4PG2C 5J89A 5EUOF 1A4KB 1ZT7B 1XF2B 1L7IH 3K8KA 4PJDA 2CDGB 1WWBX 3VI3F 4WHYH 5IVXE 4XPAL 2UZIL 5FA3A 3S35X 1VFMA 4AEHL 1A1OA 2E7BA 5D2NE 4Z0BH 1A3RL 4DTGH 4R90H 2CO7B 4UIKH 2YA1A 3O2DL 2WK2A 4Z8FL 3MRBA 4LCWA 3MZGB 3HR6A 3C5ZD 4ZS7L 1XGYL 4MQ7B 3U2SA 4Y4FB 4YPGA 4NCC2 2A77H 4HUXA 1OOAA 1D6VL 5BRZD 3QZWB 5D72L 5DJ8A 4RGNE 3G6DL 3L9RB 4YZFF 4QRPE 2D7NA 4P57B 1FORH 1NBYB 2JTDA 5T3ZL 3ZKMC 5IT2L 5C07D 3IGAA 3O8XA 2VLRD 3CPLA 4F8TA 4CU6A 4TPRL 1YY8A 1G84A 5ABDE 4XBPA 1F11A 5B4MD 3V8OA 4F8QA 2ZPKH 3PHSA 3ISWA 3KPOB 4OCMC 4PJ9D 3P0VH 5D4QA 2M26A 2VITB 1LK3H 3JTSB 3QUYB 1XIWD 1MNUL 4YC2B 4EVNA 2C5DC 5E4EC 3CZFA 4HWBH 3JWOL 2C1OA 4PRPE 4LCCC 3QUZD 5DS8A 5D7LD 1RZJL 3QO0A 4JO1L 1L7TL 2H26B 2JF1A 1QSED 3SO3B 7FABL 1UEMA 5FCUL 4ISVA 2YUXA 2BVOA 4L8BB 4PJFA 1LWRA 3P9LB 2DM4A 3NFNA 1NPUA 4HJJL 4QT5B 4RWYH 1FQ9C 2OQJA 1SYSB 1T0MB 2EC8A 4M03A 3IFPB 1HH9B 4HKJA 4LFHG 1LP9E 3QNZB 1YEDA 5I0DA 5JIPA 3LEVL 3QFDA 3U36A 3U4EA 1U42A 1CR9L 5HHOE 5FK9B 1IAOB 5CJOH 3ARUA 1CLOH 3HE7C 3S34H 1JHKH 1UH4A 2NY0D 2D7OA 4JM2A 2OJEA 4LSTH 5F89A 3BE1L 1R3IH 1U3HA 3BKJL 2X9XA 4OQTL 4F58L 1PZ5A 4FXLA 4RRPA 3NTCL 5TQ2L 2D03H 5DJ6A 5CUSL 1MVUA 4R7NA 3RVXD 5FHBH 4OZGA 2HTLD 3KPSD 1W0YT 2OBGA 4M6ML 4O2EA 4P2RA 2ZSWA 5HGBA 1U3HC 1S5HA 1CD0A 5DT1L 1TZIA 1F2QA 1S9YB 1CFNA 1ZHKA 3GJEB 3P0GB 1XMWA 1XCQA 5IMMA 5CZVH 4HLZH 4PD4K 1E4JA 4YDIH 4L8SB 1KJ2H 5J6GA 4X8JA 4J8RA 4P59H 4JHAL 2VYRE 3U1SH 5I2IA 5TE7L 3M17A 4NBZB 2JB6A 1NAMB 4Y5XB 4Z7UB 3SKNA 5L2KA 4LSQH 1T1WA 1CD1B 3FB8B 3L95A 2HA1A 2BVUA 1SYVB 4LARH 1D5XB 2DD8H 4HIJA 5MEPB 2OTPA 3RZCC 3D5OF 3QDJB 2Y06L 3GFUA 2EIBA 1CS6A 1CICD 3VW3H 1CGXA 3ARDA 3WXWL 1M4KA 5BS0A 5HHPA 1KBGH 3N1PC 1YJDL 4P46C 4PYHA 1A64A 5HDBE 1W72A 5FCSH 3LEXB 3JWNC 4Q7DA 3WFZA 4RNRA 1C5DA 5IB5A 2B7DT 4R4BA 3WO3B 1E6OH 4EN3D 5D1QA 3SDAD 1EIBA 4QY8B 1AY1L 4PRIB 3DECA 1HHKB 5IUSA 3Q2CA 5I1HL 3QFJE 2F53B 2EDKA 1IE5A 1WTGT 1TPXC 1Z5LB 1QLFA 4J4PC 2A9ML 4R2GC 3WFDL 4R4FL 2PXYC 1NUNB 4BH8A 5C0BD 1QSFE 2R15A 3QO1A 5C0AE 3T65B 4P5KB 3HAEA 4KPHH 5MI0C 1DL7H 3D39B 1PAMA 1MJJA 5KSBA 3O6MH 3VFNB 4MJIA 5C3LD 4LLVA 2ICWA 4RX4A 4U1JA 1N0XL 2AK1H 5E99L 5I1LA 3NZ8B 3MUGA 3N1MC 2GCYA 1GZPB 2EO1A 4XCFL 3D3VE 1OP9A 2EDEA 4P2QA 2NXZC 3SGKC 4NNXB 2A73A 5E9DD 1MFNA 3G6JB 4LOUC 5SWSE 2FJFB 2R0ZH 4AL8H 3T0EA 2AV1A 3S9DB 1I7RB 5HVGB 2B2XH 1PYWA 4UILH 1J8HA 1J1XH 4HWUA 3MRNB 4XT1C 3OG4B 4EDWH 3FT2A 4Z78A 4I3GA 3U0PA 3MXVL 5I19H 4K2UH 3RNKB 2VZUA 1OF2B 3O6LL 4K71C 3TA3A 5BOPA 1BOGB 4ONHB 3EUUA 3MGTB 1EFXA 2JB5L 4WV1B 1A5FL 1UWXK 4MCZA 5M7QA 4IOIB 3BGFB 3PNWB 4EKXA 4OGXL 3E6HB 4FABL 5LQBH 1IEBB 5BW7C 1O7VA 4LCWE 1YEIL 1CE1H 3BZ4B 5AWNL 4G6ML 2Q87A 3OKKB 3IKCA 4LEOB 5IM7B 5KS9B 1ZGLM 3FB6B 5CGYC 3FT3A 4XP5H 1AD9A 1G9NC 4BFEA 3KLAA 1BQHA 2NYYC 4YBLC 3MRLB 3GMLB 4JGMA 5EUOB 3RVWC 4S11A 5CBAA 5BJTB 5GGVH 4KI5D 1GAFH 4XAWH 3AM8A 1OCWL 3GSQA 2D31B 5F1OB 1DDHA 2WM0A 5I8KL 3PIQB 5KZCD 4NIKB 4G7VL 5D7JA 5DJ2A 5ETUB 2DTSA 4H88L 5C09A 1JRHH 1P6FA 1I85A 1QP1A 4Z95L 4YDLB 3QUXD 1OAQL 1WBYA 4UQ3A 3IDGB 4TTGA 1RJZA 1I8MB 3SOBL 2ESVD 4IM8A 4PR5A 4IRJC 4HPOL 1NCTA 2QQNL 2JJWA 4N0UB 3U0WL 3LKNA 5AZEL 4U7MA 1FVCA 1ORSA 3C60D 3H9SB 1CIUA 2QKIB 3LKRB 5TH2A 3U9UB 5DURD 3EIFA 1AH1A 5CEXA 1ZVSB 4BZ2H 4F7TA 4FP8H 3P0YL 4X80L 4JKLA 5DA0B 3DGGA 4N9GA 2B1AL 1A02N 1YEJH 3RWJB 4EXKA 1DLFL 5IB1A 4D8PA 4RGOH 2D0HA 2FDBP 1LO4L 3KHOA 1NC2B 3QNYB 2VO5A 4K3JL 4G6FB 3HFML 2V9QA 2Y36H 1G0YR 3AROA 4ODTL 1GIGL 2FEEL 3VXMA 1V05A 3VXNA 3R8BB 5JR1H 1D6EA 4P2CG 1JGEA 2AJZA 3VXQB 3TESA 1FLRL 3VGGA 1XF5B 3ARGD 3ILQC 5ID0B 4L9LA 1EZVY 4FQ1H 3ARQA 4IIQC 4G43A 3T0XA 5LJYH 1TITA 1MCFA 3GIVB 1DBMH 1AJ7L 4LLWB 3ARBD 4FG6C 4LLMA 4XPBL 3BT2L 4OLXH 4FOMA 1IBGL 2D3VA 4OF6A 5J3HC 5KSAC 5D1XB 1JZ7A 1HDMA 4QHMB 4M4PA 2CQVA 4NO0B 5DWUH 2X41A 4LHJB 4JZOA 4P2RE 5ILTL 3G5VA 4YX2H 2JCCA 2WBJC 1S7WB 1H8NA 5KOMC 3T4YA 3VWKD 3BVNB 1HHJB 3ROLA 2WQ8A 1T4KA 3BQUA 2DQIH 3MACL 2MTPA 1FNAA 3WLWD 1UCBL 3JV5A 5DFTA 2DBLL 5JORB 3T1FA 4WO4B 3BDXA 4ZO6A 3NN8B 4PJ7F 1FIEA 5IHBA 2VLLA 2YZ8A 5FYLD 3V7AE 1E28B 3QJHB 5I16A 1QACA 3MSPA 4W6WB 3DO7B 5DHYB 1HXYA 1JTPA 4AEEA 1F3JB 1D5IL 1YQVL 2BHZA 2W9DL 3KJ6L 4N5UA 2E9WA 4ORGB 5AYUL 5M95B 2Z9TA 5BS0E 1A6WL 3CXHK 1A14H 1XGRB 3BKYL 3V5HB 1JMZA 5EULV 3TO4C 4R97C 2KBGA 4HJGA 4XVTH 1KLGA 4OM0H 1BVKA 4K8RD 2OR9L 5C8JA 1U8IB 2G5BB 2HJLA 1SM3H 4PB9H 2QSCH 5ERWB 1INEL 2ADFH 2MFNA 4F7MA 1U93B 5IHZA 4E41B 2W9EH 3ABZA 1HILA 3UC0L 3AU1B 4Y5VA 4JANB 3WEXB 2YPKB 4F9LA 4P5MA 2H8PA 2E9IA 2I9LB 1FFOA 3I02A 1AXTH 1AXSA 4ELMF 3HI6L 3BOVA 5H2BB 4R26H 1OP5K 5E2JA 1H3TA 2QHRH 5DZOA 5F88B 4WFHE 5C0IA 1B3JA 5L88L 4Q0XL 3B2VL 5C6WH 3CCHB 1YDPA 5KSBE 1AGBA 2LAAA 1J1PL 1X7QA 1YUHA 3E1F1 4MJIE 1QO3A 4J6RH 1FE8L 5IQ7H 3G6AA 1Q0XL 4KMTH 4YBHA 4DW2L 5F6HJ 2B5IB 2NY3C 4HIXH 3MRCB 1OAYH 1GGCL 4U1NB 4A2LA 1CDJA 2EDQA 1VFBA 2Z8VC 3C6LB 3V0VB 4P2QE 4TSAH 4NKIL 2DLEA 4FQ2H 4IRSB 3HI1A 3G04A 3X3FH 2YD4A 3U30C 3T77A 3MCKA 1NGYB 1VKXB 3T0EE 4MA7L 2FSEB 4F7EB 1AGEB 3MFFA 2ADIB 2BNUB 3QNXB 5CJXA 1J8HE 1U8HA 4Y19A 2GI7A 2APVA 4ZUVA 3MRQA 3BKML 4M7LL 2IG2H 4PGJA 4HGWB 2NY5L 4LVNB 2OP4L 3AUVA 4NKQB 1INQA 4QCIB 3ETBF 1AR1D 5SWZE 1RUML 2IPUK 3ZE0F 3QCTH 3I3EA 2EDFA 2BHUA 4QRUA 2R4SH 3BESR 4V2CB 4EQ3A 4ZFGL 4CVUA 2WWKO 3CGTA 1FG2B 5GS0H 5B8CA 4BQ9A 2FJGB 2ZNXA 2IQ9H 4QTIL 1MPAL 4WI2A 5BZWB 4L3CB 5D96B 4G42A 1FNSL 2MHAA 4L3EE 3DRTB 2IEPA 1ZLWK 4FQLL 3FO9A 4E0RA 1U95A 4LLAA 3G08A 3C8KB 4OFKA 4UDTB 4XPHH 3GSUB 1AKJA 2OTUB 4PJAE 3WE6B 5HYJD 1NLDH 4OLEA 2R56H 3QDMA 2VR9A 3AC0A 1KPRA 3FCTB 4B7IA 4OGZA 2C3HA 4P4RB 1KIPB 4J3UA 1T04B 2CIIB 4HPYL 4TUJB 4OLUH 5IESH 2NXYB 1T1ZB 2XKSA 4JCMA 4XB8A 2PO6A 2ILLA 1K85A 1QFWM 1VGKB 2ORBH 1WAAE 5F9DC 1Q9OB 1IL1B 4NQXA 5LXGL 4YH6A 5KVDH 1INDL 3V4VH 5GRJL 3UROR 4CDHA 1TCRA 5JZ7D 1SJHA 4H8WC 4D9LH 2BFVL 1KB5A 3QDGB 5I73B 4K7PX 2YPLD 2W9LA 2DWDA 4CKVX 4X9HA 1F6AB 5D9SA 1CFQB 4PJ5B 4LCUB 1HHHA 3DX7A 4PLJC 1TJHL 5DMGD 4G8GE 1NAKL 2BVQA 5ALBL 4UAOB 2IANA 2I07B 4M5ZL 1K4CA 3KPLA 3RA7L 4NZDA 4ZPTB 3VCLB 1GC1L 1X5JA 3S36X 2P49B 4UB0H 4AG4H 1QTYT 5ISZD 3QIWD 5ALCH 4RIRB 4HKXB 4IJ3B 1G7HA 2A83B 2NX5E 3VXME 4K3HA 1BZQK 1VPOL 2HMIC 4KGLA 2H1PL 3BPLB 5HD8C 3W0WD 4GRLB 3ULVC 2G60L 1CU4L 2Q8BH 2K7PA 4AM0B 5HHMB 2B4CL 5DUBA 4OM1H 3GSNA 3EJYD 4CVXB 3CMOH 4WTZA 4WGWB 1DANT 3MROA 5DO2C 1PKQA 2HVKB 1KTDA 2EDHA 4DGYL 3UTSB 3MRFA 2DIAA 3MV8E 4DCQB 3O9WB 2DN7A 4WI8A 4CVZA 4ZDHB 2X9YA 2R29H 4JFED 4TUKL 1ZLUK 1V7NH 2X4SA 1TQBC 4AENA 3PWLB 4CVWA 2VN4A 2SEBB 3VA2C 1DZBA 2I60L 2H2PD 3U7AA 3MLRH 2JCCE 3QXWA 3IFLL 1X6NA 5ID1B 1M6OA 2AJYH 5DHVH 1K8IA 4U6HB 4LVEA 1UB6B 4YIQA 4DGVH 3PGDB 1D9KB 4ZNCD 4TSCL 5JNYA 2QSVA 4PJEF 4HV8B 4GG8B 2PNDA 3O3EA 1UACH 3VXRD 3TT1L 1QPPA 4YDVA 4PJXB 3EO1B 2R0LH 4PGEB 4MAYB 3VXUB 2YXMA 4MJ6A 1CVRA 4LQ1A 3O0RH 3ZT5A 1KCKA 4U1SB 4GG6A 3ZTJH 2AXFA 5JQHC 2CK2A 4ZS6D 2BP3A 3WYRA 1CFSA 1QLRA 2YBRA 3DLQR 3MOBH 2PR4L 3I6GA 4G6AD 2BJMH 2PYFA 1ZHLA 4MXVE 1JN6A 3O4LA 3KLHC 2FR4A 4WJ5B 2P48B 5C08E 2HTKC 3UBXI 5JPMA 1XGPB 2J5LC 3VGAC 4G8FB 4Q9QH 3K81A 4G6JL 5JPNB 4P3DB 2P5EA 4PJ7B 4NOFA 4HX1A 2N1KA 5CEZD 2CK0H 1J18A 4NPYA 2W0FA 3RVTD 1KC5H 3CFEB 1EEZA 5EBLB 5BXFB 4XNYL 4YBQC 2FHFA 4X83A 4NQSA 4ALAH 1MRCL 2F5AL 3L3HA 4V1DD 1LDPL 1XAUA 3CU7A 2D7QA 4JGJA 1OTSC 1RK1A 3TPKA 3LN9A 5FGRA 3BFOA 4TSBH 2P5WA 1JPGB 3I75A 5F9WC 3GSRA 4JR9H 4P9HL 1MHHB 1QFHA 1NBVL 2OL3B 3O8XD 2BHYA 3UTQB 4F15B 1ZLVK 5EZOH 1NMCB 2LU4A 4GUPA 4LVHB 4QXTB 5TDOA 5GXBB 3O2DA 5F9AC 3JBG7 1MCWW 1CDBA 1C5CH 1ZA6A 3FTGA 5I1AA 1XR9A 1AR2A 3PXJA 5IB4B 1IAKA 2APBA 4Y19E 3I3DA 4QHLA 4FQHA 1C08B 2ICEB 1A4JA 5I8CB 3OKMB 5CKGA 3LVEA 1KPVB 1GOGA 3MA7B 1MCDA 4UT6H 1X9QA 1JGUH 3VD3A 3FHQA 1P4LA 1F4WL 1HI6B 5SV3A 4O2FA 5IR1B 4GKNA 2ZKHL 4NDMA 1NAML 3FOLA 4L9DA 3KWWA 4RMRA 1I8IA 5DMIL 5E8DL 4XNUH 4U49A 1G9MH 4OCXH 1T7VA 2XWJA 3KLSA 5CZKA 3OZ9L 2HN7B 1C1EH 4FQCL 2ARWA 3EYOB 1EUTA 2DWEB 3P30L 5F6IB 4GW4B 3HE7D 3TPUA 3T2OA 5T5NF 5I1KL 5FYKH 3N0PB 3MJ7B 4FFWD 4UDUB 4N0YL 5EB9A 2B39A 1T5XB 3ZYZA 4I0KA 1RMFL 2VE6A 1DEEA 4WI6A 3BO8B 5CHNB 5JUEL 2FO4A 1UCTA 4ZXBA 3QG7L 2EXYC 5DJYB 1QRNB 4YXHH 4NYLA 4KV5F 3VFOA 3U4BL 3SDDA 4WW1B 5F9JB 4R3SB 1ZK9A 4WFEE 3GI9H 3WNPA 3QHTC 1U3HD 1XCTA 1NMBL 1I7ZA 3T3MF 3MGOA 3JV0A 1T6WA 4G6KL 4LPVA 4H1LG 4QHUA 4LRNL 1OARH 1MCEA 3NACL 3DV4B 5DVMA 1T80A 1H3UA 2GFBA 4UT7L 1W0WB 4AYFA 4M8QA 4P9ML 3O6FC 3TNMB 5JHLH 4P2RD 5T1LA 3OKYA 3HCVB 2D4DA 3AY4A 5TFSH 3TJHC 2VXTH 2RCSH 5DGQA 1FDLH 4L3AA 3CC5B 3O3AB 1E4KC 1MCJA 3EZJB 2YEZB 4JFXB 4OQTA 3QQNA 2GTWB 4ZUSB 2IANE 3PWUB 3CUPB 2IH1A 4NN7C 1IQWL 4O5LL 1EO8H 5L2KD 1NC4B 1J05A 9CGTA 3T1WA 5E8OB 2FBJH 2GSGA 4KHTH 1Q9KB 2EH8H 2X09A 4P46D 5CP3A 4RZCB 4QGTA 5T5NG 4M6OH 4ZFZB 2ZUYA 1EDQA 3LMJH 1J10A 3C6SA 3D2UA 1NH6A 1IFHH 2VIRA 1FNEB 1DQML 2G9HA 1BF8A 4OLVL 1N2RA 2HT3D 3ARDD 3HS0B 3ALXA 1NKOA 4RISL 2XQYK 4NWUH 1BFSA 3CZJA 4X6FA 3MREA 2X1WL 3DVGB 1ZT1B 3TNNA 1PKQE 4L4TA 4MA1C 3L5WA 4XPGH 1MCOL 3BP4B 4J4PD 1ZANH 3F6IA 4NRYB 4R2GD 5TPWL 4NRXB 2AAVA 3RL2A 3ROOB 4FQXC 2GSIB 5D1QD 3QCVL 3RWHA 4XRCB 1V3LA 5FGSA 3ILPA 1WZ1H 1S7XA 5KJRL 1MJ8H 3OKLB 3PABA 3RKPA 3IDMB 3F62A 3VXPB 2BOCA 3DI2B 4WIQA 2D9QB 2DQCL 2GYSA 2ZOLA 1I7UB 4OZ4A 4L4VA 2XY2A 3FQTB 3WFEL 4JN1L 4KK9C 3W11C 5CD5C 2YD7A 5I8OL 1MLCB 1T83A 2W92A 2EE2A 4XMLH 4KUZL 4LOUD 4MJID 1S7VB 2CDEB 4OB5H 1WCQA 1PGRB 2VUOA 4I9WD 4RX4D 1N5YH 1YJDC 2IALB 1MCWM 5IVXB 3UPRB 5FYJH 3MNZA 5HHQB 1RJYB 1YEHL 1JPFA 5FO8A 5D1ZA 4CMHB 1N8ZA 1B0RB 2BNQD 5MERB 1Z9SA 2CGRL 3D85A 3F12B 4OIIH 2MPAL 4FQQB 3O4LE 4ODHL 2BY1A 4AT6B 4C57C 3L3KB 1WCBA 1A7OL 1J8HD 2Q3AA 4NHUA 4BK4A 3W39A 4KQ3H 5DMYA 3G5XB 1KG0B 2PYED 5E1AA 1RUAL 3CK0H 2GJ6D 5CIPH 3FFDB 2XN9A 4ODUB 3K74B 4Q74A 2KZWA 1MEXH 3BZDA 4WTXA 2EYTA 2JK5A 3FFCD 3ZKSD 4DN3L 2P5EE 3ZDZE 1BD2E 4P2OB 2VAAA 3RDTA 4NJ9H 3RZWA 1EFXD 1VGEL 3VI4F 2DIJA 3X13A 3ZE1E 3DX6A 3PQYE 3RPIA 1ACZA 1H5BA 4YK4C 1CXIA 3DHJA 5CGYD 3PGCA 1IGMH 3QIUA 3NIGE 4C83A 1QEWB 4JZJC 4X9GA 4YPJA 5I6XC 5HGAA 1G9EA 4FFZH 2NYYD 3CX2A 3NCCB 4H5SB 1CFVH 4GRMA 2YOCA 2EO9A 5T3XL 4PRPB 4KKBC 4BZYA 4MXWL 1S9WA 4WHYG 1UXSB 4FFYL 2P5WE 1I9JL 2GY5A 3QA3B 3PHOA 4HKZB 4ZTOH 4NQDA 5ACMA 2GAZB 1RQ5A 1P7KB 3SDCB 2BMKA 5K9QI 4Q9RH 1G1YA 1TTFA 3N06B 4JO3L 2I27N 4BUGA 4Y88A 4JREB 5AZ2L 3KYMA 2P8MB 4LDLB 2Y5TB 5C0RH 1F90H 4JPVL 5FAAA 4Q2ZB 5JDJA 1KCVL 3OX8B 5D7JD 3CSYA 1TMCB 2BSRB 2P8PA 5E6IA 1EAPB 2DIBA 2HT4C 5C09D 5HHOB 1M05A 3BD5A 4M5YH 1CE6B 1CN4A 4M62H 2X4NA 4G9DA 3UTZA 1UFUA 4U3XA 5EU7C 5ITBH 2NY6D 1OP3H 5J7CC 4Z7QE 5I66A 3QRGL 3MXWH 3CFJA 2BZDA 2NY1C 3H7LA 4TYUA 3TIDA 1AE6H 1U0QA 4NP4L 5D71L 5IFAL 3QEUB 4XP1H 5AAMA 3O11B 2FHBA 3RY5A 1VADB 3JUYA 3CLFL 3B5HA 3FMGL 2DLGA 3MRKA 4H1LB 3DMMA 4OFIA 1A6ZB 3DVNB 2WBKA 3O41A 2CMRL 3BDYH 4KZDL 1D5MB 2EIEA 4DUXA 3NZHL 2Q6WA 3LD8C 4K9EL 4TOYH 4S10A 4JJ5B 5HY9A 3PWVB 3UJTL 4PJGE 4LLDB 1LK2A 4JO4H 3SKMA 4CN1A 2CRYA 3AREB 1FSKC 4NNPH 4U1MA 5J3HD 4N0CC 1DBBL 1BM3L 2AERT 4XMKH 4QXUL 1NBQA 4IHOB 4PRBA 1T89A 4JO2L 1DR9A 1KIRB 5GHWH 4P4KA 4MCYB 2V2XB 2R0KH 1R3JA 4YE4H 1FFPA 1NGQL 2P7TA 4HEME 2OK0L 6FABH 4FN0A 1EVUA 3CXDL 5I1IH 2GKIA 3P77A 1CBVH 1SY6L 2R23B 1KIUA 4P23B 4X5LA 1R3LB 3TBVA 1F13A 1IILE 4ZFFA 4HUUB 1KJ3L 2Z4QA 2GQHA 1U3JA 5I74B 5EIVA 4PJCA 4YDKL 1G7QA 3HZMA 4CBPA 4M7JL 3GSWA 1VEPA 4IBLT 1AHWA 4K3DH 1BZ9A 3REWB 3CFBB 3TZVB 2V2TB 1BVLB 3BQUD 4O58L 4UNUA 3EFDL 4Y4HA 2YPVL 1P5UA 1A9BB 5K9KA 3EOYG 3FT4B 1CGUA 3RAJL 2JKXA 1S9VB 4R9HA 2QLVB 3SKJH 1N6QH 3RL1A 4DFHA 3QFJB 2P44B 3FQXA 3STZA 5J6HB 1I1YA 1LE5A 4HLZG 1WK0A 4J23A 5J12B 1Y18B 3L3GB 4Y4KB 4ONFL 3QHZL 3V7AG 2XTJE 4RFEB 3QEQB 2AJXL 1QVOA 3Q6FA 4KKCC 1T1YA 1BIHA 1QSFB 5C0AB 3F7YB 3MV9B 3V79C 1ORQB 1B90A 3MYJA 2AXJA 3BXNB 3ARXA 5F70A 1P4BL 5MHSD 5HTSA 4L4TE 3I84A 3P4NA 4OCNC 4XZUB 5IWLC 1NFDA 3NA9H 4O51B 4LPCA 5IW6B 3VG9C 4R0LB 4IMLA 1XR8A 1JCKA 3IB4A 5C0FA 3D3VB 4Y1AE 1NANI 1OAXH 2DYPD 1A7RL 3BHBA 4PRNB 4ACPA 4L29A 4MQXC 3JWDC 1QBLL 1KOAA 1I1RA 1DUYB 2M8XA 3VFWA 3QI9A 5GS1C 1V3KA 4OFYD 1B6DA 3BPOB 5A2FA 2BNRA 3SCMC 4JAMA 3N1GC 2XNAB 4GMSL 2HFFA 2NY3D 3HUJF 2HVJA 4K55A 4L4VE 4LP4A 1J7VR 3TVMC 5EC1A 2X7LB 2NNAB 1MI5B 3AAZB 4APQB 3CLEL 4WNQA 1UEYA 1BBJA 5ESQB 4HS8H 3GSXB 1ADQH 2AXGB 4PJ8C 1CGWA 1I1AC 5CD3B 3SE3A 2A6DA 4GO6B 4PP1D 4KRPD 3UTPE 4ZYKA 2DS4A 1LO0L 3DI3B 3HE6B 2EIZB 4I18C 5EBMA 5HVHC 4MHHI 1DQDL 3MLYH 3MLVH 1FAIL 2CKBL 5FYJE 1IGYB 3NGBB 2D9CA 2VKWA 5I76A 2DKUA 5M94B 1MFCL 4OSUL 3RVVD 3VFVA 2Z8WC 5FEBA 1NANH 1FPTL 4OKVA 2VQTA 1A7NL 1BBDH 3QIBA 3WN5C 1JUFB 4OZHF 1UM4L 1ZTXH 4HF5H 3VRLE 4NSKA 5DI8B 1BJ8A 1DN2A 1UH3A 3S35L 3LRSB 2E9BA 1UJ3C 2RJMA 4W6YB 4J3XA 3O3DA 4OV5B 3ARFA 4WW2F 5T1KD 5J11B 1RU9L 2IFFH 4PLKD 2R2EB 3PWNB 5DD5H 1ED3B 2KUTA 3IFNH 1PSKL 2R4RH 5EU3A 2X05A 2XZQL 3D25B 1NSNH 3PXHA 4WWKC 5CEYA 5T1MA 1FRGL 1QFUH 4HDIB 4ZMAT 3S88L 3RVUC 3LH2H 2D7TH 4GRWE 2HJKA 3EYFA 3SPVA 5F9OH 3ET9F 3CFDB 4YHYC 4RWHA 1DVFC 5ESVB 1AKJD 3L5JA 2J8UE 2Z8SA 5EOTB 1YEKH 1WQVT 4OI7A 3D0VA 1H8OA 5D7KE 3NFNB 3QDMD 4LHUA 3U4AA 3QR2A 4EI5C 2NY5C 2BXZA 5INDB 4HS3B 2NW3B 1FZOA 2ZUUA 2OQJB 3FAWA 5IG7A 2FD6H 1XGUB 1KLFA 5HDQH 3O6KH 1ZAGA 4UUJA 1MIMH 2YC1A 3HZYB 4JG0L 3L3DA 2PO6D 3IU3A 4JPIB 3RTQB 3V0WL 1AQDB 3KYNB 5SWQB 1ACYL 1OPGL 4U1HA 5DUMH 5JIIA 1HQ4B 3VDBA 3V4UH 1FP5A 4JKPH 1OAZL 1F3RB 2F8XC 2H32H 1I8KA 4I3SH 3D18A 4UINH 3KPMA 1AC6A 5KTEL 2XRAH 4LP5A 4RDQG 4RGMB 5IEHA 4B53A 2Z31B 2CJUL 2CIKB 3M07A 2IAMA 4XBGA 4ZG1A 1JWUA 4ZTPL 4JFDA 5DD0H 2H32A 3GGWA 1CL7L 1LO2H 2EYRA 4LIQH 2HMID 3GRWL 4Y5YB 4HSQA 5HD8D 4O02H 4XNZB 5EBGA 1HHGB 4JRYB 4WFGE 5DZLA 2V2WA 4Z7VE 4BQ8A 4YHMH 5HGBB 5H94A 1S5HB 2ATKA 4K23H 3PWJA 1UWGH 1MJUL 2WSKA 2CDFA 5DEGA 1OM3H 4NO2A 2R2HA 2HH0L 3O2VH 5GRUL 1XCQB 3VFSB 1DUZB 2X4TA 1C16B 5D7IA 5EO1A 1R5VA 3GNML 3MLXL 5ICYA 3K4ZA 4BFBD 5C2BL 5DJ0B 3SKNB 8FABB 5D70H 2VKXA 1GCFA 1LEIA 2QADC 4RBPH 4N0RA 3Q3GA 3N1FC 5TDPB 1U8LA 2AJVH 1KJ2B 2VAJA 5DSCB 3RUGA 2C3VB 5DVNA 2I5YH 2ZUQC 5TF1L 4UOJA 3NPSC 2E3VA 4MS8D 5INCA 1ZEAH 1ZKAA 3VFUB 4NKMB 2FBOJ 4PJCE 3SHSA 1TNMA 5D93B 1A4KA 1ZT7A 1XF2A 5C0GB 2CDGA 5DFVC 3CJJA 1I8LA 4H20L 2OL3L 4P3CL 3Q1SL 1P9MA 3CNKA 5T33L 4R4NC 1EGJL 4GXVH 3WJJA 3QPXH 1TJIL 3WJLC 1OT1A 4CU7A 3NIDF 4HK0A 2DQHL 3V6ZB 1QR1B 4MQ7A 4MYWB 4Y4FA 3NCFB 4GBXC 5GJTH 3WFHB 3QZWA 4ETYA 2HTKD 4HC1L 3IDNA 25C8L 1A6UL 3GJFH 3L9RA 1FNFA 2B0SL 4BZ1H 4P57A 1NBYA 4FTVD 4U6VL 2Y23A 1Z9LA 2FNBA 1YZZA 5IFHL 3EO9L 3O4LD 3PDOB 2CRZA 4NZJA 3CX5J 3KPOA 4MMXC 1NFDE 3MJ8B 2W0PA 1MREH 3GJFA 1NGXB 2VITA 3JTSA 3QUYA 3PP4L 4P2QB 3ULUL 2A73B 5HYQA 3QAZB 5L2JA 1CFBA 3EFFB 3T4AB 1OTSD 3BAEL 3KS0J 5CGTA 4KROC 3GBMH 3FO1B 3TYFB 2ZG3A 4XP9L 2H26A 3MQIA 2BRRH 1Q38A 4DKEL 2E7LA 1BMGA 4QLRA 1TENA 5TE6H 4L8BA 2NY4C 3GKWH 3P9LA 4WEBL 3A6BL 4LPWA 5JW3H 4QT5A 3BRFA 3OAZK 3VRIB 5SWZB 1SYSA 4MCZB 5EU4B 3SE9L 4HWZB 4Z77B 1RIVL 2IF7A 5C9JB 3ZKNC 2RGSA 4FQIL 1TZGH 5A2KH 1CK0H 4EBQL 4AMKL 1KYOK 3IFPA 1NFKA 2NY2C 3NFSL 1MCPL 1HH9A 4Y16B 2YD1A 4P5TC 1KGCE 3QNZA 3GSVB 4HXBH 1JWMB 4MAUL 3NH7L 5FK9A 4MA3B 1IAOA 5FM5M 1YYLL 2XZZA 1V7ML 1A0QH 3S37X 1OAKH 3MRRB 4L3EB 4LEXH 3SGEI 2D0GA 3PJSB 3SJVE 4XC1L 1VEMA 3LN4B 3HUJB 3HRPA 1JFQH 1LO5B 1I75A 1CD8A 3IVKB 2WW8A 4Y89A 5T3ZD 5C2UB 4PJAB 4KI5F 3HZKB 1IAMA 4LAQL 4JFPB 3VXSB 5KVEL 4LLQB 1Q72H 4Z6AT 4MQSB 1EH9A 1LNUB 3GMQB 3QH3B 4S1RL 4YFDB 3IJHB 3GBNL 4U1KB 2YR3A 5F3BB 3I9GH 4ZOCA 2IPKB 1KF9B 2EXYD 4HH8A 5EORL 1S9YA 3GJEA 3DURB 4EIGB 4K07A 4MJ5A 5CSZB 3WD5L 1IC7H 2ATPB 1N3NB 4NHCH 4XXCA 4L8SA 3IXAB 1EO5A 1MFEH 2HFGH 5C07B 4Z7UA 4Y5XA 1QFWH 3LKNB 3DX8B 1N4XH 2VLRB 4YHIB 4NCDA 2CLVB 4G5ZH 1BPVA 1CD1A 3MLSH 2FO1A 1ORSB 1PDKA 3FB8A 1G6RH 4OZHB 5IBTL 1HSAB 4PJ9B 5TH2B 4PRHB 2FECI 1D5XA 4G8GB 3SDDD 5MEPA 1MLBB 5CLTA 2GW5A 4LRIC 2HT2D 5I71B 4J12A 3EDJA 3QDJA 3T0DA 2ED8A 4Y5XC 4WW2B 5IB1B 1D7FA 1KXTB 5I1JH 3U6RB 3V6OA 5GQBA 4BM7A 5DYOA 3FN0L 1BFTA 2NX5B 1EUUA 4D0BB 1OLLA 3WS3B 4B41A 4H8WH 5IIEB 3A6CL 1QSEB 2BDNH 1EMTL 5T1LD 3I2CL 2C7UB 2VMFA 5HVFB 4OZFH 4QY8A 4PRIA 3RIAF 1HHKA 3K4DA 4I1NB 4NM4L 4XP6L 1X5FA 4JFDE 5IHUL 4GMTL 1Z5LA 3N9GL 2EH7H 3MV8B 3ZO0A 1DE4B 5MEQB 1HINL 2OJZH 1NGPH 4LU5L 2EKSB 4WVRA 2XZAL 3T65A 4PY8J 2FGZA 4P5KA 3QT2A 3D39A 4GFTB 4H26B 1FZKB 3MZTA 5I9QB 3T4YB 5L8LB 2ZCHL 3VFNA 5D7IE 1BECA 2O5ZL 1X5GA 4DKFH 1RUPH 3ULVH 3NZ8A 4FQXD 4D9QE 3GO1H 2K1MA 4HUNB 3R0MA 1GZPA 4KQ4L 4NFDA 4NNXA 4L4TD 3TF7C 2XIDA 5HDOA 1PFCA 2X89D 5FO7B 4POUB 2C4FT 2FJFA 1AP2B 1GOHA 4XCEB 4H0HB 4KTEH 5C86A 3RUGE 2ARJB 1I7RA 3REVB 1CLYH 1JF5A 5FUOL 3MRNA 4KK9D 1PQZB 3W11D 3UPCA 2ITCB 4YGAB 1U8QB 1OF2A 1T2QH 2EE3A 1BOGA 1Z9MA 1WVZA 3GI8H 4ONHA 5DZNA 1W8NA 3V0AC 5C08B 3BD4A 3V6FB 3MGTA 4WV1A 2W91A 2AI0H 4IOIA 1IM9D 4JG1L 1WV7T 1WZLA 2F54D 3ARPA 3PNWA 4F2MB 3E6HA 3KPRD 5D8JH 1IEBA 2Z91B 4KI1A 3AB0C 4X4XB 2R69H 3BMVA 3GHBL 3R1GH 2AV7B 3VG0H 3BZ4A 3K8LA 4OJFH 3OKKA 5FGBC 4CN4A 4LEOA 5KS9A 5IM7A 2DQEL 3IF1B 3FB6A 4F7CB 3QQ9C 1CICB 3JXAA 3AMKA 4C55A 5LGHL 3D85D 3MBEB 3T2NH 1QKZL 4XH2B 3MRLA 4XBEL 3GMLA 5EUOA 4OUUB 5C0CE 4LDOB 3A0OA 3GDBA 5BJTA 3ZTJG 2D31A 2FX7L 3IXTB 4M6AA 4G7YL 3S96B 3PIQA 4B50A 5LG1A 2XN9D 4G80B 4LASL 3MGAA 2VDRL 1DCLA 1HZHL 4JDZB 5ETUA 2NY7H 4JPKL 4KKBD 3RU8L 2RAMA 2HKHL 3IDGA 3LIZH 4XCYB 1I8MA 5ANME 4OCSH 2UWEE 1DN0B 2NR6C 5C0BB 3G5YB 2NTSP 1H3PH 5JTWA 4KJYB 5CKAA 3MRQB 4UIMB 2VDLH 4MXQC 4JQXC 2VZOA 2R2CA 3QXDB 2XT1B 4F9PA 1Q1JL 4R6UA 1L6XA 2ZCLL 3H9SA 4ZD3H 2QKIA 2DLTA 3LKRA 3U9UA 3BRGC 3HI5H 1ZVSA 4NQDD 3C5SA 2NQCA 1HE7A 5LWYL 3RWJA 1I3GL 2M2DA 5J1AB 3LS5L 1VESA 1BIIB 3L7FB 1BFVH 2HT4D 3X12B 2J4WL 5A2LH 1NC2A 3QNYA 2XPGA 4DAGH 4F9PC 4WDIB 1DFBL 1L9NA 2ERJB 5E2TH 1JP5A 3VXQA 5SX4H 3C9NB 1B0GB 1XF5A 4IDJL 5ID0A 2IADB 4M48H 5DQDL 3F58L 5GGVY 3CFKB 4GAFB 4XVSH 3GIVA 3Q6GH 2C26A 1L9MA 3I50H 1P4IL 4LLWA 3UBXG 2UUDH 1F4XL 3JVGC 2FATL 5JW4M 4FNLL 5D1XA 4QHMA 1UH2A 4EOWH 1IM3B 4NO0A 1T5WB 3H3PL 4MX7B 4Q9CA 4LVOB 2DM7A 5T3ZH 1E4WH 1GPOL 4UV4L 3CIQA 4Z5RB 3VA6A 1S7WA 4NZUL 4OD1L 4KK6C 1G0DA 4NWTL 3BVNA 1U58A 2PW2B 1F4YH 3DMMD 2D0FA 4WUKL 3TIEA 4WFGD 3IJSB 4N0CD 2NTFA 4U1IB 5C7XH 4Z7UE 4OI8A 3MLTB 3TN0B 4AIOA 3DX7B 5JORA 4WO4A 2OM5A 3NN8A 3U9PL 1EJOL 2D7MA 3NAAL 1R24B 4XVJL 2F58L 3R0NA 1E28A 3QJHA 2AK4B 2VLKE 3QDJE 3DO7A 4M1DL 5DHYA 2XA8L 4OGYH 1F3JA 2RFXB 7FABH 3OPZL 3HMXH 4ORGA 2YUZA 3RWGB 3V6OE 1KENL 3FO0H 4I77H 5GGTL 3V7MA 1XGRA 3V5HA 3CSPA 2ESVB 4WCYH 4ZOEA 1U8IA 1YEFL 3MLUH 1GGIH 4LPYA 2G5BA 3U7WH 3BJLA 5ERWA 1WF5A 5HYIA 4PRIE 4QNPF 3C60B 1U93A 4E41A 3TJEH 5DURB 1K6QL 1JNLL 3AU1A 4X6CF 4JANA 3PP3K 2YPKA 2XV6B 3PL6C 2I9LA 5E00B 2Q7NA 4Y4HD 2XICA 1MCCA 5F7YC 4KKCD 3S36L 5H2BA 1SY6A 43CAB 4LMQE 5F88A 1A21A 4Q58C 1L7IL 3ZKXC 2EDBA 3MTRA 1ZS8B 3CCHA 3RIFF 4PGBB 4HWEH 1M6OB 4H0GA 5AAWA 3ARSA 1OQOA 4Z0BL 1Q9WB 4DTGL 4R90L 4UIKL 3ARGB 3DUUB 3OXSB 2WZPD 3MRCA 4M7KH 4U1NA 4YHLH 5HI5D 3O3EB 3C6LA 3AS1A 1NCDH 2A77L 4MQXD 4IRSA 3QSKB 3HG1D 2M1KA 5DHVB 1NGYA 1VKXA 5EIQA 1FORL 4F33B 1EK3A 1YMME 2FSEA 3PDDA 4ODVH 4F7EA 1AGEA 3BSZH 2V7HB 3ULVE 2ADIA 2BNUA 1AXIB 1ZT4B 3BISA 1FC2D 4PB0H 1YEEH 5GGQH 2ZPKL 5DRWB 5E8EB 3P0VL 1UB5B 3ELAT 4HGWA 1YYMH 3C5ZC 3B9KC 4CJ0A 1LK3L 1ROWA 1KJVA 3E8UL 4PJ8D 2PETA 2BNRD 1VFAB 1PY4A 1PG7H 2Y4SA 4QCIA 4JVPA 1AC0A 2W38A 1HKLH 4JKMA 4HWBL 3F7PC 5GIRB 3KPPB 5GRYA 5E03A 4CMMB 3RNQA 1JI2A 3RP1A 1FG2A 2ZUWA 5IGXH 2FJGA 2W65B 2IH3B 2VDQH 4PJDF 1BD2B 4LVNC 5BZWA 4ZFOB 3LDBC 3PQYB 1Q94B 1UXWB 4DOHB 5HHXH 5BMFH 1R3KB 1JV5B 3FO2B 5KS9E 3DXAB 5EWIH 2AJSH 3DRTA 4TTDC 1XIWC 5ECJE 5ADOH 1MUJB 4RWYL 3C8KA 4UDTA 1AY1H 3AS3A 3GSUA 1CF8H 2OTUA 1RK1B 3WE6A 1R5IB 3B9DA 5EUOE 3E2HB 3VGFA 4TNWK 3VI3E 3QUZC 3MMEB 4HCRH 3FCTA 1WT5A 4NC1C 4R4FH 3BUTA 2PTVA 4P4RA 1KIPA 1T04A 2CIIA 4TUJA 5E70A 1HKFA 1T1ZA 5F8RC 5CJOL 4U7SA 1CLOL 2Z35B 1VGKA 4QWWC 5DHXB 3S34L 1Q9OA 1IL1A 1JHKL 4DVBB 2IGFH 4OD3H 3QDGA 4LSTL 5I1AB 2WLZA 4YZFE 1R3IL 4GW1B 1AGFA 1H3XA 3IKKA 3ZYIA 1KT2B 1F6AA 5BV7C 1CFQA 1DVFD 4PJ5A 4LCUA 1WWCA 2FLRT 4MJ2A 5CJQH 3UDWA 2D03L 2VL5B 4HIHA 5FHBL 3H9SE 4OCYH 2YK1H 3K80A 1LD9B 2I07A 1E4XH 2NY0C 4PJFF 2MCG1 4ZPTA 1MCQA 1JI1A 3E3QC 1T20B 5CZVL 4YDIL 4LHUD 1KJ2L 4HKXA 5C3TA 4P59L 3U1SL 4OCWH 2A83A 1FNGB 5EBWB 5T3XE 3L5IA 4CGTA 3ZE2F 4JY4B 1LILA 4XPFH 4JY5H 4GRLA 4U0QB 1V3MA 4LNRB 4AM0A 5JXEA 1DLHB 4KFZC 4CVXA 4LARL 2DD8L 2W0KA 4MD0B 3HPLB 4NYLB 1GOFA 2HVKA