5DO2C

Complex structure of mers-rbd bound with 4c2 antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
215
Chain Sequence
DVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRDGNDYDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A humanized neutralizing antibody against MERS-CoV targeting the receptor-binding domain of the spike protein.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Viral protein/immune system
molecule keywords S protein
total genus 44
structure length 215
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2C01
3OG4B 4H0GA 2VITA 3AXLA 3RDTB 3O6LH 1ZLVK 4OLVL 5I9QB 5JNYB 1A6WH 2IQ9L 5T1LD 1LO4H 1NJ9B 1IQDA 5J3HC 1CLCA 3QJFA 2A74A 3B83A 4NZUH 1NUGA 3U7WL 4NC0B 4DN3H 1RUQL 4IMKC 4DZ8A 1YQVH 3WKNA 1BFOA 4KKBD 5HDBE 5J1TC 2OXHA 4Y2DD 3DMMA 3L3IB 3B9KA 4JANA 5DFTA 5E00B 1QTYT 1U8KA 4QF1B 5MEQB 1G84A 4M1CC 1B0WA 2W9DL 3LH2L 4ZYKA 4BSVB 1EXUB 3SOBL 1MVFA 3WJLC 4JM2B 4WEMB 3RY6A 1C5DA 1S7VB 4U0RC 1FNSL 1PSKH 4XI5C 4IRJA 3BP4B 5EUOA 2GSIA 1JMXA 4N1CA 4NNXA 5DVKA 1M71B 1YY8A 4YHLL 3KPPB 2VR9A 2X4OA 3NFNA 3MBEB 3MJ7B 5I74B 2I25N 4LKXB 2EO9A 2C7UA 4P9MH 4ZDHA 4M02A 1CGTA 3NFPA 4TSAH 5LAXB 4JZJC 3ZYZA 1ZLWK 1IEHA 5TFSH 3B43A 3IETB 3H9HA 5EPMA 4NOFA 3BP5B 1Z9MA 4JRXA 5T1DL 2VQ1A 4POZC 3FB6A 1KCRH 2FATH 4HJGA 2EIZA 4BZ1L 4CMHB 5FF6A 3Q6FB 5ERWA 3PHOA 2OJZL 3BO8B 2E9WA 5L6YH 3CDGA 3AFLA 5C0BA 3L3GB 3PP3K 1C5DB 1BQHA 1E4WL 5ELIA 1A8JH 5KSBF 2DDQH 1SJEA 3BP4A 2JJSC 3FAXA 4OGYL 4NT6B 1ADQH 4MD4B 5CJ8A 4MQ7B 1MQ8A 2CIIB 5C8JB 3L3OB 4OZ4A 5DFVC 5EZJB 4OM0H 3SEPA 5C6PB 1F6LL 1F8TL 4LRIA 4RFOH 4WO4C 5HHVH 1WICA 4P59H 3TT1H 1N4XH 2IAMA 1UB5B 4UV7H 1VEMA 4P46C 4P5TA 3BP6A 4YGAB 1KTDB 3C8KA 4E0RA 3O4LB 3O2VL 2A6DB 1D5ZB 3O4OB 1NUFA 3B9VA 4WW2C 2EDKA 2VUOA 4WFGE 1G6VK 3Q6FA 4D0CA 2EDRA 3MJ6A 2HVJB 3QR2A 4JFDB 2OZ4A 5GGRA 5EUOB 3V4PL 2DQGH 4PGZA 4AG4L 1KT2B 1I1CA 3F7VA 2AV1A 5IFAL 4MCZA 3RVUD 1DVFD 2N56A 4JO1L 3D85A 3BSZH 4WU5B 4NO0D 1FNHA 4Y19D 5I8CA 4WDIB 3V5KB 1PZ5A 2HP4A 1GIGL 1MCCA 4NC2B 1KN4H 4UU9A 4U05A 4LSTH 3L5WB 3NCYP 3KYAA 3EJZD 3QG7H 2FR4A 3U9UA 3SQBA 3GBNH 4TUOA 2HJLB 2GFBB 2APXA 2YMXL 2HFTA 3DRTA 4YBQD 4F8TA 1WBYA 3OR7B 3U6RB 1YECL 1TLKA 4XX1G 1MCJA 3WNPA 2DQEH 3Q6GL 4NKOA 2CKNA 3MRQA 4HUMB 3PWVA 3EYFA 4PRNA 5E8DH 3EHBD 1J0ZA 1G7JB 4HFUH 2VH5H 4NZJA 3VD3A 2DM4A 3F7VB 2VL5B 2ZSWB 1OY3B 2WV3A 3QWOA 1DP0A 3B3IA 5EH1A 1LEKA 1PEZA 1WV7T 4RBPK 3HE6C 3D85B 1EAPB 1F6FB 5D9SB 4JY6B 5FO8B 4ZFGH 1Y0LB 3RL2A 5IG7A 1WSST 4PJCB 3ABZA 1XF4B 1FO0L 5GGVY 5GGRB 4LGRB 1LEGB 2IANA 1MFAH 3F7YB 5CEZD 3LEXA 3V8CA 1CU4H 2ARWA 3EUUA 4XRCB 3S88H 4M1CD 1QLFA 5IB4B 3ARUA 5FGCE 2Q8AL 4C56D 1AQDB 1E4XI 1U8QB 1IEBA 3B2UC 1YJDC 4JDZB 2G60H 1YYLL 2XY1A 4GRMB 4PJ9B 3P77A 2DBLL 5IQ9B 1CVSC 3PABB 3ARGD 4FQCH 3VRJB 3CFKA 3JV4A 4XPGH 1W72A 3E6FA 5INDB 5KSVA 3IFNL 5F97E 2VLKB 3KYNA 4OZFB 2KQMA 3MODL 1A1NA 3IDYB 2Q7NA 3DUHA 4NNYB 4YK4C 4HFUL 3JWNC 1U2CA 3W11D 3VJ6B 1SEQH 5D5MA 1A0QH 3QI9B 5CGYD 1YN7B 5C0GB 3BGMA 4NWUH 3G5YA 5DJ8B 3CC5A 1BIIB 3KS0J 4NKIH 3DBXA 3FZUD 3N1MC 1XGUA 1NFIA 2QTEA 1JNLL 1LEKB 1W0VA 5LBSL 3MRHB 5DVNA 3ALWA 2GW5A 1YJDH 3BWAA 4DWHA 4PGEA 4OD3L 2UWEB 1X5KA 4IRSB 5DC4B 1QRNB 4JVPA 1P7HL 2FHCA 1I7ZA 2HKHH 5FK9A 1DQQA 1BZ9A 4X7TA 4PJGA 5LGJA 2XZQL 3WLWD 1UADC 4PJIF 4K94L 5CLWA 4XVUC 5TPWL 5GGVL 1GJIA 1X5LA 4Y4KA 5E70A 5I1LB 2G5BB 5IMKB 1AGCA 3ARFC 3DLQR 1C08B 1KJ3L 2WQRA 4Y16C 1AD0B 3QA3A 2NPLX 2VAJA 1MIML 2VZ3A 3LDBC 4GOSA 2NW2A 3FRPA 1T1ZB 5H8DA 1WISA 4AIZA 4JFFB 4L3CA 1QFWH 5E2JA 1LO2L 4M4RA 4F2MA 3Q1SL 1JIBA 3CFJA 2DD8H 3UTZB 5E2TH 3KPSA 5BS0B 7CGTA 4Z7UE 4JZOB 3O8XC 4NQEB 4P5TD 3OX8B 4MA8H 5C6WH 2I5YH 4JLRB 2Q76B 2H8PA 3TWCH 4RX4D 4Z76A 3FQXB 1UENA 4NSKB 2AEPL 2VDRL 5EFIB 5EUOF 2ZSVB 1F4WL 4H20H 1K8DA 2DF3A 4BQ9A 3QFJD 2D7PA 3L5HA 1K85A 4JZJB 3MLSL 2E9JA 3WUWA 4F7CB 3WSQH 4IDJL 5F7MC 3K2UL 5I0DA 1NGYA 5JOFB 1BWWA 2R1XA 1T1ZA 4LLQB 2GCYB 4LHUA 4DFHA 4UNVA 1BQHG 2OSLB 4U3HA 1NCDH 3LS5L 1JGVH 1MCFA 4H1LA 4YHPA 5C0JA 4YXKL 5ADOL 3SKJH 3ZT6A 4NQDD 1FLTX 3T8XB 3HNSL 3MRMB 3QUYA 4JAMA 5IV2A 5D5ME 4H5SB 1X4XA 3D3VD 1GGTA 5M95B 3CCHA 2HH0H 4OCXH 1BVZA 1OAZL 2VTFA 4HXBH 3EFDH 2VLMD 1MJ7H 1CF8H 1GGBL 2OZ4H 3NCBB 3OMZA 4LLVA 4PV8B 5EBWB 1C5BL 1DZBA 1I9IH 4YFEA 5ICXA 5HYFA 1S7VA 1DE4A 3BPNB 3DNKA 4WUUD 4GRWH 3MCKB 1CDCA 4MNQE 3EDJA 2DQHH 3SCMB 3HE6D 3BVNB 1TZHB 2BP3A 3PWPA 5GRJL 5E8PB 3TBWB 4PJEA 3W82A 5J06A 1YY9C 3RQ3A 1X5XA 1BZ7A 3MNWA 5TGBB 5F3HA 1KPVA 3TV3H 4B0MM 3MLVL 3CX5J 1IL1B 1S78D 3QIUC 4CADB 2JELH 3TESA 1EHLL 1QG3A 4ZS7H 2W60B 2HTKD 3T8XA 1OAUL 4NJ9H 5ALBH 5ICZA 1FGNL 5DQ9A 3GI9H 3MLRL 1S7WB 3X14A 1CFVL 1MI5B 5IJVB 5DRXB 5DHXB 5ID1B 3OGCA 4OLXH 4FXKB 1H3VA 3NABL 3TYFB 2HRLA 1FFPA 2EKSB 4LHQB 3M17A 4HAFA 1OM3H 1I3RB 2ADFL 3UTSA 2X9WA 4JPVL 2YRZA 1D5MA 3O3AB 4U0QB 4AM0B 1MCSA 1VCAA 2HFGL 3LMJH 1PQZA 3LKOB 5GS0L 4MDJA 5D1ZB 5I1CL 2OI9C 1RZKC 3HMXA 5JDJA 1J5OL 3V0WH 3VI4F 5CP7A 5DLML 5HPMA 5JQHC 5DD1H 4NQCE 2XN9A 3NCYS 4K3EH 3S37L 4JQXA 4JFHE 4N8PA 3WN5A 4LLUB 2A9ML 1S7SB 1HHIA 3O2WH 3WHE0 2O61A 2FIKA 4O2CB 4UTBL 4WTZA 2BX5A 2AJXH 4NWTH 4PY8I 2JIXB 1I3RA 2NYYC 3MA9H 1RJLB 4OCSL 4HWBL 2Y36L 4X0KB 3RWEA 4G8IB 4MCYB 5I8CB 1F5WA 2P43B 2UUDH 3WO4C 3V0AC 4Y5YA 1DVFB 4K7FB 1N59B 5F7UA 2VL4A 4X83A 4MJ4A 2FR4B 4M6OL 5HGBA 5HYJB 4JVWA 4F7EB 1AO7A 4P4KD 5I2IB 3I3EA 1I9JH 2FJGB 5C0RH 1SY6L 3BX7C 4RGNC 1KF9B 1EVUA 1IKNC 2B1HL 4K9EH 2UVFA 3GSQB 5F88A 5IBTH 4XWGL 5E8EB 4P9HH 1JF6A 1ZOXA 2XN9E 1CD9B 3SO3B 3TO4D 3L6FB 2HKHL 3SDCB 4HX1A 2R2HB 5ABDE 2VSDA 3AY4C 3NA9L 3WUZA 1E27B 4RAVB 1X5HA 3MOBH 4G6JH 4WJ5B 4JFEA 1JZ7A 3HZMA 1R3JA 1MCWM 3VGBA 5FYJH 1HHJA 5F7EH 5E2WH 3BGFB 3MJ8A 2W92A 4LVHC 3GM0A 4JJHA 3CUPA 1KCSL 2AI0H 2X4NA 1Z2KA 5E2VH 1NGXA 4N1HB 3HC3L 1IGCH 5MEOB 1YDPA 2XTJC 5EU7C 2H9GA 3CLEH 5KVGL 2WBWB 2IPKA 3MLWH 1TJIL 1U41A 2VIRB 4Q0XH 1M7DA 1RURH 3GKWH 4EN3B 5I1AB 4B7LA 1MLCB 1YUHB 3HI5L 1KTLB 1ZHBA 4O2FB 3GGWA 4P57A 4OLYL 1FYTA 3BD4A 2OQJB 2C7UB 2FX7L 4MJIA 3MROB 1KFAL 5BXFA 3NIFE 5I1KH 4MAUH 3VWJC 5HYEA 4RMUA 2DKUA 2YEZB 3LCYA 2BERA 2V7HA 1CWVA 4HFWA 4OCLC 4MA7H 5F7EL 1G7HA 4ZFOL 3ZKXC 5E9DD 1F2QA 5E24E 4W68A 1N7MH 5CSBA 5ANMB 9CGTA 2H9GB 3FT2A 4U3CA 4Y4KC 1H5BC 4YNYB 5ESQB 1JZ8A 1PDKA 4KROC 5D1ZD 1FJ1A 3JZ7A 1FNGB 4KZEH 3ULUF 5ACZA 4JDTH 3MCLL 4UNTA 2ADGB 2E7MA 3WUWG 5DJXB 5SWSA 1FRGH 3QBTB 3RVWD 4S11A 1DQJA 1KGCE 2HT2C 1QSVA 4GSDH 3HE7C 3BD5A 2P48B 2NW3B 1JPTH 5HI3D 1I4FA 5IT2L 2FWOA 4WW1A 4OZFG 5EU7E 1WJ3A 3QIUA 2OYPA 5IEHB 2X44D 1BGXL 2HVKA 1OSPH 1LO0L 3IXTA 3ARBC 3BZFA 2VLLB 1R0AL 4HS6A 1RZGA 3BZEA 1R3LA 2BDNH 3STZB 1KB5B 2J2ZA 1SMOA 2BRRH 3OF6A 1MFNA 4G42B 4I0PB 4S1DC 3U0PB 2QSTA 4YDIL 2O5YL 1KCLA 4Z7VB 1KIPA 2VN4A 2KDGA 4BYHA 3SKOA 5D1XC 4U6XB 1QSEA 4U1HA 4MXVF 4QYOB 5E6ZA 4FABL 5DK3A 2ENYA 2ATPB 3ILPA 1QZ1A 5LGHL 3U82B 5IR1A 1INEH 5E8NA 1UM6H 1F4XL 5C09B 2Q3AA 3ESUF 4KMQA 3EYVB 4XVJH 5CZVL 1FNEB 3OKYA 3REVA 3U7YH 3GBLA 3HZVA 3X13A 1INEL 2X89D 1AGFB 5CEZH 1OM3L 5FO7A 2H32H 3PV7A 2IALB 1KYOJ 4XPAH 2BVUA 1A14H 2H2PC 1MFCL 4Z7UA 4N8VB 5DRZA 1TPXC 5E7FA 3CZJA 4IMLA 4RFOL 2BNQB 3IJYB 5DURB 3SKOB 1J1PH 1JPGB 2IH3A 1BBJB 4KRPD 1MFEH 5I6XC 2IAMD 3C2AH 2P5WA 5JHLL 4MVBC 3UO1H 1LEGA 3SGKC 1EFXD 5FKPA 1R5IA 2R1WA 1H3PL 1JP5A 1SBSH 3FQTA 4IHOB 4W6XB 1XH3B 5DVOA 1D3CA 2F54B 5FUZH 1RHFA 2M1KA 1F3DH 1I1AC 3BMVA 1MHPH 3PXJA 1V7MH 3BIKA 3C9NA 3KPLA 4Y19E 2YA1A 1CE1L 5E9DB 2OR8A 4OF6A 4MNGB 3L3JA 5HHME 4XNUL 1P4LB 3BW9A 3PGCB 4U1KB 2D0HA 4YHNB 4NKDA 5J4MA 1A02N 3V4VH 1AH1A 3A6BH 4ERSL 2JB6B 1FSKC 1A1MA 1V05A 3IYLW 2HMIC 3I50H 1VGKA 3P0VH 5DJYB 3FQWB 3D2UD 3VFMA 3QWRA 4DKFH 3QEQE 2OTWB 2CLZA 3FONA 3T0WA 5LQBH 2IFFL 3S97C 4X6DE 4TVPL 1GGIH 5D71L 3D25A 12E8H 3KXFA 4HJ0D 3L1OL 3I2CH 4AQOA 2YSSA 5F71A 4NQSA 4ZOEA 1HHKA 1U8OA 4OB5L 2B1AH 1I9IL 3MFGB 2ZOKB 4IMLB 4RWHA 4JB9L 2R0ZH 5EPMB 3VW3H 4M48H 3SJVE 3M45A 5D7LA 1RSFA 1F11A 3TLRA 3EYQD 1T0NB 4GRLA 1DBKL 1PKOA 1U8NB 5I73B 1CG9A 4OBRA 4OZGA 4GAYA 3ZE0E 1JYWA 4I2XA 4LGPB 4KKCD 4YR6A 5HVWA 2R0KL 4Y8DC 3FFCD 5DJAA 5DUMH 3S98A 1DL7H 4NPYB 3B6SA 4K71C 1ZT1B 1XGTA 2ICWA 4PJCF 4NZTL 2APTA 2CLVA 4ODSL 4L8SC 3QRFM 3TIEB 5D1QA 3KLHD 2G5BA 4U3XA 4MNGE 2WK2A 3LIZH 3BWUC 4HT1H 1TIUA 3IAPA 3L95A 2ZCLL 3U1SH 1NGQL 2AJ3A 4J4PD 5GGQH 3T09A 1U8IA 4PJHE 3RX7A 4ODXB 5DGRA 1KCVH 3KPRD 5DZNA 3SGEH 5ADPH 3OKMB 1ZHNA 4GRWE 4TN9A 4WO4A 4FQHB 2YD9A 1ONQA 3FB5A 5D7LB 1IGYA 5DWUH 5K9JH 3LKRB 3QIBA 1G0YR 1BWMA 1D5IH 4MA8L 3QEUB 4JY4A 3UCRA 4CVZB 1HYSD 4C83B 4O02L 4Z7NF 2WW8A 2NY5H 5F6IB 3VA2C 3JWDL 2RFXB 3RY5A 2FJGA 4OT1L 3KDMA 3CDFA 2AQ3A 4JKPH 5BOZG 3DJ9A 4LEXL 3FCTA 1Z0NA 4JVUA 4XPHH 3HG1A 2V17L 1EFXB 5L2KE 2ZCLH 4GBXA 4PV9A 3VFUB 1TVBB 3DIFB 3ARGB 3WE6A 1K4CB 3H9SE 3SE3A 5J9PB 5KW9H 5HDOA 4J3TA 4O9HH 3WLBB 1J0YA 5GGUA 1TTUA 3C6SB 5L2KD 4NRZA 3CAFA 5IEKB 3FOMA 3TBSB 2Y06H 4LK4A 3BQUB 1A9EB 1U3ZA 2YS4A 3QXAA 2GHWB 3KYKH 2PF6A 4L3EA 4UT7H 3BDXA 5AWNH 5TF1L 1GGIL 3FO0H 3MLZH 5TE6H 2PO6D 4FQJL 4QCIA 4PRAA 5C08D 1ACYH 3UXFA 3MNWB 4Z7OF 3QDGD 4LLAA 1AGEA 2XA8L 1T04B 4X5WA 5DO2C 3U7WH 4APQC 1A6ZB 1G7PB 2GSGA 3JWOH 2IFGA 2Y6SD 1MJ8H 4QRTA 4EN3D 4B41A 4YE4H 1EGJA 4CVXA 4E5XA 3T0EA 4HLZH 5GGUB 4I77H 4Y4HA 1M7IB 1OPGH 2CJUH 2A77H 5BCAA 5TDOA 2YEZA 5CBEB 1WEJH 4F37K 1U8LA 3RZWA 3AROA 3BQUA 5EZIH 1IE5A 2DKMA 4MHHI 4XNUH 4GG8B 1DBBL 3UEZA 4X5XB 4Y4KD 1RV6X 4NO2B 4P3WA 1FH5L 3SJVD 2ED8A 3DI2B 3IKCB 1JTOA 4EDXB 2NXZB 1FV1A 1PAMA 5F6HI 4ONFH 3VWJD 3GHEH 4X6CF 3C08H 5SWZD 3O41A 2JJSA 5LGHH 1GRWA 3EOYG 5T1KB 3ARBD 5BJTA 5E6IC 1VFAA 4XPAL 3CIQA 1YNLH 4LCWE 1QA9B 1U3YA 5GGSA 1I8MA 3TA3A 2LV4A 1AR1C 4JQVA 4Y0GA 3T2OA 4RIRA 2G2RA 3IDIA 4WUUA 4G6KL 5I17B 1CFBA 4W4NA 4D9LH 4AM0A 3BHBB 1G9MH 1KPRA 3KJ6H 4U6YA 1UFUA 2HTLD 1A9BA 2O61B 1MRCH 1U42A 3ZTJH 2FLBT 1V3LA 1JMZA 5CD5C 2CLRB 4HUNB 5CJOL 1NCCL 2P7TA 4RFEA 3RUGE 1A6VH 5JHDB 1B2WH 5DDHB 1I9EA 4D9QD 1U8MB 3ZKQD 1QBAA 1ZS8B 2EXYC 3DARA 4JO2H 4UT9H 4X7DC 4YDIH 3V6ZA 3GMMA 4HDIB 3VWKB 4HK0B 3RJQB 4Y16A 3T0BA 5DUBA 5DMGD 4M1DL 4JFYB 3OXSA 1HWHB 4F7PA 5GZNC 5IVXA 2LU3A 2VDOH 1Q94B 1KJVA 3HC4H 2EDNA 5CGMA 4IRJD 1LQSR 2Z92A 3VFNA 4LDLB 1KCVL 4MQSB 4Q97A 2BNRB 2D9CA 3R8QA 2GAZA 3VXUE 3G6JE 1UJ3B 3DO3A 1FHGA 5CIPH 3RKDC 4URTB 5JHDE 4PJ5A 1YEEH 4NZRH 5ESAA 1HHGB 5FF6B 3OKKB 3WJJC 3BAEH 5FYJU 3WHXB 3MYJB 3QUML 5I73C 2UZIL 1B9ZA 4AENB 4KRPB 3WDHA 5E8OA 4POUB 2Q3ZA 4NHUB 5DD6B 2VO5A 4LKXA 2EYRB 1WZMA 1VADA 5CEYB 2Y5TB 3NCFB 1N5AB 5MEND 1XIWC 5SV4A 5T3ZD 1OLZA 2MHAA 4M48L 5ECJE 3H3KA 5GJTL 1U6AH 3C5JB 4PY7B 2UZYB 4WI3A 3QDME 1ZHBB 1OTSC 1A7RL 1P4LA 3RGVA 3VXQA 4M61B 3MR9A 1MCRA 2IBBA 1HHJB 1S7UB 5D7JD 1X7QB 1NC2D 1MAMH 3UJJH 3LDBB 3T0AA 1PG7W 2EH7H 5FYKD 1LDPL 5DJ6B 1U0QA 2E7LC 1L7TH 4R4BA 4P2RB 4HJ0C 4MB5A 4H88H 1FORH 3ARSA 3SE8L 3T3PE 2A9NL 1V3JA 2ITDB 3ETBF 3UTPE 4IRZL 1GC1H 2V9TA 1H15A 3HI5H 5JOPE 2F58H 4IIQA 1T1XB 3K80A 1KTLA 2KQNA 3UROR 3K46A 4ODTH 2B4CH 5A2JH 1DUYB 2ERJC 4YBLB 3ARDA 4Q6IA 3L3HA 4NNPH 3D0VB 3C6LB 2ZWLT 3VFPA 3G9VA 5J56B 1IAII 4PGCB 4TNWF 4P4RB 3S96B 3UTTE 2YRLA 4X6CA 4KK9C 3ARRA 1TNMA 4ZSOE 5H37H 4QHNB 3F5WA 1YEFL 5L2KA 3O11A 4ETQB 3P4MA 4Q2ZA 1F3RB 4U33A 1O0VA 4KKBC 2FD6H 2BNUA 3EDEA 4PRPE 1BHGA 5LVEA 1KIQA 4JZNA 4X8JA 1KB5A 2ILLA 4WV1A 3KYOA 3SDCD 4QHLA 4MD0B 2WQ8A 3STLA 1DR9A 5DJZA 2NTFB 4WO4D 4L5FL 3AREB 2OMBA 4BZYA 4ZNEA 2NXZC 3Q1SH 2AEQH 1P2CB 4YDKL 1L4IA 3SDAC 1JCKA 3LIZL 1P4IL 4WI9A 4Y4FC 2QLVB 2WBKA 1ZHKA 1TQBC 1XR9B 5CP7B 1N6QH 4J1UA 4U1NB 5D93C 4JPKL 2ZUYA 3RP1A 4JPVH 3F5WB 3ELAT 3B5TA 3V6FB 1HSAB 4OSUH 4R0LB 1KBGL 1JTTA 2HLFC 1AXSA 1FVEB 4M8VA 1R24A 1UYWH 4ZMAT 4QGTA 3QH3A 2LU7A 3KWWB 3SDXA 4LARH 1MEXL 5ACLA 2R2BA 5GRUH 3GSVB 5FYJD 1K4CA 5J9PA 2AJSH 5INDA 1D6VH 3QXVA 4PLNC 2QQLL 1IM3A 4YQXL 2VZOA 1F3JB 3BH8B 1TJGH 4NQDA 2XV6B 4PJDB 1RZ7L 2OL3B 1T0PB 4MS8C 3DX7A 3OAUH 1XMWA 2H2SC 4KXZI 3VXMA 2XWTB 3VFSA 1AQKL 1ODAA 2E27H 1R5WA 1A6UH 2Q6WB 4XBGA 3MODH 3KPLB 1PKQB 3RVXD 1FAKT 3PP4H 5DUPL 4IHOA 1TCMA 1R3HA 3TP4A 1ZA3B 4PRAB 4XPGL 3IDXH 3ARFD 3K1KC 1NCBL 2R9HD 4H0HB 2E27L 1U8PB 3SDXB 4PRDB 3SCMC 1X4ZA 2FBJL 5LCVL 3UC0L 4LIQE 4OFVA 3RJDA 4OIBA 1R5VB 3LS4L 5D5MB 3DO7A 4P5KA 4U1GB 2ZZUT 3BYTA 1ZTXL 3MLVH 4M7KH 1KPUB 5C0IB 2FEDC 1TJGL 2FL5B 4P2QA 4XPBH 4XHJD 1FVDB 4PTTA 5F3BB 2HG5B 3VXRA 4M7LT 5D96B 3S7GA 4LF3A 3VGGA 3FTGA 1MI5E 4ZTOL 2MQ0A 4J8RA 3PV6B 1SYSA 5DVLA 1ORSB 4GW1B 4XVSL 1JFQH 5DFWH 4EUPB 2G5RA 4JY5L 3AU1A 2P5WE 1WWAX 2AK4E 3VXSD 5I9QC 3WFZA 1QFWM 2C3GA 4L4TB 3P4LA 5JW4R 2J8UF 1TJIH 2H8PB 4Z76B 1EERB 1OAZH 4RNRA 4LEOA 3GIVA 4U1IA 3HS0B 3RTQB 3QUZA 2VISA 3CZFB 4KRNA 5D6DA 2P5WD 3IDUA 3NN8A 4OKDA 2IG2L 3HI6L 3WO3B 4L3CB 3WDIA 5SWZB 3C09C 3WLWC 5SWSB 5HHNA 1WK0A 2C3HA 1FZMA 1MLBB 3OKMA 3VGAC 1CXFA 5CILH 2Q86A 4MYWB 5DK2A 3PV6A 2R8SL 1NC4B 4OGXL 3QFDB 2P1YA 4PJ8D 2QKIA 4MLIA 1AC0A 2SEBB 4JQVC 4IJ3C 4X5LA 3TVMD 5DT1H 4XNYL 4KTEH 2DAVA 3OB0K 1MCDA 3Q3GB 4FNLH 2QQNL 1C5CH 2D7NA 2EEAA 3C5ZC 3W2DH 4R2GC 5EIIA 2FECL 4EI5C 3I75B 1JHLL 1XGPB 3DGGA 3W39B 1JUFB 4X7SL 1UWXH 1WFOA 2KH2B 2YXFA 2UYLB 3OKEB 1H8SA 3EO1B 1KENH 4LP4A 4YPGB 4PPTA 3EOAB 4PGJA 3S3PA 2B4CL 5E1HB 4XCEB 3KPOA 5IESL 3QDMB 1AC6A 1Q94A 4M03A 1QRNA 5CBAA 1RI8A 3QCUL 5DRWB 5CCKH 2BVPA 2QR0B 3BH9B 2NY2D 1B6DA 5FYKE 1HINH 1BECA 3M1BA 3CXDH 3H6JA 2X05A 1YEJH 1CFQA 1T1WA 4RBPH 4TNVK 2F5AH 4X7CC 2DM7A 5GGTL 4KKAD 4Y5VB 5ESAB 2HAZA 3U30C 4MXVE 5CGTA 1RVFL 1EEYA 5HY9A 2A6IA 3FOMB 5HD8C 4LVHB 5H94A 5L8JB 4PJEB 2AI0L 4JGUA 1G7MB 5EA0L 1C12A 5E8OB 1TCRB 4DVRL 4PJAA 2NLJA 3RDTC 1BBJA 3P40A 4R26H 4QHUB 4FP8H 1RQ5A 4PBXA 2W1NA 4DGIL 2DWDB 1MH5B 1CVRA 2YD8A 2OP4H 1J12A 1YNKH 3MJ9L 4FQ2L 4OLXL 4QWWD 5GRZA 4WHYG 2ZKHL 1OAKH 4F3FA 3BRFA 4M3KB 3RIFK 3MRCB 1HE7A 4PRPA 5AYQA 3R1GL 4DUWA 2NY6B 3G5ZB 4K9EL 4K8RC 4OZIF 1MY7A 1A47A 3AREC 4M5YL 4WVRA 1I7RA 1CGYA 1RMFL 4HBCH 2D3VA 2Q20A 2BHZA 3QCVL 4H8WH 4UAOB 5C9JB 1T21A 3UX9B 4N90E 3ZE2F 5TH2A 1RUAL 2MSPA 1AQKH 3STBA 3RI5F 4HH9B 4ORGB 4S1QH 1HHIB 4G7YL 4JN1H 4K8RD 3S9DB 5J1AA 3V2AR 4G6FD 3LB6D 4G8FB 3IKCA 1QLRB 5IW3A 2BNQE 5C0CD 3PF2A 4XTRD 3UJIH 3O41B 1XF5A 4RQQB 4EDWL 4GQ9H 3V0VB 4RMTA 3ORJA 4Z95L 3UZQA 1GSMA 3TN0D 4K23L 3KNBA 3NIFF 3VGAB 3GO1L 5HGDA 5FCSH 1OTSD 4HD9A 5HPMB 1GPOH 3MNVA 3GRWL 4NHCH 3VH8A 4ZNEE 5C3LD 4MSWB 1P4BL 5HYSG 1UYWL 5BZDB 1J0KA 3QZWG 3TA3B 4LLUA 3P4MB 5GISH 3VD4A 3BISA 5IFHL 1TCRA 2BSTA 3DRQB 1QA9A 1FZOA 2WAHA 3TBTA 1DBMH 3RWJB 1RIVH 2I9LA 3VXUB 5L9DL 5MP6L 4YQXH 2DQDH 1FVCA 3ULUE 1NDGB 1T2XA 2HFEB 5JW5B 4V2CB 2GY7B 2PETA 3TM6A 3WL9A 3BRGC 4LFHG 3T2NH 1HOCB 1DEDA 1RHHA 1VKXA 2LTQC 4JN2A 1QBML 2FGWL 5D7KE 4Y88A 4FA8A 5C0AD 1MRDH 3H9SD 4K7PH 5D7IA 3SE9L 1A6AB 4HC1H 4G43B 3X14B 1T21B 4D8PB 1OB1B 1C16A 4ENED 1PW3A 4PJIE 5DMJB 2F19L 2GK2A 5DD0L 3LB6C 3LN4B 1DCLA 3KG5A 4QXUL 3SDXF 3NZ8B 5B8CB 3U4EA 3OHXB 1X5FA 3QEGH 3SGEI 5I8EB 1LK3L 4LPUA 3UAJC 1B3JA 4WEBL 3ZSSA 1OP5K 1EH9A 4HIIB 4S2SA 3SGKA 1JNNL 4Z5RA 2VQ1B 2ADIA 4S1QL 4XCNA 4XP6L 2V2TB 1J11A 1ITBB 3MACH 2H41A 1CXKA 3BO8A 4K3JH 3WHXA 3QIWA 1T89A 4C54A 1Q9WA 5MERB 4NQDB 4LMQE 1MNUH 5BZDA 2IPKB 5I0ZA 1HNFA 1KJ2H 1HDMB 1HXMA 1MIEL 4Y1AD 3ESVF 2PYFB 5F8RC 4L8SB 3S34L 4I3RH 4OUOA 4H1LB 3FFCA 2AJYH 1HIML 4YX2H 3RL1B 1VADB 3ISWA 5BS0E 1YQ2A 3H9YA 3U2SA 1FORL 1DBJL 3SE8H 3OF6D 3OHXA 5BV7H 3BMWA 3LN5B 4H0IA 5EBMB 5B4MC 5C0BE 3RGVB 5IHUH 3VXQB 1CDIA 3V95A 3RZCC 2AS5M 5MENA 4NP4L 3QI9C 2FZ3B 4ZPVB 1CD1B 1K4DA 3LQZA 2V7NA 4HCRL 1TZIB 1CXIA 3TH2T 1LP9B 4P2OD 1AHWA 5HGAB 5B22A 5L7XH 5ACMA 3FZUC 3T4AB 4TOYL 3T08A 4JM2A 3ZYJA 3UTSE 3D0LB 5DS8A 1KG0A 2IQAB 3STZA 4GKSA 1BREA 1K6QH 3N1QC 5D72L 5F88B 4DQOL 3CX5K 1P7QA 3VXMD 4A6YA 3D3VA 5FM8A 4OLVH 3SOBH 2BOBB 1YEKH 3O3EA 1SJHA 4K3JL 3SDCA 3IGAA 3QCUH 5CCKL 5DHYA 1XCQA 1OWWA 3L7EA 4RMWA 2VRAA 3S3JA 3L9RA 2GJ6A 2BY1A 2HJLA 5AWNL 3KPQA 2P44B 3L3HB 4LSSH 3K4ZA 3WXWH 4L1HA 4KMTL 4GRLD 1RZGB 3BZEB 2BJMH 2PYED 3GIVB 2RR3A 4APQD 4P2RA 1KELH 3CSPA 3TVMC 2ZNWA 3LS4H 1UM4L 1RPQA 5FO9A 3S35X 1NL0H 3MRKB 2IBZX 3HUJA 5HGHB 3UDWA 1S9YA 2VDLL 3G5VB 3LY6A 5F8QC 1IGMH 4KI5D 4CGTA 3EDDA 4PLJD 1CZ8H 4RZCB 1TNNA 4EI5A 2WLZA 1S7RA 1H0DA 3HI1A 3IDNB 1UWEH 4QRRE 3RTQC 1IAKB 3NMEA 2FSEA 4NN5C 4QXTA 5SWSD 4MD5A 5EOTA 5HI5D 2WMPA 3WIIH 1EZVX 1G9ML 3CFIC 5J6HB 1QR1B 3MRDB 1ULVA 4LIQH 1UXSA 4PJCE 4HC1A 2VSCA 4NWUL 4O2CA 4LHUG 5I15L 2HVJA 4GMSL 5E5UB 3L7FA 5IHZB 1ZE3C 2B5IB 5C8JA 2XZQH 1P7KB 4YDVB 1FAIH 3NPSB 2GI7A 5F72S 3P77B 3FJTA 4JRYD 5DD1L 4PJGF 4RZCA 5DLMH 4V1DA 4KVCH 3VXSB 1NCCH 4MWFB 3EJZC 3KPOB 1MRDL 2CPCA 4LCIH 3BFOA 4R7DA 1MAML 4U6VH 2EDQA 4CU7A 1I4FB 2HFGH 1YPZF 3CFDA 4UQ2A 4MLSA 1WBXB 3HAEA 4D0CB 4X9IA 3DX7B 1SJEB 1CFQB 1JWMA 2F54A 2VZUA 4Y5VA 4LNVA 5JXEC 3TYGL 4M00A 5E95B 1DL7L 5IB5A 4YH6A 3D2UA 5HY9B 3EW3B 2EE9A 1SY6A 2EKJA 2VR5A 4XAKE 4V1DB 4TSCH 3VFGL 5BRZB 3O0RH 5T1MB 3C6LD 1LILA 3CDYA 1NBZB 4GKOA 2WINB 5F89B 2HLAB 2RAMA 1GZQB 3O6FD 3BPOB 4XPBL 2DQUH 4M1GH 4HWBA 5FYKL 1W72L 3RY4A 1RU9L 4L4VE 4M1GL 1Q72H 4M7KL 3QUKB 8FABA 2W9LA 1KB5L 2EZ0C 5EB9A 2JLLA 5IVXF 3ZL4H 2VWEC 2A74B 1OQXA 3GGWB 1RZ7H 5IFJA 4WUKH 3X13B 4X8XA 2GK0B 4JRYA 5I1GH 4UT7L 5FA3A 5FO7B 2VXTL 2FB4L 4HGKC 3VXNB 5JIPA 3EFFB 4KU1A 3QXWA 4UNUA 1T0NA 4GRLB 4HWEL 4JDVB 4HH9A 2K3TA 2XQYG 3WNKA 1XIWA 4OZGE 2HLFD 1OP5H 2YWZA 4XNMB 1A7QL 1WZ1L 1NFDF 5FFLA 3DRTB 3QAZC 1FAIL 5KS9F 3B6SB 4NJAH 2ZUXA 3DSNA 5DMGC 2D7TL 3EO9H 4RQQA 3MSPA 4KQ4H 4L4TA 4JZJA 2ITDA 3I6KA 2WLYA 4ODUA 3MMEA 4ZAKC 5SWZA 3DTXB 4LSVH 4PJHA 2DKSA 4LCWB 3BXNB 3GNMH 3HPJA 4UDUB 2H32B 3CXHJ 3HN3A 3VMNA 1PKQE 4QRPD 4X6DA 1LK2B 3ULVC 2HN7A 1OQOA 4P49A 5E6IA 1KLGB 3CPLA 5J12B 1XIWB 5KSVB 5K9KA 1VFMA 5GZOC 3BGAA 2B5IC 5D1XB 1IBGL 1VPOL 2FJFA 4OTXH 2GT9A 3SDXE 2YXMA 4ZOAA 5FUOL 2Z9TA 4KK9D 3O6LL 1HKFA 1YC8A 4KRPC 3VFMB 1VFBB 1T6VN 5A2FA 2I60L 1U8QA 5DJ8A 5IT2H 1JUFA 1TENA 4QNPF 3RWFB 3SO3C 4WHCA 2I07B 1UA6H 2Y7QA 3MV01 4U1LA 3PWUA 1CGVA 3MLSH 3BWAB 3MGOB 1RUPL 4KI5F 2I60H 4KK8D 1QOKA 4BKLA 3WJJA 4CADA 1OAXH 4X6EB 4F9LA 2O5ZL 2QKIB 3LPGA 3MBEC 4ZNCD 1UCBL 2QV2A 4WI2A 2GUOB 3C60A 2YD5A 1YNTA 1QLEL 4J1UB 1HCVA 5KSAB 2FEDD 1ZVYA 1RIHL 4OLUH 2L4OA 5FEBA 3TZVC 1T1WB 1Q9WB 4DK6A 5L8KB 3BKJL 2FECI 3I75A 4XP1L 5E2UL 1NGZA 5I8KL 1NLBL 3DUSB 1Z9LA 4ZFZA 1YJDL 5IB2A 1KYOK 1G7MA 5EC1A 1JPTL 3L95B 4WY7L 1U2HA 3GK8H 2A6IB 4WEUD 4PRIA 2AJUL 3S4SB 4KHXL 3W0WA 3FFDA 5EUKB 4QHMB 2RGSA 4MX7A 1UZ6E 4XCFL 5FGRA 4ZUWA 5DRNB 4JG0L 5CAYB 4H8WC 5HJ3B 1EUTA 5KG9A 4W6YB 3Q48A 3HRZB 1AXTL 2CMRL 5CIPB 3KXFE 5AG9A 4UT6H 3B2VL 4HWZB 2XFXA 4KTDH 4ZUTB 3C8DA 3N85L 2DBLH 3K3QA 3PWJB 1A22B 3RGVC 3OBAA 3WFDH 4HEPG 3TH4T 1ZLWH 1MCQA 2V6HA 1J05B 3OZ9L 3V79C 4XGZB 3KYMA 2DI8A 2DQUL 5GSVB 1YEIL 4MCYA 4DK3A 5KANI 5C08A 3RAJL 4MX7B 3HC4L 4GXVL 1SM3H 1LE9A 5JW3L 3DETC 4K7FA 3GKZA 4ESKA 3CCHB 5K9JL 3PG2A 4G6AC 4YXLL 3VE0A 1CFSA 3MC0A 5DA0B 3CK0H 4LDEB 1L0QA 1HHKB 3MREA 4OJFL 3O2DH 3IFOB 1KB5H 5BRZE 4G9DA 4ZXBC 4RA0C 1RAMA 3Q5TA 5B21A 1QYGL 1FC1A 2Q8BL 2JK5B 1U8HB 3MLXL 2R4RL 1CG9B 4G6JL 4OZGB 2J8UA 5TGBA 1MCKA 4OBSA 3QUYD 1D5BA 2EH8L 4U7SA 3CD4A 2BNRA 3V52L 4KY1L 4NCC1 4L9DA 5F7KC 2J3SA 3TIEA 1J7VR 1UB6A 4HC1L 3GJFA 3VXPB 3CU1A 4E42B 1A6AA 1K8IB 4XAWH 3CC5B 1Z3GL 5DUBB 1TVHA 4JR9H 4LSPL 4RAUA 5JO5A 1Q9LA 3MPCA 2VH5L 3BEWB 1OAYH 2AK4A 4U1SB 3U7YL 4Y4FB 2GITB 2W0PA 2VC2H 1PLGL 3U4EB 3V5HB 2UUDK 2D0FA 1LD9A 2WBJA 4J6RL 4N9OB 5ENWA 4Z7QE 5JW4M 1JZ5A 2V2XB 2NX5D 3D48R 4XXDB 5CEYA 2YR3A 1SQ2N 3NOIA 4OD1L 4Q9RH 3NZ8A 2V17H 1HYSC 3OL2A 2JCCA 5EWIL 4TNWK 3SQOL 1U3JA 5JQ6L 1INQA 2YD2A 2VZVA 4CU6A 3DURA 5GRVK 4S1SL 1JI1A 1VSCA 3VXOA 4QTHA 1YNLL 3RFZC 1ZMYA 4XMLL 4GUPA 3MGAA 2X1PA 4LPXA 3RWCB 1FNAA 1FCCA 4IMKA 2A83A 1MCPH 4D8PA 1BVKB 1D5IL 4J4PC 1FN4A 4QRQA 3MV9A 5MERA 5B3JF 4JFOB 1U8HA 1BF2A 1FGVL 4ONFL 2OR9H 1D6EB 3VGDA 3SE3C 2X4OB 3LRSA 3GSWB 5L8LB 1N0LA 4OLZH 4PIRF 3WFDL 1FSKB 3ZTJG 3N9GL 4ODBD 4CKVX 2QHLA 3B9KB 3ZSTA 2HT3D 3BHBA 1G0XA 3RRQA 4LOUD 1Q0YL 1U3HC 4U31A 3E0GA 1I8IB 4YZFF 3TN0B 3PJSB 4X4XA 1HQ4B 4FQXC 3EFDL 3MV7A 1MWAL 1J8HD 5JPNA 2A77L 3QISA 3BZFB 4LBEB 1MFCH 2F58L 1YDPB 1T7VA 1A4JA 2JIXA 2M2DA 4JFHD 5E8EA 1HINL 4QHUA 4YXKH 1SEBB 1EHLH 1MWAA 4MJ6B 3B9AA 4K8RL 4K9EC 2XRAL 4PRIE 3VW3L 1BM3H 1PX4A 4PJ7F 1G6RA 3TV3L 4OCNC 4N0CC 2E7BA 4YGVB 3GUTB 1MCOH 4K71B 2PXYB 2VQTA 3ECBB 5B3JE 4F3FB 1UM6L 2EDLA 1YMME 5EG6C 3FHAA 5FM4A 1FFNB 3HC0A 3MV8D 3H42L 4HKJA 1D5ZA 5MI0B 4OFIA 1AIFB 3FQUA 5DR5H 1T03L 3QDGB 1E28A 3T1WA 3T1FB 5GRWA 5E08L 4LLWA 3MUY1 2HH0L 4OCXL 1I1AD 3GMPB 3W9EB 4EN3A 1RJZB 3S34H 3HC3H 4GG6B 3QAZB 1UXWB 4Z9KB 2HA1A 1QBLH 5MENE 4XWOC 1VERA 3JTSB 1FIEA 2XKNA 4LDOB 5JW4Q 2MHAB 1AR1D 1D5XB 3G6DH 2HT4C 2IGFH 3G08A 4XP6H 4I18B 1UB5A 3QZWA 4XP1H 5E2UH 1S7UA 3VDCA 1H3PH 2XICA 5ALCH 1ZHLA 4S1RH 3IU4L 3E3QC 3FQRA 4K2UH 4PY8J 5AZ2H 3DV6A 3TNNB 1MLCA 4AQ1B 3CDCA 1LNUB 2BRQA 4YDJB 1J1PL 4I48B 1EJ6A 5HGHA 4K3EL 2A2QT 3GIZL 4MNQD 1X3DA 2H1PL 1PKQA 2XXCB 2YZ1A 5J6GA 3IFPB 1AGBA 4Y1AE 5AUMB 2R2BB 2P7TB 1A5FL 1P7KA 4N8CH 3VCLB 4GAFB 1QBMH 5F93C 1QFWL 1WIOA 1FFOA 1DN2A 5LWYL 4ELMA 1R3KB 5EIVA 5D7IB 2VLRB 3C8HA 4TVSa 5C70A 3HAEB 4U6HB 1G1CA 1MIMH 1CICD 4UIKH 2DYPB 2QQKL 4OIIH 5CSZB 5DD0H 3D18B 5F96L 4K3DL 3W9DA 4TUJB 2FIKB 1GVIA 4LCYB 4MAYA 1EVTC 2R0WL 2NXYD 1B0GA 1NFDA 3I50L 1F13A 1UQSA 4KI1A 1T0MA 3NCEB 5BO1L 2FHFA 3FQNB 3KPNB 1QFUL 5AD0B 1WGOA 1NGPL 4Y16D 1KCSH 2R23A 3P4OA 2AJVH 5GIRA 2BNQA 1Y0LA 3KVQA 1NMAH 1XF4A 1ZT1A 4YHYC 4KJPC 1L7IH 3GMOB 5DJ2B 5DSCA 2ZCKL 4IRJB 1X5YA 5D1QB 1K3ZA 3WJLA 1T20A 1ZT7A 1FO0H 4ZXBD 3V7AG 1JPFB 1KB9K 4FQJH 3T0EC 4LF3B 4PRPD 3LHPH 2VDML 4LHJB 3MRGA 4HX1B 4U1HB 3BPLB 4PJ5D 4FZ8L 5GGSY 1MEXH 2JCCF 5KZCB 4Y4HD 3CSGA 3MA7B 4WHDA 1MVUB 4LSRL 4WO4B 1UH2A 5EU4B 3EFFA 3KYMB 2VDMH 5JXAH 1QSFD 1YYLH 4Q74A 5C08B 4AMKL 2UY6A 5KBNC 2YPVH 4EI6A 4Q9CA 4P5MB 1NLDL 1VDGA 3FAWA 4PG2A 4X4ZA 1OP3H 1JGVL 4XXCC 3OKOA 2ENSA 1UACL 1IC4H 4XMKL 5GS2D 1CFTB 2W07A 3C87A 2OCFD 4OCRL 3BKJH 2UWEA 4IRSA 3O3EB 3H9HB 4QY8B 4F58H 3SGDI 2DOCA 2F8OA 4CL7A 1W0VB 1MJJA 1RIHH 4OLUL 2FX8H 4MJIB 4PGEB 1AFVH 1EBPA 4NQED 4P5TB 2V7HB 4NYLB 4NQEA 1BZ9B 3SN6N 1AGCB 2BK8A 3ZDXF 1HKLL 3G5XB 3K1DA 4OI8A 4C57C 5D1XA 3NIDE 4YXHL 1JGUH 4PBVC 4HIHB 2D7OA 4MQXD 4HSQA 1YYML 4OFYA 4CN4A 1ZANL 4L9LC 2R0LH 2F54E 2A6JB 3RWFA 1G9MC 5DQDH 3MRJA 3WFHB 1GIGH 5EBLA 3JWDH 2BSRB 2CO6B 1DQMH 4P4KC 43CAA 2QHRH 3P4NA 4WW2A 4OGAC 3FQWA 1UGNA 4X98B 2MCG1 2CGRL 1KELL 2GUOA 3C60B 4WGWB 1AY1L 2W65B 4JDTL 4XVTL 1H9VA 2NXYB 2XN9D 3FQXA 4IRZH 3MOQA 3SBWC 3QQNA 3UYRH 3DYOA 1UXSB 2NZ9C 3QUMA 3KHQA 2DLHA 4F7CA 2HWZH 3NZHH 4Z8FL 2BVYA 4N0CD 1ZWIB 3QHZH 3QHFH 1S9WB 4PJFA 5IW1A 4UDTB 3QXTA 4X99B 3QWOB 2ZSWA 3ES6B 1RJYB 1F90H 4OAWB 2JKXA 1IT9H 1BAFL 4Y5XC 1S78C 3QIUD 4NIKB 3VWKC 3MRMA 3QUYB 4JAMB 4Y1AA 5DEFB 3V9FA 1H5BB 4F15B 1S5IH 4R8WL 4PJCA 3EO0B 1VB9A 4ONHB 3O9WC 5E08H 4FQXD 3RZCA 1E4KC 3OAYK 5GS0C 5T33L 4JY4B 3O81A 5ITBH 1DQLH 3CFBB 1RZKL 1XGYH 4YK4B 3RTQD 4YAQB 5GJSH 4NQUA 1V7NL 4C55A 1I7RB 1NDMB 3O3DA 4NP4H 5DHVA 1KN2L 3MOAL 1MHPL 4FQIL 2VXQL 1I7UB 3WV0A 1QR4A 4GKNA 2G60L 4PG9B 1D7FA 5LGKA 3QFJE 3HUJF 1NAMA 4OKVA 1B4JH 1BD2E 3MZTA 4ZPTA 2CO7B 3MRIA 4QCIB 3ULVE 2ADFH 4AH2A 3FFDB 3FN0L 4TSBH 3C2AL 1YPZA 1GZQA 3FO2A 3GKWL 3TBYA 3W5NA 4DGYL 5DQ9B 4F57H 4QRPE 5H37G 3SGDH 5FECA 1P9MC 4P2CG 4N8VG 2VXUH 3G6AB 3CGTA 4WENB 1CGSL 1NDMA 1UT9A 2NY1B 1DLFH 4HLZG 5C1MB 2VITB 4L3EB 5EOCJ 1XGUB 4E41E 2XWJB 1FYHB 3K8MA 4M6OH 1FYTE 2YPLA 4NRXA 1P84J 3DIFA 4U1KA 2JTDA 6FABH 3RWHB 3AAZA 4Q7DA 5BV7L 1FL6B 3X17A 5EDXA 4PJXE 4PJGB 1VEOA 4NUGL 3MA9L 4OCSH 4ZS6D 1ED3A 2X1QA 4UIMA 2IPTH 3S3SA 3VFTA 4YHOL 4M6AA 1HILA 2BC4A 5D2LE 4N68A 2NY5C 1OAYL 3PP4L 4OZHB 4QRRB 5DUPH 5KS9B 5C0CA 3MRBB 5D1ZA 1U8LB 3QIWB 3BP7A 3IAGC 3PDOB 3C60D 1EGJL 3I02B 3JV6A 3IVKA 4F37F 4CBPA 2XWJA 2A38A 1FNLA 3T2NL 5JDSA 2ARJB 3P0YL 4A2MA 3AAZB 5D1QC 4WI8A 5SWQB 5FDWB 4XNXH 4NQDE 2NY4B 1DLHA 4PR5B 4JANB 4CNIB 4Z77B 3DURB 3FKUS 3NPSC 3IETA 2ESVA 1AI1L 4JPIA 3VXPA 3O8XD 2DQFB 3G6JF 1GHFH 4KK8C 3FB6B 2NY6D 5EZIL 1VFAB 4NC1E 4JREB 4UILH 5IMLB 4MGXA 2I24N 1OP3K 3H3PL 4P3DA 4NNXB 4NUGH 2W0LA 4DCQA 4ELKA 2YKLH 3GMMB 1O7VA 2F8XC 3QDMA 3JWOC 2VLRD 2R2HA 4XPFL 1Z6JT 3V4UH 5D7IE 4JRYE 4NJ9L 1OF2B 1HH9A 4G5ZH 4PS4H 3FT3A 3MLXH 4JFQB 5JIKA 3GB7B 1OSPL 4UIMB 4NKQB 5JR1H 2QEJA 3VFNB 6FABL 4KVNH 4R90L 5BJTB 4Y2DA 2R23B 5LCVH 2EDDA 3H7BA 4Z78A 2A0LC 5I75B 4GMTL 4YO0A 4PD4K 3GO1H 4PYHA 3WNLA 5JOFA 4ZS6C 1ADQL 1RZJC 4Y16B 3L5XH 5EN2A 4XB8A 2G2RB 1S7XA 3F6LA 1UH4A 2CIIA 3F58L 4HJJH 4YHLH 4H26B 3QULA 3NCJL 1KGCD 4PJ7A 5CWSA 1IGJA 3N1GC 4I3SL 3TPUB 5L0QC 1L9MA 4DGVL 2OK0H 2AK1L 3LEVL 2Q7YA 5BVJA 3S36L 1UM5L 1JNLH 2CDGA 2FBOJ 4PRPB 1JPSH 4U6VL 1IM9B 2PR4H 3DOSA 1BFOB 4PP1D 1I8KB 3B2VH 4PBWD 3U0WL 2Y06L 1CIUA 1V8HA 1DQLL 1MAJA 2X4QB 5IMLA 2JB5L 1F97A 2VERN 1ZLSL 3MYJA 1SEQL 5KSAC 2UWEF 4PJ8A 3RUGF 3T0XA 5HHOA 4KMLB 1C8PA 3WEXB 4KDWA 3ARPA 3ET9F 3L5XL 4Y4FD 1EJOL 4HWNA 5KSBA 4YNYA 1BMGA 4CVWA 2Y5TA 4XXCA 3UJJL 3D69A 3PXHA 1S5IL 2VXVL 4DVRH 2XKSA 4JE4B 4F7MA 1JBJA 1KIRA 5A16B 2PW1A 3QZWB 3IRZA 1FNFA 2DD8L 4XZUB 3DVNB 4G3YL 1RUQH 5C92A 1E4JA 4GG8A 1MHCB 2DM2A 2DMKA 2HWZL 3JTTB 2EKSA 5DD6A 5BQ7A 2A9MH 1PG7L 4YHKH 4H20L 1KJ3H 2X4RB 2FCBA 3QJFB 4OM0L 5T3XD 4HIHA 3GMPA 4XNZB 3H3PH 1CT8A 3WDJA 3WEXA 4P46D 3CVHL 4FXGA 5CMAB 3U36B 4HUWB 5C0NC 5GGVH 1OT2A 1L9NA 4JM4H 5KAQG 2JIXD 2VZTA 1JYXA 4NO0A 4YWGL 3X3FL 5C0RL 3RVVD 1IGIH 1ZGLA 3W0WE 4BFIB 4P2QD 4B53A 4UV4L 1BFSA 1JHKL 5DJDB 4Y5VC 2UZXB 3FT4A 5JXEA 1HHHB 4ZAKB 4HIJB 3CFCH 1ZANH 3TBVA 4IDLA 3PGDB 2DQDL 5IB3A 3KLSA 4P2OB 5TFSL 3VXUD 1UM5H 1NC4D 1E6JL 1WFUA 1YY8B 2X89A 5EOCL 2RQ8A 2DJSA 3ZLQC 3O11B 4LLMB 3BZDA 3EYVA 4DN4L 5M7QA 5MHSE 1DVFC 1BVLB 5IROC 5CJXA 1KEGH 5DJCA 1P69B 4MDIA 4Z7UB 5T5FL 1S9YB 3G5VA 5JZ7C 4J3UA 3LPWA 4LKCA 4JB9H 3VXNA 5HPOA 4OFYD 5FAAA 4MJID 1FVEA 5GSRB 4OD3H 3LKPA 3QDHA 3ZDZF 2EC9U 4WFED 4RFEB 3L1OH 2CRYA 4MA3A 4F7EA 3P9MA 3PDGA 4LL9A 4UU9B 1IKNA 4RNRB 2CDEB 2PW2B 2YZ8A 15C8H 3MV8B 5KN5A 1WIPA 2BHUA 1XR9A 4RGMB 4TNVF 1E4XH 5DJ2A 5DSCB 2A83B 5CP3A 4HKXB 3QUZB 2VISB 3CZFA 4KKLD 1WBYB 1WAAA 2FBJH 3G5YB 2ZG3A 1E4KA 4OD2B 2BSSB 1IKFL 1ES0A 3O2DA 3O4LE 4U0RB 4WHYH 4X6FA 5A2KH 1PY4A 4WGVB 4DKEH 1CBVL 4NKOB 4H8WL 1CYGA 3KXFB 4JHWL 4MD0A 1NFDE 4MDIB 1KTKE 4P57B 3GHBH 2XNAA 1R3IL 1IC5H 1MWAH 2ZOKA 1UQSB 4LU5H 4JHBA 1GGBH 3D39E 1BJMA 1NANI 1Q1JL 1YZZA 2ED9A 3B3IB 4LU5L 5FK9B 3MO1B 4E0RB 4KWUA 4UI2A 1H3UA 2AK4D 5T1LB 1NAKH 1HHGA 1TZIA 2ZCHL 1IVLA 1IC7H 5A43C 5I1LA 1WFNA 4GS7C 2WP3O 4S10A 1T5WB 1Y6KR 1NCUA 1VGKB 3LRGA 5BVPH 3UO1L 5A1AA 1EO5A 3C5ZD 3QA3B 4NHUA 2E6JA 1YUHA 4DAGL 1OD9A 4NBXB 1QQDB 4AYFA 1A1OB 3EYOA 3HG1D 3G04A 2J6EL 3VXTA 5FHBH 3C5JA 1OGAA 4PJ8C 3U79A 2Y1VA 1TVDA 2JJTC 4GAYB 3HNVL 3DUUB 1F4WH 4HXBL 4PRDA 1HN1A 1NKRA 3HG1E 5D2LB 5ILTH 2WINA 4XBEH 1FDLL 3AS3A 1FBIL 1N6QL 2IAND 3LD8C 4ZOCA 1SMAA 3VXMB 2BDNL 5E99L 5F96H 1LWRA 1KJ2A 3MZGB 1P7QD 1S3KH 4XRCA 4YBHA 5DK0B 4JKLA 1DBAH 1VGEL 5B8CC 4I9WE 1R5WB 2YMXH 3CH1A 5C0CB 4GAGL 1SVZA 4U7MA 3KLAB 1G1YA 1EDQA 1K2DB 2A6JA 1JK8B 4JKPL 1WC7A 3CMOL 1FZJB 3HE7A 4GRMA 5JIHA 3VXTB 3JBG7 3NZHL 4LASH 4ONGH 1ONQB 3RL2B 3VI3F 2YPKB 4PV9B 4MS8D 4JFZL 3JV4B 3QIBD 2EIZB 3PWPD 4K23H 4MXQC 1MJUL 4ZO9A 4PLOB 5D7IF 1CZ8L 4XC3L 5F9OH 3UJIL 3C5SA 2VZSA 5D2LA 2AEPH 1S9XB 5CEZE 1XAUA 1Y6NR 1LGVA 3JUYA 4O5LL 4ZSOA 5DD5H 3GSUB 3BQUD 2GTZB 4GBXC 2IH1B 5KVMC 2R2EA 1IGFH 5D1QD 4YHIB 1KIQB 4JDZA 2NY4D 2VKWA 4NZDA 4GBXD 3K4DA 2RB8A 4U6XA 1SYSB 1XGPA 5IOPB 4YFLI 2VE6B 4FTVB 3B8SA 5C0AB 2NTFA 1A4KA 4JFDD 2X4SA 2Z4QB 5B3NA 3GBMH 5JW4N 4U2ZA 2A73A 5DO2D 2RCSL 1IGTB 1C1EL 4M6NL 2NR6C 2UY7A 5IWLC 4YUEH 1T2QL 1AJ7L 1I9RH 4QRTB 3BOVA 2J8OA 1UCTA 1TPXB 3MGTB 1IQWL 2X10A 5C0FA 2R1YA 3W9DB 1AD0A 4ZSOB 1BJ8A 5HHQA 3B8YA 4P23B 2NR6D 3CFBA 1EUUA 4L8BA 4Y2DC 4KAQH 3T3ME 4WU5A 3GSXA 5ISZD 1M1SA 3SJVB 4WDIA 3V5KA 3QYCA 4XNQB 3LOWA 1JL8A 1JZ4A 4ZPTB 4X7TB 3L5WA 1A7OL 5C09D 5C0AA 1II4E 3OWEA 2HLAA 5GGTH 5TE4L 5TQ2L 4HXAL 4Y1AB 2YOCA 1S9KC 2BXZA 3BH9A 3BPCB 3MLWL 2CH8A 3DX8B 4GW4A 3QNXA 1OGTA 5E1AB 3EKCA 3GMOA 1A7QH 1WZ1H 2E7CA 5H35B 4I3RL 2HKFL 1NBQA 3FB7A 4OB5H 5TE4H 5KSAA 32C2B 3KPMB 5ESVB 4ODVH 5HDBF 3F7QA 4GRWB 4R4FL 2DQIH 4KDTA 1T7XA 3PGCA 2F9BT 3BW9B 4YDLB 3S5LA 1C12B 1P6AB 1AHWC 4G8EA 2OSLA 1JN6B 1Q72L 3RWDB 2XPGA 2V2XA 1JGDB 5KVFL 1AE6H 1DQTA 5HTSA 4G5ZL 4PS4L 4P5KB 3WN5C 1XGQA 4H5SA 2JCCB 4LVEA 3SDAA 4WI7A 2E7HA 1JGEA 4KK6D 1MNUL 2QHRL 4JO3H 4PYGA 4GXUN 3DVNA 2KL6A 1AO7B 4NOBA 1CXLA 1IAOB 3IDJA 3NCMA 3VWKD 1XIWD 4YHYB 2ZJSH 5C2UB 5GGQL 3SJVA 4QY8A 5IBLD 2FGWH 3QCTH 3UYPA 2H3NA 1CFNB 2P24B 4M9OA 1XGRB 5C0BD 2EIDA 1W72B 3KHOA 4WFEE 1PY9A 3V4PH 5E5MB 4XNXL 3QUZC 2CR6A 4JFEE 5GRXG 2V5MA 3FB5B 3BPCA 2GT9B 3EYQC 3QXDA 1JGDA 1WIUA 3HNTL 3DX8A 4GW4B 4JRWA 3VJ6A 1FYTB 4F33B 1UJ3A 3WNNA 3G6JA 1G7QB 4GH7B 4HS8H 2R0KH 4PV8A 2XTLA 4NN6B 32C2A 2AXGA 1JFQL 4HKBA 4HK0A 3NN8B 1AI1H 5AAMA 4QOKA 3AUVA 3BI9X 2J6EH 3I9GH 1K5NA 4POZD 4DTGL 4Q9QH 4Z7QF 2XZCL 2OTUA 2PO6A 1MLBA 1U58B 5IFAH 1I7ZB 5J1AB 1X6LA 4HPYH 4TPRH 3HE6A 4BK5A 1RUML 1FVCB 5L88L 3LN9A 3SDAD 5GISL 2ADGA 4FMFA 1D5BB 1FBIH 1U93B 2ZJSL 4LVNB 1HOCA 3IFLL 3H7BB 3P30H 4PJ7E 4HULB 2DQHL 1VA9A 3E8UH 3PGFH 4YO0B 1CL7L 2AJZA 4UZGA 1TJHL 1FFNA 1X9QA 5IUSA 2FWOB 4HKBB 3R8BB 2BRRL 4Z0BH 3CLFL 4JFFA 2ADJB 5J12C 4AL8L 1LE5A 3O9WD 1ZGLM 1YN6B 1FZOB 3TBTB 4LQ1A 1HI6A 1K5NB 5I1IH 3H0TB 4IS6B 2OTUB 2PO6B 3RKDD 4NM8L 1FE8H 4L29B 4ELME 3EYUH 5JLZB 5TDPB 2HRPL 3KAAA 4I0PA 2EYRA 1A7PL 1HXYB 3EO0A 4ONHA 1GGCH 3OPZH 1CCZA 4G8IA 2NW3A 5K9QG 3SKUD 5EBMA 2BFVL 5ITFA 5DTFA 4M61A 1BX2A 3FO0L 1WEJL 1KN2H 1RVFH 3GSRB 1R3IH 4JG0H 4ONOA 5IGXH 1BQHB 1EO8H 3A6OA 1EAJA 1A3LL 1YEJL 5KSUB 4ZFFA 2DM3A 4OGAD 4PJAB 1A6WL 1UCBH 2IQ9H 4ISVB 3L3OA 7FABH 4CN6A 4AJ0A 4LLYB 3LRSB 5IVZB 3QUXC 2DWDA 4JHAL 4WY7H 4NGHL 3A0OA 3C5ZB 3PHQA 1PG7X 3T0EE 5AZ2L 5KSBB 2JCCE 2AVGA 1Q0YH 5F9WB 4P2YA 5EO1A 3A67L 1VENA 2E9IA 4R7DB 3SCMD 2R15A 5IR1B 1KTDA 3LQZB 3ZE1E 5ICXB 25C8L 4G9FA 1BEYH 4GRWF 4EQ3A 4JKMA 1VACA 3MREB 1JHLH 2WSKA 3WXVL 5MEOA 4U6HA 3DV6B 5DD5L 3TNNA 1IQDB 4WV1C 3UPCA 5L2JB 2YPLE 3HMWL 3V6BR 2ESVD 3O6KL 1NCTA 3KXFD 5HHXH 1C7SA 5JLZA 1FL6A 3RA7L 5IESH 1AXSB 2B1HH 3PL6D 1E27A 4NRYA 5E03A 2HT4D 2JJVA 2X9YA 4N8VA 5DRZB 1U8KB 3HMWH 1U91A 1H3WM 1U92A 3HCVB 3MV7D 5SWZE 3QB7C 4R97C 2HFFB 2X9XA 5DMIH 1CICC 2C9AA 5E4EB 4O51A 5K33A 5IBUB 3L9RB 4D0DB 1MFBH 5EWIH 4XZUA 2MCPL 1N2RB 5HYSA 2LE9A 4PJXB 4HWBH 4QRPB 1B0RB 1UWXK 2GITA 3ULVL 4N0UB 4N9GA 4ZFFB 3OJDB 5DT1L 3IDIB 5BMFL 1PEWA 4K94C 2G9HB 3IB4A 5KOVC 5DJCB 2VLLA 4PP2B 2Y6SC 2GK0A 4NQCA 3VRIB 2W91A 2BOBA 5F6IC 2R8SH 2X1XR 1A6TA 3ME0A 2PCPA 1AFVL 2Y07H 3SO5A 1EAPA 1J0HA 3P73B 3T65A 4HMCA 3UP1A 5EU4A 4N0FA 4LQFL 4MNQA 4NKMB 3S35L 3GSOB 1B88A 4O58L 4PB0L 4FTVD 1QEWA 3GSNB 2A0LD 3PGDA 5IB3B 2MNUA 4XBEL 5ANMA 2R4RH 4WFFD 2AAVA 2BZDA 3WN5B 1XGTB 4XWOD 3QCTL 4XBGB 1EJOH 3HNVH 4C56B 3GMNA 3U7AA 4JQIH 1JF1A 1EO8L 1HH9B 1UJTA 3BUTA 1OHQA 4GG6F 1G6RL 1C7TA 1G6RH 4ZTOH 2NXYC 4X9HA 1Y6MR 5IB1B 4KPHH 4Q58C 4R90H 3HR5B 4CMMB 1NKOA 5EU5A 3S5LG 2V2TA 5TE7L 4QT5A 4I2XB 3UJTH 5J57B 3VCLA 5ALBL 4RFNB 4L4TD 1IILE 4JFDA 5BVPL 2C5DC 3S4SG 4OCWL 3IFLH 1R3KA 5KN5B 4M7LL 5KVDL 3BDYL 1A6PA 4DGVH 2OK0L 3GSNH 3HPLA 5TDNB 1FE8L 5FGBA 4NDMB 3QPXH 5LXGL 3P9LB 1I7TB 5BV7B 1D6VL 5F3BA 1IC5L 3VXSA 1HEZB 1KJ2L 1IEBB 3QFJB 1QQDA 3SKNA 3MRNB 3WD5H 4WCYL 2XZAL 2BVQA 4DKEL 4BSVA 3RWDA 2AV7A 3MX0A 2X4TA 4QHKI 1TTGA 5C09A 4O9HL 5CJ5A 5IHBA 1XGQB 1YNTB 4WTXA 2BY3A 5HVFB 4JGMA 2ZCKH 1KBGH 2EYTA 4I13B 3KJ6L 5HDLA 5B38B 3PQYE 3WIFB 4DW2L 4N5UA 5CD3A 5IW6B 2H26B 5FYLH 3LS5H 1NCDL 2BY0A 1RK1A 1W0YT 2Q1EA 3C6LC 4UIKL 3GMNB 4XP4L 4M8QB 1WVZA 1UC6A 4KUZH 5D9SA 3O6ML 1DQDL 3N0PB 1U8JB 4HUUB 3KS0H 4XCEA 4N5ED 1KIRB 2OMNA 1AGDA 1I8LC 2NMSA 3KPRA 4LCWA 1MVUA 3DUUA 4XAKD 2YRPA 5FOBB 1CXHA 1BFTA 3KPSD 4Z7WE 1G7QA 3V5DB 3QDJE 5ICYA 1X5AA 1AQDA 4N0UE 5DJAB 1MFDL 4HAGA 4YHIA 5E2TL 1MHHA 4OGZA 4IDJH 1CLOH 4L4VB 1I1YA 4J3XA 2Y5EA 5F9DC 3CVIH 3O2DL 4JG1L 2OI9B 3U9PH 1CTNA 2CXGA 1CFTA 3PWJA 3FO9A 2VE6A 4YEEA 2DQIL 4ELMF 2X4SB 5D93B 4BFIA 4DJMA 3BGFC 3N85H 1F3DJ 3VFWA 2E8YA 3UTZA 2X4TB 1QBLL 2GSGB 4YE4L 4JHWH 1EFQA 3TBVB 3OX8A 3WIHL 4NQVB 5E4EC 3T3PF 2DBJA 3WFBL 1S9XA 2R1YB 4HZLA 1B4JL 3AS1A 4MCZB 1RULH 3SDDD 5FXCH 2F8VA 1U3HA 5TJWK 4MJIE 4ZUVA 4CMHC 4KZDH 4P23A 2UWEE 2W9EL 4HUUA 4LCCB 1KLUA 4KI5C 3DUSA 3RBGA 2X6MA 3NH7H 1U95B 5CKGA 2V9RA 5KSBE 3JVGA 3DXAE 5I66B 1RURL 2B39A 4K8RH 3ZKXB 1U8PA 4G6ML 1LO5A 4NJAL 3W0WB 4OCYH 1E6OL 1BLNB 2NZ9D 2ID5A 1S8DB 3DVGB 2GTWA 5KVEH 2C1PB 4LLDB 4BH7A 1KPUA 5C0IA 5SWSE 1RUKH 4Q9BA 1XZ0A 4ODHL 3H42H 4RMVA 2AJUH 2BCKB 3QEHA 1KUMA 1SJXA 4D9QE 2P42B 5IEKA 3PNWA 1A7RH 1U3HB 1ZSDB 3S5LB 5CJBA 3D9AH 4X99A 4I8DA 4GFTB 4N90D 3R06B 3S88L 3NCJH 1H3GA 4F7PB 5GGTA 3QIBB 2XOTA 4FFWC 4NM4H 2D9QB 1QKZH 1QLEH 4EN3C 4OZFA 5EIQA 2Z92B 4P2OC 3QJHA 2EE2A 4NCC2 5FUOH 2PTTB 3QNXB 3ZYIA 3C6SA 3QUMH 5KS9A 5IB4A 5JA8B 3EYSH 3MACL 4CJ1A 4PJ5B 3BP7B 4KJWD 5CD5D 5F1SA 2IC2A 4ZUVB 2ZUVA 3TIDA 3MRLA 1C16B 3VG0H 3GNML 4GBXB 1MJJB 1UZ8B 3NVQA 4NO5A 5EU3B 3PUCA 2ZP0T 3D1MC 4NYLA 3OKNB 1NAMB 4OKVB 3MFFA 2CXKA 3IKKA 4L9LB 3RWJA 3ULVD 3MRIB 3PQYB 3RVWC 5F1IB 4WEBH 2EDXA 5DUML 2DIAA 1I1AB 2HFEA 1G7LB 4BZ2L 1DVFA 4NBZB 4H25A 3HLAA 3RNQB 1S5HA 1ETZA 4ODUB 5J1SC 1PQZB 3LKOA 4F80A 3VD5A 1HQ4A 3JV5A 3F12A 5GXBB 5I2IA 1CD0A 5HHNB 3IDGA 3TJEL 1PJ9A 4X5XA 3BPOC 4G9DB 5EN2B 4PD4J 1J05A 2CK0L 2XN9B 2XXMB 4QOKB 2ZUQB 3BT2L 1DDHA 2I26N 1XGRA 1KC5H 3BT2H 1FQ9C 4JFQA 5BS0A 1U8NA 3X3GH 4RMRA 4DAGH 2DI7A 3EZJB 3PL6A 3LN5A 1ZEAH 4MZ2A 5CS7A 2Q8BH 1QVOB 1I1AA 2VDPH 3G6JB 1ZLUK 3PE9A 3QCVH 1FCGA 4MNQB 5F7NC 4OI9A 4ODVL 3UTQA 5K93A 1J86A 2K7QA 4OQTL 3RNQA 1HXMB 5HVGB 3CJJA 4YHZL 3MCLH 4P4RA 1AXIB 4Y89A 4UBDD 3W0WD 1CDJA 5EU3A 1FGNH 4UAOC 3MJ9H 4KJQD 1MJ8L 3IVKB 4K3HA 2F53E 3SE4C 3DXAB 5FGBC 2NLJB 1TQBB 5INCA 5L6YL 1GOFA 1FH5H 2R2CA 4RGOL 4XCYA 3MXWL 4XB7A 5F70A 2N4IA 1ACYL 4OZHF 1HXYA 2AW2A 1B90A 3R1GH 1Q1JH 1XCTB 4UILL 2NY3B 5JXED 4HBCL 4F57L 2I9TA 3IDXL 5IB2B 5DTFB 4UT6L 4A2LA 4KVCL 4GKSB 1J1OH 5TDNA 4R2GB 4HGWA 4F9PC 3FN0H 4TSBL 5E8PA 2I27N 4ISVA 4WFHE 3HB3C 4FQ2H 5L7XL 4G7VH 4FXGB 5TDPA 5J6GB 1RFDL 1KEML 3WLBA 1IAIH 2XKUA 2YA0A 1IT9L 4R26L 4ZXBB 5LWYH 3IDNA 2HMID 3GK8L 2VLJD 2CKBA 3UBXG 5C07A 3FB7B 5CUSL 2AXJA 4JFFE 5FYLE 1IGFL 1ZHKB 1JV5A 1QSFE 1ERNA 2V2WB 2Z8VC 4P48A 4F7TA 2QQNH 4JFYA 4OLEA 3AS0A 1R3LB 4M93C 4R0LA 2BOCB 1AJ7H 1I9RL 2FGZA 4UQ3A 3T4YB 3TCLB 3IU4H 3SKJL 4H26A 2VDRH 4HHAB 3VGFA 3LEYL 2DQGL 4AG4H 2H6PA 2HYMA 4WWID 4CU8A 3DX6B 3CUPB 3BZ4B 3KLHC 1S7RB 2PXYA 1CFSB 1EEZA 3K74B 4O00A 2WIIA 3AXLB 5EZOL 3HC0B 3MLUH 3KJ4C 5JPNB 3TJHD 4I18A 4YXHH 1AIFA 5DMKA 1LK3H 5HYQA 2AJXL 4PJFE 4JFXB 1L6XA 4Q6YA 1ZT7B 1C5CL 2G9HA 2JK5A 1UM4H 3TF7C 3QWQB 5IJKA 4G42A 3LKPB 4YGVA 4OM1H 3ARDD 3RWEB 4W70A 3DWTA 2YBRB 3BPNC 2XT1B 2PCPB 2FJHA 3LKSA 3LSOA 4HKJB 2IAMB 3MJGX 4NQXB 4X80L 1UJ3C 4KXZH 4HKXA 4EKXA 2P8LA 1A1NB 4X9GA 1WF5A 1ZT4B 1RIUL 5A2LH 3UPAA 2X7LA 3QDJD 4KQ3H 3SBWA 5DJXA 3BUYB 4A6YH 1N6VA 3FFCB 2X5PA 2VDKH 3X11A 5JHDD 4JJ5A 5C7XH 3VRIA 1ZKAA 1N5YL 4HQQL 1A64A 4FQXA 4EOWH 3RZCD 5E9DA 3V4VL 2Z93B 4DUXA 4KUZL 3SDDB 1JGLH 4RRPA 2CRIA 2ITCB 4FZEH 1NBZA 3OKDB 4Y2DB 4HWEH 2VLKD 4TTDD 1CK0L 3E8UL 3PGFL 3QO1B 4YZFE 3HMXH 2AEWA 3Q5YA 4ZS7L 5T1MA 1ORQA 5GS1A 1E0OB 2PYEA 1MAKA 1QSED 3RI5K 1P5UA 3NA9H 5AEAA 1ZTXH 3IXAB 5GS3A 3EO9L 5C0GA 1TETH 4APQA 2GSIB 4D3CH 4M7LH 3BH8A 2P5EE 1PX3A 3KPPA 5E5RB 1BFVL 4IS6A 4I48A 5TQ0H 5F7WC 2R1WB 4BSWA 1UZ6F 4ZFOB 1FP5A 3MBED 4WCYH 4M5YH 3ZKNC 1NAKL 4FG6D 2JJUA 3T3MF 2YKLL 1CDYA 3DVIA 1G7JA 1FL5A 2ZOLA 2XQYK 1RZIB 4ZFGL 1I7TA 5HBBA 4PLKD 1NC4A 5D7SH 2FJHB 2NX5E 4WUKL 5E6IB 2CUIA 4JCLA 5EU5B 3GSVA 1PZUB 2R0WH 3QQ9D 3UTOA 5ANME 4DN4H 2K7PA 1FNEA 4KRLB 4X6BB 3CDGB 1RUMH 1A2YA 1CU4L 4Z7OE 3U4AA 4JEGB 1YY9D 5JUEH 3V4UL 1OAQL 1WBZA 1X44A 2DQEL 1CDGA 1UVQA 5F9WC 1QLFB 1NC2B 5I18L 4RA3A 4OV6F 1L6ZA 2CK0H 2EC9T 4LAQL 3DTXA 3L5IA 3SKMA 2YC1A 1ND0B 5HDQH 2D7MA 3RPIA 3HI1B 5E6YA 1KNOA 4PRBA 3B9DA 5DEFA 5FCUH 5T33H 1GPOL 2B20A 1M05B 1KXQE 5JA9A 3OR7A 5T1LA 1NCWH 4XMKH 3TVMA 4XHQA 4X6BA 4C83A 1AD9A 5ID0B 2LVEA 4AEIL 1JZ3A 3HUJB 1O5DT 1F90L 2H26A 4P2QB 5ALCL 2AEQL 4GXUM 1LO2H 1G9EA 1FG2B 3UAJD 3TEUA 4ZO7A 1I1YB 1T1XA 1IZJA 2CD0A 4JN1L 3TN0C 1NGZB 4FABH 3N50A 5FHAH 5FUCC 4M93B 4E41A 1KIPB 1KV3A 5D1ZC 2XI9A 4X4ME 3K8LA 1OCWL 4P0DA 3BKCL 4O51B 3WD5L 4ORGA 5DC9B 1T22A 3S96A 1GGUA 5EBLB 3JUZA 5FA4A 4EUPG 4FMKA 2EXWD 4X6EA 5DWUL 4AEEA 4HG4J 4PFEA 3LKRA 4M6ML 2CDFA 3PL6C 1FVDA 1BOGB 1WAAF 5DQDL 1BBDH 5FYJE 5T1DH 4KDVA 3VWJB 2IADA 3PIQB 3QG6A 3QQ4B 4OZGF 3D39A 2MKWA 2OJZH 4LNRB 4ODHH 5DQJA 4NRXB 1KXTB 4PJEE 1VESA 3IT8D 4FXKA 4V2BA 5FGCB 2AGJH 3ES6A 43CAB 1YEKL 3VFUA 5D2NB 5DEGA 3MQIA 1MUJB 5I76B 2XTJD 1U95A 4D2NA 4EVNB 4FN0A 1NUDA 3HRZA 3WXVH 2RIKA 3VFTB 3RAJH 5DR5L 4PGDA 3OJ2C 1MREL 1WLHA 2IANB 4JY5H 3MLTA 5C6TH 5HD8D 4KHTH 3CLEL 4Y19B 1BIIA 1RHHB 5F1KC 2XA3A 4R3SB 1DTUA 3QUKA 8FABB 4LCYA 4N1EA 3S8WA 1XH3A 1N0XL 5EA0H 1FL3A 2BFVH 3DYMA 3PDOA 5E7BA 4YBQC 1ZSDA 4ALAL 3MJ9A 4QOKD 3EO1A 3T2QA 4LQFH 5AZEL 3UTTD 1WAAE 3L3JB 4J23A 4PG9A 4PG2C 5SV3A 2ARJA 4K7PY 4P9ML 1T3FB 2Z91A 4KJYB 3VGEA 4RDQF 5CBAB 4CVZA 1UG9A 5I8EA 4OCYL 4PJDA 4P9HL 3UYRL 4CRPA 1OOAA 4TOYH 1Z9SA 4S0TD 5DXWA 4OF0A 2MQ3A 1YPZB 3FO2B 2C1PA 4YFDB 3VG9C 5JOPD 2EDYA 2F74A 1JPFA 3W39A 4LHUD 4Y19A 3IFOA 3B2UD 4KI5E 5HHQB 5E2WL 1OB1A 1S7QB 2P5EA 4HF5H 4QRUB 5DQJB 4PGBA 2DLGA 4BA8A 3MA7A 3O6FB 3EOTL 3V5HA 4Y2OA 2APWA 4KKLC 2NX5B 3TCLA 4POYA 2HN7B 4WFHD 4HPYL 4TPRL 1IAIM 5DI8B 2DLFH 3G9AB 1EO7A 3QEQA 2YA2A 1QUNA 4L9LA 5GRUL 4G8FA 1U93A 5FM5M 4JO2L 3HZMB 1OGTB 5E1AA 2VUYA 1IJ9A 5GQBA 2X41A 5IIEA 3LQMA 5D4QA 3SE9H 1U8OB 1S5HB 5HYQB 5CUSH 4J8RB 1MRCL 4UDUA 1HZHL 4I5BA 3ZT5A 2VAAA 3LMJL 4NFDA 3Q0HA 5E99H 4AH2B 4Y8AA 1T66C 3RUGB 1GL4B 4MQTB 3U2SB 3ZE0F 3KPRB 3V6OE 2YD4A 4EI5D 3MFFB 2XRAH 3UBXA 1QLRA 4YPJA 5D96C 3RHWF 2EZ0D 4UB0H 3O3AA 5CBEA 1DBML 3ZDXE 5F7LB 3GSUA 2GQHA 3CNKA 2KBGA 3FB8A 5SX4I 5H2BA 3PHOB 3NCCB 1DQDH 2Z31D 3O6MH 1CLZH 4BK4A 4QTHB 1N64H 3RPKA 5IIEB 4BUGA 1TZHA 1BOYA 4NQTA 3TBWA 4EDXA 4UOW0 4B50A 2EH8H 1TZGL 4LVOB 4NT6A 2DQCH 4QRQB 4HIXL 5J0BA 5IVXE 2ZNXA 1X5JA 4PTUA 1FJ1B 2NY0C 5DHYB 2W65A 2V5YA 5IMMB 3FMGH 4ZQKA 4P9HC 3CK0L 5HHOE 5TF1H 1FFQA 5CIPA 3QP3A 2DTSA 2CKBH 4P2RE 3TBSA 2CIKA 4ZFZB 5FV2A 4WFGD 4XCNB 3FO1A 1Z5LA 4ZUUB 3OKEA 2GIYA 3T1FA 3CVHA 3M17B 3I6LE 3EDFA 5L2JA 5FO9B 2NY2C 3DHMA 3MRRB 5C3TA 2XYCA 3ZKND 4JQIL 1XF2B 1SBSL 5KSAD 2X1WL 1N7ML 3DMMD 2JJWA 5DGQA 1UXWA 5D6DC 3RVTC 1LDPH 1KC5L 1RU9H 1W72H 3JTSA 5INCB 1TTFA 5F7FA 2QQKH 3VA6A 1SBBA 5H35A 4JPKH 4OF3A 1IAKA 1GOGA 2GTWB 2DWEA 3IF1A 2F53B 2QBWA 1BM3L 1E28B 1M7XA 2XFXB 3QEHB 4ZUTA 5HXMA 1MI5D 5E4IA 4N8CL 1GYAA 2DTMH 3QRGH 3J8F7 2ICEB 4LSQL 4CN1A 3HFMH 4J3OC 3VFRA 5DZOA 1RZKH 3WIHH 3WIHA 1FPTH 1T7YA 4GAJL 3OB0H 2RHEA 3T4AA 3REVB 2B0SL 1E6JH 3ZHDA 2XQBH 4F9LC 1IGJB 2H6PB 1MRFL 4Z7WF 4Z5RB 1A6TB 1UEYA 1FV1B 2YUVA 4Y5YB 5ISZB 2DLIA 1P4IH 3EOBB 3VE0B 5A3ID 1I1FA 3ILPB 5B4MD 1AP2B 1MHEA 2X4UA 1XCQB 3OKLB 3DSFH 4N0FB 3G5ZA 5GS0D 2CDEA 2PW2A 3MV8A 1B0RA 4BFGA 3R4DA 5AYUL 3H9ZA 3RA7H 4N9GB 3MV9D 4O4YH 4QLRA 4HKZB 3O9WB 4WI6A 1FYTD 2AKRB 5I1DB 3D18A 3EHBC 4NQCB 5E5MA 3VFRB 2GJZB 4MXWH 4RMSA 4GMSH 4G9FE 5ADPL 1HSBB 4UQ3B 2BJML 3NTCL 4HW6A 1ADQA 1GC1L 1LNUA 1J10A 1UA6L 2J88L 4EXPX 3Q5OA 1ZA6B 4ZUSA 1TITA 1YEHL 3PHQB 4JRXB 2DWEB 2Z8RA 1M4KA 5FM5O 2BMKB 1UACH 4YIQA 4U7KA 2OJEB 1Y18A 4GLRH 2ARJQ 3EAKA 1AHWB 5HGAA 3W11C 3C8KB 3IS0X 5F6HJ 4PJAE 1BD2A 3AM8A 3U46A 2WBJC 4RMQA 2ICCA 4ENEC 3MV7E 3RWGA 5HHMD 5JORA 1A1OA 3EYOB 1NL0L 4RISL 2FDBP 3HRPA 2QSCL 2DRUA 5CMAA 3ARFB 4PR5A 4CNIA 1B0GB 1NFDB 1WTLA 3HR6A 2BNRD 2W59A 1CGUA 1KLFA 3BKYL 4KZDL 2W9DH 3LH2H 3KR3H 3VFVA 3RIFF 1AR2A 1F11B 3QPXL 2B4CC 1IAIL 4HIJA 4CDHA 2Z31C 5BQ7B 3OTTA 1QPXA 3O45A 5C2BL 1OTTC 1Q0XL 3LN4A 2CUMA 3F58H 3ULVF 1A7PH 3FRUA 2OL3A 1KJVB 1RZFL 5CEXA 5F1NA 4TUKH 3ZHLA 3CH8A 3EYFB 4QGYA 1J87A 5HYJD 4OD2A 5D7SL 3QIWC 2BVQB 3AB0B 5I74C 3MRGB 4AL8H 1T5XB 4ETYA 1I85A 5K9OB 5JPMB 5E94A 5EBGA 3MLRH 4QRSA 4KDTC 3MUZ1 3QHTC 4MD5B 2AQ2A 2HJFA 3P73A 4OF7A 3GMQA 2ZUUA 1OAUH 3EJYC 1YEIH 1IKFH 5D7JB 1JNHB 1DEEB 2FRGP 2GKIA 5HSFA 3OKOB 3OZ9H 1QP1A 1LEIA 5DD3L 4MQXC 5J13B 1L7IL 3RWGB 4M6MH 3F7YA 4M7JL 3P2TA 4X4YA 4WTWA 3THMH 1RJZA 1U8JA 2FIRT 4RWYL 4FTVA 2XNAB 2VR4A 5C0ND 1SY6H 1F6AB 3L3DB 4NO3A 4LHUB 1CL7H 1ZHNB 2AXHA 4JREC 4UBDC 4XH2A 2NX5A 1M05A 4GJTB 4KFZC 1WCBB 4XCFH 5F9AC 4XBPB 4BH8A 4IOSD 2L7JA 3VXSE 1CICB 4Q9RL 3ARWA 4PJGE 2C3WA 4EIZC 3FOLA 1AGFA 4LPVA 2EDEA 2OTWA 3VDAA 2BNUB 4QXUH 1ZAGA 2GEEA 5C09E 4DTGH 4Q9QL 3NFSH 3NGBB 4R7NA 4E41B 2FX9H 2J12B 1SJHB 3DVFA 4YDKH 3VG0L 2BSRA 4DKDC 2VAAB 1JK8A 5EUKA 3IAQA 5HHPA 5M94B 5HHXL 2EXYD 2Q86B 4LAQH 4JQXC 3ARED 4Y5YC 4JCMA 4I3GA 5E9DE 4QTIL 1O7SA 4DGYH 5EZLB 2P45B 4YR6B 3O3BA 4L8CB 3CFCL 4NM4L 2DDQL 5ICZB 5IMKA 4LLDA 5KVDH 4G6FB 4PP2A 4QKXB 2XA8H 3I6GA 2AEIT 2Z8SA 5DHVH 4GSDL 4JGJA 2DJ4A