5DO2C

Complex structure of mers-rbd bound with 4c2 antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
215
Chain Sequence
DVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRDGNDYDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A humanized neutralizing antibody against MERS-CoV targeting the receptor-binding domain of the spike protein.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Viral protein/immune system
molecule keywords S protein
total genus 44
structure length 215
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2C01
4GLRH 4HCRL 1MI5D 1XIWD 3GGWA 4FQ2L 3QIUC 4S0SD 4NWUH 3C8HA 1JNHB 5E2VH 1T2QL 4HWEL 4FQJL 4LEXL 4CN6A 1DQMH 3I9GH 2F54E 2VLJA 3ARFD 3O11B 5KSAC 1AY1H 5IROC 1IGCH 1WAAA 3HUJE 4H0IA 3G6JF 5CKAA 3P9WB 4FXKB 1MREL 3NIDE 3DMMA 1DL7H 3G6JA 3VFSB 5F1OB 4PB9H 3V5HB 3FN3A 3AS0A 3NIGF 5FHBL 3JWOL 1J8HE 3PWPD 2V5RA 3IDGA 4OLEA 1KEGL 1A4JA 2WUCL 3C2SA 3MCKB 4XBPA 4N5ED 2R69H 5C0AA 4DTGL 1SYSB 2XN9A 3C9NA 3KPSB 3OWEA 2XN9D 3VG0L 5ADOL 1X4XA 2DF3A 4XVUC 3P4OA 5F7FA 2XRAH 4Q2ZA 1F5WA 1QEWA 4GW1B 4MCYB 2X9WA 1T1YA 1EERB 4G6KL 1YEJL 5HHMD 5HYEA 5GS2H 3KXFD 2ZSWB 5KG9A 2G9HA 3ARGD 1HDMB 1BZ9B 3U79A 1YMHB 1DVFA 3NFPB 4JFEA 5I76B 4NNXA 1N59B 4YFDB 1IM9D 1S5IL 4PJ8B 2JJVA 1L0QA 4WU7B 5CHNB 2P24A 1NCCL 2VDPL 2PTTB 4UQ2A 1PZ5B 43C9A 3D25A 3LDBC 1IZJA 1KENH 3O6FA 1QBML 1N5YL 1MCOL 4OF5A 1AD9A 2EYTB 2XZQH 4P23B 4EN3B 4Z7UE 3VD9A 5FEBA 1AR1D 3SQOH 4CN4A 1S8DB 2WBJA 4S1DC 1JF5A 3GB7A 2L4OA 4UT9H 4XMPL 3VXRA 5T1DH 1MHEA 3EYVA 3DTXA 4UOW1 3TM6A 3AFLA 3AY4C 1T0MB 4D2NA 4TN9A 3P4OB 4JO2H 5FOBA 3ROLA 2LU4A 1G7MA 1JTOA 3PWUB 1LHZA 1BPVA 4MVBC 1CICC 2A6JB 1QVOA 5IVXA 1EZVX 1JGEA 1VFMA 4S11A 1A47A 1KB9K 5EUKA 1ACYH 2NYYC 1PEWA 1PSKL 4U1NB 2J6EA 5F71A 3DVFA 1ZEAL 3QIBB 4DUVA 3RGVA 2JCCA 1MF2L 4HWZA 4L4TD 1TTUA 2RAMA 2V7HA 2CIKB 4DOHB 2Z31D 4KQ4H 1LEIB 2JCCF 3OB8A 3WNLA 3VI3F 3RVVD 5FDYA 2HMID 4EN3D 4MAUL 1SEBB 3QDJB 2HVJB 4P9HH 3THML 4HS8H 3A67H 4KH2A 3SKOA 5EU6E 5JDSA 3IDNB 2XY2A 5E6IB 2BNRE 2AK4E 1JNHA 5I0ZA 5CIPA 1BBDH 1OCWH 1TZGL 3DXAD 4Z7UB 4QRRE 2DBJA 3J8F7 1ZA3B 2AP2A 4QCIA 1UACL 1T7VA 4TULL 1I3RA 3MOQA 3OAUH 5TE4L 2G5RA 5I1CH 5M7QA 4PJFE 4AH2B 1S7XB 4OLYH 4APQB 1RUAL 4JG1L 3CLFL 3OX8A 1FIGH 4H8WL 4XC1L 2YHGA 4H88H 2QQLL 5BRZE 1U2CA 3WHE1 2JJWA 5T5FL 5JQHC 3G5XB 3U9PL 5IHUL 4ZSOB 3NFNB 4R4FL 3KR3H 1WBYA 4L9DA 1OY3B 3GMOA 5E4EB 3T0DA 5DMKB 2B5IC 4ZXBB 2H45A 2OTWB 5T5NF 1J1XL 2BC4B 3RHWK 5E99H 4J3WA 3MV9A 4A2LA 4DJMA 4WFGE 4XVTL 2DKUA 5FYLE 3BPOB 4NO5A 1HINL 1F4YL 3FTGA 2VXSL 3TWCL 1VGEL 3CFCL 1I9IH 2JJTC 4O51A 3IFPA 4NKMA 2J8UA 3SGDH 3DNKA 3KJ6H 2UY6A 4K3EH 1JZ2A 3NH7L 3MXVL 2EEBA 3JWNC 4NQED 3UPRB 1DR9A 1V5JA 3MRMA 3C6LA 1IQWH 4Y19A 3C6LD 2VYRE 3NBNA 3F5WB 2C7UA 4WW1B 4P3DB 4WGWB 3QQ3B 1UCBL 2BHYA 5JZ7C 1YYML 3QUZC 4X5WB 4P2OB 4PJHB 4UTAL 5DI8B 1P7QA 4HBCH 1D3CA 4QHUB 4XX1G 4GQ9L 3I9GL 4MNQE 3GIZL 2O5XH 3QQ4A 1JNJA 3RL2B 4U6XA 1WAAF 2O61B 2F8XC 3HE6D 1EO5A 3QQNA 5GS0L 5HHOA 3VWJD 1I3RB 5I1HL 5EZJA 3DYMA 4P46A 2P5WB 3HAEG 3QBTB 3V4VL 5IUSA 4LPWA 3FB6A 5GGVH 5EA0H 1CU4H 5I1AB 1RZJH 1K3IA 1B4JL 4GAYB 5IEHB 3OR7A 4WV1C 3QH3A 2PW2A 4MDJB 4D94A 5FYLL 5L7XL 4JFDA 4HT1H 2NY3D 3DX8A 4Z7VF 3T65B 4LGPB 5C70A 3KLAB 3B5HA 3V4PL 1TVBB 4WU5A 4AY0A 1INQA 4BA8A 1ORQA 1PG7L 2DQUH 4NQTA 3MLSH 3MLVH 3IFLL 1ZHLA 3CIQA 5KSBE 3D39B 2BJML 35C8H 5TF0A 2IH1A 4Z77B 4I77H 4UNUA 5KSAA 2B20A 1EBPA 5F1NB 4NQVB 4ZOAA 3BH8B 1B90A 4POUB 2ZPKL 3O0RL 3CPLA 1YQ2A 4OZGE 5ACMA 2P47B 1I1CA 4L1DA 1IAIH 2I07A 3X11B 3LPFA 3ULUL 1MY7A 3HR6A 3FAXA 3MJ7A 4W70A 3ILPA 5IT2H 1E27B 1T1ZB 5A2FA 2G5BB 2NXYD 4XCYB 2AV1A 5CP3H 2YPLE 2Z92A 4DZBB 3HNVH 4P2RD 4CVZB 5D4QA 2VB5A 1JTPA 3QIBD 1T0NB 3MRFB 4XPGH 1KNOB 4XWOC 4U3XA 4QRRB 5FA4B 3LKOB 1ITBB 3HUJF 5ISZA 4CADA 5EZLA 4GW1A 5E56A 3CVHA 4M5YL 3VGBA 5MP6H 5JPNA 1NAML 4EDWL 2GJ6E 1A1OA 4P9ML 1KPRB 1OTUC 4HPOH 4YBHA 1T1ZA 1WWBX 2VZOA 4IOIB 3UYPA 1FSKC 4KC3B 4PBWD 1D6VL 1SYSA 4EOWH 3QUML 3L95B 4RFEA 5TQ0L 5HDBF 4KK6D 4ESKA 3DMMC 1F8TL 1T5WA 4OI7A 2ZUSA 1NCTA 2PW2B 2CK0L 1A9EA 5L8KB 3V52H 3STLA 1U8LB 3MLXL 1JGVL 3L5XL 3AUVA 1HILA 3QPXL 3OKDB 2GT9A 5FO9B 1KXQE 5HHOB 4TPRH 3VFVA 1EUTA 2DRUA 4FG6D 3W39B 2YC1A 2I26N 3QJFA 3EOYG 3RY6C 1TJHL 3UBXA 1G7LB 2CGRH 2FSEA 2W07A 4BH7B 3HFMH 5DI8A 4AEHL 5JDJA 4U6YB 4NRXB 5C0GA 3TA3D 2VUOA 1JGUL 1NMAH 3IJHA 5I1AA 4NN5B 1CQKA 4ZUUB 3JV5A 2O93L 5HD8D 3MZTA 4WUUB 4L3EE 1FYTA 3TT1L 3REWA 3FN0H 1QBLH 2BNRD 3TZVD 1X6LA 5IGXH 1HSBA 4HKXA 3HZKB 3CX5J 1F2XK 1TNNA 3GSWA 3LB6D 1MFEL 4G3YH 4RFOH 1O0VA 3GGWB 4NUJA 4KQ3L 4R96B 1BQHG 1ZWIB 1JPFA 2BSRA 3EDEA 4TVPD 3EHBD 1FGNL 4G8GA 1SEQL 3WLWD 2EDQA 2IFGA 1RZKL 3LCYA 4O58H 3HC4H 3SDXA 3Q6FA 2ZSWA 3CMOL 1VFAA 2MPAL 1QYGH 5DD3H 5FECA 3QFDB 1NLDH 5IBUG 3O4LE 4Y19E 2ED8A 3ARTA 3U4EB 2ADGA 4M1DL 4Y0GA 3HMWL 3FRUA 4X99A 3RTQA 3QXDA 1KCRH 4X98A 4Y4FA 5CILL 4WFHD 5TDPA 3VWJB 4HS3A 4LSDA 2X4OA 1FYTE 3BE1H 4KXZH 2X4RB 1JPGA 4PJ8A 3PQYA 1RV6X 5F9WC 2F74A 1J8KA 3B2UC 1KEGH 2VERN 2ENYA 5HHPB 2BRRL 2C26A 5FO8A 3GI9L 4XAWH 5KG9B 3BI9X 4CAGA 2W9LA 1H3XA 3QISA 4N9GA 3S5LG 1MLBB 4FQPA 2WQRA 5L6YL 1BZ7B 1BJ1J 2X4UB 1OB1A 1FH5L 5E2WH 3DX7A 3OX8B 4HFWA 5I18H 2F58H 2HLFD 1NQBA 4OZHE 1W72H 3NCYS 1ES0A 2NY4B 2Q6WA 4NKDB 2MMXA 2FD6L 4YXKH 4C56A 1IC7H 4QHNB 2DTSA 3SJVD 4RMTA 1AC6A 4KY1H 2Y06L 4DKFH 3WD5H 3WS6A 5BZWB 4ZTPL 4OZGA 4DVRH 3C5SB 2BVYA 3EGSA 1DBJH 2APFA 3AS1A 1IEAA 5I66B 4XMLH 1MAMH 3DX7B 1KN4L 3MQIA 2D31B 3ULUF 1YNTA 1NMBH 2GSGA 3G6AB 3MRDA 4LSQH 1U8LA 3OKNA 5ISZE 5DJAB 1UWXK 4N8CL 3T0AA 4I3RL 3GB7B 3QDME 1AGDA 5ESVB 4CJ1A 3OAYH 4U1MB 1J11A 4Z76A 1XR8B 3FOLA 3T2NL 3GSNH 4E41D 1F00I 1K4DB 2G75A 2HTKD 4O2CA 4G43A 4E41A 5HYJA 2EIEA 4HXAH 3ULUH 4NNYA 1D5BB 2AV7B 2X4NA 4K7PH 4P5MB 2XICA 5C0JB 3L3JB 1KJ3H 4EQ2A 5BRZA 3SKNA 1ZOXA 4IDLA 2IPKA 3DV6B 3MV01 5EU3B 3GUTA 5FB8B 3KAAA 4WW2A 3UMTA 5DFVC 4E9LA 2EDBA 1DQQB 4CMHB 4UMGA 5A16A 1Y18B 3H3PL 4HJ0D 3QFDA 5DRXB 5EZOL 1C5CH 4HCRA 3K8MA 4UV4L 1AQDB 1HQRA 4NQUA 3P30L 2ICCA 4JFFA 2CRYA 4HLZG 5GSVB 4JFFD 3IAGC 3JTTA 5A3IC 3L1OH 1TIUA 4P46D 5EUOA 4F8QA 1REIA 2GJZB 2CO7B 1OAUL 4LBEB 1U91B 1H0DB 4X7CC 3BSZL 5K9JL 5BRZB 4PJ7F 1UYWL 5CHNA 3RVWC 1RUPH 1TFHA 2EC9T 4WO4B 3VH8A 1EVUA 2VDOH 1CTNA 5I8KH 1MRCL 5GGVL 4MB5A 5C0AB 1KULA 2GK0A 4KZDH 4KKLC 5EIIA 4OM1L 4XZUA 4MYWB 5D96C 3QUKB 2COQA 3UYRL 3GFUA 4LFHD 4XTRC 4AMKL 2B0SL 4Y1AA 1N5AB 3FT2A 4KK6C 1IMHC 5F6HJ 3L3JA 3T09A 3WIIL 2AJXL 4YHNA 2HRLA 5HHVH 1HE7A 1QFWH 3QP3A 2R1XA 2ESVB 3BEVB 4YIQA 1KC5L 4NCC2 4GXVL 5I8EB 2QLVB 4FN0A 3MFFA 3VXSE 5BZWA 1A4JB 5FYKD 2CDGA 4AG4H 3V7AE 2FJGA 2PYFB 1R3KA 4HC1L 5D6CA 1U42A 1L7TL 4V2BA 2MSPA 1MOEA 1PGRB 3T77A 1ES0B 2KUTA 1MCSA 4DUXA 1O5DT 2CDFB 2H9GA 3O2VH 4JO1L 4U1HA 4Y4FC 3CLEH 4O00A 3UCRA 3QG6B 3RPKA 1CFQA 2VRAA 5IBLC 5I8EA 5T33L 5GPRA 1JMXA 3TVMA 2D3VA 2YD7A 4MJIB 4PGBA 5T5FH 3CVIL 2Z31C 2Y23A 1W0YT 1CT8A 3PXHA 1T0MA 3DRQB 5J1AB 1KV3A 3ALXA 1JI1A 3ZYJA 3DTXB 4G5ZL 1YEHH 2NX5B 4XCNB 4MNGE 2BNUA 4PY7A 1CD1A 5CEZE 3L6FA 1G9NH 2Y7QB 3PWLB 3RDTA 1ZVYA 4HQQL 5IR1B 2BMKA 3BKJL 3OBAA 2OQJA 5CJXA 1JWSA 3SGKA 5C07D 3GKWL 3TA3A 3NCEB 4C4KO 2IPKB 3FT4A 4H25B 1K85A 3PF2A 3B9VA 4HWNA 4PJAB 4GAGH 1G9NC 4Y4HA 4EDXA 2VLJE 4JN1L 1VEOA 1SMOA 4QRRA 5JNYA 2NY3C 1AKJD 3Q0HA 5D2LF 5C7XH 2PKDA 1JPFB 2EIZA 2SEBB 3SDAB 3DX9A 1U6AL 4PTTA 5TJWK 5ERWA 5DMGD 1ZA6A 3CVHL 2E6PA 2G5BA 4LVOC 1IAII 1G7PB 3Q6FB 4GW4B 3S88L 3DYPA 1CGXA 1GIGL 2A6KA 2X42A 5FYJE 3VWKA 5ITFA 2OSLB 1NBYB 1YPZA 2DQEL 3NFNA 4JN2A 2FD6H 3D2UD 1BVZA 4NBZB 3TVMD 5GJSH 2Q86B 4MJ5B 4OLYL 3N06B 4NRXA 5KVDL 3HUJB 3QUYD 2WINB 4NZUH 3S35L 2RIKA 4K8RD 4S2SB 4JDVB 4Y5VA 3MYJA 3VFSA 1WT5C 3CDFA 1MFDL 3GRWA 2RFXB 4MXVF 4QRPB 3SDDD 5F7HA 5I19H 4JVWA 1JF1A 3FFCA 3QR2A 4WRLA 3MLUL 4OI9A 3UYOD 1YJDL 4JREC 1S5HA 5GRYA 5D1QC 5JXED 5F7DA 1HHHB 1YYLH 5DMJB 2OJEB 1FORL 1OP9A 2A83B 3EOBA 3STLB 3QNXA 4KHTH 5FYKL 2NY6D 1D5IL 4LMQE 2Y36L 4JFHD 2BX5A 4Z95L 1PJ9A 4ZUSA 1Z0NA 2B8OT 3HMWH 4YDJA 1QKZL 1EFXA 1F4YH 5MEOA 3TBWA 2H8PA 1LP9F 1OSZA 4ACPA 8CGTA 5IV2A 4H20L 5DQ9B 4U1IB 4C56E 4NKMB 5GRVK 1IAMA 4MQ7A 4O2EB 2R4RH 4JDZA 5KVMC 2E7HA 3NGBB 1MLBA 1Z5LB 3T1FB 5BQ7A 2E6QA 2EDJA 4K94C 4E41E 3K1DA 5JO5A 3QIWB 4DW2H 4KTEH 3MV8B 3B6SA 5MEQB 2EKSB 2CJUH 4UINH 2DQDL 1HSAA 1DQJB 1KGCD 3FAWA 1CLZL 1P2CA 5D7IF 5EFIA 4HJ0C 4PJ7A 1A14L 2VZUA 1F8TH 4DKEH 3A67L 5T1LD 1K6QL 1J18A 1JHLL 2XTJD 1L6XA 3FRUB 4X99B 4F8TA 4E42A 3C6SA 2H3NA 4GKOA 3X3FH 2DQTL 3S36L 3OXSA 1QBAA 3L5XH 1IVLA 2DI8A 3LD8C 2IQAB 4LVNB 4YE4L 2PR4H 3DV6A 4Y16C 3T0XA 4N0UA 2VOTA 1YUHB 4BSVB 4G6FB 4LRIC 5FDWB 1AJ7H 5ESAB 1ORQB 1BBJB 4R96A 1KCSL 1ZHNB 3FT3A 1WFUA 4U1MA 2J12B 1MCPL 2VKXA 2ICES 3CFKB 2FEEL 2FJHA 3F12B 3CPLB 1TCRA 1B9ZA 4MDIA 3Q5OA 4FZEL 3JVGC 4RIRB 4YX2H 1GZQA 4ZYKB 4PJFA 2MPAH 2D7TL 4HWBL 5L2KD 1Z0MA 3K4ZA 3HMXA 3MV9D 3RL2A 1U8MB 2OXHA 2RFXA 3BAEL 4QRPA 3OKLB 5F1IA 1G9EA 4WTXA 2VH5H 2YD9A 4G6AC 1HCVA 5D7IB 5SWSD 4UV4H 5IEHA 2YXMA 4GUPB 3CXDH 3CXHJ 5EBLA 4BM7A 3BDYL 1IT9L 3TLRA 1C7TA 1BF8A 1HK6A 5T1KA 4CADB 2NY6B 4Y16B 1J5OL 3KJ4C 1T1WA 5JIKA 4E5XB 4TRPL 5DD0H 4RGNC 3G5VB 4KV5F 3SO5A 2YRPA 3T8XA 3RNKA 4F2MB 1RUPL 4MS8D 2H3NB 1HI6B 4KPHH 1G7MB 3LKSA 2OJZL 3P0YH 5L2KE 3TJEL 4XXDB 3FT2B 3ZKND 4WU7A 1KCRL 4PV9B 3MRPB 4M61A 2IPTL 4LVEA 5I16A 2Q8BH 4CVXA 3PQYD 1MELA 4OFDA 1W8NA 5C3LD 2X4SA 2HAZA 3WNKA 5SX4H 5GHWL 3HS0A 5IVZB 4MQXD 4WI4A 3KYNB 3WIIH 3RVUD 1M05A 5KVGH 5JXAH 3OR6A 1ORSB 2CLRB 2ZCHL 2Y25A 2VWEC 3EHBC 3MROB 2BY2A 2X70B 4XPBL 1XR9A 3CVHH 4GMSL 1F4HA 4D9LL 4J1UA 4ZAKB 4NYLB 5EPMB 2GTZA 4G43B 5BVPL 1JCKA 1S7XA 4L4VD 4PJBE 4R7DB 4C59B 1TVBA 1PYWB 2EXWC 1GSMA 4N0UE 3T0EC 2AQ1A 1AGDB 4KHXL 1LEGB 2R39A 4G8FA 4PGBB 5KAQF 3PWJB 4NRYB 4JFPB 3LKQB 1DQQA 1DFBL 4IHOB 4TOYH 1KIQA 5IQ7L 1T2JA 5ICXB 1EH9A 1BFSA 1T66C 3HE7D 3LV3B 1G7QB 3HE7A 5FHAH 5I74C 3ULVE 1II4E 4QTIL 5D6DA 3L6FB 3SQOL 5D2NA 4YO0A 4LSPH 1TLKA 4XRCB 3HNVL 1RJZB 3BO8B 4L9LB 4X9HA 2FIKA 4JVUA 4C83A 1BIHA 5L8LB 2ADIA 4OIIH 2NY3B 5IB4B 2VAJA 1RZ8B 3GK8L 4PREB 3IDMB 4HUVA 4FQXB 2CIIA 2CDGB 1CFSB 3NPSB 4MJIA 2YBRA 5DK2B 3BZEA 1VKXB 1OAZL 3QO1B 5EOCH 5HJ3A 2E9WA 4I4WB 3QUMB 4PJ9B 2IH3A 2X09A 4KMQA 5K33A 3LN5B 2VXTH 3P73B 3P0GB 4Q6YA 5DHVA 2AXGA 3L7FA 4DQOH 1V3KA 3O8XC 3FMGL 5C07B 4EBQH 4AENA 2DIJA 1KJ3L 2DQCL 3BD3A 4Y5VB 5JZ7D 1SYVB 2MCPH 2XFXA 5LGKA 2W9DL 3FTGB 5IHLB 4KKAD 3QQ9D 4NM4L 5TE4H 4HX1A 4HFUL 3WFDH 4RGNE 3ZE0F 2B0SH 4KDVA 3VGAC 5EZOH 4OCMC 4O9HH 3MRRB 3BXNA 3MXWH 2FBJH 5D7LE 3ZDXE 1NCWH 3QUXC 1D9KD 2VQ1B 4MA8L 3VXUD 4YC2C 1Y0LB 3DO3A 3C60D 3O2DL 1UZ6E 1ZLUK 5I6XC 3HN3A 1MFCH 5EZLB 3ZE2F 1F3JB 4KZDL 1PLGL 3RBSA 1X5HA 3VWKC 4OB5H 3U83A 1BQHA 3BPLC 1NC2A 4WHTB 4WY7L 2FX8H 3Q48A 1Q0YH 3OAZH 4NO0D 2X4SB 2XG5A 5HYQA 1J8HB 4NO0A 2X9YA 2OTPA 3PP4H 3VXTB 1DEEB 4ONHB 4BQ9A 2FHBA 3BEWB 4L4JA 4NO2B 5I1KL 1H0DA 4NHUA 2IALA 5CEYB 1D5BA 4OCYL 5TDNA 2DD8L 3RI5K 3BFOA 4F15B 1BVLA 3HCVB 2IF7A 3INUH 3C8KA 2VITB 1XF3A 4JEGB 5CUSH 3REWB 1UXWA 4NSKA 5D7LA 3FQRB 1A6UH 4Q6IA 5F1NA 3SGJC 1IKFH 4CMHC 3W81A 2ADFL 3BGMA 3VXOA 3W0WD 3V5HA 3UDWC 4NQSA 2Y6SC 4Q9QL 3MRCA 4Y4KC 5I1JL 5C0GB 2MQ0A 5JOPE 5D7IA 1K4CB 2H2PC 3OKOB 5DJCA 5CZKA 4RQQB 4JFDB 5IBTL 1CBVH 2VLRA 4JZOB 5JDSB 2X9XA 5GGUA 2VSCA 4XBPB 5DK2A 4HDIA 1MIEL 3BW9B 3BZEB 1P1ZB 5C1MB 1BD2E 1RZGB 4KGJA 1F42A 1UJ3C 1YN7B 3I02B 4G7YL 4CW1B 3DUSA 5EU5B 1FO0H 4M43H 4HZLA 4OCSL 4TUKL 1DDHB 3O3DB 4PJIE 2AABL 2DJ4A 3MUGB 4QXUL 3KPPA 4OGXL 1JNNL 3QUKA 1E6JH 3JBG7 4YXKL 2EH7H 3AB0B 1JHLH 3I84A 3MLVL 4PJHA 2V2WA 4M7LL 1N64H 3V6ZA 1Z3GH 4R4ND 3IKCB 4XPAH 5C0CB 1B6DA 1HNGA 3MJ9A 1HOCA 2IQ9H 3ZKXC 2EYRB 1QFHA 1HILB 4KVCH 4WWKB 2J6EH 5C0BA 4Y19B 5DHYA 1QSED 3JTTB 5AAMA 1I8LC 1FNSH 1IGJB 5JOFA 4OF7A 4N0FA 1QPPA 1ZLUH 3GM0A 1EFQA 4UUJB 3L5WA 4OZHA 1LO0L 4F7EA 3LN9A 5EOQH 4QLRA 5JA8B 5B8CC 1BOGA 2D9CA 5DJ0A 3TZVC 1MCPH 4M62H 4YK4B 2CD0A 1G7HA 5HHNB 1NCNA 4OGAD 2QQKH 4AEIH 2DMBA 3MBXH 1BIIB 3QDMA 5T1MB 1NGPH 3S88H 3E2HB 5IB3B 2R1WA 1D5IH 1D5ZB 3BP5B 5FYKU 3UZQA 5DEGB 3VA2C 5IT2L 1F6LL 1OTSC 2Y72A 5IHZA 3MOBL 5E5MB 1ZSDB 3A6BL 3O8XA 4N0YH 5C9JB 2I5YL 2AK4B 1LILA 2YPVH 3L7EB 5CEZL 4U1IA 1EK3A 1AP2A 3TBSB 1OSZB 5IV2B 1BBDL 1OCWL 1WBXA 4LKXA 3OAYK 3QUMH 5J11C 3WLWC 4HIJA 1TTFA 3CSYA 4F80A 1MRFH 3SGEI 4ZUWA 5I1EL 3QI9D 2QJDA 3KWWB 5HYJD 1BFOB 4AT6B 1GHFH 2YD6A 3VFPA 1KCKA 4CGTA 3H9SA 3ILQD 3KYMB 4NUJB 3TO4B 4IOSD 2ZOKB 3MGOB 1OAZH 1A3RH 3MX0A 5CFHA 4QTHB 4BH8A 4LSSL 4EOWL 5CMAB 4HWBA 4PRAB 2PYEA 4P48A 2R1YB 5FGBC 4J23A 2OI9B 1RZIB 1U3YA 1ZVSB 1RURH 4WI8A 4A6YA 4MD4B 1M6OB 4MNGB 3W2DL 1BGXH 3PNWA 4JY4A 1ZLWK 5DS8B 1JRHL 4UQ3A 3U1SH 2AJYL 2MOVA 1C5BL 1UM5H 2UV3A 4RRPA 3GMLB 3NN8B 4I5BB 3RGVD 3I6LE 3RWJA 4M9PA 2F53B 4OZFA 4NWTH 3E3QC 3NCMA 3L3GB 4OJFH 5D1QD 1EAPA 1ZVHA 1QFUL 2GT9B 2FR4B 2DQTH 4YHIB 1QO3B 3BH9A 3IDJB 1MHHA 3O45A 2W38A 5C08A 5TDPB 3N1FC 3QIUA 5BVPH 3FB5A 3WLBB 3VXRB 1SMAA 5ANME 3VFWA 2DQEH 5MHSE 1EX0A 2GFBA 2IJ0C 1LE5B 5E6ID 4V1DE 3MOAH 2P8LB 4NWUL 4OD2A 3SO3B 3QFJE 1CIDA 3S98A 3GRWL 1U8OA 4PRIA 3VRIA 3CVIH 1KEML 1AKJA 2DBLL 3OJDB 4UU9A 1UA6L 3TA3B 4L4VE 1A1OB 3WYRA 1TVHA 4J3UA 1UJTA 3TN0B 1AO7B 1WCQA 2R23A 2VLKD 5T33H 2PCPA 4K71B 2K1MA 1KBGH 3RUGB 1BZ9A 1WIUA 3TESA 4D0CA 1HQ4A 5IB5B 1XF4B 4D9RD 1B0GA 4CU7A 1CFBA 4UILL 5IVOA 1TPXC 4J7RA 1NDMA 3JWDH 4M3KB 3GSXB 2A73A 2N7AA 3HR5B 1JZ4A 4NQCA 4Z95H 1L0YA 4HULB 4MQ7B 2Y9RT 4O2EA 2XWJB 3Q5TA 1IC5L 5C07E 3IU3A 2OL3B 3LZFL 4QOKD 5DFVD 3U7WH 1U8NB 3S4SA 2DQHH 3LKSB 3P3YA 3DX6B 2UWEB 2WSKA 4PJIB 4M03A 2ITDA 2AEQH 3QJFB 4KK5D 3L3DB 5FXCH 1G1CA 1JRHI 5B3NA 2W9DH 4U1HB 4Y16D 5DQDH 2C5DC 3MNVB 1IAIL 3SPVB 3Q3GB 4P23D 3DMMB 3RWGA 4DVBB 4JN1H 3HA0A 4F7CB 1XGUA 2GUOB 1QD0A 2I9LB 1IM9A 3F65A 1BFTA 4N8VB 1DANU 2KPNA 3OHXB 4P3WA 5CJQL 1JWUA 4WU5B 1KN4H 2IANB 2ITDB 4JPIA 4WI6A 1WV7T 4J12A 5HVHB 1SVZA 3RKDC 5BMFH 5ACLA 2DN7A 4X5XB 1KJ2B 3QO0B 1YUHA 4BSVA 1QLFB 4FXGB 3H42L 5JPNB 1Q1JH 3RZCD 2VZVA 4HKJB 4N0UB 1T03H 3NFSL 1DUZB 3B9KB 1BQSA 5H2BA 2G60L 2DTMH 1CFNA 4YLQT 3BD4A 3QDGB 3QQ4B 1QHOA 4YFEA 5B4MD 5IB1B 5IMLA 2P5ED 2P7TB 2VR5A 1S9XA 3DHMA 3F7YB 4BUHA 3MREA 4MXQC 4XB7A 2FO4B 1QQDB 1FDLL 3MA9L 1KJMA 1Q9OA 3IDUA 1ACYL 4OZIF 4LBEA 1RJLA 4YHKH 4NNPL 2VXQH 1TJGL 5D9SA 1MWAL 1CL7H 2DM2A 1G7JB 3QNZB 3EYSH 1R5WA 2ITCA 3TO4D 2G9HB 1YEDB 2RCSL 3OGCA 3D69A 1I75A 4GW5A 4F7MA 5D1ZA 4M4PA 4Y4HD 5HVFB 4LSTH 3DROB 2DQGH 2E27H 5E9DD 1ND0A 4TSAH 4U6HA 3VG9C 2W65B 3MACH 3O45B 4ENEC 3SY0B 5DJ2B 4FQLL 4JQIL 2NTFB 4X9IA 1LO5A 4NNYB 2AJSH 5KSUA 4LRNL 4F58L 3VFRA 1BD2B 3U7AA 2GJ6D 2MNUA 2YN5A 2OI9C 1ZLVH 1JNNH 1IT9H 1DE4B 2C1OA 1GHFL 1GGBL 2VXTL 1NSNL 4NKQB 3K0WA 1I7ZA 1OWRM 1MCLA 3QUXD 2BCKA 5F7DB 5D7KD 4Y5XB 3VH8G 1QLEH 4O2FB 5I71C 3BRFA 3IXAB 3MV11 5TPWH 4X4YA 5DF0A 4GG6E 3MRLB 5HHME 3AAZB 2YR3A 4IIQC 5GRXG 5CD3A 1FL5A 1NEZB 3QCUH 1GGCH 5TF1H 3TNMA 4X9FA 3Q6GL 4LASL 4BFEA 3ZDXF 1X44A 4YUEH 1R0AH 2AXFB 5DFTA 1NCUA 4YHZH 1DTUA 4APQC 1DBAL 3WJJC 3BYYA 2IG2L 4FQQA 3QAZC 4X4MA 4ZUWB 3B5TA 3I50L 5EIQA 3T0BA 2MKWA 3QDJA 3AM8C 2VLLA 4MMXC 3ULVL 4PJHE 3G6DH 2J2ZA 5EBMB 1AJ7L 2FLBT 2VLJB 5GS1C 5KVFL 3HPLB 4I3GA 1HH6B 3ZKQD 5JXEC 3PV7A 3RWEB 4XAWL 4OI8A 4E0RA 4LPUA 4ELME 2I9TB 4CRPA 5BW7A 1RZ7L 2XXCB 1HHKB 2YPLD 1UH2A 1A7OL 3NZHL 2GEEA 1UT9A 2LAGB 4WIQA 4X7SL 1HYSC 1TQCC 5ITFB 4U49A 1WT5A 2AJZB 1GVIA 4G80A 1A6ZB 5DUPH 1DUYB 1WC7B 4PRNB 4WTZA 4Z7NF 4YNYA 3IFNH 4Q9RL 1P1ZA 4EI6A 2AK1H 5HI3D 4Z7QE 1F45A 3DURA 3ZKXB 1B2WH 3RX8A 3QFJD 2X7LA 5HPMB 4OZHF 2M26A 1NGXB 1T7YA 2J7LA 4MXWL 2YZ8A 4X4ME 3JWDL 4JHAH 4P57B 4Z7WB 1CLOL 5FKAB 2DQIL 1FN4A 4L4TB 3BP7A 5EOCL 3WO4C 4XMLL 1M7DB 4ZFZA 2VMFA 3GM8A 3GDBA 2HN7B 4OUUB 2EYRA 5CSZA 1JPTH 5EU6A 5C0RH 4G42A 3ES6B 3P9LB 3SE3A 3FQWB 4ERSH 2EC8A 5ESVA 3ULUE 1JRHH 3U1SL 2NY7H 4XWGL 1PY9A 4HIIB 1I9RH 3OKNB 2P49B 3EYFA 1YDPA 4YBLB 4EXPX 2EXYC 1KTLB 1PKOA 2EIBA 4RFNB 4D9LH 3ARBA 4AM0A 4JPKH 3VI3E 1SBSH 4BFIA 1QUNA 2OR7A 2N56A 5IW1A 4K3HA 1NC2B 1JWMA 4G9FA 2AJVH 4LU5H 1S9YB 4KTYA 4E0RB 2A6JA 2AXHA 5LGHH 3JV4A 1F3JA 4Y2DC 4PJXE 3RHWF 3IDGB 3NTCH 4UV7H 1A3LL 5AD0B 5KVDH 5F7UA 3LQZB 2ZKHL 1MIMH 3SQBA 3V79C 5IVNA 4J4PD 1JNLH 5E8PA 4NT6B 1F02I 4Y5YA 2V7NB 2DQFB 5I8CB 1J87A 1CXFA 1KJ2L 2ORBH 4OCRH 2W0PA 3I3DA 2FX7H 1HNFA 5IVXB 2E3VA 5D5MF 3HCVA 4MCZA 1KCVL 2A0LD 3PDOA 2EE3A 3U30B 3K46A 5DGQA 1NBVL 3C60A 3RPIB 1BWWA 1KT2B 1U3HD 4RWHA 1ZGLM 1ZT4A 4MJIE 1XH3A 4U1SA 1DEEA 4PJ9D 5GGRA 4PIRF 1E28B 2X4PA 1E4WL 1T89A 1QNZH 3DXAA 3WNMA 4OFIA 1EEYA 3IJSB 1KG0A 4YBQD 4YGVB 4RGMB 3KJ6L 3WL9A 3QEHA 5DJZA 1CF8L 3MXVH 2GKIA 4PREA 1OGAB 2EYTA 2IAMA 3H9HA 1FVDA 2B39A 4U7KA 3CDGB 3MLZH 3ZT5A 4AEFA 4XCYA 4KK9C 1ADQH 1VGEH 2BERA 2V9RA 3LRGA 2ZUVA 4AG4L 2QQNL 1I9IL 5DQDL 3RL1A 3MCLL 3FONB 4AEEA 3W2DH 3UJJL 4DOHE 2ZNWA 2AJYH 4QRTB 2OP4H 3JZ7A 4PJDE 1OGTA 3BIAX 5DD5L 3FQNA 5LAXB 5D1XB 4OBRA 1LP9E 2R29L 3G9AB 5FM5O 4JG0L 5E2TH 5IFAL 4G8GE 5IFHH 1I8MA 1OHQA 2C3XA 3W9DB 5EU3A 5J11B 2R2CA 3O3BA 1NAMA 1A3RL 1J05A 1S9WB 3DPBA 3PXJA 3RDTD 1U92B 4PJCA 3GIZH 4H5SA 3LRSA 5HPMA 1U8IB 5HVWA 3P77A 1W0WA 1QQDA 4DUWA 5I1HH 4PLOB 4HH9B 3MREB 3MBED 1FNSL 2BOCB 1D5XA 5DGRA 2A9ML 3WL9B 3VD4A 1FG2A 5KANI 3B2VL 3VD7A 3P4LA 4ZNCD 1QFUH 2ITCB 4JO3L 2IG2H 1FFOB 1KACB 3K4AA 5EOQL 2A1WL 5DD1L 3TF7C 1P6AB 3MNWB 4QNPF 3SDCD 1XAUA 5I2IB 1VHPA 3D2UB 3R1GH 2HLAA 3W0WE 2QQKL 4AEIL 1YY9D 1RUMH 4GRLB 1CFTB 4PRPA 4D3CH 3KPRA 1EHNA 3IU4L 5CBAB 1NPUA 4NRYA 3V4UL 4KKBC 3IJYB 4M6ML 4BZ2L 1MFBL 4RAVB 4U1LA 4WDIB 5CP3A 2PO6C 4IOFC 4LNRA 1Q9OB 1UZ8B 1VEMA 5I8CA 2OXGA 3GBML 4TRPH 3QEUA 3V2AR 5F3BB 2BNQA 1KCLA 3IFOA 4XBEL 1CE6B 5CGYD 4ZOCA 1DBML 3SDAD 3EJZC 4L4VB 3RWGB 4ZNEE 1RFDL 5IMKA 4MVBD 3T3PF 2DQCH 3EFFA 3O4OB 5IIEA 1VGKA 4NZTL 2KZWA 1BMGA 4L8SA 5D71L 2FYYA 3MRJA 3OB0H 2EDEA 3TIEA 3S5LB 3WKMH 3MV9B 4BFBD 1FLRL 4F57L 5F7MC 2VDRH 2EKJA 1OGAE 1ZGLA 1WFTA 4XCFH 1U95A 1VERA 1RHHB 3EOAB 4F7CA 1Z3GL 4LLMB 4JFDD 3MRBB 1OSPH 2DJSA 5JORB 1D6VH 3FZUD 4JZJB 1DSFH 3G5XA 4XTRD 4P5TB 5D93C 2PETA 3CUPB 3JV0A 2NX5D 3ZO0A 2GTWA 3H6JA 1WBZB 5I17B 5HYSA 1EEZA 1H15B 3W0WB 1DQDH 1JIBA 4X7TB 4L8CA 3SCMD 5KSUB 2FRGP 3KPLB 1W0VA 3CFDA 5GGTL 3MGAA 1C5BH 1VADA 2GQHA 4JM2D 3SY0A 4HXBH 4NQXA 2EZ0D 1GGTA 4ZFFB 4MAYB 3NA9H 3NZ8B 1AGEB 2CQVA 3F58H 1T21B 5JLZB 1NGXA 2GCYB 3QHZL 3OKLA 1WBZA 4YDIL 4NNPH 2HJKA 3P11H 3FB5B 3TT3H 1UACH 1AD0A 1S7SA 2CGRL 2Q1EA 4MXQD 3A6BH 4N0YL 5DEZA 2R8SL 1HZHH 1MIML 4JG1H 3MMEA 4Y8AA 1OOAA 5DJ8B 4H8WH 5SWZA 3SBWC 1GGUA 2ZOLB 2BXZA 3MR9A 3MV8D 2Y07H 4OD2B 2O61A 4PTUB 5K9JH 1Q9LB 3NFSH 4WFHE 4OZIE 5E9DA 2EE6A 2C3GA 2NXYC 1IGCL 1AHWC 2W0FA 2B1HH 4L8SB 4R0LB 4POZD 3VFWB 2A2QT 2UWEF 2Z8RA 4JRWA 1OLZA 4NP4H 4X5WA 2J3SA 1L9NA 2UUDK 3CX2A 4PJBF 3LKPA 4WUKL 3MUJA 3QDHA 5BS0B 3FL7A 5LQBH 4XNZB 4HFUH 4ZQKB 4I2XE 1IGYA 4HJGB 4UAOB 3TWCH 2YMXL 2GSIA 4FNLH 5BRZD 5IEKB 2VDLL 1A6TA 3HZVB 5FM8A 3SE4C 5EN2B 4Z8FH 4E42B 3MRHA 1E4XL 4L3EB 4X9BA 4HG4J 5JHDD 4QO1A 3PGFL 4P5KA 3OL2A 2Q8AH 5HGBB 3U0TB 4NZJA 1PLGH 1INEH 3MODL 2NY4C 2NY7L 5A40E 2VDKH 4OKVA 4KRPB 4OD1H 4P4RA 1HXYB 1O7SA 2ZCKL 1F90H 5AWNL 1XF5B 2GJ6A 4V2CB 3WDJA 1D6EA 1Q0XL 2VL5A 4KK9D 3TVMC 5EWIH 5SX4I 4DFHA 3GJFB 4MWFA 3MA7B 3PP3H 4LCYA 4LAJH 4HUMB 4ORGB 4LPVA 4TVPE 4XNQB 2VABA 3EDFA 3LQAL 4NN6B 2B5IB 2MWCA 3EZ8A 3HZMB 5F9AC 1OP5H 3BDYH 3OJ2C 5B21A 2FATH 1S5IH 5ERWB 3EO1A 4G8GD 2WUBH 4UT7L 4PJBB 5E70A 5D2LA 1A1MB 4NCC1 4OLVH 4UIMA 4XHQA 1HHJB 4XP1L 4F7MB 5EUOF 3T0EE 1UA6H 3OXRA 3ZYOA 1PKQB 2Y5EA 5C0FA 1HYSD 5BS0A 2QADC 3L3OA 4A6YH 1CYGA 4HMDA 1GC1C 3QUZA 2VN4A 2V2WB 3EO9L 1TJIH 4YHIA 4I48B 4YBQC 4NJ9L 4U31A 4P3DA 4WFEE 4I0CC 3TBYA 5J3HD 4Y5YB 4M3JA 2HFEA 2FWOB 4XNZC 1JF6A 4M5ZH 2V17L 4KRNA 4IBLT 4TVSa 3TCLB 3BPCA 4YHYC 5ITBL 2LQRA 1J0JA 2KH2B 2DI7A 3T2QA 3JV4B 3T1WA 3QCVH 5TDOA 5DQJB 1P7QB 1UWGH 2J4WL 1YA5A 4JPWH 2X40A 4B53A 4H1LG 3FQUB 1GZPA 3MLWH 3GIVB 4KVNL 3MV7E 4PTUA 5IFHL 4ONOA 5D70H 3MUGA 3RRQA 1PX4A 1YN6A 5JHDB 3CFEB 2PTUA 3GMMA 3O6FD 4P59H 1IILE 1AQKL 1YJDH 3DETC 1FHGA 1FO0B 3X3GH 1ZHKB 4TVPH 3TV3H 2P8PA 1OGAD 3GHBL 3MBXL 1UC6A 1CLYH 3CSPA 1M1SA 5E03A 3CZFA 4M6NL 5ESQB 5ICZA 4RMVA 4U3CA 3RAJH 1T21A 2GJJA 5FK9B 4U6VL 4YUEL 4KI5F 4HGMA 5I9QB 4BK4A 2EH8H 3MOBH 1J1PH 5J1SC 1FZKB 4XC3H 3PGDA 3HNTH 2LU3A 5E8OA 5FGCE 1FGNH 3MA7A 4LCYB 2GAZA 1E4XI 2XQYG 4OD3H 3HLAB 3MRGA 2HH0L 4GKSB 2P8PB 2J5LB 5FHBH 1P7KA 5IESH 3NABH 2E9JA 4WO4A 3VH8B 3NACL 5IP4A 4WEUD 4P4RB 1NGWB 2Z8SA 1R3HB 3MV7A 4JFYA 4FTVB 4A2MA 4X4XA 5JMRA 3VFMA 1UFUA 1P4BH 2F8OA 1N6QL 4XPTH 5I1DB 4S1DD 3TP4A 2ERJC 3IRPX 4FMFA 4MA8H 5SV3A 4RAUB 1CL7I 5CGYC 5SWSE 5L2JB 3PHSA 3MC0A 1O7VA 1V8HA 4B41A 1BX2A 5FCUH 1FO0A 4JFZH 2NPLX 2XFXB 4MX7B 2YWZA 4PG2C 1KSRA 1OM3L 3KPQB 4DTGH 5KS9E 3I3BA 43CAA 1CU4L 4NDMA 4LVHB 3ARED 5I15H 3MV8E 1FFQA 2NR6D 5IMKB 15C8H 4TTDD 4LLWA 4JQXA 2DQJL 3QXAA 4Z7WF 3C5ZB 4V1DB 2IH3B 1G0YR 4Z0XB 2ICWI 1PG7W 1W72L 4MSWA 5L88L 1XGRA 3CAFA 3MUHL 2JJSC 2KQNA 4LQFH 2ZUTA 4LCUB 2X89D 5DJAA 3FFDB 4W6YB 12E8H 3BMWA 4PP1D 5GSRA 3ROLB 1A6UL 2AXJA 2QBWA 4JKMA 1MCJA 5J57B 3B3IB 2M2DA 1R24A 3IXAA 4G6MH 5AG9A 3W5NA 3R8QA 1MHEB 3V6OA 1P69B 1QSEA 5JA9A 3LV3A 5D7JD 1JWMB 4G9FB 1H3TA 4G6AD 1UVQB 3CJJA 3MLSL 1EO7A 5IHBA 3K1KC 1UXSA 1TITA 5L9DH 3T4YA 3PHQB 5A16B 4PGJA 3ARXA 5I30H 1RPQA 3WJJA 1RULL 4HK3J 4U3HA 4P2CG 5EU6D 3O0RH 3GSOB 3TNNA 2DI9A 1P5VA 5DD6B 1MJ8L 4LGRB 3FONA 3IU4H 1JK8B 1BEYH 2I25N 5F1KC 4O2FA 2X70A 3EDKA 3WUWB 4OM0L 3RTQD 1MHPL 4HGWB 2X1OA 1TZIB 2IANE 1FYHB 1I85A 4O02H 3AREA 3T4YB 2F54B 1LWRA 3GBMH 1ZSDA 4LIQL 3QXUA 4N0RA 2ESVE 2JE8A 4YEFA 5T1LA 1U58A 3WXVL 3B9AA 3FQXA 5DLMH 5GGRB 2FB4H 4CMMB 4ELMA 4P9HC 4D3CL 4DWHA 2VZ3A 3O4LA 3OAUL 5DD6A 5I1CL 2VDNH 4N8VG 5HGHB 3N9GL 4B0MM 1R6VA 2ZJSL 4ORGA 5SWQB 4JCLA 3S97C 3CDYA 1MFAH 2QSVA 1MPAL 3HPLA 5K9QG 2FEDD 1KF9B 2BP3A 5JW5B 4HXAL 5JW3H 1QFWM 2YD5A 4G9DB 3U9PH 3V0VB 1H5BB 3TH2T 1X5AA 1J1XH 3HZYB 4JZNA 2FGWH 3EIFA 4OD1L 3REVA 3MRHB 4L3EA 2C1PA 3QCVL 3WDHA 2CKBH 2WWKT 4GRLA 4PRPB 1S3KL 3QJHB 2BHUA 3BIBX 5HTSA 5DUBA 3ZHDA 5C0FB 3KYOA 3G5ZA 4LHUB 3BPNB 3JTSA 4KDWA 4OF0A 2C9AA 4Z0XA 4X4YB 5IGXL 3QNYB 3WN5B 5L2KB 5EC1A 1T6WA 2BVOB 3MJ8B 1XGPA 1OSPL 2K7PA 1KB5L 2YBRB 1QRKA 4QHKI 5HVHC 1OAQL 4P4KA 1NCDL 1YEFH 1YN7A 3I02A 5T1DL 5HYFA 3TNMB 4RZCB 4CJ0A 4EI5D 1D5XB 1F6AA 4WJ5A 3O2VL 3UTSD 5EBWB 3U4EA 2FX9H 4HGWA 4JPIB 3RVXD 2VXQL 2XQYK 4TSCL 4PJGE 3ARYA 3QXWA 5E9DB 2VO5A 1W0WB 4U0QB 3UYRH 3CFCH 2Y1VA 4MB3A 3V5KB 1LO4L 2BVQA 1Q72L 2F9BT 4NGHH 2VXUH 2NXZB 4KQ3H 1J1PL 5FF6B 1I8LA 3D3VE 3UPAA 3EJYC 3SCMB 4R97C 4LHUG 3TIDA 1NLBH 2JIXB 3OQ3B 1UCBH 4JQXC 3W9EB 1UJ3A 2UWEA 1S78C 2GTWB 2R8SH 2O5YH 3WEXA 4PJ5B 3S37L 2ATPA 5HGAB 1HEZA 3KPMA 2P45B 4DK6A 2AKRB 3HPJA 1RJLB 4NHUB 4X5LA 4P5TD 4J1UB 2H32B 4JO1H 3WDIA 4M1DH 5E7BA 5GGSY 3U0TA 4G80B 1OTUD 3OTTA 4QYOB 3EDDA 4D8PA 1U95B 1FNLA 4HUXA 1MCCA 4M93C 5T3ZH 2J5LC 5CJXC 3UJJH 3GIVA 4NQCE 1XZ0A 3O3AB 1XF5A 1Y6MR 2BOBA 4RSVA 4EI5A 4YXLH 2X7LB 3BESR 1A7RH 4QKXB 3CDCA 3VFNA 2VE6A 3UTSA 3CXDL 1ZTXH 5CP7A 2EDOA 3D1MC 2VDKL 1XGQB 2VDPH 2Z92B 3X14A 1L6ZA 1RK0A 3EO0A 4PJGB 3SDXF 3WKML 4JZJA 4WEBL 2OX5A 4X8XA 1ZT7B 1A6ZA 1DN2A 4QRUA 1IARB 5F88B 1FNEA 3X11A 5E2WL 1K5NB 3UTZA 1VDGA 2E9BA 4I48A 3X13B 4J3OC 2BK8A 3BJLA 1J0YA 1HKLL 2WP3T 4DN4H 1QSEE 1BWMA 4ZPTB 4FOMA 3V6OE 4LARH 4UI2A 5E6YA 1MJJB 4IMKC 5I1DA 5CSGA 5EBLB 1RU9L 2OL3H 2VISA 5E4IA 2RR3A 3EO0B 3GMNB 2A9NL 4PJGA 4ZUVB 5MEPA 2EDTA 3V0VA 5E1AA 5E8DL 1XFPA 2QHRL 3A0OA 5DVOA 3OXRB 5AYQA 2CMRL 5HDOA 5ISZB 2ZCHH 2F19L 3PDDA 4RDQG 1Z6JT 3DX8B 1FG9C 4QY8B 1PBYA 5ICYB 5JQ6L 3Q1SL 3G9VA 1AGEA 5GJTH 3QWRD 3V6BR 4ALAL 5D5ME 2HKFL 4A6YB 4UNVA 1F4WL 1P4IL 4BZ2H 1KFAL 3ARDA 3SN6N 1S9KC 2FL5B 5D1QA 2X2YA 4GMSH 5E94B 2V2TB 1FZOB 2HWZH 2NY1C 2MQCA 1RUML 3QIUD 3MPCA 2OMBA 4PGZA 1TMCB 3P4NB 4ZD3H 4PBXA 3HRPA 4X8JA 4X83A 3CH1B 3GBNH 3LKRB 2EE2A 2PW1B 4X6CA 4ZNEA 3SE8H 4M48L 5D1XD 3FO9A 1UYWH 2UZXB 3MUY1 4UT6L 1YQVL 1JL8A 3PGDB 5EO9A 2Q20A 4WV1B 4XP1H 4KTEL 2AKRA 3HPJB 4L3AA 5GRUL 1MEXL 4R7DA 5FV2A 1CE1L 3CD4A 4PYHA 5D8JH 2QQLH 4LLDB 4I0PB 1NMCC 5HDQH 2A74A 5D1QB 4OLUH 5JHLH 1W2KT 4RGND 1T03L 3U82B 1P9MA 2HFFA 2OQJB 2ED7A 3KNBA 3F7PC 2MHAA 2X4TA 5TQ2H 3LN4A 4KKCC 4AMKH 3LVEA 3IETB 3EFFB 3H9SD 4LSUL 4S1SH 4XVUD 1FFRA 1UCTA 3RX5A 3BX7C 2BSTA 3ECBB 2ZG1A 1YN6B 1NANI 4P4KC 2L0DA 1ZT4B 3RDTC 4IJ3B 1I7TA 4H0HB 2MCPL 4PY8I 2D4DA 5D9SB 1YC8A 1N4XL 1DQLH 2XKNB 3PDOB 1RZKH 3SE9L 3O8XD 4LCWB 5F9OL 5GRJH 3RUGF 5F3HB 1MCQA 2FGWL 4DW2L 3WMSA 4ZO7A 2ED9A 3U6RB 2V2XB 5DO2C 4JFHE 1A6TB 2VQTA 2BVOA 3IVKB 3QULB 1Q9LA 3UZVB 4MD0B 1K5NA 4Z7QF 2DLTA 1A14H 4U1SB 4GBXA 4F9PA 5IB2A 1DDHA 1L4IA 3BKMH 4XAKE 4QXTA 1B4RA 1JN6B 2R2HB 4ZTOH 4F58H 1K2DA 1XIWC 4ZXBC 5GZOD 3HC4L 5E00B 2FECI 3STBA 5J9PA 2UUDH 2DM4A 5CSBA 3SKOB 4NO5B 3HB3C 4IRJC 2V5TA 1U3ZA 3VRLE 3C5ZC 5C09A 2PXYD 3ZE1F 4YWGH 5C8JA 3UTZB 4I18A 4EXKA 3E6FA 1PKQA 1BQLL 5E8PB 3WNOA 1UWXH 4KI1A 1EDQA 3FOMB 4WV1A 1OP3H 4ODUA 1IC1A 3PJSA 1EFXD 1CIUA 4X6FA 3JWOH 3QXTA 1YY9C 3UJIL 1RUKL 3TBVA 3EFDH 3OKMB 3N9GH 3KGRA 1JPST 4RQQA 5EU7E 3TPKA 3GSVA 3K80A 3QEQD 3O6KH 4ETQB 3ZT6A 1BD2A 1QNZL 3S9DB 1LP9B 4CMMA 4ELMB 4Z8FL 3TC9A 1AXIB 3QSKB 3QDMD 1AP2B 1U6AH 4L4TA 1C08B 1NCBH 4GBXD 5IFAH 4W6XB 2DQUL 2F5BH 3WNNA 3BP4B 3EYQC 3DLQR 4JFFB 3AREB 3LIZL 4AQOA 2VKWA 4ZS7L 4NN5C 2EIZB 3V5KA 3KXFA 5FCSH 1CDUA 1CXEA 3WV0A 3RNQA 4X8JB 3U48A 2FZ3B 3P9LA 3O41A 2C3VB 4GQPH 2X05A 3S6CA 1MJUL 5HD8C 4L5FL 1ZTXL 3B3IA 3C2AH 1PG7X 5GGTH 4ODXB 2HA1A 3SKNB 1QRND 1IGML 3IXTB 1OQXA 2HT3C 1XGPB 2BY3A 3FT4B 2H6PB 3QXVA 4WI9A 1QBMH 1RIVH 2DWEB 4JFQA 1N59A 3LQAH 4G9FE 1UXSB 1P6FA 2YPLB 4I5BA 2B1AL 2DOCA 3PDGA 2I9TA 4PRPE 1NCDH 1YEFL 3ESUF 1OP3K 3MLUH 1FNGB 1P84J 1SEQH 4MCYA 4OAWA 3M1BA 2NXZD 5MP6L 3X3GL 4XMKL 2NZIA 2EXWD 4POYA 4Z7OF 4ONGL 4AIXA 1OAYH 3GI8H 5J8OA 4OGYL 3FB8A 4U6VH 4CVWA 3UBXI 3N1PC 4LSPL 4PLJC 3WIHA 2PO6B 3C5SA 3VXMA 1C8PA 4G6FD 1IZKA 3P0VH 1ZE3C 4OIIL 3HE7C 3BE1L 3BZFB 4POZC 1DLFH 4F37F 5IB4A 5CLTA 4X6BB 4JAMB 1UQSB 3CMGA 1A7NL 5D71H 1LDPH 2VR9A 3E3QE 3KHQA 3KPQA 3FQRA 5DHVB 4HIJB 4GO6B 4YDKH 3GJFK 3QUZD 4X7TA 3ZHLA 4L8CB 4FQQB 4GKNB 1TPXB 1VCAA 2FEDC 4LNVA 3UTSB 5I17A 1MJ7H 5GQBA 4XPTL 5JW5A 1W72B 1TZGH 5DLML 5H37H 2XPGB 3PWVA 3U0PB 4KROC 1WISA 3E0GA 2YPKA 4OM1H 5HHPA 2XNAB 3HFML 3M07A 5JIPA 4HKZA 2V17H 4P2OD 5HYQB 3GSXA 4Q6IB 1U92A 3NCBB 4PJCB 1FRGL 5HHNA 5HDQL 3OKEB 1BJ1H 5DT1H 1SM3L 1RJCA 4GRWF 4P2RA 1SQ2N 4HF5L 1JHKL 5E2JA 3SDXE 3OKMA 2CLRA 3ARDC 5T3ZE 5TDNB 3CFEA 4LAQL 4JDTH 5E8OB 4NHCH 3L5WB 4OZHB 3VFGH 2IBZY 3Q5YA 1PY4A 4FP8H 1Q94B 2WMPA 3BEWA 3GHBH 3S34H 1MCWW 3ULUD 2AJXH 5HHVL 1JZ3A 3NPSC 5F3BA 3TO4C 3CU7A 2WK2A 1RIHH 1FL6B 5C0NC 1KIRA 1IJ9A 4YDIH 3ZYIA 4Y7MA 1NKOA 4K7PX 3GSNB 2QSQA 2NY2C 3OSKA 1WTGT 1QFWI 5F9OH 3JSSA 5GRJL 1JI2A 4GXUM 5EN2A 2XZAL 5DMIH 4JY5H 4HKXB 1QRNA 3LMJH 5EIVA 1BVKB 5C0JA 1DVFC 2JTDA 4YDVB 2Y7QA 3PWLA 1A9BB 4YFLF 3V5DB 5L9DL 3S96B 1OLLA 1OAQH 2QQNH 3SDAC 3WFEL 1XH3B 1XF1A 4L9LC 4ZFGL 1KLGA 3H3BC 4GAJL 4ZAKD 1MVFA 4ZTOL 3D9AL 5IM7A 4ZMAT 5I1JH 1KB5H 5FYKE 3BW9A 4Q6IC 3BD5A 3REVB 3PNWB 2FBOJ 4JY4B 2D7QA 5HXMA 3AXLA 1KTDA 3ARSA 3U46B 4PJCF 1H3UA 2YA1A 3B9KA 5HHOD 1MIEH 4NZRL 3JUZA 3MMEB 1QTYT 2H2PD 1JFQH 1HHJA 4PJEE 2P42B 1AE6H 3LEYH 5EZIL 2VAAA 5DJ6B 3WXWH 1CFSA 5I1IL 5FCUL 4PJBA 1RZJC 1RK1A 3LEVH 1TVDA 3IDMA 4NO3B 1IGTB 3TJHD 4W4NA 1OD7A 1HKFA 2YC1B 4XP4H 3STZA 5KOVC 4XX1E 5J4MA 4QRTA 3ARFC 1U8IA 2HKHL 2IBZX 4P99A 1JTTA 2VDLH 32C2B 3O9WA 4YHML 3KPTA 4Y4KB 1S9WA 4KPHL 4L29A 3FN9A 3EDJA 4PJFB 4UAOC 3CDGA 1HXMA 3IS0X 5D2LB 1DJSA 1CICB 3KYNA 4WTZG 3PABB 4X7EC 5HHOE 1SY6L 4KTDH 3S3SA 4XNUH 5LBSH 1OGTB 2DIBA 2YD8A 4OCSH 4TUKH 1I9EA 3QIBC 1SJVA 3RAJL 4Y4FD 1B88A 4WW2C 4K8RH 1RZFL 1IC4L 1NGQH 5KJRH 4LOUD 1N8ZA 2P5EE 3U36A 4OF3A 1QPXA 3HHRB 3N0PB 2BZDA 2PN5A 3Q1SH 4PYGA 4AK1A 3RVTD 1UWEL 3RWCA 4JR9H 1X5JA 1CDIA 5FGCB 1BEYL 1RU9H 2OL3L 3H2WA 5E6IC 4D9RE 5BO1H 3C6SB 1KPVA 1KFAH 4QXGH 4NQVA 4C58B 4LLUA 2PCPB 3TBTA 3VXRD 2XTJE 1EO8L 2ADJA 1HKLH 3E6HB 4BQ8A 2DLFL 2J8HA 3DYOA 3GUTB 3EW3B 5C2BL 4IRJA 4YNYB 5GGQL 4QXTB 1FAKT 3EYOB 1NUFA 2F5AH 1INQB 4ZO6A 2F53A 5FYKH 3UTPE 2ESVD 3GJFH 5MEQA 4XXCC 1H3WM 3WUWG 2CMRH 5SWZE 5CEXA 4R8WH 5I1EH 3NGBC 2J1KA 4JM2A 1KN2L 3GMQA 4IRSC 2D0HA 5B4MC 5FUOL 4H1LB 5JQ6H 3MCG1 1IBGH 4LP4A 5GJTL 2WLZA 4DGIL 5ILTL 5F7EL 1QLFA 4NN7C 4Z77A 1JHTB 4N68A 4RIRA 4U7MA 3VFMB 5DR5L 5L0QB 3U4AA 3SPVA 5F7WC 3IJHB 3S37H 4IRSD 4S1RH 4XRCA 2WP3O 4W4OA 4GS7B 1GYAA 3MYJB 1J86A 3R06A 4M6OL 3V0WL 1SJXA 1NC2D 4R90H 4RWYL 3QO1A 1CDBA 4ODSL 3LKQA 4IHOA 4HC1H 1JGUH 1NMAL 4LHUD 3W82A 3ARFB 3O2DH 5CSZB 3ZKNC 4I3SL 3ARBB 1NBYA 1YPZB 2EO9A 5DRNB 2J4WH 1CD8A 1ZV5A 3C2AL 2WZPD 1W0VB 2Q6WB 2XIDA 2IGFL 1A9EB 4WHDA 4YHOH 5FUCC 3MRIA 3MRKB 3W0WA 1MVUA 1FCGA 1NBQA 1F4AA 4S2SA 3VD3A 1NCWL 2X89A 4FZ8H 1IAOA 1ND0B 4CU8A 4M7LT 2N1KA 2NY2B 3CXHK 5GISL 4ZFFA 3UTTE 4Q74A 2OZ4L 1QRNE 3ZDZE 4MQXC 1A6AA 1YZZA 4I0PC 3QDMB 1N26A 1XGYL 4P57A 4Z7WA 1UG9A 3U0WH 5IESL 1LE5A 3RWFB 3T2OA 3BKJH 2CPCA 1HQ4B 3PE9A 5CCKH 5INDA 1CGYA 1OGAA 2IAMB 4I9WD 2IAMD 1QLRA 1JYWA 3I50H 3TN0A 4WEMB 3DUUB 3TBVB 5CILH 2F19H 1JV5B 1NLBL 4PJ7B 3LMJL 4G8EA 5IBLD 4U0RC 1D5ZA 3BP5A 3QDGA 3WO3B 1R0AL 3HS0B 1JYVA 1GH7A 2IPUK 1CLCA 2CKBA 5T1MA 2BVPB 4XI5D 3VA6A 3VXQA 5F96H 2CR6A 3RU8H 3S7GA 3R4DA 5DVLA 1LMKA 4WI3A 2CSPA 4X7FC 3TZVA 3FB7B 4YJZL 3RKPA 2CRIA 5HGBA 5T5NG 2ARJQ 4Z78B 1IC5H 1LQSR 1T22A 4KI5E 1N6QH 15C8L 4TQEL 2GY5A 3ALWA 3LKNB 4JRYB 5E6ZA 2HT4C 1FBIL 3O3EB 5DJYB 4XPBH 1VACA 4JFOB 4JFZL 3C08H 4JPVL 3KPPB 1AXTH 3SKMB 3BGFB 2CIKA 4JANA 3RY4A 25C8H 2ZOKA 3WIHL 4JJ5B 1KJ2A 2WINA 1MCNA 1S7QB 5F9WB 5HJ3B 1NBZB 6FABH 4XPGL 1TCRB 3GMPA 5IQ9A 2KQMA 4OGXH 1S3KH 3UBXG 1MQKH 4EUPH 5I19L 2HT3D 4HJJL 5B39A 1G6RL 1NEZA 1ZVSA 1UB6B 2YS4A 1K8IA 3PL6D 4H5SB 1JWUB 5CBEA 2ZG3A 4YR6A 1BFVL 3FKUS 4U6XB 1N5AA 2XN9E 4X80L 3LZFH 4ZS7H 1FFNA 4MD5B 3MRCB 5EO9B 4LVOB 4FFWD 4LSQL 5JXAL 3UXFA 3ECBA 1CK0L 5GIRB 3KLHC 1LO3H 1NCBL 1RIHL 2FJFA 4HZAA 3F12A 4K23L 4FQIL 4H8WC 2NY2D 5DZNA 5C0BE 1JGVH 4NOFA 1OAYL 2PNDA 1RD6A 5CWSB 3GSRB 3J7HA 1IL1A 1LEKA 4LKXB 1X3DA 1MCFA 4JM2C 4O51B 1A6VH 1KJMB 3TBTB 3ARFA 3WHXB 1IGIH 2R2EB 4DCQB 1MWAH 1J0IA 2XZQL 4TNVF 4JO4H 4N0FB 4TSBH 2I60L 4GXUN 3RVXC 5JNYB 4UV7L 5F9DC 4EI6B 1AD9B 3KJ4B 4NC1E 4AJ0A 3QHFH 4LEXH 4HWEH 3QEQA 2XA8L 2DLFH 3RVTC 1G7HB 3RIAF 4CNIB 4TTDC 1EJOH 1I4FA 2DTML 4XH2B 4L8DB 3BJ91 1P2CB 3WSQL 1FL3B 1MJJA 4WFGD 1EUUA 1J8HA 3DIFB 1JFQL 2XN9B 3C9NB 3KPSA 1M7XA 3P9MA 5IR1A 5FO7B 2W60A 1CR9H 1TENA 1CFVL 1NAKH 4HHAA 4X6DF 3ZKMC 1JZ7A 5KS9A 1XEDA 1WLHA 4WHYH 3P0VL 5J12B 4MGXA 4WW2B 4WWID 4KJPD 4BSWB 5MHSD 5SWZB 4FQHB 1J12A 2D31A 5HYSG 1U36A 2DLEA 3UTPD 3MO1A 4HEME 5I8OL 2EEDA 2ZUUA 5DJXB 4DN3H 3ZKMD 2VSDA 4L4TE 3BZ4B 3CMOH 5SWSA 2BNQB 4Y2DB 4R4NC 5HI4D 4MZ2A 5D7JC 5I1KH 2NZ9C 4PGDA 1WZ1H 5C6WH 2DMKA 1KTKE 1Z2KA 1ZAGA 5DC4B 3INUL 3KYMA 3QNXB 2NY5H 4XPHH 2MQ3A 5IVXF 3VW3H 2ZOLA 4KRLB 4NQXB 3M8OH 3HAEA 4ODVH 4HZLB 1ERNA 4JFYB 1X4ZA 2Q7YA 1ZT7A 4QWWD 5IVXE 3UTQB 3VGAB 3VXOB 4DVBA 5IWLA 2M8XA 1IAKA 5IW3A 4Y1AE 2YWYA 1CZ8L 2HRPL 4HDIB 4PJ5A 2OMNA 4S10A 2FJHB 3KLSA 1H15A 3SGEH 4K8RC 1N5YH 1I8KB 3W9EA 1I9JL 2BOBB 1CGSH 3RY5A 3S34L 4X6CF 4F15C 1C1EH 1LK3H 5KVEH 5D7LD 4EVNA 1YECL 3VXNA 5FYJH 1U91A 4LAQH 4UT9L 5IG7A 2W0KA 5GS1A 2JF1A 4PD4J 1QSFA 2PTVA 2ADFH 3DV4B 4NQCB 4OGAC 1CGUA 1F58L 3D85B 2Y6SD 2DWDA 4HV8B 4Y5XC 1RUQH 2AI0H 4Y4KD 5EC2A 4YXHH 2V5YA 4OZIA 3STZB 3IT8D 4JLRB 1S7UA 3O6MH 2J8UB 1NEUA 1LDSA 2GIYA 4PLKC 5L88H 5TFSH 1OW0C 1HHGA 4PGEB 4ZUTB 1QSVA 4IRZL 2CLVA 3QAZB 5GGTA 1FAIL 3RDTB 1YEDA 5J1TC 1X5ZA 5D1XA 2BVEA 4DGVH 3ETBF 4PRIB 5ETUA 3PQYB 4G8GB 5LJYH 5GS1B 4KJQD 3QEQE 2AJ3A 1MCBA 3D3VB 3QI9C 3Q2CA 4HX1B 3HI1B 1LDPL 2VLMD 1WWCA 4HMEA 5CJ5A 3TVMB 4KUZL 3N85L 2HTLD 2CKNA 1GGYA 3EUUA 4TQEH 4YHMH 4F7EB 3UTTA 1CFQB 3ZL4H 2Q76B 5EG6C 3HNSL 4PY8J 3S36X 3VWKD 2CDFA 2H9GB 5E8NB 4YXLL 3ZE2E 4K7PY 3S96A 1FFOA 2XNAA 1MAJA 3DRQA 5J1AA 1MH5A 4WI7A 1R5IB 3V4VH 3RPIA 2IGFH 4HK0B 4WEBH 1KIPA 2X4QA 1ZT1B 3GZKA 4LDEB 3D48R 3V8OA 3PP4L 3IAQA 3BOVA 1H3PL 2NY0D 5FM5M 3BKCL 1N3NA 2DICA 4OTXL 4LPXA 3KPNB 3DI3B 1RJZA 1U3JA 3OPZH 3KXFE 4OLVL 4TOYL 3KVQA 3ARBC 2VLLB 3OKOA 1A7PH 1FIGL 3GO1L 2HLFC 2R1YA 2V7NA 2A38A 5DO2D 3NTCL 4R2GC 2ICEA 4K3GA 2DAVA 4RGNB 1MRFL 3PWJA 5AD0A 1KIPB 2X4QB 4XNUL 5LBSL 1D9KA 2C3WA 1NGWA 4AZ8A 5BS0D 1DQML 4HK0A 4MQTB 3DVGA 3HC0A 3VXUA 2CLZB 4OLZH 3AVEA 3QI9B 5GGQH 5C08D 4DQOL 1BBJA 1MRDH 2I27N 4MLSA 5HGHA 3UTTD 2X4RA 1UENA 5AYUL 1K4CA 2R0WH 4EUPA 3FQXB 4YEEA 5D7KE 3QXDB 3RZCB 1CBVL 4EZMA 4MDIB 3ISWA 2BVTA 2OTUB 2Q3AA 3B9DA 1Q38A 3ARRA 5HGDB 4LSRH 5KOMC 1UWEH 3HG1D 3CGTA 2MCG1 4WHCA 1MI5A 1XIWA 3L95A 4H26A 4KUCD 2WBJC 4GKNA 4NM8H 2OZ4A 4IOIA 2UVFA 4UZGA 1TVHB 1ZKAA 2GITA 1GGBH 2DLGA 3WKNA 1T89C 2Q7NA 2DQGL 2E27L 5EU6B 5F6IB 4QHMB 4WUUD 3WFCH 3PV6B 1JZ8A 4ORZC 2IEPA 3VD5A 3EYQD 2E6JA 1UKSA 3DRTA 3FFDA 1IFHH 1WFOA 3TGXA 4U05A 5F44A 1S7UB 2AJSL 3IYLW 4BQCA 4G7VH 1D5MA 5IWLC 4QXWA 4F33B 3WJLA 2HFTA 3QB7C 4X0KA 1OTTD 2R0LL 1A5FL 3TA3C 1KLUA 1B0WA 2B1HL 4BZ1H 5DQ9A 3BPCB 2FX8L 1WVZA 5TE6L 4XP4L 4LSUH 4J2XA 5F1SA 4FNLL 1HSAB 1LP9A 1F11B 1KCSH 3IDYB 3IDXH 4BH7A 1T3FB 3TYGL 2D7NA 4X4ZA 3PGFH 5JO5B 5J12C 3VGHA 1X6NA 3QG7H 1T1WB 4E5XA 1BOYA 2WWMD 1F3RB 1FCCA 1Z5LA 1NANH 2I9LA 3OKDA 4QRQA 5FO9A 5KVFH 3H9ZA 4V1DA 5E8EA 2APTA 4P46B 3LPGA 4C4KT 2R2BB 1CI5A 4M1CD 3Q3GA 4MA1C 1IQDB 2ZZUT 4CKVX 4KMTL 3D0LA 1DBAH 2E8YA 4K8RL 3QFJB 5KBNC 1G0XA 1JYNA 3MJ6A 2H26A 1EPFA 3G6DL 4F7PB 4JB9H 3UAJD 2OZ4H 3HKFA 4GRWE 3T0WA 3NZ8A 2OL3A 3OF6A 1A1MA 1IQWL 1VSCA 1IM9B 1CGWA 4B50A 3V6FA 4ZPVB 2B4CC 1C08A 3LOWA 4FFYH 1INDL 1FN4B 2YUZA 5KSBB 4NQSB 3EAKA 4JQVC 5FA4A 4P0DA 4QXUH 4RA0C 1BQLH 4NPYA 4Q58C 3WFHB 1ULVA 3U7WL 4KKBD 5E95B 5D5MA 2XWBB 3TYFB 3MRGB 1CR9L 1UM4H 2AV1B 4NKIH 3WS3A 4Y5YC 3GSUB 4IRZH 1TETL 1AKJB 2XKSA 4IJ3C 4XP9H 4MHHG 3OGCB 4Y2OA 2BDNL 3EJZD 1EBAA 3BP7B 3MLXH 5EUOB 5CJ8A 3VXTA 3A6OA 1WBYB 5ABDE 4MNQD 1T2XA 3HRZA 1EHXA 3X17A 3H42H 2F15A 2JB6A 4PV9A 4AIOA 1BM3L 3PHOB 2WUCH 2BSED 5DJ0B 2QADD 2R9HC 3VWJA 2R2EA 4DCQA 3DSFL 4PTTB 3ZE1E 1C16A 2NZ9D 3CH8A 2X10A 1PQZB 3VG0H 1BJMA 5D7JA 3OJDA 4UU9B 3S37X 2HFGH 4PGCB 1FH5H 3D69B 1FDLH 4XPHL 2VQ1A 4KTDL 1T1XA 5DYOB 4LDLB 3LSOB 4KFZC 3QRGL 4EDXB 4LU5L 2WNGA 4RMWA 5EU4B 3U4BL 4NZTH 5J89A 3D6GA 1IC7L 5ANMB 2R0ZL 3EYSL 2APVA 3DBXB 4FFWC 2G60H 3CC5B 4QGTA 1MCRA 4EI5C 1WZLA 1SYVA 2VDRL 5FHAL 4ZO9A 3GBNL 3T8XB 4L8BB 1GJIA 3AAZA 4BK5A 3N1QC 3ULUC 1YEGL 4OLXH 2ZWLT 1JF1B 5KVEL 3L5IA 2ORBL 4OCRL 2ICWB 4JRXA 2HVKA 2ZUQC 5DRNA 3O3DA 3BQUB 4Z7NE 1DVFD 4ZSOE 1CE1H 2JCCB 4OFYA 2CXGA 1KYOK 3TO4A 4J3VA 4GG6F 2FB4L 3VGEA 2NW3B 3FHQA 4ZG1A 5GGSB 4O58L 2Q86A 5C86A 3DBXA 5D1ZD 1NBZA 4YDLB 1U8HA 3KNBB 4K9EC 3FB6B 3GKZA 4KXZI 1NAMH 1ROWA 3MYZA 3BIKA 2Z0BA 3BWAB 1MFAL 4PJEA 4HXBL 1OW0A 1WTLA 5DXWA 3NCCB 1Q8MA 2NTSP 2XWTB 4EBQL 4MJ2A 2I60H 4HD9A 3AU1A 3LEYL 3NH7H 1G7QA 3HE7B 4ZAKC 3FO9B 4QRQB 4BFGA 2H41A 1N4XH 3SDAA 1KIQB 4MJ5A 1CDCA 2LV4A 5HBBA 3PHOA 3HC3H 4KJPC 1K3ZA 3VFPB 2XA8H 3TZVB 2BNRB 1U8KB 1OWWA 3B9KD 2E7BA 3U30C 1NSNH 5DA4A 2Z91A 1AO7E 4QRUB 3T4AB 1ZHNA 4UBDD 3IDIB 4OKVB 2FNBA 1QLEL 1IEBA 4JFFE 2V5MA 4P5TA 3BRGC 4GQ9H 1J1OH 1TJHH 3MJ7B 3BKML 4X98B 4Y4FB 5GSVA 3QHTC 5C0AE 1I7RA 3M17B 5EIIB 2QKIA 3ULVD 3IJSA 3WSQH 3NIDF 3DXAB 3ZSSA 3S5LA 1T1YB 1KNOA 3AS2A 4P23A 3V7AG 3GRWH 4N9OB 4HKJA 4QYOA 5L7XH 3V52L 1MNUH 1RUAH 2EDRA 4DZBA 5IK3A 1MLCB 5DEFA 5ID0B 4JDTL 3NA4A 4PJXA 4Z7UA 1S7TA 4PG9B 1CGSL 2VR4A 1IL1B 1LEKB 1H8NA 3IGAB 1BLNA 1QFWL 4Y2DD 1XGYH 3IDXL 3IFLH 2PUQT 1KEMH 5BXFB 4JKLA 2P8LA 1AO7D 2VLKB 4I77L 3UJTL 4ODVL 2BNRA 4QOKB 1U8HB 4HUUA 1CG9A 4O4YL 1CXHA 1WICA 2KL6A 4PJDA 4QNPE 4PJFF 3RZCA 1ACZA 2XZAH 5DMIL 1G7IB 5I75C 1R3KB 3I2CL 1MWAB 2A9MH 3QIBA 4AQ1B 3DWTA 4YPJA 2VDQL 4JRXB 1NFDB 1Q0XH 4KMTH 3EGSB 1EFXB 5MEOB 3FOLB 2F5BL 2R56L 3B5GA 1HWHB 7CGTA 4BFIB 1FGVL 3PWUA 1ZT1A 1FG2B 5HI3C 3DX6A 3LB6C 3SDYL 3IU3B 3MJ8A 3WBDA 3P30H 2B2XL 2ICEB 2XWJA 1H3GA 2AW2A 3RIAK 1U3HC 4MXWH 1GZQB 4ZYKA 3RGVB 4OM0H 2HVKB 1RZGA 1L7IL 4RNRA 4K3DL 3N85H 3WO4B 3O3EA 3O11A 3UTTB 1MJ8H 3ZSTA 3RBGA 1ZHBA 4WHYG 5HHQB 4JREB 5IHZB 1FE8H 4EIZC 3O6LL 1S7WA 4NFBA 4JPWL 4IRJB 1N6VA 4DN4L 1CFVH 1NAKL 1JGDB 4IRSA 5J0BA 1T6VN 25C8L 3WIHH 2IC2A 5C0ND 5KN5A 1KPVB 1TNMA 4WUUE 2A6KB 4BELD 3GK8H 2NQCA 4OFYD 5KAQG 4LCCC 2CK2A 35C8L 4JFEE 1NJ9A 3QDAA 3MRJB 2A6IA 1N7MH 1EHLH 3TYGH 2NY0B 1KJ2H 3QEHB 5DJZB 1I1AC 1A7PL 4N1EA 4PP1C 1IRAY 1KG0B 4YGVA 1KXTB 4LLQA 5KW9H 5KANG 1XCTA 3E2HC 2NY1D 3VMOA 3MRBA 1IEBB 2EDNA 4M61B 3TPUB 2AQ2A 4YAQA 1HDMA 2X4OB 3G04B 1BD2D 1CGTA 1QP1A 2Q3ZA 2EC9U 1P84K 4ZSOA 3T0EA 1EO8H 3HC0B 5B38B 4NM4H 4I0PD 2WANA 3ZDYF 3RTQB 2GFBB 1X7QA 5DRWA 1HZHL 4JLRA 1YC7A 1A8JH 5KSAD 1S5HB 4K3EL 4QHLA 4YHPA 4EUPB 4OTXH 4I0KA 2AXGB 2AK1L 1IGJA 1IEAB 1SHMA 3BN9C 4J6RH 4K2UH 1N0XL 5I66A 1UQSA 5IG7B 1C5CL 5FUOH 1IM3B 1OARL 4WWKA 1X5FA 5ECJE 2XPGA 3PWVB 4JDVA 5EULV 3U0PA 1RAMA 1NUNB 5LKNA 2JB5H 1P4BL 5DJ6A 2CH8A 1NBVH 5F1IB 1ZHBB 5SWQA 4GAYA 4AT6A 1QSEB 2YA0A 2EYSA 4HLJA 2QSTA 2HT4D 5ALCL 2PO6D 4IOFD 5IROA 1JPTL 3MRLA 2HYMA 4XB8A 1DP0A 3L7FB 4FFVD 3BUYB 5B8CB 2P5EB 3L5JA 1UEYA 4Q9CA 3C5JA 4UIKL 1J05B 4IMLB 4R90L 4RWYH 4U4BA 1BZQK 3DO7B 3ELAT 1E4XH 4PRDB 4OLWL 1ZA6B 1LK2A 1F2QA 3TCXA 4YHZL 4S1RL 1FZMB 4HAFA 5EUKB 3ARUA 5DEGA 1EGJA 3WUWA 4LEOB 3P77B 3C09B 4M6OH 3V0WH 4YQXL 4XP5L 4KUZH 3GJEA 4I13B 4P49A 1IFHL 1LNUA 1PZ5A 43C9B 5A3ID 3G5YA 1GAFL 4G7VL 4F3FA 5GS0C 1V7NL 1OAUH 1QRNB 2IQAA 2P46B 4QHKJ 3M1BB 3BGMB 1C16B 1CZ8H 2BSSB 4KAQH 1DN0A 1AR1C 3QQ9C 3HI1A 1VFAB 4NSKB 4J4PC 1KIRB 3KHOA 1MFNA 3PL6C 3KYKL 4CVZA 1R3IH 1EEQA 5IMOA 2PYEE 2JK5A 2YEZB 3LEXB 2HT2D 4MA7L 5DMKA 4G8IA 4CDGC 3KDMB 5C0DB 4Q2ZB 1VFBA 4LF3B 4UQ2B 4W6WB 5E5UB 1MHCB 1UB5B 3H9HB 5IW6A 5F7NC 5IJKA 1AE6L 5DTFB 2FDBP 3WXWL 3O9WD 2IFFL 4NPYB 4WHTA 2G2RB 2EDWA 5LXGH 5AZEL 5HGDA 4PJ5D 4M7ZC 3UP1A 4G6JL 1PFCA 3BSZH 1GGIL 1OAXH 1HHIB 5EU7C 5LWYH 5EO0B 2BNQD 2DM3A 2FCBA 3VXNB 1ZWIA 2BSRB 1YEEL 2P5EA 1U2HA 5CZVH 3MV7D 4P23C 5CWSA 1K8IB 3AREC 4X6CE 3GSVB 1FBIH 2BRRH 4KK5C 3OHXA 2R1XB 5CEZD 3QRFM 3DVGB 3VXUB 4ZDHA 5J6HA 5EB9A 5J13B 2Z31A 1TJIL 4MNQA 1BM3H 2W1NA 4DZ8A 2F53E 4UBDC 4KI5C 3OJVC 3C5JB 1CLZH 5I1LA 2Z35B 1KENL 1J5OH 2HWZL 4P5TC 4OUOA 2W60B 5BJTB 2QHLA 1FLTX 2HG5A 2OS7A 3C8KB 4GAFB 4XHJD 1A6PA 4P2OA 4XCFL 4UINL 4X9GA 5E00A 3IRZA 4J8RB 4QXGL 5DMGC 3BQUA 1SJEB 2UWEE 3NCYP 1FVCB 1U8JB 4M8VA 4JANB 2J8UE 3C6LB 5JW4M 1CDGA 4BKLB 5GRWA 3EYFB 4LK4A 4AIZA 1HYRC 3TT1H 2GTZB 4QOKA 4Y88A 4JO2L 2OM5A 5I71B 5IB5A 3VXSA 4ZTPH 5D70L 5C0AD 5DDHB 5IF0B 4O5LL 1AIFB 1XF3B 4OFPA 1ZHKA 5DTFA 1GOHA 1YY8A 1QLRB 1YEKH 1F3DH 2PR4L 1Y18A 5F3HA 3ZTNH 1QA9B 3SDCC 3VXMD 5M94B 4IS6B 1H8SA 5FB8A 5A2IH 5EFIB 4GXVH 4M9OA 5ID0A 3T0EB 1YJDC 1AGBB 1UH3A 4B7LA 1FC1A 1U0QA 4G8IB 3CFBA 3VXUE 4KUCF 2CDEA 2CKBB 4PJAA 1ZANH 1DBBL 1K4DA 2G75B 4O2CB 5SX5H 3UROR 5HYJB 1MCIA 1U8KA 3JXAA 4HLZH 4HG4K 3OG4B 4WI5A 4PJEF 5EDXA 4PP2B 3KLDA 3ARGA 5FGRA 5H37G 1I1AB 3MUZ1 1NL0L 1XR9B 5IOPA 1OAKL 3IETA 3QA3A 3O81A 4PLKD 4QGYA 1DN0B 2CO6B 3P4NA 3PWNB 4KV5E 4N0CC 4AL8H 1PW3A 4H20H 4M1GL 3V6OC 1KCUH 3SHSA 1NUGA 1CTOA 4Y16A 2NW2B 3VXRE 4WNQA 1DUZA 2Z91B 3T4AA 4FFZL 3D85A 2QR0B 4E41B 1TZHA 3GHEH 3TO2B 4Z7OE 3BPOC 3QUMA 1ED3A 3RWDA 1OM3H 2FX9L 5EOCJ 5DS8A 2XWBA 2GHWB 4WENB 1OPGL 5IJVA 4FQXA 2HG5B 2XV6B 3QG6A 3CCHA 2XA3A 2M1KA 4QHNA 4PRDA 2VLJD 4HPYL 1U8MA 4IIQB 1FE8L 1MCHA 2HTLC 4PRIE 1T20B 1RUKH 1GC1H 4YDJB 1T04A 3FO1A 4J4PA 2OK0H 5D1XC 4ZPVA 2CUHA 4L3ED 1OB1B 2FJGB 2PYFA 4XPFL 3LS5H 3O2WL 1GGCL 2EDDA 5TF1L 5E99L 3T3PE 4B5EA 5J6HB 2VXVH 3O6KL 4OZGB 1Y6KR 1E0OB 5F93C 2FATL 5KS9B 2YXFA 1A22B 5ANMA 1T5WB 3F5WA 4QY8A 5FYJD 2VLKA 2ESVA 1EEUA 1UM6L 3DSFH 5FOBB 4LQFL 1RI8A 1UEMA 4PG9A 5AAWA 4LARL 3BZ4A 3QHZH 5SWSB 1I4FB 1KPRA 4D9QE 4XAKD 3GSQB 3DUUA 5E8EB 4OSUL 4W4OC 2KDGA 3EYVB 3ARBD 1MFCL 3X12B 3WFEH 3DROA 3C8DA 4GG6B 1EA9C 3O4LD 4D0DA 2NY0C 1F58H 2YKLL 4MA3A 3D3VA 1DFBH 3KPOB 2VDQH 4NUGH 3SKUD 2R4RL 4PGCA 1C1EL 1JGDA 1ONQA 4L8SC 5DURB 4XNYH 2OR9L 4XNXL 3IFNL 4XXCA 3WS3B 4CNIA 2B1AH 3S35X 5GGVY 4Q9RH 3DXAE 4J6RL 4ELKB 4OCYH 4A6YL 5AZ2H 1DBMH 4BJLA 1C12B 6CGTA 2ADGB 3IKKA 3ARGB 3B6SB 3NVQA 3PG2A 4OZ4A 5IOPB 1FSKB 2PYED 5CUSL 4PY7B 2JB6B 5M95B 1QSZA 3BH8A 5T3XH 4ZQKA 4NFCA 3IF1B 5SWZD 4IRJD 1EAPB 3GSUA 4PB0L 1ONQB 5CIPB 1T4KB 3MJGX 4LP5A 4LEOA 2EXYD 1MEXH 3FMGH 1CK0H 2P8MA 1UJ3B 3UBXB 2D7MA 3GSWB 3H7BB 2IANA 2JIXA 2B2XH 1CDJA 3TN0C 3BGAA 1FJ1B 4JY6A 3LQMA 4AH2A 1I9RL 4JZJC 2W0LA 1WAAE 1QHPA 1A6WH 2FJFB 5FUCE 3DVNB 3LH2L 3GEWB 5EU5A 5CAYB 2Z9TA 4GUPA 1T04B 2FBJL 3KPSE 5T3ZD 1AR2A 4K94H 2H8PB 4I18B 3UTOA 5JW4Q 2UZIH 5D72L 5GS0D 1V7NH 2ZSVA 3BVNB 1EJ6A 4HUWA 1CXIA 2XZCL 4PRPD 4WJ5B 1DQLL 4LVNC 2GCYA 1RK1B 4YHNB 4KAQL 4JHWH 1RY7B 4Q9BA 3JVGA 2NW3A 2OJEA 4EN3C 2ERJB 3ARGC 1FC2D 5TGBB 4FXKA 2C7UB 5L2KA 4DKAA 3IF1A 1P7QD 3DVNA 3SCMC 5F6IC 3MRMB 4M7JH 2G2RA 4KU1A 5IMMA 2K9UA 4GW4A 1UXWB 4NZUL 1DCLA 3ULSA 2E7LA 4M6NH 4CVUA 2EDLA