2CLVB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm8 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct orientation of the alloreactive monoclonal CD8 T cell activation program by three different peptide/MHC complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
chains with identical sequence P
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clvB00
1R6VA 1MWAL 3BIKA 5D2LE 3ES6A 5IROC 3AVEA 1XGRA 3N1QC 1ZV5A 4P2RB 5ESAA 4YDVA 4N8VA 2NYYD 4JFZH 1LVEA 3O6LL 3TBWB 1DUYA 1IGIH 2OQJB 3F12B 2P47B 1YEDB 4PJAB 1A7QL 2HT2C 1RZ8A 2P8LB 5I73C 2CLRB 4PRIE 1H15B 1BZQK 1F3DJ 1TIUA 2W9DH 1JPSL 2W9EH 1F3JB 4I5BA 1FFOB 2HH0L 5K33A 2FO4A 4AH2A 5DEGA 2HLAB 4XPTL 5IB2A 4KKNA 4U1SB 1FG2A 4NN5B 1UGNA 5DT1H 1HQRA 3PP4H 3QFDB 3G08B 3ZTJH 1FN4B 3GSNL 4AMKH 5F7UA 1INDL 3EJJX 4NQCE 5F7MC 4X7FC 3CDGA 3BRGC 3EYUL 5HHXL 2FR4B 2EKSA 9CGTA 3ZKXB 5EU6B 3FN0H 1EFXB 5KVFH 1NC4D 2GJJA 4XHJC 4F7TA 4OM1L 1IARB 2HT3C 4LLQB 3FO9A 1LK3H 4MA3A 1S5HB 3QAZC 4NP4H 4XPFH 3QNXB 4XNQB 3V0AC 4LEXH 3H6JA 3O9WD 4Q9CA 1WFOA 5DWUH 4CN1A 4YXHL 2DWEB 4PJIF 4N68A 3T04D 4LHUG 4OLVL 3PWUA 4NQXA 3WXVL 5D1XD 1F8TH 5CZVL 4M1GL 1TITA 4P5TD 2QQNL 4LIQE 5E2UH 4YO0A 4XC3H 5EULV 1VGEH 4UDUA 2WWKT 4L3EE 1NUDA 3V4UL 4JKMA 5CGMA 1FVCA 5J11C 1PG7L 2DLFH 2HJFA 4JFEA 4ZQKA 1FIGL 4RFEA 4Y1AB 5MERB 3TJHC 2F54D 4OLZL 4X6BB 3X14A 4DGIH 4P3DA 4R3SA 4DQOH 2EECA 2HKFH 4HK3N 2DQGH 5I1LB 1EGJA 1F5WA 4QT5B 5L8LB 2ICEA 2EE9A 4XPHL 4WFFD 4FABH 3MRGB 3A6BH 4QOKE 4QRRB 3IYLW 4KJPC 3BKYL 1FLTX 1JUFB 1HNFA 1RZ7H 3C2AL 5DEFA 2VE6B 2PYEA 2OJEB 4JDVA 5HJ3A 1ADQL 4YC2B 3BN9D 3I50H 3GNMH 3JTTB 4BUHA 1A3LL 5IK3A 1IM3A 5HDOA 1F4YH 4IDJL 5BOPA 4ELMA 4MB5A 2R0KL 2A6DB 3B2VH 3IU4H 4R2GC 5DFTA 5AEAA 4P99A 1ZWIB 5C08E 1XGYH 2ZUQB 4OD2A 4MD5A 2AJXL 4DGYL 1NUNB 3ILQC 4PRNA 2O26U 5F7HA 4MX7A 4FQIH 3K8MA 2E6JA 3FO2A 1IL1A 1MH5A 4NFDA 1AGCA 4RGMB 4PJ5E 2C1OB 2G60L 1QSVA 1G6VK 5CEYB 4P23A 1H9VA 4P49A 1T0PB 3Q48A 2DI8A 4CDGC 5EA0L 5CIPH 3VW3H 1CXHA 1OAQH 3QDGE 2X7LB 1OAZL 3FB5B 3L95A 4Z76B 1QP1A 3C5SA 4R4FL 1HCVA 4HWEH 4NKOA 1C5BL 5E08L 4X0KB 5FHBH 1IC4H 3P4MB 3D87B 2M26A 2BOCA 3EZ8A 4XTRD 4ZMAT 4D3CL 1QO3B 1MWAB 3D3VD 5SWZD 2BY1A 1S7UB 4KGJA 1PDKA 4YUEH 4OF3A 4JRXE 3W0WE 1E6JL 4NHUA 3B6SA 4L9LB 4PJXB 1CFTB 3T4YA 5DK0A 4OLWL 1FZMA 3QUXC 4OGAD 4F57H 1I1CA 5EO1B 3KNBB 3VFWA 5JHDA 5DMKB 1EEQA 4Q0XH 4ZUUB 3P40A 3CVIH 3MRKB 1EHXA 5IHLB 2DQUL 2FX9H 4Y5XB 3OKYA 1MLCB 3IB4A 4LLWB 2J8UA 4YGVB 4OKDA 2XIDA 2DDQH 2HFTA 3GMOA 4XAWH 4J2XA 4LVHB 1TXKA 5FKAB 2EEBA 1A47A 1J1OL 3LKNA 4PREA 1NMBH 1GHFH 1NMCC 3VFVA 1JYVA 2X4PB 3TPUA 3GSNB 4I0KA 1KJMA 4JGJA 5E9DD 4BH8A 5C0RH 3QA3B 5JW5B 2DQFB 1XGUB 2AKRA 4OAWA 4MJ4A 1CDYA 2D03H 2R56L 4RGNE 3SKNB 3DO3A 4PGDA 5HHPA 1HZHL 3BHBA 1AE6H 3KYNA 1LE5B 3FOLB 2AEWA 5IJKA 3DXAD 5T1KA 4GH7B 3DMMB 4GO6B 3HZVB 1MIMH 1X6NA 4JJ5A 3WNOA 3MJ7A 2K3TA 3NOIA 4G7VL 2OS7A 4LRNH 4HKZB 2MPAH 1T1YB 1G7QA 1DQDH 4O9HL 5E00A 5IEHA 2YBRB 5GSVA 4AQOA 2Z92B 3FTGA 1J1XH 3Q1SH 5JNYB 4G80B 4X6CF 3VWJD 2ERJC 4U1JB 2AQ2A 3MV7B 2V7HB 3QULB 1J86A 2GYSA 4BQCA 4GOSA 3OAYK 1HHIB 3UYRH 2CK0H 4CVZA 3UBXA 1FVEB 5KOMC 5D5MF 5ADOL 3J7HA 5FF6B 3ZSSA 1QRKA 2GJ6D 4WHTA 1A8JH 4PJ8B 4PUBH 2GFBA 3X3GH 3FB6B 2DYPA 1MCLA 2BRRL 2JCCE 1FPTH 3CCHB 2EDQA 1U8IA 3PWPE 1P6AB 3KYMB 5JZ7C 2V7NA 4MAUL 4KQ4L 3O0RH 3LEYH 4LSSL 5BS0A 4IOIB 1JZ3A 4HIXL 5KS9F 1ZKAA 2XTJD 1T89C 2YC1B 2OLDA 5AZEH 2UY7A 1CD1A 3Q0HA 5D6CA 4NRYB 4HV8B 3U2SA 2RJMA 5A40E 1V05A 4BELD 2X4OA 4G5ZH 4UIKH 3F5WB 4BUGA 3FQWA 4Y4KC 4JPWH 3O2VH 5F3HB 1ED3A 1AGBA 2NY2C 4LLMB 1I7RA 4ENEC 4F7EA 4HS8H 1FGNL 5DGQA 3NA4A 1S7TA 1U8PB 2O5XH 3ARGA 3WFCL 3PXHA 2VR9A 4GKZA 1AY1L 3SCMB 4I18B 1IE5A 3FT2A 2SEBA 4Y2DB 1NC2B 3S5LG 1NMAL 3TIDA 4PGEA 1IILE 2GUOA 3HCVB 2VZUA 3WJJC 3ROLA 4QRQA 1A1OA 1VESA 5C0AE 3O3BB 4WWKA 2OP4L 5JPNB 5ADPH 5I8EB 2X6MA 2E5EA 3BWUC 3IJHB 4ZPVB 1BZ9A 3X3FL 3GBLA 1YPZB 5BZDB 2VXTH 5GRYA 1J0KA 2VWEE 1XF1A 5EBWB 5C0FB 2AEPH 1NAMA 4KV5F 3UTZB 3OKEB 1MSPA 3OXSA 3MNZA 1EFQA 2AJVH 2XZQL 5HHMD 4S11A 1GYAA 3BYYA 3GIVB 4JPVH 4MAYA 4KRLB 2X9WA 1T1ZA 2R4SL 5JQ6L 3NH7H 3EYVB 4WO4B 1CL7I 3C6SA 2V2XB 5KOVC 4AJ0A 5HHOB 1T7VA 3K4AA 4P2QA 1X7QA 4U6YA 1LWRA 2QJDA 1B90A 4KQ3L 4Z7NF 3GSWB 2QQKL 4XP1H 1B2WH 3CSYA 3RZCB 5JA8B 3PQYD 4M1DL 4XVSH 3PV7A 4I48A 4BFIA 5DC4B 3HI1A 5SWSD 2BNRD 2B2XL 4PLJC 5DD3H 1J10A 3FO1B 3D0VA 3QXVA 5EZJA 2CKBA 3RHWF 2VDMH 4NM4H 3LN5A 1JHKH 3RVTC 5GGSY 4PRIB 5I1DA 3K46A 4L8SC 1IAOA 4NO2A 4OI9A 3IAGC 1KJVB 5CP3A 3U0PB 5GGSA 2AK4D 2MJWA 3EOYG 5D6DA 2Y07L 4JM2C 1M7DB 3VFUA 3I6LD 3V0WL 1VB9A 3P2TA 1V5JA 1J8HB 2RIKA 5GJTH 4MVBD 3V5DA 3MRCB 3ULVH 1GIGH 3F7VB 4NQCB 5TE6L 5J3HD 5MEOA 1CGSH 4JKKA 5KG9A 3ETBF 4FQHA 4DJMA 3PHQB 3QDJA 2CO6B 2QSTA 1BIHA 1CE1H 5KVDH 4EUPB 5C6WH 5HGAB 5I1JH 2CUHA 3BD3A 3V5HA 4Z5RB 2IANA 1BVLB 3MUGA 2EZ0C 3QH3B 5H94B 1R5IB 1INQA 4KUZL 4MXVE 3IDUA 3LQMA 3ZHLA 4S0TD 1YDPB 4OCSL 4U1IB 4HUNB 1OF2A 3ILPB 4C4KO 1ACYL 3VE0B 3DX8B 3EDEA 4B5EA 3GBNH 4WUKH 3TYGL 1DJSA 3GGWB 4NBYB 4FTVA 4L3EB 3LPWA 4YE4L 4KMQA 1JJUA 3WFHB 2Y6SD 2GSGA 3A67L 5I8KL 5CJ8A 3JWDC 4MYWB 4TQEL 2MQ0A 4ZOBA 1GOHA 1B6UA 4AG4L 2HVKA 3OKOA 2XG4A 3VWKB 5GISH 1KIRA 1IGFL 4PJDF 4JG1H 4J12A 1MQKL 2ED8A 4BYHA 4JFXA 4QXWA 4QOKB 1S7XA 3FFCA 4Y4FB 4L8DB 2YK1H 2X70B 3OWEA 3LQAL 3MLUL 2HRPL 3D9AL 2ZOKA 4HDIB 1EK3A 1D5ZA 1F4HA 2J4WH 4HJ0D 4JM4H 3U0WH 1TJGL 3MJ8B 4RQQA 4ODVL 5FCSH 3FKUS 4I13B 1BGXH 3UTTA 3T3MF 4AIZA 4U6XA 3SQBA 1P7QB 4PP1D 3PP3H 4V1DE 1ORQA 3X11A 4HMEA 4M6ML 5E1AB 3SJVE 2PR4L 4BFBD 5C08B 1JWMA 4D0DA 4FQCL 3ARBA 2KQNA 1AP2B 4Q9RL 4N8CH 1OTTD 1T5XA 4U1HA 1L7TL 1RZJH 2P7TA 5ICZB 2HFFB 3MLTB 4LMQI 5K59F 1MCEA 2XQYG 5I66B 3NIDF 3KYOB 1N64L 3HUJA 5BVPL 4U1LA 2R0WL 5ICXA 5CILH 4U7SA 2DTSA 3PE9A 3DVNA 5CINH 3BKJH 1U91B 4M48L 4LSQL 2F19H 4ERSH 3MLYL 2P5WD 3QDGB 3LSOA 5F7EH 3C8KA 2P5EE 2GSIB 4K7FA 2F5AH 4ZAKB 4OCWH 3VGGA 4M5YL 2GTZB 3FRPA 2NY7L 4MWFA 2ZKHL 4ZO8A 2FD6L 3C5ZC 3R0NA 1BJ8A 4KJQC 3MFFA 5FECB 3F7QA 1ZA3B 3H0TB 1T7YA 4JLRA 4JRXB 3W0WB 2OL3L 3BP6B 1YN6A 1HINH 1IAKA 4LKXA 2VH5L 3VXOB 5I1CL 3GMQA 4XX1E 3WIIL 1G7LB 5I1HH 2H32A 1FV1B 4KDVA 1CL7H 4JFFE 2H8PB 1EBAA 4HS6A 2FSEB 3KPLA 1A6AA 2D0FA 2VDKH 4KROC 4M6NH 5E4EB 1KEGH 3LS4L 1CFBA 1X5IA 4MCZA 1PKOA 3JV6A 4OIAA 2R29L 5DD6B 2APXA 5KSAB 4Y5VB 2B1HH 1QLRA 1XGQB 2HYMA 1BLNB 2VIRA 1UWEH 5FYJU 4WGVB 3RUGF 5DMIH 4KDTA 1MCPH 2XPGB 3L3OA 1BWWA 3KPMB 3QRGL 5FHAL 3U4BL 4RGNB 4WV1B 1Z0NA 3JBG7 4LPXA 1XGPA 2YSSA 3U30B 5DVMA 4LLAA 3EDFA 5I6XC 5DSCA 4YDIL 3V8CA 3BDYL 4Z78A 1S9YB 1NEUA 2F5BH 4MGXA 1AR1D 5TFSH 5IB3A 4K8RH 1WLHA 3BP4A 3U0TA 1I7UA 5F8QC 1YJDL 3B9KD 3NABH 1IAIL 4EBQL 1U92B 5B4MD 2EDHA 1G7HB 3EYOA 2AI0H 4WTWA 1LP9F 4I9WD 1UZ6F 5KVMC 4FFWC 2WQRA 1F4AA 4XWGH 2YS4A 4JZNA 4KDWA 4MQ7B 4GLRI 1KIQB 4WW2B 3DJ9A 3VFRA 2VXUL 2JCCB 1WAAF 3U4EA 2NTFA 5SX5H 1DQJA 3PWPB 4FFZH 1SY6L 1AXTH 2N7BA 4X80L 3ARED 4QF1B 3HE7D 3SDYH 3QUZA 4PJ9C 4IRJC 1JYNA 1J0HA 3H9SD 4N90E 4YHPA 1BQHA 1ETZA 2G5RA 3PIQA 4J3SA 5TPWH 5EU5B 2DM7A 5DQDH 4OFPA 1BAFL 3QXUA 4H1LG 4U2ZA 2B4CL 3S4SB 4KHTH 5F1NB 4NC2B 4PRHE 1FYTD 1A1NA 1P7HL 1GGCL 3G5XA 1PGRB 4FFVC 4IIQC 4IRZL 4LCCB 4AK1A 1RURH 5EN2A 3IGAA 4IEFB 4X5WB 5GGVL 1P1ZB 1ND0A 3O6MH 2VDLL 4LSTH 5INDB 3GIZL 3RWHB 3GM0A 2NY3B 5C0AB 3TVMD 4EI5B 2OX5A 4KAQH 5I1IH 2Q3ZA 4JR9H 2I60H 2WBKA 4PRDA 3OL2A 1JWSB 3T2OA 2ARJA 3O4OB 3STZA 2EDYA 5FM5M 4FQ2H 3PG2A 1CLZL 2CLZB 1XZ0A 4HHAB 4U1KB 5DDHA 2DQDH 4P5KB 4P46D 2X1XR 1J1PH 4OQTL 5HI3D 1J8KA 3CFEB 3O8XA 1EHAA 5L8KB 4PJEA 2QR0B 3H7LA 1HXYA 1T66D 3IKCA 3QWOB 3W9EB 4JREB 4K3GA 1CXEA 1AGDA 4L29A 2AAVA 4NIKB 5E2JA 4HS3A 2AQ3A 1HN1A 1XGTA 1EEYA 2QHRH 3TYFB 1NLDH 5MP6H 3VFPB 1H3WM 4J3VA 2OL3B 3CVHL 3F6LA 2QSCL 5LBSL 5CJXA 3OR7A 2OJZH 3P77A 3FQRB 4LHUB 2MOVA 4FQXA 2IH1B 4PYHA 3TCLA 3RX8A 3EOBA 1MJUH 4F2MA 1XF3B 2AABH 3IXTA 1UM5L 4NZUH 4L8CA 2WIIB 2ZSVB 5KZCD 1PY9A 1FFNB 2XQBL 1HHJA 2ID5A 3QXAA 4NUGL 3VXSE 5BMFH 3VFGL 3RQ3A 2AJSH 1UWXK 4FS0A 3MYZA 3MRQA 1HKLH 4X6DB 4NKQB 4XBGA 4U3XA 5TDPB 1RHHA 1C16B 3SE8H 3MR9B 4J8RB 3LCYA 4O2FB 5EIVA 3N06B 1IGYB 4NQUA 1WBYA 1JNLL 3I9GH 3NA9L 4I77H 4RIRB 2EH8H 1G7IA 3K1DA 2V2WA 5F88A 2GT9B 1CT8B 3CLFH 4LSUH 4TUKL 1F13A 2R2HA 4L4VB 1BOGA 1GOGA 4RAUB 5K9OA 4ZO9A 5TQ2H 1JL8A 4GRLD 2ED9A 4LCWA 4E41D 1SBBA 2DLEA 1JZ5A 1RJZB 2QADD 5GIRB 3P11L 2UV3A 1PLGL 5EUOA 3MXWH 3U4AA 4CVUA 3OBAA 2BFVH 4ZPTA 5CEZH 2OTUA 1R3IL 5D1QA 3VG0H 4PV8B 1MJ7L 1D5MB 2XA8H 4OBSA 3MRLA 1PSKH 3PL6D 4FZ8H 1U8QB 1F97A 3UJTL 4R96B 2VDNL 1UQSB 3GMRB 1YQVL 1VFMA 1DFBL 4O4YL 1MLBA 1B4RA 5M94B 5FOBA 1A7BA 1IBGL 1S7WB 3HG1A 3W39A 2DB8A 3HE6C 1UC6A 1N8ZB 4PY8J 3LKQB 4WU5A 3C8HA 5C09A 1VKXA 4WEBH 2NW3A 2NW2B 4ZYKA 15C8H 3ARQA 4LNRB 1NCCL 3LIZH 3QRFM 1RULL 5C0IA 3VGHA 1DUZB 5KJRH 1UVQA 3T8XB 4WTZA 3VXUA 4GUPA 4HIEB 3UJIH 1UACH 2VTFA 1UB5B 2Q76A 3L6FB 1OAKL 4Z7QE 1C5DA 3PDOA 1VEMA 2BSSA 3S36X 3GB7A 4OTXL 3UTQB 5A3ID 1QFOA 4UQ3B 4FQJL 1P2CA 4GLRH 1HILA 3O6LH 3WLWC 5D93B 4JZJA 1IC1A 4NNPL 5BRZD 1PX4A 4YHNB 4D9RD 3CK0L 2W91A 4P4KA 5CJOL 5DMGD 1T2QL 2YD3A 3JUYA 5CWSB 2Q86A 1QACA 2D3VA 3QUYC 1FLRL 2HH0H 2FLBT 4PS4H 3LKRB 5C0ND 3LDBB 2P24A 4GRMB 4PJCE 5E56A 4AIXA 3CIQA 2B7DT 1BJ1J 4NPYB 3SJVB 3GSNH 2ADGA 3K80A 5T3ZD 2XWBA 5MENE 5HHXH 2DI9A 4TYUA 3VXPB 1KULA 3U9UA 2H26B 4NC1E 2YA0A 3NZHL 2BVYA 2IG2L 1EHLL 3CMOH 4QO1A 1EDQA 3VXNB 2GJZA 4KTEL 2VRAA 5FO7B 4NO5B 4R90H 5GQBA 3IFOA 1YY8B 4I3SL 3DVFA 4LAJH 2V5SA 4Y5YB 3MACL 3CFKB 3QIBC 4MB3A 4KRMB 4YHZL 2BHZA 2WP3O 3AC0A 1AKJB 2HVJA 1EH9A 4JFDE 2JJVA 4OLVH 4PD4K 1VFAA 3KXFA 3WXVH 4XCNB 5CZVH 3U9PL 3HI5H 3P9LA 2VLRE 4ELMF 3CVHB 3H7BB 1WT5A 4JY6A 4LARL 4PY8I 3V4UH 4ISVB 3MGTA 3Q5YA 4ZFGL 3RGHA 3ULUC 1DLHA 2YD6A 1FIGH 2UWEA 1VFBB 4OLZH 5F1IB 2NY5C 3ARRA 1ZLVH 5I73B 4POZC 5AUMA 5ITFA 1KB5L 3QI9C 5CD3A 2VUOA 1KCSH 4MJIB 4JFFB 3I02A 4XPHH 4RMUA 1S78D 2IAMD 4WUUB 1TZIA 3GSXA 2AXGB 2VLLB 4X6FB 1KCLA 3BKYH 4ZXBD 3AB0C 4N0YL 3M17B 4P3CL 5IV2B 3TJEL 3C2AH 5HXMA 5L2JA 1ADQH 1G6RB 1W0WB 1OPGL 1A3LH 4K71C 4IDJH 4G6AC 1TQBB 2CH8A 3TEUA 2EDBA 3VFOA 5FYKE 1DVFB 4DGVL 2YD1A 2FHCA 4D94A 1VSCA 4G9FA 5A2JH 2E9JA 5C9JA 3QAZB 3DSFL 4A2MA 3S7GA 3LZFL 3GK8L 1ZS8B 4HUXA 1CQKA 1K8IA 4NKMB 4UTBL 3S5LB 1RFDL 4F33B 1T6VN 1NCBL 3UZEA 3BPCB 1NPUA 4N0FA 2J8UF 3KPOB 1BQUA 2AJZA 3V6FA 3MREA 3GSUB 1KACB 2A6KB 1FBIL 5I1AB 5IQ9B 3QNYA 5EA0H 1URLA 2J6EA 4NQDA 5ACMA 4DZBA 4JHZA 3QBTB 2G5BA 5F72S 3D18A 3IS0X 1XCTA 2W60A 1NGXA 5J11B 2W0KA 1ZLUH 1MI5E 2FIKA 2ZOLA 4R4FH 3RVXD 1X4YA 3WJLA 1C5BH 2WINB 5E08H 1A64A 3D39A 1SYVA 3I6GB 1FC2D 2NY4D 3R8BB 3L3IB 4N1EA 3GJFB 5HGHA 2R9HD 2F54E 4YBLC 5JXED 4JFOA 3SPVA 1E6JH 1QA9B 4BSJA 3OX8B 4OLWH 4X99A 3TNNA 1NFDE 4XCCL 3TZVA 2AV1B 2Q20A 4WVRA 5DVLA 1X6LA 2WQ8A 1FIEA 4WI4A 4JQXA 2DQUH 3GMNB 1FNAA 1YC7A 3LVEA 5GSRA 1T83C 3C60C 4PRHB 3TF7C 4P57B 1QKZL 3A6CH 4NYLB 4YZFE 4WU7B 3FMGL 4YDKL 5L6YL 1SYSA 4R2GB 3P0GB 3BW9A 3DOSA 1J1OH 3FQXA 4OD1L 4ORZC 3STLA 2HJLA 5DJXB 1YEGH 3VFTA 4D8PA 5FKPB 3ULSB 2BHYA 2ZCKL 3DRQA 2DIBA 5CMAB 1DR9A 1FFPB 2AV7B 1JMZA 1QHOA 2R56H 3OJDB 1EMTL 2X4NB 5TDOB 1K6QL 5B39G 3RDTD 3VMPA 1SJHA 5HVHC 3TO2A 3QIUC 3EFDL 3RKDD 4N5UA 5DD0H 1QPXA 3NFNA 4OZIE 1RI8A 4C56D 3BVNB 3MV9D 1LEKB 4EUPH 3CDYA 2FZ3B 4P2YA 3ZE1E 5FA3A 2QQLH 1UCBH 3S9DB 1RK0A 5C07D 4P2OD 4KWUA 4P2RA 5GZND 1UYWL 3SO3C 4CBPA 1AD0B 3TBWA 4EJ1C 3F12A 1YEDA 4PJAA 5ADOH 2P8LA 5I8OL 2CLRA 5B3JF 4GRWB 1H15A 1HDMB 3K8LA 5KANI 2FEDD 4QRSB 4XWOC 1BX2B 3QUXB 4NRXB 2BRRH 1F3JA 3D3VE 5SWZE 3RWEB 1FFOA 2AXJA 2J88L 3MJ9A 2BCKA 2HLAA 2WBJD 4JRYD 4U1SA 1SJVA 4KQ4H 5D7KD 3JVGC 2Y06L 2YD8A 3G08A 4HIXH 1FN4A 4FG6C 5B8CA 4RDQF 3WFZA 4Q6IC 3Q3GB 5H37G 3VXSB 2JKXA 4GBXD 7FABL 2YEZB 2FR4A 3MRNA 5EU6A 3MO1A 4AEEA 1NMCB 1LQSR 1EFXA 4RCAA 5HYEA 1JRHL 3DUUB 1U3JA 1Z0MA 4LLQA 3QEGL 2EDDA 1S5HA 1OP3K 5E9DE 3QNXA 3RJDA 1AY1H 1EHNA 2DWEA 2IH3A 4JO4H 1CDJA 1OSPL 4APQD 5LQBL 2LU4A 5CBAB 5E4IA 1H8OA 4G6ML 3I75B 3FZUD 5FYKL 3DXAE 3TWCL 1U3YA 1F4XL 2B0SH 1GGBL 2IC2A 4L5FH 4YXKH 2OP4H 4CJ1A 4LPUA 2ERJB 4G6FB 2XZCL 4Y1AA 3WIHL 5MERA 3UTSD 4X6BA 1CCZA 3MA9L 2XZQH 3AM8C 1JGLL 5T1DL 4P3WA 2CD0A 1NJ9B 3WFEL 5I1LA 4QT5A 3RWCB 1JIBA 5DTFB 4QRRA 1JPTL 5IW6B 3HAEG 2R4SH 2GJ6E 5JQ6H 1IKNA 3SOBL 4D2NA 1N7MH 5JIPA 2OI9C 3JWDL 1CLCA 1MCOL 4LOUC 5HYQB 2WW8A 2OJEA 3QG7L 1JF1B 1Z5LB 4H25B 3L5XH 5F9AC 1CBVH 4KQ3H 4ALAL 5D7LD 4YNYB 2QQKH 5J13C 3EO1A 1E4KA 1QQDB 3SDDD 4FNLL 4Y4KB 3HMXL 1ZWIA 5JUEL 5SV4A 3BXNB 2NY2B 2HTLC 4BJLA 5DGRA 2RAMA 1AO7D 3JV4B 1DBML 1JK8B 4UZGA 1WZKA 2C1OA 3QHFL 4MNGE 5E5MB 5L0QC 1BFSA 1OHQA 4FN0A 4ZNCD 5LG1A 1QSEE 3ZYOA 43C9B 3S35X 1FFRA 5KBNC 1RUAL 4FFYL 2R0LH 2NLJB 4KK6C 4G8GB 4PJCB 4XNYL 1YEHL 3MODH 1RZKH 2A77H 2FB4H 2LABA 2X7LA 1MUJB 5TE6H 4Z76A 5MENB 2D7OA 4K3EL 4I0CC 5D7JC 4X0KA 5DHVB 3RGVC 3P4MA 4FXLA 1DBKL 1QO3A 2QQQA 1MWAA 2WUBH 3L1OL 4ONFL 1S7UA 1CI5A 4HAGA 1I3UA 4L9LA 4PJXA 4TNVF 1CFTA 3BGAA 4KUZH 4KHXL 5JO5B 5EO1A 3KNBA 5DMKA 3WIFB 2D9QB 4FZEH 4I8DA 2P1YA 4HX1B 4ZUUA 1ZEAL 3MRKA 1DQML 4N0UE 3PGCB 4Y5XA 1MLCA 2GTWB 4M7KL 3T0WA 1KEML 4LLWA 2VLRB 3TYGH 3LMJL 2Z31D 4IS6B 1P4IL 4YE4H 2DQHL 5FKAA 2IGFL 2ICWB 3A67H 5I8KH 4WTXA 4ZO6A 2EIDA 1KTKE 2X4PA 5IQ7L 3GSNA 2PW1B 3T2NL 1CFQB 3ROOB 4JKPL 3QA3A 3QUMA 5JW5A 2DQFA 1XGUA 2BNRE 2X4UB 4X6EB 4XMKL 1IGFH 3SKNA 4L8SB 1MQKH 3HUJF 4AZ8A 5KSUB 1LE5A 4AQ1B 2B5IC 3HZVA 1RSFA 5E5RB 3ZE0E 1A6VH 1ZT4B 2VDOL 3C8DA 4HKZA 1J18A 1UEYA 3VDAA 3LQAH 1U93B 2HRPH 1T1YA 5K9QI 4HLZG 3TH4T 2YBRA 1P84K 2Z92A 1QEWB 5DJDB 1TJGH 5JNYA 4G80A 2AK4E 2BJML 4PIRF 4U7MA 3LRHA 4U1JA 4H1LB 1SMOA 5ELIA 4CNIA 5FV2A 2V7HA 2H6PB 1TVDA 5F7KC 3T1WA 5EOQL 4M6MH 2PR4H 4KVCH 1FVEA 3FB8B 2JB6B 5FF6A 3TP4A 1N59B 3AUVA 3FB6A 4Q9RH 1OB1B 5HYSG 1DZBA 1G1CA 3STBA 5ISZD 4QCIB 5CSGA 1GGUA 2ZNWA 4ODXB 4CW1B 1L7TH 5DQ9A 1T04B 4ZSOB 1A7PL 3KYMA 1N64H 1WTLA 2R0WH 2XA3A 4IOIA 3SGKC 4AYFA 4GFTB 4QXUL 4X4YB 5BQ7A 2YC1A 1FL3B 4M48H 4OCMC 2XKNB 3MRJB 4LSQH 4NRYA 4HV8A 5D1XB 2EDNA 1HHHB 1U95B 3MLYH 4NZTL 4R9HA 3F5WA 4K3JL 4G42B 3ME0A 1MI5B 3CDFA 5F3HA 2C3HA 2FD6H 1U8PA 2CR3A 4Y4HC 3QIWC 2LAAA 1Z3GH 2F54B 4H26B 4PY7B 1T7WA 4V2BA 3SCMA 2OL3H 4Y2DA 1Q94A 2VH5H 1NC2A 1BEYL 4RFNC 2UUDK 3OHXB 5IWLA 2FLRT 4KMLB 2E3VA 5DRXB 3HCVA 5JXEC 4DUXA 3MRHB 3O3BA 2I9LB 2WWKO 5JPNA 1N2RA 5I8EA 1C08A 4JFED 3IJHA 4ZPVA 3LS4H 4ZUWB 1S9VB 3MOAH 4WHYH 3RPKA 5EBWA 5LKNA 2EDKA 3OKEA 3I6KB 3QWQB 2VR5A 3C6LC 2ZCLL 1GGIL 3BE1L 4ONHB 3GIVA 2ADIB 4Z95L 5FHAH 3U4BH 4HPOL 1RK1B 4Y16C 1B0WA 3RRQA 2W59A 1XT5A 4WO4A 1DQQB 1YNLL 2PYED 2V2XA 5HHOA 4PFEA 4G8IB 4GKNB 3VMNA 4F37K 4JGMA 2OZ4L 4YDIH 5CGTA 3GM8A 3BDYH 4PRPE 4OZIB 1GPOL 5AD0A 3GSWA 2VDPL 3RZCA 2O5YL 5GGRB 2FJGB 4M1CD 1TNMA 3UPRA 5DI8B 1T2JA 3R06B 1DBJL 1YJDH 4HXAH 1IAIH 4TVPD 2MWCA 3AU1A 1OAXL 2P5WE 1YEEH 1J0IA 5D9SB 4MQTB 3VRLF 4O58H 3C5ZB 3QCTL 3TNMB 2APFA 3FT4A 4KJYB 1KXQE 1LO5A 3TLRA 2ARWA 4EQ3A 5GHWL 4KI5C 4PRIA 5CCKH 4RFOL 2MKLC 3MC0A 4P23D 2VXUH 4GXVL 3U0PA 3D3VB 5SWZB 4GG8B 3CUPB 1MEXL 1FSKC 1SY6H 5I1EL 5EG6C 5CKGA 3IT8D 1JI2A 4X80H 5HDQL 1M7DA 5L88H 1JZ7A 2ZZUT 3ULVC 1J8HA 3V9FA 3MRCA 3F7VA 3PWJB 1X5GA 4NQCA 1MHCB 3ZDYE 2FYYA 3MNVB 3GSOA 3QP3A 4K23H 3GHBL 1X5AA 3PHQA 5J06A 5HY9B 4ZUSA 5HGAA 4PJEF 5EFIB 2V5YA 1F6FB 4U6TA 2W0FA 1YMHB 3QH3A 5H94A 5JHDD 3TBYB 4M7JL 4AENB 35C8H 4JG0L 1EUTA 1YDPA 4B7LA 4IRZH 5EU4B 4FRWA 3MRDB 3ILPA 5I6XB 5FM4A 3DX8A 4N8PA 2VDLH 1DBBL 2N56A 4JZOB 3DXAB 3GIZH 4HLJA 3GGWA 1I8IB 2M8XA 4L3EA 5E2VL 2BC4B 3WFHA 5DLMH 3UJJL 4JKWA 1T0NB 2I26N 3PGFL 4KKLD 1Q1JL 3UO1L 4Z7UB 5JXAL 3MBXL 1G9NH 3D48R 5DUPH 1O7SA 4YFDB 2W9LA 4KJWD 2X44D 1OAYL 4OZGE 1RZFL 3HC3H 3VWKA 4N0CD 4ONOA 4HWBH 5T1KD 3RNQA 4I9WE 1PKQA 3RHWK 2EIZB 3F58L 5DURB 2E7BA 4KFZC 4QOKA 5SWQB 1I9EA 4FMFA 1ZGLB 3CFBB 4LCUB 2GJ6B 4L8DA 2X70A 1IZKA 5C70A 1MAML 1JBJA 5KAQF 4PJ9B 3FAXA 4IRJB 2CDEB 2XZAL 4N5ED 3MJ8A 5GS0D 2QSCH 3BQUC 5LBSH 1CVSC 2QV2A 1UH3A 2GAZB 1RIVL 3OAYH 3P30L 1P7QA 1JI1A 5AWNH 3VMOA 5EUOF 1CD9B 3TBTB 2NNAB 5C08A 2R0ZL 1H3VA 4PGCB 1AP2A 2DYPD 4NUGH 4UINL 3VFGH 4HZAA 3WN5B 3UTPE 5BV7H 4GMTL 1WWBX 4IIQB 3CAFA 1FYTE 4XP6L 1RZJC 1XIWC 2WBWB 3ARFC 2HFFA 5F89B 5ICZA 4MNGB 4J3WA 1OW0A 3MLTA 1CXLA 5BS0D 4I0PA 4KKAD 1QSEB 5I66A 4POYA 3FT3B 3KYOA 2BX5A 5DJ2B 4U1NA 4X7SL 4E9LA 1JNLH 2BVUA 3NA9H 1U91A 4UQ2A 3LHPL 4TUKH 4ODBD 5FUOL 3KDMA 3PJSB 3QDGA 3L5HA 4PBVC 1KT2A 1P53A 1U58B 2GSIA 1PQZB 1N0LA 1OCWL 4ZAKA 1MFCL 2GTZA 4UBDC 3ARGD 2R4RL 4K7PY 3G5YA 1FCGA 1PLGH 4MJ6B 3S34L 5FECA 1ZA3A 3H0TA 3WBDA 3DYMA 3W0WA 4NQEE 2Y9RT 3BP6A 1R3IH 3G04B 1MJ7H 4U0RC 3VXOA 1UJ3C 4LQ1A 1G7LA 4TOYL 1HHGA 5DF0A 3UJTH 1FV1A 4OCYH 3VU2A 4WWKD 5DC9B 1UB6B 1KELH 1CLYH 1YQVH 2WAHA 1DFBH 4O4YH 4LP4A 3RJQB 2QBWA 1CICC 2VXVL 2FSEA 2VQ1B 1IBGH 2DJ4A 5E7BA 4QKXB 1DE4B 3VGBA 4OFIA 3Q6GL 3U79A 1PYWA 2F8XC 4ODUA 5GS1C 4QYOB 2ITDB 5DD6A 4QHMB 4X5XB 1RUKL 1NCCH 4Y5VA 5KSAA 4MAYD 1XGQA 3TO4C 1RULH 1BLNA 3GRWL 2AEQL 2VISB 5DJZB 1I85A 3GMPB 3O3DB 2CDGB 2XPGA 3MGOB 4WV1A 4P2QD 2NPLX 4W4OA 3BZDA 4FQJH 5GJSH 5EU3B 4Q9QL 4NNPH 2WWMD 2NY6D 1AHWC 3UPAA 1KENL 3CK0H 1S9YA 1T7ZA 5CJOH 1T2QH 4K8RC 1DANT 2E7LC 3BP7A 2BXYA 3O3EA 4Z0BL 3HMWL 1G7HA 3E3QE 5FYJH 5DUML 4I4WB 1SJEB 2NXYD 4X6CE 5I17A 4E41E 4LKCB 5E8NB 1LEIB 3K4DA 5IGXL 4H5SB 4LDOB 1FNSL 4MQ7A 5EU7C 1KIQA 1WBZA 1NL0H 1R3JA 2CIKA 2IG2H 3B3IB 3PWPA 4I3GA 1F6LL 4GW4B 3TCXA 3R1GL 4QF1A 1UXSB 3VA6A 3DTXB 5B39B 3OJMB 1FJ1B 4OT1L 1JHTB 3MRPA 4NO0B 3KPSE 4M43H 4LLVB 3QDJD 1F11B 4XAKD 3EHBC 5EU5A 4WI6A 1PG7W 1RU9L 2VC2L 2IAND 3U9PH 1FNGB 5F1NA 1MCQA 4LARH 4MLSA 5HDBF 1OTUC 2QKIB 3WKNA 3SBWA 3O3AB 3FL7A 3RIFK 4XNUH 2FRGP 3MV8B 4HK0A 4ZFGH 4LCCA 2FIRT 1B0RA 4NZJA 2IADB 3BPLB 5A2LH 3VI4E 4X5WA 2IMMA 2H3NB 1T5WB 1FORH 3IRPX 4NN5C 2VZ3A 1P1ZA 4FTVD 3G9VA 3ZDXF 1KB5H 1AXIB 5INDA 2C4FT 1F00I 3RWHA 5JOPD 4W6XB 5C0AA 4EI5A 2MQCA 5JIIA 5KSBB 2JTDA 1JWSA 5BRZE 3QUYB 2Q7YA 4D9RE 1II4E 2VNCA 4Q97A 4X8JB 4UILL 5EO9B 3H9ZA 2CLZA 4P3CH 2F53A 3QXWA 4F15C 2VOTA 4HHAA 4U1KA 2I5YL 1R3KB 4RZCB 4P5KA 3WNKA 1OPGH 1K4CB 1MCSA 3CFEA 3FFCD 4K94C 3OKNB 2QR0A 3D0LA 5E95B 4WI7A 3W9EA 5T3ZE 4DGVH 3BISA 4ZDHB 4N1CA 2R69L 3LKSB 1KYOK 4DZ8B 3O3UN 3DSFH 3TYFA 3LZFH 3UTTD 1FNEB 4CVXA 3VFPA 2OL3A 3DX7A 3QIBB 4PRPB 2PXYD 3FQRA 4LHUA 2CKNA 2IH1A 3SKOB 1NCBH 1AIFA 1DL7L 3QEHB 1XF3A 3H3BC 2FH6A 3ARBD 2ZSVA 1I1RA 2NXZD 1CGXA 5AAMA 3SDAC 2NX5B 2OSLB 4FXGA 5CAYB 1M05B 4X6DA 2E6PA 2W9DL 4MHHI 4U6HB 2W9EL 1I7TB 1NQBA 1C16A 3P0YH 3MR9A 5C92A 3L3KB 3L7FB 4J8RA 4O2FA 4N0RA 3VD4A 1OD7A 2JIXA 1IGYA 3QI9B 3EJYC 1W2KT 4AMKL 3BWAB 3MLSL 3FO0L 1HEZB 1QLFB 3HAEB 2AXFB 2GT9A 1CT8A 4OJFH 3BH8B 4JB9L 4L4VA 3I2CH 3KPQB 3BO8B 4XCCH 2XWTB 4RAUA 2F8VA 1EUUA 1A6ZB 3EYSH 2W65B 3ZO0A 2BY2A 3B2UD 3D85B 1OP9A 4JPKL 2EEDA 3LB6C 4WI8A 1K2DA 4IRSA 5TF0A 1QKZH 3WHXA 2VQTA 5DVNA 1SBSH 4IOFD 4YDKH 2DD8H 4PV8A 5DWUL 1D5MA 3RA7L 4PJAF 1NEZG 1U8QA 4MCYB 2D4FA 4E0RB 4R96A 3S96B 1UQSA 1YQ2A 3GMRA 3MRBB 3B83A 3OKDB 2ZCKH 2ATPB 1S7WA 4YPGB 4BH7A 1N8ZA 3LKQA 1K6QH 4D9QD 3QO0B 1WZMA 3HC0B 1SY6A 4TULH 1Q72H 3EFDH 4G3YH 2HKHH 4LNRA 5JDSB 2EXWD 4DGIL 4UOW0 1DUZA 4DQOL 5C8JB 3QDHA 1WIUA 3T8XA 1QFWM 3BP5B 2X4TB 3DURB 4J3UA 3PDGA 4HIEA 5IHUL 4OZGB 4PD4J 4FABL 1UB5A 3L6FA 3IF1B 3U7WH 1GSMA 2PN5A 2YXMA 2FEEI 4R8WH 1NDMB 4KRPD 3UTQA 4KJWC 3VXQB 3TN0C 4DN3L 2ADFH 4YBLB 4YHNA 3JUZA 4W6YB 3T77B 3GNML 1F4YL 5CWSA 2E9WA 3MNWB 4TTDC 4U33A 1MCIA 3QNZB 2QSVA 2X4SA 3LKRA 4GRMA 5FOJA 1G0YR 3SJVA 3T3ME 3OG4B 5IBTL 2PO6C 1P6FA 4TN9A 1A14L 3V4PL 1FG9C 3E0GA 4YIQB 4N8VG 4WJ5B 3SDXB 7FABH 3VXPA 3RP1A 3TA3A 4DW2L 1E0OB 2IQAA 1FYTB 3EJZD 1QHPA 4PLKC 2XICA 3DMMC 2HLFD 1JRHH 1BREA 2KL6A 3QUZD 4K7PX 3VXNA 5FO7A 1I75A 3G6DH 4OQTA 5IB4A 3ZLQC 4NO5A 1YY8A 1CZ8L 3O6FA 3VW3L 5K59E 4M02A 3NIDE 3ZE2E 4L4TB 3QIUB 5LQBH 1OSPH 2APVA 2NZ9D 3HZKA 4ACPA 2NY1D 4G6MH 4H1LH 4XCNA 3TVMB 5FHBL 1IC4L 3TWCH 3CVHA 3H7BA 4XP5L 5T3ZL 1R3LB 1DEEB 4X8XA 2WV3A 1F4XH 5TF1H 1GGBH 4OUUB 5IROA 4ISVA 2VXQL 4PJ8C 4C56E 1Y0LB 3MV9E 2YD9A 1QD0A 4WFGD 3ALPA 4WRLA 4F57L 5E8OB 1T0MB 4NQEB 3SO3B 2XZCH 1NBQA 3WIHH 1VFBA 5F1IA 5BO1L 3VFSB 1JTPA 4R97C 3CVIL 3MA9H 3BEWB 1JGLH 1MFNA 4KI5E 5HYSB 3WFEH 4MJIA 3PABB 3LRSB 4IMKC 4JFFA 1N5AB 1ZA6B 1I1FB 1JPTH 2PF6A 4WUUA 2AXGA 1R0AL 1FZJB 4R4BB 5CSZB 5K9KB 3SOBH 5IV2A 1NBYB 3JWDH 3CX5K 2HMIC 2J12B 1MCOH 1G0XA 1HXMB 3ZYIA 5C0RL 1JPFB 3O8XD 3QG7H 5FO9B 1G6RA 4JRYE 1J9CT 2RHEA 1W0WA 4Q6IB 4ALAH 2D03L 3W81A 4LGSB 5D96C 5IUSA 4JE4B 5DJ6B 1JNJA 3S37L 3S3PA 3EFFB 4I18C 4FNLH 3RUGE 1MIML 5JUEH 2XN9B 1IGCL 2LV4A 1C12B 2AQ1A 4PJXF 4LRNL 2MPAL 2AJ3B 4M93C 5DR5H 1I8MB 1OT1A 1CR9H 1CK0H 1CDIA 1ZLSH 1IAIM 4FQXD 4GKSB 1DBMH 2UYLB 4NKMA 3JWNC 4S1QL 2CIIB 1DANU 3QHFH 4F33A 1G7MB 2UZIL 1JGUL 3DVGA 1IGJB 3KPTA 1JYXA 3BPCA 3KPOA 1RD6A 4LDEB 3GSUA 2A6KA 4NC0B 4UUJB 1K4DB 1YYLL 4XVUC 3UYRL 5I1AA 2CK0L 5IQ9A 4O00A 3OAZK 1UWXH 4XNYH 5C71A 4ZOEA 3CSPA 4XCEB 4L3CB 1V7NL 4H88L 1XCQA 3KPRA 3MCKA 4PUBL 5JA9A 1X44A 2C1PB 4UIMB 4XVTL 1A3RH 5MEQB 3TESA 1V3LA 1NBVH 2WINA 1A4JB 1JWUB 4ZG1A 3I6GA 2LU3A 3O0RL 1ZHNA 3LEYL 5IHBA 1DBKH 3GJFA 1KTLB 2AVGA 3L1OH 4ONFH 1WAAE 3BMWA 5AZEL 1QA9A 4KHXH 5KVEL 5IBLC 4LCWD 3KPSB 2X42A 4G5ZL 4UIKL 2Z93A 4GMSL 2AV1A 4UU9B 5ERWB 2OI9B 1MCFA 2P42B 2V17L 3O2VL 5HHVL 4BFEA 1DQMH 4PGBB 5LGHL 1IFHL 1DBAH 3GMNA 4M7KH 4JPIB 1KEMH 5F7WC 2O5XL 1KUMA 5LGJB 4PRHA 3LMJH 5D1QD 4P57A 5J13B 3O2DA 1P4IH 4NYLA 2DQHH 3TPKA 3DETD 4Z7VB 2NZIA 4QHNB 5J3HC 5D7LE 4XB7A 4DUVA 1Q9LB 2FECL 3IFPB 5DJXA 5IQ7H 4X98A 3HG1D 5BZWB 5CBEA 1RJYB 2OXGA 1P9MC 2PW2B 2Y5EA 2MTPA 4JKPH 5FKPA 3ULSA 2CQVA 3QO1B 1K5NB 1MHHB 1G1YA 1FFPA 2AV7A 5ENWB 3VD5A 1UM4L 3OJDA 4XMKH 5C09D 2C4FU 5TDOA 1QFWI 1QG3A 2ZJSL 5L0QB 1AO7E 1SJXA 1BWMA 5HYJD 1ZT7B 1F2XK 2VXTL 3GMLB 1MCJA 5IVXE 1NLBH 3T3PF 2VLMD 2VDOH 4NO3B 3VXUD 5HSFA 2B20A 1KPVB 2A6IA 2FNBA 3BVNA 5CIPB 3SDCC 2FZ3A 2R39A 1I9RH 1T2XA 1LO4L 1H3PL 5D7JB 1A2YB 3NH7L 3HRZB 1MAJA 3C08H 5EOQH 1EO7A 3NIFF 1AD0A 2Y36L 1DLFL 1KJ2L 2X4RB 1KCKA 2DL9A 4P4KD 4ODHL 3FONB 4QRSA 4BKLB 1BX2A 1TMCB 3QUXA 3CFIC 4NRXA 2P4AB 3RWEA 1HH6B 5BJTB 3L7EB 4R4ND 5SV3A 1A0QL 2NY0C 5F97E 3QHTC 4G43B 4PJGB 4LCYB 3DROB 2PXYC 1YPZF 1PBYA 1WFUA 1A7NL 1DCLA 4EN3C 5I16B 1KXTB 3Q3GA 3VXSA 1HWGB 5J9PB 2I07A 3D1MC 3DO7B 3B5TA 1ZANH 4KMTH 1QSFE 1MCHA 4X9BA 2R2EA 2AJUH 2H2PC 4DFHA 4Y4FC 1UA6L 3DUUA 1M6OA 3GI9L 1EA9C 3X13B 1CE6A 2BSRA 4XPBL 2VDQL 1OGAA 4TTGA 2J8HA 5JMRA 5GJTL 5AAWA 1GIGL 5CD5D 2XRAL 3KXFD 1CGSL 2B5IB 4TSCH 1LE9B 4P5MB 1BEYH 2JB5H 4QHUA 4RRPG 4CDHA 5CBAA 1KSRA 1CE1L 5KVDL 3I75A 5L8JB 4LSVL 4AEIL 4LP5A 5I1JL 4H0HB 1WFNA 4X83A 4JAMB 1Z2KA 3Q6FA 4BZ2H 1FQ9C 3AY4C 4X4XB 3C9NB 3B8YA 4F58H 4QY8B 1MY5A 1VFOA 4BSVA 1LHZA 2IMNA 4H20H 4Z9KB 2X4QA 1SHMA 3NFPB 4UDTB 2ZCLH 1NJ9A 1MCWW 3BE1H 3HS0B 1JV5B 3PWVB 4M61B 3RWCA 4Z95H 5EU7E 1LDPL 5DTFA 3JWOC 1JFQH 4HC1A 5IW6A 3EBAA 5DO2D 3LN4A 4EXPX 4CVWA 3F8UB 4DOHE 5ISZE 1HI6B 1YNLH 1I1AC 4EIGB 3HFML 3LKOB 3SGDH 2NTSP 4JFPB 3HLAB 5HYQA 1T89A 4BFGA 5DFVC 1JF1A 1Z5LA 2OZ4H 4H25A 4JN2B 4P9ML 1GPOH 1VGKB 5DRZB 5T1LB 4YNYA 2VDPH 4JG1L 1QQDA 4X7CC 4R26L 4G9FD 1DBJH 2CDFB 4Y4KA 5I8CB 2HFEB 4ZFOL 2O5ZL 2M2DA 3BXNA 3QCTH 4PLNC 5HI5C 3HPJB 4Y4HB 4LPTA 4LLYB 3JV4A 2J4WL 4HH8A 4JM4L 1MJ8H 4W68A 1U3HD 1JK8A 3HC4L 5E5MA 5E4EC 5M7QA 4GXVH 43C9A 1Q9OA 2YKLL 1TTUA 3UTOA 3WJJA 4NQDD 4DVBB 4G8GA 4Q2ZB 1RZKC 4PJCA 1E28B 4YBHA 5EO0B 3WUWG 4YX2H 5HDQH 5CJQL 4KKCD 5C0CE 2UVEA 1EV2E 3VXRB 1MUJA 4N8CL 1OSZB 2E6QA 3D39D 5HHNB 3ZKMD 4EIZC 5MENA 1HQ4A 4HUKB 1P84J 3GHBH 3RFZC 3PUCA 4Q58C 1W0VB 5DHVA 3QFJE 2MCPH 2XFXB 1CG9B 3DX6B 3GI8L 3QPQC 3LN9A 1HYSD 3HB3C 3BKJL 3KLAB 5C0BA 2F19L 4Y16B 4JG0H 5JO5A 4PG2C 5F7EL 1KJ2B 5TE7H 3WIFA 3BSZL 3L5WB 4XGZB 1MQ8A 2IEPA 4HX1A 2F5AL 4OCWL 2DRUA 1SEBB 4PTTB 4IMLB 2IPTL 3V6ZB 3PGCA 2CRYA 2GTWA 4Z77A 1DBBH 3D69B 2VLRA 2PYEE 1RZGB 4NSKA 4JO1L 4IS6A 2P43B 2DMCA 5E2VH 3QEQB 1A02N 2ICWA 1D5BB 4ELME 3QQ9C 3PGFH 4M8QA 3K2MC 1YYMH 1BOYA 3UO1H 3L3GA 1KV3A 5I1HL 2EDJA 5JQHC 4NQVB 2PW1A 5JXAH 1CFQA 3ROOA 4LLDB 4NKDB 3C2SA 1CL7L 2X4UA 4HIHB 4C83A 4G7YL 4X6EA 3WL9B 5CGYC 1KN2L 4L8SA 2WMPA 4MQXD 3F58H 3QHZL 2I25N 5CZXC 5IIEB 3F62A 5DJ8B 5C3TA 1FSKB 2A83B 1ZT4A 3LQAC 4YGAB 4FP8H 1U93A 4JM2A 2B1HL 2PCPB 5DJDA 1QEWA 1UWEL 1EERB 1PZ5B 3REWB 4X4ZA 4NM8L 4P2RD 5KVGH 4JRYB 4U1MB 2XY1A 3P30H 1U8JB 4H1LA 2Q1EA 3G6JE 1RPQA 3VA2C 2GY5A 2F15A 4Y8DC 3V8OA 4UNTA 1KGCE 1QPPA 3D2UB 3RIAF 1MNUH 3RUGB 1TVBB 4GBXB 3FB8A 4JANB 3SGJC 1AXSA 5CEZE 2JB6A 1MFDH 4UINH 4PP2B 1IEHA 1OB1A 2F5BL 1U8OB 4GMTH 5TFSL 4CMHB 4XP6H 3WIHA 1CFSB 2CRMA 3QYCA 4TNVK 1H3XA 3NABL 4ZSOA 5JHDE 2VKXA 2VWEC 4EXKA 4KK9D 4X7SH 4APQB 4X4YA 4HWNA 5FB8B 1NGYB 1FL3A 4P4RB 3OJ2C 1Z6JT 2XKNA 3MRJA 4XWGL 5EU6D 5J12C 1HHHA 1EFXD 4PB0L 1Q38A 3AAZB 5BXFB 2L4OA 4G42A 3CXDL 1MI5A 1OCWH 2GW5A 1ZXQA 4JREC 5GGTL 4FFZL 1R3HB 2GI7A 1AXTL 2E8YA 1OP3H 5GRVL 1A6PA 4JCMA 4MD0B 5C6PB 3SDYL 3S34H 2RB8A 4H26A 4PY7A 3QXDB 4WGWB 4YR6B 2Q3AA 4J7RA 3HMXA 4ZFOB 3ARDC 3MLZL 5DA0B 4KTYA 3OHXA 4TOYH 1BHGA 2XACC 5J6GB 4KHTL 4JO2L 2MHAB 2I9LA 4ONGL 1ZHBB 4P2CG 2VXVH 1UM6L 4EVNB 2CRZA 4G8FB 4ZUWA 3WFDH 5EBGA 4Y1AD 1ZOXA 3FRPG 1OLZA 2E7MA 1S9VA 4UTAH 1S7QB 3Q6GH 4XP9H 1RURL 3I6KA 3EOAB 1RUKH 3EOTH 2R2BA 5JORB 4WW2F 4OF5A 3GRWH 2AEQH 4ONHA 4QRRD 5T5NF 2ADIA 5I1IL 1XIWB 4JR9L 3HAEH 1AO7B 2X9XA 1DQQA 3MBEC 1BFOB 3LOWA 5IVXB 1F02I 4G8IA 4GKNA 5FGBC 4Q9QH 2DQDL 4ZNEA 1KENH 4OZIA 2ZUYA 1J1PL 5I76B 2VJXA 3L9RA 5GGRA 2FJGA 3K3QA 4K94L 1YJDC 4GAYB 3R06A 5DI8A 2LVCA 5EC1B 4X5LA 1JGVH 5D9SA 2DQJL 5DUMH 3C5ZA 3TNMA 3SKJH 4KJYA 4YBQC 1NLDL 5MP6L 1SQ2N 5IGXH 1NEZB 4U0RB 1FNSH 2OJZL 1UJ3B 4GS7C 5J1AB 5EOCJ 3QT2A 3X12A 4GG8A 3CUPA 1MJUL 2AABL 1LEGB 5AZ2L 3VJ6B 1VERA 4NZUL 3HR6A 3T0EC 2L7JA 3N9GH 3R1GH 1CICB 4KK5C 1ZLWK 4W4NA 1F6AB 3T0VA 1CF8H 3KPPB 4OT1H 1XH3B 3D6GA 4RWHA 2HG5B 1MHCA 4DCQA 1WC7B 3MNVA 5GS1B 1FL5B 1RU9H 1QSFB 1X5KA 2VC2H 5C7XH 3TO4B 4RMVA 5EFIA 1SVCP 1QBML 4I77L 5DYOB 1YMHA 3IDMB 3FAWA 1YNTB 2OR9L 4AENA 1MRCH 4Y0GA 1FVDA 3MRDA 3MOBL 4ELKB 5TQ2L 1BQHG 7CGTA 3RWJB 1WICA 4ZUVB 1TZGL 1AHWB 4JZOA 4P2QE 3CD4A 2LQRA 2BC4A 2BFVL 3E8UL 1B6DA 5CEZL 4HZLB 3EAKA 4G6KL 3VG0L 1T0NA 1BJMA 2XA8L 4Z7UA 4HWUA 4UILH 1PSKL 4FZ8L 1XGRB 1G9NC 2A9NH 3HR5A 2I5YH 5ESAB 3T1FB 4X6DF 4N8VB 4QRPE 5EIIA 4AY0A 3EYFB 1DUYB 3S88L 4DN4L 3OJVC 4J3OC 1NUGA 1RZ8B 2EXYC 2VR4A 4Y5YC 3CFBA 4WEBL 4LVOC 2LE9A 2EIEA 4LCUA 2P46B 3MJGX 3SGEI 4I5BB 4HUVA 4DOHB 2R69H 5ISZB 4W6WB 4HLZH 2EC9T 3LKPB 4O2EB 4PJ9A 3BZ4B 1CYGA 4IRJA 5KJRL 2CDEA 2IPUK 5J8OA 1M7XA 2CPCA 3MCLL 4PJFE 3UJIL 1S8DA 1UACL 2GAZA 2EDEA 4KU1A 1JPGB 3CDGB 1DL7H 1X5HA 3EDDA 5C86A 1KC5L 1XR9B 3QDJE 5I15L 2NNAA 4XAKE 4F7TB 4PGCA 4MXVF 5DVOA 5BV7C 5FFLA 4IIQA 3G6AB 3V2AR 2AEIT 3CPLB 4MNGA 4PS4L 5ETUA 1O5DT 2YPLA 2O93L 1QSEA 32C2B 3FT3A 3BI9X 1YA5A 1U3HC 5DJ2A 3VGAC 5DHYA 4Z0XB 1WJ3A 4XC1L 3MLSH 1WVZA 3E2HC 3FO0H 3IKKA 4M6OL 5C0CB 4YO0B 4X9GA 4WCYL 1CGVA 4FTVE 4JB9H 3PJSA 3ZKSD 3I3BA 1TQBC 2M1KA 1U58A 5JOPE 1PQZA 1FVCB 2HA1A 4F15B 1DVFC 3CMOL 3QFJB 5D71L 2HTKD 2XNAB 4JPKH 2E9IA 1NCDL 3X14B 4R90L 3SCMD 3RVUD 4MJ6A 4Y2DD 4XXCC 1NC2D 1YMME 3O4LE 4KZDL 4OKVB 3DI3B 3RA7H 4WFHD 4OZHA 2D7PA 1UB6A 3LEXB 3HI5L 3MUJA 1Y6MR 2VQ1A 4XVJL 4NCDA 1CDUA 2PYEB 5HJ3B 1IRAY 2D9CA 1DE4A 4TPRL 3UTTE 3FOMB 3SO5A 3MUZ1 1XF4B 4WHYG 4NKIH 3ZKNC 4QYOA 1MJJA 1S7SA 2IFFL 4QHMA 1MFEL 2CMRL 3SDAB 2VISA 5DJZA 3GMPA 1KCSL 2CDGA 3BD5A 3MGOA 4HF5H 5IHUH 4Y19E 1U36A 4P0DA 2FECI 4WO4D 3BT2H 3NCBB 3IDGA 4GW1B 3OGOE 3FO2B 5HHOD 1IL1B 1L0QA 2EYRB 5EU3A 4DN3H 5J89A 4MQXC 3HUJE 3T09A 2PTTB 1BM3H 3RZCD 2EE3A 4KKBD 3VCLB 4PPTA 4OCRL 5JOFB 5GPRA 5H35B 1U0QA 3BKCH 1U8NA 3RBSA 3RL1A 5HBBA 5HI4D 3G6JB 4HUWA 2J1KA 4BK5A 5TQ0H 2BVTA 4I4WA 5F7DA 1SJEA 5D1ZC 3L3DB 5GGQL 4NUJB 4PRID 5IBTH 1A14H 3V52L 3V4PH 5E8NA 1LEIA 1X5FA 4H5SA 4HG4K 3B9AA 5I75C 4S2SA 4OLEA 4DW2H 3CZJA 5DK0B 3NCCB 4YJZL 3B3IA 3UZQA 3K1KC 3LS5H 1J8HD 1I8LC 3W11D 1UXSA 2QSQA 3GBMH 4NQCD 3DTXA 5B39A 1CZ8H 3HE6A 3TBVA 1JHTA 4NO0A 4LLVA 2APBA 1KYOJ 4ZTPL 5CKAA 1BD2E 1YEIH 2ED7A 3TC9A 3V0VB 4D9QE 4UOW1 5EOTB 1FNGA 3O45A 4HGWB 4XP5H 5T3ZH 1TZHB 3EYQD 2QKIA 4ZFZB 3WFBH 5CFHA 3O3AA 4NOBA 4CN6A 1ZGLP 2VXQH 3MV8A 2ZUSA 3B9DA 3TN0B 1R24B 2IADA 5BO1H 2CJUL 2H3NA 2RQ8A 1T5WA 4L3ED 4ZS6D 3TFKD 4WY7H 4QXGL 3SKUD 3T2PA 3SGEH 4R0LC 1G7QB 1T22A 5E00B 4JHWL 4NWTL 3A6CL 5K9QG 5KSBA 3QUYA 2OBGA 1KLUA 1R0AH 4TSAH 3T0AA 4X8JA 2A1WL 1KPRA 5EO9A 1R5WB 5DD5L 1GZPB 5DEZA 4WFED 1YEGL 3VWKD 5GRZA 4HK3J 3SE3A 2PO6B 1R3KA 4RZCA 2VN4A 4QRTB 3PP3K 4CVZB 3REVB 1K4CA 4M7LT 4QOKD 3OKNA 4WHTB 5SX4I 2YPVH 3S37H 3U7AA 8CGTA 3GUTB 4O2CB 3MSPA 4ODTL 3B5GA 2YRLA 5I30H 1IGCH 3QZWG 5JW4R 3VG9C 1EO5A 3LKSA 1TVHB 5DD0L 4DZ8A 3GZKA 4QRUB 3U48A 2BVQA 3WDHA 3RTQC 1P7QD 2QHLA 3QIBA 2QQLL 4PRPA 5IB1B 1UCBL 1I4FB 1GXEA 2OTWB 4S1QH 1CD1B 1FNLA 2UZIH 1JGUH 3SKOA 1JZ6A 3QEHA 5C08D 3QPXL 3UX9B 2X4OB 2QL1A 1YYLH 3WE6B 4RA3A 1QFPA 2NX5A 4XX1G 1V7NH 4H88H 2OSLA 3VD7A 4I0PD 1M05A 4KK8C 4XVTH 3ZT6A 3P4NB 4U6HA 3VRLE 4CADB 3MRIA 1HH9B 4GKZB 1AQKH 1HE7A 3L7FA 4HGMA 4R97B 4XBPB 4F37F 3IDJB 3VDBA 4JGUA 5IF0A 4PGEB 3QI9A 1GVIA 3RL2B 1JHLH 2E7HA 3BWAA 1HEZA 1QLFA 3QDGD 3HAEA 3ROLB 4OBRA 1A1OB 3BH8A 3RVVD 5A16B 1DQLL 4ZAKD 3S3JA 5KVEH 3BO8A 1A4KA 1VADB 4HCRL 5IM7A 4MMXC 1G9EA 4LFHG 3S36L 4GMSH 2XV6B 1A6ZA 2V17H 5HHVH 4O5LL 3D85A 5HGDB 2A0LD 5LGHH 1IFHH 3OXSB 3T08A 3W0WD 5HD8D 2FL5A 4FQQB 5D96B 5MI0C 5I74C 1VACA 4OD3L 5DD1H 3WDIA 4MAYB 1W72H 3SY0B 4JO4L 2JK5B 2DJSA 4GRWF 4MCYA 4X7EC 1WF5A 3S96A 4XXDB 4M93B 4MA1C 5D2NC 3MRBA 2IBZY 4S1DD 5DUBA 3OKDA 3QDME 2ATPA 2B0SL 4L5FL 4YPGA 1UM4H 4YXKL 4P2QB 3BZEA 4UAOC 3CDCA 4HFUL 1Z9LA 2ZJSH 4JO3L 1RV6X 1F3DH 5KSAD 3FHQA 2DQEL 2Y72A 3WUWB 4B41A 5JDSA 4I48B 4NC1C 4BFIB 3FCTB 3QQ4B 5C8JA 1D7FA 3JXAA 1G7PA 3BP5A 4RGND 2X4TA 3DURA 4QRPB 3U82B 4OZGA 1DDHB 1LO4H 4R6UA 2NXYB 1OTSC 3TBSB 1H3PH 1D5XB 3JWOL 1NDMA 5GRWA 2FHBA 3VXQA 4NO2B 5LJYH 1N7ML 2Y36H 1DLFH 1KJ2H 3BGFC 5GGSB 2EC9U 3T77A 3L5XL 1CBVL 3EO0B 4ODHH 5SX5K 5CLWA 3DHMA 3MNWA 3S97C 4L8BB 3HNVH 4PJFB 4XH2B 3V5DB 1F2QA 5D2LB 1AD9B 2HFGL 5MEOB 1A0QH 4JHBA 3BUTA 4LCWE 3QDJB 5F7NC 2D0HA 1T83A 4X7TB 3OKMB 4KY1H 3C60A 1A7NH 3RWFB 3LD8B 4YIQA 5EUOE 4WJ5A 3SDXA 1QFUL 3SQOL 3CX5J 1P4LB 2NYYC 3PWPD 4MNHB 3U36A 4KC3B 3CFDB 3U6RB 1TJHL 2ENSA 1UA6H 3GI9H 2R0LL 1FNHA 3FQUB 4NGHH 3MODL 1RZKL 4XPBH 2VDQH 1FDLL 4JJHA 2A77L 2FB4L 1HK6A 1Q9KB 3HG1E 4P9HH 2XRAH 3O11B 3DBXB 4L4TA 3QIUA 4XCYB 4FTVB 3QSKB 4HH9A 1XMWA 5FEBA 1CLOH 2VN7A 1G9ML 5HYJE 4LSVH 1JPST 4AEIH 3SDCB 4E5XB 1R3LA 1DEEA 4XI5D 1JE6A 2WUBL 4Z7QF 3PGDB 2VLME 3ARWA 4OUUA 5IT2L 3IJYA 4MDIA 1U3ZA 4WDIB 4YXLH 1EVTC 1U8KB 1YMMB 1KIRB 3PHOB 3DARA 4NQEA 3O4LB 4HMCA 5D7SL 4FZEL 5ID1B 3VFSA 4IOSD 5SX4H 3RVUC 25C8L 1GRWA 3BEWA 2NY3D 4EI5D 5E6ID 2YN5A 5IFAL 3O9WC 4Q74A 1IT9H 2VLJA 3LRSA 3MYJB 3PABA 4IJ3B 3GSQA 4YHMH 5JPMB 1LDPH 1ZA6A 1I1FA 5EC2B 5D1XC 2F53D 4PJCF 1FZJA 3MLPA 1IGMH 2NY0B 4P5TC 4R4BA 5CSZA 5K9KA 3UTTB 3T0EE 3JVGA 2YD2A 3HFMH 4Z8FH 2PXYB 2PNDA 1HXMA 2RFXA 1JPFA 5FO9A 4EN3B 1YN7A 4P9MH 4PR5B 4Q6IA 4A6YH 2A74B 1SM3L 5KN5A 2WANA 4GG6A 1Q0XH 4Y19B 1C5CL 1WTGT 3EFFA 4R26H 1V3JA 3HKFA 2O5ZH 1A6VL 2OMNA 2XN9A 1C12A 5E6YA 3JTSB 5B21A 1NCTA 2AJ3A 2ORBL 5EBLB 2LVEA 1OARH 3OKLA 4LHUD 4QWWD 4GKSA 2UYLA 3HC4H 4X7DC 2CIIA 1G7MA 1IGJA 1N6QH 1RIUH 3ALWA 2YKLH 4UUJA 3BN9C 1K4DA 3KXFE 4MA8H 5GRUH 1TLKA 4KVCL 5LCVL 5CJQH 2ESVE 2E7CA 2J8OA 4XMLL 1A6TB 2P8MB 5KTEH 3DUSB 2C1PA 3FRUB 4UIMA 4OV6F 4JQVC 4UV4H 2KZ1B 4CU6A 5MEQA 2JIXD 1CD8A 1A4JA 4PJ5B 3WV0A 3QCVL 3AM8A 2UWEE 3GI8H 5T1MA 4F3FB 1KTLA 4L4VD 5LVEA 4C54A 4XZUA 4MXQD 2HAZA 3SKMB 2A2QT 4JM2F 3WNPA 3KPSA 5ERWA 4UU9A 1I1AB 3BSZH 5GGUB 1BD2B 3MFGB 1X4XA 2IPTH 4IRSD 4JQIL 1Q9WB 3O6KH 5IKCB 3LQZB 4JPIA 5LGJA 4JO1H 1Z3GL 5IEKB 4Z7VA 3GSRB 5K9JL 3H42H 2GITB 1TCRB 3L3OB 4QHNA 4XTRC 4XP4L 1QRNA 3IFPA 3GJEB 4A2LA 5BZWA 4G9FE 2PW2A 3QJHB 4U3CA 3QO1A 1K5NA 1MHHA 5I1KH 1JGDB 2QLVB 1I9JH 5ENWA 4OGAC 4G7YH 4XT1C 1KN2H 1ZVSB 2VSDA 1VPOL 4Z78B 2YXFA 1ZT7A 3QHZH 5DK2B 1WBXA 3VFNB 2FCBA 2Z4QB 3MOAL 3GMLA 3ZDXE 1KJ3L 3TFKC 2P44B 1N0XL 1CTOA 4NO3A 2H2SD 4HPYH 4U31A 1A6WL 5CIPA 4Z7WE 2DICA 3RIFF 1S7RA 2N4IA 4J3XA 2ATKA 4NQDE 4NM8H 4HEPG 4RAVB 2YWZA 4U0QB 4PJHE 5D7JA 1A2YA 4JZNB 2PTVA 2IJ0C 3HRZA 3RGVA 1WV7T 5EIQA 3UAJD 1GZQB 2X4RA 1CFVH 5F1KC 3AFLA 1E4JA 2DOCA 3FONA 4BKLA 1BZ7B 1HH6A 3L7EA 4HXAL 3SJVD 1IEAB 4G43A 3TM6A 2GHWB 1YEEL 4LCYA 4PJGA 3RY4A 5IESL 1U8MA 3DROA 4O58L 1PJ9A 1WITA 2VITA 4YZFF 1GH7A 3TA3D 1A7OL 3VFMA 5TH2B 5I16A 4PJBE 3VWJC 1JTTA 5ECJE 3NCMA 2BNQE 4HKBB 2VQUA 3KAAA 4PB0H 5J9PA 1E27B 5CCKL 3EKCA 3AGVA 3CXDH 1FO0L 1L9MA 4YQXH 3KLDA 3BOVA 3KS0J 1CXIA 5GGTH 3O6FD 43CAB 3P4OB 5L88L 3F7RA 5IMLB 5M95B 4J6RL 5CSBA 2JJTC 3P4LA 4W81A 4HKXB 2VMFA 3ARPA 3MLZH 4K23L 4OZIF 4OI8A 2V5RA 2XTJC 3G5ZB 3U1SL 3STZB 3ZE1F 4D0CB 2IBZX 4JO2H 3UBXI 1MFAL 1IMHC 1EZVX 4JAMA 5D72L 2K9UA 4ONGH 4WWID 5FGSA 5LAXB 5IR1B 1TETL 4GQPH 1UM6H 4X4XA 3C9NA 4QY8A 1INEL 5FYJE 35C8L 3WN5C 4WIQA 2A0LC 1MHPH 3S35L 2HT2D 5HD8C 4MNQE 3KG5A 2KH2B 4MJID 4GAFB 2MFNA 3AS2A 4HKJA 4UDTA 4DK6A 4JFFD 3W2DH 3HS0A 3CNKA 4WUUD 1JV5A 3PWVA 4M61A 3NN8B 3QDMB 4F9LC 3MPCA 1XGTB 1BFVH 1XAUA 4OGZA 5DRNA 5DLML 1PZUB 3BDXA 1NCWL 1OM3L 3P77B 5IMKB 1HI6A 2C5DC 3GKZA 4FQXB 3SGKA 3UXFA 3P73B 3TCLB 4JFPA 1G9NL 1KG0B 5DUPL 4NZDA 2RGSA 4GW5B 4JN2A 5J12B 3HC3L 3TT3H 1VGKA 5DRZA 5T1LA 4XHJD 4HWBL 2W0PA 4K94H 3ALXA 2D31B 2HT3D 3INUL 2CDFA 5I8CA 1K8DB 2HFEA 1EGJH 3MRQB 2X5PA 3VXME 4XBGB 3LPFA 2DQJH 4MHHG 1ZLUK 3HPJA 4Y4HA 3QIWA 4LLYA 1EXUB 1EEUA 1NDGB 5F6HJ 4RMWA 3ARDB 5FCUL 1Y18B 2X05A 3KPNA 5AWNL 3A0OA 3OAZH 5JXEA 1BOGB 4DVBA 5AZ2H 5K9OB 5EO0A 1E28A 3KPRD 3MLWL 3DI2B 3MMEB 4LCWB 4Z7UF 4RSVA 3VXRA 3TJHD 5MHSE 5BV7L 1T1WB 4TVPH 3BRFA 1F58H 1W0VA 1ZAGA 1LK2A 2WLYA 2A73B 2XFXA 3DX6A 1CG9A 3T4AA 3MRLB 3C6LA 2Z8SA 1YEFL 1KCRH 1OAUL 1QBMH 4KJPD 1I8KB 4N90D 3KLAA 2BSTB 4TRPH 2OR9H 4Y16A 1KTRL 4QRRE 5EH1A 1U2HA 3W39B 2D2OA 2P8PB 3MBEB 5C2UB 3MOBH 1J7VR 2EDXA 3WMSA 1SEBA 2R2CA 4IMLA 2NW3B 4PRHD 3V6ZA 1TZGH 2APWA 3OZ9H 4MVBC 5FDWB 5HYJB 5C2BH 3RU8H 1F4WL 4RNRB 4R2GD 2FJHA 1VEOA 4RX4A 3E8UH 3QEQA 1UVQB 3LPGA 1D5BA 4N9OB 4G6KH 1A9EA 4XCFL 3ILQD 5F9DC 2Q76B 2YN3A 5L2KA 4NQTA 4KVNH 5I18L 4OCYL 4ORGB 3MQIA 3DGGB 4KRNA 1KELL 1CLYL 3WS6C 3IU3B 4LLDA 4NKDA 2HWZH 4YFLF 1HILB 2HN7A 4HIHA 4HJGB 3BX7C 3S88H 3F7YB 1D5IH 3JSSA 2BDNH 4DN4H 1D9KD 1FO0B 4GS7B 4LSPH 5D8JL 5DJ8A 5E6IC 2A83A 2BNUA 2YMXL 3N1FC 3T0EB 1NGWB 2PCPA 2P24B 3MLXL 5F6IC 5F6HI 2Y6SC 1PZ5A 2D7QA 3M07A 5MEPB 3MCLH 2ADGB 4U1MA 2B8OT 1U8JA 2E9BA 2DTML 3DWTA 1KC5H 3AXLA 3D2UA 5I15H 2YRPA 1TVBA 3QXTA 4JANA 5GJSL 2VLKA 3BPLC 4PGJA 3QUXD 4PV9B 4OZHF 1VA9A 3KWWB 1AI1H 4PP2A 1WQVT 1U8OA 5F9OL 4IHOB 4PJXE 1CFSA 4Z7OF 4HUUB 4DAGH 5D2NE 2C3VB 5CEXA 4V1DB 4HJ0C 5FYJL 4L4JA 4CN4A 1YY9D 1B4JL 4DTGL 1L4IA 3VXSD 3KXFB 4M7LL 3DYOA 5FB8A 5GS0H 1NANI 1NGYA 4XC1H 1FH5H 4M6OH 4PP1C 5I9QB 2D7TL 2ESVB 4WCYH 3F7PC 4F8TA 1KN4L 3AAZA 4RMQA 3WS3B 2KBGA 5F96H 1NL0L 4FXKB 1R3HA 3DX9B 1OGAD 5D71H 2UWEB 4XRCA 1NCDH 1OTTC 4MD0A 2EKJA 3ZE0F 1PD6A 3QXDA 4OFYA 4YR6A 1U2CA 5JW4Q 4ZFOA 4M43L 4KZDH 3MLVH 1MOEA 3QZWB 1WZ1H 4LVOB 4LEOB 2Y25A 5ALCL 1T4KB 3M8OL 2P5EB 1AH1A 4PTUB 4J23A 1ZHBA 3B9EA 4XVJH 2F58L 3BQUA 3EZJB 5L2JB 5C0GB 4G8FA 4G6FD 4XNUL 4TPRH 2XXMB 2GK2A 2H1PL 3MCG1 4X9HA 5IMOB 2IFFH 1EO8H 1Z9SA 1MFEH 3N0PB 2CXKA 5A43C 1FORL 5JORA 1KOAA 2CMRH 3OB0K 3GFUA 3C87A 3RIAK 5T5FH 5BV7B 3D25B 2NQCA 3E1F1 3ECBB 1XIWA 4KPHH 3ARFA 4XMPL 2RR3A 2OXHA 1KIPB 1U3HB 3VGAB 1MFBL 4CRPA 4N0FB 3P3YA 3E2HB 3MREB 5BW7C 1NAMH 4Z7WB 3NZ8B 5I76A 4OCRH 1BPVA 1F45A 5E1HB 4Y4KD 5IHZB 4GAYA 1LO3H 2G5BB 4N9GA 3BAEL 3D18B 2H9GB 2NY2D 4PJHB 1NGXB 4ENED 3UC0L 4U4BA 2ZOLB 4JY4B 2CSPA 1NUFA 4OFVA 5GGQH 1SYVB 4CU8A 1QBLH 3V52H 5DMYA 3NIFE 4HULB 3M1BB 1UJ3A 1W8OA 5FM5O 5J1AA 3SPVB 1U8LB 3B5HA 4JHAH 4G8GD 3V4VH 4X99B 3ARZA 5KSBF 1AR1C 1CICA 4PRBB 4IM8A 4QHLA 4NJAL 3CZFB 5MEND 1FRGH 1XH3A 3B9KC 4PJBB 2HG5A 5CHNA 5B4MC 2BNQB 1MRDH 1BFTA 4ZTPH 1WC7A 1UWGL 5GS1A 1FL5A 3P0YL 2G75A 3R8QA 3DV6B 1QSFA 4F7CA 4U7KA 3TO4A 4OLUH 3SE9L 5C0BD 4YH6A 1T1XB 5FGRA 2QTEA 3VFTB 5DYOA 3ESUF 5CP3H 3UYPA 2FBOJ 1YNTA 1T3FB 1KPUA 2CLVB 4OJFL 3SHSA 3VXTB 3I2CL 5A2KH 1T20B 3ZL4L 3VI3F 4CMMB 4ELKA 4WFFE 5F7YC 1SJHB 3AREC 2CJUH 3HE7C 3EYSL 2VLRD 5GRJH 4ZUVA 3RWJA 4KH2A 2DMKA 1AHWA 2WSKA 1JYWA 4QXGH 5HPMB 2E7LA 2A9ML 4JHWH 4DFIA 4NWTH 1A9BB 1SBSL 4PLJD 4HZLA 3FHAA 2R1XB 2DD8L 2FWOB 2A1WH 4NQSB 1H5BC 5DD5H 1RK0B 1PEZA 4PB9L 4U05A 5B38A 5D1ZB 4ODSL 3DRTB 4UB0L 3RVTD 3T1FA 4MNQB 3GSVB 3ULUF 3EGSA 3S6CA 3V6OC 1UADC 3EYFA 5I75B 5GS2D 1I3GL 1JCKA 3RI5F 5GGTA 1RVFL 4JM2D 4ODTH 4TULL 1PEWA 2XWJB 1FFQA 1Q72L 4G3YL 5JW3L 2BVOA 2HKHL 5ISZA 1V7ML 3WNNA 5TDNB 2BCKB 3TVMC 3LKPA 4O2EA 3BZ4A 4MSWB 3BPNC 3ZDYF 2KDGA 3DGCR 4GSDL 4KZEH 1J8HE 5B8CB 5FYKD 1HSAB 1Q0YL 3U7WL 1NANH 4O51B 3QUML 1JPGA 5FO8B 4R8WL 4YHYB 1LGVA 3MRNB 1U41A 3QPXH 1XR9A 5LXGL 1JNNL 2JJSC 4P46C 3MO1B 1ZVYA 2EZ0D 1SEQL 5HI3C 1OP5H 2N1KA 5D70H 2OQJA 3RKPA 2ADFL 3RWDB 3FFDB 3VXMB 1N6VA 5T3XD 4AEHL 1T66C 4LRIC 3PDDA 3G6AA 3KLSA 1EX0A 3CPLA 5JTWA 2C7UB 4NDMB 4CAGA 2YPKB 32C2A 1S9KC 1B0GB 2IH3B 4OSUL 1KB5B 4Z0XA 3GMMB 3QFDA 5IFHL 4R0LB 3GHEL 1CXKA 5C0CA 1MI5D 2GCYB 3BIBX 1DQLH 2K7PA 3DNKA 4HCRH 3H3PH 3VDCA 4XNZC 3S36H 3ARTA 5ESVB 4OZGF 4WI3A 4O5LH 3RY6C 3QFJA 2XNAA 3PF2A 3G6DL 3MTRA 3NAAH 1YZZA 1IJ9A 5EZLB 4WFEE 2WZPD 4XNQA 4OD3H 1PKQE 4GQ9H 4OKVA 3MV01 4E42B 4Y88A 3VG9B 4JFYB 3LEXA 1QTYT 4JVPA 4HG4J 4NN6C 5DJCB 3X17A 2D7MA 3RTQB 3E3QC 3T0BA 5TF1L 3OG6B 1A3QA 4MB4A 4HFUH 5EZIL 4GRLC 4JO3H 3ZKQD 1T03L 4NBZB 3FOMA 3WUZA 2QADC 1XF4A 5IB5B 3EO1B 2DQEH 5HHQB 3SDXF 4OQ1A 1NGPL 3SDAA 1I7ZB 1BJ1H 3VGEA 3B43A 4XB8A 1IM9B 2BXZA 2H32H 3PL6C 1A22B 3MRGA 4GW1A 5B3NA 4BQ8A 3JWOH 5FM8A 2EYRA 1QYGL 2V5TA 1JUFA 1JTOA 1KCVL 1S5IH 1MVUB 3BGMB 3S98A 4DK3A 4C58B 1J11A 1D9KC 2VE6A 2PTTA 3HZMB 2BERA 3OPZH 3JTTA 3VCLA 2V2TB 2DM4A 5JOFA 5H35A 4K9EH 2XTJE 1HCFX 3P0VL 2A6DA 2HFGH 4LBEB 3C5ZD 3G6JA 4UV7H 4KJQD 1U9KA 4AT6B 1BECA 3L3DA 4NUJA 5DR5L 2ZSWB 4G6JH 1CR9L 3IAPA 1CK0L 1CTNA 1ZLSL 3CXHK 5MI0B 1RJLB 2YD7A 5I74B 1SVZA 1QFUH 5A3IC 1BQLL 3SQOH 2BOBB 5F1SA 2IALB 4PJ7E 1TJHH 5CEYA 1J05B 4MA1B 2W0LA 5D2NB 1ZLWH 2K7QA 4KROD 5DMGC 2Z35B 1DN0B 5D7IE 1FDLH 4NN7C 4UAOB 1KB9K 3IDNB 4G9DB 3FB5A 5C0NC 4WNQB 1YY9C 1A3RL 3V0VA 3T0DA 1NBVL 4F9PC 5EOTA 1G9MH 3UDWC 4HGWA 4GG6F 1TZHA 2IPKB 5JIHA 4YHIB 5F71A 4ZFZA 3WXWL 3QWRA 5IT2H 3QUMB 5HHME 5E7FA 4PBWD 2W38A 1ZMYA 2Y23A 4NCC1 1CGWA 1HKFA 5D7SH 1R24A 3TN0A 2DL2A 1YECL 1EEZB 25C8H 3BGFB 4JFDB 3ZDZE 5IFAH 4M62L 1DBAL 2XKSA 5I19L 4YGVA 3QQ3B 2D4DA 2X9YA 4HT1L 4M7ZB 1S9WB 2YUZA 5I1GL 2R1WB 4MXWL 3T2QA 4OB5L 4DKAA 5JIKA 1R5WA 4FFWD 2FGWH 5FYLD 1GZPA 1KLFA 2DQIL 5IBUG 4CNIB 3PQYE 5IG7B 5DZNA 2GK0B 2VL5B 2FEEL 2PO6A 3TT1L 2W07A 2WUCL 4QRTA 3REVA 5SWSE 5DURD 1SM3H 4PGZA 3FOLA 1C5CH 1M71B 4ZUTB 3GUTA 4O2CA 5F7LB 3DMMA 4LIQL 5ESQB 4ODWB 1NLBL 4CKVX 4PJ9D 4IRJD 5DZOA 1S9XB 2EC8A 5H2BB 1TVHA 5DQ9B 4OUOA 2ORBH 1NFKA 4QRUA 2R8SL 3I3EA 1S78C 2IAMC 4L9DA 3EDKA 5IB1A 1I4FA 3I3DA 4M4PA 1I9RL 4RRPA 2OTWA 4ZXBC 5BQ7B 3H9YA 4U6VL 3I6LE 3MV7A 3BEVB 4HIIB 3DPBA 3QULA 4OF0A 3C08L 1EIBA 1HHIA 3WE6A 5F70A 4U2YA 4Z7VF 5LCVH 5AG8A 4FFVD 1ES0B 3ET9F 3LH2L 4XMLH 3I85A 3THMH 4PJ8A 3GO1H 1NC4B 2YPLD 3P4NA 1QSED 3VI4F 4CADA 3CCHA 1HH9A 2GEEA 2MNUA 3QCVH 4XBPA 1CIDA 3IDJA 2VAAB 1Q94B 4HXBL 3RL2A 3O9WB 5C9KA 1P7KB 4IMKA 4EDWH 3WD5H 2EDWA 5A16A 2ICCA 4XHQA 5EB9A 1VADA 1N2RB 2Z8VC 4P5TB 1MF2H 3RZWA 5JOEA 1C08B 1ZANL 4KMTL 5I0DA 5DJYB 2AJUL 3NACL 2F53E 1ADQA 5HGDA 1O7VA 1LNUB 4JFQB 4JQIH 4LLMA 4FQQA 3EW3B 5CJBA 3RVXC 3NIGE 1NGQL 3SE4C 4MJ5B 5TGBB 1QVOB 4I18A 5K9JH 3SY0A 4TSCL 1WEJH 2NY4C 3QCUL 2JK5A 4ZTOL 2JB5L 4D9LH 3O81A 4XP4H 1NFDB 2JF1A 1N26A 3R4DA 4XXDA 2R9HC 2MSPA 3GJFK 5DMJB 2ADJB 1RMFL 4BZ2L 1IQDB 4F58L 1VPOH 4PJGF 1KTDB 1UXWB 1MCRA 5F9WC 5AD0B 1YPZA 5BZDA 1KJ3H 5C0FA 3WUWA 3FB7B 3UTZA 1N0XH 3UPRB 4H20L 3BDBA 3FCTA 4K7PL 1JN6B 3MROB 1A6WH 3AU1B 3QQ4A 4RISH 1D6EB 3IDYC 4QRPA 3FQNB 1DDHA 3FT4B 1LO5B 2PUQT 1BVZA 1JFQL 3TBSA 1D5XA 1Z9OA 4X6DE 1CU4L 3RPIB 3EYVA 4J4PA 3ORJA 4NBXB 5INCB 3RDTC 2FO1A 3EO0A 4PRAB 4L8BA 4L4VE 4PJFA 4XH2A 3RKDC 1OD9A 5D2LA 1AD9A 3CLEH 4GT7A 4LQFL 5E8DH 3ZHDA 2FYYB 4H0IA 3GSOB 5IESH 3FO1A 4ZOAA 4X7TA 1IC5L 3OKMA 5KSVB 3KLHD 2R1YB 4ZUSB 1A7OH 3CU7A 3RWFA 4P2OC 1B3JA 1MJ8L 4OZFG 5GZNC 1ZT1B 2W0FB 5BVJB 1P4LA 4MNHA 1D6VL 1FO0H 1KJVA 2CGRL 3CFDA 4TVSa 3QUKB 3U6RA 3IVKB 1OQXA 5F9JB 1AGFB 1P9MA 2NMSA 2R23B 3OR6B 1LO0L 3HE6D 3FQUA 2FEDC 4YX2L 1L9NA 4NO0D 1PVHA 5BCAA 4J6RH 1Q9KA 4P9HC 1CWVA 2X89A 2WBJC 3O11A 3DBXA 4NT6B 4EI6B 4XCYA 3EUUA 2DAVA 4LASL 5A2IH 2XZZA 3U1SH 4OZ4B 2MCPL 4EUPA 2ITCB 3SDCA 4E5XA 1NCNA 4GBXC 3MV8D 1MFAH 2IFGA 4Z5RA 5D72H 3PGD