2CLVB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm8 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct orientation of the alloreactive monoclonal CD8 T cell activation program by three different peptide/MHC complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence P
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clvB00
1CS6A 4Y5XB 5HBBA 4P5TA 5DWUH 5BZDA 1K8DB 3JV6B 1WBZB 5GSRB 3QDJA 3WFBL 5EU4B 3QCTH 3TA3C 4LMQE 5F9AC 4EDWH 3MODL 4AH2B 4ZUWA 2FH8A 5FM5O 3QEQD 1UJ3C 4FQXC 1HQRB 4MLSA 4LQ1A 1A9BB 5EUKA 2ATKB 1A47A 4ZO8A 5IMOB 1XGPA 2P47B 4DVRH 2HLFC 1UM5H 1IC4L 3DLQR 5MI0C 2OJEB 4L4VB 4BA8A 1N2RB 5TF0A 1T1YA 3U2SA 2P48B 3CD4A 3VGBA 4OGZA 2QBWA 3MPCA 4QHLB 1MJUL 1P7QD 4ZXBA 3LVEA 3QIBD 1OT2A 3IYLW 4PLJC 1VGEL 1I9RH 4NWUL 5C0JB 4H26A 4ORGA 3IGAA 2QADD 4DQOL 4U1SB 1Q9WA 5JHLH 4FZEH 1K2DA 1MFDH 1ZMYA 5F7EH 1YY8A 3U83A 4X4YB 3G04A 1RFDL 2Y7QA 4JO1H 2NX5B 3RNKA 3OV6A 3TBSB 5IHLB 3FN0L 3ARED 1OAZL 1IGTB 2VN7A 3O81A 4HS3A 1MH5B 4Y16A 5IROC 4N5EC 1R24B 1I7TB 1P7KA 4XHQA 1KFAH 5EIVA 4P9ML 4WW2F 5FGRA 3SDAD 4ZNEE 4HS8L 3JUYA 5JIPA 2AXFA 3GBML 1NEUA 3SGDH 3GHBL 4ONGL 1FNSH 1DBJL 5I1DA 5TE4H 3FT4B 5GIRA 3QYCA 4P3CH 4XPAL 1RZJL 1TVBB 2M26A 3GNMH 4MJID 1A1NA 4JLRB 32C2B 5C07B 2D7MA 1IC1A 4OCWH 4XPHH 1D5ZA 4TVPD 2CDGB 3P11L 1HWGB 1M7DA 3OXRB 1RZ7H 3V9FA 5SWQA 4P5TB 3GJFH 3NFNB 4K55A 4YDIL 5AAWA 5BZDB 4XC1H 1YEHL 4UZGA 2VDOL 3QDJB 1GVIA 4ZUWB 4N90E 3BKYH 3OHXA 4LPXA 4NZTH 4G6FD 3V4VH 4QT5A 3ARBD 3BPCB 1K4CA 4I4WA 5EUKB 3IKCA 1XGPB 3L3KA 3MRPA 4D9LH 4MXWH 5BVJB 3BFOA 4JREB 3L95A 1BM3L 1T1YB 3U2SB 2EZ0C 3MCG1 5FCUH 5GPRA 2K7QA 3F58H 4QRPD 4WFHD 4MCZB 5EOCL 1BX2A 3MJ9H 4ZXBB 4GRWE 4OLUL 4FFYH 2MCPL 1MNUH 1Q1JL 3EGSA 4H26B 4ORGB 3IGAB 4FQCL 4L4TE 1Q9WB 1RZIA 1NMCC 1K2DB 2DJ4A 3D3VD 4L4TA 3SCMC 4WO4A 2NXYB 1FNEA 5DWUL 3G04B 3LPGA 4JDVA 2I5YH 2Y7QB 4KZDH 3RNKB 4EDWL 3O0RH 4KK8C 5FV1L 1CU4H 2FIRT 4MQ7A 5CGYD 4OLEA 2AK4E 2I9TA 1PJ9A 4HS3B 4Y16B 5IV2A 2AK4A 4GBXA 4IMKA 5D1QD 1LGVA 1P7KB 4MVBC 4P2RD 4OZHE 4FP8H 5C70A 5CEYA 1UWXK 4X6CF 3MACH 4OZHA 4DVRL 4DEPB 1RVFH 2MQ0A 3O2VL 5I1DB 3ISWA 1NC4A 1KOAA 3K8MA 5GIRB 2NY0D 1NGXA 1RZ8A 4FTVE 4L3ED 2WW8A 3LPWA 3DOSA 3U79A 4FTVA 4HMCA 4JZNA 5E1AA 1A1NB 4N1CA 1I9RL 4JVUA 1CDHA 1WV7T 2R9HD 5K9OA 1D5ZB 3IKKA 1FFPA 4MNGA 4PG9A 1M7DB 3VXSE 5SWQB 4FZEL 1OSPH 4X83A 2NR6C 2CH8A 1KCSL 4OM1H 7CGTA 5F7EL 5BS0E 2QTEA 3BPLB 1EHLH 4I1NB 5F7NC 4JO1L 3ARDD 3HE7A 4GG8A 4C59B 4YDVA 3OHXB 5JO5B 3C2SA 1DUZA 5JMOC 5GGTA 1XIWD 4I4WB 4YC2B 3HPLA 2VMFA 1KFAL 1ZVSA 4DUXA 3IAGC 3IKCB 3L3KB 3MRPB 3DETD 3LB6C 5C0CD 2PTUA 5DD5H 3KXFD 1FNSL 3L95B 4U3XA 5TE4L 1MJ7H 3UDWC 2R2EA 4P3CL 2BDNH 5DQJA 2WBJA 3IRPX 1CT8B 3GNML 3HMWH 5E6IC 3WLWD 5K9KA 4GRWB 1SVCP 3N0PB 3EGSB 2EC9U 4CVXB 1MRFH 3K4DA 4B7IA 3QR2A 4OCWL 4MZ2A 2O5XL 4XPHL 1OARH 3PWLA 4I48A 3U4AA 1AXSB 1RZIB 4KUZH 2IFGA 4L4TB 1E4XH 1RZ7L 2DWDA 4NNXA 4WO4B 2W65A 4EXKA 3OKKA 3HG1A 4XC1L 3IDYC 4GRLB 1I9JL 2ATPA 1JVKA 3D9AH 4JFEE 3BKYL 4MQ7B 3UAJC 2I9TB 3ARFC 1WZMA 4NKDA 4NZTL 3V4VL 5IV2B 4HIIA 2AK4B 4GBXB 4Y4KD 1AO7D 3JWDH 4Y2DD 4NKMA 4K71C 4PJ8C 3R06A 3D85D 4QHUA 4LLQA 1OGAA 4D9LL 5KVFH 5CEYB 5CP7A 2D2OA 2VKWA 3SDXE 3WXVH 4OZHB 4YBQC 2AEPH 3UPCA 1NC4B 5D7JD 4I18A 2A6IA 1NGXB 3FFCA 1RZ8B 3MGTA 5FCUL 3F58L 4FTVB 3MJ9L 4MD5A 4JZNB 5IB3A 4KTYA 3D18A 1RJLA 4FFYL 4J3UA 2IQAB 4AIZA 4NSKA 1U0QA 2ZKHH 2DLGA 1H3VA 3QO1A 3BD4A 2IAMA 1MFBL 2YC1A 4Z7WF 4MNGB 5DMJB 1T0PB 1N64H 1AC6A 4QXGH 4HQQH 4R0LC 1H3WM 2Y9RT 4XPTH 5AAMA 3HE6C 4TULH 2YA2A 4UB0L 1CIDA 2I5YL 4KZDL 4OZFG 3HE7B 4GG8B 4X7CC 1FFOA 1DUZB 1CU4L 3MBXH 3C09C 4PR5A 1J5OH 3HPLB 1ZVSB 4NHCH 1J8HE 4TSCH 4N8VG 3H9SE 3MACL 3KYNA 5CSZA 3UYPA 1RVFL 2Q20A 1A6UH 4J3XA 1E4WL 1LEGB 2R2EB 5BZWB 5J6GA 3GM0A 2WBJB 4G9FA 1QFUH 2FNBA 5K9KB 1G7IB 1TTFA 1MPAH 3RQ3A 4GW4A 4I48B 1NUDA 2BY3A 4GKOA 5FDWA 5DRNA 2C4FT 2Y23A 2P8MA 1EVTC 2DWDB 4NNXB 3TO4A 1FSKC 2W65B 4EUPG 1B6UA 3OKKB 5T1LD 1HSAA 3HAEG 4OM1L 3SDDD 2YA0A 1KYOJ 1TQCC 3QEHA 2RB8A 2ATPB 4FFZL 4JDTH 4YHIA 2VO5A 1RUKH 1XGRB 1G1YA 1AGCA 4JFEB 5KW9H 4OZIE 1MCDA 4NKDB 3DUSA 3TPUB 4AZ8A 4HIIB 3OXSA 4KROD 3FT2A 2NZ9D 4OZIA 1AGFB 1BFTA 4APQB 5DJZA 3R06B 3UO1L 4QHUB 4LLQB 1OGAB 1JZ8A 3TJHC 1R5WA 5EO1A 5CP7B 4FNLH 5JOFA 3LY6A 5DD5L 3SDXB 2A6IB 3FFCB 4KK6C 4K7PL 3P9LA 3MGTB 2EDDA 1MJ7L 4KRPC 4K3DH 4MD5B 4Z9KB 1GCFA 2BDNL 5IB3B 3QXWA 2QSCH 1RJLB 3D18B 3QUZC 1H3UA 4AIZB 4NSKB 1MRFL 3MC0A 3RZCC 3QO1B 1KEMH 3MRCA 3G9VA 2IAMB 2YC1B 3FOLA 4NZDA 4DVBA 2NXZD 3FB8A 2BERA 1G7QA 3TGXA 1OARL 1OB1A 3ULUE 4KUZL 1ADQA 4D9RD 1ZGLM 1E4XL 1P84J 4KJPD 4RMWA 3H3KA 1V3JA 4Z7VA 1FFOB 5K59E 4NFCA 4PR5B 5D1ZA 1D6VH 1T5WA 3CIQA 1DBMH 3JWDL 2EDQA 4CMHB 4OQTH 2MPAH 5ACLA 1MAMH 4Y19E 4BQ6A 3IFLH 4L9LA 2X1OA 1YUHA 2R56H 3BISA 3WXVL 3KYNB 5CSZB 2G9HA 2AEPL 3H9SB 4F7TA 3OBAA 4JRYD 2CLRA 5J6GB 4G9FB 1QKZH 3KPRE 1SJHA 2YUVA 3KPRA 2ZKHL 4ZNCD 2KDGA 1FL5A 5FDWB 1YEJH 5DRNB 2P8MB 4ZFGH 3TO4B 4R2GC 1HHJA 4QXGL 4HQQL 2D4FA 4Q58C 1HSAB 1WUNT 5L2KE 4AT6A 5CZKA 5E70A 3QIWC 3LN5B 1U6AH 3QEHB 3PP4L 1DLFH 1UKSA 3FTGA 1OPGH 3MBXL 1GZPA 3OXSB 3FT2B 4XBPA 1J5OL 5F70A 4OZIB 1IZJA 1B6DA 5DJZB 4TTDC 1R5WB 2LU4A 5EO1B 5JOFB 4TSBH 4TSCL 5CEXA 2BCKA 4XCFH 1YMME 1U3HA 2FL5A 2VQ1A 3P9LB 1A6UL 2P5WA 4LCUA 4PJXA 1T7YA 3FQTA 4HSQA 3DSFH 1JPFA 1QFUL 5C08E 3BDXA 5FYKU 3V6OC 1W72L 3B9EA 4DVBB 3MRCB 3CSYA 3FOLB 1MPAL 1BZ9A 1G7QB 3WUWA 1HXMA 1OB1B 3KYAA 4ENED 3GMQA 5BCAA 2XV6B 3VMPA 5HYSB 1G0YR 2HP4A 4PG2C 3ZKSD 4JRXE 3GDBA 4Z7VB 4HGKC 2VDQL 3ARQA 4R97C 4JRXA 2G2RA 2VZ3A 5SWSA 1GPOH 5JZ7D 1U58A 4Q7DA 1RUKL 1T5WB 5LGJB 3PWNA 1HI6A 3WIFA 1EV2E 4HF5H 2P44B 1AHWC 2NX5D 2ZUQC 2WP3T 4L9LB 4WFFD 1KN2H 4JFHE 1YUHB 4FNLL 5J06A 5GRVL 1S7RB 2G9HB 3SGKC 5BQ7A 3PHOB 1PKOA 3RIAK 4P4KB 3VA6A 4F7TB 2CLRB 4M6OH 4EOWH 3VFVA 1H3PH 4KJWC 1IGMH 1SJHB 1SYSA 2QSCL 5BRZD 2H2PC 3KPRB 4F15B 3LQMA 3QQ9D 1KEML 1FL5B 5FGSA 1HHJB 1JGEA 3HCVA 4EEEA 1TNNA 3EJYD 4AT6B 3LQZA 3P0VH 3HZVB 2HT2D 5KSBE 2R4RH 5GGVH 5CJ8A 3T1WA 4HZLA 5KSBA 3TBYA 3FTGB 5IBTL 1LO5A 4Y5YC 5CEZD 4S11A 1LO2H 3LEXA 1D6VL 3MRNA 4XBPB 2JELH 4P5TD 1BREA 2V2WA 2PYFA 1DBML 3RGVC 3QDJD 4OQTL 2MPAL 3IJYA 3V7AG 5EA0H 2FJHA 3QZWB 4BKLA 3IFLL 3BZEA 4M7ZB 2DICA 5CEXB 2BCKB 6CGTA 2ITCA 1WJ3A 2R56L 3ZHKA 1U3HB 2FL5B 2HRPH 2VQ1B 4CDGC 3GRWA 4LCUB 2E9WA 3FQTB 2OL3A 1T89A 1JPFB 2WBWB 1JWUA 1QKZL 5E8OA 5C08B 5HVHC 2X7LA 3OZ9H 3MA7A 3CSYB 4EQ3A 3MO1A 4RGNE 4GLRH 3KGRA 4NC1C 5KVGH 1HXMB 3FQUA 2ZUXA 1CLZH 4UT7H 1KT2A 3GMQB 1BQSA 2W0LA 4ZFGL 2HKFL 2JF1A 3P30H 3EFFA 1HZHH 4RMSA 1YECL 3BYYA 3N50A 5E1HB 2E9IA 4JPIA 3KPSE 3W5NA 4H1LA 1DLFL 4Q0XH 4JRXB 2G2RB 5SWSB 1QACA 3MRDA 1U58B 4OQ1A 1OPGL 5IFHH 3PWNB 3P2TA 3PWJA 4OF8A 5CLWA 3WIFB 2NXYD 1YEKH 1HQ4A 1CXIA 2DQJH 2LVCA 3QUMB 3EOAA 1FV1A 5L7XH 4M93B 3WXWH 1ITCA 3CFCH 2PXYC 4TSBL 1T1ZA 4Y16D 5BQ7B 1Y6MR 4XTRC 3ZKXC 3W39A 2CD0A 1CXFA 1ZLWH 5JORA 5HSFA 4KTEH 2B0SH 3VFVB 4K8RC 3DNKA 4NN5C 3EFDL 2VDKH 5FM8A 1SYSB 3DSFL 5F8RC 4GXVL 1EEZA 4UQ2A 4PFEA 3LH2H 4LLYA 5D1XC 2BVPA 1JGEB 3KHQA 3HCVB 1NFKA 1X4ZA 3V79C 1RI8A 2EE2A 4ZYKA 1TCRA 2YKLH 3KJ6H 4HZLB 1GC1L 5KSBB 3TBYB 1TZGH 1LO5B 1GPOL 3LEXB 1EX0A 3MRNB 1FFNA 3ILQC 2YPLE 2V2WB 2PYFB 4QY8A 5EFIA 4HF5L 4ZAKC 3VRLE 3IJYB 3OKDA 2FJHB 5IEHB 4BKLB 1WZLA 3IVKA 5E2UL 3OB0H 2JJSA 2GW5A 4N90D 4WV1A 2ITCB 2MSPA 3X11A 4MQXC 3T2OA 3QPXL 1AKJA 5F8QC 2JIXB 3O6LH 1F6AA 3HTLX 4MS8D 2OL3B 4EOWL 2AVGA 4ZS6C 1IGML 1JWUB 4WGWB 1NBVH 1EAJA 5E8OB 4ETYA 4HH8A 2X7LB 3BH8A 3GJFK 3MA7B 4K9EC 2YEZA 2BVEA 3CZFA 3MO1B 4F8TA 4G7VH 3FQUB 4PJIF 2HLAA 1KT2B 1YYLL 4OCXH 2AAVA 4HLZG 3EFFB 1RZKC 1SJVA 4LDEB 3IDXH 4AQOA 5K9QI 1WICA 5CJXC 1KPUA 5HHMB 4AEIL 4JPIB 5HGGS 2AV1A 4H1LB 4XVUD 5GGVL 3ULVH 2FIKB 1S78C 1F90L 1A1MB 2WIIB 3PWJB 1LO2L 4L4TD 5IBUB 3QFDA 3VI3E 2W9LA 2JELL 1HQ4B 5FV2A 3TH3T 4GO6B 3VFOB 3EOAB 3F65A 4FXGA 1FV1B 1MIEH 5EA0L 2GCYA 4D8PA 2CLZA 1T1ZB 3W39B 2AK4D 4WW2A 1JWMA 1ZGLP 5JNYA 1A6PA 3T2PA 4CVZA 3U82B 1NCDH 3TH2T 5L88H 4JVPA 4YLQT 4RGMB 2PUQT 5IK3A 2EYSA 3U1SH 1NC4D 3OZ9L 1EEZB 3V52H 1PY9A 3AFLA 4UQ2B 4XVJH 4LLYB 1ZHLA 1ZV5A 1EA9C 2BVPB 2YD1A 2CXGA 3BP6A 2EIBA 4FG6C 4JG1H 4QKXB 2VDML 4W70A 2AJYH 4FTVD 4UT7L 4ZO7A 4JPKH 4MD4A 1E6JH 4ZDHB 3FKUS 3P30L 1HZHL 1U8MA 2AJUH 4ZYKB 5E4IA 4OB5H 1MCPH 4Q0XL 3KVQA 2JTDA 3P40A 1FFNB 1U3YA 4H0GA 5IFHL 4HK0A 1NANH 4OCLC 4QY8B 4UILL 5EFIB 4BH7A 1YEKL 5A43C 2DQJL 3RJQB 2ED9A 4XNZC 3VWKA 3OKDB 3HE7D 3IVKB 3WXWL 4L3AA 3UJIH 3DI2B 3X11B 1QBBA 3CFCL 1KF9B 4LGSB 4RCAA 2UVEA 4LU5H 4RWYH 4CAGA 4KH2A 1AKJB 4PJAE 1W8NA 2R0KH 1F6AB 4KTEL 1HYRC 1UWGL 2B0SL 2DWEA 4E5XB 4D0DA 4PJAA 4U7SA 3TFKD 4ODXB 4YGAB 1EEYA 3S37H 3BH8B 2YEZB 3CZFB 2FX8H 3VXQA 3MOQA 5DHXB 4BZ2H 4RAUA 2F8XC 1X9QA 4UINH 5E8PB 1KPRA 2HLAB 4JY5L 2FGWH 3CSBA 2WBJD 1A6WH 4ESKA 1OAXH 4WI6A 3SBWA 1BZ7A 1KPUB 5CP3A 5JR1L 3O3AA 2AV1B 4OCMC 3RI5F 3SDCC 5JPMA 1WT5A 3WO4C 2YKLL 3KJ6L 3U7YH 2VOTA 4QCIA 2BP3A 1TZGL 3O4OB 3S5LA 3EAKA 3QFDB 5FYJE 5EU7E 1UXWA 4Z7QE 3HG1D 2WBKA 1FP5A 4FXGB 3FB6A 2GCYB 4M03A 5B8CA 5I71C 4L29A 2CLZB 2YD5A 2GJ6A 1E4JA 1YQ2A 3WIIL 1JWMB 5JNYB 1BQHA 1MLCA 4CVZB 3O6LL 1OGAD 2R1WA 1NBVL 3MRGA 3MJ7A 3UBXG 2EYSB 4Y89A 4KDWA 3MV9E 3FFCD 1KPVA 4OV6F 3ZE0F 1ZHLB 3BP6B 3MV9A 5LGKA 2HTLD 4OCXL 3OJMB 4MD4B 1U8MB 4M4RA 3IDXL 2OI9B 2IAMD 4DKDC 1T20A 3I2CH 4JHAH 4IRJB 3C9NA 2D3VA 3GRWH 1MWAA 3NIFF 2OZ4A 4HK0B 5CINH 5MEQB 4BH7B 3M1BA 3O9WC 3VWKB 4Z77A 1JHLH 2LFGA 5EC2A 4YXKH 1JZ4A 4P2QE 4LLWA 3MTRA 4P2QA 2VYRE 1II4E 2DWEB 2YRZA 4D0DB 4PJAB 1NCDL 2XQBH 3QUXC 4WCYH 1EEYB 5I19H 1DN0A 2NLJA 3F7QA 3VXQB 4WFEE 3U1SL 5A3ID 3RWIB 3V52L 4RAUB 5DUMH 4XVJL 3I6LE 1KPRB 2ZCLH 4HFUL 1JWSA 4RRPG 1BVLA 4G9FD 3HR5A 4JG1L 3RDTC 3QI9C 1KTLA 4ODUA 5J7CC 2QQNH 4QTHB 4JPKL 1BZ7B 3WNNA 1QR1A 2AJUL 3JV4B 1JPTH 5JPMB 1LVEA 3OKEA 1FCCA 3GGWA 4OB5L 3ZKMC 4KI5E 3S5LB 5DJYA 2ZWLT 4XNQA 3TO4D 1I7RA 1UXWB 4ORZC 1JGDA 1WWCA 4G8GA 1EZVY 4ZD3H 3FB6B 5BV7H 3VG9C 4L29B 2B1AH 5B4MD 3UJIL 2ICEA 2GJ6B 3ARUA 3K3QA 5C0EA 4LU5L 4RWYL 3KYKH 1BQHB 1MLCB 2IPKA 1F8TH 3SE4C 2R0KL 1FE8H 1J8KA 1VADB 2Y25A 2XTLA 1NCBH 2R1WB 5C2UB 3MRGB 1TFHA 3MJ7B 5GS0H 4TUKH 3S37L 4XP1H 1TPXC 2YWYA 4R4ND 2FX8L 1KPVB 3KNBA 4BZ2L 3MV9B 1G6VK 3BRFA 1ND0A 2FGWL 1A6WL 1OAXL 3IRZA 2NY3B 3LZFH 3N06B 2VZVA 4RNRB 3MZGB 3CU1A 3QWOA 1CICA 3QDGE 4PRHA 5GRYA 3C9NB 2J5LB 1MWAB 3QDGA 3N85L 1F13A 5HVFB 4EI5C 3O11B 4FXLA 4HLJA 4Z77B 4KQ3L 5EC2B 3PL6C 1F4WH 3KPPA 5D1ZD 4Q6IB 3HMXA 1NAMH 4LLWB 4ZSOA 1L0YA 5B38A 3QISA 4P2QB 4M9PA 1IGIH 2R1XA 5HYQA 1SJXA 4X4ME 1DN0B 3ULVD 2NLJB 2HT3D 4X4MA 2XZCH 3T04D 1UACH 3BZFA 1GOHA 4KI1A 3KAAA 1JWSB 1BVLB 2ZNXA 3HR5B 1BJMA 3UTTA 1KTLB 2K3TA 4ODUB 5JIKA 4NJ9H 3HB3D 2XG4A 1QR1B 2H3NA 4YHMH 4P23C 3HN3A 3KPRD 4I0PC 4X9FA 2HJKA 3OKEB 4YJZL 2GK0A 3GGWB 4L1DA 3E6HA 5H94A 4QRSB 3I2CL 3IXAA 4JHAL 2DLFH 5DJYB 4P2OB 1KCRH 2MQCA 1I7RB 3GRWL 2XQYG 1JGDB 2OTWA 3LRGA 4G8GB 4V2BA 5CINL 1QLEH 3GO1H 1KIUA 3MBED 2RGSA 1B88A 2APXA 1JHLL 4NN7C 3WJLA 3LAFA 4N1EA 5IESH 1O7SA 4PJCE 2EXYD 2ICEB 4LFHD 4YXKL 2E7HA 4Y88A 5C0EB 4PJCA 4OLWL 43C9A 2IPKB 3MOAH 3BJ91 2ZJSH 3DI3B 1XCQA 4Z7UF 4XVSL 4QHMA 4KJYB 3RY6C 2QQLH 2XQBL 4ZUTB 3ROLA 1RUML 4FQJL 4WCYL 2V2TA 3C8HA 5FYKH 5I19L 3CK0L 1ZGLA 3T3ME 2NY2B 2IPUG 3I84A 1U3HD 2J4WH 3QIBC 1DEEA 2P5WD 3KPOA 5DUML 3TIEA 5JW4R 5EIIB 3QJHA 1MELA 5FF6A 5CFHA 1ND0B 4X0KA 1FYTA 5AG8A 5HGBA 2KKQA 1TENA 2QQNL 4KDTC 1MI5A 2DM2A 2QADC 4UV4H 4U7MA 3QG6A 2CJUL 3QWOB 1CICB 2IGFL 4NM8L 1ZSDA 3RHWF 1FHGA 1KJVB 3QDGB 1ZLSH 4LCCC 3P0YH 2I25N 1KTKE 4LQFH 3AREC 3FO2A 2DQGH 3ZDYE 5DD3L 3NTCH 2A9NH 5J1SC 4JRXD 3BI9X 4HUMB 5SWSD 3KPPB 1LP9A 5BV7L 2I9LB 2Z0BA 4MB4A 1A3RH 2APFA 1F2QA 3SDAC 3GMLA 4ZSOB 5B38B 4ZUSA 3SOBH 2CDFA 1F8TL 1H5BC 1QSEE 4P4RB 2R1XB 1FE8L 5HYQB 4Q9BA 2VRAA 1SBBA 1QSEA 1DCLA 1NCBL 2ZG2A 4JDZA 5MERA 5F6HI 5GS0L 4TUKL 4XP1L 5J0BA 5GS1A 2HKHL 3BZFB 4HFWA 5IJKC 1KV3A 3U46B 4QRTA 2AABH 2H3NB 4J8RA 2APTA 3SGDI 1IKNC 3STLA 4KFZC 3LZFL 3BPOC 1Q0YH 2HJKB 4MB5A 3VGGA 1QOKA 1UZ6E 2GK0B 5H94B 3E6HB 5ADPH 3IXAB 2AQ2A 5ID0A 2WANA 1GH7A 2E7LC 2OTWB 3VXUA 1BBJA 1QVOA 4YBHA 3HLAA 5J57B 4DWHA 1F3DJ 4OD2A 1MCLA 4KU1A 1QR4A 3ARBC 4K3GA 3CLFH 4PJCB 1TETH 4WTZG 3QHFH 43C9B 4QRRE 1NAML 3SEPA 1XCQB 4QRRA 1N5YH 1DDHA 1IGIL 4L5FH 5DURD 4QHMB 4R7DB 4U1NB 3GI8H 5FGBC 3ROLB 2V2TB 5E8EA 1ZGLB 3R8QA 3S9DB 2C3GA 2C3VA 3HPJA 2XZCL 4X6FA 1KJ2B 1UACL 1DEEB 3GBLA 3KPOB 3TIEB 4IIQA 3QJHB 5FF6B 4X0KB 3L5XH 4GQ9L 3K4ZA 5KN5A 3QXVA 5HGBB 1MI5B 1C1EH 4NJ9L 5IEKA 4YHML 3THMH 1RV6X 3F7RA 2X4UA 3DX9A 3QG6B 4YGVA 2COQA 2P5EA 1ZSDB 4S1SL 2DLFL 1KCRL 5C0ND 5I1HH 4JQXA 4PJDE 3FO2B 5HHMD 1QLEL 2V5SA 3MLYH 3GO1L 5CGYC 3QNYA 2A83A 1QBLH 4PJDA 4AQ1B 2D03H 1LP9B 4TUOA 1PAMA 5D1QC 2OTUA 3EW3B 2KQMA 4U1MA 3V0WH 3GMLB 5T3XH 4ZUSB 3MOAL 2CDFB 5C6TH 4WIQA 1K4DA 1P4LA 1QSEB 2QQLL 5MERB 3GSNA 5FYKL 2NY0C 1UADC 4GMTH 5E08H 3BN3B 3FZUD 5GS1B 5F9DC 4HFWB 2QKIA 4JHWH 1I8LA 2X4OA 2F19H 2R9HC 3EYFA 1ED3A 3SO3C 4J8RB 3PGCA 3STLB 1CDGA 3ZE2F 3CFKA 2ORBH 3P73A 2OSLA 2J2ZA 2BJMH 2XICA 3PHSA 5EORH 5ID0B 3PHQA 4Y5VC 1ZLSL 2VC2H 1KLGA 5EH1A 1QVOB 3P0YL 3HLAB 5FUZH 4OD2B 4LQFL 4NZUH 1ZLWK 5CD3A 2DQGL 3QDME 3NTCL 5F7HA 2A9NL 1XIWC 4FA8A 5TE7H 3QDMA 4KK5D 2M8XA 1A3RL 4HKXA 1KUMA 3BQUA 4LGPB 5LKNA 3DETC 4K7PY 3PV7A 1DQLH 5CKGA 4OUOA 4QRRB 1DDHB 2F58H 5LCVH 4OF6A 3SOBL 1FVCA 2DMCA 2HH0H 4HIEA 5E8EB 3HPJB 4N5UA 3BVNA 4X6FB 3ZHLA 1NCWL 1AKJD 3KJ4B 3UZQA 3WLWC 1VSCA 5KN5B 3MLTA 1Z3GH 3W0WE 3G5XA 2AABL 5IEKB 4QWWC 4Y1AA 4U1KA 3W0WA 3QNZA 2UUDH 2X4UB 3DX9B 4F9PC 2FEEL 1P1ZA 4YGVB 3W2DH 3LKPA 2P5EB 5ADPL 4TPRH 4WU7A 4JPWL 1FORH 3MX0A 1X7QA 5IB2A 1MF2H 5DGQA 3QNYB 2A83B 4PJDB 4N9OB 1YEFH 4TUOB 4Y4KC 4Y2DC 4IS6A 2OTUB 3EYVA 3CLFL 4U1MB 1IAIH 2FBJH 1TETL 3QHFL 5E4EB 1NDGA 4NQUA 5F9WB 1K4DB 1LNUA 1P4LB 2HFFB 1FIGL 4K94C 3GI8L 5D7JC 3GSNB 3PXHA 5AUMA 3MUJA 1BMGA 4ODBD 1DQQB 1VFOA 4O9HH 5J6HB 3AXLA 5I74C 2QKIB 2ZOLA 4KZEH 5H35A 2ADGA 2W0PA 1DZBA 2Z8SA 4HWEH 2X4OB 1Z2KA 3L5XL 3EYFB 1ED3B 2Z8WC 3PGCB 2V6HA 1C1EL 2E27H 3IDJA 3P73B 2OSLB 4AL8L 4NHUA 4PP2B 3VDBA 5HDBE 3PHQB 2XY2A 5T1DH 4OLZH 1EAPA 1KLGB 4MJ5A 1MHPL 4F37K 1OD7A 2B5IB 2X4NA 4RGOH 2X1PA 4N8VA 5CD3B 3ZMRA 3MLYL 5GJSL 5TGBA 1ORSA 1QBLL 4YQXH 1YNTA 3QDMB 4XPBH 3TWCH 4K2UH 4LCWE 5KOMC 2PO6B 4HKXB 3V0WL 1JUFA 4IBLT 4KXZI 4LCWA 5T3XL 5FEBA 5IMMB 3VWJB 3VWKD 5C6TL 2VIRA 1FVCB 1UFUA 4F7EA 1K6QH 4J2XA 4HIEB 1BJ1J 5E08L 2VITA 4LSDA 3BVNB 1R3HA 3NCMA 1WBXA 4S10A 2X9WA 2YD7A 4HKJA 4JHWL 3MLTB 5MP6L 2F19L 5JIHA 3G5XB 4M7LT 4Y1AB 2MTPA 3IDUA 4U1KB 3OAZH 3W0WB 3QNZB 3QIUA 1MEXH 1CE1H 4PJIA 4DAGH 1P1ZB 1W8OA 1U3ZA 3LKPB 1FG2A 1AJ7H 5C0AD 1OHQA 4QHKI 2BJML 3SDDC 1HYSD 5EORL 4WU7B 4X80L 2VC2L 3EDFA 1T7VA 2WNGA 5IB2B 5FUZL 3IAQA 4L8BA 3LMJH 1FC1A 5T3ZE 5J12B 4KROC 4IS6B 1CXHA 2NZ9C 3EYVB 3OAUL 5TE7L 2WINB 3J8F7 3AS3A 3S7GA 3IAPA 5FYJD 1NDGB 4EIZC 1QG3A 4R4FH 1CL7L 1DQLL 3OKMA 4YUEH 4QTIH 3CUPA 4EXPX 3L3GA 4ODWA 2VWEC 4MJ6A 5E6YA 5AUMB 3SE9H 2GJ6D 1YY9D 1B0WA 4MAYD 3NIGF 1RZGA 2HVJA 5JDJA 1T80A 2ZOLB 3BAEL 1WFOA 2ADGB 1KYOK 1V3LA 1U8OA 2WUCH 1CXLA 5DGRA 2MMXA 3B8SA 4WY7L 2EIDA 3TV3L 1Z3GL 3B3IA 5IGXH 2B39A 3TCLA 2NXZC 5EBMA 3IDJB 1ZEAH 2DRUA 2NCMA 5IHZB 4N9GA 1CFNB 4C55A 3MUZ1 2L7UA 4NHUB 3ETBF 3EIFA 3MV8A 4MAUH 3W2DL 1IC5H 2YD8A 4TPRL 4KJPC 1EAPB 4MJ5B 2MCG1 2X4NB 2NY3D 4N8VB 1MF2L 4UT9H 5TGBB 1EZVX 1OD9A 1ORSB 2A77H 1YEFL 3NPSC 3KG5A 1YNTB 5BXFA 3DBXB 4X98A 3AROA 4X7FC 1E27A 5FDYA 1IAIL 1RK1A 2FBJL 4LCWB 3B83A 4RIRA 2VIRB 2A74A 3VE0B 3GSRA 3RIAF 1WIPA 2P1YA 5DFWH 4F7EB 5T1MA 1NMAH 2VITB 1NGWA 5FO9A 5HHQB 1WBXB 3NA9L 1P84K 4NUGH 5F1IA 4O9HL 3IU4H 4L8SA 4P2QD 5J9PA 4KZEL 2R2CA 4HKJB 1CD1A 4HWEL 2KZWA 2FX7L 1NL0H 1T22A 3ZT6A 5CILH 3QIUB 1GL4B 1G0DA 4U6HB 2ZCKL 3TC9A 4WFED 1XF2B 1W2KT 5T3XD 1YYMH 2P46B 3I6LD 4XCCH 3WDIA 4ONOA 2X89A 5T1DL 5FM4A 4OLZL 1Y0LB 4RGOL 2VDPH 2R23A 3GSXB 3B9KA 3GSNH 4L8BB 5C9KA 2XWTA 4NOFA 5ERWA 5HPOA 3ARSA 1JE6A 4YQXL 4XPBL 4TNVK 4XMKH 4KI5D 3WFHA 1JBJA 4K2UL 4G8GD 4KMLB 1NBQA 1ZLUH 1HSBA 3OKMB 4MX7B 3CUPB 1FPTH 1A6ZA 1SY6A 3L3GB 5T1KB 5C86A 4ODWB 4ELMA 4OJFH 4MJ6B 1K6QL 1YNKH 2YHGA 1H8OA 1F11B 5C0FA 3MNZA 4HKBA 1RZGB 2GKIA 2HVJB 5F7WC 3L3JB 3TESA 3O3UN 4JO3H 1U8OB 1WVZA 3VXPA 1Q72H 3B3IB 3TCLB 5IWLA 5EBMB 2NY2D 4DKFL 4ENEC 1MEXL 1CE1L 5IR1A 4DAGL 3MV8B 1AJ7L 3LHPL 4DJMA 5E7BA 5JZ7C 1R3KB 4OBRA 3AAZA 3CVHH 3LMJL 1CICD 4PRHD 4M43H 1PBYA 5JXAH 5BXFB 1BLNA 4X98B 1E27B 3QULA 3UTSE 3QDGD 1RK1B 5DK0B 4G5ZH 4KJQC 3V95A 5D7IF 2ZCHH 4RIRB 1ZXQA 1CZ8H 3R1GH 2A74B 4C56E 3OGCA 3GSRB 4W6XB 4YUEL 5T1MB 5EU6A 3VFSB 4C56A 5FK9A 4PGBA 1UQSB 5KTEH 4LKCA 5E94A 5CHNA 1NGWB 3SE9L 5FO9B 5J4MA 4M8QA 1OQXA 5F1IB 4AM0A 5KG9A 4L8SB 4MSWA 3T4YA 2LQRA 5J9PB 1CD1B 2WUCL 2XA8H 3QQ9C 4XWOD 2Y1VA 4U6TA 1ZEAL 4G6JH 1D9KA 5GGVY 4LAQH 5DEZA 4MAUL 3EJYC 1IC5L 3UTTD 2BSRB 2HT2C 4GXUN 4LHJB 3ARRA 3GSUA 3QT2A 5DVLA 2R23B 1Z6JT 3B9KB 2XTJE 4Z78A 3LEVL 3D5OF 3L5JA 3BGMA 4UOJA 2XWTB 3VFUB 1F3DH 5ERWB 2A77L 4P5TC 3UXFA 5MHSD 3WFHB 2BOCA 4OLYH 2BNRE 1LK3H 1OGTA 1HSBB 4OZFH 2LU3A 3VA2C 4KKCD 4BFIA 1A6ZB 2AS5M 4ELMB 2VLJD 4JN1H 2IANE 1URLA 4I0CC 1JPGA 4AJ0A 4O00A 4KAQH 5C0FB 2IANA 4HKBB 4K3JH 3T65A 4NUGL 1TTUA 2UZIH 3IU4L 1PZUB 1HINL 4JREC 3KPQB 5EPMA 4FZ8H 4H88H 4XC3L 1ZTXH 4U2ZA 5CILL 3NGBB 4ZXBC 1XMWA 1PQZB 3CXDH 4I3SL 3C6SA 3HI6H 1YYML 1FYTD 1R6VA 4K3HA 4XCCL 1QFHA 1MI5D 4M62H 4HWBL 4P5MA 1DBBH 3BW9A 5JW4N 4RBPH 2VDPL 3AAZB 2X9YA 3WNLA 3RAJH 4UMGA 4GLRI 2DQTH 4Z95L 2NXYC 1BLNB 4BFBD 3QULB 4IEFB 4EUPH 2NR6D 4XMKL 3MLSL 2JJTA 3HAEH 5J13B 1HHHA 3LS5H 3EKCA 2I26N 1FPTL 3GK8H 4C56B 5FK9B 4PGBB 4Y16C 1YNLH 1DR9A 4OJFL 4LKCB 5E94B 1YNKL 5CHNB 2BRRH 4M8QB 3MRFA 4AM0B 5KG9B 3T4YB 3K7UA 3TNNA 2XKNA 4JO3L 2O93L 3U30B 5I6XB 2J6EA 4LKXA 5ISZE 1S9YA 4XP4H 4XNYH 4O58H 3HKFA 5ISZA 2VZSA 1KCVH 3UTQA 4WRLA 4LPYA 3GSUB 4OGYL 1RURH 5HGDA 3C5JA 3TF7C 5HI4D 2Z31A 2HRLA 5EDXA 5D6CA 4Z78B 3HUJA 3BGMB 1KGCD 3CVHL 3IFNH 1CGTA 5JXAL 4M43L 2BOCB 4N8CH 3LRSA 3U4EA 3BPLC 2XN9A 3VXUD 1OGTB 1INDH 4G5ZL 2ZCHL 1CZ8L 3R1GL 4S0TD 4BFIB 5GS2H 1JPGB 2CO6B 4YC2C 2IANB 4MNHA 3T65B 1A2YA 1CWVA 3H42L 4MS8C 3VFGH 4PLNC 3BOVA 5IQ7L 1M05A 3C6LA 2IBBA 4HPOH 3T0BA 3VH8A 2EDBA 2WWKT 2GEEA 1UG9A 5EPMB 1S9WA 2XA8L 4HS6A 3ZTNH 4HH9A 1EFXA 4ZO6A 2QQKL 2ARJQ 4G6JL 3C6SB 3T2QA 4LAQL 3RTQA 3FT3A 5FYKE 1X4XA 3UROR 1CLYH 2MKWA 4XVUC 2J12B 4M48H 4P5MB 4LDOB 5L2JA 1T2JA 4DN4L 2P5ED 4WO4C 3ARGA 2CIIA 2D31A 5I30H 3HRPA 1CR9H 3V6FB 1NCTA 4OLYL 1HHHB 5C0RH 1LK3L 1KCUL 1QFWI 5A16A 1J1XH 2OMBA 1S7QA 4XHJD 4GBXC 2B4CC 4IMKC 4JN1L 2R69H 3MRFB 4KAQL 3F62A 1OW0A 4K3JL 2D4DA 2FX9L 3TNNB 2XKNB 3QXTA 5DMGD 4F9LA 4MD0A 4H88L 1PX3A 2QV2A 1ZTXL 4LKXB 1UA6H 1FAIH 1S9YB 2K7PA 1S9VA 3QH3A 1IGFH 3CXDL 4XAWH 5I0DA 5ISZB 4UIKH 3JXAA 3RWHA 3LKRA 3UTQB 1H3XA 4TOYH 3GM8A 5HGDB 1SY6H 4M62L 2Z31B 2YD9A 1A7QL 1DBBL 1RUAH 3LSOA 5D6CB 3HUJB 3QSKB 3S3SA 1UEMA 4LLAA 4FQQA 1BEYH 2DQTL 4PJEE 5GJTL 3T8XA 4U31A 3LRSB 3U4EB 2XN9B 3RY5A 3RVXD 3HE7C 4K8RH 1C5CH 3LS5L 4X5XA 2BY1A 1RJZA 3GK8L 4M7JL 1Q9KA 4XMLL 4IOFD 1XGUA 3OJ2C 3QDMD 4MNHB 3BQUD 1BJ1H 1M05B 1NANI 3C6LB 4FQHA 3CDYA 3TFKC 3VH8B 4Z18A 4OAWB 1S9WB 1J7VR 4HS6B 5DEFA 1EFXB 4PJHE 1LDSA 2WBJC 1NH6A 1S7SB 1A8JH 1HKFA 3RTQB 2X70A 3FT3B 4O58L 3WDHA 1MY7A 1KCVL 4KRPD 4LL9A 4YFLI 2YUZA 2E8ZA 4Y1AD 3W0WD 4Z7NE 5DC9B 1A64A 5A2JH 4JQVA 5FYLL 1I1CA 2EYRA 4DK6A 2CIIB 2D31B 4N8CL 3MA9H 5GRJH 2WMPA 3ZYOA 4D94A 1INDL 4JE4B 4BYHA 4NQCE 5A16B 3UBXA 5IG7A 1RU9H 4C54A 4NKIH 1S7QB 3SQBA 3QWQB 4APQC 2ICWB 3VFGL 4B5EA 2UUDK 2EC8A 2DN7A 5HYSG 2OR7A 4HAGA 5DQDH 4HPOL 1RZKH 1W0WA 4MD0B 3UX9B 5IMLA 4I18C 2R8SH 1CDYA 1IFHH 5E8NA 5T5FH 3QJFA 3O2DH 3ZTNL 3QBTB 1S9VB 3QH3B 2X41A 3NIDE 2HTLC 2P45B 3RWHB 3LKRB 5ESAA 4KHXH 1CLYL 5I1GH 2IAMC 3WFDH 4M48L 3LSOB 4HC1H 4HMEA 2NY1B 1YZZA 3UJJL 4CMMA 2R29L 4IJ3B 3V4PH 3LKSA 4FQQB 1OT1A 1JNLL 1TXKA 3T8XB 4NRZA 3MLUH 3S36H 2DQIH 1CGSH 3DGGB 4PJEB 1IEBA 1SHMA 4NPYA 3WD5H 1O5DT 2NY4B 4HEME 4X5XB 4CN1A 1RJZB 3CFBB 4DKAA 1CE6A 3OMZA 1YEIH 3B8YA 1J1XL 1Q9KB 1XGUB 4JKKA 4YE4H 3JV0A 1N6UA 4U7KA 2NW2A 4CMHC 2R69L 1ZLVH 4GMSH 4LCWD 3CVIH 4FQHB 2ZUUA 4L4JA 4B41A 1CYGA 4WGVB 4NCC1 3H9ZA 4M5ZL 1MCOH 4TRPH 2ADJA 1P4BH 4MCYA 5DEFB 1UA6L 1FAIL 4YNYA 1UYWH 3NZ8A 4PJHB 1IGFL 5CJBA 4Z7WE 4UIKL 1TCMA 1WK0A 3UTZA 3QZWG 1I8IA 4NQTA 4GRWF 3VCLA 3FO1A 4TOYL 3G5YA 2AV7A 1SY6L 3QIUD 1OOAA 5GSVB 1RUAL 3MMEA 3TO4C 2EYRB 4AEFA 4XMPL 3QPQD 1BEYL 5HD8D 4WUUE 5GGQH 1B4JH 2JB6A 2DKMA 4K8RL 2CK0H 3L3OA 4LARH 5GGRY 3QHZH 3UBXB 1C5CL 5B4MC 5IG7B 2DDQH 2MJWA 5T3ZD 3TVMA 4YFEA 4JRWA 2XRAH 3OAZK 1DL7L 3SE3A 1LQSR 2Q76A 2OK0H 1C5DA 5F71A 3QQ4A 3OB8A 1W0WB 5IMLB 4R4NC 1LEKA 4OZHF 3BMWA 4XX1E 5E8NB 3QJFB 3CSGA 3GKWH 4IDJH 5F3BA 1VEMA 3SJVA 2YD6A 4S2SB 5DJCA 5ESAB 3AY4A 4GKSA 4X6EA 3AC0A 3TO2A 1V8HA 5DS8A 4CMMB 4JN2A 2X1QA 3MV8D 5JQ6H 4Q74A 3OKLA 4NRZB 4HLZH 5ANMA 2FATH 3MA9L 5GRJL 1IEBB 4U05A 2R39A 4NPYB 2Q8BH 3WIHL 3EOBB 2E6QA 1CE6B 5D1ZC 3T2NH 4CW1A 2IJ0C 3MFGB 1RU9L 4NKIL 1I1AA 3RWDA 3C5ZA 4K9EL 5E9DA 4I9WE 2NW2B 1ACYH 1JHKH 4BUGA 4L9LC 5TFSL 1CI5A 5C09E 2YN3A 2NZIA 5DQDL 1H8NA 3ULVC 2HT3C 1RZKL 4FXKA 5C09A 2ADJB 3BH9A 5JLZA 4X4ZA 4MCYB 2Y07L 1MFEH 3AS1A 4DTGL 4X7TA 2Y5TB 1IFHL 2IF7A 5T5FL 1V7MH 5D93B 4YNYB 2SEBA 3O2DL 4MGXA 3T08A 3NZ8B 4HIXH 4X7SL 3HB3C 3UTZB 4F15C 1I8IB 3VCLB 1WWAX 3FO1B 1XH3A 5I1GL 3G5YB 3WFDL 2AV7B 4HHAA 2VH5H 3MMEB 4JFPA 4HC1L 1I8MA 3V4PL 3B4NA 1MCWM 5I1JH 3MCKB 2X89D 3MLUL 3S36L 4XCNA 2DQIL 1CGSL 4F2MA 4OF7A 4XBEH 5JW3L 2JB6B 1BPVA 4NM4H 4NJAH 4JFQA 3WD5L 3L3OB 3MV7A 3B9KD 2ARJA 2EXYC 5D2NA 4M6NH 1YEIL 3MUGA 4PJBE 1XR9A 5HGAA 4YE4L 4NRXA 12E8H 3TVMB 5IOPA 2VDLH 2BNQD 3QG7H 2WLZA 2Q76B 3FO0H 4GMSL 1C5DB 4M7ZC 2DBJA 3QQ4B 1WFTA 4H1LG 1MCOL 1MFCH 2CRZA 4TRPL 3E2HB 1U3HC 1P4BL 3SDXF 5I9QB 3VXRD 5F3BB 1JZ6A 1UYWL 1MLBA 4Z0XA 4JQIH 3SJVB 5DJCB 4OCSH 3C08H 3E8UH 4GKSB 4X6EB 4N0UE 3EYSH 4JG0L 5DQ9A 1BF8A 5FA3A 3TO2B 5DS8B 4QOKE 4JN2B 1CFVH 1NMCB 1ZLUK 4LPVA 1CGVA 4QOKA 1FAKT 1NGPH 2FHBA 2KUTA 3OKLB 4JZJA 4XBGA 1MCCA 2NTFA 5ANMB 2E6JA 1MCRA 5GGQL 2F54E 9CGTA 1B4JL 1FZJA 2F54A 2CK0L 4LARL 4CW1B 2VTFA 3GSWA 3QHZL 5DMIL 1I1AB 1CIUA 1H15A 3RWDB 5E9DB 1QBML 4YIQA 2XRAL 4M93C 4X6DA 5I66A 4ZFFA 4FXKB 3RWJA 5C09B 4YHNA 3EJJX 3BH9B 5CWSA 5DK2A 1N59A 5EU6D 4C56D 5JLZB 5DJDA 4X7TB 4YDKH 2DM4A 1F4YH 2SEBB 3Q6FA 3GKWL 4NT6A 4XP6H 4XZUA 5J11B 3PE9A 3O2WH 3RNQA 1EGJA 1XH3B 5IVXE 2DIAA 2EDHA 4UAOC 4HHAB 4GS7B 3CMGA 4JFPB 5IVXA 1PLGH 2AKRA 1D9KD 2W0KA 1FNLA 1I8MB 2C3XA 4WTZA 5L6YH 3AB0B 3F6LA 2H6PA 5JQ6L 4OI8A 3W11D 2F74A 4XCNB 4O51A 4F2MB 2FATL 2H2SD 4S1DD 4JFQB 2Q8BL 2ARJB 5D2NB 3B9DA 3MUGB 5DJ0A 5HGAB 4OFIA 3CFDA 4KMTH 4NRXB 4PJBB 1TJHH 1FL6A 5IOPB 4XNMA 1X5JA 3RVUD 3ZL4L 4A6YL 1ACYL 4OZIF 1KN4H 4W4OA 5CJQH 5HJ3A 5ICXB 3BE1L 2VNCA 4PLKD 2HVKA 3WUZA 4WHCA 2UZYB 1OAUH 2VZTA 1SYVB 2IAND 1OAYH 25C8H 2D0FA 4W6YB 1MLBB 1WISA 1T89C 4G9DA 4Z0XB 3TPKA 1M6OA 4PPTA 4G8FA 2Z4QA 1CBVH 3RPKA 3VJ6A 5DQ9B 1RD6A 3WFZA 5FA3B 1JJUA 3S3PA 1XCTA 2VH5L 1INEH 1Q9LA 2H41A 5C0NC 4QOKB 4LOUD 4XBGB 3ULUF 2GI7A 4IOIA 1KIPB 3IDYB 4OCNC 1J9CT 2F54B 4NM4L 4NJAL 4LEOA 3GSWB 4ZTOH 5SWZE 1AP2A 2EDXA 2LU7A 4M6NL 5LXGH 1YQVH 2F5AH 5K59F 3QRFM 2BOBA 4NQXA 5D7IA 12E8L 4PJ8B 4YIQB 2VDLL 3T77A 3QG7L 5EOTA 2A2QT 3QWRA 4X6DB 5I66B 3FO0L 1CD0A 1W0VA 4ZFFB 3SKMA 3RWJB 3TBVA 2M1KA 3JTSA 5DK2B 1DANU 4YHNB 1N59B 5DUPH 1MFCL 3FZUC 1QO3A 3KPLA 5DJDB 1N7MH 4I8DA 4PB0L 3Q6FB 4ODSL 4LIQH 4OI7A 4NT6B 1G0XA 3IDNA 4PD4J 4RBPK 4XZUB 4OUUA 1X5KA 2E9BA 4OCSL 5AD0A 4RGMC 5BV7C 4GOSA 4LSTL 4XRCA 3RNQB 4GG6E 2XPGA 3EYSL 2HJLA 5KSAA 4TVSa 5IVXB 2AKRB 3DYOA 1N4XH 3WBDA 1CFVL 4D3CH 4F37F 5JOPE 2H6PB 1AFVH 1JZ7A 4HAFA 3WS6A 1ZA3A 2I24N 2F74B 5FFLA 4O51B 1UWEH 2XZZA 4BELD 2Z31D 1TVHA 4CDHA 2QEJA 4KK5C 3CFDB 1PSKH 3MRQA 4OCRH 1ERNA 2HJFA 1FL6B 4XNMB 1BAFH 2XN9D 1TZHA 4JFOA 4IHOA 1QZ1A 1U41A 3GMPA 1KNOB 4RFNB 2JJSC 4UU9A 3UYOD 1FG9C 4MNQE 4XP5H 2QJDA 4WV1C 3RWCA 2HVKB 4TVPH 5D7LE 4MNQA 2NY5C 3S5LG 4LVHB 5IFJA 3EO9H 3QFJE 1F4YL 1KULA 1M1SA 1Z0NA 4G9DB 4ZMAT 2MNUA 1CDUA 1M6OB 3QFJA 3MNWA 2FGZA 4G8FB 2Z4QB 3AVEA 1J1PL 3CFJA 1QSFE 3SPVA 3KPTA 4PRPE 3VJ6B 4EBQH 1QEWA 1D5IH 1EO7A 3O2WL 4HG4K 3T0WA 4IMLA 4ZUUA 1EFXD 1FGVH 1A0QH 1XCTB 1PLGL 1Q9LB 1BQHG 5L6YL 3RTQD 5MEPA 3WDJA 3WLBA 2BXYA 1JP5A 4IOIB 2FO4A 3D39E 4WI4A 4LEOB 1X5LA 1KIQA 3D39A 1AP2B 4L8CB 1A6TA 3M07A 3ARGD 4O2CA 3QCUH 4KMTL 1Z9LA 2AERT 2BOBB 5EC1A 2GY5A 3VI4E 5D7IB 5IJVA 1TJHL 3T77B 5EOTB 1KN4L 2PN5A 4M8VA 2V5RA 5CJQL 1JNNH 5D5ME 3S37X 1W0VB 3SKMB 3TBVB 3JTSB 2GJZA 1QO3B 3KPLB 4WW2C 1BD2E 4CU8A 1OAUL 4PB9L 1XF3A 5D71H 1E4KA 3CZJA 3F5WA 1V05A 1IAII 25C8L 3IDNB 4OUUB 4RMRA 3SGEI 1MQKL 3QUZB 4UNTA 5AD0B 1FBIH 4ZFOL 4XRCB 1J88A 4PJ7A 2XPGB 2VZ1A 3RZCB 2HJLB 4QHKJ 2VLRE 5KSAB 4GG6B 1P2CA 3PDOA 1G6RA 1IARB 1BFOA 1INEL 5IF0A 3OJDA 1GAFH 5GZOD 5IQ9B 1TITA 3LV3A 3CDGB 5IHUL 1HIMH 3I9GL 1IKFH 2BFVH 1CF8H 1Z0MA 1TVHB 2NY1D 4QGTA 1B2WH 4ZTOL 5KSBF 4Y5XA 3RI5K 2O5ZL 3MRQB 3Q1SH 2HJFB 1YQVL 2F5AL 2AXGA 3PWPA 3DGCR 4JFOB 1TZHB 3D0VA 1KENH 3VWKC 1WBZA 3GMPB 2X4RA 1UM4H 5FYLE 2NY4D 4KRNA 5ACMA 1PKQE 4UU9B 5JHDE 3RWCB 1PKQA 4MNQB 3GSOA 5DUPL 1N7ML 5IFJB 5CKAA 1HQRA 4LIQL 1A9BA 3QFJB 5IMOA 2FRGP 2VN4A 3CFJB 1M7XA 1VERA 1QEWB 1Q94A 4L4VA 3O3EA 5DZNA 4V1DD 4IMLB 4ZUUB 3T0DA 1M4KA 7FABH 1Y6KR 1HYSC 1N4XL 2BHYA 3GFUA 4D3CL 2RJMA 5MEPB 1QBAA 1AFVL 2ADFL 2CSPA 3WLBB 3SBWC 5BW7A 2DI9A 1J12A 5C0JA 1RULH 2FO4B 2KQNA 3MJGX 1WT5C 1A4KA 1EUUA 1UWEL 5DT1H 5ICZA 4PREA 3T4AA 2IC2A 5F3HA 1DQJA 1KIQB 3D39B 4U1SA 1X3DA 1A5FH 3H0TA 1RJCA 1WAAE 4JHZA 1A6TB 3U0PA 1IILE 3HNVH 4O2CB 1PSKL 2PW2B 5EC1B 1WAAA 4OCRL 5EU7C 5IJVB 4X4YA 1J05A 2Y06H 3MSPA 1CTOA 4TQEH 3L3IA 1WBYA 3MLXH 3TBSA 4Z7OE 5B8CC 1IGTA 4XP5L 4FMKA 2GJZB 1YY9C 5JIIA 4TVPL 1A02N 1XGYL 5L8KB 1U3JA 1R24A 2XIDA 3BO8B 2Q1EA 2EICA 3EO9L 3F5WB 4LCIL 2Q6WA 2QSTA 3U4BH 3WN5A 4LGRB 4PJ7B 2VDNH 4NC1E 3MYJA 4CL7A 1P2CB 1CFTA 2VLRB 3PDOB 5TPWH 4F33A 1G6RB 1TVBA 4P48A 4BSJA 1BFOB 5HYJE 5IF0B 5B38G 3OJDB 1G9MC 5CGTA 3IJSA 3M45A 3LV3B 32C2A 4I0KA 2NY3C 2E7BA 3O41B 4ZOBA 3BXNA 1UJTA 2PF6A 4JM2F 4NQEA 4K94H 5IMKA 5AEAA 4R97B 3L3HA 5FKPB 3O6KH 5ILTH 3OXRA 2J5LC 3ZO0A 2OBGA 4QXUH 1DFBH 5LVEA 2CKBH 3NFNA 3HC4H 1MCFA 2AXGB 3GKZA 3PWPB 4BFEA 2F53D 3D0VB 1YDPA 4FRWA 2WWMD 3CC5A 2X4RB 4I2XE 4WW1A 1JNNL 3VRLF 1PKQB 3GSOB 3BPCA 2Y72A 1T0NA 2W07A 1Q0XH 5D71L 1HN1A 5I1CH 1PX4A 4QGYA 4HD9A 5KVMC 5BVJA 2APWA 1FBIL 4I5BA 1Q94B 3O3EB 1NLBH 2KL6A 2FR4B 3BD5A 4MCZA 5C8JA 2IALA 2HG5B 1GAFL 4GRMA 6FABH 3U7AA 3QXAB 1HIML 1A4KB 1WFUA 5ICZB 4PREB 1IKFL 1FO0B 2BFVL 3O3DA 1RY7B 3T4AB 4PJ5E 1ZLVK 5F3HB 1DQJB 3K81A 4LF3A 3V7MA 3H0TB 4KI5C 4R90H 3U0PB 1WTLA 3IFPA 4HUNB 3Q1SL 1J05B 3TH4T 2G5BA 4LSRH 1KENL 2EXWD 3MLVL 1FFRA 3L3IB 4GKNB 3VI3F 1UM4L 1WBYB 1PG7H 4LSQH 1FNHA 5EZIH 4RDQG 3TVMD 1IC7H 2Q6WB 4ONFL 1JN6A 5SX4H 4ZNEA 3WN5B 3TZVA 1IEHA 2XZQH 2NY2C 3UJTH 2G60H 3MYJB 1X6LA 5DJ8A 1NUFA 1CFTB 1VACA 4F33B 1S9XB 3PJSB 7FABL 3SJVD 4KDVA 4JJHA 2AEWA 4PYGA 3IJSB 4LPWA 2FD6H 2X4PA 1RULL 3BXNB 1I1YA 4NQEB 5DT1L 4HJGB 5IMKB 3INUH 4H8WH 3L3HB 4YO0B 1CICC 3BSZH 5FKAB 4E0RA 3HNVL 5DEGA 1P53A 1FZKA 4JFDE 1YDPB 3K80A 3OSKA 4N0CD 2Y06L 3CC5B 3NH7L 4WW1B 4JFDA 2GTZA 5I18H 3B5GA 4TQEL 2Y6SD 3MLXL 4CU7A 5JO5A 1L0XA 3PNWA 2I60H 4KK9D 1I1AD 3C5ZD 5E9DD 1T0NB 3DHMA 1A1OA 4I9WD 4Z0BH 2C3HA 3FJTA 3RBSA 4XWOC 3U4BL 4PJAF 5C09D 5HI5C 4I5BB 3T1FA 5C0IA 2VDNL 2VSDA 2X09A 4PRDA 5TPWL 3QRGH 3GUTB 4R4BA 5C8JB 2IALB 3PGFL 3LD8B 3TCXA 4OIAA 1CT8A 5EOQH 1CDJA 2P4AB 4GRMB 3BX7C 4HCRH 4CVXA 1NAKH 2BHUA 3EUUA 1U92A 3O3DB 5F1KC 5DHVA 4HJ0D 4K94L 1GYAA 4LF3B 3WS3A 1AXSA 5ILTL 3DO7A 4KQ4H 4QXUL 1DFBL 4YFDB 3IFPB 5C0BD 1I85A 2EH7H 2WQRA 2CKBL 3HC4L 1MHHA 2G5BB 4ZOEA 3RHWK 3QCTL 4KKCC 4C4KO 4GRLA 4Z7QF 5IVNA 3CX2A 3MV7D 3WJLC 1LWRA 4WU5A 3RIFF 4LPTA 4KKLD 5JXEA 5E56A 1OTSD 3HZYA 1Q0XL 1F6FB 5I1CL 3DXAE 1OP5H 4XP9H 1JN6B 4EI6A 2R1YA 3TZVB 5IHBA 1UM5L 3RPIB 3AU1A 3KS0J 4U2YA 5DJ8B 1KTRL 1VACB 1NLBL 4N0RA 2YN5A 5HYFA 2W9EH 3L5WA 1U8QA 2OR8A 5ESQA 3R0MA 2DLIA 2ZG3A 4JFYA 6FABL 5D8JH 2X4PB 2IQAA 3MGOA 3NFPA 1I1YB 4U33A 3P77A 43CAB 3FN9A 1R0AH 3T0EE 4MXVF 1A6AA 5D2LE 5JHLL 3T0EA 4E0RB 4QOKD 4R90L 5IUSA 5DEGB 3VXSA 5D2LA 1MFDL 1FZKB 1RK0A 4L8DA 2CUIA 4LSRL 4JFDB 2GTZB 1LD9A 5BS0A 4MQTB 4OFPA 4IDLA 1GGBH 2F54D 4F3FA 5TJWK 3PNWB 4LSQL 4CADA 1I3GH 1DQDH 2EH8H 4WEMB 1GGCH 5EZIL 3EDJA 1IC7L 1XZ0A 1SJEA 1A1OB 1UB5B 1QNZH 3VD5A 2ZOKA 3ABZA 4XXCA 3DURA 5C0IB 3T1FB 2XZQL 3UJTL 5GS1C 4YDLB 2G60L 3C5SA 4PRDB 1LEGA 4J4PA 5BZWA 5DD6A 4R4BB 5F93C 1JGLH 2R2BA 1LDPH 1G7IA 3OKYA 2AEIT 3KLSA 4ONHA 5HI4C 1PGRB 2FD6L 4WI2A 1C7SA 1DLHA 1U92B 4QWWD 5DHVB 4S1RH 1X5AA 3INUL 4H8WL 3WS3B 2YXMA 3VXME 1I7UA 2IQ9H 2XXCB 3BSZL 3DO7B 1NJ9A 3VXMA 1IJ9A 1CQKA 4KC3B 4KI5F 1MHHB 4X4XB 5I1KH 5B21A 5IB1A 5I18L 1TQBB 4WU5B 4QXWA 5KZCB 5C0DA 4HGWA 1XGRA 4JFEA 3TPUA 2I60L 4X9IA 2Z92A 1IQWH 4Y7MA 1AGFA 4APQA 4DFHA 3HZYB 5EU5A 4EI6B 1PEZA 2R1YB 3HR6A 4Z0BL 3BPNC 2G75A 4MXWL 4G3YH 3AU1B 1JYVA 3SDXA 4R7NA 4PJFE 3UYRH 5CEZH 3KJ4C 4IIQC 3QRGL 4YWGH 3GIZH 1JGVH 1U8QB 3L5WB 5ESQB 1I8KA 5EOQL 4JFYB 1MNUL 3MGOB 4TNWF 3NFPB 4HCRL 4O4YH 3P77B 1NAKL 5DD0H 1A6AB 4NN6C 3IU3A 3T0EB 4KQ4L 4JQXC 3VXSB 2J7LA 5D2LB 4KXZH 4JB9H 2DIBA 2FBOJ 1RK0B 2EH7L 4L8DB 1T4KA 2A6JA 4FN0A 3DUUA 5DHYA 2CK2A 5TDNA 4PUBH 2DLHA 1LD9B 5BS0B 2YUXA 3O0RL 2NTSP 2DTMH 4XHJC 4F3FB 3U9PH 4PGCA 1MJJA 2UZXB 3NN8A 2FB4H 2PTTB 5HHOE 4CADB 5E4EC 1NFDE 2JCCE 2EC9T 1XZ0B 5F9WC 1SJEB 1AGEA 2H1PH 3ESVF 1T6WA 1NFDA 3NACH 1PG7W 2JCCA 3QWRD 4KKAC 5DMGC 4XP9L 1J10A 1MCHA 2ZOKB 4ZO9A 5ETUB 4FP8L 3DURB 1J8HA 5F9OH 1F4HA 3REWA 3H9SA 3C5SB 5DD6B 1I8LC 1FGNH 2W9EL 1AQDA 2R2BB 4G6KH 1N0LA 3RVVD 4ONHB 5GZND 5D8JL 1DLHB 5CBAA 5KSAD 3WNOA 4M7LH 2AJVH 1I7UB 1NJ9B 4A2LA 3VXMB 1OSPL 5EO0A 3RVXC 1GIGH 5JOPD 2B5IC 3O9WB 1EHLL 2DQDH 3LN5A 4BSWA 5IB1B 2P8PA 2A0LD 3ZE1E 5C0DB 4IOFC 3VDAA 4HGWB 3EYUH 2BX5A 2Z92B 1XEDA 3BQUC 5IB5B 1I3GL 1DQDL 2EH8L 3MRMB 1GGCL 3MNVA 4PJCF 5DFVD 5GRWA 5ESVB 5EU5B 1QNZL 3WFCH 2VZOA 1JPST 3X12A 2DQEH 3PP3H 2G75B 1NGZA 5J56B 1YN6A 2C1OA 4MNQD 1P9MA 4R7NB 1S7XA 5DA0B 4UNVA 4CN6A 4YX2H 4Q6YA 2EEBA 3PWVA 5MENE 3K0WA 3T3MF 4DW2H 1AD9B 1JFQH 3QFJD 1I8KB 1JGLL 3HMWL 5MENA 1BWWA 1L6ZA 4U6XB 1U8IA 2GFBA 2RHEA 5EG6C 3NCCB 1MFNA 5DO2D 3VFMA 4LPCA 5HHNA 3IU3B 1EEUA 4B7LA 2IQ9L 3BGAA 2F9BT 3U7WH 4UTBH 4PTUB 4RDQF 5DRZA 3WJJA 3WKMH 5HYSA 1T4KB 2A6JB 5DHYB 3DUUB 3PIQA 5TDNB 5DVOA 4HUWB 5I1KL 2L7JA 5DC4B 3MUHL 3RX5A 3VG9B 3D39D 3D9AL 3DVGA 4PGCB 1MJJB 5LGJA 4NCC2 3NN8B 1LP9F 1T5XA 3ZDYF 1X44A 1A7NH 1AGEB 5LWYH 3BESR 4DGVH 1NFDB 2JCCB 4GRWH 2DS4A 4AMKH 5IB4A 3D6GA 4Y19A 5E2JA 5KVFL 1J8HB 4FFWD 1KB5B 5DJ2A 4DZ8A 1RUQH 1HH6A 3IDMA 1S7RA 4G3YL 3L9RA 3REWB 3PHOA 2LAGB 2O5YH 5CEZL 4P4KA 1A7OH 1WZKA 1EVUA 3VD3A 1AQDB 4YWGL 4ODTH 3GIZL 3T0AA 5EZOH 1JGVL 2PTVA 1C7TA 2YBRA 3A6BH 4XPGH 2UVFA 2AEQH 4O4YL 5CBAB 2XQYK 3ROOA 3P4LA 3WNMA 1IAOA 3B2VH 4PS4H 5DUBA 5DD0L 1A22B 1N64L 2B4CH 5EO0B 1UZ6F 4XPTL 1RIVH 4TULL 1LO4H 3TN0A 3HZVA 1VFBA 5J1TC 4BSWB 3TP4A 3N9GH 5L2KA 4PUBL 2YK1H 2P8PB 3BIBX 4J1UA 3PL6B 1F2XK 5CLTA 2DTML 1FC2D 3MRJA 3U9PL 1S8DA 1N5AA 1QPXA 3WE6B 1YMHA 4YK4B 3PWPD 3MNVB 4NZJA 2IPUK 2H1PL 4YHLH 3X12B 3QZWA 3NACL 2JE8A 4NHCL 1NGZB 3TBTA 3KLDA 1YN6B 3QXUA 2C1OB 5F9OL 1T7ZA 3FL7A 4RISH 1S7XB 4PJ9A 4UV7H 4NRYA 3PWVB 1MIMH 1YMMA 4LDLB 1FVEA 4M61B 1FGNL 5MENB 4LLMB 1BFSA 2AJZB 1U8IB 1GOGA 3GMRA 3SN6N 4MMXC 5JW5A 2GFBB 4KRLB 5C08A 3QIUC 4L4VD 1GGUA 3VFMB 4M7LL 5GGTH 5HHNB 1CFQA 2AJVL 3QPQC 5B3NA 5HD8C 5DRZB 2C4XA 1EEQA 1GIGL 3PIQB 3MCLH 4PTTA 4ZG1A 4P9HC 5E00A 1UXSA 4X8JB 3DVGB 3H3BC 1VB9A 4JDTL 4PJDF 4YPGA 5KW9L 1T5XB 3KPMA 3CX5K 2JKXA 3FQRB 1WLHA 5E5UB 4KJQD 3QUMA 5IB4B 3WFCL 2QHLA 4Y19B 2DQEL 3JWNC 5DJ2B 5F9JA 3TT1H 4QRPE 2AI0H 4WFHE 4DZ8B 1HH6B 3IDMB 3L9RB 3OG4B 3RVWD 1F4XH 2CO7B 1D7FA 4KVNH 4YX2L 1JL8A 3QIBB 3ALPA 3HC0B 3S35H 1U8NA 1ORQA 3FQNB 4DW2L 4K3DL 1D5BA 4M00A 5D72H 2Z8RA 3LQAC 2YBRB 3IF1A 3VRIB 4YHYB 5JDSA 3ROOB 3OG6B 1IAOB 2HFGH 1D6EB 5DUBB 3G6AA 1F02I 3KR3H 4CBPA 4OIBA 4N0YH 3U7WL 2W60A 4UTBL 2W0FA 3EZ8A 5C07D 3TN0B 1MY5A 1VFBB 2KBGA 4UUJA 5L2KB 2BSTB 4NQED 5I8KH 4J1UB 1UM6H 5DF0A 3B5TA 3MRJB 3TBWA 4P2RE 5AG9A 1R3JA 1S8DB 1UZ8A 1N5AB 1YEGH 5A2FA 1YMHB 4G7YH 1A7NL 3B5HA 5LWYL 1MAML 4DGVL 5IEHA 3TBTB 4V2CB 2A9MH 5BVPH 1JTPA 2AP2A 2VXUH 2ZPKH 1RUQL 3D48R 5SX5H 4YHPA 1NCNA 5DFTA 3FQXA 4PJ9B 4NRYB 2O5YL 4K07A 4L8SC 1YMMB 3H9HA 3JZ7A 1A7OL 2JIXA 1FVEB 2FYYA 4LRNH 4ODTL 4P46A 5EZOL 5ALCH 3IDGA 4JZOA 3GMRB 5FECA 1A7RH 3VFRA 3A6BL 5JW5B 3GI9H 2AEQL 1B0GA 2QSQA 1CFQB 4PRNA 1YEJL 3B2VL 4ZXBD 5FM5M 2B4CL 2JLLA 3SKJH 3FB7A 1RIVL 2Z9TA 3ARDA 4PTTB 4JKPH 2RAMA 1LO4L 1U2CA 3B9KC 4YZFE 1U6AL 5E00B 2EECA 1UXSB 3P0GB 2FIKA 3T3PE 3KPSA 4OCYH 1A1MA 4HJJH 2Q86B 1I3UA 2WIIA 4LRIA 2Y5EA 4NYLA 4YPGB 3KPMB 4ZPTA 2BXZA 3VFOA 1U91A 3KLAA 3KXFE 3OL2A 2OXHA 1I9EA 2DQFB 4YHLL 4U6VH 5F9JB 1T6VN 4XCFL 5E2WH 1J0HA 4RISL 4QYOA 4KPHH 2V2XB 3U0WH 3NABH 3KS0H 4UV7L 1MIML 1U8NB 5KVDH 1ORQB 1HILA 1NCUA 1D5BB 1KB9K 2GY7B 2YA1A 3NMEA 5IWLC 3TZVD 3IF1B 5EN2A 2BMKB 1EHNA 2GSIA 1YJDH 3NGBC 4XPFH 5JDSB 3G6AB 5GGTL 2W60B 1JNJA 1NLDH 2W0FB 4ZDHA 1J1OH 1ZHBA 4JM2A 3CCHB 5JTWA 2E9JA 4UUJB 5HDBF 3MCLL 1AO7E 1CN4A 4E9LA 3FAXA 3TBWB 1R3JB 1UZ8B 1ZT7A 4QO1A 4YXLH 2LTQB 5H2BA 4I77H 5J13C 2YPLA 4WUKH 5D6DA 2OP4H 4JFDD 3L7FA 3SKNA 4DUVA 3V2AR 2K1MA 3EO0A 4E42B 1KN2L 1OTUD 1UH3A 3TT1L 3SDYH 4YHPB 2ADIA 3FQXB 4HPYH 2H8PA 3O6FA 1F4XL 1ADQH 3H9HB 4KVNL 3SQOH 4KV5E 3S35L 3ULUH 4M6OL 1ONQA 2XOTA 4E5XA 2FYYB 1H3PL 5I75B 4P46B 3ZDZE 1DJSA 4ODXA 3IDGB 4JZOB 5D72L 3U30C 2YZ1A 5FECB 3VFRB 5I6XC 4OGXH 3DV4A 5JPNA 4YHZH 3WO3B 1NBYA 1D9KC 5FOJA 1B0GB 3R4DA 1CQYA 4PRNB 5E8PA 3A67H 4GAGH 4RGNB 3W11C 3KR3L 4LNVA 3FB7B 2V5MA 4N0YL 1LEIB 4PP1D 3VH8G 2H2SC 4S1DC 3ARDB 3P0VL 4POUB 2YR3A 1QFWH 5HPMA 1U2HA 2R4RL 4ODHH 4MXQD 5I8KL 3UBXI 3KPSB 1UM6L 2VISA 4NYLB 3UPRA 5GGSY 4IRSA 4AEEA 4WO4D 3RVUC 3ZDXE 4ZPTB 4X9GA 1R5VA 1YEGL 4G7YL 1U91B 3QQ3B 3KLAB 2Z93A 4WVRA 1J18A 5FXCH 1O7VA 5F7UA 4GRLD 4PLKC 3KXFB 5CIPB 5KZCD 5TQ0H 4JFXA 2A9ML 2FDBP 1AGBA 2W91A 5BVPL 1FIEA 5JXED 1OLZA 5KJRH 2VXUL 2ZPKL 4GBXD 4QYOB 2HRPL 2R0WH 3ES6A 1P4IH 4LCYA 3L5IA 1CK0H 3S98A 2YRPA 1HILB 4UQ3A 5E99H 1DVFA 4LRNL 4LAJH 2Q8AH 4EQ2A 5ALCL 5EN2B 4L3CA 2XWBB 4YDJA 1A7RL 2GSIB 5ELIA 1L6XA 3GI9L 4LOUC 1EK3A 5KVGL 1ZOXA 3GMMA 1DE4A 1CLZL 3G5VB 3SKJL 1HEZB 1ZHBB 4JM2B 2VE6A 4JKPL 1LO3H 2DLEA 4JGUA 4M6MH 2WZPD 1OP5K 4IRJA 2CMRH 1YPZE 4OCYL 4HJJL 3T0ED 1ZT7B 4R96A 2B8OT 3VXSD 4NIKB 1YPZA 2JJTC 5H2BB 5MEQA 3IB4A 1ZVHA 4D0CA 3QHTC 2YPLB 4PGZA 2UWEE 3VMNA 3L7FB 3SKNB 2VWEE 5BS0D 2UWEA 3N1MC 3EO0B 5C9JA 5L7XL 3BKMH 2YPKA 4U6VL 3U9UA 1WEJH 4N0FA 4OTXH 4XVTH 2ADIB 2H8PB 3O6FB 4KPHL 2AJXH 1ONQB 2DD8H 5KVDL 4HWNA 3WNKA 1KXTB 1NC2A 2VDKL 2O26U 3DV4B 5JPNB 4LVEA 5A2IH 4D9RE 1NBYB 3L7EB 2V17H 4PY8J 2IBZY 3RWIA 3ALXA 4J4PD 2L4OA 3LH2L 2ZUYA 4JGMA 1CD9B 4KTDH 4QTHA 1NLDL 5DI8A 3NFSH 3QUMH 1J1OL 2Z31C 3JV4A 4KMQA 5HPMB 3QUYA 2B20A 3FFDA 4W6WB 1UB6A 3MJ9A 3DECA 2VISB 3UPRB 4IRSB 4CVUA 4PD4K 5CCKH 1R5VB 1HK6A 4YXLL 2CRMA 4I77L 2Z93B 4PRIE 4KRMB 5C71A 1OP9A 1CVRA 4WUKL 4ZODA 3MFFA 4PRIA 4JRYE 4JFXB 1AGBB 4JFED 4ELMF 3SDYL 4XCYA 3O45A 3ES6B 4HPYL 4APQD 3C6LC 4LCYB 1KLUA 1ADQL 3SQOL 3H7BA 3RWEB 1VADA 3HNTH 4UQ3B 2P42B 1DVFB 4ZTPH 1IAKA 3BGFB 3LKNB 4L3CB 1JYWA 4YDJB 4RWHA 4OGXL 4NO2A 4YHZL 3O3BA 5DRWA 4G7VL 4PYHA 3RTQC 2NYYD 1VGEH 1DE4B 3A67L 3GMMB 4GAGL 2BVUA 5C6WH 1L9NA 5CSBA 4M3KB 3V4UH 2VE6B 4BUHA 1QFWL 4ODHL 4RNRA 3ULVL 1VCAA 4Z5RA 3ARGC 2RBLA 4KROB 2P24B 1IM9A 4JFFE 4R96B 1YPZB 4JFFA 4D0CB 4MA8H 4CJ0A 2J8UE 2OL3H 4R9HA 3L1OH 3O11A 4ZPVA 2J8UA 2UWEB 1NDMA 1MIEL 5C9JB 3LKQA 2YPKB 3U9UB 4N0FB 4Q6IA 2HFTA 1OW0C 5C0GA 2HAZA 2R0ZH 1DTUA 1YC7A 1AC0A 1CK0L 4U1JB 4F9LC 2H9GA 1NC2B 5E99L 2IH1A 4C83A 4H1LH 1J8HD 4OZGE 5L88L 3G6DH 4XPAH 4XXDA 1TIUA 3H9SD 4OZGA 3H9YA 5GZOC 2OLDA 3N1PC 2AJYL 4MLIA 5GQBA 3V5DA 1E6JL 5DI8B 4QEGA 1S5HA 5JMRA 2ZP0T 3QUYB 3FFDB 2NY1C 1LO3L 3T0VA 1AR1D 2YSSA 4IJ3C 4NBZB 4QRSA 4B0MM 1MCPL 1EHAA 4M6ML 1UB6B 4A2MA 4P2OA 2CMRL 2VDOH 2NX5E 2Z91A 4WFFE 5F7YC 2NY4C 1U93B 1TTGA 3MFFB 4PRIB 3PQYE 4JJ5A 3BKML 5GRXG 3V5KB 5I8CA 4D2NA 4MHHG 3PQYA 1N3NA 4XVTL 3RVTD 4OTXL 4JRYB 1SQ2N 3FQWA 4XCYB 3O45B 4K23H 2I07A 3GJEB 5ID1A 1KLUB 3I6KB 3H7BB 2BSED 5BRZE 3BRDA 4R3SB 2YUWA 2AJXL 2DD8L 3K46A 4KJYA 1ITBB 1BM3H 1PFCA 1IAKB 3LN4A 4ZUTA 3CAFA 3SE8H 4NO2B 1AI1H 3O3BB 5DRWB 1T03H 2D0HA 1CVSC 3RKPA 2GK2A 1FCGA 3DUHA 4UINL 5EIIA 5A2KH 3S36X 4ZQKA 5JA8B 2J3SA 3CH1A 1F00I 4Y4HA 5CEZE 3NFSL 2EDFA 3CLEH 4JQVC 2HTKD 4Z5RB 1QFOA 3U7YL 2OCFD 3QDJE 4WI8A 2NY5H 5MEOA 3PP3K 1IM9B 4XX1G 1KJVA 2ZUSA 4MB3A 3ULUD 4BQ9A 4JFFB 5CCKL 3FO9A 4ZPVB 2J8UB 2F8VA 1W0YT 1NDMB 3LKQB 4POZD 4ALAH 3NAAH 5EBGA 2I9LA 4LVOC 1KLFA 4TYUA 1K8IB 5C0GB 1BQUA 3UCRA 4P4RA 3O2VH 2H9GB 3HNTL 4Y19D 2IH1B 4ZTPL 4C83B 1R3IH 4J3OC 4LVNB 4XXDB 5KANG 4OZGB 2YS4A 4OLVH 4P4KD 3ZYJA 1FJ1A 4JGJA 3U46A 2NY6B 2MKLC 3V5DB 4YEEA 2UY6A 1NEZA 1S5HB 3V4UL 3MLWH 1I9IH 5KSUA 1L9MA 3DX6B 2YSSB 3H7LA 1KCSH 2VZUA 3HUJF 3HFMH 5EZJA 2WWMC 2Z91B 2GT9A 5B22A 1LE5A 1W72A 4MA8L 3TN0D 2OL3L 3L1OL 3RUGE 5L2KD 3V0AC 4JJ5B 3RUGA 5I8CB 3PQYB 3P4NA 2XZAH 1N3NB 2A73A 4P2CG 1OWRM 3FQWB 5KOVC 2I07B 1X5YA 5ID1B 4X5LA 3BDBA 3B6SA 4WI3A 2R0ZL 4U1LB 3CH8A 1INQA 4R7DA 2CXKA 2NMSA 3JV5A 4H0HB 5BRZB 4HW6A 4U1NA 3LN4B 2HN7A 2GAZA 1ULVA 3G6DL 1XF1A 5D93C 3I3EA 4PJ9D 1EDQA 1KJ2A 1YMMD 2ZCLL 5DZLA 4ZQKB 4RFOH 3ESUF 4MDJB 5C3LD 2VDRH 4WHYG 2O5XH 3CH1B 4Y4HB 5A40E 5C08D 1JPTL 5MEOB 3W9EA 3RRQA 4UT6H 3TNMA 1MFAH 2EXWC 1I9JH 2VAAA 3FO9B 2J8OA 4ZD3L 15C8H 5ALBH 5GGUA 5IFAH 1RQ5A 1EJ6A 4LBEA 2B1AL 3TVMC 3B9VA 3SE3C 4K23L 1WGOA 3KYKL 3H3PH 5JW4Q 3BEVA 2D7TH 2IBGA 2NQCA 1ZHNA 4P0DA 1CDIA 3ZHDA 3S4SA 5CP3H 3E2HC 1BGXH 4JFHD 5I9QC 3SE8L 2DAVA 1AI1L 2DYPA 1T03L 3O8XA 4X9HA 4OQTA 1FJ1B 4F57H 2EDNA 3AY4C 5FYJH 3EO1A 5B3JE 1NEZB 1MFBH 5SX4I 1BFVH 5KSUB 1ZT1A 3CLEL 3MV01 1U8KA 4XAKE 3C60A 3EJZD 1YY8B 4Y8AA 4UB0H 2NY5L 5EZJB 4PV9A 4N0CC 2GT9B 3VGAB 2CUMA 1LE5B 1RIUH 1W72B 1H9VA 1KJ3H 4M9OA 4PJEF 5EUOE 2Y6SC 2EDEA 4OFDA 4PJGE 5E8DH 4MA1C 4KK9C 1REIA 5EUOA 3RUGB 1I1AC 2EDJA 4PJGA 4ALAL 1F4WL 3C5ZC 3P4NB 1G9NC 2A73B 3PABA 3NAAL 2FJGA 2PW1A 2AXFB 3B6SB 4FHBD 2DTSA 3ET9F 1INQB 3C87A 1JF6A 1G9MH 2PYEE 1WTGT 2HN7B 2GAZB 2PYEA 1E4WH 1R3IL 3S8WA 4WI5A 5CD5D 1MWAH 3JUZA 2OZ4H 4OLVL 3JVGA 2JIXD 5J11C 2DB8A 2MFNA 4PJHF 1WF5A 2ID5A 4P46D 3ZZ1A 4B53A 4MNGE 2Z35A 4HJ0C 3MLWL 4GS7C 1I9IL 1MSPA 2FECL 4NO3A 2IADA 3AB0C 4RGND 3W9EB 5TQ2H 3HZMA 4Z7NF 3HFML 2P43B 5DLMH 3TNMB 3OR7A 2VAAB 5SX5K 4YR6A 4FFZH 5GGUB 1VESA 5D2NC 3EOYG 2FCBA 3BZ4A 4KKLC 4QT5B 2Z8VC 3KPSD 1K4CB 2C26A 2WV3A 4LBEB 5IESL 1RIHH 3KHOA 1B0RA 2XZAL 1OTSC 3EYQD 3BUYA 3MJ6A 2GTWA 3UO1H 1IE5A 5KSVA 2NY7H 2ZSWA 2ZJSL 3BEVB 5DMYA 2HFFA 4RA0C 1ZHNB 3S4SB 3RL2A 4K7PH 1E6OH 2DYPB 4X7EC 4GQPH 2KZ1B 4YHKH 3O8XB 1BX2B 1DQQA 2XWJA 4GW1A 5J6HA 2J4WL 3BWUC 4I3RH 2HMID 1EBPA 1V5JA 4RFOL 3EO1B 2VDRL 3NIDF 5E6ZA 1SEBA 2DJUA 3ARPA 1X5ZA 4TUJA 4UV4L 3OTTA 1ZT1B 1U8KB 4K7FA 4L1HA 2XYCA 3HG1E 3C60B 4PP2A 2XXMB 3Q3GA 1ZWIA 1A7BA 1FNEB 4GAJH 4POYA 4JZJC 4JDVB 4PV9B 4UTAH 4UT6L 4U0RC 1MFAL 3ZLQC 4JM2D 3LEYH 15C8L 5ALBL 3RWFA 5IFAL 5EUOB 4PGEA 4PJGB 3SY0A 3D2UA 4HG4J 3ZTJG 1ZT4A 3PABB 2FJGB 1YEEH 2PW1B 1OGAE 3DVFA 2PO6A 2C9AA 2C4FU 2R4SH 5IMMA 2YPLD 3H3PL 3VWJA 4F58H 2D7TL 2ED7A 3FFCE 1JF5A 2DI7A 1F4AA 1JRHH 2FH6A 1PZ5A 2PYEB 1BGXL 4RX4A 1VENA 3O6FD 2DQCH 3UEZA 5E1AB 2BVYA 1LK2A 4F57L 3MRLA 5K9OB 5FYJL 1MJ8H 2Z35B 3K8KA 4ELKA 1FFPB 1A9EA 4PG9B 1BFVL 1Q0YL 3HMXH 4NO3B 2IADB 2XI9A 1XAUA 2V7HA 3E1F1 5LBSH 3HZMB 2DM3A 2CRIA 1V3MA 5LAXA 2ZUWA 3OR7B 3PP4H 4QNPF 4YR6B 1RIUL 4YDVB 1WCQA 1KJ3L 1MCNA 5AWNH 4HGMA 3BZ4B 5E8DL 1JK8A 5BOPA 4CN4A 2WSKA 1S7WA 1B0RB 4IRSD 2WINA 2F15A 3BUYB 2GTWB 3EDKA 4W4OC 3SGEH 5KSVB 2ZSWB 1F5WA 4RFNC 4G42A 5DVNA 4PV8A 1N5YL 4L5FL 1G9ML 3RL2B 2GITA 1FLTX 2VXSH 4G9FE 4LVHC 5FUCC 4X8XA 2CGRH 3FONA 5DQJB 2XWJB 4GW1B 4JFZH 1MWAL 2BVQA 2OZ4L 2YPVH 2IBZX 1IGYA 4Q9RH 1W72H 1DVFD 2D7PA 1SEBB 1F3JA 3FRUA 4OF5A 4LHUA 35C8H 4TUJB 2QLVB 3PWLB 3THML 5IHZA 1CFNA 4K7FB 4WFGE 4J23A 2H32A 1UVQA 3Q3GB 1ZWIB 2WQ8A 3HG1B 3ARWA 5TQ2L 1HOCA 5DLML 1IAIM 5IVOA 5I1HL 4PIRF 2VDQH 1WIOA 4DN3H 2DMKA 3RWFB 5F72S 2R15A 3W81A 4LMQI 4PGEB 4DFIA 3SY0B 3D2UB 4IRJD 2D03L 1T04A 1ZT4B 2ZZUT 4NKMB 1RIHL 3DBXA 1KJ2H 3LDBB 5F6IB 3V8CA 1RAMA 4PBWD 4YH6A 2VXVH 2NY7L 1EO5A 4D9QE 3VE0A 4IM8A 4P3DA 1PZ5B 4I18B 1PYWA 4GMTL 1E6OL 5HHQA 4YHKL 1LILA 5D4QA 2IMNA 4HBCH 3TIDA 3DHJA 5L9DH 3Q48A 1I1RA 3RVVC 1LK2B 1MCQA 4I3RL 3MRLB 5GZNC 5I73B 3B2UD 1B90A 1NC2D 4WHTA 5KSAC 4ELKB 1J11A 1GXEA 1A9EB 1EMTH 2EDKA 2ORBL 5DK3A