5D4HA

High-resolution nitrite complex of a copper nitrite reductase determined by synchrotron radiation crystallography
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
337
structure length
337
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 93
structure length 337
sequence length 337
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4hA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4hA02
1RZPA 2YXVA 4A2FA 1PZCA 2FQFA 2WO3B 2BW4A 4JKNA 2IDTA 1OOWA 2XUWA 1OCCB 5PAZA 1CC3A 4DP6X 2TSBA 3KW8A 3NJGA 3AY2A 4E9TA 3FQ1A 1ID2A 4YSCA 1AZNA 3NP3A 2VW6A 3FSZA 2PPEA 1E65A 2JFCA 1SF5A 4BDVA 3ZIYA 3CVCA 1JZJA 1CURA 4GP4B 3GYRA 1E5ZA 2IWEA 4DP4X 6PAZA 1AZUA 2YAPA 3JTBA 4NAJA 3DKHA 4M3HA 2VN3A 1PNCA 3CDZB 1A65A 1MG2C 2FWLB 3U25A 1SHWA 1W6LA 2IH8A 1WAEA 3PLYA 4YVNA 1JZGA 3T6VA 4E9QA 3GXUB 2FJSA 1BAWA 5I5JA 5I6LA 3IBOA 2UXTA 2VMJA 1SDDA 4AI7A 4F2EA 1GS7A 2PP7A 4YSPA 3S3BB 3S3CB 2AVFA 3EH5B 5LDUA 4KO7A 3QJUB 5E9NA 2VW7A 3PAUA 1ZPUA 3TBBA 1XB6A 3AG1B 4DPBX 3CZUB 1J5CA 2YARA 3IN0A 2XV0A 1BXVA 2UXVA 4NB7A 2Q5BA 4DP5X 4FA7B 1M56B 2EIMB 3NSCA 1J9RA 2XV2A 1ADWA 2J56A 4JHUA 2CALA 2VW4A 4BDVB 5I5IA 3ZX1A 1I53A 2R7EA 3FPYA 3ABGA 2BWIA 4JHVA 3ERXA 1SJMA 1ILUA 1NIFA 1IUZA 2W88A 2BP8B 3WI9A 1KYAA 1N68A 3SBRA 7PAZA 1OCOB 2FT8A 2GI0A 2VSKB 3AZUA 1IKOP 1AAJA 5AFAA 3UACA 2ZWNA 3WKQA 2XV3A 4FAAB 4K9JA 4ENZA 2BHFA 2PPFA 1A3ZA 2H47C 1SFHA 1T5KA 2QPEB 2EIJB 1WA0X 1IBZA 4KNSA 1NICA 3TU6A 4A66A 4GYBA 2YAEA 1A4BA 1YLBB 1NIAA 5EHFA 5AZUA 1ZV2A 4X4KA 2HLEB 2UX7A 2FQDA 5FC9A 3WNJA 4KNTA 1AIZA 2PCYA 2XXFA 1VLXA 4W9ZA 3OMAB 2HZHA 4YSEA 1AOZA 1ETJA 2PLTA 5B1BB 1A8ZA 1V10A 2AZUA 3SQRA 1KBWA 1GR7A 1JVLA 1PMYA 2J55A 2XX1A 4RH4A 1BEXA 5I5MA 3FT0A 4HZ1A 2B3IA 4L0PB 2P80D 1DYZA 1KGYE 3FU9A 2CAKA 1L9TA 2OCCB 4G7QB 4AZUA 1PLCA 3N55A 2BW5A 3QJTB 4AKPA 1WA1X 3QQXA 3PPSA 5I6KA 2Y1AA 4HHWA 5A7EA 2UXGA 1HAUA 4QKTA 4YSQA 3X1GA 2N0MA 1ZIAA 2VM4A 4DP2X 1PNDA 4WKXA 2ZONA 1X9UA 5I6MA 3SBQA 1J9QA 2J5WA 2QT6A 1L9OA 2AFNA 1RZQA 3IE9A 2WSDA 3OMIB 3DTUB 4YVUA 4E9SA 1ET5A 1B3IA 3HEIB 5TK4A 5B7FA 2H3XC 2YAHA 3H56A 3H4HA 1GS6X 3T6XA 3FU8A 4A68A 2HX7A 2XVBA 1N70A 2LLNA 4A2GA 1M9WA 2JKWA 1BYOA 1KCBA 2DY2A 3NSFA 3TBCA 1IBYA 2XU9A 3UAEA 1E67A 3X1BA 3FU7B 2QPDB 3EH3B 1GSKA 1OE3A 1MDAA 1PCSA 2XYBA 2YAQA 3IEAA 1JXDA 3AW5A 3ABKB 1NIDA 1AQ8A 1XB8A 3QJSB 2X87A 1PY0A 3DIVA 4QLWA 2GBAA 4DP8X 3FYIB 1W8EA 3PAVA 4DP0X 2A3TA 2DYSB 2PPCA 3X1FA 1MZYA 1SNRA 4G70B 3NYKA 2AZAA 4G7SB 1JXFA 1GYCA 1AS8A 1RKRA 5F7AA 2ZXWB 1GS8A 1AZBA 1WS8A 1E30A 1WA2X 1NIEA 5D4JA 3UGEA 1AS6A 4CSPA 4YSDA 1JOIA 5ANHA 5F7BA 2VSMB 3NP4A 5PCYA 3UABA 2BP0A 6PCYA 4DP7X 4YSRA 1MG3C 3QPKA 1FFTB 1ZIBA 4Q89A 1E5YA 3NT0A 4NERA 1W6WA 2GSMB 5B1AB 1MZZA 1BQKA 4KOBA 4Q8BA 2R7EB 3D12B 1L9PA 3SBPA 4ZK8A 1AZRA 4N8UA 3PAZA 4HIPA 3EH4B 1OCZB 3ABLB 3QJVB 1GW0A 4DP1X 4KOCA 4GXFA 9PCYA 3L45A 4TXVB 2E86A 1DZ0A 1CYWA 2CBPA 4BXSV 2IH9A 2JXMA 2FQGA 2I85A 3BVDB 3T9WA 4N4YB 2GC4C 3S3DB 3AG4B 2QDWA 4F2FA 5I6PA 2XX0A 1ZDQA 4G72B 4BXVA 2PP9A 2EINB 2FTAA 4E9XA 4YSUA 1JVOA 4GP5B 5B7EA 1TEGA 3V9CA 2AANA 1ASOA 1SFDA 4P5RA 5TK2A 3WIAA 1OE1A 3X1NA 4A2HA 1AG6A 4YL4A 4YSSA 1CYXA 1GY2A 2IDSA 3G5WA 3JT2A 2YXWA 2HX9A 1M57B 1HAWA 4HCGA 4HHGA 4GP8B 1RCYA 2PPAA 3EF4A 4UAHA 4F7KA 1L9RA 2GC7C 1UATA 8PAZA 1EHKB 2WO2B 5AKRA 3NJIA 1J9TA 1A4AA 2FQEA 3KW7A 2IDFA 1BQ5A 1F56A 3FS9A 1QLEB 3PXLA 4PAZA 2HX8A 1PLBA 3ZBMA 4AX3A 2YAMA 3CVDA 4BWWA 2B08A 2IDUA 2UX6A 3WKPA 1A4CA 2OV0A 4A2EA 1BXUA 2UXFA 3HB3B 3QJQB 1ET8A 1X9RA 1KV7A 1PZBA 2CUAA 2EIKB 4P5SA 3FU7A 1OV8A 5B1KA 5D4IA 4E9YA 1XB3A 3GDCA 1ZDSA 4DPAX 1NIBA 4G71B 1NZRA 1L9SA 3NJMA 2PCFA 1HFUA 2FT6A 2I7OA 2I7SA 4MFHA 3NSYA 4DPCX 3IN2A 1NWPA 3OQRA 3ZDWA 1CUOA 2GHZA 3TASA 1AZCA 1PF3A 1IC0A 4W1TA 3UADA 2QDVA 1ASPA 2J57A 3N2JA 3WG7B 1JZHA 1OE2A 3FQ2A 4EF3A 3FSAA 3FSWA 4M4RB 1AR1B 1NTDA 2RACA 2HRGA 4HCFA 1L9QA 2H5UA 4KO6A 5B1JC 3ABMB 2OJ1A 1KCWA 5B3SB 3T6WA 1NPNA 2GIMA 4BK5C 3CVBA 1TEFA 4WTQA 3CG8A 1GY1A 3NJNA 2ZOOA 1V55B 2MRYA 2XLLA 2DV6A 4YSOA 4CSZA 3OD3A 2BP8A 5I6OA 3NJFA 2IDQA 3FPXA 3CDZA 1FA4A 2BWDA 3PCYA 2IWFA 2BO0A 2CJ3A 3RYMA 1TU2A 2Q9OA 1URIA 1SF3A 3WNIA 2YAOA 5IY5B 2EILB 3NJLA 4E9RA 2W8CA 3H4FA 1NDTA 4BWUA 2XXGA 3AG3B 2HRHA 1PZAA 1BXAA 3C75A 3FSVA 2FNWA 1OF0A 3MX0B 1ET7A 1KDJA 2BZCA 5I28A 2YQBA 2CCWA 2IWKA 3NSDA 3UAAA 1NPJA 3S8GB 4YSTA 4HCIA 1KDIA 1AANA 1ILSA 3AG2B 4DP9X 1BYPA 4KNUA 3QJRB 3NJHA 5B7MA 1XMEB 1KBVA 1QHQA 1R1CA 3OM3B 4A2DA 1NINA 1JERA 2DWSA 1PLAA 2XWZA 3MBWB 1J5DA 1BQRA 2MTAA 2Y69B 3T6ZA 2NRDA 4G7RB 3V9EA 1J9SA 1EZLA 4HAKA 5I26A 3NJKA 3X2QB 1ASQA 5I6NA 4E9VA 2VM3A 1AS7A 2YAFA 3ASOB 4PCYA 2DWTA 5B1JA 2DYRB 3ASNB 1V54B 2TSAA 2P80A 2BP0B 1WS7A 1AG0A 4A67A 2X88A 1QNIA 3BQVA 3NJJA 5D4HA 3OMNB 3TA4D 3FYEB 3X1EA 4AKOA 4KO5A 4UF7C 7PCYA 3EHBB 1JZIA 4YSAA 1PAZA 4HALA 3FQYA 1OCRB 1AACA 2FT7A 1SDDB 1SHXA 2BZ7A 2PP8A 4BWTA 1JZEA 1FWXA 4GY4A 1NWOA 2GB2A 4KO9A 1TKWA 4UANA 4E9WA 4AKQA 2IAAC 3S8FB 3T71A 1JZFA 2PPDA 2HXAA 1JXGA
chains in the Genus database with same CATH superfamily
4H26B 4X6CE 1UCBH 4KK9C 4GG6B 4MS8C 1N5YH 2VLJA 1AXSA 4YDVB 2HLAB 5I8EB 2LLLA 1G7LA 4O51A 5TDNA 5FW7A 1ES0A 1W80A 1M7DA 1TSHA 3L9RA 4G9FB 4KY1L 3KW8A 1GYWA 4M9OA 4Z7UF 1R3KB 3TVMA 3MRLA 3TN0B 3E6FB 3DVNA 4M7LH 4UV4L 5DHYB 5E8NB 4BELD 1WBXA 1NDGB 4RQQB 3CVHH 5LCVL 2JB5L 4AZ8A 1YJDC 2XKSA 4YIQB 1DSWA 1FL5A 2NOYA 3UFIA 4BDVA 3TVMD 1XSOA 1I9JH 1UOWA 3WHXA 1L6ZA 5FHAL 5HPOA 5BO0D 1TU2B 4ANKA 3NQKA 5BMFL 3HZKA 4PH8A 2BNRA 4MA1C 4ERSH 4J3XA 1QR1B 1XL6A 2ZX9A 3MNZA 2IPUK 4F9LC 4ZMTA 2O5XL 4MDRA 5CGTA 1BYNA 3U25A 4XAWL 2CGRH 3FH5A 2IH8A 3FCTB 1IKFL 5DJZA 1SDYA 3ES6A 2E6QA 5DJ6A 5C9JB 3BH9B 2WWNA 3EJUA 4GEJA 5DGQA 4LLVB 3SGJC 2UZXA 4Y4FA 4DOHB 3QDJD 2EH7H 3D3VB 5LO7A 4KK9D 1WAAE 3NCMA 4XZUB 1G9NC 4JRXA 1U8MA 1SDDA 2XG5B 4ZFZB 4MNGA 35C8L 3OKKA 4MSWB 2C1PB 2PP7A 4KGJA 3I6LE 4RVBA 5IIEA 4FF9A 5LDUA 4KO7A 3OF6A 4XOBA 4UBDD 1RK0B 3NRFA 4FZ8L 4S0SD 1Z9MA 4Q6IC 3HA0A 1J12A 5T1JA 3P0GB 4UZSA 1SZNA 2GJ6B 3ULVL 5CP7B 3HC4H 2B4CL 3POHA 3WJLC 2NXYC 4I18B 5D70H 3SDXB 4IHOA 1U9KA 1BZQK 2G5BA 2YD5A 1VGKB 4ADIA 5IEHA 2VLRA 4TRPL 4APQB 1JV5A 4X4ZA 5HJ3B 5KYWA 5FYJH 5E9DB 4YHOH 4LDCA 3SDAD 1BAGA 1MW2A 2J21A 3AREA 4L9DA 3ZSSA 2BP3A 1FN4A 5KBKA 3KPRB 3MYJB 3BWAA 4ZO6A 5TF1H 3ZL2A 3QYNA 1QRNE 3JVFC 1J05B 5F1IB 1FYTD 5C0CA 2V33A 1PKOA 1BFVH 1OSEA 2FO4B 3AZUA 3OG6B 1P7QB 3KPRD 3IVKA 2KUTA 2MOVA 1J5IA 1DFBH 2XBDA 3CLEL 5DRWA 3AT9A 4MS6A 3FQNA 4P3CL 5EBWB 4B5ZA 1T5WA 2Y7NA 3GSUB 4JX0A 4NZTL 5FK9B 5L2KB 3ULUD 4LCYA 5AAWC 4JJHA 3BN3B 4APQD 3RDTD 3TFKD 1ROCA 4M61A 4D0DB 4DF9A 2LR4A 2XY1A 2XQYK 4HUNB 4ZW5A 2ZSWA 4AEIH 2ED8A 1YLBB 3OZKA 3KPSD 2JF1A 3QUMA 4GO8A 4NRYA 1KCVL 4NKMB 4KY1H 2R1XB 4N87A 1U2YA 4RRPG 3RKDC 3HI5L 3V0WH 3IXAB 4F7TB 3N1GC 2XWEA 3SE3C 2X09A 4KH2A 5C0RL 4G1MA 1CDUA 4MNHA 3NCEB 2IAMD 3ULUL 1UC6A 4K5OA 1U3JA 3P77A 3AB0B 3WNOA 2EYRA 2A99A 1DQLH 3VXSD 3ZTDC 4PJAF 3DO4A 4HBCL 3HTLX 3IKCB 4P5TA 3P2DA 1CQYA 1HYSC 3BAKA 2JXMB 3EGXB 3FT0A 3GZOA 2XXCB 1UXWB 1U8NA 2ZWLT 3SKMB 3MJ7A 2CNZA 4ZDHA 4MNGE 4JDEB 1E8ZA 2G0KA 3MRJA 1YN7B 4CDGC 5LGKA 5ALBH 3B5GA 1XCTA 2RCSL 3F00A 1BCIA 3OX8A 2J6EA 2LABA 1G7QB 1TQCC 4OZFB 4WKXA 1QP1A 3VJ6A 1AI1L 4G8GB 3T0EA 3G5YB 1ZLUH 1KXTB 4NNXA 2WK2A 3BQUA 4JGJA 3MV9D 4MQSB 5F7EL 1ZLWK 3RVWC 4OD2A 1FGVL 4JVUA 3T0XA 4J39A 1YVLA 1JZ5A 1QEWB 4UT6H 2NNRA 3MNWA 4WJG3 3IJYB 1INDH 3FKUS 3HC4L 2ADJB 5CF3A 5F6IB 3QVAA 4X8JA 2VR3A 4JKWA 4YK4B 1WAPA 3MFFB 4P4KD 3MV8B 2PTUA 4LMQE 5IR1B 1IEAB 2BVYA 5CBEB 4UV7H 2UUDH 5B38G 4B9FA 3K6NA 4DO4A 4JRXD 4WDIB 3DDGA 4JG0L 3QRFM 2WLIB 1RZ8B 2BSED 4PRBA 4FXKC 1RUML 2QPDB 3EH3B 4HSQA 3T4AB 2XCMC 4HS8L 1TF4A 2YO3A 3AW5A 3S7GA 2LU3A 2Z0UA 3OHMB 5D71H 5FWQA 3ZYZA 2JKTM 3SDAA 1JTTA 2EXWD 4QCIB 4G59C 4GPVA 4IOSD 1W8EA 2Z4QA 3OZLA 5LQBH 3BUTA 4RMSA 3MACH 2IQ9L 4J3VA 1KXQE 2PYFB 4V1DE 5I18L 4PJ9B 3TIEA 3QO1B 4FJZA 1ITBB 1UD3A 3LRSB 4QJ4B 1PQZA 1TR7A 4PB9H 4Y5XA 5E1QA 1MH5B 4Z7VB 4TTDD 5KYYA 4MWFA 4FQXA 4N2EA 1HINL 5I74B 1UH3A 1S7TA 2V2TB 4ZAKB 1GVIA 1CO1A 2WTRB 5INCB 3VFTB 1F1AA 4DHLA 4AQAB 4J2QA 1VEMA 2Y7OA 2W07B 3GBML 1QEWA 4OF3A 5KBDA 1UM5L 3UYPB 5DS8B 1S5HA 3CFDB 4N9GB 3U7WL 4PBVC 1JNNH 3VXMA 3NZUA 2G60L 2VXUL 4L4TD 2Z6FA 5CJBA 3QS2A 4YBLB 2Z8VC 4HBCH 4KDWA 3MBEA 2A0LD 2NY2B 4LSSH 3Q7JA 1AGEB 1JYVA 4P5KB 3QXAA 1YY8B 1QLEH 3NRPA 3IDJA 4JUSA 3MTXA 3L3KA 4P99A 4Q8BA 4XP1L 4ZMZA 1NUGA 3DJRA 2N7SA 5D1QA 2HKHL 4BFIB 1GOHA 2EH8L 5L9DL 2PXYD 3L4XA 1F4YH 2BFGA 5FCUL 1U93B 2DD8H 2WXMA 2R69L 1IAIL 2PTTB 1VA9A 4P9MH 4PJIF 3SCMA 2QPUA 32C2A 4OUOA 4YWGH 2AK4B 4Z0BH 4PW9A 2GC4C 2WXIA 3QUMH 2C34A 2QDWA 3TBWB 3TM6A 3KPMB 4K2UL 4ZRGA 5EORH 5F7YC 3GDBA 3UL4A 2OTWA 5DMIL 4BSJA 2DQGH 1HKFA 2AANA 5BV7C 2Y1VA 4PRHB 4B60A 4FNQA 3EYSH 5JW3L 4YO0A 5KJRL 1E8WA 3HIZA 4JO1L 4M8VA 4YSSA 4PJAB 2G3MA 4GUCA 2EYTA 1C1EH 1IFHH 5SX5H 3GLEA 3JT2A 1I7RB 1OAQH 2X89D 3CZFA 3E8UL 5E8PA 5F9WB 4AW7A 1T1ZA 5EC1B 1MCCA 3PAYA 3STZA 1DVFD 3H9SD 5IF0B 1HIML 4WWID 4LBEB 3CVHA 2W59A 5JXAL 2CRIA 1BVLB 5AKRA 2EUWA 5HI5D 3QNFA 3P0YH 3SOBH 1L9NA 1IZKA 3E1F1 1W15A 4X6CA 4XVOA 1OK8A 3FS9A 4E0RA 5ICXB 1E42A 4P46B 3WKML 4NQEE 4FQXD 5G5DA 2OMNA 5KSBF 2IDUA 3EGSB 4QRPA 2NX5D 2L4OA 5FYKL 5AW5B 4ELMB 3LD8B 3QJQB 1NCCL 3QPQC 5IP4A 4WU7A 1OZTG 2EIKB 2KZBA 3VJ6B 3WAJA 1O5DT 3EBAA 4JFWA 3APFA 3GMMA 4LIQL 2R4RH 1SLWA 4QOKD 4MJ5A 4XNBA 2I7OA 2I7SA 3DX7B 3NPZB 4KJYA 4ZX4A 2Q7YB 2KYIA 3VWKB 4CGTA 1RZFL 1SGKA 1UJ3C 2CM6A 1RHFA 5FUCE 2GHWB 3GD1C 4HK0A 4QNPE 1XAKA 4J3OH 4HEME 2JJTA 4WO4C 1YEIL 4P2AA 3N2JA 4L2LA 4JZJB 2FATH 3BYTA 1T1XB 3MRHB 4FABH 2VLRB 3BGMB 3NZSA 3KYKL 2F7OA 1FAKT 3GIZL 3HN3A 4RGMC 3ROOB 2UVFA 1R5VB 2IALB 2NNXA 3D39A 4A7UA 2OJ1A 1XGPA 5DHVB 1I8LA 3KLQA 4NSKB 3BPCA 1RUAH 4HUUA 3TO4A 4ZOBA 1NPNA 1EX0A 4YFEA 3BAIA 4LLYB 1KFAL 3CN2A 2VJXA 4XNMA 3P2BA 4R97C 5C70A 3PDDA 4JO3L 4OFKA 4WHYH 2H26A 3S5LG 2WKOF 4AYGA 4D94A 3VSQA 2O5ZH 1N3NB 1RJZB 5E8DH 3UC0H 5CEXB 1RH8A 2BWDA 5LCVH 1WFTA 1XR9B 3M07A 5FHBH 5IJKA 3EO1B 2CJ3A 2I9LB 1URIA 4XMWA 5DJDB 5DYOB 4JM4H 3NJLA 1Q9LA 1PEZA 4X9HA 4BWUA 3BGFB 5DLLA 1FG2B 4KDTC 2R0KL 1O7VA 1PZAA 3HKFA 3JWNH 1IGJA 3FSVA 5EBWA 1K8DA 3S88L 1CGTA 2DWXA 2PWHA 2KPNA 1L3WA 2HKAA 5C7XL 3MUY1 1KDJA 5HGAB 4JDEA 1TJGH 5MEQB 2ADYA 4HSCX 1AY1H 4HU8A 2YC1A 1S7VA 4XNYH 4KUZH 5I24A 2Z31D 2NW2B 2XTJC 4D9QD 3DMMC 1K6QH 2I32A 1SYVB 4NQXB 3RNKA 3QJRB 1AQMA 3I9GH 3RWEB 2X6BA 3NJVA 1T21A 5C6TH 1R1CA 4O58H 3ELQA 3FU6A 3E80A 4F92B 1HH9A 1AGEA 1FF5A 5EIIG 1JHLH 4G7RB 3G04B 4H8WL 4MHHG 1ASQA 3LH9A 5I8EA 3SDDC 3TNNB 1CFVH 1WZKA 4NENB 5CSGA 5F7EH 1SMDA 1JZ3A 1BECA 2DYRB 3N41F 1JUFA 4PJBB 4Y5VC 5J1AA 4N2FA 4DKEH 3ALXA 3V52H 3SDCD 2W07A 5I0YA 3ZR6A 2R9HC 4XP4L 3MMEA 1DVQA 4YE4H 4PJAE 1WSST 1FNLA 3QORD 1SJHA 2IGLA 5BV7B 4L1TA 4TQPA 3S36H 4B9YA 1T2QH 1LWRA 2CHDA 1FGNL 2IH3A 4WK2B 3FQYA 4YNYB 2CO4A 5L8JB 3CSGA 5IFJB 4XODA 4I77L 4HF5H 5I0WA 1FLTX 1TVHA 1J5OL 4YHZL 1S5IL 3GJEB 5JW4R 1TG8A 5T1MB 4BFRA 1YZZA 1QBLH 2BOBB 3OKMA 5FHBL 3HN5A 5A16A 4K7PY 4S11A 4FYSA 2FX8H 3BZEB 4OCLC 4MJ4A 3ZU8A 1PD6A 4ECNA 4KXCA 3PIQA 3HNVL 2C8NA 4PJ7B 1TTGA 1S7QA 3MLPA 4GFXA 4R7NB 5C9KA 1X44A 1MI5E 4LDLB 2WJ7A 4AC4A 3IMUA 4R90H 4ETQB 4EPSA 2VRQA 2IDTA 4YBLC 3CIQA 1OCCB 5PAZA 3OKNB 1YYLL 3G6DL 3L2NA 1NCGA 1VACB 3E6FA 3ZR5A 2GJ6A 2Q2EB 3NK4A 4L3FA 2J6EL 4HGKC 1AZNA 1IM3A 1HI6B 4F24A 3PNRB 2HP4A 2PNDA 5IB2B 1PKQE 1U8LB 3N91A 5E70A 1RI8A 3CVCA 4GOSA 2XDHA 4JQXA 1AVAA 4UDUB 3RA7H 1ANUA 4JZOB 4K5LA 4OLVH 3P0YL 2B59B 1NCAL 2P47B 4GSUA 5LNEA 5CN3A 1A1MA 2A6IB 4WY7H 3T65A 4QHNA 1CT8B 2EUXA 3WUZA 4GUOA 4HXBH 1VCBC 3VXUB 4Y19E 1PJWA 3U0TB 5E4EC 4KQ4L 3W5MA 1AYRA 4FXGB 3KDPB 2ITCB 2Z7YA 3O6FD 3CWGA 4GJTB 4PSRA 1T1YB 5ICZB 3RL1A 5AW1B 4U6HA 4N68A 3VXPA 5IFJA 1N6QH 5ISZD 3SOBL 1MQ8A 3GMQB 1UQSB 3LIUA 5BJTB 3KVPA 1HL5A 1VKXB 1QSED 4I7ZC 1BDYA 5E9NA 2ZNXA 1S9YA 3CLWA 4DPBX 4G82A 4WTZG 4NIKB 2WXNA 3INUL 3QXDA 1Q1PA 2D9CA 3FTYA 1YEJH 4OCMC 4IBZA 2IMNA 3OKEB 3QI9C 1BXVA 1UCTA 4TVSa 4PVMA 1RP9A 1FE8H 3T3PB 3WUWG 5D1XD 4DK5A 1LE9B 1MAKA 3DK0A 3JWNE 4DN3L 4DKAA 2CALA 4LU5H 5KSBB 1U8JA 4YDVA 2CBQA 2EVJA 4M93C 3FT3A 2IPTL 4QXGH 5F0MB 4HAGA 1W16A 5CLWA 4YR6B 1IM9D 2EXWC 2VDQH 5D7JA 1N68A 5A2KH 4MVBC 5JIHA 1XHHA 1GGBL 1B0IA 3IFNL 3MUHL 4GW5A 3ZMNA 3DYOA 1R3IL 2Y5TB 1AQKL 4XAKE 3MN8A 1A0QH 4NN5B 3FSOA 1GHFH 1IGYB 1B9ZA 4YDIH 3S3JA 3WKQA 4RGNB 3QORA 3RFZB 3QUZA 1NLBL 4OIBA 4N8VA 5KG9B 1UUNA 2P8MB 4IRSC 3KBFA 3S2AA 1PSKL 1GZHA 3KYNA 1A3ZA 4Y4HD 5IB1A 2DIBA 1JNHA 1JE6A 3LKNB 4P59L 4ZODA 3X14A 5LKNA 4LSSL 3UTTB 2A9NH 4ELKA 2X38A 1AIFB 1IBZA 4BGLA 4WIQA 2FJUB 1JNLL 2YAEA 1LQSR 5H2BB 5EA0H 3F62A 4MMYB 4PJEB 4JQIL 2IBZX 2GCYA 3TYFA 3IPFA 4R97B 4Y4FC 3QUHA 5BOJA 1G6VK 5C0ND 1U8OA 1EBPA 2WCGA 4MMXB 1XX9C 2PLTA 3I3DA 3WEAA 3B5HA 1VFBA 1DQML 4NSKA 2EO7A 2HA1A 1TIUA 1BJ8A 2NY1D 2P8PA 3NCJL 3IJHA 3HE6B 4KPHH 3ILDA 3QDGD 1QTSA 2MKWA 4M5ZL 4OKDA 4LKCB 5DURD 3ZYIA 4XP6L 1KENL 1L9TA 3FFDB 3CQPA 4HETA 1M3IA 3BN9D 2IF7A 4G42A 5JO5A 3WY1A 1VIWA 2WUCH 3K6FA 3FQTA 5KVDL 3DX7A 5B3NA 4YSQA 3FOLB 1BZ9A 3PQYA 4IU2B 3QDAA 3IDNA 2MH4A 4JO4H 4JANB 3SPCA 5D7LB 3RB7A 4OZFH 4OGYH 2IXQA 1T04A 3FO0H 5DS2A 1M6OA 2E3VA 4BQ6A 3B56A 4ZMVA 4J3OG 4Q4IA 1YEFH 3IMTA 1G6RL 3OMIB 4OIIH 4PM1A 3TURA 4L3AA 5E00B 1JGLH 5I1HL 4WK4B 2V17H 2KQNA 1Q9OB 3FQUB 5FA3B 2AJVL 5A6LA 3FU8A 2IFFL 1PFCA 1NEUA 1VGEH 2H6OA 3CH1A 5HI3D 4OCXL 1F4WL 2FX7L 3L3DA 5C0IA 1V3MA 1KF9B 5BUAA 2F1BA 2VE6A 2GJZA 2OMXA 1H15B 3Q13A 3WJMA 4ZX3A 1WH0A 3FUMA 4FFVD 4ONOA 1MJ7H 2YAQA 1OIOA 4NRXB 5A7BA 3QR1A 2CLRB 2FDBP 4Y1SA 4ELMF 1PY0A 2ENYA 4LARL 4RZCB 3RDTA 2XIBA 3BC9A 3FYIB 4XNQB 2DQUH 2DPKA 3MODL 4FFYH 2B1OA 1QYGL 3ULVF 2VDML 1W8OA 4M5ZH 1ZHBA 2EC9T 1ETB1 3QGVA 3DX8B 4Z78A 1FSKC 5E08H 4G5ZH 5HGAA 4NIYE 2BLFA 2KZKA 4L8CA 1KGXA 1QSEA 3QH3A 5JW4M 4PJ5D 4M93B 2Z93A 2O72A 1EFQA 1AS6A 1IBGH 2ITCA 3HZMA 3VM5A 4DZ8B 4MMZA 1HHIB 3IBEA 2BP0A 3U7WH 3VRLF 5KS9A 5DUPL 2HLFC 3D06A 3F01A 3CDCA 4KXBA 2DWYA 5HJDA 4O2CB 1LEKA 4K71B 1MFVA 4XOCA 3J2PA 1GYUA 3Q2NA 5GSVA 2KMWA 3GXDA 4OV5B 5B1AB 4KI5C 4PPTA 1GTFA 2A5UA 3MBXL 2CK2A 4X6CB 2K45A 4HU2A 5I74C 5FGCE 5ETUB 3SBPA 2VTFA 5B3JF 5KW9H 3O3UN 2VRAA 5E2VL 3ARBB 4NCC2 4N2GA 3II3A 3OKOA 4GRLA 1E5UI 4C4KO 4BXSV 2HTKD 3TJHD 2BSRA 1JXJA 1U8PB 2IH1A 3TFKC 4XPTH 5LNDA 2B2XL 3SE4A 2HVBA 1AHWB 3WGUB 4TTDC 4EDXA 2OMUB 3Q48A 4BXVA 4F7CB 1A9EA 2A4CA 1QFWM 3LD8C 4HULB 3Q5OA 1A6UH 3IJEB 2XNAA 1BX2B 2EC8A 5HGBA 3S0PA 5BRQA 3RUGB 3VRJA 3FZUC 4PW3A 4Y9CA 2QV4A 1P5UA 3G5WA 4MAZA 4N90D 3KNBA 1FE8L 3K71A 4NM4L 2VN7A 1D5BA 4PTUB 2AJVH 1YEKH 2HVJB 4QJ5B 2FL5B 3MCKA 4AGNA 3MLWH 3WIIL 5JA9A 2BVTA 4HIHA 4Y4HC 1N7MH 2P5ED 3QIUC 4Y1AA 3JWNG 5CEZH 2J2ZB 4HJJH 4XN8A 3L3IA 1N8ZB 1KCSL 1IJ9A 4TSCH 2JV6A 1XGRA 4FMFA 2L04A 4AM0Q 1XT5A 5CR8A 3T3MB 3VXMB 2HG5A 1NEZB 5KVGL 2VLJD 5T1LB 2NY3C 4UT7H 1X9RA 2DKSA 4J3OC 2DQHH 2CKBA 4KJQD 4MHHI 4TVPD 3W0WA 2I07A 3SOTA 2WIIA 5HGHB 4JM2D 1NMBL 2O5XH 4GAJL 3QNXB 3T0EB 2Y7QB 3MR9B 4PRDA 4PJAA 4FMVA 4CVXA 5JOFA 5I1KH 6CGTA 3FB7B 2D3JA 1HFUA 2ZX7A 2F58H 4AJVA 5E4OA 5DJXB 4JRYD 1F6AB 1MCPH 3BKJH 4A7GF 1ZLEA 4ZYKB 3E2HB 3WLWD 4YDMA 1ZOXA 2A9MH 4IBUA 5DJ8B 4PTTA 1KJVA 1MUJB 4XNDA 3BO8B 1DQJA 2RTTA 3QIUA 4JVPA 4ZZFA 4LFHD 5B1JC 1AP2B 3LRHA 3BQUC 4WY7L 2XA8L 4E2OA 5E24E 1J0IA 1BD2D 3W81A 4X5RA 3BH8A 3EOTL 4P48A 3DMMB 3ZTNL 4Y16C 1QA9B 5J57B 3B2MA 4HJGB 3OAZK 2WLIA 1T0MA 4UT9A 4J3TA 3EO9L 4EKXA 3PWNA 2R2EA 1DQVA 1IC7L 4OZHB 1EDHA 4YHOL 3TA3C 2IDQA 4YEEA 5GGVY 1K4CA 2MQCA 2V2XA 2EDMA 3UJTH 3VQMA 3FUKA 3WSQL 3WNMA 5K9JH 1ZJBA 4GSQA 1BXAA 4J3BA 3VXUE 5E1GA 4HWBL 5CMAB 3CLFH 2IANB 5LAXB 3EYVB 3GM0A 1Q0EA 3KD4A 4X5PA 5TE6H 5ADOL 2CCWA 2H0EA 3U0WL 2P9RA 1HHIA 2ZPKH 4M9PA 2ZCLL 3CXHJ 3L1OL 4PJ9A 3TIEB 1KDIA 2AGJL 4BA0A 4LU5L 3TN0C 4HD9A 1KXVA 3G5ZA 3ZHFA 1WQVT 1L0XA 2H2SC 3OR7B 3WNKA 1T3FA 4FI8A 3NCXA 1NC4A 4H8WH 4L23A 3PWPE 3CCHB 4YX2H 4YHIB 1RUPH 4HC1L 1JWUB 4E9VA 4AWJC 3VFGL 1QPPA 4MAUL 1YEFL 1RIHH 4MMZC 2G5BB 3II2A 4PCYA 4EN3A 4ELDA 3W0WE 1AD9A 4EZJA 5A2IH 2O6DA 4ZW8A 4NKOA 2OFQA 3ZT7A 1EO8L 2HT2C 4E0RB 1WS7A 5ESVA 4BK8A 1G7JA 1N64H 1XF4A 5D4HA 5SWSA 3L2MA 4I89A 2R8SL 4TKWA 4JFDA 1UEYA 4N1EA 3SBWC 2XICA 1LEIB 2KI6A 3P4MB 1Y7VA 5IQNA 1MHHA 4FHJA 1TOXA 2XY2A 1SDDB 5DUBB 4QRUB 5T5NF 5IB5A 4XN9A 3HE7C 3IE4A 3GXTA 4JR9H 4LLQA 2P1YA 4OZHE 1B0RA 3A6CL 4YHNA 4QTIL 2AC0A 1R17A 5D6DA 5E8PB 2J5LC 1TKWA 4R4BA 5AYQA 3VI3F 2FEEL 2A9ML 2DTML 3QEGH 1OZUA 3RB5A 2OMZA 3JUZA 3RGVA 4Y9BA 4M3JA 1NUDA 4GI8A 4AV5A 4YDLB 1PDKA 3OJDA 4NHCL 1MFDH 4QUOA 4QJ3B 2N1TE 2AQ3A 2OP4H 1IRAY 3G9VA 5I8OH 1WFOA 4DGVH 1F13A 4OBSA 1MFMA 1V7MH 2H6PB 2E7CA 3L3GB 1HEHC 1MVUB 4ZUSB 2XQYA 3GLAA 1OTUD 4E9LA 4JHWH 4KROC 5DZVA 2HT2D 4JM0A 1CTMA 4MYPA 4DAGH 3IU4L 3KPRA 2BNQE 5MEPA 4RMQA 4L4TE 3CZKA 4GAYA 4KQ3H 1MREL 1V3JA 4FQLH 4WWKC 2CNYA 3SE8L 3ZDXF 4QRRE 4D0CB 1F4HA 1WD8A 4KI5F 1FVCB 4GI6A 3V0AC 5JPMB 4M00A 4PRDB 4TQHA 3ULSB 4HXAH 4KXDA 1NBVL 1CURA 3TO2B 2VXTH 1A4KB 4JPSA 4PJ8D 5K59F 5MEND 1R0AH 2X2JA 1YEWA 3WTWA 4JL2A 3AU1A 4PU2A 2B4CH 2H0JA 2J6WA 1N8ZA 5KSAC 4C4BA 4HLJA 4TN9A 1Q90A 5IVOA 4EUPG 2Q7AA 5CJXA 3EZJB 5DVOA 2EVGA 3PRZA 2Q87A 3KJ4C 3OC5A 4PV9B 4PHXA 1QG3A 1KGCE 4K9EH 4WW1A 2OW7A 1B4JL 4PY8J 1AO7D 2WQWA 4Q6YA 1RJLB 4WI9A 5GZOA 2LU7A 4AMKL 2Q1EA 1HU8A 4F2EA 2VRKA 1QFOA 2QV2A 3BVWA 5G55A 4Y16A 2YOCA 1HHHB 4WRLA 1C5CL 3VFUA 1WWCA 3Q2VA 3EJCA 1J5CA 3KYNB 3UZQB 2F8XC 3U6XA 4M1DL 2BIIA 1SRDA 2WBJB 2XQYG 3DXAA 2UY6A 4MKTA 2K78A 3SDDB 4KUCD 4FA7B 1ZK5A 1JN6B 2MJWA 4WUUB 1KC5H 1PG7H 3NCYP 3RL2B 2PYEB 4U1SB 4HKJB 2XWJA 2K0RA 5E6ID 2BMKB 2XWBB 4BDVB 1Q9KA 5HJ3A 3LVEA 5JOPD 3L4UA 4M5YH 3WN6A 5KBMA 4AGPA 2CXGA 5JUEL 4PRBB 5L0QC 2EDWA 1NIFA 3LKSB 2VJ0A 4PJ8C 4BKLA 5L4FA 1M9SA 1X5FA 4DQOL 3CH8A 1OCOB 3FN0L 1ECYA 1RUKH 4OIAA 3RPIB 1J8KA 5HVWA 4UINL 5FCUH 5E1IA 1IAIH 2ID5A 3V6ZB 4LAJH 4IDJL 5J6GA 1E8XA 1U8IB 4F7PA 5AAPA 4XZUA 1R0AL 2PPFA 4NXKA 5CWSA 3TEWA 3IVKB 1NMCC 2F8OA 1QLEL 1OAZL 5F89B 3WJJC 3GMPA 3TEYA 1TVDA 5ADPL 4YGVB 3ARGD 4LSQH 4NBXB 4XTRD 5GRVK 3DNKA 2N4IA 3ORJA 1ONQA 2P8LB 4GYBA 4L4TA 4OI8A 5C07A 1NIAA 4IOFC 5I8CB 4IOIB 4IRZA 1QI4A 1A7OH 2O5YH 1ACYH 2W0PA 1NMAH 4P05A 4KMQA 4WSJA 2GEQA 1INEH 3C6LA 3DJZA 5FGBA 5FYLE 3RL1B 4C57C 2CUMA 2QSCH 1TZGH 2PMZA 1JV5B 3MJ9L 3BLKA 3BYYA 4URKA 2X9ZA 1NM4A 2R83A 4ONGH 5B1BB 3SDXA 3QCVH 4NQVA 3KYOA 1AQDB 3HI6H 3N1FC 4WFGD 3WMQA 4NBYB 4EI5C 4RH4A 2X1QA 3QUZC 4OZFG 3A4DA 3KH3A 2HRPL 3C5ZA 4C4KT 2R0LL 3LXUX 2BPBA 1CF8H 2KT6A 3HZ3A 1MCDA 5ESAB 5C0IB 3RY4A 3DOSA 2OCCB 5DFVC 2ZYRA 3GTVA 4NKDA 2OMXB 2R0ZL 3SBWA 3VFOA 3PPSA 1NEPA 4XX1E 2Q3ZA 2Y1AA 3DO3A 1F3DJ 4BKLB 4F80A 4P4RB 1FP5A 3F7KA 2UXGA 4KFMA 3ARDC 3X1GA 5FWRA 3SN6N 3S96B 5AALA 4FLOA 4TL4A 4Q9QH 4K7PX 4K5NA 5HDBF 1DO6A 1S3RA 1HZLA 2ROXA 3ZDXB 1G7HB 1KPRB 2J5WA 4K3GA 2AFNA 2UY6B 2P46B 4PJ7A 1PKQA 1JF1B 5AOMA 1JNJA 1AR1D 5C0DB 2Z3FA 4WFFD 4L8SB 4ZMYA 1R3LA 3M17A 2C9SA 3FB5A 1U42A 1P69B 1ZXKA 4GBXA 4HWUA 4MB1A 1NAMA 3OHXB 3BWUF 4YJZL 3MRLB 2G3ZA 3A4EA 5L7XL 2PCPA 3NSFA 3TBCA 5DDHB 4B9JA 1CWVA 5C3IA 3B7TA 5F3BB 2X3BA 1G7LB 1E67A 1OHQA 3RBGA 2PR4H 4NZRH 3HE7B 4F8TA 1GSKA 3J7HA 1AGFB 5C07D 3IEAA 2D2CC 3A24A 3H6JA 5EU7C 3VSUA 3GWJA 4J8RB 3U4EB 3RWIB 5F21B 1EZSA 4AEHH 3S35X 4DP8X 4N6RA 2PO6D 4XCNA 5FM4A 5JIKA 2I24N 1M2VB 4GW4B 4W9JC 1JYNA 1SNRA 3IJSB 4G70B 4XP1H 4B7IA 4AG4L 4ALAL 4HFWA 2A4EA 3SEPA 3MLSL 4RGND 4MYWB 4XBPA 2Y7MA 5JDSB 3KJ6L 1CD8A 3EO9H 3QP3A 4BFFA 5K9QG 3B9KB 1OB1B 3L95A 1A66A 4HPYH 3BE1H 3UJIH 4YBQC 4I0PC 2CO7B 2VWEE 1FNSL 1FYHB 1VRSA 1WA2X 1GC1C 3GEFA 2UZXB 1FORH 4Y4FB 2KC0A 1UM5H 2ZYIA 2NY6C 4JFOB 1JL8A 2NY4B 3D18A 5EO9A 1S4IA 3QPKA 4KKZA 4LKXA 1MW1A 3DHUA 1AD0A 4Q89A 4Y9GA 4XWGL 2DIAA 4NHCH 3DRQB 5L2JB 3HI1A 4GXUN 4PRIB 5CN1A 5ABDE 1X6LA 4ZMNA 3MRCB 1DQTA 1KN4L 3ARXA 4LZKA 1UHVA 4YBQD 1Q9LB 3MOBL 4KOBA 1JD7A 1UASA 4QY8B 5F8RC 5E8NA 3B1UA 5BO1H 5L4MA 1BHGA 4ZK8A 4NKDB 4N8UA 5D72L 4ODTH 5DWUL 4YIQA 3RVVD 4OZIB 3VXSE 4KOCA 3JWDL 2XPZA 4NQTA 1U3ZA 4IRSB 1CE6A 2CLVB 3WS6A 1LEIA 3UZEC 4R3SA 1F3JB 5IHLB 3OXSB 2Y2TA 4R5XA 1ZANL 4KXAA 4XMPL 4HKXB 2GUOB 4IKLA 4OT1L 2OSWA 4YSUA 3GMLB 1CL7I 4U6XA 1D5IH 5JW3H 1RK1A 2GAZA 3STLA 2DBLL 4WUUE 4XNYL 5EG6C 4OGAC 2BJML 2QKIC 1TJIH 5IMKA 1NFDF 2DLEA 4H1LH 4NJAH 1QO3B 4K9EL 4ODWB 1FBIL 5IJVA 3EDDA 4Q9BA 4RA0C 3WIFA 4UAHA 3EF4A 5D2NA 5E94A 2MMXA 4AL8L 2HJLA 2ICCA 4L05A 4GRWF 4LEOA 4AQZA 1HZHH 5CBAB 5CO1A 2KKQA 5GGQH 1P4IH 1UATA 3TEUA 5MI0C 1H0DB 3UCRA 2DF3A 1J9TA 5IK3B 2XWXA 5I8CA 4JCWA 3WIHL 3KW7A 3BD3A 2CSPA 3IF1A 4L0ZA 1KOAA 2DMBA 1UT2A 5ITBH 4QT5B 1JMXA 4HWZB 3GHBH 2BHUA 3ZBMA 2I69A 4UZGA 3ZY7A 5BQ7A 2B08A 3L1FA 4Y4FD 1ZHLA 2FLRT 4GO6B 1ZLSL 3UOAB 3VRIA 5HHXH 5DQJA 4P46A 5GZND 4O2EB 1KB5A 5LBVA 3RPIA 4ANVA 3MV11 5SX5K 5CCGE 5GGVH 3ZZLA 3KHQA 1FO0L 1KGUA 3UMTA 2X2HA 2O5YL 5FV1L 3TA3B 4OB5L 2ATPA 1L9SA 4GUQA 3UAFA 5EC1A 2DYPD 4HPYL 3STZB 2FZ3A 1WVZA 3UH8A 2LQRA 3DOSB 4JFUA 4ETQA 3T2OA 4X4XA 4BK5A 3I02B 1U3HC 2W9EH 3UAJC 1JN6A 3LB6D 3PL6A 1XBDA 3AQZA 4FQJH 2Y36L 2EIDA 2BMKA 4EF3A 2E27H 1BF8A 2ZXQA 3U2SB 3VMPA 3EKCA 2XA8H 2RACA 3QIUB 1KTDA 1L9QA 3C5JB 2EZ0D 3ULAB 3NK3A 2GTQA 3SDXE 1DN0B 4FQHB 3LDBB 5B3SB 3QJXA 4I9XA 2V3EA 5LHDA 5ITFB 3RWCA 1KYOJ 3F7YB 4Z3FA 5E9AA 4N0YL 2JIXB 5K9OB 2FYVA 4PS7A 4GQRA 5AZEH 4EIGB 1RJYA 2VQUA 2FYYA 4CL7A 2QVKA 5DMKA 1G0DA 2ADIA 2FO8A 2PW1B 3FPXA 5IG7A 3LH2H 1BBDL 1FZOB 4RA3A 5I19H 4PWIA 2ZXGA 3P4NA 1NDTA 2BRRL 3F7QA 3MLXH 1Y18B 2GJRA 1HHGB 3HMXL 2HRHA 4OZIF 5TGBA 2YJLA 3NG5A 4MJID 2ZG1A 4O9HH 4OF8A 4NQUA 2AJSL 4UQ9A 1BIIA 3US1A 4GXVH 4D0BB 2NNFA 5F7DB 1K4DB 1N12A 4WI0A 3IU3B 4YSTA 5DD6B 1NGXB 3TBSA 3A67H 5EUKB 4DP9X 4PG9B 3AFLA 3GSQB 4OZGE 2A77L 4MWFB 4CMHC 4PBWD 1NINA 1MVUA 3PXHA 4DN4L 2DWSA 4JGNA 5MP6H 3HG5A 5DTFA 3EBGA 5JDJA 5GISL 3BLBA 3INUH 1EZLA 4HAKA 5EBLA 1KCUL 4ZUSA 5LNGA 2VM3A 3BZ4A 1AS7A 4UIKL 2YJQA 3ILEA 3OPUA 5B1JA 3IMVA 5DVNA 4IYKA 3A6BL 1I7UA 3FC8A 1S7UB 4CW1A 5IM7B 1CCZA 5E4EB 1IGJB 3NTCH 1ZT7B 3BHBB 4FS0A 3SCMC 5A2JH 2XKNA 3EHBB 3GSNB 2VQTA 1JZIA 4LHUG 3O6KH 1MHHB 4HZAA 5JLZB 5BZDA 5E1AA 2LU5A 3V9FA 3UTZB 1UYWL 4YFLF 1URZA 3U36A 5HYSB 4JPVL 1DBKL 3O8XC 2HTLD 3CFEA 4ICXA 4NQDE 5D7KE 1KSRA 4ODTL 1X4YA 5DWUH 1RLBA 4QOKB 1G1OA 3N1MC 4FXTA 3NQIA 2V2XB 5AW6B 4UANA 4JM2C 4WVRA 1GYVA 3WE6A 4E9WA 5C8JB 1WEJH 2VOTA 1T4KA 4OH2A 3CQQA 2L7QA 1DJHA 3NCYS 3AXLA 1WZAA 2NYYD 5HYJB 3VE0B 1PZ3A 4OQ1A 2FIKA 5J13B 3AM8A 4IS6A 1I1CA 2Z64C 3JV4B 1KTRL 1KBGH 3E3QE 5EZLA 2X05A 2I27N 4GG8B 3G9AB 5L8KB 2FGWL 4G6AD 2WVSA 4K7PH 4GSDL 5F7KC 1G5AA 4MRBA 1OP3K 5EZPA 5EF3A 2IG2L 5EN3A 1F2QA 4KUCF 4UU9B 5F7UA 3S4SA 3FTZA 4DEWA 3EH1A 3NP3A 4LP5A 2P4AB 3S3PA 3D33A 2PPEA 3VRLE 3GI8H 2XN9A 4PP1C 1EH9A 3MLTB 3ZIYA 1DVFB 3I6KB 4OCYH 2HRLA 2J43A 4OBRA 2BX5A 3D85A 5AVVB 5IW3A 3T5WA 5DXWA 3N04A 3IKCA 4RFOL 4Z7VF 3U9UB 1UWXK 2IWEA 1EHLL 1TMQA 6PAZA 1GSMA 1KCLA 2AQNA 2VH5L 3HG2A 5TQ2H 4R7DA 3RHWK 5EC2B 3WCYA 2OMZB 1MOEA 1FLRL 1CICA 4N25A 4PG2C 4CVXB 3RTQD 1X7TA 3C2AH 2C7UA 3RVXC 5JMOC 5DD1L 4FX5A 3PLYA 1YECL 1B4TA 4LAQL 5EUOA 3M1OA 2OYLA 1CFNB 3QRBA 1EERB 3D25A 5GS3A 2VDRH 1Q9WA 1OARH 5SWZE 4C83B 4WK0B 3P9LA 5C0BD 5L7XH 1ND0B 5I1GH 2G2RB 4G6KH 2FAUA 4PB0L 1N59A 3DETD 5GJSL 1A21A 3S37H 3IFPB 1CLVA 3L08A 3MA9H 1P4IL 4IGBC 4NN7C 4B5EA 3RGVC 3RURA 7FABL 1KCUH 4U1KA 1KXQA 1F4XL 3M86A 2E6JA 3HFMH 3TXAA 2P24A 3ARQA 1F97A 2AP2A 2NY4D 4G7YL 1U3HA 3NIGE 1EGJA 2VDOH 1G4MA 4ZOAA 3F12B 2D7NA 2XN9B 3CU1A 5JUEH 1SHMA 2XRAL 1PL3A 4A39A 2IPTH 2Z8SA 5F71A 2YXFA 3S4SB 5BRZA 4RDBA 2AJUL 4DNLA 2JKXA 5GHWH 3US0A 4X7EC 3CVHL 1TCRA 2AK1H 5JQHC 2C4FU 3AUVA 3KWTA 1UENA 1KIRA 3CMOL 2L7UA 1RD6A 2EDRA 4R84A 2LTQB 4AIOA 3VM7A 2PO6B 3UACA 4B3VA 5J6HA 4B0MM 1AXIB 3Q6FB 4JDZB 1U91B 4X7FC 4HV8B 2F2HA 1YAZA 4G2AA 4Y2DC 2BHFA 3LEYL 3D2UA 4NC1E 4YC2C 2Q3XA 3E6HA 3V2AR 3HE7D 3LPGA 4LLUA 1KB5H 5EFIB 1KN4H 2A74A 3C12A 2BNQA 2DI7A 4NUJB 3V8CA 1S7TB 2V2TA 4JY6A 1UZ8A 2C9PA 3K0YA 4N8VG 3B2PA 2Q6WB 4M7LL 4Q4EA 5I71C 1J87A 1XMWA 1Z3GH 3FAXA 3HMWL 2HLEB 3VGFA 3WYRA 4NOFA 2DD8L 5ID1B 5J56B 5EZOL 3UBXI 1F02I 3VU2A 1FORL 3QEQA 5DHMC 2VUOA 4HS3B 3H7LA 2NUTB 1ETJA 5GS1A 3EXJA 5K9QI 5D2LB 3OXRA 1IKNA 1H0DA 2DQTL 3MOQA 2MCPL 4HUWA 4YHPA 2AEQL 1HSAB 1LO0L 5F8QC 1DR9A 1DSFL 1KYOK 1V3LA 4LOFA 2FECL 3QFJE 1YCSA 4ZTOH 4TRPH 1FSKB 1LO5A 2EEBA 2GEEA 3K5SA 1WAAA 2J4WH 4O00A 1TLKA 3QJFB 5JPNA 3QJTB 4X4XB 1PZ2A 1MIEH 3QZMA 4FQCH 1LO3H 4ANWA 1AGBB 3OWEA 1P84K 3R1GL 5AUMA 5DC2A 4KTGA 2TRYA 4CBZA 4RMVA 5I17A 1JWSB 2OJZH 5F97E 3EW3B 1P53A 2JJSC 3FQXB 4MD4A 4N0UE 4L18A 3WL9A 4X8CA 4G6KL 3QHFH 1JYXA 1K4DA 2OYMA 1BMWA 2I07B 5HGHA 3MV8E 3B34A 2ODHA 3T4AC 1DLHA 3PHOA 4JCMA 5EOTA 1A47A 5GRVL 2X6MA 4HCRH 5BPPA 4LLDA 3DVIA 1NFDB 4KKBD 3DGGA 1HXKA 3FTVA 3QIUD 4YVUA 4YHMH 1ET5A 3L3JB 1NMBH 2EKSA 4MNQA 5TK4A 1M7IA 3CFBB 3UC2A 4QRTB 3HNSL 1EFXA 3VFVA 3ZHNA 3B9KC 4QRSB 5AQ0A 4JKPL 3MRCA 4GSXA 1A25A 4HOMA 1JGUH 5AEAA 1E6OL 1FIGL 1ZEAH 2AJUH 4PJCB 2O6PA 2MOGA 3DRQA 4IEFA 7TAAA 5L2JA 3IDYC 2Z35B 1ZA6A 3MRQA 2D0GA 5DK2A 1KCRL 1CDIA 4B50A 2YN5A 3CHRA 5D4QA 2O26U 4AT6A 4HPHA 2XZCH 1NMCB 3OLIA 3MRKA 4P5MA 5H37H 1PZDA 3IPEA 5AG8A 4QHMB 4V1DA 1ZSHA 4ATWA 2CA4A 4FERA 3SKNA 1N9PA 1GC1H 3RDTB 1L3NA 5E6UB 3K4DA 5E5RB 4LRNH 1I7TA 3LKRB 4UNTA 4B27A 4JO1H 3PV6B 3KL3A 2YRBA 3LKPB 2VXQA 4PLKD 3MRNA 5IW6B 1KIUA 2ZCLH 2TRHA 1TJGL 1MCPL 4TLSA 4UYPA 1WZ1L 3A3YB 2ZSWB 1QBMH 5JXEC 4F1SA 1UH2A 1A6TA 5F93C 5T1LD 3R1GH 2WUBL 1J11A 4NRYB 4YSDA 3AB0C 2P5EE 4KKQA 5E6IB 2VSMB 5PCYA 4L3EB 3GHEH 4YSRA 2YXMA 2EO9A 4R7NA 5E9DD 4MJ2A 4QRRA 5E00A 3V6OC 3D34A 2YMXL 3TCLB 3RG1C 1ZAGA 3HI1B 3IDGA 3S2CA 2OXGA 2GW5A 3QIBD 3MBXH 4G8FA 5AOJA 5BS0D 3BRDA 3F05A 2EDFA 1DDTA 4QHUB 5D2LF 2V5RA 1YPZA 3GJEA 4NP4L 3TT1H 4X7CC 3GLDA 4LSPH 2VDKL 4OFYA 5JO5B 2K70A 3PAZA 5HGDB 4NFDA 3U79A 2R4RL 4GXFA 4HF5L 3MRDA 1NC2A 3LKOA 2VMEA 1R3HA 43C9A 4GRMA 4WFED 1OGPA 3OLDA 2ZQKA 3FRUB 4L4VD 2W81C 4BH7A 1TQVA 5AVSB 3DX0A 3ECVA 2OL3A 1GOGA 2CIIB 3RU8L 2EINB 4HOXA 3MBED 4KITB 1BQSA 2BJMH 4B53A 3V9CA 4N2NA 2DTMH 5MENB 2MEJB 1YNKH 2AV7B 3NIGB 5F7NC 1RULL 3CSBA 4XO9A 3KR3L 3L3HB 4CJ0A 3DXAE 1KIPB 3ZSTA 1MHCB 4ZXBB 4CADA 3DIDA 1I7TB 3LKRA 1MJUL 1HAWA 1HN1A 4H88H 4OD3H 1LVEA 1PX4A 1RCYA 3SGJA 5HHME 2WYHA 3L3DB 1YEGL 1HCFX 3B9EA 4KK6C 2A6KA 2Y72A 3FUEA 1F8TL 1ODUA 1BVOA 1L9MA 1NAMB 4OJFL 4PJEA 4XMVA 1BVZA 1CFSA 4OLEA 3AMKA 4OLXL 3D3VE 5TF0A 4BJLA 4V11A 3FB5B 1I8KA 1JPTH 3O2DH 3TPKA 3GUTB 1FHGA 2NYZA 3PWPA 1JCKA 2ZSVB 2X6AA 2VKXA 3O6FA 1KULA 3MNZB 4GIAA 4K94H 3BXNB 3J27A 5TE7H 1FG2A 1C5BH 1BF5A 4PJXF 4N8VB 2Y5TA 2BS8A 2R4SL 4HHAB 5DVMA 3QR2A 3ZE0B 1IGYA 2TAAA 1O6TA 1MRFL 1TO4A 1EANA 3H85A 1NAKH 1I1FB 5L9DH 4GW5B 1BW8A 1NZRA 1A1OA 3RIFF 3BJ91 1XIWA 4A6YA 4NKQB 2W9EL 1H3WM 3Q8BA 3CTTA 1TTAA 1XZWA 1TVBB 5DO2D 1KIPA 4H8VA 3QZNA 1KGCD 3HBPA 2RA1A 4G9FE 1KTCA 4ONGL 4RIRB 3AADB 5F96H 1AXSB 4WW2B 1AR1B 2CO3A 4MNQD 3I50H 5CCJA 2H5UA 2GVYA 4ATTA 2GSGB 3HG1B 5B22A 1WT5C 5J12B 1T03H 1TUPA 5MENE 3HR6A 4MXVE 4F8PA 4HIJB 1KZYA 2H1LM 2XPGA 3QAZB 4HKJA 5T3XL 5LG6A 1EDYA 2ZAIA 3KLSA 5LCVA 2APFA 3LOWA 4U3SA 5KOVC 1IT9H 4MXQD 4TULH 5CJOL 3TOPA 3H0TB 4M6AA 2Y23A 1TZOA 4KAQH 3GSVB 1NJ9A 1SF3A 3SQBA 3QXVA 2K8MA 3O4OB 4PJFF 4NO0A 5EU7E 1JNHB 3LKNA 4NQCE 4UINH 1LGVA 1YEJL 3DGCR 1O7DC 2B14A 4KQ0A 3Q2CA 1VPOH 4J28A 2XZCL 2P49B 4X98B 1LK3L 4POZD 3IAPA 4KKCD 4I1RA 5DO8A 1HKLL 5IT2H 3FU0A 4L3EA 1NPJA 3ETBF 2Y07H 2ZOLB 3MGTB 2PETA 5DU7A 3A23A 4KXZI 2XRAH 5BXFA 1D9KA 5HXMA 5C0CE 5L88L 1FIGH 1E9OB 2VM9A 3SD2A 1FDLL 5FDYA 4JB9H 5FECB 2YGOA 4WFHE 2CGYA 2F7IA 1PLAA 5GRUL 2NDGA 3K8MA 1RVFH 4S1QL 1CXFA 4Z7NB 3MA9L 2ITDA 4XH2B 3GK8H 3K4AA 5T5NG 4H40A 4MDJA 1NGPL 2K1MA 3L5IA 1UB6B 1ERNA 3VD9A 1MI5B 1OF2B 4XNUL 4R2GB 3HJ0A 1AG0A 5I8KL 4WGVB 5C0NC 5KVDE 1F86A 1P4LA 1QNIA 3HRZC 3F85A 1DQMH 3ARGA 2LW3A 1LO5B 2DRUA 4Q9CA 1TVHB 4UF7C 4OJAA 5LLIC 3CFNA 3MRQB 4ZOCA 1NCDH 1HOCB 1NC2D 1FCGA 3QUXC 4HX1A 1HILA 3W9DB 3AUWB 5AWNL 4F5CE 1DBJL 1WC7A 4JPIB 5ISZA 2QLVB 4FXGA 1UUSA 2C9AA 3QO0B 4OGAD 3CNKA 4JFEE 1YAIA 4GB9A 4GY4A 1CLZH 1WHPA 1NWOA 4N2AA 4ZPTB 3I85A 4FABL 4KO9A 4PRPB 3W38A 4KAQL 4P4KC 4OJDH 1DJYA 3FT4A 2PPDA 3MHZA 2FEDC 4PWJA 1NCTA 1YQ2A 1A9BB 1SEQL 1NL0H 3NAAH 1ZLVK 4Y4KD 5EOTB 3NPSB 4DCQA 4M4RA 3QNZB 1A6WL 2OXHA 4F57H 2QMJA 4XN5A 4UM8A 5EN2B 5JHBA 2WGXA 1XH3A 1UWGL 4R7LA 5FS5A 1FZJB 3B6SB 5HDLA 4OCYL 3EXLA 5IMLA 1J5HA 1MJ8L 1DVFA 1E4WH 2I60H 3I6KA 4UWQB 4OJYA 3F04A 3PWVB 5DD0H 1D7BA 4KFZC 5CSZB 2VITB 3UP6A 1CXHA 2WPGA 3V0GA 1O6SB 3A21A 4NZUL 2R27A 2JSFA 5D7IE 3P02A 2JKRM 1BQLL 4KJYB 1UJ3A 3AGVA 5GSRA 1RFDH 4CNIB 4WWNA 3QWRD 3HAEA 3D09A 4GSRA 2I9LA 4PJFB 4KMLB 4HUKB 3W5NA 2WXLA 3LIZL 5TDPA 43CAA 5TE7L 3WENA 5AB2A 3VDCA 2VO5A 2YRLA 3IMWA 4PJGF 4R4FH 5T3ZE 4F93B 4MA7H 5L88H 4ZSOA 1JFQH 7CGTA 2HVKA 4FQQA 5I6LA 5LB1A 1W72A 2UXTA 3MLSH 2HFGH 3TO4C 4Q9QL 1O9WA 4WW1B 4Y89A 3S3BB 4UOQA 5E99L 2A74B 3B7YA 2Q8BL 4TNEA 3CV5A 3MV7E 3AS3A 4V33A 2YARA 4FXKA 1R47A 1EEYA 1OPOA 5J1AB 3I6LD 1AKJA 3L81A 1IARB 4U1IA 5CN2A 4N26A 3DROB 3RWFB 2DJ4A 3GSOA 1H8LA 2VAAB 1FVCA 1QUNB 3H9YA 4P2RE 4WU5A 4OU3A 2WXRA 1CICB 2YD6A 4XPFL 2Z8WC 4JHVA 3RWJA 3ESNA 1I3GL 5DLMH 5EH1A 1G87A 4PBDA 2BP8B 1X5XA 2EH7L 4MJ6A 5EU4B 5CD5C 1S7UA 4CW1B 4JDVA 7PAZA 3VFPB 2YEZA 1O6SA 1UADC 2GI0A 2VSKB 4E42B 2JCCF 3WMPA 3CX2A 5GGTL 3ULVD 3GHEL 1CZ8L 3UDWC 3AQYA 2QSQA 1EQWA 5LXGH 2D7MA 4OD1H 4P2OB 4J1UB 1ZK9A 1UA3A 3CXHK 3LN5B 1QNZL 5AYUL 3P3UA 4PG9A 1EA9C 2QQLL 4WNJA 4OGXL 3UBHA 2BNUB 2EIJB 3LB6C 1LD9B 1QFWI 1FNGB 3QFDB 4GINA 3L9YA 3KPLB 4OR1A 4W70A 5DUML 4UILH 5AW0B 3VSVA 3QEQE 5HYJA 5KVDH 5HHOA 3WUWB 4UBDC 2R1XA 5EZOH 2EZ0C 3MUZ1 4KMTL 4Z7WA 1F3DH 3RGBA 4A6YH 3DROA 3RWFA 3FBQA 3SDCB 4WFGE 4RETB 2XXFA 4LDOB 2NXYD 1N6UA 4EBQH 3RDJA 5BMFH 1EEYB 2HCZX 2VQ1B 5BQDA 1MW3A 2AJZA 2WXKA 4J3UA 1BV8A 2D3LA 4TUKL 3MRRA 3C6LC 4FJ6A 2CDFA 1BM7A 4LL9A 2X0VA 3GK8L 3DC0A 4HZ1A 1F4AA 4PJFA 1K3IA 1E9PA 2B3IA 4OCWL 3VTTA 3QUGA 1HXYB 2VSCA 4NRZA 1EGJL 3L5XL 3KDMB 2F0CA 2H6UA 3ME0B 4CMMA 2J20A 2AERT 1S9WA 3CXFA 3SCMB 4MJIB 2DQHL 1I3VA 4GLRI 5GRWA 4D9LH 5EIIB 4XHJC 4MJ5B 3O6KL 5I6KA 5FM8A 4NX0A 5T33L 2YPLD 1P7KB 3EDEA 4YGAB 4XRCA 3S9DB 2CLZA 3D0LA 3D30A 2BSEA 2YS4A 2ZONA 4PLJD 1X9UA 2XVKA 3O0LA 3ARYA 4TSCL 4UDTA 2DMKA 3FB6A 3WIHH 1J9QA 3DMMD 5CZVH 4NC0B 1CLZL 2PR9A 1H5BB 4NWTL 1DE4B 1LK3H 4IK6A 1U8QA 3KYMA 4AEHL 2JIXD 1R75A 3MV8A 5HI5C 3JVGA 4U1LB 5B7FA 2H3XC 2DMHA 4YK4C 4ENEC 3L6FB 1ZWIA 3H2WA 1XEUA 2VDPL 3QRLA 2IAMA 1CDCA 1D5ZB 2EH8H 5AVXB 1BYOA 1YEEH 2WTRA 1I1YB 1KCBA 3WHE1 3TH3T 1NCHA 3GRGA 3TF7C 3X13A 3O2DL 1BOGB 4BD4A 3S98A 4X7TB 1WRFA 1J0HA 5E95B 2JKLA 3B2UD 1EMTL 4UNIA 5E2UL 4Q6IA 4ODSL 1M42A 4NM8L 1HQ4B 1VADA 1JPSH 3TCTA 4F5CA 4DW2L 5JHDB 1MDAA 1PCSA 3OGCB 5SWZA 4U6YB 4KRPB 4PRAB 1VHPA 3GSNL 5DI8B 2B2XH 4HGMA 4DGYH 4HX1B 4NAMA 2BNRB 2WQSA 4JFDE 1IVLA 3HMXH 1YNLL 3CMGA 3UJTL 2VITA 4KKLD 4Q14A 4F7CA 1KCVH 4HA1A 1G9NL 1AGCB 3M7FB 2IQAA 3ZE2F 4NRZB 3DTXA 2QVIA 3HBZA 1K5NA 2XN9D 1BFOA 1DQQA 4X6FA 1KTBA 3VD5A 3RJQB 3A4AA 4JKMA 3V6FB 4XGZA 1ES0B 3L9RB 5EUKA 3QNYA 3K2UL 1IEAA 4YWGL 2OK0L 4BUGA 2NX5B 1H9DA 5F7DA 1I9IL 4JG5A 5MHSE 3R19A 2DW5A 4XH2A 2CDGA 3MBEB 2O6EA 1W72L 3N85L 5I5RA 2CA3A 3CFCL 3ILQD 4LPTA 1BVKA 4KK5D 4V2CB 4HEMA 3KPSA 4JK0D 1OTTC 2ADGB 2OSLA 1F90L 4UQCA 3LIZA 3MOBH 4ZTPL 4HJ1A 5T5FA 2ZUWA 4TLUA 4XPGH 2BY3A 4QY8A 5BVJB 3AQXA 2R7EB 3C8KB 1BQHA 4WFEE 1AZRA 1JD9A 4HIPA 1KJ2H 5DSCB 1HILB 1GW0A 3O6FB 5JXAH 4Z3TA 4PGCA 5BS0B 2CWRA 4Y2DB 2E86A 1DZ0A 2O6CA 3QIBB 1RV6X 2VL4A 1WF5A 2JTDA 3RY6C 2JXMA 3EGXA 3GSWB 4JFFB 1LM8V 2FO4A 2YSSB 1DVFC 3MJ7B 4KJQC 4TS6A 4Y8AA 2ZE0A 4MQ7A 3VRJB 1BZ9B 3PQYB 1BAFH 4IU2A 4PLKC 3MXWH 2EUZA 2ZJSH 1RULH 4YHYB 4CVUA 1MNUH 3NMEA 1D7DA 3A6BH 2IBGA 3QZWA 4A2HA 3V0FA 4NHUB 1N0XH 1EZVX 1KCKA 4UTBA 5D1ZC 4K23H 3ZO9A 5IREA 1J0YA 3HCVA 3RZCD 1T7WA 3IXTB 2FUTA 4S2SB 3PU7A 1TFHA 1X5LA 4G80B 4L5FL 2GT9A 5CP7A 1U0QA 1JF5A 1PYWB 2WHVA 4GMSL 5HI4C 4KK5C 1PZ5A 2WAQA 1A3LH 2CHZA 4FTVB 4MX7A 3ASWA 3DECA 3NJIA 2F19L 4PVNA 4R96B 2HUEA 5LDSA 5HBBA 2E47A 3WXWL 3B9KD 3RWHA 3SE8H 4AIZB 4EO5A 3NIGF 1A4CA 2VXUH 3JTSB 4FYTA 4Q0XL 4QT5A 4ZAKD 5K1JA 1X5AA 2VR9A 3GRWL 1D5XA 4HHAA 4NO5B 4W4NA 4M7KH 1G9HA 2IOIA 4HEPG 4NN5C 3I9GL 4OCWH 5BW7A 1X5KA 1NFIA 5LWYH 2XACC 2UWEA 3WIFB 1PD0A 1WAAF 1I1AC 1FFOA 3DX8A 4XO4A 4Z78B 4HS6B 4IIQB 4L29B 4R9HA 1RZIB 1PLGL 4AENB 1MJJB 1UD5A 1RP8A 2ENSA 2Z91B 3JTTA 5AVUB 2NY0B 2PW2B 5FOBA 2B1HL 5CAYB 4G6MH 3V4PA 3BPOB 3EBHA 1OP3H 1T03L 1H3UA 4KO6A 5DHYA 2VMCA 2RH0A 2WCPA 4MZRA 4HIEA 3ZRSA 4G9FA 2YA0A 3BDXA 5IFAH 3VGGA 5E1HB 1DSYA 4MNHB 4UILL 3CZEA 1QHOA 3QDMA 5FW8A 1EJFA 3MV8D 4MMXA 4DIXA 3KBPA 4UIMA 2ZOOA 5H37A 1IT9L 1U21A 3WXVH 4EOWL 4J3SA 2B5IC 4N85A 5C0JA 1WCQA 2EYSA 3QEQD 5EU5A 1JK9B 5I23A 3MRFA 5I1JH 4BUHA 2QADB 1KTLB 3KLHD 1CS6A 2FX9H 2VC2H 1NDMB 3RYMA 2OR9L 1QLFB 4N0CC 3VFGH 4MB3A 1A3LL 2DLIA 2DWDA 1J5OH 3H4FA 2F74A 2AW2A 1S9VB 3UO1L 2XXGA 3AG3B 4MZ3A 5F6HJ 5BVPH 2NXZD 1PX3A 6FABL 43C9B 1L7IH 1Z9SB 2AABH 5FFOA 4DQAA 4OI7A 2AEIT 5GRXG 3VNYA 4TYUA 2UWEB 5I28A 4HK3J 4JLRA 1IFRA 1UA6L 1B4LA 1G1KA 2X6CA 1EAPB 4M5YL 2VZ1A 4ZX5A 1G43A 3T4YA 3JV6B 4HT1H 3NJHA 1Q38A 4R2GC 1NDGA 4RQQA 4WFHD 4L3EE 2YZ8A 1F00I 2ADFL 2F54D 3SE6A 4CU7A 1BREA 4BQ9A 4Z7OB 2MTAA 3SO3B 4XXWC 3WO4B 4R4NC 3QISA 4C4UA 4F1ZA 5F1OB 4Z3JA 1RZGB 4M02A 5DJ0A 4IHOB 2YAFA 1NGZB 3VO0A 4R96A 2EDLA 2XTJD 4U1GB 3MRGB 5C0GB 3WXWH 2VLRD 4MBRA 4K3EL 2VT0A 2YRPA 4NUQA 5FUOH 3S35H 1S78C 2YA1A 3JYCA 3LZFL 4Z7WE 3AAZB 5TD4A 4N2OA 4XBGB 1Q9KB 7PCYA 2JCCB 3GMOA 4XPHH 1BG9A 4Z7WF 4U0RC 4ACTA 1HHKA 1FYTA 4GQ9H 4ANXA 2NY3B 3GBNL 4XE5B 1SHXA 3T0WA 3QUYA 5DT1L 2BZ7A 2PP8A 3KWWB 4FL4C 3HMWH 5E56A 1OTSC 2CR6A 1LYQA 1UWEL 2EABA 1OTUC 2A6JA 1AIFA 3DUHA 5EMYA 3QXUA 4PJCE 5I0XA 4HJIA 5BS0A 2R59A 1WZLA 1H3TA 2EIBA 2QQLH 4BCXA 2LVCA 4PREA 4RDQF 4XXCA 1G84A 3KLAB 4EVNA 4X5QA 4JO3H 1ONQB 1IE4A 2Q6WA 3PDOA 3UTSE 2ZT9C 2YIHA 5J3HD 2C9XA 2E7LA 2CU9A 1B88A 1J1PH 1NBQA 1SXNA 1SDAB 1D9KC 1KLUB 2WBJD 1PJ9A 2YQ3A 1OPGL 1MF2H 1U95B 5ILTL 4AYBA 5IMOB 3DIFB 2OL3L 3FQ1A 1IM3D 1ID2A 2LU4A 5IVXA 2G5UA 4HXAL 4A7QA 4YSCA 1LTXA 4O51B 5IIEB 5FV2A 3GI8L 1Q1JL 3R06A 4XC3L 1HNYA 3CBKB 2JB5H 1Z5YD 2A2QT 2BY1A 3L7FA 4IU3B 4PRHD 4RGNC 3WFBL 4XMTA 4TQEH 4DP4X 3LY6A 1AO7B 1KBBA 4MXWH 1AQDA 4NAJA 2YBRA 4IDJH 5LUMA 2D7QA 2FWOA 1K5NB 3ZKND 5I17B 3LQZB 2EC9U 1XH1A 4AV0A 3HPLB 1HEZB 1W6LA 3AJ7A 3MLVL 4M1CD 4JFVA 3D3VD 4HIIA 4EIZC 1JZGA 5I30H 1E5BA 3V4PH 2FJSA 2VDQL 1VAHA 4HDIA 4R7VA 3ZUNC 2CBTA 1WFNA 3VYOA 2DQ6A 1K8DB 2PN5A 1E6OH 1ZEAL 4QTIH 3S3CB 3LZNA 2AVFA 3L4YA 2ICEC 4ZFGL 4YGVA 4OLYH 1J86A 1FG9C 1SN2A 3TBBA 3X3FL 5AOZA 2GJPA 4ZUUA 3IN0A 1OP4A 2LFGA 5D8JH 3H9SA 4EIBA 5TE4H 2DI8A 3O6LH 4NB7A 4NUGH 1CVRA 5F1SA 2AJYL 5IWLC 3O3EB 2DEYX 5D5MA 2K6ZA 2MPVA 3BOVA 4OF5A 1J9RA 4I88A 4JHUA 2CR0A 4LLYA 3C87A 4U7KA 2W80C 5D1ZA 5IUSA 2BNRD 1ICTA 5EOCJ 1G7JB 1QBAA 3KCPB 4R8WH 1UACL 2PWEA 5F88B 1ZY9A 1F2XK 1YEEL 3BUYB 1LMIA 3E1ZA 3E0GA 4IIZA 4R7DB 4TSAL 4LP8A 1EJ6A 3EUUA 1G6RB 4GS7C 1K72A 4EKJA 4FNLH 4PLOB 1NLDL 1WISA 1U30A 4D0CA 1WICA 1AAJA 4MBOA 4QXWA 4ORGB 5DFVD 3MX0A 5FA4A 3D8MA 5K33A 4BSVB 5ABZA 1VEOA 3ETTA 1NFIB 1LO0H 3GGWA 1QFHA 4ZFOA 3GIVA 4XR8C 2R1WB 4MJIA 1CFTB 4OCRL 4K4KA 4WW2F 4YBHA 4AGOA 2CCLA 2BIQA 1NOLA 3BWZA 3RGVB 4X4KA 1RJLA 4W6YB 4X0NA 1F6FB 3KM1A 3I9IA 3BEWA 4RAHA 1UZ8B 2H26B 2VNCA 3K2KA 4A7VA 4XNMB 3NIDE 4XMLH 4OF7A 4N8CH 1A8ZA 2NSXA 1KJMB 1Q94B 4NQDA 4K3DL 1JUFB 4C56A 1PMYA 2XX1A 4OZHA 4XXWA 4Y19A 4F33A 4XXDA 5B8CA 1F90H 1TNNA 1L6XA 1A4KA 1DFBL 3O8XD 4UTBL 1T0MB 4WWKD 2CO1A 1L0YA 4LEXL 4L0PB 2AXWA 4MXVF 4OIFA 3MACL 1S7WA 3VFSA 2CAKA 4C56D 1YQVL 1CXIA 2UWEF 5JHDE 1QZ1A 3PL6D 1TJMA 2AK4E 4FFVC 2J88L 2ZICA 4G6JH 4ODHL 3UEQA 4H88L 4RFNB 2QPFA 4DQOH 5A7EA 4QI3A 1J88A 2A9DA 3QUXB 1R4XA 3IB4A 2F5BL 2WINB 3MGAA 3KPMA 4GAGH 1KFGA 3C09C 2VM4A 1S7VB 2AI0H 3QORC 4HSAC 1CI3M 2AK4A 3HHSB 3MU3A 1G7IB 2YGNA 2MCMA 4P3CH 3L1EA 4OLXH 1JGEB 1UVQA 3N9GL 3L54A 1KC5L 1V3KA 1ZA3A 3F6IA 4WWKA 2DQUL 4WSGA 1XXDC 2K3HA 4F15B 5C08E 2BIMA 2FJFB 2H0PA 5ACLA 3MNDA 1WLHA 4QRPD 3L3KB 4XMZA 3MRMB 1BD2B 3EBIA 2C3HA 3K91A 1GGBH 2MQGA 1GMIA 1OAQL 1M9WA 3L4TA 2QKIA 1OP5K 3AS0A 2Q76A 1SN5A 1FPTH 3KPSB 1WWAX 2WTPA 3WO3B 3ZRFC 2HFEB 5GZOD 2APSA 1KT2B 2WCSA 2DDQL 5D1XC 3UAEA 1WBZA 4JFSA 4NQDB 5BOZG 1E9QA 2MPAL 3CFEB 2Y0SA 4KI5D 1INQB 1YHPA 5I1DA 4QOKA 4XCFH 5E1AB 4Z7UB 4EN3C 1CICD 1QFWH 2GJJA 4FXLA 4BZ1H 5AAMC 3BLPX 5F1NB 4EMZA 1OTSD 4TQEL 5IJKC 1MAJA 3ZOAA 2WZPD 2PPCA 3MV9E 4APXA 3ZDZB 4XBMA 4M5SA 4DUWA 1Z32X 1GA2A 5KVGE 1NPUA 5JIIA 1RKRA 8FABA 2AQPA 5F7AA 1PBYA 1GS8A 4R4FL 3SDYL 3AT0A 4UOJA 5T3XH 1JPFB 1J1XH 1A6ZB 1T1WA 4KKAD 3T2NL 1ZSDA 1RPKA 2ZUSA 3O3AB 2JKNA 3G5ZB 4NLHA 1CGUA 1I7UB 2MIZA 4O5LL 4X0KB 2WLKA 5ANHA 2IC2A 3JV4A 2NUTA 6PCYA 4JQXC 5GS1B 5LGHH 4TNGA 5IVZA 1S7RB 2JK5A 1W0WA 4WI5A 5IKCA 4NZUH 4RESB 2EDTA 4BSWA 2ZXAA 2WLZA 2GQHA 4QXUH 4QRBA 5CSBA 1C08B 3D4YA 1KLFB 5JXEA 4G6FD 4MAYD 5EU6E 3RWGB 3ZE2B 4M8QA 2X2YA 3N50A 5C09E 3ZL4H 4N2LA 4PB9L 4EI0A 2VDMH 2HFEA 2W60A 3NACL 3G5VA 5I1KL 2ATKB 4ZNCD 2EAEA 3WN5B 1U3YA 5IUCA 1CG9A 2Q76B 3PV7A 4XZ4A 2A38A 3D0VB 4UOW0 1CTOA 1HJBC 2CBPA 3RILA 5ES4B 5FF6B 3EGDA 3QYCA 1IBGL 4PJ8B 4CSSA 3HC3H 1AMYA 5DJ2A 3LRSA 4DGWC 4F2FA 5I6PA 5M7QA 3IDIB 3QI9A 5E0QA 4KGLA 2QKSA 5F7FA 3CFIC 5D1QD 4JPIA 3NJXA 4FFYA 4K3EH 5D7EA 3TBWA 1ZTMA 5KBNC 3F5WA 3G6JB 2IDSA 3QIWA 1P5UB 5GRZA 5AW4B 1P2CB 3E8VA 2D0FA 1BX2A 1QZNA 5AWNH 3HBQA 4YZWA 2QGDA 4X80H 2P24B 4WDIA 2KBGA 5KVFL 3FTWA 4C59B 4P57B 3FB8B 2N56A 1KELH 3GS7A 1XXFC 4S1DC 4Y2OB 3OTTA 1JIBA 3QXAB 1E9QB 1ZHNA 1F56A 2MHAB 3SPVA 3LRMA 4PJ9D 2NNAA 2CO6B 1E27B 3EJQA 2VE6B 3VX1A 1T66D 3D87B 1A1NA 3PGDA 3HS0C 2PTVA 1LILA 3ZE0F 3DPBA 2V8LA 3KXFD 2WV3A 5CZXC 1E6JL 3PJSA 1HH6A 2ITEA 3V95A 3FU7A 1MWAH 5IHWA 3IKKA 4U1NB 5ELIA 5IROA 1BPLB 1KEMH 1Q0XH 4I0KA 1UXSA 2MKLC 4ZFFA 4QHKI 1OAUL 2YD7A 3FCSB 2H9GB 2FT6A 2IFGA 3NSYA 2F53E 2HVJA 4APQC 5F7MC 1J48A 3BAWA 4FTVE 5IJDC 3OAWA 5FDWA 1DCEA 2R1WA 4W1TA 1QMUA 4XMUA 3MRBA 5ISZE 2IPUG 3WG7B 3LX9A 1Z0MA 3K6DA 5J12C 2P5WE 3HC3L 5D5MF 5IQLA 1UKTA 4HCFA 3NEOA 4NN7B 3FAWA 3FNKA 3LEXA 2ICWI 3MREB 4ZUVA 3UPCA 1KGWA 3CVBA 3V0VA 3KAAA 4KRNA 1FFQA 3IJ7A 4RISH 1X9QA 5I6XC 2R8SH 4FE9A 3AAZA 3SE9H 3K6IA 5I6OA 2XG4A 2EXTA 3OKDA 2EVHA 2BY0A 4V2BA 4B95C 4K8RL 1CB4A 3A6CH 4PP2B 4XC1L 3B9AA 5J1SC 1ZVSB 3H7BA 2J5LB 4CVZB 1CR9L 3EJYD 4P2YA 4HKXA 5ACZA 4IRSA 2O93L 1BVNT 4JM2A 3V4VL 3U4AA 3KGSA 2BK8A 1BVNP 1A1OB 2NW3B 5BQ7B 5FK9A 3HLAA 1PIFA 3IFOB 3VMOA 2YQBA 4H25A 3LRKA 2IVFC 2BDNH 4OZFA 2V0AA 3VUAA 1P1ZA 1QNZH 1VERA 1BYPA 3OX8B 2Y2YA 1R3JA 4H1LG 1LO2H 2HJLB 1OT2A 5EOQH 3OM3B 2P8MA 4X80L 3MBWB 2NX5E 1J5DA 4KJPC 3V4LA 4EUPA 1KPRA 2B7DT 3WKNA 3EFDH 3CGTA 3EDJA 3LV3B 3V9EA 3PWVA 4WV1B 2K9UA 2YK1H 1RHHB 4TOYH 3HR5A 2YGVA 1OSZA 3BP5B 2DIJA 1E3FA 2FWSA 4FFZL 3MI6A 2P44B 2J73A 3VB9A 1SY6A 3ASNB 5KTEH 5GGSY 5D7SH 3DVNB 3O6MH 4UQEA 5E5LA 1UM6H 2H2SD 3MKGA 3P4LA 3SGKA 3BQVA 5HJGA 3OMNB 5TDNB 3OXSA 3D05A 3U9PH 3BVVA 3DX4A 3ECBB 5DD1H 4F9PA 3IU4H 4ACPA 5IVXB 3QZBA 3OF6D 4IJ3B 1JBJA 1YG9A 2XZAH 1AACA 2FGWH 1LO3L 3V0HA 3Q05A 4UB0H 2HT3D 1T66C 4FNSA 4QLRA 4AIEA 1TTCA 3RWIA 4KKLC 1E4KC 4WNQA 5F0PB 2PYED 1TZAA 3HRZA 1GYAA 4GRMB 4YHLH 5FO8A 2N3JA 1S9YB 3FUNA 1GIGL 3OB8A 5DD0L 3EYSL 3TBYA 5KJRH 1OP5H 3ZW3A 2ZOKA 3S8FB 4XNZC 3T71A 4HS6A 3IS1X 4IIQA 3LKOB 3F7LA 1E7VA 2ZF9A 3C6LB 4J3OF 5DRWB 4BHUA 4CC4A 1WBYB 3LJ3A 1R3JB 1NBZB 3F2LA 1D5RA 4K7PL 3KL0A 2XC8A 1CMOA 4GG6F 4F2MB 5TQ0L 3BZFA 1JF1A 4GLRH 1MCWW 4R90L 3LEVH 3BDYH 5EA0L 2NY4C 2P5EA 4XX1G 3EFFA 4JQIH 4Y1AD 3SYPA 3TBTA 2Y7LA 3U1SH 5DC4B 5I71B 4LOEA 1SEBA 3C9NA 2GI7A 2VW6A 4G83A 4AIZA 2JFCA 4Y16D 2C1OB 2C3WA 2W0FB 2E0PA 1L7TL 1P9MC 4OV6F 1NDMA 1RIHL 2DKMA 2YAPA 1MQKH 1IVTA 2NZ9C 2BSDA 5K59E 5EU5B 4U1MA 5EEZA 4PLNC 3OKYA 5H4YA 4GAJH 4WZ9A 1DUZB 3CBJB 3DX9A 1EJOL 4ONFH 3VFOB 5I8OL 5CGYD 2ZOLA 3MGTA 5D7KD 1ZS8B 3OLEA 2W5PA 2C1PA 3PDOB 4FYRA 4RMRA 5C09D 4PB0H 4X9YA 4Z95L 5JIMA 3N6YA 1SJEA 3EJTA 3ZDYE 3QDHA 5GGRY 4AYSA 1HEJC 2ICWB 5FOBB 4YSPA 3HUJF 3KWUA 3ZKNC 1KN2H 2VDKB 3M17B 5AKSA 3SB3A 4MRCA 3QAZC 3AG1B 4P23A 1UEMA 5GS1C 3O6LL 3VH8A 1P6AB 2GBVA 3VFNA 2X1PA 4OCSL 3TIDA 1P4UA 2H41A 3RPBA 5KUKA 4PJ5B 3NSJA 1QW8A 3VFVB 4FLRA 4A1RA 3RZCA 3JWDC 2BVQB 3VG9C 2DWDB 1CLCA 3L8QA 4IBTA 2J1WA 1VZIA 2OQJB 3ZX1A 1I53A 4KUZL 1BMGA 3WS3A 5IEKA 4O02L 1IC7H 2EE0A 2W88A 3WXVL 4EOWH 2EYSB 3E9UA 1R5IB 3KE0A 5E0FA 1QVOA 2X1XR 3FT3B 5F0JB 1DLFL 4P49A 3OJVC 2FBOJ 4A38A 1LK2B 2ISDA 3DSFH 2B16A 4WEMB 1GMEA 3C2SA 3GQFA 1XSJA 3OKDB 2B1HH 1H3PL 5KVMC 1KPUB 1XIWB 1NAML 3QULA 1O9ZA 2BVOA 3L1OH 4JAMB 3B2XA 1RHHA 1U41A 2IIJA 1YC8A 4IKJA 1ULVA 1LNUB 1J10A 1M71A 1TFPA 4RISL 4X6BB 1LP9E 3GFUA 2IG2H 4NHUA 5DEJA 5JHLH 4FFTA 3ZMRA 2J8UB 3PNWB 3TIDB 3WTTA 1MIEL 3S37X 1K8IB 5LGHL 3HZVB