5D4HA

High-resolution nitrite complex of a copper nitrite reductase determined by synchrotron radiation crystallography
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
337
structure length
337
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 93
structure length 337
sequence length 337
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4hA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4hA02
1J9TA 1CYWA 1IBYA 3JT2A 4PAZA 3PCYA 3QPKA 5AKRA 1BXVA 1TEGA 2BWDA 3TBCA 1AR1B 4KNTA 2AZUA 1NZRA 4PCYA 2TSAA 4JKNA 2PCYA 3IBOA 4FAAB 2FWLB 1KDJA 1KGYE 3OQRA 2R7EB 4YSRA 3S3BB 1A8ZA 2TSBA 2FJSA 2W8CA 4KOCA 4Q8BA 4TXVB 1E67A 1MZZA 2A3TA 1NINA 4G71B 9PCYA 1PNDA 2PPDA 2W88A 5I6LA 3NJKA 4DP2X 4GY4A 2HRGA 4KNSA 3NSDA 1V54B 3NT0A 5TK2A 1ASOA 1ZDQA 2IWKA 2I85A 1EZLA 1BQKA 1ET5A 1AACA 3FPXA 1B3IA 3T6ZA 4P5SA 1AZUA 1SDDA 4A2HA 3AW5A 4HAKA 2VW7A 1JVOA 3ZBMA 2BWIA 2WSDA 3V9EA 3ZIYA 3NP3A 1L9RA 2BZ7A 2XUWA 2EILB 3QJTB 1WA0X 3QJQB 1ASQA 2ZOOA 5LDUA 1GS7A 4GXFA 2UXTA 4YSDA 2HRHA 2PLTA 1AOZA 4YSQA 2FT6A 1V55B 1FFTB 1M9WA 1W8EA 3AG3B 2ZONA 3CDZB 5E9NA 1GS8A 1NTDA 4BWUA 1JXFA 3ZX1A 2DWTA 2PCFA 4EF3A 1JERA 5B1KA 4YSAA 4G70B 4K9JA 3NYKA 4F2FA 2XXFA 3AZUA 3D12B 3MX0B 3FU7B 3ABLB 1NWOA 1FWXA 1JZGA 1PNCA 4A2EA 1NICA 4P5RA 4KO6A 2BP8B 3UGEA 4MFHA 3N55A 5F7BA 2PPEA 2X87A 2ZWNA 4NB7A 7PCYA 4HIPA 2PP9A 4M4RB 1AG6A 1BQRA 1GS6X 1PZCA 2GI0A 2EIKB 4JHVA 3KW7A 3T6WA 3EH4B 1XB8A 1OCRB 2IDFA 5I6PA 2YAOA 2XV3A 1J9RA 2AFNA 3TASA 2VSKB 2BW4A 1ADWA 3BVDB 2HX9A 3ABMB 2VW4A 2IH8A 4BDVB 1ID2A 1AANA 3DKHA 1KV7A 1OE1A 5FC9A 1E5ZA 4UF7C 2J5WA 1MDAA 1A3ZA 3S8FB 1ET7A 3NJMA 1JZFA 3GXUB 1JXDA 2PP8A 2YQBA 1JVLA 4NERA 1ET8A 3NJJA 1NDTA 3AG2B 1OCCB 3NSFA 2AVFA 2XV2A 2IWFA 2DYSB 2YAPA 4N4YB 1ZV2A 5TK4A 3ABKB 1NIEA 1SF5A 2CJ3A 1BAWA 2MRYA 5I6NA 4G72B 4DP8X 3T9WA 1SFHA 2XYBA 3EHBB 1PLCA 1VLXA 2CUAA 3PAZA 4E9XA 3JTBA 2YAQA 1BEXA 4YSPA 1OOWA 1ILSA 1PZBA 6PCYA 2PP7A 1A4CA 5B1AB 2CAKA 3IEAA 2YAMA 4BWWA 1SNRA 2IAAC 1CYXA 1UATA 1PAZA 5AZUA 5B7EA 2IDUA 2VW6A 4E9QA 5PCYA 4JHUA 4W9ZA 3NP4A 1KBVA 4E9SA 1IUZA 1HFUA 1R1CA 4AKOA 1E65A 1A4BA 3WKQA 2PPFA 2DY2A 4A68A 3FT0A 4GP8B 5B7MA 2YARA 5I5JA 1NIDA 1AZBA 3FPYA 1A4AA 3HB3B 2UXGA 1CURA 1L9PA 2XU9A 1J5CA 3QJSB 1L9OA 1QNIA 3WI9A 5AFAA 6PAZA 2GB2A 2HZHA 4UAHA 3QJRB 4WTQA 3S8GB 4HHGA 1AZRA 7PAZA 1ZPUA 3FU8A 1ZIBA 2WO3B 4F2EA 3G5WA 4A2DA 4A2FA 5B3SB 3AG1B 4GYBA 2HX7A 3WNJA 1BXUA 3ASNB 2HXAA 3FS9A 4AZUA 2AZAA 4X4KA 3IN2A 2VM4A 5I28A 5B1JA 4E9VA 1V10A 2IWEA 1PF3A 1IKOP 1AQ8A 1L9TA 1OV8A 2R7EA 3NJGA 3PXLA 1AS7A 4KO7A 2PPCA 1YLBB 2FQGA 3NJIA 1QLEB 1JXGA 2BW5A 2XX0A 3CVCA 1BYOA 3X1EA 3WNIA 3FU9A 1JZJA 1X9RA 3IE9A 5D4HA 1SJMA 1J5DA 3CVDA 4YVUA 4G7RB 1M57B 2BO0A 4ZK8A 2J56A 2YAHA 1F56A 3FYIB 1IBZA 1FA4A 1KCWA 3V9CA 1T5KA 1BXAA 2GHZA 3CZUB 2BHFA 2YAFA 1E30A 1WS7A 3SBPA 3CVBA 1OF0A 5I6OA 2OJ1A 1GYCA 1X9UA 4YSUA 1NIBA 4KO5A 2BP0B 1AIZA 1AZNA 3FSAA 2B3IA 2CCWA 2OCCB 2FT8A 3U25A 3RYMA 4DP4X 2AANA 3TBBA 5B1JC 4DP1X 2UX6A 2XX1A 2E86A 1GSKA 2XV0A 5B1BB 2HX8A 3PAUA 2EINB 4BK5C 3PAVA 1GY2A 1OE3A 3QJUB 3H4FA 3UADA 1OE2A 4AKPA 2JFCA 3FU7A 3FYEB 3CG8A 4HALA 1XMEB 1ZIAA 2YXWA 1JZEA 3AG4B 3AY2A 1I53A 1CUOA 2XVBA 1E5YA 5ANHA 4E9WA 1NPJA 4ENZA 1SF3A 3SBQA 3T6XA 3SQRA 1WA2X 2QPEB 4HCFA 5F7AA 3PPSA 4YVNA 4YSTA 1WS8A 4UANA 2J55A 3GDCA 3KW8A 4E9RA 2UXVA 5I5IA 2X88A 3IN0A 2XLLA 2FT7A 1PCSA 4BWTA 3T71A 4BDVA 3NJFA 2P80D 3X1GA 2FTAA 4KOBA 2LLNA 4Q89A 3X1BA 1W6LA 4G7QB 2B08A 2UXFA 2J57A 3PLYA 2NRDA 3FQ1A 4W1TA 2EIMB 1KCBA 4A67A 1ZDSA 2N0MA 1GW0A 1TKWA 2H47C 2QPDB 3OMNB 4DP9X 2MTAA 1URIA 2Q5BA 1KYAA 1L9SA 2UX7A 4HZ1A 1A65A 1HAUA 4DPCX 3NJLA 1M56B 3FSZA 2GSMB 3UAEA 3GYRA 3WIAA 4CSZA 4RH4A 5I26A 1W6WA 4HCIA 1TU2A 2FQFA 2FQEA 2VN3A 4DP5X 1SHXA 4QLWA 1SDDB 2YAEA 1HAWA 4YSCA 5IY5B 1BQ5A 2XXGA 2VM3A 2I7SA 4KO9A 4AKQA 4A66A 1BYPA 4E9YA 3HEIB 3TA4D 4WKXA 1N68A 1IC0A 4DP6X 3EH3B 3C75A 2P80A 4FA7B 5I5MA 1RCYA 1PMYA 4DPBX 4CSPA 2PPAA 3NJHA 1GR7A 4E9TA 1AZCA 2Q9OA 3OMAB 4HHWA 2GBAA 3T6VA 2GIMA 2GC7C 3FSWA 2HLEB 1NPNA 1SFDA 1ETJA 2RACA 4BXSV 3H4HA 2ZXWB 4YSEA 4L0PB 3SBRA 1JZHA 3OD3A 3NJNA 1MZYA 2XWZA 2EIJB 3TU6A 1AS6A 3ASOB 3ERXA 5A7EA 1AAJA 3DTUB 2CALA 2QDVA 4HCGA 4DPAX 1RZQA 4M3HA 1CC3A 1WAEA 4KNUA 3MBWB 2OV0A 2CBPA 1XB6A 1WA1X 3OM3B 2I7OA 1ILUA 3BQVA 2YXVA 2DV6A 2Y69B 3X1FA 4G7SB 3CDZA 2FQDA 2VSMB 5D4IA 3OMIB 5PAZA 3ABGA 3EF4A 3QQXA 4NAJA 1J9SA 1MG3C 4DP0X 3X1NA 4BXVA 1EHKB 3FQYA 5EHFA 1PLAA 2DWSA 1KBWA 3FSVA 1NIFA 3S3CB 2Y1AA 1AG0A 3DIVA 1RZPA 2VMJA 3ZDWA 3N2JA 2DYRB 3S3DB 3L45A 8PAZA 2QT6A 4A2GA 2BP8A 2GC4C 1J9QA 2QDWA 1OCZB 1JZIA 2JXMA 1NIAA 1TEFA 3WKPA 2BP0A 1NWPA 2FNWA 3H56A 2IDSA 4N8UA 3NSYA 4DP7X 1JOIA 3UABA 4AI7A 4YSSA 4YL4A 5I6MA 1PLBA 2WO2B 1XB3A 3FQ2A 1PZAA 1ASPA 3QJVB 4GP4B 1GY1A 1DZ0A 3WG7B 2IH9A 2BZCA 1L9QA 3NSCA 1MG2C 2IDQA 1RKRA 1OCOB 3UACA 2IDTA 1N70A 3X2QB 5D4JA 3UAAA 4AX3A 4QKTA 5B7FA 4F7KA 2H5UA 1SHWA 1KDIA 1PY0A 1AS8A 4YSOA 1DYZA 3EH5B 1QHQA 5I6KA 2JKWA 4GP5B 2H3XC
chains in the Genus database with same CATH superfamily
3HAEB 1JXJA 2CM5A 3VSUA 5ICZA 2H9GB 4JM0A 5AVTB 4A7GA 2RH0A 5L8JB 1F90H 3OB0H 5AKRA 5K93A 4KQ4L 3VXQB 2BWDA 2LW3A 4GQRA 2BIPA 1I7ZA 1SLUA 2DMHA 4KI5F 5D7SL 2X2JA 5IB4B 3C9NA 3IBOA 3NFPB 1IQDA 1WISA 3FO2A 3OKEB 5CMAA 3LHAA 2NSMA 4A1RA 3ROOB 1O9WA 3IDMB 1ZY9A 3NAAH 3MJ7B 5B38A 1MFNA 3FU5A 1XD1A 3S36L 4EKXA 4IHBA 3V79C 1A6AA 3U30C 2XY2A 4OTXH 2IFFL 3QQ3A 3HFML 5CUSH 3MNZA 3N06B 3LEVL 2CR6A 2Y0SA 4OLUH 3V6OE 3ZSSA 5BOZG 2XPGA 3C8DA 3F7QA 2IBBA 2A9NL 4OJFL 4J3BA 3K2IA 5DRWB 4DH2A 2WQAA 3SYOA 3TYFB 4CC0A 2Q7AA 4MCYA 1S2EA 1J12A 3APNA 2FEEI 3Q6GL 5AL8A 3E7JA 3AT9A 1OD9A 1LMIA 3PFUA 1EO8L 1RK7A 3K3QA 4NP4L 4ANWA 3UJIL 3MLPA 1NBYB 4TQEH 4JKLA 5AW5B 4I77H 4XZUB 1TCMA 3VFPA 3WTYA 4U3XA 2A38A 4LLUB 4QRAA 1FFOB 2R2HA 4GXFA 5JXEC 4AQOA 4MKTA 1SXNA 4KJPD 3UTTB 2V7NB 4Z77B 1DDHB 3BIKB 3CC1A 3VSVA 4KKLD 1NUGA 3AG3B 1N5YH 3ZYZA 5KTEH 3MA7B 2DQTH 3ZX1A 4Y2DC 4MAUH 5FUOL 4FTVE 1WBZA 1BZQK 3UEZA 3RTQA 4NQTA 4A04A 3TPUB 4JG0H 4P2OD 4KTYA 4H8VA 3DX3A 3KLSA 2NT1A 4L9DA 1SVZA 3FB6B 3TO4B 4CVZA 2OW6A 2R1WB 1DVSA 2WO4A 4DO6A 5EZIH 3BT2H 3TCTA 3KW7A 4BD4A 4WUUE 5IB2A 2YZ8A 4PY7B 1K8DA 5IM7A 5A2LH 5ISZD 3WS6C 1XF3B 1N12A 1UB6A 3MRMA 5CJXC 4ORGB 3GT6A 5DJAB 2GT9A 1T2QH 4PWHA 1KXTB 2WWKT 5FHAL 3ECBB 4WFGD 1AD0A 3UROR 4L3AA 1Q9OB 2J5WA 3OSKA 1SYVB 5KUMA 3EO1B 3QQNA 1QW8A 4FRWA 3FT2A 3KL5A 3S88H 3ZTCC 5T33L 3CU1A 1A14L 3HVDA 4PS4L 4BSJA 5C09A 5GGVL 1OCCB 1I8MA 1TPXB 4MCNA 3H9SE 3EFDL 3R1GH 1JDAA 5DMGC 3UC0L 2CGRH 3ZKSD 3QO0A 1IU1A 3GEWB 4BIKA 1D5BB 2W0LA 3MV8B 4OJEH 4N1HB 2NY4B 4R5VA 2R1XA 3PWLB 5E8DH 2BHYA 4TLTA 1KGXA 4X5PA 3SOBH 2Z8VC 2YAQA 3FCTB 2L3BA 1DBBH 4R96A 3VGAB 3MLWL 3MR9A 6PCYA 1BEYH 4J4PD 2A9AA 2FLRT 4RA3A 4ZFZA 2GUYA 1U92A 2YSTA 3MV01 1JGLL 4PRHB 3V4LA 2ICWJ 3PGDA 3HG0A 2D3JA 4UAOC 3VA2C 3VM5A 3M1OA 4WAFA 9CGTA 3TBSB 5C0JA 4JJ5B 2YC1B 3RPBA 2VLLB 4KVPA 3K81A 4WWKC 2V9UA 2YUZA 1BHGA 3SYCA 3I6SA 1MUJA 1Q9WB 1ZWIA 2ZCKH 3AUWB 4F58L 5GRYA 3WO4B 2W38A 5I5JA 5IBTH 4PBVC 4WJKB 4EZKA 3FB7B 5DLMH 3K1DA 4UDTA 2DQHL 4DQAA 3G7TA 4M48H 4UZGA 5EO0B 1QFWH 3TV8A 4EDXB 1IX2A 1N59A 5DD1L 1FIGH 4M43H 4ABQA 3S2AA 4XPTL 5JPMB 5HHXL 2VN7A 4K71C 3U1SH 3FL7A 1L0PA 1NFDF 1HL9A 2XG5A 2Y5QA 4JRXE 4MD0A 1HCVA 3O3DA 4XGZB 3Q7JA 3JUYA 3B9VA 4S11A 1GPOH 5H2BA 4X6CA 3W81A 4GBXB 5E1AB 2AABH 2YD2A 3GSXA 4WWNA 3BVNB 3GMMB 1JZ5A 4MAYA 4MXVF 1RZIA 4OGYL 3CX5K 5CZRA 3Q8AA 4PJEB 3QWOB 4KROD 5CZVH 5I1JL 1C8PA 2AQTA 1GMIA 2HT2D 3P1VA 1CFNB 1J88A 3ZQ9A 2VCOA 2IAMB 3L17A 4KJWC 2XWXA 3EUDA 4WI2A 3KVPA 1L0YA 4W4OC 4QHKJ 3E0GA 1CG9A 2EE6A 3REVB 3X1EA 1IFRA 2Y1ZA 4RGOL 4XVSL 1XGUB 4DCQA 4NNXA 3RA7L 5AAWC 5BXFB 1ADQL 4IW4C 1VACA 5DD0L 2I9TB 3A21A 2HFEA 5AG8A 2NW3B 3I3BA 4WW1A 3S36X 4AGOA 3D30A 3NEOA 4LASL 3KCWA 1C9SA 2DOCA 4ZMPA 1U21A 2ROYA 3P9LB 1QUNA 1TYRA 3MLZH 1BXAA 3RWCB 3NIDB 4PBDA 2R29H 3SBPA 4AJVA 1KACB 1V05A 2HLFD 2NXZB 2WYTA 3A6CH 5EV7A 3U2JA 5I6OA 4AE0A 1XTMA 1ZVHA 3FULA 1VCBC 3RAJH 4M5YL 1JZ8A 1RQ5A 5JW3H 4LNRB 4TNGA 3MRHB 5HYJE 4WKZB 1HWWA 3PY9A 2B3IA 4WO4D 4HX1A 3U25A 1TMQA 3OKKA 2BPBA 4LT7A 4Z7UA 2NXYB 3WXWL 4WFHE 1EANA 4LBEA 1CU4H 3RLSA 1H5BC 4XB7A 3RUGE 3HG1B 4HUUB 4HEME 5JMOC 4X6EB 5GS1C 5F9DC 4JFOA 4ZD3L 5D2LF 3FZUC 5H37A 4HV8B 2JKIS 2D7OA 2NY5L 1A8JH 2GVYA 2HFGH 4IRSD 5DS2A 4Z8FH 2VDRB 2NLJA 1QYGL 2XSKA 2XPYA 2LGNA 4M7ZB 1CZ8H 3CSTA 3HCVA 3PIQB 3CG8A 5CD5D 4HALA 1A5FH 3ZZ1A 4PRBB 2E9IA 2QKSA 1BVNP 1CXEA 1EJ6A 2PN5A 3PWPA 1A4KA 1FHGA 1VKXB 3T0EE 3G5YA 1BLNB 3ZT7A 3NCEB 3O6KH 1XR8B 4TLSA 4LK4A 1INEL 3KPLA 3WNKA 1J0HA 1KGWA 4P3CL 2GFBA 3QEHB 1AZZC 2O6CA 2OXHB 2J55A 4KTGA 3QJHA 4U6YA 4KHXH 1Q0YH 3CXFA 3GO1H 4RGNC 1KXVA 3RWHB 5BVPL 1LMKA 3WGUB 3BHBB 4TUKL 5F0JB 4PJ9B 3M7OA 3MOQA 3B2XA 4LVEA 4PJCA 3L95A 3V6ZA 3IWUA 1UUSA 1IARB 1UZ6E 2EEXA 1A1MA 4M8QA 2VJ8A 3K6NA 3CZNA 3V0HA 3O4LE 1U3ZA 1OP4A 5GGTA 1QNZH 4ZYKB 4JRYB 1KXHA 3HB3D 1XGZA 3KEDA 1URIA 4KDTC 4APQB 5BO1L 1NGXA 3KPQB 4OFPA 4DPCX 5EU7E 2UY6A 4PGEB 3OAYH 1MW2A 1CDCA 1UASA 4HWNA 5J6HA 3OHXB 1W6WA 4G3YL 3FFCD 2YKLH 3IXAA 3KWXA 3CFUA 4E9LA 4I5BB 2I60L 3FRUB 5EZJB 4XC1H 5DK0B 1BFOA 4UBDD 3OJMB 1QTSA 5JHLH 1DANT 1OGPA 3HZVA 5DO2D 3U79A 3NJVA 1N0LB 2Q2EB 3NCJH 5DSCA 1HINH 1QFWI 1E6JL 3O11A 1AY1H 3FQWA 1TDQA 4XNMB 1WC7B 1TETH 3MUHL 5D8JL 3PREA 1BFVL 3CFDA 1FVEB 4PGBA 4S1RH 5HJ3B 5K59F 2BFGA 2XRAH 1YPZE 1TUPA 2GTWA 4AGLA 4G6KH 2N3JA 5G2NA 3AUVA 4LLAA 2JB5H 2PPAA 2NOYA 3INUH 3O3EB 2BSED 3HZ3A 3HI5H 4B6ZA 3BSHA 1CQKA 4DKDC 4NO3A 3WN5B 2DL2A 1U93B 5E5UB 1E90A 4WWOA 3VFTA 3IJYB 4R5XA 2V5SA 3UTZB 3OWEA 1P5UA 1DVXA 3C08L 4LIQH 2AMUA 5BV7B 1YYMH 4YX2H 3MRBA 4TSCH 4NQQA 4ENED 2FYVA 2J8UF 3DA0A 1RY7B 2A99A 3DYPA 1S7VB 3QUML 1L7IH 4R2GC 3BH9A 4ZG1A 4BH7A 2NY6D 3FTGA 4MD5B 1H3VA 1P7KA 3A5VA 3B6SA 4HUWA 5IW6B 3O81A 3K71B 3MBWB 5FKAA 5AEAA 2ZP0T 4AEHH 1DDTA 1W0WA 3QNYB 4MXQD 4I18B 1TYJA 3LN5B 4M00A 2ZCLL 4JL1A 5F3FA 3P2DA 4JFXB 3QDAA 4PHZA 5DHYB 4NENB 1R3IH 3H3BC 3FTYA 3ZL4H 2NY2C 5FCUL 2IPKA 3ZRSA 1IBDA 2ZZUT 4LDCA 3WCYA 1U3HC 4OAWA 3SOTA 4OCMC 3BP7A 2ADGB 3F84A 2ATKB 3UYPB 1DVFA 1O75A 4N2GA 3O6FD 3SE6A 4PEEA 3ULVD 2ICWI 4GI8A 2AQ2A 4P2OB 4Z7WE 2R2EB 5L4JA 2X5PA 5FA4A 5ETUA 4L5FE 3APDA 3DDFA 4A2GA 3U82B 5FK9A 5BRPA 1YEIH 1WG3A 4FLOA 1S7TB 4G80B 1D6EB 1ACXA 4WLCA 2VL5B 5FO2A 1RZFL 4JFFA 1ZS2A 1WITA 2G60L 1MQ8A 2LFEA 3VXPB 4DGYH 1UD5A 4ANVA 2DI9A 2FSEA 5ISZB 2L7JA 3UABA 3KLHD 5FEBA 3DV4B 4XP5L 4XNYL 3P4NB 1T0OA 3QCVL 2C3XA 4XOCA 3VDAA 4NXKA 5D2NE 3HE7D 1I7RA 1B4JL 4YHPB 4A37A 1U91A 4OF0A 1YEEL 2K1MA 3M6DA 1HSAA 3MLXH 4XXWA 4AM0A 5JOFA 3HKFA 4NQVB 1DQJA 3OKMA 3PGFH 3JTSB 2ICEA 1FDLH 2YPKA 4NIYE 1BQHG 3I74A 4AEIL 4XH2A 1NQBA 3S34L 2KZBA 3MRGA 4KUZL 4U4BA 5F0MB 4A6YL 4DZ8A 3GB7A 4JFDA 3N9GL 3APMA 4XNUH 1TEGA 1VA9A 1WFIA 5MP6H 4QHKI 3GKZA 4GKLA 1BM3H 5IMMB 5CS7A 1SHSA 5C0NC 1A6TB 1YEJH 2G2NA 1JHLH 2X3CA 3RIAK 5DJYB 4JN1L 4JVPA 2IGFH 2ZD0A 3PWUA 5EEWA 1B4TA 2YGQA 4G71B 5I16A 1A7RL 4NI6A 1I9RL 1U58B 4K9EC 4AE1A 3QIWD 4BQ8A 2C7UA 2IH3B 3SSGA 1JAEA 2WLZA 3MRDB 4QHMA 4RMBA 1BQKA 2W65B 2MOQA 3F7YB 4Q56A 4PJ7F 2XXMB 1GSMA 4WHYG 1TTBA 4K3DL 1KCRH 4PJIE 4R0LC 4P5SA 1K6QL 5JW4N 3RWFA 1TZGL 4KQ3H 3ORJA 3FFDB 1OPOA 2VC2L 1WV7T 2KYIA 3S3SA 1UG9A 1KIUA 1L0XA 2WYZA 4F27A 5KVEH 1KG0B 5D72H 1NGWB 4JZJB 2Z92A 2NT0A 3KPTA 3EOBA 3TT1L 2BNUA 2OMWB 2IQAA 5T3XH 5IMOB 4JR9H 1E9PB 4WI4A 1OAKL 1T03L 4Q9QH 2I26N 3AC0A 4KROB 4Q9RL 1G9MC 1RZKC 1AGBB 1IEBA 3HRPA 3QG7H 2O6FA 1J5OL 1INDL 1AXSB 4TQPA 2E7CA 2WOYA 5DJXB 1A9EB 5E95B 5GGQH 2WGNB 4NUMA 3GXTA 1F4YL 1ACZA 5IJCC 4QNPF 2VXVH 2WZ6A 1WD8A 5I8EB 1GGBL 1XSOA 3MNWA 4FZEL 1JHTA 2APWA 1LDSA 3LEYL 5D9SA 5F7BA 3F05A 2PPEA 3D39D 4JQVA 2VLME 1CL7H 4L37A 2JE8A 3LKRA 2K6WA 2FATL 4RIRA 4YHLH 1T5WB 4FCAA 4ETYA 4P06A 1G43A 2KDGA 1D5ZB 1G7JA 4UIMB 5TJWK 4R7NA 1KGJA 5L2KD 4OCSL 5I6PA 3VFOA 1FL5B 4LSQL 4ALAH 4GB9A 3LKSA 3UBXA 5ELIA 5ESVB 2HX9A 3QJZA 4TM9A 4G7VL 4B7LA 4UTCA 3BZFB 4NQSA 2I9LA 2FECI 3NSJA 3TA3C 4WO4B 4LE8A 2YD1A 4U7SA 4RRPA 4XCNB 1HH9B 4YOKA 1VERA 2HT3C 2R2CA 4MQXD 2QV2A 3JYCA 4Y19A 3M8OL 1CK0L 4IU2A 4K3HA 3NSFA 4WENB 3B9KC 3OBAA 1K9TA 4Z7IA 3BAEL 2CJ3A 4AYDC 4IRSB 1E3FA 4JFVA 4G72B 1VGEL 1YY9D 2GCYA 3I75B 5HHOD 1SM3L 3GSRA 3AREA 4MCMA 4XBPA 5I8KL 4Y4HD 4ZXBC 2VDPL 2CUAA 4N87A 3P11L 3O8XD 4OW6A 5C0AD 4EXKA 1BEXA 3RB7A 2EDHA 4NO0D 5C6TH 3QEQE 1H6TA 1PX4A 4MX7B 5CU5A 1N2RA 1N8ZA 4NGHH 5HHNA 5FDWB 1QEWA 2YD9A 5I71C 3W37A 4G8EA 2IAAC 2XHNA 5B7EA 1CGYA 1PAZA 5F7NC 2IDUA 3IVKA 4N2DA 2XQYA 2KUTA 5FW7A 4GG8A 1QEXA 2CGZA 2OMTB 4M7LL 1BF5A 4IOSA 1Z1WA 3FQ4A 4NIKB 2IQ9H 4XO9A 3D0LA 1NSNL 3QZWA 4Y9FA 5TDPA 1WCQA 4N0YH 1OXYA 2DY2A 2CGYA 3IT8D 4OFVA 4ZSOE 5LCVL 4U3HA 4G8FA 1GAFH 3GMRA 5C07A 3IRPX 3OKNA 1DFXA 4X6BB 4Z7VF 1TSHA 3UAJC 2LQRA 2VMFA 2QQKL 5D7IE 1YJDL 1KFAL 3HB3B 4D0DA 4ZTOH 4YHIB 2EXWC 2RFXB 3CK0L 5D71L 2OK0H 1W0VB 4AGNA 4GS7B 4TOYH 5EOQH 5LGJA 4Q0XL 1SOQA 3WJMB 4JG1L 5LXVA 3F7LA 5BVJB 3FFCB 3GSNA 3V5KB 1LEGB 4UMSA 1B0RA 4AYID 4ELME 5A1AA 2RGSA 2AV7A 1I3RA 4O2EA 3EJTA 3SEPA 1XCQA 1KLFA 3WE1A 4QJ4B 3O45B 1ZA6A 4NZUL 3MV9E 3NRFA 4XBGB 3NJGA 3MAWA 1CIDA 1PY4A 3EDFA 1MVYA 1QLEB 2CD0A 3FOLB 3GSQB 2W0PA 4N3UA 1FC1A 2OTPA 2HB0A 2VXUH 2HKFL 5TPWH 1OLLA 2R0KL 3M1CA 4AW7A 2BNQE 2X4RA 4ZMTA 3CVDA 2FJUB 2CKNA 4NDMB 3EO9L 4FNPA 3HE6C 4F9PA 1YG9A 1DEDA 1M7IB 2IBGA 4R7VA 2FGWH 1I7TA 4HS3B 4AC2A 3BRGC 1XF2B 2R0ZH 3L3GB 2A73B 1XIWC 2WMPA 3US9A 4K7PL 1L6ZA 4FNRA 4PP1C 4UT6A 7TAAA 4O51A 1G6RL 3UP6A 3SIKA 1DQML 1AJ7H 2ZUXA 4S0HA 1KELL 1U8CB 1W72A 3NA9L 5KVFE 4GG6A 2WXPA 3V52L 1R3KB 3KLAA 3MREA 1LO0L 5IBUB 4NS0A 3LS5H 2G5RA 3D0VB 1CL7I 2NY6B 1FG2B 1FVDB 1EBAA 1USZA 1G1CA 1SDYA 5CGBA 2VAJA 1IC5L 1LTXA 2ATAA 5A2JH 5JIIA 3DUUB 5B1BB 1BA9A 3N43F 1R5IA 2HX8A 4LKCB 3V6FA 4FQIL 3L4TA 1BQLL 2NCMA 1SUHA 4AKPA 4WEUD 1CFQA 5LAXB 5ACMA 3U7AA 3MX0A 2FUTA 2BIHA 1C5BL 3OG6B 3OR6A 2YD5A 4MVBC 3VD5A 2BNRD 5GJSL 2AXHA 4AL8H 5TFSH 2RJMA 3QPXH 5F93C 1T1XA 5C71A 3O6FB 5E08L 3N6YA 1MAJA 1QP1A 3DVGB 4E9WA 5HY9B 4ENZA 2MCPH 4DEPC 3SBQA 1J10A 3IMSA 2DLTA 3GMLB 5SX5K 4HCFA 4GAJL 1ZLSH 5I1IL 3QISA 2VXSL 4R26L 3NFNA 1P0SE 2CLRB 4E9RA 4IIQA 2WXKA 4LAQH 2H1PH 5EUKA 4AV4A 2FT7A 3VXOB 1FL6A 3PXJA 5EH1A 4JGNA 3P02A 1YUHA 1JYWA 4FMVA 1S9KC 3BD4A 3B2UD 4ZX3A 3GJFA 1FV1B 1A0QH 2N7SA 3PHAA 2X0WA 5CLZA 1ZVSB 3OGCB 1DQQB 3ESOA 4L8DA 3PWVA 2H47C 3UERA 1TSRA 3BFOA 2MTAA 3HE7B 4JO2L 5GJTH 5KG9A 1NFAA 1PKQE 3K72B 1HEHC 3EG9A 4GAYA 2L7QA 1JP5A 1NCNA 1WGOA 3PHQA 3MO1B 3GYRA 4Q97A 1XF4B 3DPBA 3VXME 2CR3A 2R23B 4YHYC 1M7XA 4DP5X 1LEIA 5F7KC 1KCVH 2B1HL 2FEDD 2OFQA 3ETBJ 3QI9D 4QHUA 4WDIB 5C6PB 5LNEA 4LPVA 4GINA 1Z9LA 1EGJA 3S6CA 3GJEA 3CLWA 5C0FA 2H9GA 4RETB 3V10A 2NQDA 1N9PA 4KK6D 3T3MF 3TT3H 4QHPA 4X98B 4WNJA 4N8VA 1HU8A 3NH7H 4NNPL 4K73A 5DDHB 5IB4A 2EYRB 2PW2B 1A7QL 4JO8A 4N25A 3EDKA 4HBCL 1G6RA 4HUMB 4NQCD 1E4XH 1HVXA 4UMGA 4YNYB 3MRLA 3RGVA 4J12A 1YMMD 2WLLA 4G42B 3KLQA 4L2LA 4Y5XA 4HXBH 3ROOA 4ADIA 3HMXL 5FX3A 4D9LL 3N85H 2GBAA 5D6CB 4NT6A 4GSXA 4LCYB 3IGUA 3QRGH 3QIWB 4Y16A 2CA3A 4I13B 4LOEA 3D9AL 2O5YL 3TZVC 3RZCD 1FC2D 2EZ0C 4N9GB 4AEFA 2WWMC 4RESB 4U6HB 3TC9A 1HZHL 5DRWA 4JJHA 4Y9GA 2WLHA 3BAJA 4KTEH 4RFOL 5IIEA 1PZUB 5J6GB 2VABB 3HUJE 3I84A 5EOCJ 1AS6A 1VESA 3DPDA 5JUEH 1T0MB 1TLKA 3TN0D 2J12B 4BGDA 1CI5A 1MCLA 4HCGA 1K8IB 1HHKB 2ITFA 2ZOKB 4XO3A 4OCXH 4P57B 1NBYA 2A77H 4N1EA 5CCGE 4XZUA 5MENE 4HMCA 3BVXA 2OV0A 4XPHH 4LLUA 1AMXA 3O3UN 3EBHA 1FUNA 4N3TA 2V7NA 4Z77A 3BIKA 2OAAA 3CN1A 4U1SB 4XP9L 2BIQA 4EQ2A 1CN4A 1CTNA 4R97B 3OMIB 3ETBF 2BERA 1N6UA 3MA7A 3DSNB 2WK2A 3QZPA 4LSPL 2PTUA 3HRZC 1MJJB 3L3HA 4PFEA 3GSUA 3FSVA 4Q4EA 4L48A 5EULV 1HHHB 3KEHA 2WP3T 3TPUA 4A55A 1IM9D 1JPST 1NKRA 1MPAH 2XBZA 5E1GA 3MVSA 4KI5E 2DM2A 1IC7L 3DXAE 3R4RA 8PAZA 1F18A 2Y36H 1KLUB 4UILL 2GC4C 1XAKA 1XBRA 3D39B 2QDWA 2OS7A 3FB6A 2R1WA 3RVVD 2BP0A 4WV1B 5L2KB 4CC4C 4TUOB 5JIMA 4Y5YB 1YEGH 5AVQB 4NXSA 4ORGA 4FZ8H 5DJAA 2HVJB 4J8QA 2WLMA 4WI6A 5AVRB 4BGLA 3M86A 3BWSA 1KXTA 3FQ2A 3ECBA 4QOKE 5BUAA 4K7PX 1ONQB 1QACA 5IVXA 2AQNA 1MCHA 3BWAB 2J4WH 1Q9OA 1SYVA 4AW4A 2YZ1A 3EO1A 3GSWB 4HWEL 4PN6A 4XVUC 2KHAA 3IGKA 1M7DB 3MBEB 2GJPA 4YDMA 1HKLH 3UTPD 3NK4A 3EZJB 3QFJD 3IPEA 1YC8A 5HGHA 2OL3L 4U1GB 2Q8BH 2XJKA 1CD8A 3N44B 2XVGA 2Y06L 4RDQF 4YE4L 1KB3A 1J1PH 1UTDA 1K4DA 2DQIH 3MV8A 1GZHC 3B7SA 5HHOB 3ESMA 2FAUA 5I6KA 3PWLA 4Y4HB 4ZO6A 4OZFG 3Q06A 5T3ZE 3O8XB 4JW3A 5C0AB 5I1GH 3VRJB 1SJVA 3FCTA 3TJHD 3KPMA 1DBAL 2IBZX 4NO0B 4KZDH 2FSDA 1AI1L 1U8MA 4HUKB 5AVVB 2OSWA 4KY1H 1S7SB 5EOCH 1IV8A 1KYUA 1T7VA 4PRHA 5HDBF 4QAMB 4ANXA 2XWJB 3OQRA 3KXFE 3QHZL 4YN3A 4GFTB 4Y1AE 3GBNH 2FO8A 1KTDB 1GA2A 5E1HB 3ZUNC 2O61B 2A3TA 4FHKA 4ZOCA 3TBSA 1I31A 4KQ0A 4ADGA 4B53A 2B0SL 4U2ZA 2AXGB 2VLLA 2W88A 1JPSH 1PZ3A 3FUIA 4KDWA 5JOEA 2IOIA 1Q9WA 3NSDA 3P0VL 1V54B 4GXUN 1JNJA 4LCCC 1RIUL 4W9GC 3EDEA 3P77B 3QCUH 2P52A 2BJMH 2X44D 3FB7A 4ACTA 2GPZA 2H26A 1UWEH 4PJFA 5DHXB 4FABH 5HYSG 5KYWB 1E4XI 1H3XA 1N19A 3BE1L 4FXTA 3D18A 5DJ2A 4DKFH 5E4AA 1AZUA 3VD2A 2QPSA 2J25A 3GNML 2YFOA 4LVHB 3V9EA 3CCHA 5JPMA 1L9RA 4NAQA 1SEQL 2YLHA 1GGCH 3DHMA 3RI5F 1KTLB 5DMKA 4PJHA 3ILEA 4ONFL 3OJ2C 1BX2B 1EJOH 5F0PB 1ZHLA 2CDEB 4Z9KB 3CLEH 6FABL 1DLHB 4XGZA 4OLYL 4XO8A 1MCIA 2ZOOA 2DM3A 5E1AA 2VLJD 5CNHA 4WFFD 3GMMA 5ES4B 25C8L 2R69A 3ZDZF 1OAXH 2ENJA 1M9WA 3FO0L 4PJEA 3QWOA 3VJ6B 4F7EB 4HA1A 5GRJL 2MJWA 3LRKA 4LLVB 3O2DL 2VN4A 5ENWB 5LKNA 4U7MA 1JERA 4L4TD 5H94B 5IVNA 2IAMA 4MMZC 4UB0L 2JB6B 4W9FC 3REVA 4I87A 3HPLB 1G0DA 2QSVA 3Q3GB 1XTLA 1H9DA 4ONGH 1XGUA 1Y6NR 1GYVA 2DWDA 2ZCHL 2C1PA 3QWRD 4JKKA 4KO6A 4PJ6A 1ZTXH 5F44A 4RZCB 4HSQA 4F2MB 2I9TA 3OKDB 4HIPA 1C12B 3VW3L 4JHVA 3MLSH 2YUXA 2NW3A 2VOTA 1W9XA 3FOMA 3EH4B 1TR7A 4RGNE 1G9EA 5JO5A 4TVPH 5DUML 1T3FA 2G5BB 4YWGH 3K2UL 5INDB 3K8LA 2WVUA 4WUKL 2F61A 3EJJX 2HAZA 2DEWX 2IH8A 3DRTA 1IT9L 1RVFL 1T83A 2J2ZB 4FULA 1PG7L 3N42F 3ALPA 2NNFA 1D6VH 3RFZC 4HKJB 1BIIA 4WKZA 5IOKA 4B95C 1DANU 3AACA 4FNTA 3ZKNC 4ODUA 4HJTA 3FKUS 4JFZH 2DI8A 4U1IB 1D9KA 1DP0A 4F9LC 4LCUB 4E42B 3O9WC 3D2TA 3HG1A 4HUUA 3RPIB 2WXOA 3VQ2C 4HWBA 2FLBT 4X6EA 4OIFA 2AJYH 2ZX5A 5D1ZD 3K2KA 2VH5H 1I85C 2V9TA 2WINB 4I1RA 2YXFA 4HIJB 5TK4A 4HV8A 2XYCA 1NFDE 4WIQA 1BFTA 4Z7AA 4OT1H 4URTB 1G9NC 5CP3A 4H20L 5B1CA 3UMTA 2WAHA 1PLCA 2BNRB 3PIQA 5FXCH 4PRBA 5E9DE 1HIML 5D7HA 3N1GC 5F3HA 4D3CL 1X4ZA 3DX1A 3ARBA 4EUPH 1IGML 3FHQA 3GPEA 3WEXA 1MCJA 3FQUA 4JNXA 4XX5A 1OOWA 2EXYD 2WWOA 4Z3FA 1XR8A 5D7JC 3UC2A 3R4DA 1RZ7H 4AMKL 3QEHA 1KPUB 4N0UE 2VW6A 1NM9A 3S5LB 4RDQG 1FNAA 1OARH 3RWHA 4JN2A 2B77A 4A2MA 4W9ZA 2VZUA 3BHBA 4BZ1A 4PJ9A 1HH6B 2WLJA 4R90L 4FTVD 4J7RA 3DIFB 1IILE 4JKPH 2D7TL 3I50L 3CLFH 3DX6B 1MW0A 2BCKB 2APXA 3GBML 4KJQD 4U6VH 3S97C 43CAB 4A68A 5B3JF 3IFNL 3VFMB 3FPYA 2AJ3A 4TULL 1MCOL 4BV1A 5IHBA 3H6AA 3H6JA 4ZYKA 5C08E 1H15B 1WTLA 3I9GL 3OQ3B 4ZTPH 4APQA 4ODVH 2ZNWA 3CPLB 3KPQA 1W2KT 2AJXH 3H7LA 4WUUD 4YHMH 4PGDB 4B9CA 4F7CB 4PGEA 1CFTB 3GTNA 3WIFA 2LABA 2PR4L 1Z9MA 3OHXA 2VMDA 4EAEA 8FABB 4LVNB 4HHGA 4ZUUA 3K6FA 2DZEA 4I5BA 3FRUA 3HOGA 3OSVA 3AQDA 3QI9B 4ZQKB 4GYBA 2OKMA 4I9WE 4N8CL 1J1OH 3B8YA 5E51A 3T2PA 4TF4A 3UG4A 4QWWD 3I2CL 4I89A 4Q7DA 1YNKH 4GPVA 3QGVA 3ZHFA 1WJ3A 4FMFA 4JFHE 1RMFH 2XNAA 4XNMA 1WC7A 2FQGA 3R0MA 5JQ6H 2CKBB 3H9SD 3U2SB 4NQCB 2UWEF 1YQVL 1CF1A 3F6LA 2PR9A 1YMMB 1E4WL 2X40A 3B9AA 1JZJA 4JRWA 1DQKA 4P99A 2X1QA 4MA8H 3O3EA 3IMRA 1W15A 2ZCZA 4G1MB 3EYFB 4P5TD 5LJYH 3NG5A 3WN5A 3ZT6A 1U93A 5TGBB 1MEXL 3RZCB 3IJYA 1R24B 2DWYA 4OQTH 3UTZA 4Z78A 1N10A 1WEJH 4HPOH 2JXMB 3BVWA 3KM1A 1E8ZA 2CRIA 2F8OA 1DJYA 4UV4H 4U6XB 4UT9A 1CFSB 2OCCB 1P6FA 3O6LL 5DRZB 3TN0B 4D0BA 1G7IB 4ZMVA 1OB1A 4DAGL 4MD5A 4IKLA 3H7BB 2F54E 2VR7A 3K71A 1N64H 4NKMB 1KY7A 4I18A 1GSKA 2XV0A 3LN5A 2NZIA 1UM4H 2G3MA 5FKPA 4JFXA 4X5WB 1CR9L 1VZHA 4HZLB 4JLRB 5DHYA 2VSCA 4NENA 5FM4A 2O6DA 3PWJB 3S5ZA 1JFQH 1LM8V 4PJBE 4RISH 3SQBB 3VFRB 3SDDC 4WGWB 1HHGB 1XMEB 4UUJA 1ZE3C 2ADGA 2ATKA 5EO1A 3UYPA 3A67L 2Z0UA 5DUBB 3EKCA 4JRXD 4RDBA 1WT5A 1NPJA 1IGTA 4U33A 3A4AA 4BCYA 4KK5C 4H8UA 2EO9A 5E5LA 4N85A 1K4CB 5J1AB 4P2OA 3CWGA 2R2EA 1IM9B 4BFBD 1P5VA 1WS8A 1X4XA 4XC3L 3FQNB 5K59E 2CDFB 3O4OB 1QASA 1EHNA 1I9IL 2IJ0C 4XVJL 5DS1A 2QJDA 4LQFL 3VXPA 5FHBL 4G7QB 5CGYC 5HVWA 5ISZA 4YUEL 2X53A 3EO0B 2ITCA 4ZS6C 3P4NA 2AS5M 2G4EA 3SDYH 1DSFL 2C4XA 5GS0D 1OP3K 2G9HA 4NJAL 1ZDSA 3VFWB 5LWYH 5E94B 5TQ0L 2CUMA 2G75A 2Z91B 1YY8B 3QS2A 5IMLB 3BXNB 4FFZA 3LH8A 2K9UA 3LNDA 4UT7L 2J8UE 4AUYA 2K0RA 1FFQA 3MROB 2B1AH 5J6SA 5EUOB 4KK9C 2W0FA 3LZFL 2X6MA 1I1AB 1SDDB 1CFVL 1AP2B 1I8IA 4NNYA 5LBSA 2L04A 4DN3H 5HYJD 1H6UA 4EIGB 4EI0A 4NSKB 1TZAA 3LRHA 3S5YA 3RWGB 4A66A 3IMUA 2VN5A 3T04D 2VTFA 4WFHD 5EBLB 4ZFGH 2C1OA 2V6HA 3VE0B 4NQDA 4P9MH 2XN2A 4ZX6A 3TPKA 5IMMA 2QFPA 1A6TA 3OZ9L 3NZ8B 5AW7B 4OLZL 1RULH 2FYYB 4JY4A 5T1LD 3DVFA 4EDWH 5DJYA 3VTMA 1WZKA 4K2UL 1ROWA 2BVQA 2DS4A 1EZVX 3T0ED 1CD1B 1BBJA 1JPTH 1ACYL 2JJTA 2IH3A 5LQBL 3H4HA 2GJJA 3MRDA 3LEXB 2GY7B 3D07A 3U7WL 2AEWA 3DARA 3NJNA 1E5UI 2NQCA 4LPXA 2EC8A 1YMHB 1F58L 1V7NL 1AGDB 3K7UA 4FXGC 4KTDL 3EGSB 2D73A 4NKDB 2PWGA 3CAFA 5CJOL 1MREH 1CC3A 2DEXX 3FUHA 2IOOA 3U6XS 4IBUA 2EXSA 1U4EA 2ZWLT 3VAEA 4J3OD 2WTPA 1KG0A 2QMJA 3O4LD 2ZE0A 4JZJA 1XB6A 1ZAGA 2VLJB 1E3ZA 5L9DL 4K8RC 2E27L 3SGEH 2E9GA 3KS0J 3FB8B 5L4MA 5IMOA 5AVZB 1UEYA 4G7YH 3CQFA 2IF7A 1A66A 1JGEB 1PEWA 4ORZC 1AGBA 3ARRA 1LEKA 3QDGA 4KU1A 3EF4A 1KJVA 4L4TB 1AXSA 1LGVA 1I1YB 2YWYA 5EHFA 1TOXA 4M93C 4KHTL 1KBWA 1SBSH 2BIOA 5F2FA 1RZPA 1SMDA 2D2CC 4Z5RB 1CFMA 5I8EA 5EIIA 4N2KA 1EIBA 1C5CH 1M05B 3AU0A 3WFZA 3GQFA 3UZEA 4CMHC 3MOAL 2ADJB 1LK2B 1EMTL 3K80A 1TQTA 1T5WA 2K3TA 2QGDA 3R7QA 3AB0C 1MRDL 3MV11 3CFEB 1AHKA 3NSYA 1FL5A 1NC4A 5IQ7H 4G8GE 4C4KO 3ZTJG 3V4VB 2WCSA 5SWQB 3V0IA 3RG1C 4KI1A 1JBJA 4NAMA 2P44B 5FYJU 5J4MA 3BZFA 4IBSA 4Y4KD 4CSTA 4LQ1A 3ME0B 1FFPB 4M7KH 4PJ7E 1HH9A 4QRUB 2K9FB 5FYJD 4FQLH 3TL5A 5T3XE 4GAAA 4OLVL 1NL0H 5IJKC 3SPVB 2JKXA 4OCWH 4MMYB 2FIKB 4N2NA 5D1ZB 1FLTX 3LDBB 2R4SH 2OMXB 4TNWF 2GSIA 4IRSA 5J9PB 4LSTL 2X4NA 1LXMA 3I75A 4JUTA 3UG3A 3JT2A 4XN7A 1U3JA 4W9KC 1ZGLP 1IGIL 2LFGA 3U46B 4F91B 3NCYS 2ZXBA 2VDOH 3X11B 1MHPH 3FU6A 5FDWA 1OCWL 4L3EB 2YBRB 3T1FA 4YH6A 2FEJA 1HWGB 4NRXB 1RERA 4WNSA 5J5EA 2X9YA 2CLZB 4XNAA 2FJSA 4KJPC 1OAUL 2WNKA 2YSSB 4QNPE 2OLDA 1M7UA 2WXQA 3M1BB 5L6YH 1LO5B 4N68A 4FTVB 5JHAA 4F5CA 3BKCL 4OB5H 2WVTA 2XQBL 5TK2A 3KS0H 4IRJA 5IFHH 1T04A 4JDEB 1ZDQA 1X5IA 3NK3A 2I85A 5DHVB 3QAZC 5GSVB 4X6BA 1ET5A 1IIIA 4K94C 4QRPE 4AQAB 4JS7A 1T1YA 4RRPM 2QKIA 3LQAC 2C3VB 3OPZL 1ZV9A 3X17A 1W0VA 4WUUB 4ZT1A 1OTTC 3KDPB 4S1QH 4FI8A 3TYGH 1F11A 2BZ7A 2CUIA 3LXAA 1H3TA 3SDCD 3SPHA 1NLBH 2YRBA 4FP8H 1U30A 3V5KA 1LEGA 2M26A 1ASQA 4JFEE 1CGSL 1YZZA 3KPSD 4HU2A 3WTVA 5JMRA 3OKYA 3WKMH 4AYEC 5BOJA 1R0AL 5E2UH 4OZGA 3QCTL 2ERJB 1UOLA 3O45A 4W9EC 3EZ8A 4U1NB 5E9NA 4WTWA 2OYLA 4TLUA 3MACH 3VQ1C 1AQKL 1SY6L 4MASA 2ZX8A 2V4LA 3H9SB 4PJ8A 3FOLA 2R56L 4TQHA 1A3LH 4OD3H 2BIMA 2W9EH 4M3JA 1LL1A 1QO3B 4LAJH 1NWOA 2MTPA 3GUTB 1HSBB 3KE0A 1MCPH 2B8OT 2NQ3A 4MFHA 2OR9L 2PYFB 4GW5B 5IKCA 2ID5A 4ZJ9A 2ZWNA 2DLEA 4NDMA 1KEGH 3SGEI 7PCYA 4N20A 4KITB 2EYTA 4P5TB 4L1DA 4DK6A 2FL5B 3HHSB 4OSUH 4JCLA 4FHBD 3T2NH 1MCNA 1F3DJ 3JWDC 4J6RH 1E3XA 1JXKA 1U3YA 1XX9C 3E3QE 4HS3A 3BVDB 3L3GA 2A73A 4DVRL 3IDYC 3C6LA 1MHHB 5KBLA 1S6NA 3WUZA 3BAXA 1OE1A 15C8H 4UF7C 4Z7VE 4IK6A 43C9B 5KYYA 1R3KA 3F3HA 2GK2A 3MBXH 5EN2B 3LPOA 4X6CF 3TGXA 2XTSA 5BZDB 1FG2A 2ATPB 1RHFA 2HT4C 3AG2B 4O9HL 5DJ0B 4DGVL 3B1TA 3HZYA 4LKCA 3LN4B 4XPFL 3FUMA 5E6YA 5ERWB 1LWJA 1UD6A 3RQ3A 5KVFL 1OLZA 5LAXA 4R7LA 5C0EB 5LAPA 4ZPTB 1OVZA 5L88H 4BSWB 1ZHBB 4XPAL 3IU4H 5KANI 3V4PB 4JRXB 3IDXL 1CGUA 5GZNA 4EZJA 5DR5H 3VI3B 5HY9A 2VO5A 1GCYA 1BW8A 1I4FB 2O5NA 3GMLA 2JQAA 4OLXL 2Z1PA 2JCWA 2X6CA 3PL6D 1I8AA 2CLRA 4LEOB 3B1UA 3VWJD 1VFBB 1AO7A 1CDJA 2FEEL 3MRJB 4JL2A 3LHPH 5DEFA 4B97A 1AGFB 1LO3H 4OF5A 1UACL 1KBVA 3K6DA 3GHPA 3INOA 1A4BA 1HYRC 2PPFA 4LLWA 2EH8L 2Z65C 1CVRA 1MJ7L 1KPVB 4NUGL 1FV1A 2YEZB 4HSCX 5C7ZA 1MVFA 1ZVSA 2DQ6A 3OGCA 1DQQA 2VDMH 5IQLA 2VLMD 3I9AA 3MMEB 4J3TA 3ZK0A 5I1KH 1L9PA 3CQQA 4PWFA 3K72A 4IIZA 2H32B 1L9OA 3BP5B 4J3XA 4RMWA 1OANA 2HRPL 4NP9A 2PWDA 2CPUA 2W9LA 2WSKA 3MO1A 4H1LA 4ZUTA 1HC1A 2Q0ZX 4FG4A 1XF4A 2WNWA 2HH0H 5DC9B 4PS8A 5C86A 3GD1C 1GTFA 5FS5A 2R23A 5KYUB 5IR1B 4MNQA 2F68X 1WAAF 3SGKA 2X2IA 1JZ7A 2BOBB 3QUZC 2B7DT 4G9FA 4WDIA 5HYJB 5LG1A 2DJUA 2X4SB 1F3DH 2AZAA 4QCIA 3IN2A 3P0YH 4WHYH 5DHEA 3X13B 3R18A 4BZ2L 1T2XA 2IWEA 1QRKA 1TLMA 2DQEH 4F20A 3BWZA 5H37H 1OV8A 3RUGB 3PDOA 1S7UB 1O6SB 1S78D 4DTGH 2CRMA 3HNSH 4X98A 2DQUL 2FBRA 2DQCL 2HMIC 1R3LB 1NEPA 1FYHB 1C8QA 5DDHA 5EBMB 2EYRA 1CB4A 2XX0A 4PV8B 3S37L 1FO0L 4YNYA 3SCMC 4OI7A 3BZ4A 4I9XA 4G42A 2WZAA 5T1LB 4PJCF 3MNDA 4JKWA 1PVHA 2VZ1A 2NX5E 3FQTB 5SX5H 4AZ8B 3ZDYE 4B0MB 5ABZA 4FA6A 3QHTC 4NN6C 4KX9A 5D6CA 5HDQH 3T0EB 4LCYA 2EDTA 4OBSA 3BRFA 3QEQD 2WQSA 3NZHH 3G04A 2EJ1A 5A6IA 1EHLH 2EVIA 4N9GA 5I18L 4YQXL 3QVAA 4U6HA 5CLXA 4XCYB 1S9XA 2GI7A 4HEPG 4XPGH 4YSUA 5L7XL 3US1A 3QJFB 4KO5A 5ACZB 1P69B 5EU6A 4HS6A 1YYLL 2ZKHL 3PV7A 5GS3A 4PGZA 4EZLA 5HVHC 5CIPB 3O41B 5LN4A 3MUZ1 2EEFA 1K8IA 4M5ZL 1LNUA 5GGTH 2ZOKA 3AU1A 4MJIE 1MIEH 3WLBB 4P57A 1N8OE 3HNTL 3KGUA 3E8UH 4FQ2L 5KVMC 3O4LB 4NQUA 3OAUH 1EAPB 3U9UA 2BRRH 2DQMA 3W2DH 5ABAA 4DFHA 3H4FA 3BN9D 3LQMA 5HDRA 1UT1A 3VNYA 3UP1A 2FX7H 4U1SA 3R06B 5I1CL 1JV2B 3CMOH 1DBKL 5MEQB 1RJYB 2MIZA 1BQSA 5K1VA 1OTSC 5I6XB 1I53A 1CUOA 1WUZA 1I8UA 1NC2A 2H8PB 4G8IA 1F90L 3DSNA 3AS2A 3GLAA 1MJJA 3NPSB 4O2CB 1GC1H 1HQRB 3CHQA 3T3ME 2CRYA 2GSGA 3L5XL 2XETA 4TLKA 3T77B 5BPPA 1Q90A 4ZO7A 3SKNB 1KLUA 3MV9D 4TNVF 4BWTA 5G55A 1KJ2B 4P04A 1QOKA 2WKGA 1F00I 5I1DB 3NJFA 1KUMA 3VRIB 1V3JA 5HHQB 3NJXA 4WV1A 5L2KA 3AS3A 4P23D 1QMUA 2FH8A 3RY5A 3CH1B 2WVSA 1E8WA 2HVJA 1TZIA 4S1SL 2BNQD 1WPCA 1UHVA 1J0YA 1ONQA 2KZWA 2QPDB 3ZTNL 3NPZB 4Y4KB 3BWAA 1MRFH 2QV4A 4N5ED 4FQXD 4OV5A 4FFYA 3F58H 1JGVL 1ROCA 2PW1B 3B7UX 1M7DA 4M8UA 3FFOA 3MBEA 4DKTA 5DRNB 4LSRH 4JM4L 4TKWA 3FO9A 4TQEL 5I2IA 4I77L 1SHXA 1DJWA 1KWGA 2V5YA 1EBPA 1WHOA 4HF5H 3QWQB 4R4FH 4LOUD 1Q9KB 4XB3A 5AYQA 5HHOA 3KGTA 1CLVA 1JMXA 4XO4A 5CCKL 4J1UA 4Y4HA 1AHWB 3O8XA 4K0OA 4G43B 5C0AA 1N5YL 1DQIA 4HCRH 3VRJA 1KXVC 4NO0A 5E2JA 1M2VB 5KTEL 1OSPH 2DQTL 3C5ZC 3HHRB 1S7SA 4NPKA 4EN3D 3EYUL 3BDXA 1IIKA 3HFFA 2VAAB 2XWJA 3PFQA 4KAQL 4DGUA 4XVTH 1JZDC 4W93A 3BGFC 1S8DB 1G9HA 1KTDA 2O61A 5FW6A 1UOVA 4KRLB 2AQ3A 1DUZB 5ADPL 2VDKB 2AXGA 4FXKC 4QHNA 1H3UA 2JI1A 4QXGL 3WKYA 3AM8A 2COVD 1QRNE 2P1YA 4Z6AT 1J0JA 3FBQA 3OKLA 4BFFA 3P77A 1FG9C 2JKLA 4POZD 1ORQB 5CJ5A 3ZE0F 4ANKA 2Q3XA 1LP9A 2ZWYA 2G4GA 5ACLA 2EIJB 1Y1DA 2B9BA 3QYCA 3CSBA 2CALA 5C0GB 3SDCB 3S88L 1KTLA 4QRSB 1MFVA 4CJ0A 4EVNA 1BX2A 4EKJA 4NC0B 3DNKA 1DLHA 3KPSB 2CBPA 5LB1A 3WYRA 4KUCD 3R1GL 2CXGA 5D2NB 2CGRL 4DESA 2A6KB 2OJZH 2Y25A 1B2WL 1ZSHA 1Y18B 5E8DL 4F7EA 2VQ4A 3Q5OA 1MFBL 4ZNCD 5ENWA 3SOBL 4B9JA 4PLNC 4H2AA 4HU8A 3OKOA 3VXMD 4DP0X 3DOSB 1LE5B 5AZ2H 3CVIH 3FQYA 3T65B 3T2LA 3BRDA 2DJSA 1BEYL 1AG0A 2I07B 2VDLH 3F62A 3HPLA 3B3IA 3ELQA 3N2JA 3Q3GA 3O0LA 3S37X 3KPRD 3B43A 1P5UC 5HDBE 1ZT4B 3G6JA 4HXAH 5JXED 5EN3A 5KBKA 1C12A 5DZVA 3WS3B 5I1EL 1R34A 4GSRA 1J0ZA 2JJUA 3FB5A 2ZCKL 4WTZG 3MYJB 5INDA 2P9RA 3LKPB 1SXZA 4Y2DD 4NWUH 4PW9A 3TIEA 5DLML 2J2ZA 5AOJA 1J0KA 5JR1H 4GXVH 3BDYL 1O0VA 5HHME 4GQPH 4M48L 4BSVB 1QFWL 2TAAA 1K5NB 3DX7A 1FIGL 2MEJB 4LCUA 5CF3A 3BZ5A 1XHHA 4BCZA 1UCBH 3WEAA 4GAFB 2WINA 4FJ6A 5JDJA 4HIJA 3DGDA 1KN4H 1HNGA 4PJIB 4G8AC 5KW9H 3HC4H 1PD1A 5GGVY 2AABL 3SKOB 1J9TA 1UKQA 1L5GA 5DVPA 1S5IH 3MJ9H 1HXKA 4BKLA 3L1FA 3PCYA 1THCA 1MCKA 5CZVL 1XMWA 5MEND 2R59A 3LXUX 2TSAA 4CBPA 3F83A 2OP4L 3HHMA 3QA3B 1HQ4B 3BAWA 3WLWC 2YMXH 1VF5C 1KPUA 3PL6B 4P46C 2Y07H 5EU3A 5CEZH 3VWJB 1RK1B 5DMGD 2BVPB 2WIIB 3DVNB 5GS2D 1ETZB 3MQIA 4LEBA 4B27A 2QGCA 3BESR 4U7KA 2B1OA 1HXYA 3FK3A 5I75C 2HRGA 1KBGH 3DX6A 1WIUA 43CAA 4R3SB 1A47A 3QQDA 1O6TA 5BNXD 4KI5D 1EZLA 3I02B 4C56D 3DXAD 5A2CA 2R29L 2OJEB 4W68A 4XXWC 3VFSB 1MDTA 3A6CL 3MRNA 4BEIA 4NKIH 3MXVH 2WKLA 4HLEA 4DUXA 3CPLA 4ABVA 3HI1B 1FVCA 3O3BB 4PGDA 1CFTA 4F7CA 1RSFA 4K07A 5AUMB 3RVUC 8FABA 4WWID 3F7PC 2EILB 5J13C 1CU4L 5IVZB 4YDLB 4WWKD 3UOAB 1FZMB 5LUMA 4QOKD 4L8SC 3TF7C 4JG9A 3QI9A 4XNXL 5K39B 4LLMB 4ZQKA 2UXTA 1OIOA 2BSTB 1RJLB 1I9EA 4QYAA 1E42A 5F8RC 5LGHH 2ARJQ 1AOZA 4Z8FL 3FUNA 4PVBA 1BD2A 1LWHA 3LH2L 1CZ8L 1MY5A 2DQFB 3LIZL 5IK3B 2H7WA 4UOW1 1RUAH 1BG9A 2PCFA 5B1KA 4GRWH 2MOVA 2X4PB 1WICA 3AZUA 3FU7B 1E9QB 3QQ4B 3QQ9C 5BUGA 5JIDA 3D25A 1QHPA 4RLDA 5C6WH 5T3ZD 1JZ3A 3MYZA 1GGUA 3HS0B 3MPCA 1DJIA 3A4FA 3X12A 4G1MA 3I9PA 2PYEE 1BQRA 5I9QC 1FGVH 2GI0A 4G6MH 3BGAA 5INCB 1BMZA 4IOIB 4UNUA 3RZCA 1EEZB 1MCDA 5DS8B 3TS8A 2QQLH 4ZFOB 1ADWA 1XWVA 2XN9A 3KXFD 3V0WH 4AMXA 3ABMB 3HBPA 1G1OA 4Y1AD 2VLRE 2A1WL 5JPNB 4KJWD 5E6SB 4P48A 5B3JE 1G94A 1U36A 4U6XA 5BQ7A 1CFSA 2BOCB 1E5ZA 4Y5VB 1GRWA 2VITA 3SQOH 5DRZA 3TN0A 1JXDA 1G7IA 2FJGB 4CKQA 4ZSOB 2VDNB 4JPVH 1E4JA 1MCQA 3H7BA 3MLYH 2ADYA 3MRKA 3OF6A 4M03A 1CLZH 2YKLL 2Z35B 5HGAB 4X5WA 4HZLA 3W39A 2VDQB 3U36B 4NQXB 4XC1L 3PWJA 1T7WA 4L1LA 3GSNH 4UU9A 4OKVB 3SQBA 3IDIA 1HHGA 1P4LB 5IJVB 3CSFA 3BW9B 3VQLA 3UO1L 2WC7A 3SPIA 1HINL 3BLKA 4JQVC 5DUBA 3ULUF 5AENA 4AY0A 1AY1L 2MNJB 3HN5A 2NNRA 2R29A 5HDWA 4ELMB 3T3PE 4P4RB 4AQ1C 1TETL 2VM9A 5J1AA 3BSZH 4S1RL 1Q9LA 1KULA 4DERA 3VFUB 2XRAL 1IC4L 3FTUA 5CM1A 3LAFA 4GO8A 2LHAA 1UT2A 4G6KL 2AXFB 3U4AA 2UWEE 3MV9B 5T1KD 4DSYA 3FZUD 2JB5L 4E9QA 2AP2A 4HVBA 1UZ8B 4OZFH 4L29B 3RP1A 1HFUA 3INUL 1P4BH 4ZAKC 3CFCH 5C3IA 4L8BB 1T80A 3A24A 3HI5L 3IPBA 3GKWH 4J3UA 4P23B 2FK9A 4GG6F 4PBXA 3QUYA 3UYOD 4AYFB 4F7PB 3EO0A 1LVEA 5AVXB 5DFAA 5EU4B 1V5JA 1EH9A 3UJJH 4B96A 5I1LB 4LIQL 5E94A 1YYML 4YX2L 4TSCL 3IAPA 2UXGA 4P5KB 5GHWH 2Z91A 4FQXB 5IMLA 1Q8MA 3BXNA 4FLRA 4GKSA 1J1XH 4X0KA 2VN6A 2F9BT 1E27B 4QHLB 4RGND 1QSVA 1L7IL 4MZRA 4UT6H 5DJCB 3AREC 1SUJA 3UBXG 3AS1A 1XFPA 1W72H 1L7TH 1MFCH 1WBXA 2P8PA 4UQDA 5EUOA 1ZPUA 5C0BD 3VXRE 3WE6B 4YHKL 1I1AA 4AEHL 1AP2A 1UWGH 1TIUA 1NCIA 4Z0BH 2JNZA 3EJZC 4HK0B 1H8NA 1XO8A 4NSKA 4AK2A 1R3IL 3M17A 3ZL4L 2YD8A 1RLBA 1A6WH 5LG6A 1YRKA 3BJ91 1UM6H 4QO1B 4PHXA 3H0TB 5ANMA 4EN3B 3H3PL 2SODB 2GK0B 4RMUA 1BV8A 4NJ9H 1MHCA 5H4YA 2LTQB 3NZ8A 4MGXA 2A0LC 2FYYA 1QHOA 3T8VA 4DK3A 2VXTH 1NCWH 1J5DA 4LSSH 4HFUL 2ZSVB 1BZ9B 1Z9PA 4PRIE 5JIHA 4E0RB 2OA9A 1CD1A 1FNFA 1BBDH 4S0TD 5BW7C 2KPNA 2FD6L 4HKBB 1I8KB 1UM5H 2FR4B 3TEZA 4FN0A 2VIRB 5D93C 3CVBA 1JYXA 2ZQKA 5L8LB 5JHLA 5FAAA 4GRLA 2NW2A 5DWPA 2ETWA 4YLQT 4HJEA 1YMHA 1YC7A 4JDTH 2XFGB 4NRZB 1OP3H 5LN8A 2AQPA 5AVWB 5DJ6B 3EGSA 5KAQF 3TBBA 4LLYA 3VG0H 2X6VA 3DO4A 1P9MC 3G6AB 5JHBA 5GGRY 1RH8A 4ZO9A 1RIHL 3MLXL 3S4SG 3U30B 4GT0A 3D69B 5KSVB 2H0PA 4CVWA 5C08D 2W07A 4AV0A 2VLJA 1PKQB 1QSZA 3DO7B 1AGCB 4HFWB 4XNUL 3ULUC 1Z9NA 2EIBA 1XXDC 3VXMB 3BOVA 4L4TA 2X28A 3S5LG 1UEMA 4R2GD 3HAEH 2X09A 1EGJH 2AQRA 3LOWA 3IJHA 4I9WD 1BM3L 3BH8A 3GDCA 4FYTA 3KPRB 4WTXA 2VR8A 1YEJL 4R5TA 1ERNA 1JHLL 1NCJA 3BIBX 3DO3A 2ZYIA 4JZOB 2ADJA 1LK2A 2IGFL 2ITDA 2YQ3A 3ETSA 3QHFH 3JWNC 4NUJB 4NZRH 4KOBA 3AGVA 2NY2D 1PPIA 4H4NA 4I3RH 4V1DB 1U3HD 3CFEA 3L3KA 4Z1PA 3FHEA 1AIFB 4PGCA 3O6MH 3V4VA 4P5MB 4Y2DB 3S3JA 3PWNA 1IAMA 4PG2C 5SWQA 1DLFH 4NHCH 2A6JA 5KSAA 3A4EA 2WOBA 1UWXK 1ZK5A 2A9MH 1FFPA 1KCRL 4WSJA 1WCBB 1CTOA 1JI2A 4KQ3L 4YMPA 3V6OA 5D96C 5I66B 4G83A 1U42A 1U9KA 4MMYA 2FE0A 2FIKA 1TU2A 5FYKH 1OWRM 1EX0A 3JWNG 5D1ZA 1OGAE 3R0NA 5KVEL 2I24N 2OMXA 5D72L 1HDMB 4AXWB 2GABA 4OI9A 3HUJB 5J9PA 2EDXA 3H8NA 3LQZA 1YJDC 3I6KB 5E5RB 5BMFH 5I0XA 5T3XL 3WDJA 4JR9L 4HJ1A 4MCZA 2EO7A 4KPHH 1IB5A 1I8LC 1YNTB 4UQ3A 3F04A 2Z34A 3QG7L 5K9OB 3EXLA 3X11A 3STZB 5ADOH 4L3EA 4FOMA 5GGQL 2YBRA 4YHZH 5FGBA 3VQMA 3IDGA 4F1ZA 5IW1A 1XGQB 1F0LA 5B39G 4O02H 2YSSA 3HBZA 3CHPA 3H9ZA 1EAJA 2WPGA 3B5TA 1CL7L 3M1BA 2B5IC 4H40A 5IVXF 4LRNH 35C8H 4TQIA 3DX2A 1HN1A 2XA3A 3JYBA 4JDEA 4OGZA 3D85D 5DHVA 3DXAB 3OG4B 5GSVA 4C56B 5ID1A 5BJTA 3D4CA 1CD9B 2VUOA 3OPUA 2C3VA 5C0ND 3ASOB 1XXFC 2B4CH 1JPEA 1TZ8A 4OD2B 1XCTB 3P3YA 4UAOB 2EDNA 3RNQB 4XRCA 1Z32X 3MRFB 1UJ3A 2COQA 1MN4A 2SEBB 3JXAA 3KL0A 4QOKB 2LU5A 2LU3A 4GQ9H 5K9QI 3RWEB 2CA4A 3HC0B 1D5MA 3E8VA 3N1PC 1CDBA 5FO8B 4L9LC 3WFBH 1UZGA 5F88B 5FECB 5EBGA 3RGVC 1DCEA 3N40P 4Y5XC 3A23A 2ORBL 2ISDA 2OMYB 3AY4A 2GAZB 3H9SA 5KAQG 2XZQL 5C6TL 1AZVA 1GL4B 4LCWB 1N5AB 4K71B 2R1YA 2QBWA 3O2VH 4Y16C 4FEMA 4NGHL 1X7TA 3FT3A 3GUTA 1HSBA 2PYFA 4GW5A 1EZSA 3ZR6A 4IEFB 1HL4A 4MHHG 2W0KA 1RZGB 3G3LA 3WKPA 4P5TA 2MCG1 2FL5A 3HHSA 1IGFL 4PJFF 4C55A 2F5AH 5CSZB 5DC2A 3T0WA 4AI7A 3S0PA 4GJTB 5I6MA 2CXKA 3D4GA 3I85A 4U0QB 3E9UA 3KXFB 1GAFL 2BRQA 4Y1AB 4UM9D 4QRBA 1PZAA 1GY1A 4X9IA 4NWTH 4PJHF 2FO1A 4MRCA 2E47A 1G84A 3H54A 1NKOA 4ZTOL 1HILB 4FYRA 4LDOB 4XMWA 5EZOL 5HD8C 5C09E 1UD2A 3EYSH 2OK0L 4TOYL 5BZDA 1TVBA 3DC0A 4JPIB 5EOQL 4HOWA 3NRPA 4AM0Q 4F7KA 3Q8BA 3TV3H 4M5TA 4FG6C 2AK1H 1WP6A 3OZKA 5ERWA 3UGEA 2MMXA 2JCCF 4CU7A 1A3RH 3D8MA 1E5CA 4JHAL 5C0EA 1Q1JH 1X5LA 2WHVA 4ZPTA 1TMCB 2HTLC 4Z7OF 2YPVH 4BSWA 3WD5H 5C3LD 2F58H 5AD0A 5D6DA 1QBAA 1BXVA 5I24A 3TA3D 2MOGA 5F7LB 3VI3A 2R69H 4KDVA 4WEMB 2I27N 2NY7H 3L4WA 1MF2H 2HT3D 4CVXB 5DYOB 2WXNA 3ARYA 1SN0A 1H5BB 1R47A 1UQSA 3OX8B 2VXUL 3S3BB 1KB5B 3B9KD 4LEOA 3WXVH 2X10A 5GS1B 2TSBA 5T1KB 4QRRE 1VFBA 3MRJA 5TPWL 1E67A 3C6SB 1E4HA 3GI9H 2CJUH 2R4RH 5EMYA 4LSVH 3PYCA 2DWEB 4ZXBD 4ABUA 1KPVA 1IQWL 4L3CB 1ASOA 1PQZB 3SY6A 2Z9TA 2YEZA 2LLGA 2FGWL 4UWQB 1ODAA 2R0ZL 3VA6A 4ZMQA 3KLKA 2DRUA 3MMEA 1HJBC 3QXTA 1KTKE 2JLPA 4KKRA 2C3HA 5I73B 1AJ7L 3WL9B 1XGPB 4TUUA 2HJLA 4JREC 3BP5A 2NTFB 4RGNB 1DL7H 1JCVA 1MCEA 5I8OH 2DYPD 3L2NA 4L1TA 4G8GD 3OL2A 1VZGA 3CIAA 3JTTB 5E2TH 3ARFC 5C0BB 5KYUA 4X6CE 4PRAA 3SODB 2ODHA 5B8CA 3IU3B 2DIJA 4KC3B 1GS7A 2BOBA 3G5XA 3OJDA 2WVVA 2D0HA 1A9VA 1E5BA 4C47A 3X13A 1IBBA 1IL1A 3ES6B 4HWBH 2WXJA 4LHUA 3UAJD 1AGEB 4ZMZA 5KUKA 1NTDA 3TP4A 2IALB 3C60B 2EXWD 3RUGA 4AL8L 1FGNH 5TTRA 1S7UA 1O6SA 2VDRH 5TFSL 1UXWB 3QPXL 4DQOH 3WUWA 4YSAA 3DECA 1R3LA 1K72A 5EBMA 1NFDB 2AQSA 2MCPL 3KGSA 3UPAA 5DHMC 5ESQA 3L81A 4AG4H 3VUAA 5T1LA 1ZLSL 1J9CT 5J56B 5EORL 5SV4A 2JKRM 5CKAA 4MWFA 2XPZA 3DROB 1URZA 1F86A 2E59A 4R7XA 3DURB 5EC1B 4LAQL 2H1PL 3WNOA 1MAMH 3FF8A 1XZ0B 3LVEA 1URLA 1JV5B 1T22B 3TASA 1IM3D 4OF8A 4N0UB 3UTSE 1A0QL 1QTYT 4XCYA 5DEGB 3VU1A 1ID2A 4KMTL 5ACZA 3MRRB 1KV7A 3GIVA 3GINA 4GW1B 3KPPB 3V0FA 5CIPA 4Z7UE 5GJTL 4YZFF 4BH8B 2YQBA 3ISWA 3WLBA 3OLIA 3HE6D 3VXSD 1ZS8B 3MJ6A 2XY1A 3O4LA 2QLVB 1T6BX 4NFCA 5AG9A 1EAPA 1OW0A 3SPJA 4JHBA 3WJLA 3Q0HA 5C08B 1OF2A 1U8QB 4XNQA 5MI0C 1EXUB 1LK3H 3MRCB 3T8XB 4C8XA 1PAMA 1XIWD 3PWPE 3R06A 4IK7A 4OCYL 1JV2A 3BVVA 4PP1D 1RJYA 4RQQA 2E46A 3CXHK 2V5RA 2H8PA 3S3PA 1P2CA 4R2GB 3KYOB 4JFED 4X9HA 2ADFH 4O2CA 3T09A 1I7UB 4FD0A 3NH7L 2AJSH 3APCA 3NTCH 1CBVH 2YAMA 4XP1H 3MA9H 5C0DA 3VD0A 3UJTH 4MJ5B 1E4XL 3T77A 5D2LB 4D8OA 3SKNA 2ITEA 4AQEB 3CZKA 2FLMA 4JQIL 2QADC 2O6EA 3NESA 4HXBL 3Q13A 3MNVB 3TBYA 4JHUA 4M7JH 4PY8J 3NP4A 4A7UA 5ICYB 1XEUA 4PJCE 5GRZA 1RUPH 3JV4B 4JHWL 3T2QA 5I1DA 4ODSH 2NY2B 4RGMC 3ILDA 4MVBD 1U3HB 1KXQA 5HHPB 5EEYA 4JHZA 4W9IC 4AGPA 3QRGL 5C0IA 1CJYA 3CH1A 2YEQA 2F7PA 1AKJA 1D9KC 5FM8A 3AWFA 4JQXC 3ZDXF 1A4AA 3HZMA 1VDGA 4XB8A 3AXHA 4ZMNA 1R3HA 4Y4KA 3N50A 4V11A 5HI5C 4J3SA 1QNIA 1UYWH 5T5NF 1DN2A 5JUEL 2PW1A 4D94A 5IWLC 1OZUA 4F37F 1H0DB 3C2AH 3VCLB 2X70B 4OCXL 2A77L 3ARBC 4JUSA 4PCKA 2C9VA 1F2XK 4J6IA 1NGPH 1Q9KA 3ASNB 4AZUA 5I28A 3X3FL 1AHWA 1E2WA 3KL3A 3L3JB 4G43A 2R7EA 2BDNH 5BRZD 2B15A 1M2VA 5KSUB 3QUGA 1OY3B 3UH8A 1Z7JA 1OTUC 1UZ6F 2BW5A 2WTOA 1OB0A 2VDMB 3E2HC 3WTWA 2VAAA 3OXRA 2N4IA 1OT4A 4GW4B 3TNMA 1QVOA 5FDYA 1MPAL 4MNHB 2Y36L 4XCEB 5DI8A 4R8WH 2CH8A 1DUZA 3FYIB 2CHNA 2V2WB 3FDWA 1CT8B 2IH1A 1YN6B 2H1XA 3IRZA 1B0IA 3SE4A 4U1JB 3D85B 1CGVA 3MOBH 3EBIA 1MFMA 4N2MA 3QEGH 3REWB 1MCFA 5M7QA 1BQUA 4FZ8L 1AC6A 1ORQA 4ERSH 2CG9X 3CVHL 5HYIA 1FYTE 1K2DB 5LGYA 3RX5A 1K3IA 1A21A 3RZWA 2WAQA 4NQEA 5F1IA 1JUFB 4QLRA 3VRLF 2I69A 3EBGA 1MI5E 1YEDB 4QRSA 1HKLL 4AIOA 5DK3A 1WZ1H 1EZUA 1J8HA 2OCFD 4FFZH 5BZWB 4EE2A 3KPSA 2QGEA 3D0AA 1EFXD 1YPZF 1J1PL 2EZ0D 2A6KA 2WWMD 2E5EA 2Q10A 4Q2ZA 3KZ8A 3VD4A 4PWEA 2J8UB 1Y18A 5HGDB 4MJ4A 1CXFA 4R0LB 5I1GL 2A6IA 4J2XA 5G4OA 2DQDH 3BEWB 1RU9H 4KZDL 2R9HD 4X6DB 3UBGA 4KY1L 3WN5C 1S9YB 2I07A 5EOCL 3PPSA 2BXYA 5DCCA 2FJHB 1T4WA 3KJ6L 2X6UA 3JVFC 4XHJC 3TIDA 5I5IA 2QSCH 4LARH 1MNNA 4JFFE 1ZT4A 3KD4A 4RNRB 5DQDH 2P80D 2CBOA 3FH5A 1NAMB 2GIXA 2UXFA 1C5DB 4N6QA 2X2HA 3BUDA 5DTFA 3MYJA 2C9AA 5EC2B 3GXIA 1UVQA 1YAZA 1QBML 2AVGA 2NX5D 3HZKB 2BJML 3QCUL 4QF1B 3V5DB 2N01B 4FABL 3W9DB 3V0EA 4DKFL 5GZOA 3ZE0E 4W9HC 2W60B 1QSEA 1MRCH 1VIWA 1QATA 1K5NA 2EDBA 3SD5A 2EQDA 2Z93B 3DYOA 1FHNA 2W92A 4M6NL 5HPMB 1NPUA 1EJOL 4ELDA 4HPYH 3CLEL 1U2CA 3NCBB 1WT5C 4JDZA 4YSCA 2XXGA 4PJIA 5IB1A 5IFJB 2X3AA 4IBZA 5E6UB 2VRAA 4DZBB 4KO9A 2NPLX 2A9DA 2X0VA 4MJID 1BYPA 4YGAB 3TA3B 1CXIA 2O30A 4AIZB 4RFNC 2BMKB 1S46A 2FBJL 3DGCR 4XVUD 2WLNA 1C08A 1CLCA 5EF1A 3QA3A 1HQ4A 2F1BA 1FLRH 3ZMNA 5D7LA 4W9CC 2BVOB 3KYMB 3PL6A 4DPBX 3B9KB 4UNTA 3VWJA 1RK1A 5D7SH 1MW1A 3P69A 5E6RB 1ZTXL 2WIIA 3DVNA 3SN6N 1E2ZA 4KH2A 1ETZA 1P7BA 2ENPA 3TONA 1QKZH 1ETJA 4ZXBB 1DBML 3MLSL 1RZJH 2E0PA 3AT0A 5TD4A 4QYOB 1F4WH 3JVGA 3FF7A 4IMLB 4L0PB 4TVPL 2Y1YA 4WHTB 5E23A 3ZR5A 3I02A 2DMBA 3EHBC 4O58L 2UZIH 3VXNB 5I71B 3V0AC 1BPLB 3LEVH 1DE4B 1Z5LB 1D6VL 4LEXH 1IJNA 2OULB 2A9NH 4OJFH 3HI1A 3DRQA 3HJEA 1OM9A 2DYPB 3DUHA 3ZT5A 4G8GB 2RQ8A 5AUMA 1VADA 3WTXA 3KVQA 1NDMB 5IVZA 4XPBH 2BOLA 1FZMA 4NOFA 4BFIB 4DEUA 1ZXQA 2AJYL 5K39A 4LLMA 1S7WB 1RJLA 1NCDH 1BAGA 4PJ7B 5FOBB 1XH1A 1A9BA 4OT1L 4Y9EA 2KZKA 5L4IA 2DBJA 3M7FB 1C7SA 5DT1L 5PAZA 2DQFA 3QQXA 4IDLA 5IK3A 4ES9A 2A9BA 5I1AB 5F7WC 1NGZA 1PIFA 4CN1A 2W5PA 5DZLA 1FORH 4F15C 4UOJA 1AQMA 4TMPA 1M6OA 1T66C 2DYRB 1RZ7L 4PY8I 3TNNB 3IF1B 5FUOH 4Y9BA 1BCIA 1KT2B 3HS0A 1OARL 4L1HA 4AQ8C 2AW2A 3C5JB 4IOIA 2LVEA 3CFKB 1JGDB 4JKPL 4S2SA 5DS8A 1IM3B 1T4KB 1PZSA 4ZFOA 3EXJA 4U6VL 3VM7A 4NBYB 3RWDB 4LRIA 2VWEC 3RDTA 5ABDE 1DZ0A 2VSDA 4H7VA 4Y5VA 3QXDA 3NSCA 1N67A 3AMLA 3QDMD 4ZTPL 4C83A 1BAFL 4Y19E 4ODVL 3MKKA 1T89A 4JO1H 1QRND 1D2PA 1UOKA 2AJXL 3A6BH 1CICC 4YHML 1ZA3B 1NGQL 2V33A 3HE6B 3VXSB 1LO4L 3BPNC 2XA8H 4OZGF 5F1OB 3BO8B 3OZLA 2D31A 2Z35A 3EDJA 4Q6KA 4K55A 4ZX5A 3SJVA 5HGAA 4GRWE 2JKWA 4G70B 1XIWB 1UT9A 3SE3C 1E8XA 4OKVA 4OCLC 1J1OL 1P4LA 4PAZA 3UC0H 5IJVA 3BW9A 3QPKA 1NBZA 1RUQH 3UZEC 3ZKND 4JFEB 1RMFL 1N3NA 4ELMA 2C9RA 3BZEB 4X0NA 5JQ6L 2IVFC 5FO9B 2MFNA 1SYSA 3M07A 3O9WD 2FWLB 3VFUA 4YSRA 2E9WA 1QLEH 3MV9A 4URKA 3EH2A 5DU7A 2P5WA 4HIHB 2DBLH 4L29A 1X5AA 5I6LA 1Z6JT 4L8BA 4G82A 3E1F1 4P23A 4YBHA 3GUFA 4NO2B 5C07E 4OFYA 1YECH 3JWOL 2BIIA 5SWSD 3BSGA 4F7PA 4OQTL 2CHWA 1EZVY 2X1WL 4OZIB 4PGJA 1ORSB 1MFDL 1WEJL 4DEPB 4HPOL 5I1LA 2VERN 3ZOAA 2VYRE 2K3HA 5D7JD 4F58H 3DTXA 4XXDB 3D87B 4QHLA 1F6LL 4CL7A 1S9WB 1KGIA 5DJCA 4YS4A 4XP4H 1Q0EA 2AJZB 3P4MA 1QWHA 4FERA 2ZAHA 3NUKA 1NGYB 3QJQB 5H8DA 2PKDA 3RNKA 4F7MB 2CPCA 1U8PA 2EAEA 3WE6A 1N64L 2MCMA 4KNQA 1IGCL 4XPTH 5HHXH 4Z7VB 4YSDA 5A2IH 4ZZFA 3RVTC 5F9WC 4HK0A 3TXAA 1NBVH 3L5JA 2ZONA 1JNHA 4NN7C 4RISL 2JVUA 5BRZB 3I3DA 3KVDD 2EDDA 4QO1A 4RAHA 5IQMA 2I5YH 3H0TA 3IDUA 2F1AA 1N7MH 5CP7A 4OGYH 3I6LE 3D12B 2GK0A 3UPCA 3ULUE 1JZGA 3OR7A 1F4HA 4HG4K 4IRJC 4YHYB 3V0VB 4IM8A 5D7IF 3ULVH 1MHEB 1N4XH 3SE9H 4BQBA 2ZSVA 1BZ9A 2BVUA 3K6SB 4E0RA 2OI9C 1A6ZB 1A1OA 2QKIC 4F37K 4RX4A 1ADQH 1I8KA 3LVTA 5E70A 4MBRA 1Z9SB 4TNEA 1RK0B 2VIRA 3SZ6A 5CHNA 4GG6E 5E5MB 3ZZQA 1EUUA 4M9PA 5FC9A 1F4AA 5LWYL 4CILA 4NRZA 3RX9A 1ET7A 5F1SA 3DJRA 5DJ6A 2QZ5A 4NPYA 3HBQA 3TBVB 1Q72H 1J5IA 2C8NA 4WU7B 2H1LM 1NDTA 4LSUL 3NVQA 4XE0A 2B1AL 2XV2A 1EFXB 1GZPB 3D69A 4G5ZL 5A16B 2HFTA 3TZVB 4PRNA 4WVRA 4YDNA 1WWAX 2XT1B 3WXWH 4PJ8C 4KXAA 1PKQA 4U3SA 1HHJB 4G9DB 4DN3L 1TYEB 3AAZB 3PAZA 1AGCA 1B90A 1OSEA 5DO8A 3JTBA 4S1DC 2YJQA 3CFJB 2NY5H 4OQTA 3VXMA 2YD4A 1XAUA 4OJCA 3KCPB 4BINA 5A40E 2K70A 3ARDC 5FA3B 2W80C 4XN8A 1ID5I 5IROA 1SNRA 3L16A 3N43B 5TDNA 3K0WA 1ZOXA 1HE8A 5IQNA 3KPRA 4XMPH 3ZUCA 1HEJC 5I74C 2MQGA 5I19H 4JZOA 3C6LC 4R4BA 4AKOA 4P3CH 1CBJA 1E65A 5DEJA 3E6FA 1DJSA 1G5AA 4V1DA 3SDDD 1JPTL 4ZBJA 1INQB 2ED6A 1AIFA 3FU3A 4GP8B 5KS9F 2YARA 5F9AC 4P5MA 1AZBA 4FQ1H 5TDOB 4Y2DA 4RVBA 3HA0A 4WK2B 3HRZB 4MS8C 1HX0A 5IOPB 4PVLA 3DHUA 4KK5D 1ZT1A 1J5CA 2PYED 2K8MA 1JMZA 3C8KB 4LMQI 5HJGA 5C0RH 5I66A 1MREL 3HKZA 3S35H 1KBBA 5BO1H 4M29A 4X83A 5CGYD 2P8LA 1K3ZA 1HDMA 1QLRA 4MA7L 3HUJA 3EDDA 4FTDA 5CJXA 4MB3A 1Z3GH 3FN0H 4ZS6D 4OZFB 4K94L 3I6KA 1V10A 2VKWA 2WWKO 4F57L 4MJIB 2I60H 4G7YL 3MODH 1IKNA 4KO7A 3SKMB 1XL6A 1YNTA 4PIBA 5JA9A 1VPOH 2XFXB 5JW5B 3STZA 2CNYA 3VX1A 5IJBC 4IJ3C 5DJZB 2PXYA 1OHQA 1GYWA 3AMKA