1YN6B

Crystal structure of a mouse mhc class i protein, h2-db, in complex with a peptide from the influenza a acid polymerase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Lack of prominent peptide-major histocompatibility complex features limits repertoire diversity in virus-specific CD8+ T cell populations
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yn6B00
1RZKL 1M71A 1T1YB 1HHJB 2X1WL 3QG7H 4F7EA 2AVGA 3UTTE 4HCRH 1JWSA 3QFDB 1CXFA 1J1OL 1WLHA 3S4SB 3HAEH 4I48B 4JQXC 3PIQA 1WZKA 1BD2B 1KTLB 5CILL 2UUDK 2HJFA 1ZLUH 1FPTH 3VE0B 1XFPA 2JLLA 3Q5OA 2VDLH 5ERWA 3VI3F 1S7SB 5E2VH 2QSCL 3SPVA 3MODH 4R97B 5DTFA 3FN0H 2EDDA 4XNYL 4Q9QH 1XGPB 2J12B 5FYLL 3DYPA 5HGAB 4AJ0A 4OFYD 5TH2A 5DQJA 2BY1A 4KMQA 1JWMB 1LDPL 3B5HA 3CDGB 4OCYH 1OTTC 3UTZB 4PJEF 3FT3A 4K94H 3G5YB 2HA1A 1IAIM 4YEEA 3P9LA 3OR6B 5D7IA 1ED3B 3PXJA 3VFVB 4HWZB 4G80B 3ZTJG 4K8RH 1JPTH 1JVKA 2OR9L 1JTOA 3MREB 1MH5A 1X5LA 3QDJE 2X41A 2Z92B 4Y4KB 3K7UA 4FNLL 3VFTB 3GSXA 3TJHD 1U3ZA 3VWKC 5DF0A 3PWUA 1J0ZA 3I9GL 5A40E 5HVWA 1RAMA 2AERT 2E9BA 1YMMD 4P4RB 1CIUA 1GC1H 5J12C 5IR1A 1DUYA 3H9ZA 3VFOB 5DJ6A 4NQDB 4F58L 4PRDB 1I9JH 2W0FB 4M7KL 3S35H 1E6JH 1EGJA 5BRZB 3GMQA 1KN2H 4NP4H 1W0VA 2QQNL 4PJ9B 3MGAA 1VFBB 2BC4B 5JHDA 2ERJC 3KS0H 3IDNB 3SE8H 3WIHL 3QNYA 4PGJA 4KI5D 3TZVB 5I30L 1D5XB 4XBGA 1XZ0B 2VN4A 3PGDB 4NBZB 5GRJH 2ZSWB 5KBNC 4JO3H 4ELMB 2FX8L 4NNXB 1RZJC 2ZG1A 1G7JB 5I1IL 5I1GH 1AGFB 1SBSH 3EZJB 1TXKA 5DJ0B 3WNMA 3L5JA 5B8CC 1BGXH 3MOAL 2J4WL 5C0GA 3EDJA 2DI8A 1ZHBB 5KJRL 3QO1A 3RNKA 5FKAB 4M93B 1CI5A 2IEPA 1D5ZA 1ZTXH 3WO4B 5CLWA 1T6VN 1TCRA 5C86A 3ARDA 5T3XL 1FV1A 3SDXB 4IRSD 5JPNB 4AT6B 3W11D 4POZD 2OCFD 4PJAE 4K23H 5F1KC 3VXUB 2C3HA 2XWJB 2C5DC 5DD1H 3F7RA 4X6DA 1CICC 3FQTA 3QXAB 3LB6C 1I7ZA 1P7KA 4OI9A 3HMXH 4PJXE 1JPGB 4GO6B 4LLQB 4ZOEA 5AZ2H 5EUOB 3CCHB 2FX7H 3ABZA 5F72S 3RWGA 3ARGA 1R3HA 1WCQA 4DFHA 3D25A 3SOBH 5CMAB 1JL8A 3C9NB 2F8OA 4JFQA 1XCQB 4U05A 2E3VA 4PJ5E 3ULVC 4I9WE 1CCZA 1FFQA 1A14H 4I18C 3MLUL 2ADJB 1VFOA 2ZOLB 5IM7A 4ZUTB 3JV0A 3FQRB 3NH7L 3DVGA 1ZHNA 4NUJB 2I07A 1EBPA 1QD0A 1P7HL 4CVZB 5KVGL 1S7RB 3QI9D 5B22A 3PDGA 4PY7B 4YGVA 5IG7A 4JLRA 2VE6B 4ELKB 1A6VH 4PLKC 2YZ1A 4YC2C 3HMWH 4LSDA 2PF6A 5GHWH 4PJAF 3WJLC 2H8PA 3IU4H 3WSQL 5IOPB 3O3EA 4E9LA 3DGGA 1C5CH 4HFUH 3TIEB 3TBTA 2YPVH 1ADQA 1JGVH 3VXSE 4PJXF 2ESVB 4LHUG 3BZDA 3W0WB 4BQBA 4WI9A 5T3ZE 3PV6A 5IMLB 4RBPH 5FYKD 1YC8A 1BFTA 1SEBA 5DRNA 5KTEH 4H1LH 3C5SA 1HI6A 5IHLB 3V8OA 3BN9C 5DUBA 4CBPA 1QSEE 2HFFA 1L6ZA 2PW1A 4L1HA 3MRJA 5SWSB 4AM0A 3IFPB 5JXED 1NCBH 1NBYB 5JW4R 4H1LA 2Y36L 2BRRH 3VRLE 1KB5A 3DHJA 4F7CB 1KPRA 4ZUSA 1DJSA 5E6ZA 1N7ML 1TVHB 4GS7C 1FYTB 4M9OA 1NGWB 1U8LB 1YY9C 1V7ML 3MV11 1ULVA 4OB5H 1ZGLA 1HN1A 2AS5M 1CE6A 2YSSA 2IALB 1Y6KR 4YWGH 3EIFA 3QDMD 2X4PA 3IJHB 5EFIA 1S9YB 5AYUL 5IGXH 5I1DB 2HJLA 3I6LD 4P46B 5DJYB 1IGMH 1JYNA 1MIEL 3HE6B 4WU7A 2BVQB 5L8LB 1DVFC 3MROB 4RIRB 4GKZB 1TNNA 3ZKQD 5CBEB 1I1RA 3IAGC 4ZXBB 4JPKH 4YO0A 2D0HA 2PTUA 2PXYB 3BPOC 5C08E 4IEFB 5F1IB 4NT6A 3T77B 4EDXA 3O8XA 2EEBA 3VXME 4AEIL 5I9QB 4PB0H 3VRLF 4N0UE 2ORBH 1J87A 1F58H 4L8SC 4XPTH 5C0AD 4NUGL 4U1KA 3MCKA 4HS6B 3LH2H 1G9NC 3TJEH 5BMFL 2I26N 4QF1B 2X4UB 1MFEH 4OM0H 3QXDB 5DD5H 4AEHL 1RJLB 2DM2A 5JORB 4PRNA 2A6KA 5DO2C 1N6VA 2AK4B 5C9JA 3IJSA 4KH2A 1VEOA 5DSCA 2CKBB 3BFOA 3DX8A 4WW1A 4DW2H 2VNCA 1DL7L 1VGEH 4OCXH 4YLQT 4BKLB 3MR9B 1LWRA 3PP3K 5ICYA 2APVA 4JFXB 4OZFB 3DRTA 2VXSL 4P2RE 2VKWA 2FECL 5C0CA 1S5HA 4OLWL 1MRDL 1CN4A 2V5SA 1OTTD 4X5XB 3CLEL 4PRIA 3O2DA 3O4LD 4M1CC 1S8DA 4WJ5A 3PUCA 1A4KB 1SEQH 4G5ZL 4I0KA 3LVEA 2AJSH 5KVMC 1CF8L 5L9DL 4XMLH 3Q6GL 1F8TL 1VFAB 1FQ9C 3PDDA 4YDIH 3STZA 4Z76A 1ACZA 4QRPB 1NMBH 1NPUA 2XRAL 5DJDA 4WUKH 4I4WB 3UTOA 2WBWB 5DZLA 2RAMA 2XOTA 5HHPB 1ES0A 3EHBC 3VWKD 4U6XA 4OZGB 3OPZH 3AM8C 3DX7B 4QOKB 3BKCH 1CLYH 5E8PA 5DA4A 5EBMB 5IUSA 2GT9A 1QR1A 4V2CB 5BJTB 3BRGC 2WMPA 4K7FA 4X83A 1EK3A 4I0PB 3WL9A 4KK5C 3O2VH 4MAYD 4ODSL 1JF1B 3CDFA 2FBJL 2BHUA 3KXFE 4WW2C 1HINL 5CFHA 4GUPA 4PJCA 4X7EC 5C3TA 4X8JA 4N5EC 4P59H 3VGFA 5ACLA 1KIRA 3V2AR 1HHHA 4M61A 5J1SC 1YEIH 4LGRB 4EI6B 3RUGA 4FFWD 3C60C 5GGSA 3FB8A 3HAEB 1HEZB 2CGRH 1QHOA 1F13A 3CSYA 1BZ7B 4Y4HC 3MLPA 5IT2L 5J06A 3NIFE 3WKML 1J11A 2A9NH 3WYRA 1U3HC 4YGAB 1R0AH 1AGDA 4GMSL 1QRND 1FRGH 5LJYH 1IKFL 1DE4B 3AC0A 3MLYH 4GAYB 5IHUL 4LIQL 2ZSVA 5A2KH 2R2HB 2IH3A 1I3GL 5C1MB 2DLEA 3NA9H 2CRMA 3JV4A 1CDJA 2OTUB 1B4JH 2X5PA 4Z5RA 3FQNA 1L9NA 4RMWA 2X1PA 2B1AL 1KTDB 1Z9SA 1LILA 4QT5B 1KJ3L 4HWNA 4LKCA 1CICD 1LK3H 3BKJH 3KYNA 4D3CH 1FFPA 1CT8B 3F12B 3MGOA 5EC1B 3P0YL 1GZPA 3K2MC 3BSZH 4RAUA 1KN4L 5CCKL 1MEXL 3CX5K 4ETYA 3VFUA 3DYMA 4XNQA 3I02B 3VMNA 2CUMA 3NIFF 3CX5J 4FQ2L 4ZFGL 5IP4A 2AEPH 4LVEA 1PG7W 3DIFA 2DD8L 5IFJA 2BSTA 1MFDH 1HH6A 2HKHH 1A6UL 1JYWA 4OQTH 1F3DJ 3GMPA 5D7JA 3C6LC 3QDME 2IWGA 2AJ3B 3S5LB 1NQBA 4QRRB 4TN9A 4PLKD 3ARZA 4LMQE 3MRQA 3MV7B 1FP5A 2UY7A 1HHGB 1OAQH 1KIQB 3FHAA 5J6HB 3MMEA 2MHAA 2D3VA 3U2SB 2W9DH 2YXMA 1MCPL 1D9KB 1D5BA 3UZQA 2GJZB 3EYVB 1HSAB 4QTIH 3UBXI 3S9DB 3KVQA 5EORH 1F3RB 5E2TL 4MA8L 2DQUL 3I2CL 2CLVB 4PFEA 1AQKL 4HG4K 3BN9D 4W81A 2VLLB 5LWYH 1K6QL 2P8PA 4PLOB 2CK0H 4HG4J 2I60H 3O9WB 4RMVA 2VDOH 5F9DC 4S1RL 7FABL 2VUYA 4GW4B 4URTB 4Z0XB 1M6OB 1J8HD 4MQXC 2HFGH 3LS4H 4BSWB 2OZ4A 2IAMC 4Y2DC 1HQRB 2HT2D 2AP2A 2ITDB 3PL6C 2KBGA 3MLWH 1FNGA 2VDPH 4L4TE 4JO4L 1WZ1H 4LFHD 1YY9D 2G9HA 5IB3A 3BGMB 1A9BA 3SKJL 4ENED 4QHNA 3IETA 4P5MB 4FZEL 3O4LE 3NA4A 3TYFA 3NIGE 4FQXA 3PJSB 2F74B 3W9EB 32C2B 4MLSA 4XP9H 4MNQA 2DLFL 2JCCB 4NCDA 2V2TA 4NKMB 5BQ7A 2VL4A 2R1WB 1DVFD 3G5ZA 1IBGL 4XVJH 3QDGA 5DJAA 4XNXL 3TP4A 4UT9L 3A6OA 4GMTH 3SDCC 3GI8L 4NQCA 1JNLL 3PE9A 4HK0B 5E8EB 1NMAH 2C1OA 4PB9H 1QFUL 5EU3A 5HHOE 1F90H 2GJJA 3G6JB 3LKPA 5J13B 3RY4A 3LV3B 5M94B 2NY0B 4ZPVA 2DYPA 5C3LD 8CGTA 3CFDB 1YMHA 4FXGB 1HIML 2XIDA 1E28A 3HC3H 1XGYH 5TJWK 1OLZA 5GZOC 4DVBA 2SEBB 3PDOB 4N8VB 3BIAX 1PGRB 2OI9B 1G1YA 2BXYA 2JIXA 3B8YA 3NIGF 5MI0C 3SKOA 4PV8B 2I9LB 4MJIB 4H1LB 1JI2A 3V52H 2X44D 3V79C 3O6KH 1AO7A 1BEYL 4NC1E 4Y4FD 2A6IA 3KNBA 1BAFL 3OKMA 5F1NA 2NLJA 1H5BB 5E2JA 2E9JA 5DD6B 2DQGH 4HH9B 1JTTA 2AXFA 4M1CD 2OTWB 1QRNE 3OB0K 3GJEB 2UZIL 3ZKNC 2YR3A 3QEQE 4G8FA 1F4WH 4RMSA 3KR3H 3X3GH 4YR6B 2VLKD 3WE6B 3EW3B 3H9SA 4DTGL 5INDA 1L6XA 2OR8A 3IU3A 5KAQG 1JTPA 4QGYA 2QSTA 3CXDH 4LF3A 2HWZL 4X6BA 4QY8B 5J3HC 4PJIE 1TZHB 3KPMA 3OAZH 3VGDA 1I8IB 5L8JB 4XMPL 4P3DA 3HNVL 5TDNB 2H6PA 3M1BA 3DV4A 3UTQA 1XF1A 1AJ7L 3IF1B 1XGUA 1CL7H 4PJHA 1P69B 3FFDB 3UTSE 1BLNA 2E6QA 2IQ9L 4G6KH 2EIZB 1G6RA 1X7QA 1ORQB 4KK5D 4N1HB 1CE1H 5CIPH 3FT4A 2EZ0C 1NC4A 4HKBA 4R90H 1MRCL 3VCLB 1YJDH 2JKXA 4KK6C 4XAWL 1RK1A 2ICES 1A3LL 4LLMA 4N5ED 1T0MA 1JZ3A 4J23A 4LNRB 2EDXA 1RJZA 3EJYC 1BQHB 1IQDA 3OKNB 2AJXH 3K0WA 2EYSB 2A73B 3C60D 3MACH 3DI3B 3AREB 5HYJE 3BGFC 25C8H 5H37H 2WWKT 1P4IH 4ZAKC 4OGXL 5F88A 2H9GB 5CINL 3D85B 5FYJD 1U3HD 1TJHH 2HMIC 4EI5D 4HH8A 2DTSA 1A5FL 4PJIF 1DN0B 5DRWA 2VLME 5BO1L 4K3GA 3MJ9H 3KYMB 2VAAA 2DQEL 4HJJL 3PQYB 4MNHB 4R0LB 3V5HB 3OKKA 2ICEA 1LQSR 5DJCA 1KCUH 3SGEH 4Y16A 5D2LB 5E94B 4ZFOB 3U36B 5MEOB 2ADIA 2YD3A 1T5XA 1U8HB 1XGQA 4GKOA 3EO1B 3QZWG 2EIEA 5FGCE 5E99L 3TPUB 5KG9B 5GJTH 3ROOB 5MENA 4P2QD 4AYFA 2EDWA 5KW9H 1T4KB 1AGBB 4BFIA 3AMKA 3BYTA 4JFFB 4HZLA 1J8HE 1WK0A 3EO0B 1J1XL 4UT7H 5JOFA 3JXAA 1HDMB 2BSRB 5GIRA 4PUBH 2FEDC 3WN5C 1S7WA 1KBGL 1CFNA 2JB5L 3LKOA 3RX7A 2BOCA 1H3TA 3CVIL 1D5MA 1UH2A 5E00A 1TTUA 2DQTL 5SX5K 3S3JA 1AFVL 4PREB 4XMKH 1MHHB 4PRPA 5CJOH 5FA3A 4Z7VA 3C6LD 4M61B 3BH8A 3SKMA 4WUUB 5TFSL 5EN2B 4PJGA 2VZVA 4LCIL 3V5KA 5HHVH 3U30C 4IIQC 4JKMA 2BSSB 1LEGB 2FYYB 1SYVA 5CLTA 1FJ1B 1M1SA 4HQQH 3CK0H 1EIBA 1EEYA 1D6VH 1QPPA 5E5UB 3LEYL 1KT2A 4G7VL 2NXYD 4FFZH 1INQB 4TULL 1QP1A 1HKLL 2R0LH 2X4NA 3MV8D 4KKCC 4R7DA 1B88A 2DBLH 2P43B 2V5MA 2VTFA 2YN5A 4N0YL 2GEEA 3FB6A 1YQVL 4X4YA 3HRZB 1WEJH 4HIHB 2R0WL 4F3FA 3ILQC 1DBML 4YX2H 1DBBL 3TCXA 3ZT5A 5ISZD 5C0IB 2YPLA 3RWDA 1JNHB 4CN4A 1EH9A 3O2WH 3PWPB 4GRLC 1UT9A 5IESH 1CGUA 3V6OA 4M48L 3GBNL 3ARSA 1EFXD 5ELIA 5EU4A 2VDRL 3IDUA 5GGVL 2OSLA 3HG1E 4MQXD 3SBWA 5KS9A 3BKML 2JE8A 3RWEA 5IFHH 1Z0MA 4F8TA 1X4YA 3ULUE 3P40A 4UIMB 4LCCB 4M03A 4MXQC 3VWJA 1O5DT 4JRXB 4XNQB 5FOBB 2XWTB 2GIYA 3S37L 4YHOH 3D2UA 1TQCB 4HWUA 5EUKB 5DQ9A 3GI9L 3RVVD 1NFDB 3GK8H 3U48A 5JLZA 3OV6A 1BM3H 4AK1A 5IHZB 1CK0H 2ZWLT 4WV1C 1XF3A 1YPZE 3MLXH 1H0DA 1LP9E 2XPGA 4RISL 4TPRH 2JJTA 3PWLA 1TNMA 4FXKA 1KNOA 1PX4A 1MAMH 3HC4L 4MGXA 1U8KB 5F3HB 4L4JA 2IANA 4PRAB 1NGXA 1ITCA 4JFEB 2EYTA 5F3BB 5L2KD 1G7LA 2PCPA 5K9OA 4TYUA 5ALCL 1BOGA 3ULUF 4N68A 1NJ9A 4RQQA 3QRFM 4R26H 1NCDL 5CZXC 1K5NA 5IB5B 2Z8RA 3BO8A 1H3PH 1P6AB 5I17B 2PW2A 5DRZB 3P11L 4L9LB 1DQJA 3ARRA 3EYUH 3IKCA 4P0DA 2A6DB 3HKFA 5I2IB 1AE6H 2XT1B 1M7IB 1SJXA 4X5WA 1JZ7A 1MCHA 1YPZF 5C7XH 3TO4C 2I9TB 4NRYB 1LP9F 3I75B 4K7PL 1MWAH 1SQ2N 4JRYB 4EJ1C 1RHHB 2F8XC 5E6IC 3RQ3A 1FL6B 4F7TA 4ZNCD 4XTRD 3IXAB 4NDMB 4U1MB 5HY9A 4FQLL 2FJHB 3SDAA 3GSWA 5JW3L 4CGTA 3SJVA 2M8XA 3MCLH 4ZO6A 5ID1B 1FH5H 1CU4H 2VZUA 1I4FB 2GK2A 4YHIA 4HUXA 1ZLSH 3ULVH 2YUWA 1OLLA 4G9FB 1NMCC 2Z31C 1KXTB 3F65A 4MS8C 4GAGH 5J3HD 4YHKH 4WU5B 4UUJB 2CDGA 4LLUB 3RNQA 2DLGA 3QDGB 3QQ4A 4PJ8B 4F37F 1SM3H 1HYSD 1A7PL 4RWYL 3U0TA 2C7UB 4LKXB 4NPYB 4K3EH 4NQSA 4ODVL 4RGMC 4PBWD 1LO2H 4UMGA 3P4OA 3NPSC 1SYSA 3MBEB 3ARQA 1QPXA 1JHKL 3G5XA 5J11C 1A9EA 4HHAA 4KXZH 4RRPG 4YFLF 3RPIB 5H35B 3EJYD 1HHKA 5EWIL 2VLRA 4YBLB 2FLBT 2WIIB 1OD7A 4QEGA 4CU8A 2XG4A 2G75A 4JFYA 4ZAKD 3MGTB 4XC3H 3V4UL 4JPVL 1NKOA 5FECB 3PABA 3B9KB 5IROC 5D9SA 2HMID 2IG2H 4H0HB 1JGUL 1BJMA 1W2KT 2APBA 3NFSH 4L29A 5C6TL 4LPTA 5IQ9B 2WQ8A 1HHIB 1J05A 5CBAB 2GCYB 4OLUL 2YRPA 5FM5M 2IC2A 4R2GC 1PY4A 2X09A 4O5LL 1PG7X 5HPMA 1S9XB 3QG7L 3IDGA 4BZ2H 1D7FA 2HVJB 1CFVH 4Z77B 5FHAH 4HCRL 1UQSA 5JOEA 3VXOB 4N8CH 3HPJB 3SY0B 4IRZH 2DWEA 1RMFH 1YN7A 1VACA 2C1PA 3RZCA 2WAHA 4LVHB 3LRSB 3QIBC 5T1MB 1FO0H 1FC1A 3AS0A 3MRLB 2VDLL 4JN2A 1AHWC 2OTPA 1KB9K 5E2VL 3MODL 3G5VA 3EOTL 4Z18A 4BK5A 2KZWA 1D6EB 2CSPA 4PJHB 4H20H 3ZYOA 4Q9QL 4YNYB 5CD3B 2P8MB 1KUMA 2FEDD 3DTXA 1BWWA 5ALBL 1DLHA 2CDFA 4GXUM 1EDQA 1PZ5B 2X05A 2XFXB 3WFZA 4U1GC 4EVNA 4TVSa 5DT1H 4OCYL 3FQWB 4HWEL 3TBSA 3G6DL 4NBXB 4XB7A 3MRIB 4K94L 5I74C 4OSUH 3BRFA 1UM4H 5CIPB 2HVKB 3ECBA 3ARWA 3DV6B 4KRPB 1B4RA 2X6MA 1G9NH 5BS0B 3UYRL 5D7LD 1TPXC 4XAKD 3NIDE 1JPTL 1XCTB 5F7DB 2VC2L 1X5HA 2Q7YA 2F53E 2NTFB 4Y5VB 3L3OA 4JM2A 4MA7H 4OLVH 1LE5A 2V2WB 3ARBA 1C08A 5DRWB 2JJSC 4X6CE 1IKNC 3RWHA 4DOHE 2DL2A 1BVKA 4C56A 3RL2A 1U8QB 1GC1L 5DEFA 4ESKA 1WTLA 1PEZA 2GITB 5CZVH 4FTVE 3WLBB 4FMFA 4NRZB 4OKVB 1XF5A 2C4FU 1FE8L 1TLKA 4JPWH 1E6JL 3S35L 4GRLD 3QJHB 4NP4L 1KN2L 4YXLH 3ZDXE 4Z6AT 3QIUC 1FYHB 3MJGX 3SE8L 1I7UA 4J3TA 2YPKA 4Z7WA 1S9KC 1TJIH 2IJ0C 3WIIH 2P5ED 3FOMB 2D7NA 4OCWH 3L3GB 3FO1B 5GRJL 4GG6B 3NIDF 3V6BR 3MV9B 4JO3L 4KTDH 4OTXH 4IMLA 3LQZA 4G8IA 3SQBA 3BWUC 2WINA 5I1GL 4LU5H 5HBBA 5C0RH 3QUYC 1SBSL 3SCMC 4LHUB 4X6CF 4QHLB 3R0MA 1BGXL 5D2NB 1QUNA 1CVRA 1ZA6B 4HS8H 4ETQA 3R0NA 3NCYP 3LQAC 3OJDB 1ZTXL 4BELD 1HQ4B 1KCRH 3NPZB 5JA9A 5DEGB 3K81A 1T7WA 2AJZA 3BPCA 4K23L 4YH6A 3L5HA 4E5XB 3O6FA 4UILH 3ZDXF 5DD1L 2EC8A 3B9VA 1U41A 2Y7QA 4OGYH 2ARJQ 4PTTB 3FB7A 3HE7A 2FX7L 4ZUVB 3S3SA 4MCYB 4ODTH 5IMMA 3SOBL 3JV5A 3NABH 3UYPA 4H0GA 2HLFC 5E0QA 2R1XB 1KJ2H 4X9GA 1A7RH 4F33B 3QUXC 1UXWB 2WBJC 4MDJA 4OLZH 4Y1AA 2CO6B 3C08H 1A14L 2ZPKH 2ZKHH 1XGTB 1UB6A 1I3UA 1P84K 4PYGA 5CD5C 3N9GH 1BJ8A 1HWGB 3VFWA 3RTQC 3L3HB 4OCRH 4EN3D 1P84J 2EDFA 2VO5A 4P2OA 1F11B 3OAYH 4OIIH 1YYMH 4D0DA 2F15A 3AY4A 5E6ID 3VFNB 4PG9A 2FIKB 1ZANH 3TBVA 4OGZA 3HMWL 4JE4B 3L3JA 2K7PA 2R1YA 3IU4L 5EULV 3BH9B 1JHTB 4GQPH 2HT3C 2JB6B 3QIWC 2EO9A 2F5AH 1C5CL 4M4PA 1TMCB 4HFUL 2VXTL 2YPVL 1MHCA 5DMKB 2LU4A 1JGVL 5FA4B 3UXFA 4HIEA 5SWQA 3CVHH 4OLXL 3KPQA 4CMHB 5D8JH 3VWKB 1X5JA 2Q8AH 5BZWA 2ZUWA 2Z31D 2ADGB 4XP1H 3D69B 2BNRE 2I5YH 1QEWA 3CVHA 1MCFA 3QA3A 3WUWA 1RZ8A 4Q97A 1NCTA 5DVKA 2BVEA 4X6EB 3OR7B 4FA8A 3BWAB 4P5KB 4IOIB 1H8OA 1NCBL 5C0DA 3IGAB 2EC9U 2FB4H 1N5AA 1R5WB 4L4VE 2NXZC 3BZ4A 3OF6A 1UCBH 3HPLB 1U8JB 3P4MB 4EKXA 4PJBA 2BRRL 1I9IH 4KZDL 5FO9B 3TLRA 2Q6WA 2XYCA 3O0RL 5D1QD 3V6ZA 1NUDA 5I1LB 1LK2B 3TN0C 4AIZA 4XBPB 3IDJB 3PGCA 4JFDE 2XG5A 5HJ3B 4E41D 4OB5L 3HZMB 1ACYL 1TZGH 5EOTA 3ET9F 1OGTA 4JVWA 4P5TC 4JJ5B 1MCEA 3CC5A 4XHJC 4ZO8A 2ATPA 5EZJA 5KN5B 2PO6A 3BUYB 3TGXA 5DVOA 5IGXL 1A0QH 4ALAH 4HMCA 4LQFL 5JIKA 1HXMB 5B8CB 1QSFA 4OM1L 4V1DA 1FIGH 1SY6A 5D7LE 1HOCB 3QZWA 5LBSH 4XAKE 1IGML 2XN9B 1NBZA 4DJMA 4KK8C 4WFGD 1LGVA 3FO2A 3F6IA 1AD9B 2VZSA 1BFOB 5KSUA 3UJIH 1DQQB 1FNFA 4U1JB 5ECJE 3RAJH 1FCGA 4JPKL 3G6AB 1QA9A 2XICA 4OLYH 3BN3B 1MWAB 4R2GD 5JO5B 5HDLA 3L6FB 2BOBB 4PB0L 2ORBL 5C0BD 1F58L 4WO4C 5IB2A 4RDQF 4XHQA 4B50A 3TJEL 3BZEA 3LH2L 4GBXC 1HZHH 1MFEL 5DD5L 3S8WA 5DJXA 5I73B 2K7QA 4ODUB 3QQ9C 2GSGA 3ARUA 5J6GB 3ZHDA 4DW2L 4RMQA 5JNYA 4LLYA 3HUJA 4OF7A 4KRMB 4OCXL 1NAMH 4I18B 3ROLB 2GTZA 2P5EE 1ZHLB 3BIKA 2BNQD 2ITCA 2GK0A 4LLVA 1AGCA 5EPMB 1IC5L 1HSBA 2DQFA 4TUOA 2D9CA 4X80H 4X4XB 3QFJD 1JWUA 1I7TB 4YC2B 2R56L 4ZFOL 2XQBH 1XEDA 3SGJA 1SEQL 3OKDA 4C83B 2H3NB 3MNZA 4NO2A 3SDDA 5IMKA 2AJSL 2H26B 1RQ5A 2Q87A 4M1DH 4WVRA 1U58A 2FIRT 5E1HB 4YDIL 4WWKB 1T66D 5D1XD 5EBLA 1R24A 1NMBL 3KPRA 3RKPA 8FABA 4NQTA 3Q5YA 1HNFA 4WUKL 2R2BA 3GRWA 1FZOB 3QUMA 3W81A 1DBAH 4D8PA 1JZ6A 4XCEA 3OPZL 2YHGA 3IB4A 4WGWB 4NKOB 1X4ZA 3EYFB 5FCUH 1B0RA 1LNUB 1JF6A 2QEJA 3VXQA 4JFOA 3O2VL 4U1LA 1E4WH 1RULH 3KWWA 3MQIA 1CQKA 5SWZD 2R2EA 4IHOA 1RFDH 4WEBL 5DMGD 5EU7C 5GS0H 3KHOA 1A7BA 1FL5B 3RVWC 2FNBA 4P59L 3QIUD 4X0KA 3GMMB 3LIZH 4Q2ZA 4XWGH 1YEIL 4HC1A 5FV2A 1IGFH 3THMH 3Q48A 5KSVB 5I8OH 4P2YA 2CGRL 2R9HD 2G2RB 2GSIA 1FO0B 5GSRA 1IGJB 2IBBA 2A9NL 1UWGH 1R0AL 1DLHB 4XT1C 3SCMD 1FRGL 5CEYA 2DB8A 3MZTA 4JVPA 4UU9A 3MLYL 3KPNB 4L3CB 4HZAA 5EZOH 3SGDH 3GMRA 3NA9L 1MCRA 1RZ7H 2NPLX 3ULUC 1AXSA 3BPOB 4NQED 1PY9A 3WUZA 5J56B 3F7VA 3RWIA 3GSNH 2V7NA 4RGOH 2FO1A 4JCMA 4L8SB 1IAII 4PJ7A 1LK3L 3BKJL 3U7YH 1F3JB 4YBHA 1UM5H 3EFFA 3FOLA 4UZGA 3FN3A 3IDYC 2QV2A 2YA2A 3BSZL 3Q6FB 2GAZB 2GJ6B 4BH7B 4PRHB 1AIFA 3DUHA 3MPCA 4JN1H 4MD5B 5GGRY 4APQA 1QBMH 1RURH 4G6AC 3QQ3B 1HCVA 4NN6C 1K3IA 3QUXD 1P9MC 1NDGA 3I6KB 1ZA3B 5EOQH 5IK3A 1MFDL 43CAB 5CD5D 3DX9B 3DMMA 2HKHL 4LLWA 4P23C 3RTQD 5CAYB 4OQTL 3T0XA 5ID0B 5FF6B 4EIGB 3MFFB 1DN2A 1EZVY 1WAAA 5D5MA 2NY2C 1F97A 1OGAE 3FZUD 1IGTA 2J8UA 5D7IE 1WUNT 4LVOC 1T7YA 3BP7B 4M02A 5HYEA 1OAQL 2F8VA 2HT3D 3QIWD 4M8QA 3S37X 4HGWB 1Y0LA 4M43H 3ZMRA 5FKPB 1J0IA 1WIUA 5JDJA 2W9DL 1LD9A 4IDJL 2F58H 2PYFA 5IFAH 3BDYH 3FO9B 4QTIL 2CMRH 3FRUB 4HKZA 1ZWIA 5BV7C 1C12A 1F6FB 5EORL 5I16A 3MZGB 1EPFA 3JZ7A 3PP3H 3TNNB 5LWYL 2NY7L 2BSED 2CK0L 2I60L 3U6RA 1QO3A 2VDOL 1PKQB 4CUCA 4ODXA 4DKFH 4PR5A 4WW2B 2NXZD 4CADA 4OF6A 3E6FA 3VGAC 2HFGL 3INUH 3LS4L 4NNYB 2X7LA 1MI5D 5JHDE 5D7IF 4FQCH 3MLWL 1UH3A 5J9PB 2VDPL 4FG6C 1WZ1L 5IBUG 2YN3A 3UEZA 4PJ5A 4Y4HB 1JGEB 4P5TD 4RFNC 2O26U 3QFJE 2EIDA 4XHJD 1OM3H 1U3HB 3WEXA 5DJ8A 4PG2A 3N0PB 4JANB 4R8WH 5ANMB 1KJ2B 1UENA 5JW4Q 2Y5TA 3QUKB 2AXGA 1YEFL 3IDMB 4XP9L 2LQRA 3OKOA 3T0EE 2IFGA 1FFOA 3GGWB 5B38G 2Z8SA 4KK8D 5T1LB 3NZHH 2YRLA 5D71H 4XVJL 3GO1L 5I1AB 1NCNA 3MRBA 5C07B 1OF2B 4GMTL 1FBIH 5T3ZH 1A6ZA 3H7LA 1NMAL 4PB9L 5E4IA 4YDVA 4IRJC 3VRIB 1F90L 2YWYA 4K71C 4A6YH 3VXSA 4FABH 2W0LA 2PYED 2PKDA 3RGVA 5FYLE 1FFRA 4RX4A 3W82A 1IM9D 3GB7A 3H6JA 2ED7A 4WO4D 3BQUC 4W68A 4GBXD 5IWLA 1W8NA 2F54D 1XGYL 1GAFH 2DQHH 4R96B 5CHNB 3VD9A 2A74A 1K4CA 2OXHA 2MOVA 5GJSH 1NDMA 1EEZA 3QQ9D 2PTTB 1T7XA 4EQ2A 3QPQD 3V0WH 4G9DA 2L7JA 1GPOH 3NMEA 4QYOA 4O02H 2QLVB 4OZIE 3MO1A 4M1GH 2V7HB 3V52L 3O6KL 2Q20A 3QULA 1II4E 1W72H 5HHMD 4ZFFA 4OUUA 4R4BA 4NFCA 1JPFA 1A22B 3C6LB 3HR5A 3FFCB 3DURA 2DQGL 4OFYA 1JNNH 3BGAA 3OXRA 3VXNB 1F4WL 2ZCKL 1DCLA 5TGBA 3DETD 3KR3L 3X3GL 4KKAC 1BMGA 1GOFA 4AQOA 5A2FA 4ONOA 3CXDL 4MWFA 1S7QB 4LP4A 1QFWM 2HFEA 2VDMH 2EE6A 3L9RB 3FO2B 3GSRA 4KDTA 3VJ6A 1N26A 2BVOB 4JHZA 3PWJA 4OZIF 3KPSD 1CL7L 4UQ2A 5HVHB 3AUVA 4G6KL 3VW3H 3NN8B 2R0ZH 4N0UA 3ZO0A 5TE4H 4XPFH 1CE1L 1BJ1H 1YMMA 2Q7NA 4R90L 2IAMB 3C5ZC 4Y2DB 1YJDL 3WDHA 3PL6B 4R4FL 3U46B 1I1YA 1GCFA 4L3ED 1IAKA 2YXFA 3MACL 2ARWA 5FYKL 5J1AA 5T3XE 5K9QG 25C8L 4WHTB 1OQOA 1P4IL 4DKEH 3SE3C 1P2CB 5K93A 5HVGB 4FFYH 1G7MA 4Y5XB 1NAMB 1VHPA 4BQ9A 4R3SA 5DI8A 1JPSH 3MJ9L 5DC4B 3BW9B 3G9VA 1OAXH 5F9WC 1UADC 2IH1A 5FCSH 5E56A 3KS0J 15C8H 2C3VA 2D03H 3SDCB 4CW1A 5T1KB 4XCNA 1KCUL 3MNWA 4IMKC 4MNGB 1EJ6A 4O51A 4JFHE 3P77B 4XZUB 4PBVC 4NHCH 4PRBB 5EZIH 3SGKC 3QEGH 1X3DA 3BP4A 1KIPB 1IAOA 1OT2A 4IRSA 5DHYA 3NACH 4Y88A 3WFEH 4Y4KC 5GJTL 3AU1B 1MVFA 5FUCC 3P4NB 2DDQH 3S7GA 5KW9L 1KJMA 1BBJA 5E03A 4PJEB 3D0LB 1JK8A 1EHLH 4OBSA 2X4OA 4IOSD 4JQVA 4UT7L 3UZEA 5MI0B 3BEWB 4LSPH 2RBLA 4PUBL 4QO1A 3QEHA 4JG1L 3UTTB 3JWOC 2DTMH 3AAZB 4U6HA 2I27N 1ZMYA 1X4XA 3M8OH 4JY6A 2CUHA 1XGRA 3VXRD 4FQPA 1NL0H 3VFMA 4XMKL 1V3LA 5CJOL 2X89D 2B1HH 2NY2D 4MD4B 5IVZB 1KCLA 5AD0A 3TZVC 3QI9A 2X4RA 1I1CA 5HHVL 1KPUA 3FTGA 5ITBH 1DP0A 2HJKB 5MEQA 3MRRA 3QUZC 5J8OA 3DECA 3IFLL 3CK0L 1D6VL 4MCZB 4FQ1H 4FFZL 3K8LA 1J10A 2R0LL 4K55A 2DBLL 5LVEA 5I66A 4TTDD 4LEOB 4K3DH 1WEJL 2CLZB 1HXYB 4Q6YA 4YX2L 1ND0A 4D9RE 4DZBA 1I1AC 1H3VA 3T1FA 1AXSB 2BCKA 5T1DH 1KGCD 2X10A 1Q0YH 3T2NH 5IESL 1JRHL 2A6JA 3ARFD 2BNUA 3QDJB 4LCUB 3WFDH 1XAUA 4GW5B 1EA9C 3M45A 5EZLA 43C9A 4PJCE 3T4YA 3GSNB 5JXEA 5IFHL 5GS2H 3GMNA 1QFHA 3GZKA 4I2XB 5AZEH 1HH9A 3RUGE 3RWJA 2XKSA 1B2WL 3KLSA 2JK5A 5H8DA 2DLIA 1AD0A 3X14B 5JW5B 4KXZI 3GJFH 3GK8L 1RUKH 4M6ML 1BM3L 1CK0L 1NLDH 3CFKB 1VESA 4WI3A 1NGQH 1YUHA 3QHFH 2MCG1 2DRUA 3MLXL 1JBJA 1UZ8B 3QDMA 1ORSB 2DQCH 4TVPH 4WGVB 4TPRL 3HC0B 1IEAB 3IS1X 4YBQC 3HZKA 5JPMB 1MAML 1BIIB 1EBAA 2FJFA 3U9PH 2VLJB 1NGPH 2QSQA 3W9DA 3EBAA 1DLFL 3HNTH 2A77H 3D0VB 3WNLA 4TRPH 1REIA 4IRJD 3WS3B 3CZJA 1BZ9B 1SJHB 3QCVL 5F8QC 4PJCF 3NGBC 1I8MB 3DXAD 3P2TA 2V5RA 3EO9H 3KPSE 3OGCB 3EOBA 1NCWH 4PGDA 5MERB 3RUGF 2J6EL 4R26L 1CR9H 4QHKJ 5A2LH 5C0AA 2RQ8A 2B4CH 5IIEB 2WWKO 1H3PL 5FEBA 2IQAB 4RMRA 2MNUA 3U4EA 1JUFB 4NJ9H 4PJAB 5E95B 3EYUL 2Z35B 3BEVA 1DSFL 3WN5B 4S1DD 4MLIA 1U8NA 1RZIA 4L3EE 1T22A 1GHFH 4TNWF 5C7XL 2J8OA 3NCJH 1M7DB 5MEPB 4PJXB 4OGAD 1WBXA 1MWAL 3FKUS 5EC2B 2PETA 3UBXG 3RWFB 4MA3A 5E5MA 1P7QD 2X42A 1DDHB 5DK0B 3IVKA 4FQHA 5C6PB 3TVMC 3U30B 4NO0B 4OCLC 2FEEI 4WFFD 2NZ9C 4XXCC 4ZFZA 4HIJB 2UWEB 3O4LA 3MCLL 2XKUA 4YIQA 1RK0B 4BFEA 1H3GA 4GG8A 4KKAD 3JV6A 4YHPA 4U1HA 3W5NA 1FH5L 5TQ0H 1Y6NR 4R4NC 1CU4L 5GGVY 3G04B 2BZDA 4MXWH 5DRXA 1ZLSL 5CEXA 3ULVL 5CWSA 3MJ6A 4HX1A 3MNVA 1AI1H 4GAGL 1Z9LA 4MX7A 4QHMA 4WI2A 4YHKL 1WZMA 3ZYJA 2VSDA 1CGXA 1MFBH 3UPRA 4F7PA 1SM3L 5GRVL 5FK9A 3TO2A 1A7NH 1UWXK 1QLFB 5DYOA 4ZXBC 4UNVA 1UKTA 4N1EA 2PXYC 3LEXB 5B39G 5HHOA 1I1FA 1MCLA 3QR2A 4K3EL 4NHUB 4F2MA 3FT2A 4W4OC 1LO2L 3MRHA 1VSCA 1RZGA 5DZOA 4MAYA 5K9KB 4JZNB 4KJYA 4A6YB 1A6AA 1OP5H 4LIQE 4POYA 1BD2D 2FWOB 3N1MC 3C8KB 1G0DA 1Q9KA 1QSEB 4UDTA 3MV01 1IL1B 1X9QA 1TZIA 4KTEH 2VISA 1OTUC 2V9RA 2IG2L 4WV1B 4G8GE 4GRMA 2L4OA 1DQLH 3OX8B 3NFSL 3SDYL 5D7SH 3U9UB 3QNXA 1AR1C 3OBAA 4HUUB 4XGZB 1W72B 5HI3C 4DGYH 3BP5A 1QRNA 2DWDB 4FHBD 1AQDA 3REWB 5C8JB 1U91A 4BZ2L 5TGBB 2ICWA 1W0WA 3DSNA 2VWEE 1CFVL 5FHAL 3SO5A 4D0CA 5L8KB 3AGVA 1N3NA 4N8CL 2VABA 2VYRE 1Q94B 4K7PY 5CKAA 4IRZL 1RMFL 5IVXA 5L88H 4GAJH 3MYZA 2HTKD 4Y4KD 4PJIA 4JZOB 4X7TA 4D0BB 3VJ6B 3LSOA 2CIKB 1CICA 2EKJA 5D7KD 5C08B 5I1HH 3MUY1 3UTSA 3LRGA 3DUSB 3VXMB 2BMKB 3GIVB 5J4MA 5F1OB 4NQDD 1T83A 4I0PC 3TO4B 3NFPB 5EU6D 2R23A 1AO7E 1C16B 1MCJA 1NCCH 4LVNC 2PN5A 2ZUUA 1G7HB 5BRZD 1QNZH 3DX6A 2IBZX 2HH0L 4OSUL 1UM4L 4PJ9D 5AAWA 2E6JA 4RGNE 1G9NL 5HYJA 4HKJB 1NEZG 3TZVD 2BXZA 2KDGA 2LAAA 3H7BB 3QUZD 1J5OH 4ZUWA 1BF8A 1R5VA 3RIFF 4P2RB 2XA8H 4MA7L 5BZDA 4OLVL 3WJLA 3MLZL 4RDQG 2DICA 1NMCB 4GKNB 4X5LA 1ETZA 5DA0B 5E2WH 1P4LA 4Q6IB 3MRKA 3IDIA 3M07A 5H94B 1Z9MA 3AFLA 3DXAE 5DURB 1I1AD 5D93C 1O0VA 3H0TA 3N1GC 1S7TA 1B0GA 4YUEL 4JPWL 2DKMA 4MZ3A 4RGMB 3VXUD 4YXLL 4ZO7A 2QKIA 5A3ID 1P1ZA 3BD3A 3IJYB 3BVNB 3CFJA 3NZ8A 5J11B 4OV5B 2WUCH 3ALXA 3DI2B 2OMBA 1TJIL 5ESAA 3HLAB 4K8RC 5B38A 3PNWA 4R7NB 3MRCA 2E9IA 1R5IB 1J8HA 1K8IB 4JDVA 3I84A 5IW6B 1FL3B 2QQLH 4NCC2 3T8XA 2CIIA 1C8PA 4LU5L 3KXFB 5C0RL 3IFOB 4HIXH 4JHBA 1VEMA 5E1AA 2ARJB 4FQIH 5E9DB 1JYVA 5TDPA 3MLTB 4KQ4H 1EV2E 4WFFE 1IGYA 2UY6A 1MIMH 4NC0B 1I7RA 2BVYA 3U1SH 1KCRL 4R2GB 2OQJB 1Y18A 4U1SA 3QISA 4DUWA 2YA1A 3L95A 3CDCA 3F7YB 3OTTA 3FB5B 4UILL 1T3FB 3O3AB 1DVFA 3RVXC 1YQ2A 3MYJB 4ZQKA 1EAPA 1OPGH 3CX2A 3BD5A 2VUOA 3HS0B 3PHQA 3QIBB 1PYWB 2QQKH 4OGYL 2ESVD 2EDTA 3W0WD 3QEUA 4ODTL 1DQDH 3OAUL 4OAWB 3NABL 4DN3H 5F7HA 4Y7MA 3OKLA 4ZTOH 1FG9C 1KJ2L 3JTTA 3MRNB 1A7RL 3LKQA 1UA6H 1QFOA 1BZQK 1FZKA 4OLZL 3C08L 4ZS7L 2ZPKL 1E4XI 4JFPB 2VITA 1PEWA 5DLMH 2W0KA 3ULUH 3N9GL 1BD2E 5C92A 4U1GB 4OCRL 2DQJH 5FGBC 5DD0H 5F6IC 4OIIL 5I74B 1PAMA 2FZ3B 1WC7A 4HV8A 5DS8A 4H25B 5C2BH 5DMIH 1CGSH 1ZANL 2NX5D 4Z7VE 4Y4FA 3ARGC 4DAGH 5I8EB 1P5UA 1TPXB 4PJGE 1FYTD 1CXKA 3X12B 1Z6JT 1BREA 3O6LH 2NZ9D 2H1PH 4FP8H 1XH3A 3EFDH 3RI5K 5HHQB 2OJZH 1MNUH 5J89A 5D8JL 4YDJB 1YPZA 5D96B 1AGEB 2Q8AL 1OARH 4ONHB 2VLKA 3BUTA 4TSAL 3GJFB 3MRFB 1L7TH 4NFDA 5F9JA 4XP1L 3T08A 4P46D 5KSBB 2YUVA 2I5YL 3HE6D 1WBYB 3FCTB 3VH8A 4MQ7A 4JGJA 3ZT6A 5FDYA 4LK4A 3Q3GB 4ZXBD 4EXKA 4FQQB 2PXYD 2YPLE 2HLAB 2CQVA 2FB4L 4U0RB 1N8ZA 1IJ9A 1UCBL 1WVZA 2VKXA 3MRGA 3LKNA 2LTQC 3AM8A 3K80A 5J13C 1I9IL 1KJVB 2Q86B 2W59A 4XRCA 1OSPL 1E27B 3D3VB 4E0RA 2GTWA 5ICZA 4Z7VF 3RL1B 4U6YB 1CLOH 5I19L 3FO0H 4PJGF 3IXTA 1TITA 3OAZK 2AV1B 3HHRB 3AXLB 2IPKA 1TZGL 2AK4D 2D7MA 4RA3A 1EHXA 4ZTPH 3EDFA 4U1NA 2Z8WC 3AS3A 4NQXB 1GGIH 2CPCA 4JY4A 2CRIA 5CSZB 2RFXA 1A0QL 4M5ZH 3QUYB 4ALAL 5BV7H 4LSVH 4HWBL 1RD6A 3ME0A 3L7FB 2BHYA 1OTUD 3MUJA 4NQVB 5LBSL 1X5IA 3TBWB 4LLAA 1FNSH 5E70A 4I0CC 4WFHD 1ZE3C 1WCBA 1AR1D 3UJIL 4L4TB 5KSAB 1VGKB 4WCYL 4EI5A 1NFIA 3LPWA 4WI7A 4OLYL 3WMSA 1L7IH 3N85H 5EH1A 4H5SA 3SGDI 4NN7B 1E4JA 4PD4K 3FQXA 2W60A 4YQXH 1ZAGA 2WSKA 4PD4J 1HZHL 4QRPD 5DEZA 5BXFA 3WXWL 2JJUA 1J86A 3SDXE 3KYAA 1FORH 2FO4A 1L0YA 2EH7H 2WP3T 2WBJB 5DJZA 1JI1A 1KSRA 1FNAA 1NAML 4QOKD 1WWWX 1UVQA 2P24B 2RR3A 4P2QA 5D70H 4KHXH 3LPFA 4O2EA 4F2MB 3RTQB 5CGYC 3VDAA 4X9HA 1CDIA 4I0PD 3RVTC 2UVFA 2FATH 5F97E 3MUGA 4X80L 4CNIA 1YEGH 4J4PA 2G60H 5IF0A 6CGTA 1MVUA 4K2UH 1R3LB 3GBMH 4YPGA 3X13B 4NRXA 3HRPA 4X4ZA 2R69H 4M1DL 5GISL 3GIZH 4BH8A 5ITFA 1I8LA 3SJVE 3X11A 3JVGA 1YEEH 3LPGA 4UDUB 1B9ZA 3SDXF 4U3HA 2XKNA 1A2YB 1FLRH 5DWUH 1DBAL 4LDLB 3WFHA 2XI9A 3DSFL 1MCNA 2XZZA 3V6FA 4HUWA 2A9MH 4HIIB 3MV8A 3QEQB 5BVPH 2ESVE 4JKPH 2HN7B 3N1QC 3RIAK 1E4WL 4CL7A 2XNAB 1TFHA 2BERA 1RFDL 2C26A 4HWBA 4EOWH 2H32A 5ISZA 1MI5B 4F8QA 4U7KA 3TN0B 2DJSA 1CFTB 4RAHA 3LIZL 4FN0A 1DEEB 1LEKB 4JDTH 5FB8A 1OCWH 4XWGL 2OL3A 1IGFL 4K8RD 1YNTA 1I3RB 5HHNB 5SWSE 1EFXA 1WFOA 3THML 4GOSA 5I8OL 2VLRE 3EGSB 4XI5C 1QKZH 1YY8A 4PGBA 4J6RH 1RUQH 5IB1B 4JZJB 1UJ3B 1UWGL 3S34H 4MJ6A 5DUPH 5E6YA 1FYTE 1K4DA 1ZT4A 1S9WA 1ERNA 4HPOH 2X4SA 3OKEA 4M7LH 1GZQA 3K2UH 5EZOL 5FDWA 1RZ7L 4QXUH 4QRRD 1T0NA 4F9PA 2O5ZH 1CD1A 5JXAH 3MFGB 5GRXG 3GSNL 5IEKA 1NUGA 4MJ4A 1IM9B 1YDPA 4RGOL 3MV7D 3P9MA 5HYQB 4GBXB 4KJWD 3U7YL 5EBWA 5DR5H 3SKNB 3FN9A 4KQ3H 4XCYA 2E9WA 1RJYA 3OGOE 1U92B 4S2SB 3UPCA 4ZUUB 1T7ZA 4JN1L 3RKDC 4PGEA 1QBML 1RURL 2IADB 4Y19B 3VFSB 4O4YH 5L2KA 2Q76B 5IBUB 4FTVA 3TFKD 5I1JH 5IEHB 3ELAT 4HW6A 4JDZA 1C5DA 5HHMB 2ILLA 5EOQL 1BIHA 3MLSH 3OSKA 3QNZA 5FGCB 1A4JA 2XXCB 4BYHA 4O2CA 2MQCA 4I8DA 1Q9OA 2Q8BH 3QQNA 3HFMH 4X98A 4CJ0A 1AKJB 2P7TA 3L1OH 4ZS6C 4RZCA 4LCCC 3TYGH 1UH4A 4UI2A 5IJKC 4M43L 3DYOA 1WIPA 1S7UB 3GM8A 5I76A 4OFIA 1UB5A 2F58L 2ED9A 5IFAL 3BDYL 1LE9B 2CMRL 5D7JC 2R0KH 3MA7A 3O81A 2D2OA 5D6CA 4C56E 4BFGA 4LSRL 2R39A 4IDLA 1R3KA 3SN6N 4ZO9A 1NC2A 5GGUA 3GSOA 4XNZC 5EU5B 2IGFL 1J9CT 5DDHB 4DKFL 5ESVA 3CSBA 3VXTA 1G7QA 4M7LT 3INUL 2NY0D 4UIKH 3A67H 4FQCL 5FHBH 3VFRB 1CFQA 2IPTH 1WWBX 1ZS8B 4WDIB 5GRVK 4PLNC 5GZND 4JPIA 5GS1A 4GKSB 4L9LC 3WNPA 4R8WL 3SE9H 1T5WA 2OK0H 2GY5A 4MJID 2AKRB 3MBXH 2YUZA 2X70A 3HG1B 1QQDB 3NZHL 4ZAKA 1FVEA 5D71L 4HXAH 2FSEB 2YMXH 4HUVA 5B4MD 3C8HA 2N1KA 1V5JA 1E6OH 1FBIL 3UO1L 2WLZA 3BAEH 2UYLA 3H9HB 5TQ2L 5BVJB 3P73B 2LVCA 3VRJB 1VADB 2R15A 4A6YL 4FABL 4ORGA 4MB4A 4YAQA 3F62A 3QAZC 1OSZB 2AV7B 2NYYD 3OZ9H 5C9KA 3IDYB 1QLRB 2NTSP 4GH7B 1FNEB 1GAFL 2ZJSH 4M3KB 1LP9B 3BDBA 5HYSG 3DROB 2D0FA 1EXUB 3BZFB 3D87B 5GJSL 1V7NL 4NN6B 2FR4B 3QJFB 3V0WL 2YBRA 4TSBH 4HBCH 3UPAA 3H3KA 4HXBH 1GPOL 1KG0A 4LCWB 4O02L 3VD4A 4LSQH 5IMOB 2GUOA 4Y1AE 4I77H 3VXRB 4P23B 1W72L 2BP3A 1I9RH 2X4QA 2X9YA 4LLDB 3O3DA 4LSSH 5CGYD 3ZHLA 4Z78A 1Q38A 3RHWF 3RVTD 3DO7B 3JTSB 1XIWB 3A0OA 1CGYA 3OJMB 3P30L 5D1ZB 2A83B 1U8IB 4LVOB 5F7EH 2XTJE 4JGMA 1BX2B 4PS4H 2NY4C 4IS6A 4TUJB 5IW3A 3GMOB 2GQHA 4YBLC 3EOAA 1JNNL 2W65A 4MMXC 1PQZB 4L8BA 2VOTA 3VA6A 3ARED 1U0QA 4YZFE 1FCCA 4CJ1A 1YEJH 1R3JB 5GSVB 5MP6H 3STLA 4QRRE 4UOW1 1DUZA 1OAUH 5D7LA 3RDTA 3D85D 5JMRA 4IIQA 5HGBA 3B9KC 3L5WA 5BV7B 3I6GB 1KELH 3E6HA 4U6TA 4LDEB 4OCMC 4N0CC 4JQIH 4RGNC 1QSZA 3ILPB 4PLJC 3PQYD 4K9EC 3VW3L 5C0JB 1OHQA 2R0ZL 1Q72H 5TE4L 5KAQF 3QG6B 4B7LA 2APTA 4PJBE 2OP4H 4RSVA 4AZ8A 4MSWA 1KCSH 4IOFC 4RMTA 5L6YH 4GRLA 2E7LA 1JN6B 4KU1A 3RY5A 2C3XA 4I5BA 1T1XB 4RFNB 4YZFF 1H15B 4JFFD 2MMXA 4QXTB 3V95A 4KMTH 4XI5D 3B2VH 2P5EA 2EE2A 3R06B 4DKEL 3L3KB 4LCYB 1QVOB 4DCQA 2DQDH 3KPOA 4ZPTB 4Q9CA 4FFYL 1T04A 3MJ7A 3RBSA 4OD1H 1QSFE 3AROA 4NO5A 3O45A 3DUUA 3PHOB 1JPSL 4CVXA 5C0EA 1OAXL 1NGYB 1WZLA 4LMQI 15C8L 2D03L 5TPWH 2EYRA 3B6SA 4WUUD 4H88H 1KV3A 3REVB 4K71B 3AB0C 4NHCL 5ICXB 4PJBF 5CP3A 5EZIL 3CFBB 3QEGL 4ZNEA 2NY3C 3ULSB 3BQUB 3NACL 4XNMB 5C6WH 3WFEL 1X5ZA 2WBKA 4QXGH 5C09B 1IE5A 3EYOA 2DDQL 2Z93B 2O5YH 4S0SD 4D9QD 5GGTH 3UMTA 1EHLL 3R8BB 4OZHB 1A6WH 5EO9B 3CFCH 4G3YL 1YNLH 4LSPL 1DBKL 3DO3A 4AENB 1MLCA 3HUJE 1VKXB 5JOPE 4Y16C 2DTML 4ZSOB 4P99A 2X1XR 2Y1VA 2MPAH 4XH2A 3M8OL 5EO0A 1A21A 1XF2A 3PWPD 3LKRA 3TBYB 4GW1B 1NL0L 5IV2B 5C0FA 1P7QB 2B1HL 4ZDHB 4N9GB 5I1EH 2AAVA 3WLWC 4EN3A 4MJIE 2YC1B 5ITBL 1PVHA 3IRZA 2G5BB 2GFBA 2RCSH 4JRXD 1WSST 1G7IA 5E6IA 2LFGA 1JZ2A 5E8DH 3CAFA 4EDWH 5JQ6H 3O3BB 1JV5B 2X4TA 4Z0BL 3LOWA 3KPRE 4ISVB 5IW1A 4PJFA 4KRNA 2Y07H 5D2NC 2W92A 4K3DL 2P5WB 4O2FB 3S96B 5D7JD 4DUVA 2EEAA 2KH2B 3BKYH 4U2YA 5T1DL 1JZ8A 1MHEA 3HUJF 3KDMA 3E3QE 3WIFB 5CP7A 1Q0YL 3V0VB 1EMTH 5DJ2A 2IFFH 2Z31A 2F53B 1CDHA 1VA9A 3LN5A 2YKLL 3TNMB 3WFDL 3C5ZB 5HGDB 4LSTH 2Z4QB 1S78C 4F7MA 2ATKB 4XPHH 2P46B 4WNQA 4X6CB 4JFED 4B0MM 1RJYB 1KLUA 1UEMA 2VXQH 3UBXB 5CUSH 4HD9A 3L3IA 3VXPA 3GBLA 4LEXH 3QO0A 5D1QA 1BVZA 4OV6F 1CG9A 1G7PA 5EO1A 1N59A 4Y5YA 1OOAA 4WRLA 3CPLA 3PWVA 1JHLH 4E41A 4GRWE 4EBQH 1RUKL 2Z91B 3C87A 2HT4D 3ESUF 5AUMB 3V6OC 1NLDL 4EIZC 1K8DB 1NAKH 4NKDB 5DMJB 3HI1B 5DGQA 3QPXH 4TVPL 4U1IB 5F9WB 3NAAH 1OGAA 4RAVB 4JRYD 3SBWC 2BFVH 4LBEA 4JHAL 3BP6A 3C5JB 4NZDA 3VWJC 2J88H 1N0LA 1NGPL 4XVSH 2ICWI 3HNTL 5B39B 2A77L 4W6WB 4M62H 1UCTA 4MQSB 4QHUB 4TRPL 2CJUH 3KPLB 1LO5B 2B5IB 3IKKA 4XXDA 5GRYA 1K3ZA 4HULB 5I71C 2DMCA 4PJ7E 2AW2A 3EO9L 5JDSB 3QWRA 3D39B 1A1OB 2I24N 4CMHC 5ETUA 1TVBB 4MNQD 1CR9L 5C0BA 5F7WC 3CH1A 4G9FD 2EDHA 3FAXA 3LKSA 2L7UA 1N2RA 1QR4A 2YD4A 1NBQA 1EGJH 1JGLH 4MYWB 2FHBA 4NJ9L 5KANG 3JUZA 3QDGD 1T1ZB 4GRWF 4PJ8D 5IB4B 4HLZG 3LQAL 5EU6B 1FZJB 1FN4B 1VB9A 4NQCD 3FONA 1AHWA 1ZVSB 1ONQA 4UNTA 3NCJL 3KYOA 3DBXB 2OXGA 3U79A 4HFWB 4JFFE 2FJGA 3OXSA 1ZT1B 1WAAE 2BNQA 4UBDD 3CZFA 5D5ME 1ZSDB 3MBED 3CSGA 1NANI 1YC7A 3IS0X 4XC1H 2J8UE 1FZMB 4PIRF 3QUZB 3T3ME 4H26B 3O41B 5CEZD 4XPAH 5DK2A 3QFJA 1S7VA 5DHVA 3B3IA 4PJ7F 3QWOB 3HNSL 5I1CL 3V4VH 4XCFL 1F2XK 5TQ0L 4X99B 2AJUH 4NOFA 2J1KA 5H2BA 3WJJC 3T0EA 3SEPA 2P8LB 2QSCH 3U0PB 12E8H 5IJVB 1A1MB 1AI1L 3B9KD 1CXIA 3ES6B 4OFPA 4P49A 1G84A 1J0YA 5D1XA 1I1AB 4MA1B 1MFBL 2M1KA 2NW2B 3G08A 4DZ8A 5CJQL 1T2QL 4WTWA 5ENWB 2JJWA 1A7NL 4X6FB 4L8CB 3U0WH 4RFEB 4KROC 1YA5A 4OZ4A 3SDAC 4ODWA 4YHMH 5JIHA 1FFNA 1S3KH 2VL5B 5F89B 1WAAF 3JWNC 1T20A 4QRQA 5D5MF 5FFLA 3F5WA 1U9KA 1T21B 4CMMB 5JHLH 2BVTA 4XVUD 5SWZA 1CD9B 2J8UF 2BNRB 3T3MF 5A43C 5I73C 4HDIA 4OD3H 2OR9H 2VMFA 1NEZB 3QIUA 5FM8A 5E24E 4OD2B 4OZIA 4L4VB 4FNLH 2NW3A 4QCIB 4KTEL 1Q0XL 1N5YH 1DQLL 1NCUA 1S7XB 3KLHC 1CD0A 5D7SL 4JRXE 1V05A 3LN4B 4MD0A 2VXUH 4JFDB 4DGYL 3QH3B 5ACZA 1UZ6E 1FGNH 3SCMA 4G43A 1ADQH 5FOJA 4V2BA 3M17A 4HJGA 1FHGA 3R1GH 4Z7UB 4G42A 4KRPD 4KVNH 3P0GB 4TNVF 5BS0D 3ZSSA 2OS7A 3NFNB 1ZKAA 1RUPL 2HYMA 3NGBB 5BCAA 3MRDA 4NQEA 5IQ7H 3MJ8A 3CU7A 4KUCD 4WWKC 1MCBA 5L88L 1A64A 4GAJL 5I8CB 1WFUA 2XACC 2FH6A 1TIUA 1XF4A 4HSQA 1T6WA 3WIHA 2FX8H 4NM4L 5I0ZA 2EDKA 2O61A 5I1HL 3LHPH 4JFEE 1KB5H 4QRTB 3OKYA 1D5IH 4HEME 5DUMH 1QFWI 1U8PA 2J4WH 1VFUA 4HGMA 2ZOKA 3WNNA 5GGQH 1MJ8L 2VXVH 4UT6L 3WBDA 3DRQA 3GMLB 1MUJB 4PY8I 3QUXA 1CLZH 4RNRB 1QNZL 3MRPA 3V5DB 2NX5B 1UZ6F 4UV7L 3KLAA 3RZCC 2KKQA 1VFMA 3GSUA 2BX5A 3TVMB 3B5GA 4JFZH 3TIDB 3WLWD 1CBVH 1YN6A 4KKNA 1J5OL 3MV9D 4DVRH 1A6TB 1TDQA 1Q9LA 3HI6H 3ZDYE 2XA8L 5KVDH 4BQ6A 4M7ZC 3ALWA 4NN5C 3OQ3B 1SHMA 3QIWA 1C7TA 4LHUD 4TOYH 2YEZA 4WIQA 5E2WL 1OAKH 3V8CA 5FM4A 5INCA 4YXHH 4PV9B 3GSQA 5K9QI 3QDHA 1E0OB 1JGDA 4Z95H 4AH2A 1UKSA 4N8PA 2H2PC 3RFZC 4EUPA 1HILB 1YMME 1XR8B 1FDLH 5CGMA 3MRMA 2WUCL 4JM2C 3CSPA 1RVFH 4KKLC 5IKCB 3EYOB 2DMKA 3L3DA 4PTUA 3MOBH 3FMGH 5FO7A 2YS4A 1ZOXA 3CUPA 3W39B 1L9MA 1C7SA 3ZDYF 2VQ1B 3CFEA 4FZ8L 2QQLL 4PJDA 3TCLB 4KI5E 1CGWA 3BISA 5B3NA 3C6SB 3O2DH 4HIXL 1KFAH 4FQIL 5C70A 2V17H 4P5TA 5JMOC 4KQ4L 3WHXA 1AP2A 5HYSA 1MIML 1Q9WA 4P57A 4NWTH 3U1SL 1BQLH 2WANA 2VIRB 1FG2B 3WCYA 5E8OB 4J8RB 1U8OA 4YFLI 5M7QA 1UWXH 1YYLL 1PG7L 1YEDB 2V2XB 4X8XA 1P6FA 1N0XH 2QR0B 3VFPA 1Z5LB 3QDAA 3ZYZA 2HG5A 4LPYA 1XR9A 3T65B 1OPGL 2X4TB 3K4ZA 3RP1A 5LAXB 2QQKL 1OB1B 4M6AA 1V7MH 1I75A 3VU2A 1RJCA 1DQDL 4E42A 4PP2A 2PYEA 1T0PB 3MA9H 4FXLA 1X5GA 4QTHA 4NO3A 4ZTOL 4WO4A 1F6LL 1UA6L 1BVLB 2F54A 4KI5F 3TWCL 4XPBH 3P4LA 1HYRC 2EDJA 1M71B 2EKSA 5DLML 4F7EB 3ULUL 4LVNB 1JWSB 3O6FC 4LASH 4Y89A 1U93A 3N50A 5DD0L 4LSUH 5BW7A 1L4IA 3PIQB 4MDIA 5E8NA 4F9LC 5DMIL 2HJFB 2ZG3A 5ERWB 1KPVA 2R4RH 3T2QA 4DAGL 3SPVB 5DTFB 4LOUC 3FQUA 3O6LL 5EO1B 4K07A 5LGJA 3DOSA 3LY6A 4NQUA 4HK3J 2H1PL 1Q8MA 3HB3C 3EFDL 4FP8L 5TH2B 4J1UA 2OJZL 1MNUL 5DQJB 1U95A 1IM3A 4P2OC 1OARL 5BS0E 1L7TL 2NNAA 4BSVA 3FT3B 2XN9D 2YK1H 3P9LB 5D93B 5D7IB 4F15B 2J2ZA 5DGRA 2PUQT 2XTJC 4YHLH 4NCC1 2E7BA 3ZKMC 2RIKA 5FYKE 2DIJA 5FO8A 5FXCH 4M00A 4HKXA 4KROD 2GW5A 1MH5B 4FRWA 1U36A 3KPSA 4RFOH 1I8KA 2MCPH 3LB6D 5FYKU 3WNKA 1CLOL 3GSXB 3FO0L 2XZQH 3PWUB 3WV0A 1A6PA 3TT3H 4ZTPL 5IR1B 1T1WA 1DUYB 4ONGH 5DJ6B 5GGRA 3C09C 3ULVD 4M5ZL 5BV7L 4JO1L 4UV4H 4L3EA 4LSVL 3GMQB 1MJJA 4QRUA 1QYGH 1W0VB 1BJ1J 1FNSL 5JHDB 3MV9E 4JKLA 3KLHD 3QNYB 3BMWA 1VENA 2ZUYA 4X9FA 1B90A 4HS3A 4XBGB 3BHBA 4XP6L 3IT8D 2FBJH 3I6LE 1YEKH 1L7IL 3N85L 2X9XA 3B3IB 1CDCA 1NGZA 3ARPA 1IEBA 2B0SH 4YQXL 4XVTH 3ZT7A 4WWKD 1CZ8L 2EDBA 1S9VA 5C0GB 2GHWB 3QO1B 3RNKB 4QRSA 1FORL 1J1PH 1D5ZB 1FLTX 1TCRB 4OZFG 5C0AE 2DIBA 2EH7L 3ARDB 4BZYA 1FV1B 5D72H 1WGOA 5GS3A 2Q1EA 2VR9A 1M05A 1KCKA 1H8NA 2ENYA 5D70L 2OZ4H 4C57C 1NFKA 4KHXL 4UTAH 5HVHC 4LIQH 5TDOA 4X6DB 3FQTB 3CFIC 1DANT 2FATL 1I7ZB 5F6IB 3RWCA 1P7KB 1QTYT 1MHPL 1UACH 2D31A 1YEGL 1F4AA 1P9MA 2G60L 4AEFA 4NYLA 5I15H 3RWGB 3ARGB 1R3HB 5HGGS 2W0PA 3D25B 3GBML 4K2UL 1SJEA 2CDEA 4JFQB 2R69L 2X89A 3D18A 2NY5H 3IDXH 5IM7B 4M9PA 1OL0A 1GVIA 1YEEL 1FVCA 5A16A 1KN4H 3DVGB 1ZHNB 2I07B 4G8GA 1FLRL 5DWUL 3WNOA 1FNLA 4HF5H 3P9WB 4Y5XC 3OL2A 2VR5A 3ZKXC 4YGVB 5IG7B 4JLRB 2UZXB 5DXWA 1J0KA 4P4KA 1IAIH 4P2CG 2DD8H 2H8PB 3SGJC 5BVPL 3CMOH 2R29H 3O3EB 4JKPL 4DFIA 1RI8A 3SDDC 1A6UH 3DGGB 1AH1A 4Q58C 2CLRA 3TBTB 2LTQB 4KJPC 4EOWL 2X40A 5CEZH 1LEIA 3BXNA 2MKWA 1J88A 3PV6B 3HAEG 3FRPA 3QHTC 4JDTL 3ARFA 1OCWL 1SEBB 5DRNB 1TQBC 3ZTJH 5DO2D 3GSVA 1UXSA 3C5SB 1HI6B 2GJ6D 4PRHD 1QKZL 5DUBB 4J6RL 2HFFB 2PW1B 3GHBH 1RUQL 3MRJB 4AM0B 1MCPH 3S34L 5DUPL 4PGCA 4X7SH 3VMPA 3QCUH 4QNPE 3HZYA 3DVNA 1CVSC 3I3EA 4K9EH 1KB5B 4J3VA 1KPRB 4ZUSB 3K2UL 1MCCA 1AQKH 1CXEA 4KUZH 2APWA 2OMNA 2YD2A 2QBWA 2XWBA 3QRGH 5GS0C 4JAMA 1ZGLB 4S1RH 3TA3A 2O5ZL 5JXAL 1FVDA 1CE6B 2YSSB 4L8DA 2FBOJ 2X4PB 5EFIB 2XN9E 1KLGA 4ACPA 3GJFK 4DKDC 4ZYKA 2HJLB 3TM6A 4JO4H 2B39A 4KQ3L 5IVXE 1ZEAH 4KZEL 4D9LH 1A7OH 4IRJA 4WU7B 3EYSL 3EHBD 1G6RH 3DXAA 4FZEH 4O4YL 2UVEA 4YO0B 5I1JL 4JKWA 1QHPA 4NT6B 4EDXB 3O8XB 3J7HA 4QNPF 1G1CA 1PSKH 2BVPA 3MLSL 4WHYG 2O5XH 4U1KB 3MCKB 3LD8B 2DLTA 4H0IA 5HGHA 4UT9H 4PRNB 2Q8BL 2A6KB 2FL5A 5C9JB 3IJSB 3HFML 5DSCB 1A1NA 1CFSA 2FX9L 3HCVA 5GPRA 3L1OL 3WUWG 1ZHKA 3DX8B 5AG9A 4WW1B 4APQC 1NSNH 4F80A 4HT1L 4LOUD 3T04D 5ICYB 4Y4HD 1N4XH 3DRTB 3EJZC 5IVXF 3QCTL 5AWNH 3HZVA 5C0CB 1S5HB 4LGSB 3AS2A 4YHNA 1F6AA 2WP3O 3OG6B 1NCAL 2NCMA 3JWOL 4CDGC 1MLBA 1MPAH 2D7PA 4YEFA 2R0KL 4PRIB 1S8DB 2QQQA 4WJ5B 4YHYC 3I50H 3MUHL 5T1LD 1CLCA 2ZCLH 2OJEA 1BEYH 4MJ5A 5L2JA 2K1MA 1ZT7A 4NSKA 3ZKMD 3MOQA 5C07D 2CKNA 2GI7A 5EIIA 4G8EA 4I3RH 5F9AC 1H3XA 3STZB 4Z76B 2RHEA 3ETBF 1WBZA 3O11A 1U8MA 3ESVF 3T1WA 5DJDB 4UIKL 1NEUA 4HGKC 3A67L 3O4OC 5HI5C 1ES0B 5FHBL 1T1YA 3UDWA 1HHJA 4U6XB 5F6HJ 2IPTL 4BUHA 5L0QC 3RGHA 5E8PB 2MKLC 3QFDA 3E2HC 2GT9B 2Y6SC 1QR1B 1QRKA 1EJOH 1WIOA 2XZAH 4ZOBA 4K7FB 3S4SA 3R4DA 1T2XA 4I48A 3WL9B 1BD2A 1KTLA 3WKNA 3SE9L 2FGWL 3VE0A 3MBXL 4K3HA 3TH3T 1F4YH 1S7SA 4GUPB 4PJCB 4X8JB 5E8NB 1JIBA 2A0LC 2H45A 3EJJX 4YXKH 1EFQA 1MY7A 1KIRB 4HXAL 1HHHB 2YMXL 1XGPA 3FFCD 3RUGB 1OP5K 5HGAA 3GDBA 3FB8B 5GGSB 1E6OL 4Q0XL 3BAEL 3BPLC 5EIVA 1JWMA 1MRCH 3ARTA 3CSYB 3CDGA 2BJMH 1AC0A 3UTZA 1AGDB 1EVUA 3G5YA 3BD4A 4CVWA 4PG2C 3OR6A 3TT1H 5GRZA 3LDBC 2EE9A 1ED3A 2HP4A 4QXWA 1CDUA 2ZJSL 4V1DD 2ZSVB 2J5LC 3VFVA 4HWZA 4G80A 2IH3B 4LARH 1IFHH 1MF2H 5CINH 3MREA 1GGYA 3EYQC 3JV4B 4HBCL 1NBVH 5JW4N 4HXBL 4Y4KA 1F02I 2Z92A 4Z5RB 3FQNB 3KJ6H 4OJFH 3RY6C 3QBTB 3VFTA 1I9RL 2DJUA 4LSSL 4CU6A 4LKCB 3KYNB 3RGVC 1FFPB 4P4RA 4MHHG 5JUEL 3MGOB 3T0WA 3VFOA 4DGVH 5IWLC 2IAMD 4Y2DD 1GZPB 4RAUB 5F7EL 4PS4L 3PL6D 4PRDA 2W0FA 1RU9H 4DQOH 3VFUB 5BRZA 2FD6L 5F7LB 4J3UA 4PJ9A 1VFBA 5C2UB 2BC4A 3DIFB 1YEJL 1GGUA 2FHCA 3IDNA 5IFJB 2BSTB 5T5FH 1HH6B 3VA2C 3TZVA 1D5XA 1XZ0A 3PGDA 1MSPA 2ZSWA 3GMPB 4OCSH 5D7JB 1EX0A 1KELL 4ELMA 2VLKE 4NNXA 3L5XH 4BZ1H 1G7JA 4JKKA 4JQIL 3ZKSD 3MRQB 5AG8A 1JFQH 2DQTH 5DJ0A 4XNZB 3SDCD 5T1KD 1AFVH 1Q72L 1ZHBA 2ADFL 2CD0A 3MMEB 4UAOB 5FKAA 1BQHG 5F9OH 2MHAB 5LGKA 2B7DT 4KC3B 1D5BB 3SDXA 4LAQH 1KCSL 5JPNA 5L6YL 2EECA 4AT6A 3VXUA 2XWJA 5GZOD 4KDTC 1PKQE 1U2HA 3EUUA 2E27H 1E4KC 3QXAA 3V4PH 4RA0C 3B2VL 5DFWH 1KEMH 3TJHC 1JPGA 4LLQA 2P8PB 5JTWA 5EUOA 3CCHA 2DQDL 2I25N 1VDGA 3A6CH 3UTTD 1IGCH 4OD1L 4F57H 3SKUD 4N9OB 5CMAA 1TTGA 4U2ZA 3C9NA 3KPPA 2X9WA 1XCQA 1ZVYA 3NOIA 2C9AA 2V6HA 1MJ7H 5FYJE 1FNGB 5TPWL 1LDSA 2ADJA 2G9HB 2ZOLA 4NKIH 4ZUTA 5IB3B 1A9BB 5GS0D 2AEQH 3FQRA 1T03L 5ANME 4NUJA 4CVZA 3ZKND 1S7RA 3MXWL 4QHNB 3IETB 4PP1C 5GGVH 3QAZB 4PY7A 3TYFB 4KI5C 5FYJU 2VE6A 4ELKA 4FQXB 2WNGA 4ERSH 1IVLA 1C5BL 2EDRA 2CKBL 2YA0A 4MNQB 4QXGL 5IOPA 2V5TA 5C07E 3EAKA 2V2TB 2O5YL 3L7EA 5BQ7B 1DBJL 4WW2F 5GGTL 3TIEA 3G5ZB 4U6VH 1A6WL 2BY2A 5DJAB 3CFCL 4Q6IC 4UINH 2ESVA 3W0WA 4NQCB 2C1OB 2W9EH 5EU3B 1XMWA 5IMLA 4P2QE 3LKPB 4AIOA 2MPAL 4ZPVB 2DYPB 4DGIH 1YMHB 3QDJD 2EZ0D 4IRSC 1E28B 1TETH 3W11C 4KK6D 4BSJA 2NY4B 5SWSA 3QP3A 5I1EL 3IFPA 2W07A 4DVBB 1NBYA 3RRQA 2ZP0T 1WISA 2RCSL 4JQVC 1FAIH 2JIXB 3SKOB 5E8DL 4EDWL 5JQ6L 4HBQA 1HWHB 1QZ1A 1ZK9A 3KPTA 1TVHA 1AO7B 3EJZD 1FYTA 4BUGA 1NGWA 2A6IB 3KNBB 1U8LA 3OKMB 2BY0A 3LZFH 5F1NB 2YRZA 2Y07L 5CJXA 2XA3A 2NLJB 1ODAA 3BT2L 3N1PC 2VAJA 4I3GA 4X7DC 4JG0H 2ZCHH 2IALA 1RUMH 4RGNB 3IJHA 1S9YA 2AXFB 2HKFH 5I1DA 1I85C 3MV8E 3QI9C 4G8FB 5ADOH 4OUOA 1EMTL 2JTDA 2IFFL 4AL8H 4K7PH 4OBRA 4P46A 3KGRA 1G0YR 4HAFA 5DJYA 4UQ3A 3HE6A 2VLJD 3H9SB 5FUZH 2BVQA 1GH7A 5INDB 4RIRA 3IU3B 3MROA 4LGPB 4LSTL 4GKZA 2DOCA 4XPGH 5CBEA 4OIAA 4XPHL 4ZXBA 5ISZE 5KVFH 2PXYA 4LF3B 2VXQL 4X6BB 5F1IA 4NGHH 3KPMB 1FPTL 5HI5D 3T77A 5CUSL 1I3VA 4P3DB 1IRAY 2BY3A 2ID5A 1U2CA 4LEXL 2D9QB 2H6PB 3M1BB 3DV4B 3UTQB 4YDLC 1KB9J 1XGUB 3FN0L 2Y6SD 1BLNB 1H3WM 4QF1A 2X4UA 1JHLL 3QXDA 1G6RB 1X7QB 5JORA 1RJLA 4EBQL 2NR6C 1KOAA 1G0XA 2AK4A 5GXBB 3FT4B 1NC4B 2R2CA 4HKBB 1NAKL 1FNHA 2CKBA 3QPXL 4O58H 1RK1B 2AGJH 4LLMB 1T0MB 4F37K 2A0LD 4BKLA 5JXEC 1BFVH 1RJZB 1IQDB 2BFVL 5EA0H 4JFXA 4OZFA 2J88L 3AB0B 4XVSL 4K8RL 3RBGA 1N6QH 4M62L 4NO0D 2CJUL 2NY3B 4GLRI 4I9WD 5F88B 4X5XA 1INEH 5E7FA 1A4KA 2CK2A 1MCOH 4KKCD 5D96C 4MNGE 4KRLB 2VAAB 3T2OA 3T0DA 3ILQD 1VFAA 3AS1A 4YHZH 3OKKB 2VDKH 2ICEB 1CS6A 2DAVA 3QXVA 4QRPA 5L2KE 3EYQD 4H8WC 5DJCB 1JE6A 2PNDA 4Y16B 4I4WA 4N0FA 1I9JL 3DARA 2ADIB 3ORJA 5HHPA 4U0RC 1T5XB 4WTZA 1XGQB 3VXSD 4OZGA 4QOKA 1FC2D 3DX7A 3LN9A 4RX4D 5EBMA 5E7BA 5T3ZD 1YECH 5BJTA 5MENB 4O5LH 2E7MA 4BFIB 4I0PA 3BMVA 4XC1L 1JF1A 4HZLB 4J2XA 4MXQD 5JOFB 4XPAL 5GIRB 1X44A 4JR9H 1QSED 3V4VL 1S7WB 1CFNB 3LKOB 2IPUG 2AJUL 2BOCB 4HCRA 1D5MB 2B4CC 5E00B 4EZMA 4EI6A 2N7AA 3EOTH 12E8L 3HAEA 4PRPB 1HEZA 4UB0H 5FA3B 3H8NA 4Z7VB 5J7CC 1BZ7A 1F2QA 1R6VA 3BH8B 3SKMB 3U4AA 5JA8B 4PJGB 5KSAC 4WEUD 5ALBH 3V5KB 3U0WL 1SYVB 4HWEH 1DE4A 4GAYA 4JVUA 3G6DH 1EEYB 4ZODA 1KT2B 4YHML 4NN7C 1OP3K 1S3KL 2R2HA 5CJ5A 3HMXL 2X4NB 4WTXA 4R7DB 5AZ2L 5JHLL 4EQ3A 3UYRH 2OTUA 5KOVC 1FSKB 3FB6B 4X4YB 4F3FB 2VC2H 1KTDA 2JJVA 4OD3L 3WFBH 2EDYA 5CZXD 4QT5A 1B0WA 4BQ8A 2YPLB 1CT8A 3F12A 5C08D 5TE6H 3RWDB 4OIBA 5EC1A 3D1MC 3VXMD 4XP5H 3NCFB 1N5YL 3CMGA 4I2XE 5EU4B 3TO4D 2OSLB 3I02A 2VXUL 5KS9B 3RWEB 1A6VL 4MAYC 1FGNL 1I9EA 1ADQL 2XTLA 5GHWL 1FE8H 3VWJB 3QHZH 3R1GL 4WHYH 4KVNL 3D2UB 3UTPD 4GSDH 5DQ9B 4PP1D 5I71B 1Z0NA 5IQ7L 2AJ3A 3S5LA 4HAGA 4QRRA 5JLZB 1HNGA 4FFWC 4NC1C 4P2RD 4P3CH 3PXHA 1XF3B 3MC0A 3MV7A 1H0DB 1HHGA 2XPGB 5KTEL 4JM4H 2VLJE 1KIQA 3PWLB 4MS8D 4FXKB 1KNOB 5J6HA 4AEEA 3LHPL 6FABH 2B20A 4U7SA 1KB5L 1D5IL 5ADPH 5DURD 2JELH 5DUML 3U2SA 1D9KA 2GJZA 2IANB 3EYVA 5GGQL 1NGXB 2VXVL 1HSAA 3GNMH 4DUXA 2C4XA 2EYTB 2XXMB 1CLZL 1G7LB 2PCPB 5K9OB 1BOGB 1RIUH 1NJ9B 2CLVA 4RQQB 2DQIH 2VLLA 1V3KA 1UYWH 3VFGH 4JFZL 1NLBH 1K5NB 3O9WA 3BO8B 2PW2B 4LPVA 2Q3AA 1CBVL 4AMKH 5FGBA 4GW4A 1SY6H 4Z0XA 1M6OA 5EOCJ 1DQJB 5H37G 3IKCB 4DVRL 1TENA 4YWGL 4BSWA 3HI6L 1QBAA 5KVDL 1HQRA 4X5WB 4IM8A 4JZJC 2ITDA 1UJ3C 1T80A 1T83C 3KXFD 1KTRL 3BGMA 3KPPB 4CN1A 3HMXA 4QGTA 4TOYL 5E9DD 5GQBA 1OAKL 5C71A 4P5MA 2UWEE 4M5YH 3SHSA 4YXHL 4F7TB 5HY9B 2JF1A 3K8KA 3PJSA 2F74A 3W9EA 4TTGA 4KROB 32C2A 4Z95L 3SDAB 2N7BA 3GSWB 3SJVB 2JCCA 2AJVH 4NKMA 4XPTL 2R1WA 1FDLL 2FECI 4YHIB 1RVFL 4HUXB 5IBTH 4OM0L 2WM0A 4P9HC 2NY1B 3MOBL 1E4XH 3FMGL 3L7EB 3QIBD 4HK0A 5E8EA 2VXTH 3G6JA 2CDGB 3RNQB 3QQ4B 3LV3A 1VGEL 3JBG7 3U0TB 3CFDA 3TV3H 3KJ4B 4OLXH 1SMAA 2AQ2A 4FXGA 3S3PA 1KENH 4NQSB 3O2DL 3IAQA 1KFAL 4U3CA 2NR6D 1B6UA 2SEBA 3PDOA 4N8VA 2V17L 3P4OB 1SYSB 1CDBA 2UWEF 3G5XB 1A9EB 3B9AA 4HHAB 4NWTL 3VD5A 1BQLL 3GFUA 4J3WA 4PV8A 1HHKB 2I9LA 4MJIA 2VLRB 1OVZA 2DKUA 4HMEA 5EB9A 4KZDH 2G75B 1N0XL 1N64H 3GRWH 3O0RH 4JFYB 3QUMH 4XMLL 2HT2C 1JP5A 1H5BA 3ZHKA 5GS2D 5DD6A 1QBBA 4ZNEE 3PABB 4HH9A 5D9SB 2OTWA 3WDJA 3GJEA 1ACYH 4EEEA 4AG4H 4L29B 2CO7B 4HPYH 4ENEC 3MA9L 3STBA 4W70A 4YR6A 1J05B 3BKCL 3WE6A 5KZCB 1CLYL 4LQFH 4XPBL 1NUNB 4OM1H 5HPMB 2X1OA 3IDGB 5LGHH 4UQ3B 4TVPD 1UQSB 4QY8A 4LASL 1TZHA 4HC1H 2IBGA 1I8IA 4JCLA 2DWEB 1YN7B 5TDNA 1VACB 4LSUL 2C1PB 3RZCB 2F5BH 3UJJH 3IF1A 4ZOAA 3D3VD 3EDKA 3FFDA 4JN2B 2R4RL 2EIZA 4GRWH 1ORQA 3RJDA 3G5VB 1MAKA 4DKAA 4WEMB 3VCLA 5FGSA 1MCQA 4M7ZB 3DTXB 4NN5B 5F70A 2CDFB 4LNRA 1IGIH 1T89A 3OJVC 1BQHA 2KL6A 2AQ1A 2EDQA 3OKNA 3QUYD 4EVNB 2EYSA 4PJFE 2A73A 1MCWW 3TBSB 3AREA 3F58H 3UTPE 3LEVH 1V3JA 4JEGB 1B6DA 4O9HH 2YK1L 2F19H 3ECBB 2H9GA 4YHLL 3TPKA 3D85A 4Y4FC 5E4EB 4L4TD 3D6GA 5KSAD 5ABDE 1B4JL 1IC5H 4AY0A 4ZOCA 1DN0A 3K3QA 2Q7YB 4I1NB 5TF0A 3L3OB 2R56H 3KYMA 4JM2B 4D3CL 3PQYA 4RFOL 1LE5B 2MCPL 3ARBB 1C08B 4MNHA 4R0LA 3V5HA 1CTNA 4NZTH 2XZQL 1KCVH 3RWHB 5D2LA 4AQ1B 1BVKB 5E94A 1UWEH 4C56B 3RL2B 4ZFOA 3U36A 1CWVA 2NZIA 3TT3L 5MEOA 5DEFB 2HLFD 1U8HA 4ONGL 3SE4A 3EO1A 2WBJD 2AEPL 3TPUA 1EUTA 4N0FB 2BDNH 5KG9A 1XF5B 4UV4L 1KEGH 3ROOA 1WFNA 2OLDA 3IRPX 4PJFF 2ZUXA 5HHOD 4E41E 3OG4B 1T4KA 1AGBA 1QYGL 4JFFA 5SV4A 1I7UB 2MFNA 2YPKB 3EO0A 1XIWC 3WS6A 3FAWA 4Z7WB 1HDMA 2BSRA 1LO3H 3ZZ1A 5D1ZC 4BK4A 4HJ0C 4WEBH 1YEKL 4JB9H 1J0JA 1EAJA 5KANI 4IMLB 5E9DE 3LQZB 4TSCH 4G8IB 4WFGE 4PREA 2R8SH 1MHHA 1Z3GH 2WINB 2FH8A 2B0SL 4XVTL 4WUUA 5EN2A 2WUBH 2BSSA 3IFNH 4ETQB 2HRLA 1J1PL 1LEGA 2FYYA 1FJ1A 5C0BE 2ZZUT 1Z2KA 5D72L 2W91A 4EI5C 5D6DC 1INQA 2AJZB 4OI7A 3BPCB 2OZ4L 3QEQD 4UTAL 3O6FB 4S1SH 2XQYG 2E8ZA 3HRZA 4HIHA 1IAMA 2Y7QB 1UACL 3FB7B 3HE7B 3TN0D 5I15L 1U42A 4JREB