1YN6B

Crystal structure of a mouse mhc class i protein, h2-db, in complex with a peptide from the influenza a acid polymerase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Lack of prominent peptide-major histocompatibility complex features limits repertoire diversity in virus-specific CD8+ T cell populations
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yn6B00
4AY0A 2ZJSH 4IMKC 3L1OH 1EV2E 2JIXB 3R0NA 5C0GB 1JHLH 3RAJL 1WIOA 3MQIA 4RMQA 1RPQA 5FDYA 4KRMB 5DMKB 4PV9B 1XF3B 3LS5H 4U6XB 4PUBL 3W5MA 1A7PH 3UBXA 4KQ3H 3LEYL 4OCRL 2FR4B 4NGHH 4ONHB 4BFGA 4K7FA 3KYOA 3B5GA 1QRKA 2NXZC 4ZD3L 4F2MB 2V9RA 1QSEE 5E2VH 2BSRA 5D96C 3ZKND 2VSCA 1RZJL 3MV9D 3AREB 1VGKB 3QDJE 5I17B 1CZ8L 3RHWF 2D0HA 1UZ8A 1W8OA 4N9GB 4IIQA 1JYVA 1QFUH 3U4AA 3X3FL 5TQ0L 5JLZA 5B38A 1MWAA 3IFLL 2VLKB 1HOCB 4NM8H 1J12A 1I8MA 4UDUB 3MNWA 3GKWH 3WSQH 2Z92B 4ZFZB 3LAFA 3FTGB 3S37X 4TRPL 1E4XL 4HBCH 2V5MA 5ISZA 5TF0A 3W9EB 3QQNA 4KRLB 4Y0GA 2EYRA 2AEPL 4HKJA 4GRLA 1KCKA 2ZOKA 1AIFB 3VRIA 1HN1A 1QTYT 4OQTL 5HHVH 1F45A 2WBKA 3ILQD 3STLA 2XN9A 1SM3L 4Q97A 1IKFL 3KDMA 3Q6FA 4L8DA 1W8NA 4RAVA 4AQOA 2CDFB 4OLEA 1WT5A 2JJSA 5HY9A 2RB8A 5C1MB 1NCCL 4DVRH 5I15L 4YQXL 5LGHL 4JRXE 1A6WH 3OZ9L 1IC7H 3V52L 2LU3A 1A1OA 4TVPH 1XGTB 3GIVA 4WFHD 3DMMD 3KR3L 1NBYB 4HQQL 2CPCA 4UZGA 2BSSA 3ELAT 5DVNA 3IVKA 1EJOH 1EK3A 3FT2A 4UV4H 4P5MB 3KPQB 3VMPA 1PQZB 1UWXK 4CKVX 1MFBH 4U3HA 4AIZA 4HGWB 4DW2L 5HPOA 3VXRE 2R56H 2XYCA 1KXQE 1K6QL 1QA9B 4PD4J 5I74B 1V8HA 1Q9OA 5T5NF 2P5WA 3BO8A 3BIAX 4WHTB 4AMKH 2YPVH 4XX1E 1RUMH 1RK0A 2YBRB 3VI4F 1IGFH 2A73B 4I77L 5HGAA 3I6GA 4WFED 1VGEH 4KK9D 1X5AA 4O2FA 5GIRA 3BJ91 2YD9A 4OF8A 2ZSWB 2F8VA 3MGOA 1INQA 2IAMB 3KPSE 3KYMA 4XVUC 1U8HB 1Z9LA 1AGDA 3RKDD 1KCLA 1BVKB 2E7HA 4HXBL 1U8IA 3WFEL 3D2UB 2R69L 1NMCB 3H3PH 4JKWA 5EU5A 3D69B 3QO0A 5FO8A 5LAXA 2ATPA 4GUPB 4PB9L 1JRHH 3VI3F 2YR3A 4RGMC 2XKNB 4QHMA 3BEVB 4APQA 2BOBA 4M43H 1SMAA 4ZTOH 4KROB 1DCLA 5EO0B 1L0YA 4J6RH 4WUUD 3QPQC 2VXTH 1ZMYA 5C0DA 3C2SA 3D25B 2Q86A 2AQ1A 3BN9D 4AT6A 1Z6JT 2Q8BL 5DFTA 1I7RB 25C8L 4HJGA 5ITBL 2VZSA 2OP4H 1A6TA 3EO1B 4NRXB 4X7SL 2OQJA 4LDOB 5E2WL 2EEAA 4WHCA 4LSQL 3IFOB 2GTWB 5ICYA 1S7SB 2YK1L 4KI5D 4LHUB 1FORL 3VGDA 3OR7B 5HI4D 1DN0B 2IG2L 4NN6B 3F7VB 1SHMA 5GGQL 5F89B 5FM5O 3R1GH 4JY5L 2CKBL 1MVFA 3A0OA 5ACMA 3BKYL 3VGGA 5C0AA 3ZTNL 4L3CB 4NUGL 4POZD 4FQXA 5MEOB 3V6FA 3WLBB 3SHSA 5KN5A 3HZMA 5I73C 4GG8B 4OD3H 1CL7H 4AK1A 3HMXA 1BFOB 2A9ML 5C0IA 4JG0L 3SJVB 5CLWA 1FZKA 4R26H 1L6XA 1HCFX 3WJJC 4JPWL 5L6YH 4PJHF 4U6YA 3D3VD 5H35B 4JM2D 4V1DB 5INCB 2IFGA 3DV6A 4IHOA 3X3GH 4XCCL 2VZVA 3D39B 2EDQA 4XBGA 3SDXE 4FA8A 1G7QA 4JLRB 2WBJA 4BZ2H 4PJGE 4NO0B 2ICWB 2IANB 4ODHL 5AYUH 3CCHA 3QIBA 1TCRB 4ZAKC 2R2BB 1RI8A 4JPKH 1TCMA 3WO4C 1AKJD 2IH1A 4H88L 4RISL 4G5ZL 3WFCL 2FHBA 1LDPH 4XNMA 5C07E 4X8XA 3CU7A 1OAQL 3KLAB 1A6UL 1CFBA 2VZOA 3BHBA 4OSUL 5FYKL 4RFEB 4NOFA 4PTUB 4PJ5E 5HVGB 3RTQD 4HBQA 4X9FA 1YEDB 4PJHB 1XF4B 4BQ9A 1MREH 1JPFB 2OJEA 3VRLF 5FA3A 5JXEA 5F3BA 2DYPD 3C6LB 3KYNB 4XMLL 3UTSE 2HT2C 4WHDA 4LSDA 3ARPA 2RBLA 2GAZB 3W9DB 5JW5A 2VYRE 5GGRA 4R8WH 1DQMH 1Q38A 4TUKH 1JWSB 5D9SB 4LCIH 1T5XA 3NA9H 4MX7A 5JIKA 5SWZE 1MCOH 4MQ7B 1D5ZA 2VKXA 4Y4KD 4DTGL 4F80A 5GRXG 4Y5XA 5TDNA 3FO0L 2PXYB 4G6ML 3U4EB 3UJIH 2O5ZL 1NAML 5C0BA 1CGSL 1C08A 4KWUA 3VFGL 4JFDB 3GB7B 1VESA 4QOKE 5GRZA 2NX5D 4BKLA 5IMKB 2FX7L 1JZ5A 5GS1C 1BX2B 4F8TA 4JN1H 3B2UC 2E6JA 3ARQA 3MBED 2W92A 3WDJA 4Q9RL 2XTJD 1FSKB 1Q9WA 3EO9H 4MJ6A 4CN1A 1UCBL 2W9EL 4XCNB 2OTWA 3FFCB 5DTFA 4LLVB 3RUGF 1BZ9B 5BV7C 3KWWA 1UM4H 3WKMH 2AJYH 1CBVH 3WBDA 3MNZA 3LKOB 3AAZA 1R3KB 1P4BH 4K8RH 4RGNB 2X70A 3KJ6L 5C0JA 2K7PA 2JLLA 3HE7A 2PCPA 1ZT1A 1FVDA 5JOPD 5DDHA 3RDTD 5I1HH 3P73A 3FHAA 5IBTL 1IT9L 3GDBA 4YH6A 1J18A 5TPWH 1CS6A 4M00A 3QRGL 1LGVA 3TBVA 4I3SL 3U7WH 1G9MH 3RWHA 1N7ML 5DFWH 3S36L 3TN0B 3FO9A 3MJ7A 2CSPA 3EYUH 2HT4C 5BOZG 3G04A 2UZIL 3RVTD 3ILPA 3CFJB 4Y16D 4YGVA 3EOBA 4ZPTA 4XC3H 4G80A 2AP2A 4Q6YA 3NZHH 3TEUA 1PFCA 1X5YA 3DX6A 1RU9L 3VE0B 1S7XB 4X99B 4NO2A 1EUUA 4LVOB 3QEUB 2VLJA 3RUGB 1EFXD 4HF5L 2AJ3B 5JZ7C 4ZS6D 1DUZB 5JQHC 3RJQB 5KW9H 1HI6A 4LCWB 5T3XH 4UU9B 1OLLA 3ULUF 5D6DC 1WTLA 4XVJL 3F12A 5C6TL 3FFDA 4EI5B 4LLUA 2P24B 1LQSR 1XGPA 3HAEB 1DBAH 3P9LB 5MERB 4XNUL 2CLRB 2DQIH 5B22A 1MWAL 3CFBA 1OAZL 3L3KB 4P2OB 3ZKXC 1AXTH 4HULB 4DGIL 1HILA 5E08L 1G84A 3O11A 2I07B 3MOBL 1M05B 3SDDA 3LN4A 3GMQA 2AW2A 3OB0K 2QHLA 4FQQA 2P8PB 4LCUB 4JFXB 1Q0YH 4GW5A 4IRJB 4WTZG 4YGAB 2ZCHL 1I8IB 2ED9A 2QTEA 5BS0A 1JNJA 3ZZ1A 15C8L 5ERWB 4PRPB 1XFPA 2ADFL 5EORH 3RP1A 3H6JA 4CADA 1RUPH 2H32A 1LP9F 2D7PA 5E94B 4WWKA 1F58L 3HNVH 1AC0A 4RNRB 3WE6A 5AZEL 5JPMA 2BVQA 1MLBA 4KU1A 4JKPL 2IADA 3BQUD 2ZKHH 2JIXA 1LWRA 5C0GA 2GKIA 3QWQB 3UJTH 5J4MA 2Z8VC 3TF7C 1IGCL 3CPLB 5DR5L 4YDLC 3KXFB 5DMKA 4PV9A 4ZOAA 3QDMD 1XF3A 4U6XA 3MZTA 3GI9L 2FR4A 2LAAA 3SQOL 1IC4L 5L0QB 5C8JA 2VZ1A 1KEML 4R90L 1OAUH 4F2MA 1DLFL 1MCWW 4HW6A 4NCDA 1N59B 2VN7A 2NXYD 1LP9B 3AREA 2F54D 2HMIC 1VGKA 3R06B 5I17A 4BZ1H 5DK0B 3WLWD 4N9GA 3NPSC 4FQIH 4XNZB 1KENH 12E8L 3D87B 4IDJH 2VDLL 3NPZB 4OT1H 3UYOD 5MHSE 2VLKA 1HOCA 3IDGB 4NQCB 4UDUA 5EU6B 5BRZB 2Z92A 4ZFZA 4CUCA 3FTGA 3SE4C 3HMXH 4KV5F 1KN4L 3RL1B 4M3JA 1BQHB 4KKLC 3VH8G 3C60D 3GKZA 4TTDC 3U7YL 4IRZH 3M8OH 1I8LC 3DBXB 3UEZA 1GOHA 4KJPC 3W9EA 3ME0A 4M1DH 2VLME 4FXLA 2BRRL 1AIFA 1F42A 3QXTA 3VXME 4NYLB 4TSBH 1JWUB 3UTOA 1ADQL 3BZDA 3RY6A 4K7PH 4I2XE 3A67H 3BI9X 2IMMA 3PE9A 3SDAB 4M3KB 1NCAL 1MAML 2C4FU 2CDFA 2N7AA 5L2KD 4WEBL 2H9GA 1O0VA 3HRPA 3ARRA 4HC1A 2D7TH 4OGYL 3H3KA 1S7QB 2YA0A 4FZEH 2FNBA 3C9NB 4U6VL 5KZCB 1XGTA 2WV3A 3H9SE 1S7UB 1NBYA 5I1LB 3W2DL 3G6DH 4V2BA 1EO5A 2J88L 4RGOL 3LS4H 3EJJX 5GGSY 4MNQE 2Z9TA 4P5MA 3KPQA 4PRID 1PQZA 2BY1A 5LXGL 4HGWA 2Y9RT 2AXGB 3P0YH 2HFTA 3IDYC 1QA9A 4HUMB 3QIWB 3MR9B 2FH6A 4YO0B 4H5SB 2DDQL 4OF6A 3TA3B 4WHTA 2DTMH 3VFSB 3ES6B 2YBRA 1IILE 5AEAA 2A73A 3MUY1 1B6DA 1PKQB 2PKDA 4ZNEE 4WO4C 4DGVH 6FABL 2ZSWA 2HTKD 3QEQE 4L1DA 3MV7B 3QQ9C 2KQNA 1VEOA 4FMFA 5ECJE 2IAMA 1U8HA 2BHYA 1I9IH 2O61B 5HVHB 1BVKA 1VKXB 4JVWA 5DXWA 1U8MB 3D2UA 4JO1L 3TZVC 3D69A 3DROB 2QV2A 1JI2A 2WUBH 4GUPA 4WUKH 2R23B 2WMPA 2XKNA 5LVEA 3BEVA 4HLZH 5FCSH 4ONGH 3AMLA 3HR5B 2JJTA 3MRJB 3B8YA 3DOSA 3SGJA 2BHZA 4D0BB 5EO0A 1NAKH 3DGCR 4HHAB 3MV8B 3SGKC 2NY6C 1FDLH 3D25A 1CR9L 1CTNA 3U6RB 5CJXC 2AEQL 1I7RA 5GS0L 1MAJA 3EO1A 4NRXA 2VH5L 2E9JA 4Z77B 1U8LB 1CD8A 3IFOA 2GTWA 3TH4T 3EDFA 4G9FE 1S7SA 3B2VH 4GAJL 3D0LB 4TNWK 4LHUA 2R8SH 3OR7A 4GS7B 5L8KB 2YD8A 1DN0A 5EN2B 2XRAH 1NC2B 3F7VA 4OLYL 4UV7H 3GM8A 5F89A 4KDTA 2DQTL 4YHNB 3WFBH 2BVUA 1WIPA 3MACL 2QHRL 2OL3B 5MEOA 4PJFF 3WLBA 3BESR 5I8EA 4GG8A 3V6OC 4YBHA 5I1GL 3TFKD 1Z9SA 1BFOA 1XCQB 4HKBB 3SJVA 5L8LB 3VW3L 1DBBH 2I5YL 4JREB 3EOYG 1PVHA 5MENB 2JELL 4LSTH 3HUJF 5H35A 4AEIL 4V1DA 5INCA 5C9JB 1K3IA 1QLEL 4JHAL 2ADJB 3D39A 4ELKB 2GY7B 4X83A 4EQ3A 5BV7H 4PLNC 4NO0A 2ICWA 2IANA 5JO5B 4D9RD 1E0OB 1TCRA 2Z31B 3HI6L 3I9GH 4PJFB 1A6PA 4KZEH 4WI6A 1JFQH 4NQXB 4XXCC 3CJJA 4QY8B 3BZFB 3UO1H 1OW0A 3KLAA 4ONFH 2J4WH 4N5ED 4NQED 1WUNT 3MRPB 4PTUA 2ZUVA 4TPRH 4G6FB 1YEDA 4D9LL 3K8LA 4PJHA 3HUJB 1TJHL 1CLOL 1XF4A 1JPFA 3DV4B 1C1EL 4YFLI 5ISZE 4PLJD 2XKSA 5D70H 4G6JL 3LD8C 4P4KB 1MFDH 1NCTA 3C6LA 3KYNA 5EIVA 1KUMA 1NUGA 3T0XA 1FFOA 1CFQB 1BD2B 1HQRB 1LDSA 2DQHL 3U0TB 2GAZA 2XZQL 3W9DA 1I1RA 5GS3A 4LHQB 1JWSA 4R6UA 5D9SA 2XN9E 1A14H 4EQ2A 5BQ7B 1B90A 2JB5L 4QF1A 4KC3B 4MQ7A 1FYTB 3LKNB 3VD4A 2EXYD 5IW6B 3QAZC 1GHFH 2YHGA 2AGJH 2PXYA 3E6HB 4GRMB 3U4EA 1NCUA 4YDVB 4F57L 4PFEA 4H20H 5FV1L 3EZJB 4WU5B 1NGPH 3T3PE 4Q9BA 1M71B 3GB7A 4JFDA 5IMLB 4F3FB 1BF8A 2ZNXA 2JKXA 2KZ1B 3RWDB 4ODTL 2A6JB 5ANMB 5IMKA 2YWZA 3P11L 1BX2A 4M5ZL 5K9KB 1CFTB 1IAMA 2ENYA 4MYWB 2VE6B 2WLZA 4XCNA 3FFCA 4LLVA 3RVUC 1BZ9A 1I85A 3RGVC 1KPUB 4F15C 3ZE1E 4Z0BH 2XT1B 3UTTB 3LKOA 1R3KA 5EZIL 3B9DA 1CICB 4EXKA 4KKAD 4Y1AD 1K4CA 5F21B 2P5WE 1UT9A 4NNYB 2D4FA 3BH8B 2R4RH 3CSGA 2BX5A 1MH5B 4F7TB 2V9QA 2IFFL 2MTPA 3TN0A 1TJGL 3ZDXF 2EDRA 3GHBH 5DC9B 4YHZL 4LRIC 3CFJA 5GJTH 3SO5A 1RULL 1SY6A 1MCKA 3GIZH 2NTFB 4YHOL 3VE0A 4HC1H 1S7XA 4X99A 2MCPL 3V7AG 4P46D 3UZVB 1DQJB 3QEUA 4M61B 3RUGA 5C70A 3EYSL 2AJ3A 1MJ8L 3BWUC 3N85H 3V8OA 3BPNB 4LCWA 2X6MA 1EHNA 3GK8L 2VITB 1BBDH 4PJ8B 4EI5A 1TZIB 5BW7A 3J7HA 2P24A 3VJ6B 4MGXA 4TVPD 1T7WA 3VXSD 4YK4C 1WIUA 3HAEA 3VXPB 5CEZH 3G9VA 3P9LA 5BMFL 2CLRA 2I26N 4ZFGL 4AQ1B 4DKFL 1ZANH 1DBJL 4K71C 3CFCL 1PG7W 3QNYB 4YX2H 3L3KA 5F7DA 4P2OA 4FXKB 4XMKL 2DL9A 1W0YT 2I07A 4HIHB 1M05A 5LJYH 1YQVH 1E4WL 2P8LB 2X4PB 2P8PA 4LCUA 4JFXA 2OXHA 4IRJA 3KPRE 2X1OA 4ETQB 1I8IA 4U1KB 2M2DA 2FX8L 5ERWA 4PRPA 1P7HL 2G5BB 3A6CH 4NT6B 3MRIB 5F1SA 3SE9H 5C0AE 3T0ED 5E94A 2XY1A 2A1WH 2KDGA 5KG9B 4LEXL 4RNRA 4X80L 9CGTA 2ZUWA 2XOTA 3LRHA 4LMQI 1OQXA 5DHVB 2OX5A 3HC3H 3MCLL 5EULV 2X4NB 5D1XD 4K3JH 1MI5D 4C56D 1GGYA 1MPAH 3A6BL 3CPLA 4A6YL 3KXFA 1TTUA 1UM6L 5DUMH 5DURD 4CRPA 3P30H 1GL4B 3V0WH 4GAYB 1A7RL 1BFVL 4N0YL 4PJEF 3UC0L 5JUEH 1YEHH 3EYFB 1UYWH 1N59A 1KCVL 3I2CH 1XIWC 3U9PL 1LP9A 4Q9QH 1T1XB 3S8WA 5F6IC 4P2QD 3QUKB 2OTUB 1YEEL 3R06A 2BP3A 4JO3H 5DK0A 4ODSL 1CXFA 2DMCA 1T83A 3K1DA 1RZ7L 3GMOB 4Q58C 3U48A 3LIZL 2DQDL 3IDGA 4OLUL 3GO1L 5EU6A 5BRZA 2NZIA 4XPTL 5IB4B 2Y06L 3RL1A 1BQHA 2AVGA 1UEYA 5DHYB 4LPWA 4PJEB 3Q5OA 3DBXA 4OV6F 4KUZL 1T7ZA 5IOPB 3CXHK 5EUKA 3NABH 1HSBB 1I9RL 3O9WC 4XVSL 3ROLB 4NYLA 4RDQF 5KSAB 1JWUA 5DI8B 4Q74A 2YKLH 1OCWL 5HVWA 5TFSH 5C0BE 3L3JB 1DJSA 3SDAA 4PUBH 4KRPB 3LEYH 3RZCC 5EU7C 2NY0D 3HE6B 1AE6H 3D9AH 1E4XI 1TDQA 2FATH 2ICEB 5IR1B 2B8OT 3CSBA 3C9NA 1D9KD 3SQBA 3T2PA 5F8QC 4R4FH 1RD6A 1S7UA 2EYSB 5I1LA 5DRNB 1CVSC 3C5ZC 4LIQH 5C09B 1MCNA 1UB6B 4HWEL 3O81A 4PB0H 3X12B 2NW3B 1MRDL 3FAWA 4UT6H 4HPYL 4ZOCA 1PBYA 3OAYH 1GC1H 3ZTJG 2DD8L 3FMGH 1RZIB 2AXGA 3WS3B 4P4RB 2A6KB 3IDXL 1QRNB 2VC2L 3QIWA 3MR9A 2DWEB 4TRPH 5IQ9B 1J05B 5TE4H 4YO0A 3R4DA 4H5SA 5J6HB 1CXLA 3TA3A 4XHQA 4KAQL 3VFSA 3WXWL 3ES6A 3VXUD 1E4XH 3FN0L 4UTBL 1ERNA 3PWPD 3CFEB 5L88L 1PKQA 2J8UF 4DKDC 1IGML 4KK6C 3ZHLA 4G7VL 4KMLB 3BKJL 4ODVL 2R4SH 1SYVA 4QHKJ 2VLJE 1N64H 1QNZL 1YY9D 3MV7A 4JCLA 4JFYB 2D03L 3FQTB 4Y2DC 3RVWD 5HGGS 4LNVA 4XPHH 1UB5B 1JZ7A 1N0XL 4HEPG 2O61A 4P0DA 1VKXA 1Q0XL 1U8MA 4XAWH 2P46B 3PGFH 5FM5M 5C08B 3DROA 3VFRB 4CVZB 3NGBC 4KMQA 4MAYB 3T09A 2PO6B 2R23A 4D0CB 2AAVA 3EDDA 4RSVA 1E4KC 1I3VA 1YECH 4UQ3B 2P5EA 1ZLVH 4CMMB 3HR5A 3MRJA 3V52H 3F65A 1OM3L 3TPUB 4D0BA 4HHAA 3MV8A 4EUPB 3IDNB 5SWQB 2J8UB 4K8RD 3TYFA 3U6RA 3FKUS 3MLUH 1NPUA 4NC0B 2Z93B 5I1DA 2R0ZL 1TITA 4OFYD 5BS0E 1U8LA 3P77B 2DQGH 5IHZB 5E6YA 3DETD 5D7LA 3GRWA 3QQ3B 4DW2H 4X5WB 5HD8C 3D0LA 1SY6H 2BVOB 4Z7OF 2B1AH 1DQLL 5FKAB 3TBTB 5EN2A 3FN3A 1NC2A 1DQDL 1YA5A 1F8TL 4YHNA 1YY8B 3WIIH 4D3CL 3BVNB 1VERA 2VQUA 3BRDA 1C5DB 2OL3A 2EYTB 4TYUA 4QXWA 5EC2B 5DHXB 1QUNA 2P4AB 2Y36L 3P4OA 3S35H 1XCQA 2NXZD 4HKBA 1BHGA 3OKMB 5EOQH 4NWTL 4HXBH 1FH5L 1JNHB 3UROR 1KNOB 2HKHH 3ARBB 5MENA 3CVIH 2Q7NA 5K59E 3GJFH 3MTRA 2ITDB 5A2JH 5C9JA 1FQ9C 3HMWL 3IXAB 1F4WL 2BCKB 1FAIH 2ADJA 1J0HA 4ELKA 3K4DA 3AB0B 1UWEH 3THML 4BELD 3DYPA 2AKRB 3KJ4C 4E5XB 2YMXH 1BJ8A 1GGIH 2Z91B 5IVOA 5JO5A 4UBDD 2VLKE 2Z31A 4ORGB 4PJFA 4QXGH 2OR7A 4X7SH 5D5MB 4NQXA 1QBLL 1LNUB 3O3DB 1ZT7B 4QY8A 5KVDL 4FQ2H 3LRSB 1YEIH 3BZFA 3G9AB 1FGNH 4KFZC 2P43B 4IMLB 2EKJA 1U3HC 5CD3B 2XQBH 1KOAA 1ULVA 1H5BB 2IG2H 3KPTA 3BGMB 3HUJA 4DQOL 1NCBL 3DV4A 4EEEA 3VMNA 3U46B 1ZLUH 3QCVL 3P0VH 3VWJC 2VNCA 4XH2B 4P4KA 3ZTNH 2YA1A 1YEKL 4P5TB 1R5WB 2FDBP 3HC4L 1HQRA 1CFQA 1BD2A 3U0TA 1KLUB 2RR3A 3GBNL 5SX5H 5BQ7A 1YEGH 4JG0H 4ZPVB 5KSVB 5I18H 1FYTA 3LKNA 3VGBA 1OTTD 4HMCA 1NEZB 3RWGB 5IW6A 4JPWH 1J1XL 4FQHB 3S97C 3UYPA 3E6HA 1EGJL 1UXWB 4YDVA 4JR9H 4WU5A 3AU1B 1X5IA 1QFWL 3B5HA 1M71A 3FQNA 3O2WH 5DD0L 5IMLA 4N8PA 4F3FA 3CNKA 4FFVD 3DARA 3RWDA 5HYIA 2O5YH 4LQ1A 2A6JA 5ANMA 5M7QA 4ZXBC 3MV9B 3MBXH 4AIXA 3V4PH 5F9AC 3HLAA 1IEAB 3NCCB 1CFTA 5J13B 5K9KA 1FGVH 2VE6A 4UDTB 5SV4A 4IJ3B 3F8UB 4WW2C 1KPUA 1UKQA 4EDWH 5FYLH 4U0RC 4RISH 3UTTA 1CICA 1S78C 2DI8A 1EH9A 3JSSA 4MQXC 4WVRA 1A6UH 1G7JB 2FLRT 4OSUH 5D71H 3S37L 4NNYA 3BH8A 4YHIB 1F13A 3ULVL 1MH5A 3GSWB 4F7TA 1EEYB 3ESVF 4TOYL 4DGYL 4XVUD 2F19H 4OFPA 4LCCB 2F5BH 4O58L 3SE8H 5I8OH 3BDBA 3MRFB 5KTEH 5JXAL 3I6KB 3MMEA 1BGXL 2NTFA 5C0NC 3MLZL 1U42A 1W72L 1DQJA 1NFIB 1AR1C 4FQJL 4M61A 4TVSa 1JL8A 4OCWL 1YNKL 1S8DB 3FO0H 1B9ZA 3LKPB 4G6MH 2O5ZH 5DJCB 3QPQD 5EH1A 2VITA 5IFJB 4PJ8A 1TZIA 4URTB 1A9EB 4QRUB 3VJ6A 2ZG2A 3BZ4B 4BSWB 3P4MB 2B7DT 4OCLC 4HFUL 3TO4C 5DVMA 3VXPA 1MOEA 3MO1B 3PWNB 2FX7H 4LP5A 5IK3B 3TLRA 3VI4E 4GKZB 1KB5H 2GJ6D 3SKMB 5J12C 2BJML 2J6EA 4HFWB 3DMMB 3QNYA 3UBXI 3LN5A 2W9EH 3WV0A 5GRVL 2AJUH 4HIHA 4QRRB 4FG6D 5GGVH 2OR9L 4I13B 1A64A 2BVEA 3O0RH 3Q3GB 3CZJA 2P8LA 4S1QL 5DD1L 5FYJD 1TQBB 4JZJA 2RQ8A 3MRRB 2FECL 2W9LA 3FONB 4ETQA 1CIDA 4U1KA 1IQDB 1IT9H 4R97C 3NACH 3QRGH 5L9DL 4NT6A 3OKEB 3MRIA 3BGFC 4HAGA 3S36H 2IBBA 4NDMB 4DFHA 5BZDB 1H15B 2WNGA 4UQ2B 5KG9A 2HLFC 4HIJB 1P7KB 2F5AH 3V5HB 3WNPA 4NJ9H 1QBBA 3TYGH 3SJVE 4HJJL 4K23H 4O2CB 4NFBA 2AXFB 2X4NA 4MJID 5GGTA 4S1RL 1QFWM 3CX5J 4IOIB 4HF5H 4XCFH 5H37G 2Y07H 4QHNB 4V1DE 3S34H 3IKKA 3N1GC 1UQSB 4LLYB 4JQIH 4RBPK 5C6TH 5J9PB 1CLYH 4JY6B 4GAYA 3D39E 4ZAKD 3EYFA 4LF3B 1J1PH 4WUUB 4CN6A 1T1XA 2NY2C 4KK5C 1D5MB 3QUKA 2OTUA 1ZVHA 2AK1L 2VDOL 5GPRA 5IFAL 3MOBH 4PP1C 3P9WB 4KKCC 4AL8L 1DFBH 4XP6L 2UYLB 4JDTL 3GMOA 5AD0B 1CI5A 4OZFG 2LTQC 1J5OH 3DXAD 3CVHH 4UILL 1H9VA 4PJHE 3Q1SL 2HT2D 2PYEE 4WCYH 5C3TA 1PZUB 2E5EA 1ZSDB 5IB4A 5EWIH 3C6SB 1SQ2N 5DHYA 2R2HB 3GM0A 4PJEA 3FHQA 2NY4B 4NN7C 5AZEH 1NQBA 2Q20A 3DVGB 1GGBH 5AAMA 5FGSA 2VABB 2OBGA 1BECA 3GZKA 1HSBA 3ROLA 4KKNA 5DI8A 1WFUA 1J88A 2EDEA 1Z5LB 3S3PA 3J8F7 1QSED 3SDCD 3L3JA 4HPOL 1IGTB 3WXVH 4JFDE 3D3VB 3QDJD 2V5TA 4N8VA 3R8QA 3TNNB 3HE6A 1KIPB 1OWWA 1P5UA 3PP4L 5IP4A 5DD6B 5HBBA 4NCC1 4X98A 5I66B 4R90H 3QP3A 3W0WB 3MRKB 3VRLE 1FZMB 3MREB 2ICEA 4MAUH 4I0PB 5IR1A 4X7EC 1BJ1J 3FFCE 5GRJL 3GRWL 3VGEA 4UT7H 4U1IB 2EYSA 4GLRI 4J3UA 5DRNA 4RGNE 3ULSB 4U1SB 5C09A 1UB6A 1AKJB 4XP9L 4OB5L 1ZLSL 3X12A 2NW3A 5D2LF 1CU4L 1IM9D 2HFGH 2HT4D 1MHPL 4X6CF 4HWBL 1RZIA 3WS3A 1KEGH 2OL3L 3RTQB 4P4RA 5T5FH 2A6KA 1QRNA 3E1F1 3F7QA 4X4XB 1F00I 1J05A 2ZPKL 5IQ9A 3RZWA 5J6HA 1H8OA 2DYPB 3GUTB 3CFEA 4P9HL 5JZ7D 2HRPH 5M94B 3MXVL 4LSPL 4K9EC 3RX5A 1KGCE 3RUGE 1MIMH 4KTDL 3FQTA 4LCWE 5I19L 1UB5A 4QHLB 2AS5M 1VACB 4XZUB 3BOVA 1LO2H 5C08A 1GAFL 2VLRA 2XZAH 3VFRA 4CVZA 2DKUA 4X6CB 4KKBD 2FB4L 4MAYA 5ID1B 2PO6A 4D0CA 2W9DL 5EA0L 5E6IC 2DKSA 4UQ3A 4CMMA 7FABL 1WFNA 2E7BA 3KG5A 3TPUA 3MBEB 4Z95L 2XTJB 1QFPA 5HJ3B 2I60L 3VXRD 4EUPA 3IDNA 2JE8A 5SWQA 5I6XC 1AGFA 3P4NB 2HH0L 1INDH 1MFNA 1Z3GL 2Z93A 4EIGB 3VG9B 1VSCA 2PTTB 3RIFK 1CF8H 4NHCL 3P77A 4M8QB 3RGHA 4ZFOB 2DLHA 5IHZA 3RDTB 3QQ3A 3EGSB 1KTLB 4X5WA 2V9TA 5F1OB 5FV2A 3ULUE 5CIPB 4YE4L 2BVOA 5FKPB 5FECB 5FKAA 3TBTA 3ALXA 4B53A 3KPSD 1T22B 4BH8B 1GGTA 5TE6L 5HI5C 4OFKA 2QBWA 2V7NB 4PGCB 3IB4A 1ZA6B 3NBNA 1YY8A 2FH8A 3BVNA 5D1ZC 4Y16B 1C5DA 3QCTL 4PGDB 3REWB 2EYTA 2AQ3A 2KPNA 4M6NL 2DLFL 2VDPH 5EC2A 1MHHB 2CH8A 4GH7B 3M17B 3GSVB 3ARFB 3AM8C 3UBXG 3KXFE 2L4OA 1EFXB 1NMCC 1NEUA 1XGYL 1EMTH 3OKMA 4UT9L 5JR1H 5DWUH 1JNHA 1KNOA 3ARBA 4QTIL 1IAKA 1KN2L 1WWAX 5CEZD 2HMID 1WBYB 3IDJB 2ITDA 2XXMB 3C08L 4EI6B 4ZO7A 1LP9E 2DLTA 4NO5B 4Y8AA 3TT1L 4DEPC 3IXAA 1RIHH 2SEBA 2BCKA 4PJ7F 4JFHD 2VL4A 3HR6A 3WJLA 4WW1B 5B38G 2AKRA 1FRGL 1BFTA 4OZHE 4E5XA 4QTHB 1CR9H 3LKRB 2Z91A 2AEQH 1E6OH 1U36A 4JG1L 4ORGA 4OM0L 1WTGT 5GS2H 4JM4H 4NQCE 3ZYJA 5D5MA 4KKLD 3TVMD 1LNUA 5EU6E 3O3DA 1ZT7A 2XPGB 5BRZE 1ITBB 4P57B 5LWYL 2X89D 1U6AL 3EFFB 5D1QC 5HI3C 2NMSA 1A22B 4IMLA 1KBGL 5CD3A 5F7UA 3O6FB 1U3YA 4JFOB 1H5BA 3BGMA 3N1QC 3O3BB 3MRDB 5GGTH 5BVPH 3OG6B 3T0WA 5J1AB 3U46A 3HG1D 1MFCL 3MJ6A 1F90H 4XH2A 3FCTB 4P5TA 3MACH 4JGJA 1R5WA 4BUHA 4N90E 5J89A 4LDLB 4PJ7B 2D4DA 4V2CB 3BQUB 1KLUA 4TNWF 1MEXL 3E2HC 4UAOC 3QUMB 1FLTX 3OPZH 1BQLL 4X9GA 4KUCF 1AJ7H 2XNAB 4ZPVA 5KSVA 3VW3H 3U30B 3MGTB 4X7TB 3IDUA 4NP4H 5IF0B 4L8SB 1NEZA 3RWGA 1A3RH 4FQHA 2I9TB 4R2GC 3V2AR 1UXWA 3AU1A 4AEIH 1UCTA 1AFVL 3QRFM 4DUWA 4KV5E 2ZCLH 4NSKB 1JN6B 1FYHB 5T3ZH 2QQLH 3MV9A 3LQAL 4DKAA 2F54B 3OR6B 5C07D 5JIHA 2C4XA 1IEAA 4JO4H 1ED3B 4UDTA 3MCKB 1UACL 2ZCKH 4YLQT 4F9LC 5AWNL 5FCUH 3UTSD 4H0GA 3NIFF 3SKUD 1ZGLB 3FAXA 2CRIA 2ZUXA 1G7JA 4R3SB 4CGTA 5B39A 4JAMB 4KK9C 4WO4D 3ZHDA 4YHIA 2EDWA 3GSWA 1CLOH 1EEYA 1G9NL 1PKQE 3C60B 1S9XA 3QQ9D 5SWZD 1FNGB 1UWGL 3LDBB 3L5WB 4LCCA 5CGTA 2H41A 3STZB 3MRFA 1WBZA 2PTVA 4WIQA 3MV7E 3MJ9A 5EO9B 5HYSB 2FGWL 4POUB 3QIUC 1OGAB 2WZPD 3I6KA 3TZVD 5C0FB 3QH3B 4OIAA 1GYAA 4QOKD 4F9PC 5IWLA 2Y6SC 1NFIA 3ZMRA 1MHEB 1FNFA 1S8DA 3LKPA 1UKTA 1YUHB 5DJCA 1RY7B 3WUZA 2W59A 2Q3AA 5L2KB 5IFJA 2NY6D 3F58H 4AEHH 1OPGL 1A9EA 4QRUA 1JHKL 4OLXH 3BZ4A 4X6EB 4BSWA 4JFZL 1F6FB 3P4MA 4Z7VF 3BN9C 3K1KC 3MO1A 3PWNA 1U2CA 4MXWH 5IK3A 5BZWB 3P11H 4GKZA 2VB5A 4M5ZH 4JFPB 2ORBL 4LGSB 1H8NA 5DA4A 3VWKC 2H2SC 4HFWA 3DMMA 1RHFA 2RCSH 2V5YA 4K94H 3TCLB 4QRRA 4HH8A 4KI5C 3Q3GA 5HDLA 4J7RA 2E9IA 4DZBB 4YHLL 5DUPL 3MRRA 4HUWB 4PRIB 3FONA 4JRYB 4NFDA 4NKIL 4XHJC 1IQDA 2APXA 4MB3A 1JK8B 2NY5L 3LKSB 4NFCA 4X8JB 2IFFH 3OKEA 1MFAH 5TE7H 1CDIA 2Q76B 4NDMA 5BZDA 1H15A 4UQ2A 3HRZB 1BAFL 4Z7VB 5SX4H 4HIJA 4BQ6A 1P7KA 1TQCC 3V5HA 1MSPA 4BK4A 2ITCB 4Q9CA 2QADC 4MS8C 5MI0B 1IGIL 3P3YA 3NIGF 1TMCB 4OI9A 4O2CA 2AXFA 3CK0H 4JM2C 3ZKQD 1U92B 3ZKMC 5MENE 2R0WH 4IOIA 5FUZL 2QKIB 2GT9B 1BOYA 1T20B 3PL6B 4QHNA 2QQNL 3DTXB 4W6YB 1UQSA 4LLYA 5J9PA 3TV3H 2BNRD 4JY6A 5D7KE 2OZ4H 3CUPB 2VUYA 1TFHA 2VWEE 5DMIL 3QFJD 3LSOB 2BDNH 1G9EA 4LF3A 5CILL 4U1NB 4WUUA 5A2KH 1DBJH 3CFCH 3G6JF 1D5MA 4NBYB 4XMKH 4PJFE 1NGXB 3U0WL 3MXWL 1IJ9A 1BM3H 1WSST 2GHWB 3FRUB 2YRPA 3KPNB 3OAUL 2FIRT 3DURB 2UYLA 4LVHC 1HHJB 1W2KT 1F2QA 3CXDH 5AD0A 3VRJB 2X2YA 3PWJB 2YN5A 3HUJE 3MNVB 3O6LH 4Z78B 3ARUA 1AO7E 1ZSDA 3C6SA 1B2WH 4K9EH 2WW8A 1ZHKB 2CGRL 3BRFA 3ULVC 3PQYD 4KHTL 2R2HA 3IKCB 1A6VH 3HNTL 2D7NA 3DVGA 1V5JA 2B5IC 5HHXH 2VABA 1FNSH 3G6JB 4R7NB 1FYTE 2YEZA 3MRBB 1Z5LA 3MODL 5I1EH 4UB0H 5FF6B 4HIXL 4EDXB 3D85D 5CHNB 1IGTA 2XQYK 2IPUK 2QL1A 4XP1H 5FHBL 3D3VA 1GVIA 2AEIT 1AY1L 1O7VA 3TNNA 4YJZL 4BYHA 1KIPA 1DL7H 4N0YH 1IFHH 5DD6A 4OKVB 5I66A 3RVUD 2C1OB 3RGVD 3MRKA 3W0WA 4QGYA 1DEEB 1FZMA 2D9QB 3MREA 3QDGD 4I0PA 4Z18A 3AS2A 3EW3B 5JNYB 5ALCL 3MRCB 4PS4L 3QUYC 4U1IA 3WIHA 4N0RA 3UTTE 3ULSA 1RZ7H 3O8XC 3ARGB 4JGUA 4U1SA 1AKJA 5HGHB 3DUSA 1XAUA 5F7YC 3OAYK 5ACZB 5ABDE 3FOLB 5C2BH 3RTQA 5CJOH 1JPSL 3MRQB 2R9HC 4Z7UF 4X4XA 3SOBL 5E24E 1LD9B 4I1NB 4ZQKB 2D0GA 5IBUB 2DYPA 3GUTA 3B83A 4KUZH 1E28B 5FDWB 2AXHA 1S3KL 3I84A 4XVSH 3QO1B 4Y4KA 4HLJA 4OI7A 1IAIL 3E3QC 4WTXA 4QHLA 5CEXB 4LVNB 1VACA 3NFSH 4XZUA 4CMHB 5DVOA 4ZS7L 3H9SD 2EH7H 5DEZA 1KXVC 1RZKH 5FB8B 4YAQB 1VFUA 5EZOL 5ID1A 1WVZA 2APVA 3ZDXE 4MNQD 5CAYB 3QUXC 1ZLVK 1OHQA 3KNBB 1QFHA 1ZEAL 3MBEA 5GXBB 3T2OA 5ETUB 5HJ3A 2BXYA 3P4NA 4JKMA 2B0SH 5D2NB 3H7BB 3OKLB 2PTTA 3MUGB 2UWEF 2EC9T 5FYKD 1T04B 4RFNC 4W4OC 4M8QA 1BZQK 4LU5L 4ZFOA 3JWOL 4G43B 5LBSH 2DD8H 3NAAH 3RDTA 5C0RL 3EGSA 4M7ZC 1KTLA 1AHWC 5CIPA 4IS6B 5CLTA 1JGLL 2VC2H 3MOQA 5FKPA 4I9WD 5FECA 5E03A 5C3LD 4RFOL 5E5UB 1T22A 3SBWC 1DBKH 4BH8A 1OQOA 1T89C 2V7NA 4PGCA 2BY0A 1SEQH 4BUGA 1ZA6A 1IGMH 3EOAB 4WV1C 4Y16A 4PGDA 5I75B 3REWA 1JBJA 5ALBL 2QSTA 2V5SA 1MHHA 3OWEA 4PJXF 1QNZH 3M17A 4P46B 3GSVA 5CP3A 3ARFA 4ZYKA 1EFXA 4KZDL 1C5BL 1Q0XH 5DO2C 4XCEB 4XMPL 1XIWD 2UWEB 2NXYC 2W1NA 1MHCB 3KS0J 1WBYA 3LEVH 3IDJA 3GJFK 1N5YL 1RIVH 4EI6A 5JW4Q 4NO5A 2YC1B 1ZT4B 4O02L 3IDIB 4QWWC 4PY7B 3UJJL 4WW1A 3MOAH 1RAMA 4QTHA 3LKRA 5IB3B 1FO0B 1T1WB 3Q6GL 4WY7H 4WHYG 5DRZB 1CLCA 2WANA 3VCLB 2F15A 4M1CC 4PJXB 2XPGA 5KVGL 4P57A 1KELH 4MA7L 3UTZB 3EFFA 1F4XL 3BD3A 3LPWA 1OSZB 3MX0A 3O6FA 5FHAL 3NFNA 4KVNH 1P4IL 3O3BA 4NC1C 3LQZB 3MRDA 3O9WD 4PJEE 1M4KA 5FGBA 3T0EB 1CDBA 5F96L 1KT2B 2DQUL 2Q7YB 4O4YH 4M7KL 2B1HL 1DQDH 1N4XL 1U93B 3CSYB 5DJDB 5J1AA 5KSUB 3FCTA 1RURL 4P2CG 4M48H 5CGYD 2WUCL 3JWDL 4PJ7A 5I2IB 1INEL 2H8PB 3PWVB 1C12A 3BQUA 4X4ZA 3QUMA 1ZK9A 1MI5B 1MJUH 3KHQA 3AS3A 4UMGA 4C56B 2XNAA 2DQCL 3OTTA 2B20A 3MGTA 1LE9B 4X7TA 5IF0A 4L8SA 2IQ9L 5J6GB 4MXQC 1WLHA 1Z9MA 2I9TA 1MIEL 1CGWA 3JTTB 4I18B 2PF6A 3GSXB 3RWCB 5D7SH 1YMHB 2NYYD 3E6FB 3TP4A 4NSKA 3GMNB 1JN6A 3C5ZD 2VDKH 4MA8H 1HXMA 4POYA 3QJFB 4FQCL 2IBZY 4TUJB 2F54A 4JE4B 3U36B 3OR6A 4P2QB 1ACYL 4XI5C 1A7OL 4HUXB 4JFFB 4UTAL 5C09E 1ED3A 3BKCH 3MCKA 2EDJA 2X4OB 4HK0B 4CVUA 1V7ML 3KLDA 4OLZH 5JW4R 1HSAB 5ISZD 4OAWB 5IHLB 3P9MB 4M6ML 1W0WB 2C3VB 4O5LL 3QDHA 1QRNE 1ZGLA 1J87A 2ZUQB 4R3SA 4KK6D 4P48A 4JAMA 2IH3B 1I1FB 3QG7L 2E6QA 3CFDB 3C60A 1X5ZA 1FNGA 4Y2DD 2P7TB 3WCYA 3L5WA 4HH9B 5E9DD 1A7BA 1FNEB 4X9HA 2IMNA 3STZA 4QHKI 5EO9A 5HYSA 3MLWL 1QZ1A 4GQ9L 2OI9B 5I1JL 5C0FA 3QH3A 3CLFL 1FC2D 5E5RB 1I7ZB 2ICCA 3F62A 1ONQB 5C08E 1BQSA 2W0LA 3OB0H 5IQ7L 35C8H 3IU4H 5IBLC 1RJCA 3AMKA 1HHHB 1YUHA 2CXKA 2NY0B 5L2KA 4UIKL 1PKOA 2X4QB 4PD4K 4U1JB 4X6EA 4IOFC 4EVNB 4JQVC 5FO7B 5BZWA 4XPAH 3U1SL 3IT8D 4FFYH 2J8UE 1D9KB 4JFPA 3SCMC 4OGXL 1Y6NR 5DJZB 5D72H 2IJ0C 3OGOE 1CE1L 3TCLA 5HD8D 1U8QB 4HS8L 5FGCB 4PGBB 4LHUG 3UAJC 4DZBA 43CAB 5MEPB 4HUWA 4PRIA 2AK4B 3SDYH 3EOTH 4DOHB 1Z2KA 3VH8B 4ZTPL 1QKZL 1EZVY 4JANB 1F3DJ 1CK0H 2EZ0C 5HGDB 4Q6IB 1JK8A 1CDGA 3S37H 2X4UB 2YZ1A 3O2DA 4GXUM 3LKSA 1GH7A 1JTPA 1OARL 4X8JA 5E70A 4M5YH 3VXUB 5GHWH 1U8PB 2Z8WC 4DGYH 1ZWIB 3PWPB 1NBZB 3KHOA 2Q76A 3TFKC 4GO6B 3HRZA 3FQUB 4Z7VA 3F6LA 3FZUC 1PGRB 4GBXB 3SO3B 2ITCA 3VFNB 5HYJD 3VFMB 4APQD 5IV2B 2ID5A 1B4JL 1JPGB 4ZMAT 2FECI 1G0XA 2Y4SA 1TPXC 4G8GB 2HLAB 1U92A 5E2UL 3ET9F 4L9LC 2QKIA 1PY4A 3L5IA 1T1ZB 1YNKH 3QQ4B 2GT9A 3PL6A 1T20A 1T3FA 2VDMH 1MCRA 3DTXA 2DQJL 2CO7B 2H1PH 4Z7OE 1AQKH 2BNUB 3CUPA 3EHBD 2R0LL 5E8DH 3LSOA 4FNLH 1IVLA 3BKML 3KPRD 4U1NA 1IKNA 3SKNB 4HV8B 2R29L 3WYRA 2ESVD 1Q9LB 1NGXA 5CIPH 4OFVA 3FRUA 3KPNA 4N5EC 2QQQA 4S1QH 3DURA 4KGJA 1HHJA 1KC5L 2MQ0A 4GRLB 4PJDF 1AP2B 3VRJA 2VDRL 3RIAK 1U8JB 5CJQL 5CMAB 5ICZB 1PG7X 3MNVA 2VMFA 1KPRB 1ZHBB 4Z78A 3WS6C 4KPHL 1MELA 1ZHKA 4LNRB 2EDNA 5E99H 1G9NC 2YD5A 3IKCA 4OF7A 3WKNA 4J4PC 4BFIB 4RWYL 2AI0H 1FIGL 1D5IL 4TULL 5DJYB 3MA9H 1TJIL 3AC0A 4R7NA 4XP5H 4YXKH 4RQQA 5AYQA 1EUTA 2NXZB 1CDCA 1RVFL 3MRBA 1RJYB 2VQ1B 3T0DA 1Z0NA 2A74A 5FF6A 2YXFA 4IBLT 5D96B 2WIIB 2IGFL 4EDXA 1NBVL 3GJEA 5CHNA 4ZXBD 4HG4J 3BP4B 4PJDB 3L3GB 2APTA 3AS0A 4XNXH 4BQCA 3I3EA 1JGDB 1A3QA 2WWKO 3MV9E 4OKVA 1ORQB 2C1OA 4G3YH 3SKJL 3T2QA 2KH2B 1DEEA 5I0DA 4KY1H 3R0MA 1BF2A 2LABA 1S78D 5GS2D 1A0QL 4MQXD 4NKMB 5JNYA 1OAYH 3MRCA 1DTUA 2R39A 4XPFH 5F44A 1M7DB 1CD9B 5JXED 3OJMB 3MLXH 1R3IL 3ARGA 3DUUB 4ELMF 4O2FB 2AJSL 1RQ5A 1KIUA 2VDNH 4G6AC 5HGHA 3VXOB 1SYSB 1LO0L 1ETZB 4OD1L 5ACZA 5T1LD 2C7UB 3MRQA 2F8XC 5F88B 4XPGL 1LD9A 2W60B 2NY5C 5DEFA 4ZQKA 3BSZH 3MJGX 3VFWB 3S7GA 1AR1D 1T03L 2Q8AL 5KSAC 5D7JC 1VENA 1E28A 1J8KA 4JY4B 2GI7A 3RFZC 2DBLL 5FDWA 2V5RA 1IL1B 3GSOA 5HDBF 3QO1A 1P9MA 1PD6A 4LOUC 3TO4D 1IQWH 3L3OB 2GSIB 5CEXA 3HAEG 3LY6A 5GJSH 4ELMB 1L7IL 2VDQH 2X1QA 4JFED 4KMTL 3P0GB 1ND0B 2X4SB 2BK8A 3V4UL 5FB8A 4YAQA 2D2OA 2HVJB 4QEGA 4WFHE 1VFMA 4OQ1A 3H3BC 2CRZA 3KNBA 4ALAL 5ETUA 5GRJH 4QRRE 4YXHL 3ZL4H 4X0KB 1QSZA 3QA3B 2DJ4A 5D2NA 3H7BA 3OKLA 4XP9H 3MUGA 3DIFB 1T04A 4JRWA 3EFDH 4Y1AA 4FFWC 3IJYA 1CYGA 4G43A 3JVGA 3B4NA 2HLFD 1QLFB 2YD4A 1KCSH 1RMFL 4IS6A 3HC0B 5FOJA 1GJIA 2ZPKH 1T1YB 3RNKB 3QB7C 3H9YA 4WFEE 3QUML 4YWGL 3ALPA 3DVFA 5D8JL 1RSFA 5D1XC 3GSRB 4YR6B 3EOAA 3DSFH 1YYLL 1CTOA 2MPAL 5AZ2L 4OLVL 4P46A 5FOBB 4KTDH 2ZUTA 5KAQF 2EC8A 4RGMB 5DF0A 3WN5C 4X6DA 2OMBA 3ARVA 2DBJA 5J1SC 3HA0A 5F9DC 4XCEA 2UWEA 4S11A 2NY2D 1MHCA 4KK5D 4JKLA 4MNGB 4WUUE 2FB4H 3MLRL 4EN3C 4PP1D 5IGXL 1FFRA 5EA0H 2YC1A 1ZT4A 4LARH 7FABH 3CU1A 2GJ6B 2GSGB 1HKLH 3IDIA 1QYGL 4FHBD 5J11C 3BE1H 4PY7A 5F7FA 1T7YA 4LASH 2WINB 3MRNB 5F9OL 3WD5L 4H8WL 2HH0H 4YEFA 3IU3B 1RZGB 5IB3A 2QSQA 1FO0A 1T1WA 3L95B 5DUBA 3HNSL 2E7LA 4XC1L 5DRZA 4FABL 3VCLA 4NHCH 4PJXA 1TIUA 5DK2B 2KZWA 5CD5C 1BQHG 3SE3A 3UTZA 2JIXD 3RBGA 3BZEB 1XEDA 1JCKA 4XWGL 1OSZA 4YHPB 2VAAB 5I73B 4E0RA 1MRFL 5TDNB 4LGRB 3T65B 5A16B 1MCPL 1G7IB 3LQZA 3T0EA 1WV7T 4X7FC 1KT2A 2Q7YA 1A2YA 4JDZB 3RIFF 4XVTL 1U93A 1X7QA 3CSYA 5DJDA 1BFSA 4OIIL 5IT2L 5KSUA 2J5LC 2WK2A 2OK0H 5I2IA 2H8PA 3PWVA 3PF2A 3QWRD 4MJIB 1DEDA 1MI5A 2V6HA 4P59H 4C56A 5T1DH 3TO2B 2C3GA 1D6VH 1KTRL 3BJLA 1CIUA 3OKNA 3D3VE 1LE9A 4UT9H 5J6GA 5JW3L 5DJ8B 3DHMA 3MYZA 3IETB 3JTTA 4I18A 3AY4A 3GSXA 5F6HI 3RWCA 3WFDH 2UVFA 1YMHA 3W0WE 1FC1A 4KJQC 5K9JH 2WM0A 3L5XH 3E6FA 3TT1H 4OCSL 5B4MC 3GMNA 4LKXB 4TSCL 5DMYA 1PZ5B 3WO4B 2WWKT 5DRXB 3MV01 1T2JA 3QJFA 3BYYA 3LHPH 4TUJA 4Y5YC 1GGCL 3U36A 4LLQB 4P2QA 5F70A 3VG0H 4HT1L 4JFFA 3FO9B 4LSSH 2DM7A 3CMOL 4U31A 3O2DL 2X4OA 4HK0A 4FQ1L 4HUUB 1RIUH 4C58B 3ILPB 2PR4L 1HSAA 4Y4FC 4GMSH 4OAWA 3DX7A 3P9MA 5B8CA 5DQJB 3DXAB 4XP4H 1HINL 4LFHD 2C3VA 3LH2L 1U6AH 3LEXB 1CFVL 5BO1L 1KXTB 2LV4A 2B2XL 4U3CA 3C8DA 1HI6B 2VXSL 1I1FA 3UMTA 3CFDA 3O2VL 1MCHA 5CUSH 2P7TA 4JVUA 3KPMB 3QXUA 4BQBA 4HH9A 3RVWC 5FM8A 1BJ1H 1FNEA 1OAXL 1WCQA 4KHXL 1HIMH 5J8OA 1PSKH 1IC5L 3L9RB 3U4BL 4NZUH 3QPXH 4XNQB 5TGBB 4QRPD 4EOWH 1I7ZA 5D2LE 1NGQH 1ONQA 2GYSA 3K80A 1I3RB 3PGCA 3W11C 1HHHA 4X6CE 2DM4A 5TDOB 1WEJL 1TTGA 2X4QA 3GBLA 1J8HD 4U1JA 2VXUL 5I1IL 1ZGLM 1QBAA 5BV7B 3ARXA 4EVNA 4GKOA 5DJ0B 2XTJE 2FBJL 1S9VB 2Q6WB 4UNVA 2YWYA 4MD4B 1D9KA 3WNLA 2XWBB 5HHPB 1SVCP 5DJZA 3AVEA 5IFHL 2HAZA 4P23C 5F71A 1U8QA 5LGJB 4YUEL 3H9ZA 3QEGL 43CAA 3Q5TA 4LRNH 5MEPA 2HFEB 2AK4A 1IM9B 3MROB 3NN8B 1UC6A 1RUAH 4M7JL 4PJBF 5HI5D 4YFLF 3DVNB 1P53A 3GMMB 3VH8A 1WBXB 4JANA 1PEWA 2MOVA 2XZCH 4N1EA 4Q6IA 5D1ZD 1IBGL 5HGDA 3T0VA 2HWZH 2X4UA 3BIKB 2VXQL 4YDKL 4FRWA 2J1KA 2ARJB 1F2XK 1P2CB 3VXUA 4M02A 1U8PA 1ZWIA 3PWPA 1NBZA 1UWGH 2BFVH 3D2UD 3GSNB 4TQEL 4O00A 5C8JB 3FQUA 2AJVH 3KVQA 3TPKA 4GBXA 2FGWH 3VFNA 4L4TD 3VFMA 1NCWH 1HQ4B 3IFNH 1MCLA 5IV2A 2XZZA 1JPGA 1QQDB 3JWDC 4G8GA 2HLAA 5SWSD 1A7NL 1T1ZA 3QQ4A 3BWAB 5E2JA 1BIHA 4ODUB 5TF1L 5D4QA 2G9HB 3ZSTA 3BDYL 1WWCA 4PJBB 3TWCH 3ZKXB 2DIJA 2BNUA 2BVTA 5KS9F 1FN4B 4UBDC 3V8CA 1TZGL 2WLYA 3QUZC 1V7NH 1ZV5A 3SKNA 4HV8A 4NKDB 5CFHA 2FIKB 3MLSL 1Q9LA 5D1QD 5HI3D 5IW1A 2EIZB 4MA1C 1NGZB 4GXVL 5E8PB 1MF2H 1MQ8A 1OT2A 4OFYA 1AP2A 4WI4A 1U8JA 3L1OL 5CMAA 5ICZA 1JHLL 5F7KC 3TT3L 1KPRA 4R4NC 1ZHBA 4IMKA 4LBEB 1EO8L 3GMLB 1YC8A 5D93C 3BPOC 1U3JA 4HUKB 1A7PL 4N1HB 4PJ7E 4LNRA 4KQ3L 2H9GB 4OTXH 4V1DD 5KS9B 1HNFA 1OTTC 4BFIA 4R2GD 3EYVB 1IGIH 1F6LL 5DJYA 3MJ8B 1FG9C 5DD5H 1R0AH 1RJYA 2VQ1A 5FUZH 5DQ9B 4FFVC 2WIIA 5EUOF 4PV8B 4X5LA 8CGTA 1QFUL 1F3JB 3BP4A 4PJDA 1JE6A 3L3GA 3HZKB 4LPCA 4GW4B 4PJIF 1JGDA 3NPSB 4TUOB 4NM8L 2VL5A 1FO0H 2F54E 1ORQA 3N50A 3GKWL 4PLKC 5CILH 3OF6D 1J0YA 1HXYB 1V3JA 5CEYB 2N1KA 4RX4A 4PIRF 4NKMA 2PYED 4G8EB 4QT5B 3QYCA 4HBCL 1M7DA 4OUUB 1GIGH 3QNXB 3DUUA 5JHDB 1BP3B 4L3AA 3HZYB 3VXOA 1SYSA 4X5XB 2MKLC 5E2TH 3WUWB 1ETZA 5HHVL 4GRWH 4E41D 1J9CT 1PLGH 3IXTB 5EUOB 2COQA 2C7UA 1FV1B 2R15A 2A6DA 2AJXH 5F88A 3QIUD 3N0PB 2NY4C 3INUL 2W60A 5JIIA 3HG1B 3VFWA 5DT1H 2E8ZA 4PJIB 2Y6SD 1F02I 5I1CH 4CU7A 1NDMB 5JORB 3T77B 4L5FH 1OGAE 3FRPG 4JY4A 1NH6A 4DVRL 4UNUA 3TJEH 3EDEA 2I9LB 1A6WL 1BOGB 4QXUH 1IL1A 1JPTH 3MRMB 1A47A 1IC7L 2YUZA 3D1MC 2EDYA 3L3OA 2GSIA 4ELMA 1WICA 1KG0B 4OCXH 3OXSB 3NIFE 5FHBH 4OJFH 1EJOL 3ZDYF 4KQ4H 3VWKD 2H2SD 1ND0A 2X4SA 3QZWB 4UV4L 1I3UA 3GSQB 5FFLA 2HVJA 2HJKB 4FG6C 2R56L 2ZWLT 5C07B 4H1LG 1CLZL 4G8IB 2PUQT 1D3CA 4AMKL 4XHJD 3ZDZF 4W68A 2YPVL 1RUML 4ORZC 4X0KA 5HYQB 3IDYB 3WHXB 3QA3A 4PRIE 5ADOH 3G5XB 1IGFL 1M6OB 4RAUB 1IAII 4JRYE 1II4E 1S7RB 1NLDH 3GI8H 1X6LA 3JZ7A 3ZKSD 2D7QA 3DIFA 5I8EB 3QHFH 5CZKA 4L29B 4GMTH 4C55A 1ZAGA 4Z7NF 1G6RL 3FB8B 1QLFA 1I7TB 2CMRH 4WO4B 1T0PB 3HC0A 4AEEA 1NLBH 3WO3B 2QADD 1T1YA 4MS8D 5K93A 3RNKA 1KJ2L 5TJWK 4Z7VE 1QR1B 3OG4B 4GSDH 3H3PL 3UDWC 3VXQB 3ZKMD 5LQBH 1UH4A 3GSRA 3H9HB 4EI5D 4YR6A 3ZLQC 1UH2A 4WNQB 3ABZA 1JRHL 2N7BA 1S3KH 4R9HA 5C2UB 3TZVB 4K3EH 5FAAA 4M43L 1CD0A 4QOKB 4J6RL 1MQKH 5FOBA 2VXTL 3F7PC 4F7CB 2YPLD 4PG2C 1G6VK 4YNYB 2EDFA 1FPTH 1MAKA 3K74B 4YHMH 5IMMB 1T6VN 4PY8I 5I30H 4LLAA 2OP4L 2NY6B 4F58H 3H8NA 4MNGA 4ISVB 3MUHL 4JO2H 5EZOH 4YIQB 2GJ6A 2GSGA 4LL9A 3NTCH 4NNXB 1FE8H 1KIRB 4LSUH 2WINA 3MRNA 3PXJA 3R1GL 3NIGE 3IU3A 1RZGA 1FFOB 3CFKB 3L95A 3UPRB 1A5FH 1K3ZA 4OGZA 4UIMB 1JF5A 5DK2A 4AENB 1ZHNB 5J3HC 4OD3L 3ULVD 1CL7L 1NFDF 3O6MH 2QSCH 4FQLH 4JVPA 3RVVC 3SPVA 4QF1B 5I8CB 3BZEA 1YJDL 4YHPA 2CK0H 2VAAA 1NUNB 5DLMH 4R26L 4M8VA 2HA1A 5ESAB 3T65A 5A16A 1G7IA 3KXFD 1DZBA 4JDZA 1CWVA 3M07A 1EX0A 4NNPH 4UINH 3W81A 1VEMA 4ODWB 3SDCC 4U1MB 2NTSP 3WJJA 1YEJH 3G6JE 1A7QL 3MLTB 1J0ZA 3PJSB 1GGUA 4MJIA 3TO2A 1B0RB 4YXLH 3FOMB 1C5BH 4DN3L 5DJ8A 5AYUL 3IETA 2CDGB 4I4WB 4JPKL 3N1MC 3DRQB 4Y2OA 2BNRB 1SEBB 1NFDB 1OTSC 3QUYD 1K4CB 3QFJB 1G7PB 1BBJA 1RJZB 1KIQB 1LDPL 4ZAKA 5HYFA 1MJ7H 4NQCD 4B41A 2NW2B 3O8XD 4LKXA 3TGXA 1PZ5A 3RNQB 5DRXA 3T3MF 3S88H 1OD7A 4OLWH 1MRCH 4UNTA 4D9RE 1RZFH 3DLQR 1X5LA 1NANI 4LLQA 4P2RB 4RDQG 1MREL 5JHLH 4W70A 1DUYB 2YXMA 1YC7A 3MLYH 4HUUA 2GFBB 2J8HA 1T66D 2R9HD 3Q6GH 4PR5B 1WF5A 2G75B 1WK0A 4KJWC 5DQJA 4HZLB 3DXAA 3LD8B 4R8WL 2V17H 3LEXA 4TUKL 3UZQA 1OL0A 4TSAH 4LCIL 5DA0B 3B9KC 1WZLA 4ODBD 3NA9L 2DI7A 4NWUH 1FFNB 1P4IH 4MD0B 2DQFB 2R1WB 1U58B 2NR6C 3UJIL 3PQYB 3UP1A 3KPMA 5CINH 3K8KA 3QAZB 1X3DA 3QULB 5C71A 5C0EB 3JWDH 5CS7A 1NANH 4OM1H 4LSRH 2DKMA 1ZLWH 4MVBC 1AI1H 3L9RA 1FZOB 4XNQA 3JTSB 5F7DB 5TGBA 2DQCH 1EHLH 5KZCD 3GJFB 2AV1B 4MMXC 3D85B 4KKBC 5GS1A 3QUXD 1I3RA 3N1FC 1MIEH 1WZ1H 1UM4L 4QLRA 3WKML 2AJYL 4CAGA 5TDOA 1CBVL 5JMOC 1KLFA 1LO3H 4Z7UE 1P4BL 4MWFB 4EUPG 3RGVB 5DVKA 4JJHA 5DZOA 5DJ0A 3ZO0A 5I1HL 3QDGB 5F9WC 1S9VA 2Q6WA 4Z8FH 1L9MA 5TPWL 2ZOLB 3OKOB 4MD4A 4PJAF 2XWBA 3BAEH 1QEWB 4OZFB 5D2NE 3U7WL 5HHPA 2YN3A 1MFEH 4XNYL 4YDJB 2EE6A 5LGJA 2AJZB 2EDBA 3L3IB 4H8WC 3S5LG 2HFEA 5GISH 3MROA 1IM9A 3NN8A 4XC3L 5FK9B 3Q5YA 4NBXB 4LSVH 3DVNA 3NZHL 3GMMA 3NCMA 2AQ2A 3UYRH 1WBXA 4HD9A 4Q7DA 4HXAH 4X9BA 3ZT7A 3BIKA 3NCBB 1DLHB 4LCYA 1J1OH 2ARJA 4RBPH 3SY0B 5KW9L 1P2CA 4KJYB 5T3XL 1NUDA 4R0LC 3GSNA 2YUVA 5DJXB 1BEYL 3R8BB 3AXLB 2WIMA 1MCBA 4OCNC 4J12A 5DO2D 5D6DA 4LQFL 4PJAB 1HQ4A 1TZHB 2X41A 3CLFH 1LEIB 1QQDA 5FEBA 1NCDH 4YK4B 4P9ML 1NSNH 3DO7B 1AXTL 4OFIA 5ESVB 2A38A 3DECA 3BWAA 1ZXQA 5IQ7H 4ODUA 4TVPE 4QWWD 5KVEL 2G9HA 4PJBA 1S5HB 1KJMB 1LVEA 1Q0YL 3K2MC 3NIDF 5CSZB 4FOMA 5CP7B 3VFVB 4XPBH 4XCYB 1FN4A 3U1SH 4CDHA 1NDGB 4PGZA 4XBEH 4H25B 5EORL 4M1CD 5B3NA 4NKDA 4I8DA 3TVMC 2FIKA 3HI5H 2H6PB 2EIZA 1YDPB 1NGZA 1KSRA 3HNVL 4PJXE 2MNUA 5E8PA 2FO1A 5KVFH 5KJRH 3CDYA 3ZE0F 5EUKB 4X7DC 2ZKHL 3DI3B 2H2PC 3TH2T 3VFPB 5ESQB 5FA4B 4NUJB 3KS0H 3UJTL 4BQ8A 1JIBA 3OL2A 4LBEA 1J0JA 3GMLA 2NY3C 3MYJB 4OF3A 4IRSC 1AC6A 4CVWA 1S5IH 4M62H 3RWEA 2WWMC 2IEPA 5KS9A 2CIKB 4MXQD 1SJHB 1W0VB 2FGZA 1AGCB 1NEZG 1MI5E 1OAUL 3EYVA 3VGHA 2RHEA 1YYMH 3MJ8A 3NCFB 5IM7B 1N3NA 1V3MA 2F9BT 4U6HB 3QCUH 3O41B 2A9NL 4IEFB 1Q8MA 2DQEH 4BZ1L 5DQ9A 2RAMA 4PV8A 5IB1B 1XIWB 4FQIL 1KENL 2DQJH 1F3JA 2Z31D 4JHBA 5F6IB 3HZKA 4XI5D 4OT1L 4L3ED 1KB5B 4GW4A 1IKNC 4TUOA 5EO1B 2R0LH 5FYJH 3VD7A 5DD3H 4HJ0D 5JTWA 3ORJA 4JFFE 4Y5VC 1MCWM 1YMMD 1HXYA 3K2UH 1VFBB 5CEYA 3BDXA 3HMXL 3CDGB 3G5VB 4G8EA 5L2JB 4G7YH 4HCRA 4QT5A 4AYFA 4OUUA 4IRZL 1AO7D 3QNXA 3SE4A 3M8OL 2K9UA 5JHDA 1KC5H 2WAHA 2VRAA 5C92A 1SYVB 3HZYA 4M1DL 5IESH 2X89A 4X5XA 3WUWA 4TSBL 1I8LA 2F53B 3I02B 1NC4D 4NKOB 2E8YA 3IXTA 5EUOA 5GSRB 4OUOA 1XF2B 1FV1A 2VTFA 3UXFA 4MA3B 1LO5A 1FYTD 3O9WB 3UCRA 5IHUH 4KPHH 3VDCA 2DLEA 3A67L 2P44B 1OAKL 2DAVA 4DN4H 3HG1A 4M03A 4PJIA 5JORA 1NDMA 1BWWA 3T77A 3RIAF 2FEEL 4LAQL 1B0WA 2P5EB 5IBLD 1DVFC 1D5IH 2I9LA 4C4KT 3RZCB 3QXDB 1BOGA 3QR2A 3EDJA 4BA8A 3MRMA 4FZEL 5T33H 3QXVA 1RVFH 4M1GH 4IOFD 1RZJC 4Z7WF 3TYFB 4B7IA 3T08A 1NJ9B 4WGWB 1KG0A 2EC9U 5I1DB 3G6DL 3OXSA 1NGYB 4PRHD 3SCMD 1P4LB 2F74B 3LS4L 4JHWH 4QCIB 3QZWA 1EVTC 5DQDL 5D7LB 1FLRH 3CLEL 3GSQA 3C5ZB 4S2SB 2CDEB 1CGXA 3SKJH 3TBWB 5T1MB 2HJKA 3I50H 3UAJD 3GNMH 5GGSB 1S9WB 5C07A 4G8IA 3NZ8B 4RMWA 5FGCE 2DTML 1R6VA 2EZ0D 2WQRA 5GSVB 5HYQA 4OZIF 1OP9A 4HDIB 3EO0A 3WHXA 2AK4E 3ARDC 3G5XA 1M6OA 4RAUA 3A6OA 4ZSOB 3CVHB 2X4TB 1S7RA 2NY7H 3E8UH 4RZCB 1H8SA 4Y19B 3RX7A 4L29A 4DGVL 4Y4HC 3UTPE 4HKXB 3P4OB 4OCYH 3RY5A 4OV5B 3FB8A 4Z7WB 1I7TA 3FZUD 3U83A 4WO4A 5ADPH 3GMRB 1I9IL 2CR3A 3PWPE 4XWOC 4XPGH 1ZHLB 3GBMH 4MJ5B 3EJZC 4YZFF 3SGEI 1HWHB 1QR1A 4Y2DB 3EIFA 3VXQA 1C7TA 5E9DB 5KBNC 3H9HA 2DICA 2WUBL 2EDXA 4OKDA 4WNQA 3PUCA 4N8CH 4WUKL 1FNAA 5A2IH 4EJ1C 3TZVA 4G8GE 5JPMB 1GSMA 4KVCH 4ONGL 1CGVA 1MY5A 4QOKA 2VR4A 3NGBB 1NAKL 4OF0A 1LO4H 4F7CA 4OZIB 1JGUH 1EEUA 4YNYA 2WQ8A 3VGAC 5IMMA 3SGKA 4P2YA 1ROWA 2DMKA 1T5WB 1K5NA 1F5WA 4ISVA 5CJXA 1HE7A 3TNMB 5F1NB 1HHGB 1SVZA 3QG6B 4YIQA 5DS8B 3B2VL 3OJVC 2R8SL 4NNXA 1M1SA 4DKEH 1KIRA 1L7TH 1N6QH 2XRAL 4UV7L 5I9QC 4KRNA 2XFXB 1ZVYA 3EJYC 2GTZB 3CFKA 3UPRA 4FFZL 4UIMA 3CX5K 3MUZ1 3GSNH 4AENA 1ZHNA 3NH7H 3L6FB 5KOVC 3WEXB 3JXAA 2VZ3A 5I8CA 1URLA 4KDVA 4J4PD 1DBBL 3V6OA 3PHOB 1UG9A 5MP6L 4MJ2A 5ESAA 3MRGB 3X17A 1X9QA 4LSTL 5HHNB 4HUVB 2YSSB 3FQNB 4JDVB 2ZUUA 4ODWA 4OQTA 4MZ2A 1Q9KB 4U1MA 2L0DA 4NQUA 2QQKH 2IBZX 2XG4A 3MLTA 4GAGH 1KCRH 5HYJB 2MPAH 5T3XE 4JPVH 3PJSA 1OSPH 3MRHB 3LB6C 3HFMH 2LAGB 3HLAB 1MCCA 4FTVB 1B0RA 1QACA 4JQXC 1C5CH 4PJDE 1EPFA 3FOMA 1D5XB 1IM3A 3KJ4B 3I9GL 2CDGA 4I4WA 4KZEL 3DRQA 3ZTJH 2BNRA 1SEBA 3CGTA 1NFDA 1SJEB 3QI9C 3B9VA 3MLRH 3QFJA 1G7PA 1RJZA 1KIQA 1JNNH 2NW2A 4ONFL 2VKWA 2J4WL 3KPRB 3RNQA 2Y23A 1A1MB 4OZGF 3KLSA 4XXCA 4G6AD 2P8MB 3JV5A 2ESVB 4P2RA 1XMWA 3IS1X 3WD5H 1VADB 3MLVL 2R2EB 1IGYB 5DMGD 4H8WH 5CKAA 5GGRY 1JNLH 1U3HB 2DL2A 1DUYA 5D70L 1J0KA 4P3CH 4NOBA 2GFBA 1MFDL 4FABH 4PR5A 2JK5B 2G75A 2HJFA 5IJKC 3KYKH 4QXTA 3MMEB 4HZLA 1DQTA 3VWJB 5IKCA 1PG7L 1A14L 5KSAD 2Q1EA 2AV7B 5D7JD 4WW2F 3BT2H 1RK1B 4NN5C 3WNOA 1FFNA 1MCPH 4MD0A 2DQFA 1GHFL 2R1WA 1U58A 4ENEC 2AGJL 4XVTH 4H20L 2G2RB 3PQYA 4LOUD 4B0MM 3QULA 4RRPA 2ILLA 2E27H 5C0EA 2YD7A 5E4EC 3V4VH 3UTQB 4OZGB 1GXEA 5E7FA 3PXHA 4LPYA 1FZOA 3BGAA 4I18C 3JTSA 4ELME 1F11B 1F4HA 4RMSA 1KFAH 3LN5B 3V6ZB 3GJFA 2AV1A 3D85A 4ZXBB 1JGEB 1SMOA 3MSPA 4CW1B 3M45A 3QJHB 4JZJB 3WDHA 4Z0BL 3H42H 1EZVX 4HCRH 4MJ4A 1JYWA 4MWFA 3TH3T 4WW2B 3RGVA 32C2A 2EDLA 3VFTB 3QDGA 4U0RB 5CCKH 2ICWJ 5GRUL 2R4RL 2A6IB 2ZOLA 4K55A 3OKOA 1QRND 1T2XA 4FFWD 4OZFA 1QEWA 1NL0H 2YRZA 4GG6F 3LMJL 1I1AC 2CO6B 3IS0X 1UM5H 4WEUD 3GHBL 4FQ1H 5K9QG 1P6FA 5HDBE 1VA9A 5CJBA 1DN2A 4YDJA 5HHMD 1A3LH 1N8ZB 2AJZA 3L3IA 5HVFB 5GJTL 5JW4N 2IPTH 1E6JH 1HINH 1RUQH 1D5BB 5FK9A 4HC1L 5T1LB 4LRIA 1NMBL 4J23A 4GW1B 2EE9A 5KVMC 1A02N 1DLHA 2OSLB 3N85L 4O9HL 3SY0A 4KJYA 1YJDC 4NZRH 1GZPB 1TETL 3L3HB 1BBDL 4N0UB 1JZ3A 5DJXA 3AXLA 1XH3B 2EE2A 4LPTA 2OJZL 1Q72H 5LCVH 3QISA 2FYYB 4PJAA 2EE3A 1TZHA 1LEIA 1ZANL 3TO4B 4GG6B 2DM3A 3DO7A 4EN3D 1NFKA 1OB1B 1ZTXL 1UJ3C 5ESVA 4JFEB 5J12B 1YQVL 5EFIB 1S5HA 4NM4H 5ILTL 1KJMA 5I1IH 2VXUH 1WGOA 2GJ6E 4ZDHB 5CSZA 5CP7A 3VFVA 1MCIA 4XCYA 1NMAH 4MNQA 4DCQB 2GEEA 2J8OA 5IB2B 1JTTA 1NDGA 5IROC 5I71C 1TENA 4H25A 2A77H 1QSFB 5CD5D 3A6CL 4FP8H 3SE9L 4J1UB 4R97B 5IFHH 3NCEB 1G0YR 2A1WL 2H6PA 1YDPA 1EFQA 2CJUH 3VU2A 1YEFH 2PW1B 4YUEH 3G5ZB 3QEGH 4AM0A 3BGFB 3IGAB 3VFPA 2BXZA 1JGVL 3RAJH 5ESQA 1Q1JL 3HC3L 5FA4A 3O4LD 2APBA 1CT8B 4NUJA 4K3JL 1MPAL 1VFOA 5CGYC 3MYJA 4QNPF 2YD3A 4N8VB 4LEOA 5FGRA 5DUML 2A2QT 4OCRH 3OGCB 1MJJB 3BPLC 3P30L 3V0WL 4LPUA 5CSGA 2DB8A 4XT1C 4X98B 4ZD3H 4D9QD 2CIKA 2A0LD 4DVBB 4MJIE 1SJHA 1W0VA 1AGCA 1YEHL 1X5JA 3QNZB 4IIQC 1UYWL 1RZJH 2XKUA 4MDJB 5IM7A 1AXSB 3I2CL 4KJQD 4U6HA 4Q9QL 1IEHA 1CZ8H 1XGQA 3O41A 1P5VA 3HN3A 4JO3L 5B4MD 5CJ5A 1A7NH 2NYYC 3EBAA 3X3FH 5IB1A 5TQ0H 2K1MA 1XIWA 5TF1H 2EO9A 2NY2B 2AABL 4TNVK 3IFLH 1KJ3L 4WFFE 1PW3A 1KB5A 5EO1A 4LPVA 3F7YB 2DLIA 4XX1G 1TZGH 3DUHA 4Y4FD 5C0CD 2LTQB 3CAFA 1VFBA 4L4JA 1H3UA 1L0QA 3MLSH 3CDGA 4GRLC 3G5VA 5L2JA 3M1BB 1JMXA 5CBAB 4GXVH 3OJDB 2X9XA 2Y25A 2AEPH 1B3JA 3RL2B 3IJHB 1AD9B 4OQTH 3NABL 3ARTA 4S1DC 4IDLA 4NN7B 2ENSA 2F53A 3TT3H 3I02A 4NKOA 2YKLL 5GSRA 3RWFB 1WT5C 1K4DB 1SM3H 1IKFH 2JJSC 3C5SB 3I75B 1EO8H 5TFSL 1XF2A 4MA3A 3O9WA 5HYSG 3TJHD 1U91B 3MCG1 2VLRB 1JI1A 4MSWB 2EEBA 1SBSL 1AE6L 1NCCH 5I15H 1QBML 4YQXH 5LGHH 3D9AL 1S9YB 4HMEA 3OZ9H 3W11D 3U7AA 2FATL 3RZCA 1FL5B 3QXDA 1R3HB 4HZAA 2FJGB 5BCAA 3KR3H 5SV3A 4HQQH 1I75A 1AGFB 1G1CA 4R4FL 1KJVB 1R3LB 1NJ9A 4YBLC 3NA4A 3OX8B 4WFGD 1NGYA 4LIQL 1P4LA 2F74A 4QCIA 1CDUA 4PB0L 1OD9A 3CZFB 4UT6L 1P7QB 4P23D 2XA8L 3C5ZA 1GC1L 3FMGL 4S2SA 2CDEA 3TBWA 1K6QH 5T1MA 5IUSA 4U2YA 5GGSA 5MEQB 1S9WA 4NQDD 1Z9OA 3NZ8A 5TE4L 3K46A 2EICA 5IEHB 5GSVA 4I77H 1OVZA 4AH2B 4HDIA 4WI7A 3QHZL 4ZSOA 3CVHA 2X4TA 3ZYIA 4RZCA 1U8KB 3QDAA 5D5MF 2R4SL 4Y19A 3ZT6A 3PDGA 4HKXA 4OV5A 1N64L 2X10A 4Z7WA 5H37H 4E9LA 5HHOB 4XPHL 3GMRA 1R5IB 4LPXA 3FQXB 3WFEH 1ZHLA 3U2SB 3INUH 4MJ5A 1IAKB 2HFFB 2R69H 4XAWL 4APQC 4PJ9B 3PGFL 4Y2DA 4YFEA 2NZ9D 5E9DA 4L4VD 4PB9H 3O3UN 4UUJB 1RFDL 4OD2A 1TVHB 2SEBB 5ID0B 1K85A 1YECL 4A6YB 4QRPB 1GCFA 4OZIA 1E4KA 5E6IB 2Q8BH 3EHBC 25C8H 5ITBH 4PJBE 1TNMA 1U95A 3QUZD 3MLUL 4QRRD 4OZFH 5E2WH 1CGUA 1CCZA 1J8HB 1T5WA 5I6XB 4LSQH 2DQGL 3TNMA 4M4PA 5F1NA 1HHGA 2YK1H 3QG6A 3RPKA 5DS8A 1IRAY 1FORH 1SY6L 3RKPA 3DWTA 1CLZH 2B1AL 1JRHI 3JUZA 5GGQH 5IB5B 4FQXC 4JY5H 5GRYA 2CKBH 1F6AB 1CFSB 1AGEB 2XFXA 3BKYH 4R4ND 4NUGH 3WIIL 2GTZA 1PAMA 5D7IF 4M93C 4C83A 5DSCB 4FS0A 5ITFB 3L6FA 1G6RH 2YA2A 5D1ZB 2A9MH 4U7KA 3WEXA 3S35L 5GZNC 1K8DB 3F7RA 5EOCJ 1RHHB 5EOQL 3PHOA 1KJ2H 3MRGA 2HKHL 5KS9E 1LMKA 3CVIL 5HHNA 4HUVA 3O4OC 2YSSA 4JDVA 1M7IB 1ADQA 1Q9KA 2WBJC 5HYJA 4XCCH 4L4TB 3X11B 4BSJA 3MRHA 3QIBC 1FAIL 3RQ3A 1UWEL 5SWSB 4FTVA 4YC2C 2FX9L 4DEPB 4ODHH 5CEZE 2M26A 2YMXL 1CL7I 1GGIL 4AG4L 4PLKD 2IBGA 1D5XA 1T0NB 3ULUL 1JF1B 4QXGL 5D7IB 4H88H 4G5ZH 3WFCH 5GS0C 3IF1B 2X9YA 4JFHE 1WZKA 1SJEA 4UOW0 1OAQH 4FQ2L 1YEIL 1N6VA 5FYKH 1FGNL 5B39B 3KPRA 5JXEC 4N0CC 4X7CC 1A1MA 2XQBL 2GCYB 2P8MA 2ESVA 4LP4A 1S9XB 5D1QB 5JDJA 1VADA 2R2EA 5JHDE 1IGYA 3T1FB 2BNQD 1AH1A 3DX8B 1U3HA 4HSQA 3P0VL 4XMLH 3S4SB 4RAHA 2BHUA 4MCZB 1WBZB 2JK5A 2NY4D 3VFUB 1PDKA 2MJWA 2DF3A 5D6CB 2DMBA 4Y5XC 5EUOE 3VWJA 3OMZA 5IBUG 4JJ5B 1YEGL 2AV7A 4DTGH 1K2DB 1YJDH 4RA0C 3ECBB 3HG1E 1RK1A 5I18L 3E2HB 4PBXA 4PJIE 4UAOB 1NAMH 1CGSH 4KDWA 3VFGH 2F8OA 4JR9L 2G2RA 3L5JA 5IVNA 4KH2A 3O2WL 1A7QH 4R2GB 3S9DB 3UTQA 4OZGA 3W0WD 2O5YL 2EXWC 2DS4A 1FFPB 3LN9A 3MBXL 1ZLWK 4Q9RH 4I0PD 2YUWA 3V4PL 1F11A 3BUYB 1WAAF 2KKQA 3V6ZA 2B39A 3PNWB 1JZ2A 2NY1C 1UCBH 4ODXB 1R5VB 5IVXF 1FGVL 3UZEA 4DN3H 4ZXBA 3HE7C 1JGEA 1OT1A 4CW1A 3V5KB 3QJHA 5F7EL 4EDWL 5FYLL 3KJ6H 5TQ2L 3H7LA 1MVUB 4WW2A 5IBTH 1LHZA 4LMQE 3VFTA 3W5NA 1QO3B 5D71L 2JJUA 5DGQA 4YBQC 4WTWA 2A6IA 4I3SH 1N7MH 2DI9A 3VI3E 5F93C 2PYEB 2X1WL 2O5XL 2F19L 2UZIH 2DJSA 2PETA 3C87A 2F5BL 1N8ZA 3SE8L 5I8OL 2CUIA 5KTEL 1I7UB 1D5BA 2APWA 1RU9H 2EH8L 1C8PA 4E41B 5T1LA 5IVXB 3ZDYE 3U79A 4KI5F 1A1NB 3K4ZA 4GW1A 3QIUB 4YHYB 4WJ5B 2OSLA 5E00B 4Y89A 2YD6A 1WWBX 5JOEA 4XVJH 3EKCA 1CDHA 4U2ZA 1GZPA 3L3HA 4N0UA 4U1GC 4BFEA 4ZUWB 1XH3A 4WRLA 4HIEB 5CBEB 5FM4A 4WDIB 1P84J 4XNUH 2FYYA 3ZDZE 1MWAH 4HK3J 3SDDC 1CXKA 1EO7A 2IANE 1KB5L 1OAZH 2VXVL 4GG6A 3TO4A 5E08H 4DGIH 1OB1A 5A1AA 3GGWB 5JOFB 1UZ6F 5EB9A 3L3DB 5CZXC 2AJUL 1HZHL 4JFEA 5GGVL 4Z7NE 3VWKB 3O0RL 4M6OL 5EFIA 4KK8C 4JM2F 2ZCHH 5EOCL 4ZDHA 4UOW1 4R96B 3C5JB 15C8H 4WWKC 4LIQE 2R2CA 4XAKE 2ADFH 4DCQA 5IB2A 4OGAD 4NHUB 2IQAA 3NACL 1QSFA 2ADIB 5J3HD 4J1UA 1F58H 1BREA 3RVVD 3L5HA 1AXIB 4XNYH 2HN7B 3X13B 1QSVA 2PW1A 4JKPH 3G5ZA 2F5AL 1F97A 4NJ9L 3IGAA 1X6NA 1TVBB 3TYGL 2CLZB 2YEZB 1G7MB 4K23L 1GZQB 4BM7A 3V6OE 1TQCB 4MB5A 1IGCH 2Z35B 1CT8A 3ARFD 5E8EB 5DR5H 2QADB 1QHPA 4XCFL 1EXUB 2Y07L 3S34L 4JM2B 3GI9H 2UZXB 3SQOH 3OGCA 1IC4H 1ZA3A 4JQIL 4P3DB 1MJJA 5F6HJ 3ARWA 1CLYL 1BEYH 3AREC 3U9UB 1KEMH 4DVBA 2PYFB 4LAJH 1DLFH 3F6IA 1RUKL 4I3GA 3QNZA 4LQFH 1XR8B 1J1PL 4DK6A 5HHQB 1L9NA 4MDJA 1AXSA 1TVDA 3ULVF 2X42A 4P9MH 5JA8B 1OTSD 2YPLB 1N5AA 2FJFB 1HK6A 4U05A 4OZ4B 12E8H 2BNRE 3B9EA 2VDLH 1CG9B 5KVEH 1NFDE 1DFBL 3QFJE 2MCG1 3RWIB 4TTGA 3DUSB 3CH1B 3LKQB 5F97E 3RPIB 3F7YA 1J5OL 4HMDA 4K2UL 1FCGA 3PABB 4LVHB 4NZJA 3CVHL 4P2RE 3WL9B 5EPMB 4KJWD 4WCYL 4QYOB 2IPKB 1PYWB 1KN4H 3JV0A 3MGAA 5FYJU 3O6FD 3U7YH 5HPMA 5EWIL 1DP0A 3M1BA 3B9KD 5CBAA 3OJDA 1UVQB 2DN7A 1UEMA 3RY6C 2FEDC 4PRAB 3V0VB 3T04D 3T8XA 4OZHF 2BRRH 2NR6D 1GGBL 3OAZH 1T7XA 3RL2A 1ADQH 1AD9A 3IJHA 1FL6B 4GLRH 1U41A 4Y4KB 4JRXD 3RWFA 2B5IB 1K4DA 3C5SA 3I75A 1KYOJ 3PQYE 1NCAH 4MVBD 1U91A 3RA7L 1MAMH 3WXVL 4CNIB 5E1AB 3T3ME 1UJTA 4MSWA 4U7MA 4WEBH 4DWHA 4ONHA 4OGYH 1W72B 2NX5B 5DMJB 2HJLB 1S9YA 1OP3H 3QWRA 3O3AB