3M45A

Crystal structure of ig1 domain of mouse syncam 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cell adhesion molecule 2
publication title N-glycosylation at the SynCAM (synaptic cell adhesion molecule) immunoglobulin interface modulates synaptic adhesion.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 101
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m45A00
4XPHH 4RAHA 1HHGB 3QEQE 1YZZA 4WEBH 2VL5B 1MUJB 1A8JH 3UBXG 5ID0A 1SJHA 3IDNA 5D8JL 1IAII 3JV6A 2HN7A 3MV7A 1H8OA 1F97A 4PLJC 2I9TA 2P5EE 5E9DB 3MR9A 1TQBB 1FN4A 3HA0A 4PTTB 3INUH 5I30H 3MFFA 5MERA 3MLPA 2XZCL 4LSQH 3T0DA 5E4EB 1C12A 5GGQL 2VN7A 3QXDA 4JHBA 5F9DC 1P4BH 5FYKL 1FDLH 3ILQD 4AL8L 4KQ4H 1S8DA 2X4NB 3HC4H 1AD9B 3QEQA 4QRRD 5DJDB 3DX8B 3U4BH 3T2NH 1JGUH 2FYYB 1UWGL 4M5ZH 4L5FH 1BZ9A 1JPTH 1FVDB 4OTXL 4Y2DA 4CKVX 1A6WL 1KJ2B 3ULUD 2LU3A 4J12A 2P5EA 2ATPA 4FQLL 3O11A 4M5YL 5JO5A 4NBXB 4RFNB 5HGDB 4RWYL 4ONOA 3HI6L 3QIWC 3PHQB 1WLHA 3JXAA 2YUXA 3LPFA 3WIIH 1V7MH 5T5NF 4DTGL 5ANMB 2EEBA 3MUGA 1GGBL 1AP2A 4L4JA 1I1AA 3C09B 3MRBA 2DQCH 4LNRB 1PYWB 2OL3A 1KLGB 1CXFA 1UWXH 5HHXL 2V5TA 4HUXA 1IC4H 1WZMA 2DWDB 5IMOB 1NMBH 1UA6L 3MGOA 3OG4B 4JRXB 4QRPD 4LLVB 5C2BL 5IW3A 3ZYOA 2AXFA 1PGRB 2QL1A 1U8PA 2DJSA 2EIBA 4K3JH 1PJ9A 5TH2B 5IB1A 3MZTA 5M94B 5H2BB 2Z8VC 5DF0A 3NOIA 3SY0A 3KPQB 5FOJA 1JF1A 3EYSH 1ROWA 1BP3B 1UFUA 1H9VA 1WBXB 1S7QA 3TNMB 5J13B 4FQCL 4Z7UF 1WAAF 3FOMB 3BGMA 2C4XA 2I9LA 2YZ8A 2NR6D 1JYWA 4NUGL 3AU1B 3MLYL 4N8VG 4OM1H 4YXHH 2GFBA 3K3QA 1FO0H 4HQQL 4K07A 3N1GC 5DVKA 5KVDL 4L8DB 1KIUA 4MVBD 5SWSB 1E4XI 3HG1E 3FFCD 3O4OC 4DWHA 4NKOA 1O7SA 1QTYT 5B4MD 1JRHI 4ZUVA 1JZ4A 1J1XH 1XF5A 4NCC2 5I8OL 2Q8BH 4JFOB 2CUIA 1VEMA 4N5ED 1ZVHA 2X4SA 3O2VL 1H3GA 2ZCHH 5I1EL 3QUMA 4GS7B 1D9KC 1G7HB 2O5ZH 3K2UH 3M8OL 1DQTA 3WEXB 3X13A 1YNLL 3BDBA 4MHHI 1HDMB 5BQ7A 3SKMA 4L8SB 4YEEA 1JTOA 4Q6IB 1RIVH 3S88H 5SWZE 3MOQA 1HILB 3QDMB 3TH2T 4JR9H 5D6DA 2BJMH 3MBXL 5E8PB 3TBSB 3WSQL 1FAIL 2JE8A 3G5XB 3ROLA 1J8KA 3RFZC 3GKWL 2IGFH 1UWXK 5AD0B 1P5UA 3HG1A 2VDML 3TCLB 4U1SB 4Z95H 1MFBH 4EBQH 3KVQA 2JLLA 1I9JH 3QG7L 3FT3B 1F3JA 5ICZB 1PAMA 4D3CH 1T3FA 1KB9K 2HT4C 5JIPA 2DIAA 5BS0D 1QFUL 1YEDA 2ICCA 4JN1L 2FO4A 5MI0B 2YR3A 3UTTE 4Y5YB 4KROD 1R3JA 3IFPA 4ZPTB 5SWZA 5JZ7C 2I25N 2C4FT 1XZ0B 3QDHA 5CWSB 5DEZA 1T03L 3H0TA 3F7YB 4PY7B 4U33A 4LHJB 2EO9A 2EEAA 5FK9B 3KDMB 3DOSA 3QI9A 1AY1L 1V8HA 5JXAL 4V1DD 3OAZH 4GO6B 1B6DA 4WHTB 1BIIA 1CGTA 4I5BB 3ZL4L 3U2SA 3N50A 5F7MC 5K9JL 1JN6B 5D1XD 2PO6A 5DJ6A 1YMHA 1UWGH 5DLML 4JQXC 5E9DE 4EXPX 1CFVH 3DXAD 4PJCB 1UCBL 3U0TA 3H7BA 4JFFB 1A6WH 5HDQL 3UTTA 1RZ7L 4PRBA 5D72L 1KEML 1FCCA 1CG9B 4OZGF 4CVZA 3VG0H 3EIFA 1FSKB 1HOCA 3HNVL 2JTDA 4YFLF 5E8DL 3TGXA 3WHXB 1DTUA 1CF8L 3BSZL 1HINL 1HHGA 5CINL 4UQ3B 2VL5A 1MUJA 1U8QB 4HFUH 3V9FA 1N26A 3NMEA 4KRLB 4JFYB 2X4QB 4YZFF 2M8XA 3TO2B 1ND0B 4K7PY 4YQXH 1XIWB 2C26A 3NBNA 1WF5A 1A21A 2P4AB 3NCYS 5E9DA 5T1KB 4PTTA 1MCWW 3QB7C 4OLUL 3EOYG 2B1AL 4KPHL 1WCQA 4J4PC 4DKDC 4MB4A 4HIXL 2NZIA 4CU6A 1KG0B 5ANME 4P3WA 5GS0H 1IEHA 4JO4L 4X7DC 3KPMB 5CFHA 3TZVB 1DL7L 2D31B 1QFWI 2X4NA 3JUYA 4GQPH 4Y4HD 4RGNC 1AD9A 2HT2C 2IFGA 4F37K 3LDBC 5DJDA 3DX8A 3UJTH 5D1QC 2FYYA 5HGGS 4D9RD 4IIQC 4XBEL 1FVDA 1CFTB 4JRXE 3ZTJH 4B0MM 4LHQB 4EUPB 1KJ2A 5HYJD 3ARED 3RY6C 1AXTH 2P48B 3OAZK 3ORJA 5HGDA 1NBVH 2RBLA 3PHQA 3MBED 3OF6D 5DQDH 5ANMA 4XPTL 3DUSB 5DJZB 2EH7L 5I8OH 4LNRA 1PYWA 1KLGA 3NH7L 2MPAH 1MFCL 1X5ZA 3LY6A 2DWDA 3M8OH 3PDGA 5IMOA 4BSJA 3SDCC 1I8LA 4U0RC 4JRXA 4ZFZB 5F8QC 4WDIA 2Q8AL 2VISB 3ZT5A 4LLVA 4P2OB 4R26L 5SWSE 2KPNA 4IRJD 4LEXL 4OZFB 3LB6D 4G8EB 4RMRA 1CGSH 5TH2A 5JHDD 2YRPA 5H2BA 2E7CA 2VDMH 3LQAC 1HNGA 3KPQA 3E0GA 5CS7A 1GZPB 1WBXA 3QG7H 3TNMA 4GOSA 5HVWA 3FOMA 2BNUB 2NY4D 1FYTB 4QRUB 3AU1A 3QDME 2VB5A 4KKCC 2BERA 1ZSDB 3MA9H 2APTA 4L8DA 4LKXB 4K8RD 3E3QC 3QPXH 2OX5A 2VRAA 5SWSA 3VRIB 3I9GL 5C8JB 3VMOA 3WS6A 4P23D 4M9OA 3DETD 3V6ZB 3NCBB 7FABH 3NGBC 4JFOA 5FYLD 1DN2A 4IMKA 2BY2A 1AY1H 4TNWK 3T3PF 1OW0A 1GC1H 1L0QA 3S35L 2F74B 2RJMA 5TE4H 4G9FB 4A2LA 1G7HA 5E0QA 3WEXA 2GJ6B 1FPTL 5F9OL 3ZL4H 3LMJL 2HMIC 4UV4H 5IESL 4L8SA 4XNUH 4Q6IA 3V5DB 4RMWA 1HILA 1WFTA 3O2WL 3QDMA 4I0PB 1RZIB 3OAYH 1F4WH 5E8PA 3TBSA 1QFHA 1RZGB 1RZ7H 3L3KB 5AEAA 3G5XA 5HI3D 3FHAA 5D72H 4LGRB 4OFDA 2Y06L 2CJUH 5AD0A 3TCLA 4U1SA 3VD5A 4MS8C 3QIBC 5E8DH 1TIUA 1CF8H 5DUPH 3FT3A 3Q48A 4TNVF 5FYKE 3DX9B 3MRJB 1YEJL 5ICZA 4X8XA 3T65B 4M1DL 5DI8B 1PG7W 2R2CA 4EDWH 4PJCE 3SDDC 3BZFB 2X5PA 1CDYA 4JFFE 1JP5A 4KY1L 2XZAL 4ZPTA 1VGEL 5GRYA 5L9DL 2YOCA 4ZUSB 3GJFK 1XZ0A 5CWSA 3PP4H 1S7WB 1T7VA 3MXWL 3F7YA 4HXAL 1A5FH 4PY7A 4KPHH 1BF2A 3O6LL 3EKCA 2CUHA 1N0XL 5FK9A 3KDMA 1P4LB 4YHYB 3SJVD 4BK5A 5D70H 4PJHE 1LP9B 4JO4H 4WHTA 1S5IH 4FXKB 1GXEA 4I5BA 3ZE2F 1DL7H 2VR9A 3X14B 4LP5A 4FRWA 1J0JA 1JN6A 2NY6C 3CX2A 2NXYD 6CGTA 1IAMA 1MF2H 1ZT1B 5MP6L 3BEVB 4PJCA 4OIBA 1PZ5B 3KLHD 3F8UB 4JFFA 1ZA3B 2Q1EA 2SEBB 5CEZD 4KGLA 1NCDH 3SHSA 3QHFL 1CG9A 5I71B 5TQ0L 2R0LL 3DI3B 4NN5C 3WHXA 4MXQD 1DQDH 1FNLA 4GSDL 1KN2L 2J8HA 2WNGA 3QNXB 4K3EL 4M7JL 4UQ3A 4PJHA 3CZFB 2EH7H 4WI5A 1U8QA 1QPPA 3OAYK 1UB5B 4JFYA 2IMMA 2X4QA 2WUBL 3TO2A 1BIHA 1ND0A 4I3SL 4LARL 4QXWA 4KRPB 4X0KB 1XIWA 4OLYH 2EXYC 4ORZC 3PWLB 2ZCKL 3BZDA 3QQ9D 4OF5A 5T1KA 3P4MB 3PDDA 3WD5L 4NZDA 1T6VN 5H37H 3CCHB 4FQ1H 2Q8AH 4TSAH 4PJDF 5F7LB 2OJZL 3MMEB 1GIGL 3I6LE 4D0CB 4LEXH 3IDUA 2C1OB 2K1MA 3KPPB 1FGNL 1KG0A 1ZLSL 4CW1B 1NGWB 3KPMA 1F42A 1YPZB 4U1IB 3TZVA 4CMMB 2D31A 4N68A 1UM6H 1U3HC 2VDKL 2D7PA 1YEEL 2FHCA 5HDLA 7CGTA 4WFGE 3SE9H 3WUWB 4P3CH 1Z6JT 2EDYA 1CFTA 4ZNCD 2IPUK 4XHJC 1FL6B 4EUPA 3RL1B 2BFVL 3QHTC 2PF6A 5I1IL 3MA7B 1DJSA 5I15H 5HHPB 3GZKA 1VFBB 3I9GH 4PGBB 4YHIB 1HZHH 5C6PB 3MRCB 4HW6A 3DUSA 5DJZA 3ALPA 5IW1B 2GSIB 1HXYB 3MRDB 1AKJB 3LVEA 3QH3B 4P2RB 3CXHJ 4BSWB 2X4OB 4UZGA 4MYWB 2V17H 3D0LB 4UU9B 4U3XA 3ZE0F 5TFSL 1FYTE 3T3MF 1FPTH 4NM8H 3SO3B 1QO3B 4M9PA 3NIGF 1O7VA 1RFDH 5EC2B 1G9ML 3LMJH 4AEHL 3TO4C 5C07B 4ZFZA 1FC1A 5IBTH 5JDJA 2VISA 1RHFA 4P2OA 3O2WH 4OZIB 3P0YL 4YO0B 2E9WA 4OZFA 4LU5L 4G8EA 2DLEA 3DROB 2CLRB 3VFWB 4FQIH 2Y06H 3PL6D 2AEIT 1U91B 1T7ZA 4MDIB 4NGHL 5HHME 4MJ5B 4G9FE 2YD9A 3BQUD 1I7UB 1GZPA 1CD9B 2AJXL 2GJ6E 2ZOLB 1NCAH 2HP4A 4GBXC 2BNUA 2UUDH 1CL7I 3UTQB 1FYTA 4QRUA 5SV4A 3EOTL 1ZSDA 2YKLH 4FQPA 4BZ1L 4KY1H 2XZAH 4LKXA 2L4OA 1J18A 1W2KT 3X3GH 5INCB 1T5WB 4JPKL 3VRIA 4WFHE 2DQEH 3FQXB 5C8JA 4K94H 4WUKH 4JM2D 3V6ZA 3O6LH 1I85C 2VITB 2JJSC 2X7LB 3Q6FB 1N0XH 1BECA 1FNHA 1OTSC 4X5WB 3VFPB 3JSSA 3WLWC 3RBSA 4WI7A 2F74A 3O8XB 4G9FA 5C1MB 4MQXD 1WFOA 4WWID 2GJ6A 3NCFB 1QLFB 5F97E 3RVVC 1H3WM 1J0HA 2ZP0T 2A6JA 3MXVL 2BNQD 3O9WC 3V5DA 4DGYL 5HYSB 4I0PA 3LIZL 3U9UB 1RZIA 5GSVB 3TT1L 1IGCH 1RZGA 3L3KA 3FRPG 3A6BL 1FGVL 1P53A 3DHJA 3QHFH 5EUOF 1MWAL 2H3NB 4NQCD 3HFML 5LCVL 3IRPX 5DRNB 1LP9E 4LLWB 5GRZA 4HD9A 3DNKA 4LSSL 4QEGA 3DX9A 3MRJA 3ZKMC 3NTCL 2F15A 3T65A 2NY3D 5DI8A 1Y18B 2VDPH 3ZDXE 3BZFA 4I3SH 4LARH 4HMEA 1JWSB 5KAQF 5EULV 1H3TA 3FTGB 4M1CD 4ZUSA 3HZYB 1IRAY 2K9UA 1S7WA 2X09A 5ESAB 5FUCE 4PG2C 1TCMA 3K80A 1FGNH 3VFRB 5ENWB 1P4LA 1T4KB 2UUDK 1LP9A 3LKOB 4FXKA 3S36X 3X14A 1TTGA 1GPOL 4WI6A 1JZ2A 4XVTL 3HI5L 4NUJB 3SBWC 4FG6D 1DUYB 4PV8B 2VDOL 4LVHC 1JFQH 1FRGL 5CGYD 3BEVA 4I77L 1PZ5A 4HK3N 1T0MB 5CSBA 4KJQD 1ZA3A 2SEBA 3W11D 4NSKB 1MIEH 2EH8L 1KLUB 25C8H 1IM9B 1TQBC 2VZ1A 4KMTL 2XICA 1Q0XH 1MRFL 5KANI 1MCWM 5TF1L 5DURB 3OPZH 3QNXA 4BSVB 1RZKL 3O3DB 2R4RL 4Y5XB 4PJFF 3WE6B 1D5XB 3CZFA 1FBIL 1F11B 2PUQT 1KUMA 2XI9A 3I3BA 1INEL 1K6QL 4JG1L 4JGUA 4M61B 1UB5A 4MWFB 1NC4D 5F1IB 5D96B 4RFOL 5TFSH 4X0KA 4IRSB 3PWLA 5EO0B 3HE7C 4S1QH 4AEHH 3P4MA 2CRYA 3VG9B 3CCHA 4XPBL 1X44A 5IVOA 3MMEA 1PG7H 4XI5C 2CQVA 1I9IL 4D0CA 2C1OA 3KPPA 4CW1A 4LU5H 1HWHB 3PWNB 1NGWA 1NKOA 4NO0B 4YPGB 1F3DH 4OUOA 4P2RE 1YPZA 1ZA6B 4U1IA 4U7KA 4Q9QL 2VR5A 5JW5B 4CMMA 3BKCL 4M3JA 3DV6A 2ATKB 3IAQA 4Y5VB 5A16B 3PP3H 3S7GA 3WUWA 5C07E 3HE6B 3MOBH 3LQZB 1FL6A 3JZ7A 4OD1H 3RL1A 4GMSL 4LRIA 4H8WL 4OZIE 4S1RL 3EOTH 4KK5D 1I8LC 4JZJB 1QVOB 3MA7A 1DBJL 3DV4B 5HHPA 1LNUB 1VFBA 4FQXB 5DUML 2GHWB 4PGBA 4YHIA 1AC0A 3MRCA 3QP3A 3RU8H 5IW1A 2GSIA 1HXYA 3MRDA 3WO4C 1AKJA 3CFKB 3QH3A 4P2RA 4PJXB 3HS0B 4UV7H 3KLAB 3ZTJG 5I2IB 4BSWA 5DWUL 3RVXC 2X4OA 2EDKA 1N5AB 4E41B 2WW8A 3D0LA 2XA8L 4UU9A 3ARFB 4P57B 2R0ZH 1QO3A 5C6WH 5EC2A 3MXVH 5C07A 1L4IA 2FZ3B 4OZIA 1R5IB 3LIZH 1A7QL 4UUJB 4YO0A 2FSEB 3TT1H 3FO1B 1HHHB 3T08A 3A6BH 3DROA 2CLRA 3VFWA 2PYED 3BPCB 3FAWA 2D7QA 4KMQA 4LHUD 3SDXF 5A2FA 4XC1L 2VIRB 1U91A 4MDIA 4MJ5A 4EI5D 3D3VD 1I7UA 1MWAB 4LSSH 2ZOLA 1OW0C 3RWGB 2D0GA 4BELD 4AJ0A 2NY0D 1H5BC 3UTQA 4FQQB 3QUZD 2QHRL 2I5YL 1NGYB 2IPTH 1V3KA 3DSNA 1GOGA 4NRYB 2EE2A 4YBLB 3GDBA 4MMZC 5INCA 1T5WA 3KYKH 3W0WB 3BT2L 1ZWIB 1R3IL 2ILLA 3FQXA 1T7YA 3B83A 4Y7MA 2ADJB 5FHBH 2VITA 5DFVC 2OI9B 2X7LA 3PP3K 3Q6FA 1DFBL 1FIEA 3OHXB 4X5WA 3VFPA 5I9QB 5IB2B 5E6IB 1MCKA 1JNNL 3NABH 3O8XA 2AQ3A 3T09A 3RWIB 5F21B 4QGYA 3GNMH 1QLFA 2QJDA 5DZNA 3B2UD 1F4YL 1GPOH 5FA4B 3B9KC 4RBPH 4R6UA 1B3JA 3BGFB 2IQAB 5HYSA 3ARGD 3U9UA 5GSVA 5ISZD 4PP1C 4HDIB 1EJOL 1Q38A 3NAAL 5CJ8A 2H3NA 5DC9B 1MJ7H 3DIFB 3NCJH 4MX7B 1I7ZB 3BYYA 2PTVA 2OR7A 2DQIL 1Q72H 1MRFH 3RKDC 4JY5H 3CDGB 5DRNA 4LLWA 5GXBB 2G75B 5TF1H 1NMCB 1OTUD 5ITFB 2R4RH 2FECL 4IJ3B 1JYNA 2NY2D 4MGXA 1S5HB 1Y18A 3TJHD 3EW3B 3DMMB 4MLIA 4JG1H 5T1LD 4RFOH 1JWSA 3UAJC 3ZO0A 3U0WH 2DMCA 1KC5L 3FTGA 4JCMA 5DVOA 4PPTA 3HZYA 4P5TC 4XPBH 3EO1B 5ESAA 1BQHB 3BDYL 1U8JB 3MGAA 3HZMB 1YQVL 2DLHA 3VFRA 3F7QA 1FSKC 5ENWA 1T4KA 1GGUA 2EXWC 3OKLB 2YUZA 3LKOA 3GSQB 2HT3D 3U46B 4XB8A 4XNZB 4NUJA 1DUYA 4NHUB 4KKNA 2HFGL 4PV8A 3RZCB 2IPUG 4Z77B 1T0MA 1EVUA 4JFHD 3VGGA 1KLUA 1MCPL 1IM9A 2B7DT 3QIUD 5TE6H 4U6TA 1OAZL 1DBJH 1X7QB 4WTZA 4ZG1A 3CFCL 4UAOC 1OD9A 1B2WL 1HHIB 2R2BB 4ZFOL 3QDGD 3ULVD 1MPAH 2KQMA 2F53B 1HIML 4Y89A 4BSVA 1MCLA 3O3DA 4Y5XA 5GS1C 2DB8A 4RBPK 2OYPA 3WE6A 1D5XA 5DD6B 1FH5L 1F11A 1T1YB 4DK3A 3TZVC 5GJTL 2ZSVB 4M61A 4MWFA 4EQ3A 5DWUH 3WLBB 5GS0C 5I1KL 5F1IA 1J86A 1PSKL 1IZKA 2BXYA 4IRSA 5EO0A 4FXGB 4Y4FB 4G8FB 2VZTA 3GI8L 3JWDC 1Y6NR 5C08D 4NZUH 1A7QH 2AV7B 3TIDB 2ICWJ 3PWNA 5KSAB 4YPGA 2WBJD 1V7NL 4PJXE 1FQ9C 1ZA6A 2XFXB 4XC1H 5JW5A 5KW9L 3IU4L 2DOCA 3ZDYE 4E41E 3GBML 1A6VL 2ATKA 3WIFB 3ARDD 4Y5VA 5A16A 5H37G 1F4XL 4YE4L 2HRPL 5I8CB 3HE6A 3LQZA 4J3WA 3L1OL 4JZJA 2Y1VA 1QVOA 1LO3H 2YBRB 3DV4A 1BJMA 4MNQB 1IFHH 2IANB 4HGWB 2XACC 4GW4B 1LNUA 3HNSH 3ZDZF 4FQXA 4N0CD 3Q6GH 3TFKC 3WUWG 1MJUL 3KYNB 5J6GB 3EBAA 4QOKB 1RUKH 1FFRA 4J3SA 2HJFB 3DX6B 4LKCB 3MUJA 3CFKA 4NWUL 4OT1H 4PJXA 3HS0A 1QSEB 3KLAA 5I2IA 2Z31B 1N5AA 2Z8WC 4E41A 3E6FB 4KHXL 3ARFA 3G9AB 2HVJB 1EO8L 1YY9C 1AH1A 3UTPE 2P46B 2R39A 5D5MB 2A0LD 2EEDA 2FZ3A 3W0WE 2FX8H 4IDLA 4DW2H 1R5IA 1QZ1A 4UUJA 2FSEA 1MJ8L 3FO1A 1HKFA 1HHHA 1Z9LA 3TNNB 1EJOH 3NAAH 1QBLH 3HMWL 3BPCA 4S11A 2FH6A 4Z7NE 4RISL 2QSQA 1TDQA 2VIRA 2DQIH 4PJAB 2IPKB 4Z0BL 1MWAA 5E00B 1ORQB 5FDWB 3RWGA 4S0SD 3BIBX 2OSLA 1ZLVK 2J8OA 1NGYA 1T22B 1GC1C 4NRYA 2JJUA 2E27L 2VXTL 2EKJA 3UTOA 1JZ6A 1FP5A 1KC5H 4OCMC 3W0WA 1ZWIA 4HWUA 3FQWB 5E7FA 4PJBF 3BDYH 1BOGB 2ADJA 2IAMC 1PDKA 1YQVH 4HWEL 2AJ3B 3OHXA 5IB2A 3HR6A 4OLWH 5E6IA 5HYEA 4U6XB 3RWIA 1RMFH 1NCWL 4R97C 5J12B 1TZHB 5BO1H 5FA4A 2KH2B 4GFTB 5DR5L 3WS3B 2HFGH 4J3OC 4NQVB 5FHAL 1LO4L 2IQAA 2NZ9D 4GRWH 2C7UB 4FNLH 3QZWB 5M95B 1A7NH 3ZTNL 4HKJB 5T1MB 4HDIA 2DQGL 4L3ED 1CD1B 5B3JF 2ICES 5EZOL 4F37F 2Y7QB 3DIFA 1RQ5A 4IOFD 4KKLD 1I7ZA 4MX7A 4X9HA 3CDGA 3CFCH 2G75A 1HIMH 5MENB 5ITFA 1CLZL 1JYVA 5FGCB 1NCBL 1S5HA 4ZFOB 2ERJC 3DMMA 3DSFL 5GJTH 2VDRL 3P0GB 1UH4A 4AENB 1SJVA 5FYJL 3KYOB 6FABH 1OARH 3KXFB 2P5WB 5T33L 4DKEH 4X80L 2HKFL 4PJCF 1IGMH 1V3LA 1MI5D 1OWRM 3IVKB 4HLZH 3GI8H 5GS3A 4KH2A 3EO1A 1BQHA 1JPST 1U8JA 4NNXB 5I71C 1LWRA 3HZMA 3O3AB 1BQLH 2F53E 4WW2B 1YNKL 4TTDC 3D5OF 5JPNB 4NOFA 1Z9MA 3OKLA 4PGZA 4X7CC 2D0FA 5EU6D 1V7NH 5LWYH 5GGVL 3GSQA 4PJHF 5KW9H 1KNOB 3U46A 3IU4H 1XIWD 3KPTA 4FS0A 1JMZA 4OQ1A 3BISA 1A6VH 1MCSA 3DX7B 4W68A 4NHUA 3RZCA 1AGCB 1F4XH 5HTSA 3B4NA 4WHDA 4YE4H 1T66C 3STZB 4Z77A 3U9PL 3QCTL 3C5JB 4OUUB 2EDJA 1QRNB 5E8OB 5IK3B 5KS9F 1BWWA 1UH2A 1X7QA 1OB1B 2R4SH 4JB9L 1L9NA 3DRQB 1HHIA 2R2BA 2YD1A 2AABL 1MJUH 2F53A 5I75B 4JM4L 5DZOA 3MRLB 4R7DB 1M05B 5DD6A 1T1YA 3WFCL 4HH9B 5E2WL 2ZSVA 5EN2B 1MAML 1EJ6A 1JGVH 3WLBA 1YEIL 3HI1B 4Z7OE 5MEQB 4LPVA 4KHXH 1A7OL 2EYRB 2M1KA 5C09B 1EO8H 1IKNA 4FXGA 3D69B 4Y4FA 3V5HB 4G8FA 3I6LD 5SX5K 1K8IB 2RFXB 3H6JA 4MNQE 1EEUA 2IANE 1WFUA 2XKSA 3GSNH 5EORL 2AV7A 3MNWB 3TIDA 1MJ8H 4QOKE 4M6OL 5KSAA 3CK0L 5A3ID 2B0SL 3HMWH 3O3EB 4QKXB 2X1XR 1QSEE 1VADB 1Z2KA 2XFXA 4IBLT 5T3XL 3QCVL 3RDTB 4Z0BH 3L5XL 2XQBL 3DLQR 3WIFA 3E2HC 1WIUA 3RGVC 1BEYH 2CD0A 5D5ME 35C8H 2R8SL 4WCYL 2QQNL 1IAIL 4GRLB 3MJGX 1VEPA 4G6MH 2XRAH 2VXTH 2YBRA 4W6YB 4MNQA 3N9GL 2F54B 2IANA 4HGWA 4NQEB 4GW4A 4X4YB 3KYNA 5J6GA 4QOKA 2WK2A 2VLMD 4PJAE 4DEPB 2HJFA 3DX6A 4LKCA 4HWEH 4I0KA 3WXVL 1QSEA 2A9ML 2Z31A 3OXRB 4LSTH 3E6FA 5TE7L 4JFED 4KK8C 2HVJA 2FJHB 3WNNA 2X4TB 3H9HB 1RK0B 2DJUA 5I19H 4PLJD 1M7XA 5DR5H 5D5MA 3RVWD 1G7MB 5FHAH 1LO4H 3NFNB 5IVXB 2UVFA 5A43C 3ZTNH 2R29H 1GOFA 1TPXB 2WUCH 1TJHL 1I1FB 4KK6C 5EBGA 3VXUB 3TNNA 5C2UB 2A77L 4PJAA 2IPKA 4HIEB 1IILE 4LAQH 3RTQD 3QCUH 2J6EH 5C0BD 5E00A 1ORQA 1BGXL 3RAJL 5EPMB 5BMFL 4K94C 1PLGL 5FDWA 1CLZH 3O8XC 4I0PD 1WFNA 5D4QA 4P5MB 2P8PB 3CMGA 4G6AC 3CUPB 1EBAA 1T22A 1JUFB 3D25B 4C55A 3LKRB 4X80H 3FQWA 1A6AB 3QIWD 1SEBB 1A3LL 4GG8B 1BOGA 5ESQB 5MENE 2AJ3A 4UOW0 4U6XA 5FGCE 4UT9L 3QR2A 5GGVH 1VDGA 3OKEB 1Q94B 5B8CB 4IEFB 2ORBL 1LO5B 4MAYD 3IXTB 1TZHA 4JRYB 4ERSL 3KXFE 2P5WE 1P69B 5CHNB 4AEEA 2HAZA 2XY1A 4OGYH 3WS3A 12E8H 4YHNB 4NQVA 4M1GL 2BHUA 2C7UA 3QZWA 4HKJA 3QCTH 3TBWB 4Y8AA 5T1MA 3SE8L 1G7JB 1IAOB 1SM3L 4WY7H 4O4YH 1CD1A 1E4WH 2LQRA 5J56B 43C9B 2Y7QA 2XQYK 1F58H 3NIFE 3G5VB 1OT1A 1E4XL 4EI6B 3O6KL 2GCYB 4MQ7B 1IEBB 4U1LB 3O6FB 4ZXBB 3EOAB 5MENA 1A3QA 1RI8A 1NH6A 1LEGB 1X5YA 4OCSL 5F7EL 4WWKB 5HDOA 1OF2B 2VERN 4ZFOA 3O3UN 4DQOL 4PLKD 1YEIH 4AENA 3KYOA 1MEXH 3KXFA 2P5WA 1A7OH 5JW4M 1QRNE 4HF5L 4R0LB 1CE6B 3IVKA 1DQMH 4OGZA 5C6TH 1KSRA 1I3VA 4M6NH 4NNXA 3PG2A 1KACB 3O3AA 5EORH 2YC1B 3RWJB 2D7TH 3G5ZB 4WW2A 2N4IA 4M6OH 1XR8B 5JPNA 2OK0L 3GIZL 3D85D 3MYZA 2OLDA 1KNOA 4P2YA 2R0KH 2X1WL 1H3PL 3QCVH 4OJFL 1D9KD 3DX7A 2XQBH 2FWOB 5C09E 1AGCA 2C3GA 4U1NB 4W70A 4WU5B 2J7LA 4JFZH 4XMKL 3STZA 4NIKB 3GMQB 2ZPKL 3GHEH 2ED8A 3C5JA 4M4RA 4OUUA 4W4OA 1IAIH 1OPGH 1QRNA 5MHSD 5E8OA 2WP3O 5IK3A 5ACZB 4HJ0D 3VG9C 1Y0LB 1OB1A 2AEPL 4QHMB 1X5JA 1AO7B 3B43A 3DRQA 1II4E 3IFLL 1ZHNB 3MRLA 1ACYL 2ARJQ 3L3IB 4R7DA 5DQJB 1M05A 1F4AA 1ACZA 5IWLC 4GG6F 4HH9A 5EN2A 1EHNA 3HI1A 3MCG1 5MEQA 3ARXA 2HT4D 2RB8A 1A0QH 1AQDB 2EYRA 4L4VB 4EN3B 2ZJSL 1OL0A 5C09A 4GQ9L 4OFIA 5C0IB 3V5HA 4KDTA 1K8IA 2RFXA 1G7IB 1CXEA 2F54E 4NQEE 1I3GH 5JZ7D 3B9AA 3WFHB 4JY4B 3ULSB 1REIA 1TJHH 4QXUL 4F2MB 4FQXC 3O3EA 3S3PA 1VADA 1NFDB 2A77H 5DFTA 1BFVH 3CH1B 4ZOEA 2W9DL 3RDTA 3IAPA 2JELL 3RPKA 4WI4A 3RAJH 5BMFH 3G6DH 4ZD3L 1XFPA 3BW9A 3HC0B 3BESR 3H3PL 1H8NA 5IB5B 4M93B 1C5BL 1NCUA 2IEPA 4U4BA 5C9JB 5IVXE 2HTLC 3QDAA 4GRLA 2F54A 2VC2H 3VXUE 4NQEA 4L9LB 2O5XL 3BPOB 4X4YA 1U8LB 4JRWA 2UWEB 4ODBD 4XMPH 1NCCH 4YHZL 2APVA 4OCXH 3N1FC 4HT1L 1OVZA 4PP2B 4O5LL 5ABDE 2RQ8A 1MFDH 3OXRA 4R4NC 4ZQKB 4X9IA 1H0DB 3CU7A 4JO1L 1MJJB 4YXKH 2FJHA 2ORBH 2X4TA 2X9YA 3H9HA 1RK0A 5KZCB 4HX1B 1KN4H 4G3YL 2DM7A 1G7MA 1GGYA 3NFNA 5IVXA 5FYJE 3GJEB 5D71L 1T7XA 2Z91B 1I1FA 3VXUA 4J4PD 1SM3H 3VGEA 2CKBL 1IVLA 3WHE1 3VFVB 4M8QB 3GSXB 1G1YA 4HIEA 1E4XH 3O6KH 2OI9C 4DZ8B 1VHPA 5EPMA 5E6IC 5HY9B 4JRYE 5F7EH 1JRHH 2IBZY 4P5MA 2P8PA 3C60D 3MRFB 3BJLA 1IGYB 5IB4B 3CNKA 3CUPA 1PKQB 4DQOH 5JXEA 2WMPA 2UYLB 1JUFA 3D25A 4Z7QE 4BH7B 3LKRA 1IAIM 2ZCLL 4NM4H 1JHTB 4YH6A 5JQHC 5BVPL 3RUGB 2DDQL 4HF5H 1U9KA 1R0AH 1A6AA 1NMAL 4UT6L 3T0EC 1SEBA 2OMNA 4XX1E 2GK2A 4WRLA 4GG8A 2NX5D 5ESQA 1JPFB 4CAGA 4NC0B 2WIMA 2AAVA 3P4LA 2ED9A 2OK0H 4JZNA 1G0YR 2IG2L 2OQJB 3OKEA 1ZLWH 1Q94A 5B8CA 3H9SD 4JANB 1LO5A 1H3PH 3IXTA 4OQTL 5JLZB 4JRYA 5D7SL 4S1SH 1U8NB 1S7VB 5CHNA 4YHNA 5IV2B 4LSUL 2BXZA 5EZIH 2ZPKH 3TBWA 1G7JA 1LEKB 2BSRB 1IAOA 2BDNL 3ARBD 4KTEL 43C9A 3ULUL 5D7JC 1XGRB 3T4AB 2VLJD 4YHLL 5IHBA 2AEPH 3G5VA 1BREA 5DJYB 2BY1A 4EI6A 2ZUWA 4EQ2A 2GCYA 4MQ7A 1IEBA 2C3XA 3O6FA 4OCLC 3EOAA 4U1LA 3IFLH 3RWDB 3V52L 4XNMB 5EG6C 1AI1L 1ACYH 1LEGA 1WT5A 2VQUA 3QUXC 4WWKA 5GGVY 1OF2A 5DD5H 1T0PB 2VDLH 4JLRB 2NY7H 3V6OE 3FMGH 5T3XE 4XNZC 5HYIA 5D2LB 1PY4A 2YA2A 1P7KB 2ZJSH 4S1DD 4KKCD 5A2KH 4R0LA 1CE6A 3O2DL 4ODVH 4P5KB 5EBLB 1G6VK 3UX9B 1AO7E 1S7UB 1RZFL 3BKYH 2CR3A 2YC1A 3RWJA 3G5ZA 1EFXD 3MOAL 1XR8A 5KSBB 1QBML 3IGAB 1NQBA 3DJ9A 3QAZC 4XPAL 5L2KD 3MLRH 2GEEA 2EE3A 2X10A 2FWOA 4L4VE 4YDIH 5F88B 3MCKB 4HLZG 5DJAB 4U1NA 3MLXL 4WU5A 3V6OA 4ZD3H 2HMID 3C2AH 4G5ZL 3VXSD 4JPVL 3H3PH 3GMQA 4HIJB 1XF3B 4Y4FC 4NO0D 4M03A 1UJ3C 4F9LA 5ACZA 1OP9A 1LDSA 3UPRB 1Y0LA 1NANI 4QHMA 1ZLWK 2XTJC 4FQHB 1AO7A 5K9KB 4WTXA 1KIRB 1NFDE 1ITBB 3C9NB 4OM0H 3QIBD 1ZHNA 4YHZH 1N4XH 4MJ2A 3L3IA 2JIXB 5DQJA 9CGTA 1M7DB 2QQKL 3HE6D 4O5LH 1FNEB 4U1KB 2E8ZA 3S3JA 4TVSa 1OAQH 2ESVD 3IS0X 2R0WL 1AQDA 5IT2L 1LO2L 4L4VA 4EN3A 1QFWH 1I1RA 1TVHB 2FIKB 4I9WD 3SDDD 4EOWL 5C0IA 1G7IA 1T20B 5FKAB 3U7YH 2QBWA 1EGJL 3WFHA 4JY4A 3ULSA 4Z7WB 2UWEE 4LOUD 1EMTH 1DSFL 1U92B 4DZBB 5I6XB 1H3VA 4UT7H 4F2MA 1KV3A 2J2ZA 1A02N 3OBAA 4NNYB 2DRUA 1NFDA 2NQCA 4XB7A 1ZT7B 2JJWA 3CH1A 4MQSB 5EWIH 2CKBB 3ARTA 4BFBD 3WFZA 2W1NA 2OS7A 2Z31C 3SCMD 2NY6D 4D9LL 1E28B 3HC0A 1KYOJ 3EDKA 5IB5A 1YMMB 2VDQL 3O0RH 5HI5D 4HWNA 4K71C 5C9JA 3VFSB 5ILTL 2IBGA 4LRNL 3EYQD 5IP4A 4RA0C 2WIIB 1RZ8B 1ZKAA 4L9LA 1TITA 2CXKA 2O5YL 4OZ4B 1CQKA 1U8LA 3V0WL 2UWEA 4UT6H 4FQJH 1J9CT 5TPWL 1C8PA 2W38A 4PP2A 4ZODA 5AYUL 2Y23A 1RUQH 1Z3GL 4CDHA 3UTPD 4ZQKA 1H0DA 1PKQE 1WZ1L 1MJJA 1DBML 4OQTH 5D7SH 1MFAH 2AK4B 4HX1A 4PD4J 1QD0A 3RUGE 1KTDB 3GJEA 1FFNB 2Z91A 4N0YL 4NZJA 5EU5A 5F3BB 1RPQA 4QRRB 4NZTL 1RJLB 4DVBB 5J89A 4AY0A 4KTEH 3ULUH 5J4MA 3VFVA 2XQYG 4LFHD 4YHLH 1FL5B 4M8QA 3GSXA 2AEQL 5FV1L 2JB6B 4RX4A 4DZ8A 2ZKHH 3I2CL 3ZKXC 3V52H 2BK8A 3LRGA 1U3HD 1AI1H 5HY9A 3NA9H 1I7RB 1NAML 1X5KA 2GT9A 3CSGA 3MRFA 5E03A 5B21A 3A6OA 1IGYA 4D0DB 1HCVA 5IB4A 1PKQA 5J12C 2UYLA 2D03L 4BH7A 3X17A 5C0EB 4XMLL 1KULA 4TQEH 1KCSL 1ONQB 1HCFX 2NW3B 5DJXB 1JHTA 4G6KL 4WI8A 4G8GB 3RUGA 4OIIH 1OAUL 3VDAA 2B4CH 1ZK9A 5JOEA 5F1KC 2FB4L 4NQTA 5H35B 3VH8B 3HRZB 4EZMA 1JPFA 2LTQC 3MOAH 3FCTB 2N7AA 3DMMD 5HHVL 4ZO7A 1WIOA 3VWKC 3D87B 2OQJA 4DUXA 4XXDB 1T2JA 3BPLB 2VLKD 1K5NB 4JANA 4NZRL 5JLZA 4ZO6A 5GJSH 1U8NA 1IGIH 1S7VA 4FFZH 1ZANH 1H3XA 5IV2A 2YPKB 3BUTA 3MLXH 5HDBE 1PX3A 4JPVH 1NGZB 1CL7L 1B4RA 4RNRB 2BSRA 1LEKA 4Y4KC 4XP9H 2BNRD 3T4AA 1KTRL 1XGRA 5KG9B 3QDJD 5F6IC 1KFAL 5KSBE 3TV3L 3J8F7 1TJGL 1VESA 5DJYA 2J4WH 4XCNB 3VXTB 3RWDA 3OL2A 4WW2C 4XNMA 3A6CH 1MCJA 4YBQC 2YA0A 1UWEL 4KMLB 4FFWD 4UMGA 4JLRA 2ENSA 4HUNB 4CN4A 3TBYB 1HYSC 1A4JB 4HAFA 3GBNL 2P24B 3ZLQC 5IROA 4GBXD 4A6YL 3CZJA 3D0VB 1MNUL 3FFCB 1I1CA 4LCUB 3MX0A 1OSZA 5D2LA 2Y6SC 5DMIL 1P7KA 2NXZD 2UZYB 5E6ZA 4EOWH 4F7PB 4P5KA 5EBLA 2H2SC 5JW3H 3SE4C 4WO4B 3K4DA 1UVQB 2PETA 1S7UA 4NBYB 4W4OC 5MEOB 1ERNA 1DSFH 1A3RL 3C5ZC 3BIAX 5KSBA 1AD0B 1RU9L 5F72S 3C87A 3IGAA 3E1F1 1OTSD 3HAEH 1HQRB 1CR9H 1FLRL 4XZUB 4Z5RB 5F88A 4JGMA 3MCKA 1Z9SA 5DJAA 1GZQB 3SGDI 4D9LH 4ELMB 5GZOC 4OI8A 2BY3A 1Q9KB 2XV6B 4J7RA 3O9WD 4BQ8A 4BA8A 2VDQH 2W9LA 2R15A 2FNBA 3F62A 4HIJA 1XF3A 5I1HL 4Z7WE 2JJTC 3I6GB 4N8PA 1D3CA 5EU7C 2DWEB 3UPRA 4FQHA 5SV3A 3V0WH 5K9KA 3BI9X 4K8RL 5BS0B 4X5LA 1KIRA 1HH9B 4HGKC 3C9NA 1RUML 2JIXA 1T83C 2X42A 1M7DA 4LCCC 4KROB 1GGCL 3AY4A 3SEPA 1FNEA 4U1KA 3TF7C 3ARZA 1Z3GH 5FYLL 1YMME 4F15C 3UCRA 1C5CL 5D6CB 4QHLB 1DBMH 1TVHA 2FIKA 1D5IH 2IAND 4LDLB 3S34H 5CCKL 2XWJB 4KC3B 3HMXL 1T20A 4V1DB 5FKAA 2Y72A 4XVSL 1E0OB 1SBBA 2DQDL 4K9EL 2O61B 3DO3A 4Z7WA 4GRLC 4NCC1 1U92A 4DZBA 4XXCC 5I1CL 5D1XB 5ITBH 3FN9A 3NPSC 4HS8L 4NNYA 1HYRC 4LDEB 1N6QL 1ZT7A 2ZSWB 3DXAB 5CUSL 3W39B 2CKBA 3I2CH 5HGHB 3VD4A 5T3ZD 4X7SH 3L5JA 5EIVA 1NAMH 1E28A 5FUOL 2AK4E 2B8OT 1TQCC 1YMMA 5GGTH 1MSPA 2L7JA 3VFSA 2YD8A 4XPGH 1NAMB 5D5MF 4JHZA 4XBPB 2WIIA 4QRRE 1RZ8A 1OAUH 4OZ4A 1UACL 2KZ1B 2X4RB 1QQDB 3GO1L 1RJYB 3WJJA 3EJYD 3VXOB 4GKZB 3SOBH 3ULUE 3SDYH 2GSGB 1CXIA 5HHVH 4H1LB 1B4JL 1NGPL 4FZ8H 4OZHB 5J6HB 2Z93B 2AK4A 4O51B 2A73B 4YXLH 5KSUB 1BAFL 1FVEB 2EDXA 1Q9LB 5CJXA 1DUZB 5I66B 4OQTA 4H5SB 4LAJH 2MQ0A 1KTDA 1PY9A 1FFNA 1JNLL 2BVYA 4Y4HB 4XC3L 5DMJB 2PR4L 5F3BA 4XI5D 4QRRA 1RJLA 4DVBA 5CEZL 3V7MA 4FMFA 2E5EA 1RSFA 2C3VB 4XNXH 4KVNL 1FL5A 3TV3H 1LDPL 4LSPL 2JB6A 4CMHC 2CUMA 3AREB 3RA7L 5INDB 1I7RA 5HVFB 4PJIF 4NJ9L 1UWEH 4MNGB 5B8CC 4D0DA 3KNBA 3MBEB 4A6YH 1RVFL 1MNUH 2JJVA 2E8YA 5C0EA 1ONQA 2EDOA 3SQOH 2NW3A 5L7XL 5DJXA 2YD3A 3OAUH 4P46C 5JQ6H 4G8GA 1S7RB 1S9XB 4LSVL 4A6YB 1JHLH 3E8UL 1IEAB 4NWTL 3QXTA 4TPRL 2D7OA 3OKDB 4GRWF 5H35A 4ISVB 3DHMA 3VH8A 3HRZA 1W0VB 3KS0J 3D18B 4G7VL 2HFFB 3O2DA 3FCTA 2APBA 4NKMB 1RU9H 4W4NA 2QSVA 4DJMA 4XXDA 3SKOB 5DHVH 2P5WD 1K5NA 2XZQL 4QCIB 3R0NA 1P9MA 4IRJB 3FFCE 4WWKC 1FLRH 3TLRA 4I18B 4ZTOL 5JIIA 4MHHG 5JHDB 1GSMA 2AKRB 5DHVB 2YPKA 1XGTB 2E9IA 1NGZA 3K46A 3QULB 4M7LL 4RNRA 4UBDC 4ZO8A 5CEXB 3KPSD 2X41A 5KG9A 1U3ZA 3RIFK 2FO1A 3ZT6A 1P4IL 2NY4B 1UEMA 4WW2F 4XCNA 3HTLX 3VXTA 1RIHL 4K8RH 2AQ2A 2CSPA 4F80A 2I60H 1RIUL 2H32H 5T1DL 1GGCH 2BRRL 3TBYA 1A4JA 1BJ1J 2P24A 4FMKA 5FYLH 5BXFB 4ELME 3D0VA 3FFCA 1JJUA 3IFOB 4LCUA 1SYVB 4P23B 1C5CH 1OSPL 5IFJB 3RNQB 3V6OC 4HC1L 5CCKH 4F7PA 3JUZA 1CE1L 2CGRL 4WO4A 4K9EH 2OXHA 3KPLB 1UVQA 5F7YC 5CZXC 4HBQA 5BS0E 5MEOA 3U30C 4NKDB 4EIZC 1KJ3H 1A7RH 5GHWL 5DFVD 1AD0A 3P4NB 3G6JB 4GMTH 1DBAH 1EGJA 2Q86B 5E94B 5DD1L 1HQRA 4HS3B 3KJ6L 5DRWB 5C09D 4XZUA 4Z5RA 3LH2L 1DP0A 2G60L 2YN3A 1GZQA 2DQTH 5FUOH 4ELMA 3B9KD 1Q9KA 2L0DA 4V1DE 5JOFB 1FNAA 4FA8A 4YWGH 1F6LL 5IHZB 3I6GA 1KYOK 3WKNA 2DWEA 3FRUB 1T1WB 2CR6A 5F6HI 2BVEA 2OZ4L 3PE9A 5BS0A 4JY6B 3RDTD 2DMBA 1LE9B 1HH9A 1QSZA 3DXAE 4CNIB 2F8OA 4Q6YA 1VCAA 4MA7L 4PLNC 4KV5E 5IVZB 2GW5A 4U1HB 4LCIL 3MV01 1JIBA 3VA6A 4HXBH 5D6CA 4QHLA 4XP1L 1FHGA 2F9BT 2XWJA 2BHYA 3AM8A 3F6IA 4V1DA 5HI4C 3SJVB 3UAJD 4ZAKC 1XF4B 2C5DC 2O61A 2IFFH 1T89A 2DTSA 1BLNB 4XC3H 3AXLB 2PR4H 1OY3B 3CLEL 2F58H 2Y36L 4KRMB 5D1XA 2A9NL 3VI3F 5CEZH 2NXYB 4DOHB 3NFPB 5K59E 2EKSB 4NKQB 1RUPH 3F7RA 4KVNH 2IBZX 1LDPH 3DXAA 4ONGL 5DS8B 3W39A 5IMKB 5HGHA 4R3SB 4OZHE 4M48L 3RA7H 3BPNB 5FB8B 1NAMA 4I8DA 1D7FA 1P2CB 4XBPA 4FN0A 1QBAA 5L7XH 4FTVD 1AGFB 1QQDA 4D9RE 3OXSB 1RJYA 4TPRH 2HKHL 3VXOA 2R9HC 3QEGH 1P7QD 4GKZA 5KVFL 2GSGA 4G7VH 3CVHL 1R5WB 2F8XC 5JIKA 4H1LA 4MNGE 5K9QI 4NN7B 5GS0D 2QTEA 2WSKA 4OZHA 5J6HA 2Z93A 2H2PC 3P3YA 4O51A 2A73A 5FYJD 5KSUA 1FVEA 1Q9LA 1DUZA 3S36L 5I66A 4H5SA 4YDJB 1TCRA 1OAYL 4Y4HA 3QXVA 5E6YA 4LPCA 1VB9A 1M4KA 2MFNA 4KUCD 2LAAA 2C3VA 3D39D 2DMKA 3QUYC 1ZGLP 3SGEI 4PRID 4DFHA 4M6AA 4HIIB 4JO3H 1U3YA 2ZUTA 3AREA 4TVPD 2PXYB 5INDA 1RIUH 5JHDE 5HPMB 4MNGA 2BRRH 4PJEF 3GM0A 3MBEA 3QPQC 3WKMH 4PJGB 4ODHL 4AQ1B 4CL7A 5J11C 5D2NB 2AEWA 3V95A 1LGVA 4Z7QF 4FQ2L 1S7RA 1S9XA 4A6YA 1NEZB 3L6FB 2DYPB 1BVLB 1IEAA 2CGRH 4Q9CA 5ADOL 3OKDA 5L0QC 4ISVA 1W0VA 4P9ML 1OAKL 3D18A 2HFFA 4WVRA 3CAFA 5GHWH 4NKMA 3IETB 1KIPB 2DQFB 1Q0YL 3SKOA 5DD1H 1NUNB 3H9ZA 4QCIA 4IRJA 4GLRI 2CK0H 4I18A 1P6AB 4BQ9A 5JHDA 3LH2H 4L1HA 2AKRA 1CFBA 4MZ3A 5DHVA 5E5MB 1AGBB 5IM7B 1XGTA 1ADQL 5FYLE 3TYGL 2EYTB 4D2NA 3R1GL 3FN0H 1XF1A 4ZS6C 1URLA 2IALB 3QULA 3I75B 5CEXA 5EOQH 3MLUL 3BQUB 5I1DB 4U1MB 3MLWL 3ZT7A 1AXSB 3G6JE 1F90L 4PY8I 3GK8L 2UV3A 2BVTA 4YHML 3S37H 1CICD 3ZYZA 4PRAB 5BXFA 2EZ0C 3IFOA 2EDEA 3VWJD 4NRXB 1SYVA 5AAWA 4P23A 5IFJA 3VXPB 4JM2B 1CCZA 1Z0MA 4XP1H 3RNQA 4Q58C 2JB5L 1MQKL 4WI2A 3KPLA 3H8NA 3GKZA 1EXUB 5LXGL 3MTRA 4NKDA 3HMXA 3JVGA 5D7IB 5C0NC 2IAMD 2Y36H 3MO1B 3P4NA 3G6JA 3HB3C 3M17B 5SX4I 2Q86A 2X70B 3T77B 5E94A 4N9OB 4HS3A 4L4VD 3KYMB 5DRWA 2ICWB 5I73C 1NGQL 2BVQB 3EJJX 3U7WL 4M48H 3W9EB 4NQCB 4FZEL 4QXTB 3SJVE 5JOFA 4WU7B 5C0DB 5IHZA 5JUEH 1CFSB 4PJ9C 1B0RB 5LBSL 5D7LD 2GUOB 3FRUA 1T1WA 3HAEG 2NY3B 4AQOA 4DOHE 4JY6A 1LE9A 1ZEAH 3DWTA 4CNIA 5CEZE 3C6LD 5IVZA 2J5LB 4U1HA 4PYHA 3CVHH 2IBBA 1SQ2N 3LN4B 2AI0L 5BW7C 2HH0L 4CGTA 1KB9J 2K3TA 4XWOC 1JTTA 3CVHB 5FYKU 2ITCB 1KTKE 5H8DA 3RL2B 3SJVA 3QHZH 1XF4A 4D9QD 2ICEB 4BZYA 4U6VL 2VWEC 4H20L 1OAYH 3PGFH 1BLNA 1FYHB 3AXLA 1G9NL 4RDQG 2VQTA 3IYLW 4JO2L 3LS4L 2EKSA 3P30L 5CZVH 3BAEL 2RCSL 3LKQB 5DS8A 5IMKA 5KZCD 2DTMH 3ARPA 4R3SA 4U3HA 2ZUQB 3W81A 4MCZB 1JMXA 4DVRH 1FFQA 2IH3B 4PJ8C 3AGVA 5JA9A 3BJ91 1T66D 5FB8A 1CLYL 1P2CA 4PBXA 3UYPA 1AGFA 3V4PH 3TESA 1F2QA 2CKNA 3OXSA 1N2RB 1NC4B 2XKNB 3VRJB 3RWCB 1BM3H 4P9MH 4HV8B 4KAQL 3D2UB 1R5WA 3F58L 4U3CA 2APWA 2OL3H 4PGCB 4OGAC 2ENYA 1Q0YH 3ULUC 4ZO9A 4XCEB 4YLQT 3WFBL 1NAKL 5D2NE 2AJZB 4LEOB 2DI7A 4ODUB 5J1SC 2X89A 4YDJA 1P1ZB 5J8OA 3R1GH 1EH9A 4WGVB 3CX5K 4H1LG 1HE7A 4NQUA 3RUGF 1BZQK 1DQLL 1G7LB 4UIKL 1IC7L 1WSST 2I27N 5JW4Q 3MLUH 1K3IA 4CUCA 2F5BL 3MLWH 4P9HL 2R2HB 1AJ7L 2QR0B 1X4YA 1F90H 3PXJA 2B4CC 2KUTA 2YZ1A 4HIIA 5EO9B 3ULVL 4HCRL 2D7NA 1TZGH 2PXYA 5F1SA 5HPMA 4R7NB 5EDXA 4J6RH 3T0XA 1ZXQA 4BUGA 4TUJB 1MCFA 5B38G 5IKCB 4PJGA 1K9TA 2YSSB 5D2NA 4HUVB 4KI5D 3Q5OA 1NEZA 1YECH 3L6FA 1JBJA 2DYPA 1BVLA 4UIMB 4MAUH 4OIAA 3ARUA 4HC1A 1EERB 1ZAGA 1TETL 2A6DB 3WNKA 1A47A 1YUHB 3IETA 1KIPA 4XP4H 2DQFA 1SJXA 2NR6C 5AAMA 5EOCH 1FG9C 3QUMH 2FATL 3AB0B 2ITDB 1NGQH 1J11A 2OBGA 3TM6A 1BD2B 4MVBC 1WZKA 4CU7A 2PYEB 5E5MA 1AGBA 3U7WH 5IM7A 2EYTA 4LHUB 3PL6A 1I3RB 5D93B 2IALA 3QFJB 5B4MC 3I75A 4EI5B 3D3VB 4FP8H 3BQUA 4O2CB 4KJWD 1QHOA 4POYA 5I1DA 3P0VL 4U1MA 5LGHH 4JQVC 3S4SG 4CVUA 2Q20A 4N5EC 5D7IE 3VRLE 5LJYH 4KK6D 4YHOH 1LK3L 5F7HA 1AXSA 2NY0B 5JDSB 5KSBF 3QUZB 2FX7H 4WIQA 2ZUYA 4X6CF 1K4DB 4LASL 5C0RL 2OZ4A 4JHWL 2P47B 5HJ3B 1JZ7A 1C5DB 4PRAA 5HVHC 4G6AD 4NQCE 4R9HA 4NRXA 2WWKT 3VXPA 4JM2A 1RJZB 4WEMB 2F19L 5C0CD 1C1EH 1FAKT 1DANU 5IVNA 2V2WB 1L7IH 4TOYL 4MXWL 2CMRH 1PW3A 3WN5B 3MCLH 4QXGL 2JIXD 4M02A 1EXUA 4OLVH 3UC0H 1CWVA 3QT2A 4FFYL 4H20H 1IBGH 5D7IA 3SN6N 1NLBL 1G9NH 3MO1A 4AM0B 4MDJB 1QFOA 2VZ3A 3M17A 2X70A 3T77A 3LS4H 3Q5TA 3P30H 1LK2B 3KYMA 2ICWA 2RR3A 3ARGB 3VW3L 2BVQA 3L3HB 1PBYA 3KJ4B 1T0NB 4KROC 5ISZB 2NY1C 1DCLA 1MELA 2R1WA 3W9EA 3WCYA 4F57H 4NQCA 4Y19D 4QXTA 5F71A 1U8MB 2FEDD 4WU7A 5C0DA 3IKKA 3FQNB 1X9QA 1Z0NA 2CLZB 4O9HL 1CFSA 4JFXB 1B0RA 2GUOA 3JWOL 5E7BA 2NY2B 1JPGB 5KANG 5KJRL 5ICYB 4ENED 3AUVA 2B5IC 1LE5B 1C7TA 5D1XC 5T1LB 1KENH 4KAQH 4M7KL 4JKPL 4LVOB 4CJ0A 1J8HD 4LLMB 5E2VH 3LN4A 3TT3L 4UINL 3LZFL 3SGKC 4FFVD 3BMWA 3CVHA 2ITCA 2Q76B 4TRPH 2X2YA 4Y8DC 3RL2A 1W0WB 3ZSTA 4DUWA 4OF3A 4NJAH 2QEJA 1YEGH 4UNTA 5J3HC 2ICEA 3GEWB 4C56D 3GSUB 4MA8L 4UIKH 4E0RB 5DD0L 4O02H 4IRZL 1ZVYA 1T1XB 4P9HH 3V4VL 5I8EA 1FORL 3IDXL 3LKQA 2E9BA 2FD6H 3GI9L 2AK4D 1Q9OB 1MHHB 1CFQB 3CMOL 4ZOCA 1JYXA 3DYPA 2J88L 2QHLA 3QIUB 4MCZA 4PS4L 5HSFA 4LSRL 1JGLL 2IH3A 4HJJH 1Z5LB 1A9BB 1U2HA 3GMRB 3QDGB 4NQDD 1KJ2H 1MRCL 1NGXB 3SGJA 5B3NA 2XA3A 3EYOB 4M7ZB 4Y16C 3DTXB 4C54A 4Y4HC 1K4CB 3TPKA 1N2RA 1B90A 1NC4A 4M6ML 2EE6A 1S9VB 2XKNA 5DD3H 3RWCA 3VRJA 1M1SA 4HV8A 3D2UA 4QWWD 2YD2A 5E1AB 5I1GL 3ULUF 1L9MA 4PGCA 1IL1B 1FL3B 5C08B 4XCEA 2AS5M 5IJKC 2V5RA 4YEFA 4G8GD 1EAJA 3RIAK 4F9PA 2AJZA 4M43L 3X12B 5A40E 2WBJB 2YMXL 4LEOA 4ODUA 5SWQB 2VXSH 1P1ZA 1D6VH 1SJEB 4LPYA 2NLJB 1L7TL 2W91A 1G7LA 1SVZA 2AJSL 2IJ0C 1ADQA 1ZLUH 2P1YA 3ARDB 2R2HA 2QR0A 1ZHBB 3O81A 3NZ8B 3F6LA 4PGDB 2DLFL 2FX9H 2V5MA 3BFOA 2HTKD 5EO9A 3LHPL 3RJDA 3ZKSD 2F8VA 3ARVA 4UDTB 4Q9RH 3LEVL 4LASH 5C0RH 3QEHB 5J7CC 1KBGH 1BD2E 4R7NA 5DT1H 3BRDA 4JHWH 2PYEE 4GKSB 1UZ6E 4TUJA 1NDMB 3LB6C 4I18C 5IKCA 1YJDL 5IBLD 3QFJE 1CGXA 2YSSA 4RZCB 3D3VE 4AEIL 4HUVA 2XZZA 3TJEL 1FNFA 3B8YA 4ZOAA 3OSKA 5JNYB 1UJTA 4UIMA 5IR1B 4TOYH 1HNFA 2OR9L 4MXWH 3N85H 4JPWH 4FFYH 3TVMC 4OCWL 1IC5L 2A6DA 4YUEH 1NLBH 2GTZB 1YUHA 1BHGA 4UTAL 1JZ5A 3GRWL 1UQSB 2XXMB 5I8KL 4R4ND 2ITDA 4WFFD 4L9DA 4ZYKB 1BD2A 5B39B 4K8RC 1SMOA 3UJJH 1QKZH 5DVMA 1NL0L 2PYEA 4WO4D 1W8OA 3MFGB 4OFPA 4LHUA 5CP7B 4LIQL 1I3RA 4NNPL 4KRNA 4MQTB 3QFJA 3NN8B 5E2TL 4EI5A 3D3VA 4O2CA 4O9HH 1VFAB 2I26N 1N0LA 3KHQA 2RHEA 3JWOH 5JDSA 3CC5B 3L3DB 3QUZA 2AVGA 1IGFH 5AZEL 1CU4L 3QO0B 3OGCB 5BRZD 1K4DA 4K9EC 3V4UL 5ISZE 4X8JB 4WTWA 3QA3B 4TSBL 4M7KH 5HJ3A 5I1JL 1C5DA 4NP4L 3AS2A 3MRRA 4TUKL 3ARYA 4UINH 4XWGL 3BOVA 5HI3C 1RJZA 3QXWA 1ZLUK 2DBJA 5CAYB 1PZUB 5IMLB 4YJZL 1UGNA 2V2WA 5AWNL 1XCTB 5FXCH 5CP3A 2Q7NA 5D8JH 3WN5A 1QA9B 3T0ED 5CJQL 4MA8H 1RJCA 5DD0H 2YXMA 4IRZH 4AM0A 4BK4A 2A38A 4MDJA 1MLCB 3LS5L 2XZCH 1WV7T 5ALCL 1LK2A 1PQZB 1FORH 4F58L 1X5IA 2FDBP 3ARGA 3Q0HA 5F7FA 5GGQH 3UJIL 3ZHDA 3GI9H 3L3HA 1T0NA 5FYKH 3CMOH 1ZHLB 5ISZA 4L3EB 4AL8H 4D0BB 4RDQF 2Y9RT 1U8MA 4JDTL 3MRKB 2HG5B 5BZWB 3FQNA 2CLZA 4OCRL 5A1AA 4JFXA 1MRCH 3LSOB 4N9GB 4TSCL 1NC2B 5ELIA 4K3DL 1JPGA 4BZ2L 5D7JD 4OTXH 5ICYA 3DYOA 2VXUL 2VE6B 4M6MH 1LE5A 4FQLH 4M5YH 1IAKB 4Z7UB 5T1LA 2NXYC 4RWYH 3IRZA 3HI6H 4KZEL 4JFHE 1Y6KR 3THML 1KCUL 1MI5B 1IARB 4LLMA 5I1GH 3RY4A 4DTGH 4ZSOB 1GGBH 3ULVE 3QDGE 3EFFB 3CFEB 3WNOA 5ICXB 2Q76A 4KVCL 1W0WA 1JV5B 2NTSP 5EU6B 1QFPA 1UT9A 5HHXH 5FIEA 1R5VB 3GSUA 3UO1L 3BE1L 4E0RA 4UI2A 1T04B 1UA6H 4J1UB 1SEQL 3OMZA 3NCMA 1J87A 4NN6B 1CGUA 1CD8A 5C2BH 5K59F 2V7NB 5C08E 1Q9OA 1MHHA 1CFQA 1SY6L 3FB6B 3LHPH 4JHAL 1MREL 3QIUA 4GXUN 3LEVH 4XAKD 1X6LA 1WTGT 5DVNA 4OZHF 1MCOL 3RIFF 1Z5LA 4J3XA 1A9BA 3GMRA 2HWZL 4X83A 3QDGA 4HCRA 1QSFD 3KGRA 3JV5A 1W8NA 1YJDH 3KPOB 4GUPB 3V6BR 4EUPH 5JW4N 1NGXA 2VLRB 5JPMB 1HI6B 4FQCH 5ADPL 3GUTB 3EYOA 3HKFA 4HPYL 5M7QA 2WBWB 2A6IB 3DTXA 3QXUA 1VGKB 1K4CA 2XTJD 4NUGH 2OR9H 3MLYH 1S9VA 1J1PL 3KPRD 4YNYB 4GKOA 3BO8B 4HQQH 5KVDH 2BCKB 2X1PA 2QSCL 3EOBB 5E1AA 1IL1A 3GRWH 2QQQA 1FL3A 5C08A 1MHCB 5GQBA 3WNLA 3BN9D 3VGHA 1ZT4B 2D4DA 4DKFL 3X12A 3O2VH 2WBJA 4QHKJ 5SWQA 5I1EH 1SJEA 2NLJA 3CDYA 4NNPH 1YNLH 1YEKL 5E2TH 2V9RA 4JVWA 5GS2H 4OZFH 5F70A 1EAPB 3ARDA 1ZHBA 3NZ8A 4YX2L 4PGDA 3MBXH 4S2SB 2P43B 1YEHL 3WSQH 1FAIH 1A14L 3PQYD 3GKWH 4UDTA 3KHOA 3QEHA 1IQWL 4J23A 4GKSA 4AIXA 5I1JH 4PRPD 4OZGB 2VNCA 1NDMA 1CXKA 3TN0C 4XWGH 4I13B 3RWHB 3VDBA 1FNSL 4RZCA 2Z35B 4J2XA 3PL6C 5JNYA 5IR1A 5AWNH 1QFUH 2WINB 4JN1H 4U1JB 4JFEB 2DI9A 5CJQH 1QLEL 2CPCA 2GTZA 3HNTL 3EDFA 4N0RA 4LQFL 1WVZA 1E4KC 3VU2A 1UQSA 3IDJB 1T03H 1YYML 3CPLB 5IFAL 1UM4L 3UJIH 3V6FB 3QQNA 4ZYKA 5B39A 1PVHA 5JXAH 5T5FL 4GAGL 3BP7B 5CP7A 4JDTH 3NN8A 5K9JH 3RTQB 4GJTB 1HDMA 1VFAA 5C0BB 1XR9B 5DO2C 1BMGA 4I3RL 4N0FB 5TDOB 5DLMH 2JF1A 4K3DH 3UTSB 4BZ2H 4MQXC 1UCBH 3CC5A 4PG9B 5HDQH 4LHUG 3G6JF 3QO0A 3OGCA 1KEMH 4U31A 4X8JA 3QA3A 4L3EE 3HNVH 4HIHB 2JCCF 3QIWB 4OF8A 3BSZH 2FBJL 1HINH 3FZUC 5HGBB 5CINH 4HKZB 1QBBA 3EO0B 3H42L 5IMLA 3FQTB 3NCYP 1F3DJ 4L3AA 1XCTA 1Y6MR 4A2MA 3DARA 3IXAB 1QA9A 2GAZB 3U0PB 4Y5YA 4MAYB 3UYRL 4Z7UE 4KFZC 1MLCA 4UTBL 4OLUH 1MI5E 1PQZA 1NANH 1EHAA 2B1AH 2R56L 4P4KD 1CXHA 4HIXH 4OCYL 4PJ7F 4ZSOE 1ZHLA 2J5LC 2QADC 2Y4SA 3MGTB 4L3EA 5JMOC 4M1CC 4D0BA 3KPNB 1MREH 4XP6L 1IM3B 3MRKA 2HG5A 5BZWA 4ODSL 5EU6E 1YNTB 1ZHKB 2YA1A 3LSOA 4N9GA 4MA1C 3DPBA 1NC2A 1QLRB 5ADPH 1B0GB 2VH5L 4XBEH 1TLKA 4HPOL 1MHPL 4HPYH 3PV6B 1UG9A 2V2TB 2VE6A 3B3IB 3MV8D 2XNAB 5HYFA 4Z7UA 1IAKA 3WFEL 5BOPA 3WYRA 3TPUB 1MI5A 1CBVL 1EFQA 3OGOE 4XT1C 4KJQC 1TVDA 4ZPVB 4ZSOA 5FECB 4XPTH 3LOWA 3EFFA 3CFEA 3O4OB 5ICXA 4RMSA 2DIJA 5D1ZD 2Y6SD 3IDMB 4JKMA 1JV5A 3NH7H 4DKFH 1WGOA 5EU6A 1MFCH 3D85B 1R3LB 5DXWA 1R5VA 4LNVA 3RX8A 3BMVA 1T04A 1D9KB 4LVNC 4Y2DC 4J1UA 3C5ZD 4HKBB 3MJ7B 4R26H 4YX2H 2V7NA 1GJIA 3Q2CA 3UMTA 3FB6A 5FM4A 2X89D 2H26B 5HHOD 2ZG2A 4XVJL 1I1AC 3NA4A 4GUPA 3KPOA 5JPMA 1EVTC 2VLRA 4OB5L 5DDHB 5AG8A 1FNSH 5L6YL 3LD8C 1HI6A 3GUTA 1YY8B 1INQB 4U1GB 1U41A 2A6IA 4LIQE 1VGKA 5EUKB 4WUUD 2PXYD 4YNYA 2MTPA 4D8PB 3BO8A 2ADIB 4N8CL 3S8WA 2BCKA 3OJMB 3EOBA 1ZTXL 2GJJA 4Y1AD 4MNHB 2ZG1A 4WI3A 2ZUUA 1I7TB 3BP6B 1RURL 1YYMH 3WO3B 1OGAD 1MHCA 4B7LA 3GSVB 5IFAH 1SMAA 4KK5C 4OZGE 4GXVL 1ZT4A 2VLME 1L0XA 2DYPD 3GRWA 2AXGB 2DICA 3S35H 2QV2A 4F7MB 3BX7C 5F9OH 5DFWH 5C0GB 1A1OB 1QP1A 3VD3A 1N64L 4JFEE 1EAPA 5IESH 4HZAA 3ZYJA 3H7LA 4YZFE 2Y5TB 4S2SA 1KELL 3TH4T 1G6RL 4R2GC 2YPLD 4JFQB 4QRSB 5GRUL 4OZGA 3EAKA 5GRJL 4BUHA 2BP3A 3RWHA 3M07A 1WICA 1YEJH 2FHFA 2Z35A 2GJZB 5C0BE 4M1DH 4F7CB 3ZYIA 3B2VL 3H42H 5CBEB 3PJSB 4QNPE 1OWWA 5D93C 3HCVB 4EI5C 2WINA 4HUMB 3UTSE 3ECBB 4U1JA 1AIFB 4JFEA 5FGBA 1OCWL 1KXTB 4YGVB 1VGEH 2NY0C 5DJ0B 5L9DH 5D6DC 2XWBB 3CPLA 3FO2B 3OJVC 3MXWH 4HXAH 2R56H 4LL9A 3V6FA 1WTLA 1YEFL 1JWUB 2MWCA 3BP7A 4F8TA 5E99L 4DAGL 2W60B 4ODSH 4RIRB 1KB5L 3N0PB 4XNYL 3RTQA 1VFMA 1BPVA 5EIIB 5C0BA 4X4ME 1XR9A 2N1KA 4YDLC 5B39G 2DQUL 3LDBB 4N0FA 5EO1B 5TDOA 4LF3B 4HUWB 3S3SA 3C60B 5MP6H 3UTSA 3VRLF 1JGDB 4HPOH 1MHPH 3VCLB 4PG9A 4K2UL 3SQBA 3DECA 5CILL 5KTEL 3WFEH 3QNZB 5TQ0H 2R0LH 1IQDB 4WI9A 1CBVH 1TENA 2WQ8A 4HIHA 1G9NC 3AS1A 5BV7L 3QIWA 4GSDH 1KN2H 3KJ4C 4K3EH 1J7VR 3QI9C 4M7JH 5HGBA 2NX5B 4HKZA 3EO0A 3FQTA 2WUBH 2PCPB 3IXAA 4W81A 3SGDH 3CFBB 2GAZA 3TIEB 3U0PA 2HA1A 4X4MA 3H9SB 1QR4A 2PO6C 1T21B 4MAYA 2YD7A 3AFLA 2BVPB 2ZCKH 3WD5H 3BWUC 4G7YL 1MCBA 5ESVB 4U0RB 2OJZH 2VZOA 1GIGH 1ZLSH 3U36B 3L95B 4NYLB 2G5BB 1A6UL 3MGTA 4GAJL 4LVOC 3ARBB 5E2UL 3KPNA 2HLFC 2D0HA 2UZIL 2VLJB 4ZTPL 3VFOB 3EO9L 4OF6A 3V7AE 1SY6A 1OLLA 2VDKH 1G9EA 3NCCB 1YEEH 1DR9A 4OD2B 1UADC 1YNTA 1ZHKA 4OB5H 3T3PE 5F93C 1BBDL 5I1AB 1QLRA 4N1HB 1ZT1A 1B0GA 1TVBB 4QRQB 3PV6A 2V2TA 2HT3C 1K2DB 5C7XL 5L8KB 1A22B 2BFVH 3B3IA 3I3DA 5F9AC 2XNAA 5BJTB 5I1IH 1U8OB 4N8CH 3TPUA 5E4EC 4ZUUB 1G7QB 5MHSE 1ZTXH 2QQLL 1BQSA 1YPZE 4Q7DA 5JOPD 1IT9L 4ZPVA 1NCNA 4HLJA 4P9HC 5FECA 1CGVA 2VLLB 2GK0B 2YUWA 1EFXB 3N06B 3NIDE 3IDMA 4GXVH 5GRWA 5GRVL 2OP4L 4DUVA 4LBEB 4JN2B 5IMMB 3D85A 1R3LA 2OMBA 4LVEA 5L2KB 4H0HB 3D2UD 5CZXD 1D9KA 1N64H 1G9MH 3VXRD 4HMDA 1G0XA 4HKBA 1X5LA 3MJ7A 3LPWA 1HXMB 3VXSB 3W82A 3P0YH 1ZGLB 5F96L 4RFNC 1T2QL 4ZUTB 1G6RH 1RV6X 1JVKA 2OM5A 3MRGB 3WL9B 4PR5B 5JA8B 2H26A 1G6RB 4NGHH 2YD6A 5DRXB 1K8DB 1DLFL 1S7XB 3C09C 3IAGC 5EUOB 3QISA 2AJXH 3R06B 3QIBB 5DDHA 4LMQI 1YY8A 3B2VH 1INQA 3BD5A 3BXNB 4B53A 1NBQA 5EUKA 3ZE2E 2ESVB 4APQD 1MFNA 4BZ1H 4D8PA 2ADIA 3C08L 3SKJL 1OCWH 4YHKL 3SDDB 3SPVB 5KSVB 3QWQB 2VMFA 4JPKH 4MNHA 4NC2B 1UB6B 5IFHL 3CSYB 4LLAA 1I7TA 3BP6A 5CSGA 4EUPG 3GSVA 1F45A 3MRQB 3P11L 1UKSA 4HG4K 4H25B 1VA9A 2MKLC 2AXGA 1I9RL 5H94B 1YEFH 4F7MA 4L8CB 5HI4D 4JKWA 2FLBT 5C0GA 1A1OA 5J13C 1KB5H 1KXQE 2K7QA 4O58L 3CXDL 2VDNL 3K4AA 3SCMB 2DQUH 2NYYC 2NY6B 2XKUA 4DGYH 2Y5TA 1KB5B 2X6MA 2VAJA 1BD2D 1FGVH 5CILH 1MWAH 2UVEA 4JFQA 4LPUA 1KCRL 1TJIL 3HFMH 5DSCB 1S7TB 3WS6C 5LCVH 4QRSA 3QFJD 4OLZL 1QNZL 2ED7A 5BV7H 5LGKA 4NN5B 4IMKC 4OZFG 1UZ6F 2G5RA 3IDIB 3NTCH 2GJZA 1MIML 4GW1B 1NSNL 4F7CA 2GYSA 4GS7C 5CBEA 5BV7B 1J5OL 1NJ9B 3PJSA 4GW5B 3HCVA 5IGXL 4KHTL 4XCFL 2AJVL 4HS6B 2J12B 4PJFB 3ECBA 4I48B 1DBKL 3BD4A 1AIFA 4L8SC 4Q6IC 5ALBL 4YGVA 5DJ0A 1EA9C 5E70A 5TDNB 2XWBA 3FO2A 3TA3D 3JWOC 3T04D 1NUGA 3AROA 2B39A 4XTRC 4J4PA 4GAJH 2NX5E 4J3VA 2H2PD 5E2UH 5LQBL 1JWUA 1XCQB 5T3ZL 4PRDB 5KOVC 4RIRA 4AK1A 1CTNA 1NLDL 1CT8B 4N0UB 5EIIA 3CFJB 4XPHL 3HI5H 3H9SE 4XVTH 1ZGLM 1U3HB 2VDOH 4WEBL 5EO1A 4WHCA 4LF3A 4HUWA 1FRGH 3C60A 1S7SB 4I77H 1JGDA 5MI0C 3VCLA 4MB5A 3ZE0E 3HUJB 4Y5YC 3TWCL 4KJPC 3QUYD 5D7KD 3OKNB 3NIGE 2EH8H 3QNZA 2DM2A 4KMTH 4YFEA 1IQDA 4QTHB 3RY6A 1FLTX 2NZ9C 2QQLH 2VLJE 4LSQL 3U7AA 4G9DB 4XVUD 1WBZB 2BVUA 1RZKH 1YC8A 2XYCA 3QPQD 2NX5A 1P4BL 1FBIH 3W2DL 1FDLL 2YN5A 1INEH 1K6QH 4KQ4L 4LP4A 3GMLB 2PCPA 3CFBA 2R2EB 3TIEA 1Q9WB 3HC4L 2VLKB 3H9SA 1T21A 2BVPA 3T2NL 1JGUL 4M5ZL 5ESVA 1KJVB 2FL5B 1JPTL 3RIAF 3TO4B 4EXKA 4JG0L 1F02I 1I9IH 3UYOD 3U36A 3E3QE 3L95A 4NYLA 3PWVB 2G5BA 2EDHA 5E1HB 3RVTD 3ARBA 2BNRB 3VA2C 3QDJB 2VLJA 2BVOB 3VFOA 4Q9QH 3BKCH 1V7ML 2HLAB 3REVB 1UC6A 4OD2A 5L2KE 5DMYA 1FVCB 3SDXB 4NPYB 5I1AA 1TVBA 4QRQA 1DE4B 1K2DA 4L4TD 1XIWC 2ICWI 4GMSH 1EO7A 4GBXB 4H8WH 4NSKA 3VXSE 2Q3AA 1IC4L 4S1RH 5BJTA 1U8OA 3FKUS 2NXZB 2VO5A 4ZUUA 1G7QA 1P84K 5CSZB 4IOSD 1OP5H 5DUMH 2VLLA 2GK0A 3AS3A 3FO0L 4K3JL 5EUOE 2V7HB 1EFXA 1KPRB 4UOW1 4QF1B 4ONFL 4LBEA 4JN2A 5IMMA 1SBSL 5F7KC 5E95B 2XA8H 5L2KA 2XOTA 2ESVE 5I18L 3K8MA 4RSVA 4YK4B 4ALAL 1YJDC 4I9WE 5C0ND 1HXMA 3VXSA 5J1AB 1ZGLA 3GSOB 3O9WB 5FKPB 4ZUTA 1LHZA 4YXHL 3MRGA 3BDXA 4NO0A 3DURB 1MH5B 1ITCA 3WL9A 4PR5A 2MQ3A 1TJIH 2CDEB 1FZKB 4OFYD 1G6RA 1BZ7B 5DRXA 1K8DA 1S7XA 4OLZH 3VGFA 5EUOA 3R06A 3QIBA 3K2MC 5A3IC 3H3BC 4PJ9D 3BXNA 5CJ5A 1OM3L 2ESVA 5IHLB 2QHRH 2I5YH 1BF8A 5DJCB 1GYAA 2AJVH 1VEOA 2O5ZL 4L3CB 3SDDA 3SPVA 5KSVA 1JCKA 4P2OC 3QRFM 3BT2H 1UB6A 1R3IH 3CSYA 1CDBA 4YR6B 1V05A 2EDNA 3MRQA 3MSPA 1UXWB 4H25A 3SGEH 2BOBB 1DFBH 2IGFL 2AGJL 1JNNH 5H94A 3GMPB 4L8CA 3UZVB 5T3ZH 4P57A 3KR3L 1MFBL 3EJZD 4DCQB 4JFDB 3RVUC 4EBQL 1F4YH 1I9EA 5BVJB 4PJFE 1X5GA 4U6HB 4D3CL 3SCMA 1EK3A 4WJ5B 1OP5K 1KB5A 3CSBA 1HSAB 5FGBC 3UP1A 1DDHB 4LVHB 3TWCH 3MUHL 5DSCA 1S7TA 3RVWC 3HHRB 4Z18A 5CD5C 2NY5L 1AR1C 3IDIA 4PJ8D 4HWZB 1N59B 4GW1A 4N0UE 1BFSA 2BMKB 4GLRH 3W2DH 1AE6L 2CH8A 2C3HA 1NJ9A 1DQQB 4GW5A 4FQQA 4CBPA 3RTQC 3KLDA 4HS6A 4PJFA 1BVKB 4I48A 3UDWA 3HUJE 1LILA 5C0JB 2W65B 2DI8A 5F9WB 4I0PC 5TDNA 3HE7B 1CFVL 4JG0H 4OGAD 1FNGB 1UZ8B 3VG0L 1H8SA 1XCQA 4G6FD 4PRDA 2H6PB 1ZMYA 1CT8A 5FOBB 4N0UA 3CFJA 5IEHB 2VLKE 2MOVA 2OXGA 1U3HA 4NT6B 4OKDA 4HFUL 1S7SA 5L2JB 3HUJA 3LCYA 4MAYC 3OKNA 5DHYB 4YQXL 3ME0A 3LRSB 1MCPH 4HZLB 3MRMB 4XBGB 4RQQB 1OAZH 3MPCA 3C6SB 4NKIL 4OGXL 4QTHA 2BNRE 1B2WH 2E7HA 3QDJE 4WDIB 4BQ6A 5HYSG 4G9DA 2W07A 5SX4H 1WBZA 4YHYC 1XMWA 2LU7A 1AXIB 1NC2D 3FO0H 4CADB 2UY7A 2FR4B 1FH5H 4KK9C 5GS0L 1DVFD 3SDXE 3BZEB 1F5WA 2GITB 4K55A 4G80B 4ONFH 1JPSL 2ADGB 3WO4B 3GMLA 5I1KH 1SBSH 2GKIA 2R2EA 1Q9WA 2VLKA 1CI5A 5I18H 1PSKH 3HLAB 3JWDL 3UJTL 5B22A 3ZMRA 4ALAH 4C4KT 1KJVA 2FL5A 4PLKC 4KKBC 3TO4A 1CDUA 4CN1A 1EUUA 4KXZI 3PWVA 2DF3A 3KPSB 1AXTL 3VI4E 5FUCC 2BNRA 2FEEI 3RX5A 1NBVL 4NC1E 2VZUA 3QDJA 2BVOA 3QUKB 4UOJA 4TVPL 3IDYB 1WCBB 4HWBL 2R69L 2HLAA 3GBMH 5DQDL 1IJ9A 3REVA 1FO0B 3HPLB 1FVCA 4PGEB 3SDXA 2I07B 3RJQB 4NPYA 3HC3L 5FO9B 1EX0A 2HRPH 1DE4A 2MPAL 4HEPG 1Q8MA 4KRPC 1OM3H 2EC9U 3L1OH 4GBXA 2NNAB 1H5BB 4HBCL 2UY6A 4N1EA 2HFTA 2E7BA 3H2WA 3IU3B 1HQ4B 4P2QD 3MNVB 3L5WB 3RY5A 3SDAD 2E6PA 5CSZA 2LE9A 2VLRD 1GRWA 3LAFA 1CGSL 2V7HA 1KPRA 2VTFA 4HJ0C 4NWUH 4QF1A 1I85A 2JJSA 2AGJH 4PJBB 4WTZG 3KWWB 3KR3H 4RGOL 3OZ9L 3RX7A 3LN9A 4YC2B 4U1GC 4LRIC 3R8QA 5J1AA 3B9KB 3GSOA 3O9WA 5FKPA 3WDHA 1CVRA 4EJ1C 3DURA 4XHQA 3MA9L 1MH5A 3FHQA 3RPIB 4RISH 2CDEA 3QPXL 2NY1D 1FZKA 1INDL 1OLZA 1BZ7A 2NY5H 5CLTA 3I02B 1AHWB 3WIHL 4JFDE 7FABL 3I6KB 5I8CA 5T3ZE 1AE6H 2YD4A 2XWTB 2H8PB 1GC1L 5TE4L 3SO3C 5DJCA 1CDJA 2E27H 2ARJB 4L3CA 4LLYB 2PTTB 5DK3A 3GGWB 5L88L 4UV4L 4U49A 4XNUL 1DN0B 4E9LA 1DANT 4WENB 4YR6A 4OF0A 1F4WL 2V2XB 4CVXB 1UXWA 4P5TB 3CD4A 3G04B 2BOBA 4H88L 5DMGC 4PG2A 2CJUL 2WAHA 1Q1JL 3GMPA 2AW2A 3F5WB 5J3HD 4DCQA 4JFDA 3LQMA 1NCWH 5KAQG 5BVJA 5DUPL 1K3ZA 1I1YB 5F8RC 5CKAA 1KOAA 4PJHB 4U6HA 5CBAB 1S9YB 4WJ5A 3SBWA 1BQUA 1HSAA 1DDHA 3ISWA 4EDWL 1T2XA 3QO1B 5EZJB 2BX5A 2DQGH 5EZOH 4FTVB 3VJ6B 3D48R 2X9WA 4NKIH 4OGXH 3PP4L 4JFPB 5KS9B 1A5FL 3IJYB 4UAOB 4HWZA 1N59A 1P7QB 3PGCB 4MA3B 3BEWB 3WBDA 2BMKA 1NCBH 3RRQA 4OF7A 3UTSD 3L5HA 4UDUB 1DQQA 4FABL 5GS1B 3DSFH 5D70L 1JPSH 2VDRH 1KCLA 1S5IL 5GGSB 4Y16D 4LLUB 1BVKA 4QNPF 5FYJH 4I2XB 5C0JA 2W65A 5T33H 3ARRA 5F89B 2C1PB 2HKFH 3JWDH 3NFSL 3C60C 1MF2L 5IW6B 5LGJB 1EV2E 3HE7A 5EA0L 3UEZA 4OFVA 1FNGA 1NCDL 1YNKH 1UZ8A 1NKRA 2W59A 2V6HA 3CFIC 3ZDZE 4MD4B 1WWAX 3D39B 2H6PA 3P2TA 1BVZA 4TVPH 5ACMA 3T1FB 4HWBH 1DQDL 4HK3J 2R69H 5FOBA 4PRIB 5C3LD 1MCHA 3BP4B 5IEHA 1JE6A 4NT6A 4X99B 4XNQB 5I16B 3HC3H 1KLFA 2EICA 2V5SA 1KCVL 5L2JA 3EZJB 3FQRB 3U9PH 4LFHG 4MJ4A 2ZNXA 5DHYA 4X5XB 3LRSA 4HBCH 2DKMA 2AQ1A 4HZLA 5F3HB 3MRMA 4XBGA 4OLYL 4RQQA 1L6XA 1GCFA 3KPSE 3C6SA 4JB9H 4FOMA 5FUZL 2AABH 1MCQA 4FQ1L 5EB9A 4TSAL 1LP9F 4JM4H 2LVEA 1EEQA 3ARBC 4CADA 2VXQL 5DJ8B 2FR4A 3WFCH 4GXUM 3BZEA 2GITA 4G80A 2FGWL 2J1KA 3D6GA 5E2WH 3C8KB 1MAMH 1I8IB 2ADGA 1CK0L 5CJOL 2X4UB 1UM6L 4RGOH 3ZDXF 2DS4A 3GJFH 3HLAA 5C0AD 2BY0A 3T0AA 3OZ9H 1X5FA 3WXWL 3EDDA 3TVMD 3L7EB 4HUKB 3SE9L 4P3CL 3GJFB 3TH3T 3R4DA 1A6PA 4S1DC 5HPOA 3CK0H 3KPSA 3D1MC 5I15L 1HHJB 2B0SH 4ZFGL 2LABA 1XT5A 3QUKA 1INDH 1WCBA 1GVIA 2FLRT 4PJBE 4Y5XC 5T3XH 1BQHG 4GKNB 3RI5K 3EGSB 1FO0A 3HPLA 3L5XH 3ZHLA 1RAMA 1HZHL 4PGEA 2I07A 3WIHH 1KXVC 5FO9A 3FQUB 1OHQA 5D96C 1CICB 5LVEA 3BP5B 2P8MB 4IHOB 5HHMB 2R8SH 4IRSC 2V17L 2NNAA 4WCYH 1H5BA 2QQNH 5HYQB 3FRPA 3VWJB 4NM8L 3IU3A 1RFDL 3N9GH 2YRZA 1HQ4A 3MNVA 2A6JB 1MVFA 5L88H 3L5WA 3RKPA 1G9MC 5IBTL 1T80A 5ID1B 1BFTA 1MOEA 1YPZF 4LCWB 5B3JE