3AU0A

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
339
structure length
339
Chain Sequence
b'PVVNVADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
molecule tags Cell adhesion
source organism Staphylococcus aureus
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
total genus 85
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A02
2F68X 2Y7LA 2Y7MA 4JE0A 3V10A 4F1ZA 4BBWA 4F24A 2RALA 5IHWA 3IRPX 1R19A 3IRZA 4Q6KA 4FJ6A 4MBRA 3AU0A 2Y7OA 3IS0X 2YLHA 4B60A 4JDZA 2VR3A 4LE8A 4MBOA 5CFAA 4LEBA 4F27A 4B5ZA 4JDZB 5CF3A 2Y7NA 4RMBA 1R17A 1N67A 3AT0A 4F20A 4LEEA 2F6AA 3IS1X 2Z1PA 3ASWA
chains in the Genus database with same CATH superfamily
4UOW1 2JKNA 3AITA 3LEVL 1QFPA 3L9BA 3RAJL 2DH2A 5CEZD 1U8KB 1GGUA 4X4MA 1T66D 1XF5B 4G7RB 5GGVL 4F92B 1E65A 3T1FB 1MCOL 2OL3H 3AMKA 2MMXA 3TYFB 1W8EA 1X6LA 1A1OA 2B7DT 3QRBA 3C5ZD 2R2HB 4IBQA 1KPRB 4G71B 1RZJC 4B5ZA 3AGVA 2H26A 2CKBA 2PXYB 5I9QC 5AW7B 3L48A 5D72L 1PSKL 3JSSA 4KDWA 3E9UA 4XNAA 3W11D 5JPNC 1EHKB 5B1BB 4ZMZA 4JK0D 1YUHB 2G75B 5GRUH 3U2IA 4DSYA 5BS0E 3D25B 4IRZH 3CVCA 2R29L 5FO8B 3OAUL 5KJRL 5BVPL 5CR8A 2XJLA 5ERWA 3VB8A 4JG9A 3TZVA 4G9DA 3IF1A 1A0QH 4HEPG 5DMKB 1G6VK 1NFDF 4KMLB 1BVNP 2ADFH 4WSJA 3MN8A 4R26H 2JKIS 2XLLA 3DPDA 1Q9KB 4GMSL 2I9LA 1OCWH 1SYSA 5FHAH 1I1RA 4KJYA 4MVBC 5C0CB 1R24B 3MV8E 3ZDXE 4A63A 1RU9L 3ELAT 1XH0A 3F04A 2VLJE 3N41B 3QB7C 1CLZH 4NO0A 3VSTA 2X70A 1YJDL 2WCGA 3QUZB 3C9NA 3WE6A 4FYQA 5INDA 2DQHL 2A6JA 4B9ZA 4AQ1A 1BAFL 1J0IA 1MAKA 2BOBB 2CH8A 4LDLB 1BM3L 1HXYA 3QJZA 4I48B 3MXWL 5I6MA 3K5SA 2RQ8A 5T3XE 3HJ0A 3HZKB 3GMOA 2HN7A 3GI8L 4PJIE 1K8DB 1G6RB 4GBXD 4WDIB 2KS0A 3SDAA 5BQ7A 3FUEA 3UP1A 1GPOH 3UZVA 1YJDC 3PGDB 1YEHH 1QR1B 1B2YA 4W9IC 1NKRA 1R3JB 2Z0UA 5DHVA 5KS9E 4V11A 4P06A 4UT9L 4Z7UA 3UG4A 5HHNA 1HXKA 5DT1H 2JVUA 3HI6H 1QO3A 5FOBA 4M61B 1KTKE 1SJHB 3ULSA 4HU8A 3BGMA 1DVFA 2WK2A 5EEYA 1NM4A 4PP1C 3EO9H 4XPGH 1B0RB 3VRLF 1SF3A 1GZHA 1ZTMA 2QADC 5DJ0B 3L5XL 4UTBL 2QSTA 1ZLSL 4KJWC 3H3PH 2DQEL 3Q3GB 5EC1A 5C0DB 2H32A 5IZ7A 5EO0B 1LQSR 3OPZH 3TV8A 4UOQA 1BZQK 3ZKND 2VT0A 1KYAA 3DMMC 4YLQT 4UIKH 2DKUA 3BUTA 3O6KL 1MAJA 3LV3B 2D7PA 5MERB 4HH8A 2DH3A 4JFPA 4RGMC 2BH0A 1OAYH 2ZF9A 4EVNA 1BLNB 2OL3A 1JZHA 3CXHJ 2F1BA 4FG0A 3HE7A 4TSAL 4PVMA 3S88L 1S9YA 5FECB 2GQHA 1FZOB 1FP5A 3CU1A 2HAZA 4R3SA 3IVKB 2J73A 5L9DL 1ZY9A 4JAMA 3SDXB 4M61A 3SE9L 2ADJA 1MREH 3GLAA 2LVCA 3X1NA 2HVKA 4WKZA 2YN3A 1EFXD 4WUUE 3QZLA 3R1GH 5F7LB 2L4OA 4DP2X 3T2LA 1C1EH 4MXQD 3U30C 2BX5A 3APCA 4G1EA 4M7KH 4LLVB 2WNKA 4DZ8B 1XF2A 4WEBL 1XEUA 3GMOB 5GRVK 1ASPA 1AGFA 4R4BB 3MRIB 2V6HA 4U1IA 4LCCB 1N59A 3CG8A 4MA3B 1M71B 2WZ0A 5DHVB 4LCIH 2KL6A 2JNZA 3DXAD 4OLZH 4X6CB 2X6VA 1WLHA 3VRLE 2E9GA 5KYWA 4QLRA 5AAWC 3RIKA 5A2FA 4N8UA 3HE7D 3NCBB 4POZC 1OAZL 3BPCA 3CFCH 2Z34A 4W6WB 1LO0L 2QDWA 4MAUH 1LDPH 2DL9A 3DPBB 2H8PA 3U0TA 2DQCL 4IRSD 4NGHL 4P5RA 3H56A 1WIPA 3BH4A 1KWGA 2UZYA 2VN5A 1E7UA 3FRUA 1TZGH 2EDXA 3ZYOA 2RGSA 4YX2H 3QR1A 2IDQA 5TDPB 2R2EB 4X7SL 3NFNA 3NCCB 4RAUA 1WFOA 1YPZE 5D1QD 3RDTC 2ZPKH 5KSUB 4EN2A 3K8LA 3S37H 4HUCA 5C1MB 4LFHG 4WWNA 4PJGA 2DYPA 4W9KC 2ZWLT 3ROOB 5ETUB 2FSDA 5B7FA 3MBWA 4XRCA 3VXRD 1D9KC 2JXMB 2QPDB 2X2HA 3OMAB 4G3YH 1IAOB 3FQ1A 4I18B 4CJ0A 4DKEL 3AABA 4QRTA 4QRRA 4G80B 4NHUA 3X13B 1PMYA 1JHKL 1NPNA 3J07A 2E9JA 4HGKC 5IMKB 2BY0A 5D2NA 4Q6IA 4TLUA 3E0GA 3ZOAA 1UEMA 2V17H 1FZJA 4UNTA 4WFFD 2NNXA 3AG1B 3SBQA 2O5ZL 1MQ8A 4ZD3L 2J5LC 2MFNA 3VI4B 2H26B 2PXYA 3BIBX 4PQXA 1UXSA 1HEJC 2FQDA 2X3AA 4I0CC 1J8HD 3DURA 2ESVB 3AFLA 4BELD 4Z78B 1HOCA 4LEXL 3UJTH 3FCTA 4AJVA 4YHOL 1RZGB 3E7JA 3PWLA 4XP6L 4WF7A 2VLLA 4N24A 5AW6B 3LZRA 1A5FL 5E9DE 2GFBA 3QNXB 1HJCA 2V8LA 3VXNB 4OQ1A 4KXAA 3ZN6A 2ZCZA 3UCRA 3GI9H 4Y5XA 4O2CA 4BGLA 5GZOD 3ZKQD 5I74C 2OZ4L 5F9AC 1DUYA 2ZOLB 4HJIA 2GAZB 5IVOA 1TJIL 3B8SA 4M5YH 3EGSB 3ZGIA 2PO6B 1T7XA 3BQUD 4KHXL 2XQYK 2CNYA 5LBSA 4F7TB 4A7GF 2R8SH 3RIFK 3CZSA 5DO8A 4OW6A 1VCAA 1ZWIB 1JWSB 1FL6A 4M5YL 2RHEA 3VA6A 3MV7A 1UD6A 1HHKB 3RWCB 4XVTH 3N5AA 3PUCA 4K4KA 4YOKA 2B1AL 2G0LA 3N1PC 1BBDH 5E2JA 3ZE0F 4YHYC 4P9MH 1B9ZA 3REWB 3Q2NA 5E70A 4GRLB 3L5WA 3DJTA 3EBAA 2XCMC 3MA7B 4NJ9H 5C09D 1MCEA 3ISYA 4BFNA 4WI0B 2Y22A 2KDYA 3GB7A 5TFSL 4LU5L 5FUZL 4F7EB 4UOW0 3CV5A 1CYXA 4AOFA 2XWJB 3O3DA 4G43A 1MJUL 3HG1E 2HWZH 3OB8A 3V0VA 5JDJA 1VZHA 2YJLA 5F9WB 5L4MA 1HHJB 1U4FA 2IVFC 3Q3GA 5EC1B 4ODSH 3RLSA 3N06B 5E56A 5GZNC 1NC4B 4ZX5A 1N0XH 3RWCA 1UOKA 2EKSB 4PB9H 2YAFA 4JG5A 3ZGHA 4R83A 1B0RA 2YD2A 4GG6E 3FTWA 2D7TH 5CWSB 1L9NA 5L9DH 1Q9OA 4JN2A 4S1RH 4BH8A 1G7LB 2ATKB 4HV8B 5DO2D 3X3FL 3IJYB 3I9IA 3QZNA 3AM8C 2Q9OA 1S5HA 1R3HB 3A21A 2WB1A 4MAZA 1AHWB 4D0CA 4D0DA 1LE5A 3UPCA 4L9LC 4NNXB 3S36L 3WO4C 1PS3A 4O4YL 4ENED 4I0KA 3CFNA 2RTTA 5BRPA 3FUFA 1AGEB 1M05B 3HI1B 2VRQA 4ELKB 1V7MH 4OJCA 4AV4A 5K9OA 1MJJA 3S6CA 2VWEE 4RMQA 2V2WB 4M8RA 4FABL 4HP5A 3VCLA 1JGLL 2Q3ZA 4KNTA 1JZ5A 3H3PL 4BBWA 1KEGL 1S7SB 3RNQA 3GSNB 1YRKA 2ROXA 4ZSOB 5FYKH 4OZIA 3QDJA 5BOZG 1KDJA 3A67H 4RBPH 1KZQA 1CQYA 3QEHA 4AGOA 4OKVA 2Y7OA 4ICXA 1JHTA 2A6IB 2VYRE 4A6YL 3T3ME 1EXUB 1NIBA 4XVOA 1GGCL 2AS5M 4XPAH 1UWYA 4P4KC 3UTSA 4S10A 4IKJA 5IB4B 4PRPD 4J2XA 4XBGB 5IVZA 3MLPA 1N59B 4BGDA 4XNYL 5B1JA 1E40A 3M17B 5D1QC 3VFMA 3U4KA 2XXCB 2X12A 3WL9B 1NCCL 3OV6A 4BQBA 2GJ6B 5J1TC 1X5XA 2UWEB 2W8CA 1KT2B 1NBYB 1JHTB 1PZBA 2D8KA 3A6CL 5IY5B 3RI5K 1OF2A 2WKOA 5E8PB 5D2LE 4YN3A 1YJDH 3U4BH 3ATAA 4K94L 1AY1H 2K9FB 3QYCA 2VN3A 2G60H 3QUYB 5F6HJ 3NZHH 2NY4D 4OUOA 3QO0A 4LCUA 4DGIL 5IESH 5E1QA 3L4TA 2BCKA 4JHVA 3ESVF 5LJYH 3T4AA 3S4SB 4NFDA 4NS0A 2XQBH 3ZDZB 5E51A 4ZAKC 1L7IH 5GGRA 3IRZA 4NEHB 4Y88A 4FFWD 1NIFA 2PYFB 1AI1L 2NNAA 2ZZUT 3NYKA 1IM9D 1UJTA 2ZUVA 4ZYKB 3AS2A 3JTTA 4KKLC 4PRHB 1DLHA 1MELA 1YVLA 3OQRA 4MLSA 3D9AL 3GXMA 5ECJE 3E8UL 4ERSH 5CU9A 2EEAA 1KTBA 1FZJB 5HYSG 1PZAA 5MENE 4ABUA 5F7FA 1HJBC 4KTDH 2APFA 1I8KB 2DQDL 4QOKD 4Y2DA 2RA1A 3WIAA 1T3FA 4ZFZA 4D9RD 3ZMNA 3DXAE 3KWUA 4WFEE 5G4NA 1IBGH 1GGTA 2ZNXA 4P49A 4X6DB 4X99A 4H40A 1EXUA 5IR1A 2P5PA 4FQHA 1DN2A 4K0OA 1F3DH 3MX0A 4ZODA 5EZLA 5F3HA 1G1CA 1T4WA 4OF7A 3GUTB 5TQ2H 3VYNA 1Q1PA 4NXSA 3HR6A 1CFTA 2JCWA 1ZSDA 3QEGH 3UTTD 4ZMQA 1W15A 3C87A 2AXWA 3NMEA 5GJTL 1DL7L 3FN3A 3STZA 1X7QB 3QDMD 1UOVA 2B77A 5T1KB 2HT4D 4R5XA 3TVMA 2XVGA 1OP3H 2B1HH 4WU5B 4M4RA 5C2BH 4MCMA 1OP3K 4TF4A 4IIQC 1XB8A 1ZT1B 1OHQA 4X4YA 4L2YA 3T0DA 4O51B 5F9JB 1W91A 2GW5A 2MPVA 2Z7UA 3U82B 3VXQA 25C8L 3QRGH 5GISL 3GMQA 3NA4A 1I7ZB 4H8UA 4XNZC 4YBQC 2AJUL 4XP1L 3FO1A 4JW3A 1A6TA 3P02A 2B59A 2ISDA 2DLHA 4HH9A 1ACZA 1ZK9A 1HZHL 4Y16C 4CVUA 1B2WH 4MS8D 2YLKA 2X1QA 1QA9A 1KG0A 4MJ4A 4XP4H 2FE0A 4KK8D 1K2DA 4GAFB 1V05A 4AYID 3LQZA 4NHCH 3MU3A 3FUJA 1J8HE 4ZQKB 1SJEB 3H6AA 5I0ZA 2HTLC 1LEKB 3BESR 4ZTOH 5H37A 1HEZA 1I8LC 1M3IA 1NC4A 2G5UA 4MA8L 2EVJA 5AAWA 4UTBA 5L88H 1YG9A 2VXQA 3SDYL 3QUZA 4Z7VE 3RU8L 2A6DA 1NANH 1B0GB 3DOIA 4OLUL 3QT2A 5CJ5A 4JG0L 4XNXH 3PG2A 4LLYB 3GMPB 3APNA 4HIEB 1ZMYA 5AW0B 3T8XA 2A1WH 3DSFL 3C2AH 2DIJA 2Z8VC 3AADB 4FAAB 2ICWJ 2CLRA 6TAAA 1I4FA 3US1A 3OKNA 4WWID 5DGRA 1E5BA 5HJGA 4KMTL 1MVFA 3BWAB 4A68A 3CZGA 5EZIH 3CQFA 1J8RA 1FIGH 1UXWB 3L4YA 2IQ9H 4QRRB 3SODB 1V3KA 1LE5B 4JFQB 4JFZH 4ZUSB 5ESAB 5FIEA 2IMNA 4E0RA 1E9PA 1KBKA 1ILSA 1ZGLP 5ISZD 2F74B 1GYVA 4X7TA 2GJRA 1R3KA 4KRPC 2E5EA 4J1UB 3WJMA 2FVNA 3C60B 3ZR6A 5G55A 4AKPA 2X3CA 4HT1H 1XVSA 2B4CH 4HMCA 3FOMA 4YHKH 1JPEA 1A22B 3N40P 2W81C 1OW0C 4XPHH 1H6TA 3FN0L 4RGOH 5I18L 1I9JH 4B9CA 3U0WH 3RI5F 4Z7UB 4HULB 3SQOH 1AJ7L 5BZWA 3JYBA 1WA1X 5FV1L 1DUYB 1PLGH 4YBLB 3G6JA 4XHQA 5E1AA 4HK0A 3VWKA 4ANKA 4E9XA 5B1AB 1RMFL 2PYEE 3MACL 1NLBL 1KC5L 5JQHC 1DSWA 1EV2E 3G9VA 3QPQC 2BJML 5DEFA 5E24E 3RWDA 2APTA 4NP4L 1GZQB 3V6OA 2P7TA 5T3XH 3RTQC 3M88A 1KELL 2CO3A 3L7FA 3V0WH 5IEHB 3IFLH 2TRHA 5K9QG 3SY6A 5C3LD 4TULL 3QXVA 4IEFA 4U1JB 3SYAA 2VH5L 1DBMH 1YMMA 4PJ7E 1P2CB 1G6RA 1U2CA 2CAKA 1DN0B 2AJYL 2EO9A 4P23C 3TWYA 1OP4A 5GGTH 2K9UA 1Z1WA 2UXGA 3UYRL 3OKMB 1MI5D 3ZXAC 3HC3L 2FATH 5G5DA 4Z7WE 4XVSL 2WPGA 2AMGA 5KVEL 2E7LA 1NGPL 1JHLH 3GO1H 3JQOB 4TULH 4CVXA 3N3EA 4K8RC 5I73C 3L3OA 3DRQB 2H8PB 3Q5YA 1UB6B 2E74C 4Y5VC 3FQWB 2VERN 1WBXB 5EZOH 1YHPA 1I7RA 1T04B 2JQAA 3QEQE 1JCVA 5HGAB 5SWSB 4W1TA 1OAXL 3MJ9L 3K6IA 4P2OB 2XPGA 5I71B 1RQ5A 4P2OD 4NQCA 5I8OH 3RPIB 2B2XH 3Q2CA 3N40F 3MACH 1NBVH 4L1SA 4IEFB 3OXSA 2CPCA 2GJZA 3K0WA 4NBZB 2MCMA 1UH3A 2VQUA 3MNWB 4R97B 3DVGB 3DOSA 3LKNA 4QTIL 1J12A 1RJYA 5KS9B 5IB1B 4XNUL 5D2LB 2IQ9L 1DE4A 4AMXA 3HHMA 1XBRA 4OJFL 4WCYL 1JVLA 1N4XH 3V5KB 3KBHE 3S34L 5SWSA 1L9PA 1OGSA 1V8HA 2WO3B 3NIFF 4GRWB 4WHYH 5B3SB 3W56A 4JFTA 3P3UA 2A1WL 2KPNA 3DSFH 3GRWL 1EO7A 3FUNA 3UDWC 3UJJL 1T0MB 3DO7A 3QQ3B 4GAAA 1FG2B 4EZKA 2G5BA 2YO3A 3JWDC 1KN4L 4OI9A 4KJPD 4P59L 1QATA 1NIAA 4P3WA 1WTLA 4QYOA 4P2OA 2DAVA 4U1IB 4IU2B 3KAAA 5E6IC 3T0AA 5MEND 2JJWA 3WTVA 2A4ZA 4NC1C 4Z1PA 1ACYL 3RYMA 1SM3H 1FNAA 1SMOA 4ILDA 1U2HA 3MRRB 1LEIB 1HZHH 3VG9C 3V9CA 3CLFH 3B7RL 4TQEH 4KO5A 1WAPA 1E5YA 3LS4L 4GAJH 5I1LA 3VYOA 3BLKA 4OFYD 4Z8FL 3SDXE 3IU4L 2H0JA 4MX7A 4BSVA 5D9SA 4JJOA 3PYCA 4PPTA 3RHWF 5CUSH 4JO5A 1D7BA 4R6UA 2VUOA 1NIDA 2FIKA 4GFTB 4JQXA 3EADA 4XMLH 2BVUA 1RULL 3K72A 1U8HB 3MCYA 3ZMRA 1HH9B 5IESL 4JN1H 4RISL 1JZIA 2DMBA 3OHXC 3TH4T 1OGTB 1VEMA 1NFIB 2EABA 2OR9L 4M6NL 2MNJB 3LKSB 1KXVC 4MNQD 3UZQB 4HIJB 3VJ6B 1T03H 3LXCA 4LVNC 5ID0A 1V10A 1T5WB 1NC2A 4L5FH 3P69A 5TE6L 4G9FE 4L3FA 3UFIA 2W91A 4ODHH 2WM0A 1UFGA 4FG6C 5IW6B 3GYRA 1JN6B 2G3NA 1MAMH 2Y1VA 4MMZC 4OD1L 4AQOA 3NJNA 5FYJE 2ZTBA 3VG0H 3MGTB 3WN5A 3NSJA 4XNYH 5CZRA 3ZZQA 3SDDA 3R18A 3KBEA 1MVUB 4Y4FD 2MCG1 5B7MA 3GKWL 1U91B 2SODB 4Y4FB 2FX9H 5D1ZC 1E9PB 3V0HA 5J12C 4ISVA 3D0AA 3LIZA 5B8CC 1GZQA 2YPVH 2YBRB 3O3BB 2XZZA 3OJDB 4LL4A 1EJOL 4P99A 3EYFB 1IM3A 5FYKL 3F5WA 2H7WA 5JUEH 1CXFA 2RQEA 2VGLM 1NBZB 5KZCB 1I9EA 2FWUA 2X40A 1KBGL 4HQQL 4XH2B 4DKDC 3D69B 1GKEA 3H9YA 4OVUA 3QFJE 4JGJA 4YVUA 2PYEA 5EFIB 1QASA 2UWEF 4UMGA 4E5XA 2F5AH 5BZWB 3VXUE 4OF3A 2W94A 1U58A 4Y5YB 1M7DA 1T66C 2WLYA 3OZ9H 4ABVA 4FADA 5LGKA 43C9B 3CTTA 4N0YH 1DDHA 7CGTA 3BRDA 4OZIF 2BERA 4NQVB 4XNQA 3RNKB 2MQ0A 3F6LA 3F7LA 1TVHA 3QXAA 2XKUA 1U8QA 3TVMC 5BO1H 5FGCE 3BQUC 1WV7T 1WWBX 1AGCA 1B0GA 2OSYA 3K4DA 3RFZC 3HA0A 4OTXL 2DL2A 4XNDA 4F5CA 2X0WA 2Z93A 3NIGE 5IROD 4DHLA 5KSVB 1UOLA 4OLYH 3VFPA 1RZQA 4K94H 5HYQA 1UA6L 1NCOA 1OD7A 3QAZC 3WXWH 2CJSA 4PJHA 3LB6D 3PHQA 4KVNH 2YKLL 3IDUA 4R5TA 2PYED 1A6PA 2X9XA 2CRYA 4LL1A 4PBXA 1MFAL 1OTUD 1U8MB 3ZT6A 1OIOA 2C7UB 3X11A 4HIHB 3ULVC 1GOGA 2G4GA 1WFIA 2IGTA 4KQ3L 4U3XA 3A5VA 1JMZA 4KK5D 5MEPB 4YSEA 4ZX4A 2QTVA 1UZ8B 4EUPB 1LQBC 3D39A 3PAUA 3MLXL 5HYEA 43C9A 3KWWA 2A74C 1EEZA 3QFDB 4M48H 3UBXI 3KS0J 2VIRB 4DQAA 1M53A 3MRJA 5F9OH 3UBXG 1WWCA 5E2TH 2ITDB 4ZO7A 3GBLA 2DQTL 3GIVA 4NM8H 1ACXA 3IBEA 1I1YA 3KS0H 2BINA 1OARL 3MR9A 1ZVSB 4FFVC 1MG3C 3C8KA 2VB5A 3LQMA 3RVWD 4BFEA 4ALAH 4HWBA 3MRMA 2YJQA 3O11A 5I6LA 4H25B 4K3HA 4DAGH 3BKJL 3ILQD 2DIAA 3L8QA 5FYJL 4WI4A 4PJAE 4PW4A 3FW6A 3Q8CA 1P7QA 4GEJA 2EDFA 3IFPA 3QWRD 3MX0B 4QHUA 4X9BA 2DZEA 5FO7B 3SGDI 3IJEB 2AHIA 3PIQB 5AW1B 2AKRB 1A5FH 1S2EA 3QI9D 3ZSTA 2YD1A 2W65A 4WW1A 4NUPA 1AE6L 4BYHA 5EOCL 1E9OB 4RMWA 1G7JA 4BKLB 3AS0A 1XCQB 3IU3A 1FCCA 2VMEA 3I6KB 5EU3B 2XTJD 1J8KA 1SXAA 2W9EL 3QEQB 1CIDA 1Q94B 5HDBB 1SXBA 1T2XA 4OIBA 3JTSA 1OW0A 4U1GC 5A2IH 1OZUA 5DZNA 3N85L 4KRMB 2WLHA 2IFGA 4R0LB 5F7DB 5CEYA 5F1KC 4N8VA 3TCLA 1P5UB 2HLFD 1MPAH 3PFQA 3VXTB 2NY2B 3NH7L 2JQZA 2CA3A 1KNOB 4XMWA 1YMHB 5C8JA 4KHXH 4X4KA 2XWCA 1CLYL 3L2MA 4CU8A 4X50A 5SV3A 1AFVL 3B6SB 1S5IL 2IPUK 1CR9H 2OZ4A 4JANB 4YX2L 2FEDC 3H8NA 3NN8B 2NZ9D 1IFRA 1LE9A 1A3ZA 2VDMH 1HHKA 4YE0A 1LDPL 4E42B 1TO4A 5IFJA 3T0EE 3X3GH 4KKNA 4GG6F 3VO0A 4ZT1A 5BUGA 5KVMC 3GIZL 3MRDB 1HHGB 1FZMB 3GSNH 5CLXA 5AYUH 3W57A 3LZOA 3MUGB 3QUZC 4L37A 3U25A 3VGAB 4N2DA 2WLLA 2H0EA 2XFXB 3BEVA 3ZHNA 5CP3A 3PWVA 4G6KH 4G9FA 4EUPH 2IAAC 5D7JB 1P4IL 4P2OC 5I1DB 2OP4L 5I71C 2NNRA 5E0FA 4JO4L 3TT1H 2YMTA 3PHOB 4Y19A 3ZU8A 4LMQE 1SLVA 1CN4A 1MFMA 3KZ8A 3LKPA 2XQYG 4LLDA 5CSBA 5BUPA 2IBGA 3D0VA 1VJSA 4U0RC 4ZXBA 2WBKA 4LPXA 1GGBL 5EFIA 1A9EA 1I1AA 3QH3A 3MRPA 2F9BT 1MREL 1TMQA 5C92A 2OBGA 1NGYB 2XV2A 1OTSD 3WNIA 4PJCB 4Z3GA 3LZNA 4JFED 1MHPL 4GSUA 4E0RB 5F7YC 3FB8A 1F1GA 2BHZA 3OGCB 3OKDB 4LLDB 1XZWA 1FVDB 2CK0H 3NZ8A 4NQEE 3O8XB 3DTXA 3HNSL 4Y5YA 4Y4FA 2V7NA 3O0RH 5HI4D 4FRWA 2BP8A 3NSCA 4G9FD 4G9FB 5HP5A 1QFWI 4ZBJA 4UUJA 4M1CC 2W95A 2I69A 5FS5A 2Z31C 1K8DA 2I25N 4P8QA 3O3EB 1IIKA 2IQAB 5F7AA 1N68A 3UYPA 4JM4H 2P8MB 4LXFA 1KGJA 1MJ8L 1H3VA 1T7VA 1H0DB 1IILE 1XCXA 5HGHA 3TBTB 4APQC 4M7KL 5I6KA 5DI8B 5EU5A 1MF2H 2VAAB 4WFHD 4N2AA 4FC3E 2MJWA 3D39B 3N50A 1NWPA 1LK2B 3WENA 4N86A 1S9WB 3TC9A 4JFEA 2JFCA 5GGTL 4YHZL 4IHOB 2YEZB 3CBKB 3W2DH 2PXYC 4MA3A 3O2WH 4I85A 1RHHB 2OK0L 4WEMB 4AC2A 2EDBA 2F54B 4H4NA 4PGDA 2XN2A 4RDQG 4XMTA 1OB1B 2BZDA 4RSYA 3U7WH 2NYYD 1IX2A 3K0YA 3UACA 4HIIA 3ARBD 3VXUD 1TQBC 3BPCB 4C4BA 2AEPH 1M2OA 3ARBB 3NCEB 3VXUB 1N67A 4IBYA 1XGPB 3DUSA 3AW5A 4BZ2L 4WK0B 4F2MB 3ZRCC 4LHUB 1CK0H 3D33A 1VPOH 3ZDXF 5I6NA 3ULUE 1DLFL 1FJ1B 1ETZA 2XSKA 4OCMC 4IMLB 2JI2A 1A0QL 3CHOA 3EJYD 1N18A 3AY2A 3FOLB 2JV6A 4J7RA 1KCLA 1A4JB 5IF0B 3ARPA 3DTXB 1FNSL 2K6YA 1RJLB 2QSCH 4Q58C 1EUTA 5JXEC 5BOPA 5J9PA 3BLPX 1SVZA 4PJEE 4PGJA 1JE6A 1I8MA 2EJ1A 1FGVH 2WXRA 1RIVL 2BP0A 4P4KD 3K8KA 4IS6A 3DYPA 1J05B 3SIKA 3MLXH 4UMSA 1NBZA 4W9LC 2ZG3A 2B4CL 4F8PA 3I6GA 4PY8J 3NSYA 1IGFH 2C4FT 5DVMA 3CXDH 2PTTA 3EO0B 2PW1B 2ZE0A 4KQ4L 2ZSVB 4J3BA 2DWEB 4MTMA 1FHNA 4MCZB 3SYPA 3TNMA 3DX0A 2UV3A 3KH3A 2CPUA 4JZJC 4W6XB 3MBEB 3BPLC 2OR9H 3QIBC 4TVSa 3HMWH 3WMQA 1FNLA 4DFHA 2COQA 4L1TA 4JPIA 2FEEL 4Z76A 2CKNA 3BVNA 5D2NC 3TH3T 1A8JH 3LRKA 4GI9A 1E7VA 1FZKA 3LKOB 6FABL 1BF2A 2AABL 4W4OA 3M86A 4KK9C 4FFWC 4HPOL 4KKCD 1UCBL 5I5MA 1XSKA 5FWRA 2AQ3A 2IPKA 2EXWD 4CC1A 1IL1A 3U9UB 5BVPH 3QUKB 4DZ8A 4YH6A 4NO2A 1CDHA 4POUB 3TYGL 1F1AA 1TNMA 4KZEH 1GIGL 1IAOA 2CO2A 4I18A 1QSZA 3J27A 1QPXA 3KPQA 1N2RB 3BVVA 2QADD 4NHCL 2PUQT 3NUKA 1MHEA 3SDXF 2YXMA 4V1DB 2Q6WA 5EIIG 4B5EA 1BFOA 3VWJC 1XF3A 4OM1L 2VITB 4JLRB 3Q1EA 3CLFL 1FZKB 4NQCB 4Z7WA 2EE3A 4G6ML 4UDUA 1UWFA 2NW2A 1TQBB 4R26L 5F7KC 2BZCA 1E8WA 1YN6A 3PP3H 1UWXH 1CS6A 1PG7H 2HCZX 1FIEA 3CXHK 3E3QC 4U6HB 5EIIB 5PCYA 2V7HA 1YEEL 3FCBA 3PWLB 2H1LM 1CLOH 5JA9A 5K9KA 4RWHA 4FLQA 1ZHLA 1I53A 1PZ2A 5ALBH 3U83A 1KYOK 4AYFB 3T6QC 5KN5B 3SDDC 4F8LA 4D0BB 8CGTA 5JLZB 2AABH 4YXKL 1YEDB 2JELL 4U6VH 2PW1A 1JN6A 4M4RB 1URLA 4PBWD 4X6CE 4Z7UE 4X6FB 1SYVA 3DX6A 3BPNB 3SQBB 3CSTA 3VFGH 5DMKA 3QK0A 4MA1B 3VDAA 2E9WA 1DR9A 1ORSB 2OCFD 4APQD 2XT1B 3H9SE 4JFUA 2AJVH 2VDKH 4B0MB 1SMDA 4E36A 1OCCB 1ZHLB 1YC7A 4CGTA 4FFYH 2VR8A 3EYVB 4AXWB 5KSUA 2HT3C 5AL8A 2EC8A 1CF8L 3SQRA 4PCSA 4NQSB 3A6BL 3WEBA 3VFGL 1MJ7H 2B0SH 2WYZA 2N56A 4M7JL 4PTTB 1J1PL 4XB7A 3QYNA 1IBDA 4KZDL 1H6UA 5K5YA 3ZDZF 3VXSE 3ETBJ 4ODTH 1HL5A 2C26A 3NIDE 5DS1A 1OE2A 4FTVB 5CUSL 2VABB 3QDJD 4IRJA 4HEME 2BIPA 1RUPL 1HI6B 2X53A 5BRZD 4OZHA 2WJ5A 5BCAA 5FYLE 5MERA 1LO5A 5LAPA 5AOMA 2VISB 3GMRB 4LAJH 1WFUA 1PG7L 1QFOA 2XWJA 3O3DB 4OGXL 4ONGH 4PJBF 5D7IE 1UKTA 1I7TB 1MHHB 3OR7B 1DLFH 4NQVA 4XNQB 5EZPA 3RNKA 4DGIH 1FL5B 1RZFL 2JIXA 1HYSD 1A1MB 2FO4A 4MAYD 1QVOA 2AJYH 3PPSA 3KWVA 2AK1L 1GC1C 3RDTD 4YHNB 4ZMPA 1TQCC 3SKUD 2GT9B 3QJUB 5T5NF 5JOFB 3FO0H 1BDYA 3CLEH 1UYWL 3CVHL 3UPAA 4H0LC 5KSVA 4FQLL 5HHVL 4PRBB 5IQ9A 1QUPA 1OF2B 3P0VH 1XMWA 3SB3A 4J2QA 1XB3A 4GBXB 4OQTA 4G8FB 5DHDA 5DJ0A 4QD2E 3T2NL 2YPLB 1Y6NR 3KPOB 1WUZA 3LKQB 4M6OL 1KSRA 1GC1L 1Q9WA 3X1GA 1MFCL 2OL3B 4Z7AA 4PJ5E 5FGBC 1ZE3C 4OUUB 5GRVL 1P84K 2CWRA 2OJ1A 2QQLL 1U8KA 4JDTL 4ZAKD 5I24A 3FJTA 5DLMH 1AQMA 2ZG2A 3EYVA 1IKFL 2EYTA 4HUUB 3RGVA 4L48A 1BQHG 4WFHE 4WKXA 5CP7B 3UBGA 5KBKA 3ORJA 2D7MA 5CIPA 5AVXB 5L7XL 2JKLA 2AK4E 3ZIYA 3V6ZB 3C5SA 4AKOA 2WHVA 1FV1A 1I7RB 3WELA 2ZD0A 2NDFA 2XWEA 3QIBA 4U1GB 2EUVA 4QEGA 4XE0A 2CUIA 1S3RA 2FBRA 4AT6A 1IGFL 1IAIH 1MZZA 1LWRA 4GQ9L 4M8VA 2AEPL 3QFGA 3B5TA 1T4KA 2WCSA 3I50L 4X5RA 1OZTG 3WHE0 3H7LA 2H9GB 4O4YH 4OY9A 2BVQA 4UOZA 4WJ5A 4JCWA 3ZKXC 1X9UA 3WFHA 2IDSA 2VDLH 4PMEA 4HG4J 3TO4A 4XNMB 3G6JF 1KIUA 2FIRT 3WUWB 1SN0A 3HC3H 2CXGA 4RFOL 1WIOA 4X5WA 4ORZC 5HDQH 3V6FB 2YD9A 2JKTM 4DFIA 5JXEA 1FFPB 1MFDL 5CKAA 2HB0A 2R23B 1LO3L 2EDKA 5D4IA 4NENB 4AUUA 4GSQA 4CU7A 4JPVH 3IXTA 3BUBA 4PRHA 4XR8C 1U8NB 2OP4H 5DUBA 3SKOA 1P4IH 4H8WH 4XWGH 5GRWA 4Z0BL 5JHDA 5AB0A 4ZG1A 1HWWA 2O5YL 4XX1G 1L9SA 4LCVA 5EIQA 5KBPA 5AVYB 1EHLH 4X2UA 1KMGA 3S3JA 1EFXA 4LPWA 2VDNH 2MEJB 1NEZA 3KM1A 2DEWX 2E3VA 3LMJL 1DEDA 4ZUTA 1EAPA 4P9ML 4ZQTA 2BVTA 2R1XB 5KYUB 4KO6A 2LTQC 2IDCA 1V7NL 4TUJA 2R1WB 2DLFL 5I8EB 1Q4NX 1AANA 2KC0A 2DWDB 4C57C 4UQ3A 2FJFB 4WSGA 5AENA 1QFUL 4E9TA 3NG5A 5ID1A 3EH4B 4ECNA 2IH3A 3UPRA 2F58H 2WB7A 4YZFF 1JXFA 4WW2A 4F7MA 1Y6KR 3DXAA 2HRGA 1KFAL 4X98A 4Z0XA 3WKNA 3LPGA 5D7LD 3QNFA 3CH1B 1GA2A 5EORH 1JJUA 4JX0A 1CG9A 1GZPA 2Z1PA 1DL7H 4EKJA 3QR2A 4Z7QB 1UXLA 1SPDA 1ZV9A 1RV6X 3BZ4B 3OKOA 4FP8H 4H88H 4O2CB 5SX5K 3FU7A 3UJTL 4MYWB 2ZOTA 4NCDA 3D4GA 3U7YH 2V9RA 2BSEA 4J12A 2EH7L 1J0JA 4OZGE 1N3NB 3ZDYE 4U7KA 4LLWA 2WSKA 3BAWA 4WK2B 4Q9RH 1E27A 2ED7A 4FNPA 4GUPA 4Y5YC 5DTFA 2XFXA 3BEVB 4LQFL 1KN2H 2KQNA 1ZHBA 3AT0A 5ESVB 5ABAA 5E2UH 4OLVH 4WGKA 4DO6A 5IUSA 4JRYD 4N2NA 3MRQA 2JCCE 3U30B 1WZAA 4XN2A 4ORGB 4A2GA 4G3YL 4DKEH 4RETB 2VQ1A 4IDJL 3WGVB 1TMCB 3SBWA 3V4UL 5BXFB 4J5VA 2WCPA 2CBMA 5F96H 4LHQB 3VQ2C 2H3NA 3VB9A 4OZIE 1RZKL 4AK2A 1G1KA 2VXSH 4TNEA 4ZTOL 1CDIA 2R4RL 5DSCB 3QNZB 4AMKL 2FJGB 2DWSA 1ED3B 4KOBA 5D96C 1RK0A 3TBSB 3C09C 2L7QA 4J4PD 3WE6B 2ZXBA 5AZ2H 2WWMD 3KPQB 3SBPA 3H9SD 4BZ1H 4J4PC 4K5PA 1EZLA 4UT7L 3VI3E 3MJ6A 1XIWA 4RRPG 3CIQA 3WXVL 1P6FA 1KCSH 1BYOA 3S7GA 2VCOA 4K71C 4GKNB 2BP5M 1Z9MA 1NCCH 3ABLB 5C0BD 1GCFA 3IDYC 4LSUL 3PWVB 2XBDA 4R8WH 3FS9A 4XX5A 1RIHH 3JZ7A 3NOIA 2X87A 1JXJA 3FFCD 3WXWL 2E7MA 1AXSB 3FFCB 3QDJE 3MJ7B 2Y9RT 4Z7OE 3VFNA 2Y1ZA 3GRBA 1OAUL 1NEPA 2DQFA 2VZ3A 1DBKH 4L8BA 3W0WB 5JW5A 1CICB 1CU4L 1ETJA 1QTPA 3WY4A 1DJGA 3UAEA 5IV2A 3BKJH 2DQIL 3SE9H 1IC0A 3ZKSD 1QBBA 1FORL 2A73A 2HRHA 4L4JA 4PSRA 4PJIA 1UM5L 5JPMA 2MOGA 5L8LB 3S88H 3FSAA 1NGYA 2W9EH 1PFCA 3I6SA 3N9GH 3ARGC 3MFGB 1KCBA 5IGXH 3N43F 1FZOA 3D4ZA 3V4VB 4FABH 4AIXA 4FQ2L 2L8AA 3QEUB 5BJTA 3L13A 2EXTA 2Y24A 1LXMA 3LPFA 2NY5H 2QLYA 2EKSA 3EHBD 1FYTB 4JJ5B 1V7ML 5DJXA 4GKNA 1CFNB 2BP8B 4DP8X 3IGAB 5HJ3A 2V9UA 4NWTL 4RGNB 1WCBA 1UURA 3QE5A 4RGND 3RWGB 4Q97A 2A4CA 2V9TA 1R3LB 1HCZA 3ML8A 2M2DA 5FM5O 3K8MA 4A67A 2OI9B 3MZTA 5EN2A 2XFGB 1PDKA 3OMZA 3DWTA 3KL5A 1QWHA 3S4SG 3CGTA 3BN9C 3T6VA 4C4KO 3VFOB 4MMXB 3HBGA 2GUOA 3T08A 4Q8BA 4JM2D 1HL8A 1ONQB 1M05A 4JFDE 5B39G 1DQMH 3P2TA 2CHDA 4PB9L 5GSVA 3LN4B 4IMKC 5D6DC 2NNAB 2Z8RA 3BFWA 3QXDA 1T1ZB 3SHSA 4FQQA 3WSQH 4Z7NF 3QZWA 3CMOH 5LN4A 3L3DA 4G7SB 5EC2B 4KX8A 5J13B 1A02N 1NMCB 2HWZL 4JDZA 5IMOB 2XN9B 4N0YL 4NQDE 1MFAH 3NJJA 3DMMD 3VFVB 3W82A 4J3SA 5T1KD 4ZMXA 4NKQB 4B96A 4LLMA 5J56B 5LDUA 1UUNA 5C0IB 5C0JB 5JXED 2EIJB 3I84A 1QLEH 5DJYB 2OMXB 3SDAD 1L4IA 3H54A 4L4VA 4MQ7B 5A6LA 1E4JA 3H2PA 3CDGA 3LNIA 2A2QT 2IWEA 4PV9B 4U1LA 3V9FA 3L7EA 1MW1A 2J71A 1RL1A 2SEBB 4Y9BA 1SHSA 1D5RA 2NT0A 4HUKB 1K3ZA 3FU7B 4JM2A 2VLKB 3QCVL 4MD5B 2GC7C 3H2WA 1PZ5B 4I3SL 5T3ZE 4YGAB 1SFHA 2D03L 3CN0A 5KVGH 1USZA 1DSFH 1PQZA 5ESQA 4L5FE 1MCQA 1OO2A 3ARFA 5LAXB 4PCYA 4Z3JA 3JXAA 3CSFA 4LLWB 3OPUA 4ELKA 3HZYA 3U1PA 4WO4A 2AXFA 3LDBB 3KLLA 4G80A 3Q8FA 3SD5A 3V4UH 4G8IA 3VXMD 5L0QB 1WSST 4DUWA 4Q6IC 1RLWA 4HDIB 1YDPB 5GGSY 3VD1A 4P46C 4PCTA 5JYLA 1Z5YD 1PY0A 3LSOA 3QIBB 4UIMB 1VZGA 3SOBL 1MNUH 4AV5A 4GMTH 4JKKA 2ZNWA 4HF5H 2CUAA 4ZMAT 2CCLA 4XBPA 4EZLA 4TPRH 2GUOB 4FOMA 4AENA 2ZKMX 3STLA 3DGDA 5JW4R 1E3FA 2FQEA 2IH1B 3UGEA 4MYPA 4Z7NE 3CFTA 1F58H 5J6HA 3AUVA 1QZNA 3JTTB 2FZ3A 5DD5H 2QZQA 1NSNL 3QNZA 1AGBB 5GHWH 1E30A 3SDCC 2R51A 3CC5B 2OTWB 3LKPB 4UT9A 3K71A 1JRHI 4GJTB 3CFIC 2P49B 4BKTC 4X6EB 1MRDH 3C8DA 4D3CL 4LBEA 4AL8C 5BPPA 1S7UB 5EORL 1DBBL 3OQ3B 4TVUA 1NZRA 2ED8A 3T1WA 5HHOB 1BMWA 2P24B 3QQDA 3CHSA 3CFJB 3QO1B 1D3CA 4J3OF 5HHPB 1DJWA 1FL3B 4LL9A 5DFVC 1G7IB 4ODHL 2QFRA 3C08H 3D2TA 5JXAH 1JK9A 4N0CC 4HLZH 1VGKB 4XGZA 3BP7B 4QRBA 5TDOB 2F53D 3PV6A 3T3MB 4XXDA 1TOXA 5CLYA 1IC5L 3F83A 1D2OA 5KBMA 1E2WA 3VFRA 4PRDA 3WO4B 3ARDC 1TLMA 3KE0A 1N64L 2O93L 1A14H 1L0QA 4O02H 1NLDL 5IJKC 1K6QL 2A9CA 4NZUL 2HRPL 1K3IA 3SPIA 4PWIA 4KKBC 5A2BA 4J6RL 4M02A 3W1ZA 5JDSA 1RZKH 3QA3A 2R27A 5KTEH 5DA0B 4POYA 5C0AE 2VE6B 2Y36L 2Y7QB 2CBTA 4TOYL 5EU4A 2A6JB 3FTUA 3UJJH 3QWOA 2WAHA 2BIOA 2BVOA 1MCIA 5KOMC 5LG1A 2O6PA 2PKDA 4M1GH 5F88A 5DA4A 4AENB 2R69A 5CINL 4F9PA 1LD9B 3LHPL 3VWJD 3BZFB 2H1PL 1MW0A 4QRRD 3FYEB 2CCWA 1ACYH 3U2JA 4LRNH 2FX7L 2E6PA 5CLTA 3QA3B 5EA0H 5FUCC 5IMKA 1R5IA 2G9HB 3F7QA 2ZOWA 4UZGA 2YBRA 4U2YA 3UTQB 4LARL 2A6KB 4KK6D 3WFCH 2ODHA 1LTXA 4QHLB 4AQ1B 2FNWA 1MVYA 5IB3A 2GTZA 3PV7A 4NUQA 1E28A 2HLEB 3DURB 3GSNA 2IV9A 3FAWA 2YAMA 2OULB 3ZMEA 1AH1A 2R29A 5DEFB 3RZCB 2D9QB 5B3NA 3PXJA 3T5WA 2FLRT 3ERXA 5DFAA 3OR6B 4YZWA 3H9HA 5H37H 4EQ3A 5B4MC 3GMMB 5EEWA 4IK7A 1DQTA 1FO0H 2YMXH 4KGJA 1FQ9C 2X6AA 3LH2H 3GC3A 1GGIL 3FB7B 3QUMB 5DC0A 1HWGB 3RY6A 1FFOB 2C3HA 4RGOL 1J0ZA 1NQBA 2VC2L 3HI5H 1T7ZA 4KTEL 4NRXB 4U0RB 2J4WL 5EPMA 3SBRA 1HIML 4X9YA 4OQTL 2C3XA 2DJSA 4YHKL 3IKCA 1QVOB 2ZWZA 4PV1C 3KL3A 3ILPA 1JD7A 4DKFH 2NY1B 1QR4A 2GPZA 3EDKA 5IG7A 2X3BA 3HN8A 1OQOA 4OM0H 1J9TA 5PAZA 2LHAA 2NY5C 4HIEA 1OKEA 4HLEA 2O5XL 1IIIA 3SKJH 4LT7A 5F72S 4G42B 4YHPB 1JF1A 3M1BB 2KKQA 4EZJA 1YA5A 3NJHA 1LD9A 1W16A 3QG6B 5IREA 4M00A 2FO8A 3GPEA 1RU9H 1TCRB 5FC9A 5FDWB 5E08L 3E6HB 5J4MA 3MRGA 4XTRD 5ESAA 4QJ4B 3TN0A 5A1AA 4GUOA 1ZLVH 5TJWK 4IBSA 3MRRA 4FQ1L 4K2UL 3TYFA 5GQBA 1Z9PA 4E2OA 1WHPA 2CMRL 1KIRB 5DK0B 2UY7B 4F15B 4ZUUA 1RUPH 4LLVA 3GJEA 4D9RE 3AM8A 2VL4A 2Y06L 3DX3A 5L6YL 5GRUL 3MUUA 2NXZC 2Q8BL 5CJOH 3I6GB 4NLAA 4RLDA 2EH8H 3MRDA 4B0MM 1JXGA 4DP4X 3CCHA 3A6BH 2FEEI 2ICEB 4Q14A 2QSVA 1RFDH 1KJ2B 3EYQC 4TPRL 3IF1B 2FWLB 2UXTA 4DGYL 2DLEA 1IEBB 4DVBA 1U8IA 5GZNA 3MA9L 2YD8A 3DTDA 4Q0XH 4QXVA 1BX2A 4P46D 1Q38A 4LVHC 3CC5A 4IMKA 1PLGL 2CHNA 3TEXA 5HHMD 1QLRB 4PFEA 1KCRL 3CVIL 2IWKA 5BVJB 4YMPA 4RAVA 4DK5A 1QSED 4WSKA 4X7CC 2B1HL 5CSGA 3K5RA 4DVRL 5I1HH 3SO3C 1KLGB 3FT1A 1XR9B 1SY6L 5AOZA 4A6YB 1UM5H 1BHGA 1T3FB 4ZFZB 5I6XC 3U9UA 4N5UA 2CALA 3ZKNC 1ZDQA 2J6EA 4JFOB 4LAQL 4BQ9A 4KO9A 4PS4H 1FRGL 4MMXC 3VXME 4DERA 3IJ8A 5T1DH 1RIUH 3EJRA 4DH2A 4FQLH 5HHVH 2VXVL 3FCSB 2NY2C 1A6TB 2O6DA 4HJSA 2Y3AA 3CHRA 3DJSA 1R47A 1CDGA 4YFLI 1ZJBA 5DMIH 4KBPA 1SXZA 4FKKA 2Y07L 5MI0B 1ZANL 3G04A 1Y0LA 3ZTEA 1UQSB 3KG5A 1EAQA 4KRPB 4AIZA 4GOSA 2ENQA 4UM9D 4WTXA 3Q6GL 1YYMH 2I27N 2ICEC 1QSEA 5DEJA 4OGXH 2DEXX 3WIIH 2BIHA 4UT7H 1GIGH 1FGNH 3GRGA 5JIPA 32C2B 5KUMA 1ORQB 5D5MA 4BQ6A 1CIUA 2H2SD 1DQML 3HE6C 4KNSA 2CO6A 4MD5A 5FA3B 2BDNH 4HUWA 4MWFA 2CBPA 4FQJH 2FCBA 3CC1A 3E38A 1Z3RA 1T22A 1N8ZB 1SYSB 3HS0C 2YD4A 4ODVH 3AREC 1UD3A 1N6UA 1PZSA 1B2WL 2NX5B 1IFGA 1EAOA 3F58H 2BM3A 2EE9A 2X4UB 4M7ZC 3MV9B 1K5WA 2Y5TA 3MRNB 3PREA 3NCFB 1LYQA 4ELMF 2F7PA 3II1A 4PB0L 1FFRA 4JDVB 3U2SB 4LDOB 4AYDC 4JY6B 2VDKL 1AKJD 2F7QA 3EIFA 5E2UL 2V7NB 1FFNA 4Y16D 3ARBA 3B5GA 5E4EC 3VXUA 4JHBA 3LVTA 4ZFGH 3D85D 4KTDL 2I26N 1MIEH 4LEOB 5LDSA 3BN9D 4UQDA 3K80A 2QJDA 1GSKA 3PJSA 2C3VB 3VRIB 3VWJA 4AM0Q 2X05A 5J3HD 3LN5B 5HDRA 1RK1A 5HI3D 5FOBB 4NQEA 4CNIA 4KOCA 2O72A 2DY2A 3QDMA 1WA0X 2QSCL 3MOBH 4JM2F 3T3PF 3U2SA 1CGSH 3HI1A 3ZSSA 3G6JB 5K33A 3PWNA 4BA8A 3H9ZA 3MNMA 1MLBB 1NCJA 3GBMH 3OF6A 1XV8A 4Y4KC 1KIQA 2X4UA 3RJDA 3KVPA 4ZTPH 2DMGA 1KCWA 4AW4A 1UZ6F 4EQ2A 5C70A 2VDRL 5B4MD 1H0DA 5E99H 4OZGB 3ZDYB 1CDYA 3TBVA 3MNDA 4MD4A 3AUWB 1HCVA 3CMGA 2D0HA 1GTNA 2WUBL 1RURL 5JNYA 1LK2A 3OSVA 4AQ8A 4HCIA 4HWBL 2VDNB 2X4QB 4S1SH 4AE0A 4K7PH 1CMOA 4WHCA 1A7OL 1IM3D 3ZQ9A 4F91B 2VUKA 1BFTA 4NHUB 1L7IL 4L3CA 1AKPA 1SJEA 1LNUB 3IJ7A 4ABQA 3PP4L 1OGAA 3HAEG 3ZTJH 1NGQL 3QUZD 1OB1A 2XG4A 5C0FA 2IXQB 4WHTB 2Y7SA 5IFHL 1Z5LA 4IGBB 4DTGH 5JOPE 4XPAL 4C56A 2IEPA 4F24A 4KUCD 3MFFB 3QEQD 4PJEB 4YZFE 4WU7B 1CVRA 1X9QA 2IGLA 3HZ3A 4PJAA 1EHNA 4F2MA 3FUDA 5DD1H 1HHHB 2CRZA 2G0KA 2J3SA 4IKNA 4XHJD 5DRWB 4E68A 5KAQF 3POHA 5HDQL 2B16A 3L3JA 3BGFB 1U6AL 2KDGA 3V6OC 4WI8A 5HGGS 4WTWA 1KTCA 4AYEC 3VNZA 4XMKL 2LQRA 3FSWA 4AK1A 3OXRB 2APBA 1LK3H 2D2CC 3IFPB 3HZYB 3MFFA 4PJEA 2NSXA 2YA2A 4GRWE 5F0JB 4K3GA 1OCOB 2FT6A 2E76C 1TQTA 3RWGA 5DYOB 3ZPDA 1BPLB 2IXQA 1UVQB 4L8DA 4RFNC 1R9FA 3EW3B 4S0TD 5MEOA 3F7PC 2IH9A 2SEBA 2BHFA 4TUKL 2P43B 2Q2LA 2VM3A 3PAYA 4L1LA 5L0QC 2V37A 1KXVA 1Q90A 5CILH 2AGJH 3SGJA 3KWWB 4HZAA 3QIWB 2Y23A 4RAHA 5E8OA 3BO8B 4BFFA 1LILA 5C0NC 3WTYA 2QL1A 1CFTB 1WT5C 4HALA 5TH2A 4LRIA 3BFOA 5E94A 3WIHL 3RZWA 1FYTE 4ZXBB 3KLAB 1A4JA 1XGYL 3WNJA 5IF0A 4FULA 4L3AA 3MRCB 3QCTL 3KGSA 3RL1B 2R2EA 4XNZB 4NC2B 4YHZH 3QWRA 3VFPB 3L4UA 3VFWA 1TYJA 4PJCA 1T0MA 5C0RH 3DO7B 2DWDA 2DD8H 3AY4A 2V5MA 3LDBC 3COOA 1XBDA 2IPTH 3IGFA 3U0TB 2D0GA 32C2A 5FCSH 5D5MF 3CLEL 2R69H 2HZHA 35C8L 1TKWB 3BVWA 3DXAB 4LSQH 1BZDA 1QSEE 4E9SA 1K8IB 5GGRY 1IO4C 3N6YA 2HT2C 4GXFA 5CGYD 5JIKA 3TTYA 1KG0B 4FNUA 4K8RH 1DDTA 3IGUA 1IE4A 4A66A 4JM0A 4ZI8A 5EBMB 4TSBH 5IMLB 3FPYA 3DV6A 3IJHA 5L2JB 4IRSB 3KPSB 1LL1A 4HKJA 4MA7H 5ES4B 2FNBA 1S7RA 3UDWA 1GY2A 1BFVL 1OAZH 3CFCL 2AI0H 2IANB 2IOMA 4HWZA 4WY7L 4JKWA 3LIZH 3MLWL 5HGAA 3GMLB 1W72L 2VAAA 5F71A 1ZLUH 2BOBA 3I6LE 1SYVB 1RZJL 3UMTA 2WUBH 5DMGD 2NTFA 3I02A 4HAFA 3K2UH 3II2A 2APSA 2J8HA 4YDIL 3PRZA 1CGVA 1IFHH 4FFVD 5FV2A 1MIEL 1U8LB 4HBQA 1FNGB 2FSEB 2ZOKA 4FTVE 1EZUA 1J0HA 4JKPH 4KY1H 1ROCA 5F7NC 5SWZA 5HDWA 3EJSA 2IFFH 4HOXA 3HN3A 3MJ7A 1D6EA 2HUEA 3GBML 2AJSH 4Q74A 4KNUA 5EZJA 5FYJH 4HUXB 1FN4B 2XETA 3PNWA 4JCLA 1PEWA 1WEJL 1D7FA 3W39B 1M4KA 1TTBA 3OJMB 4R0LA 5F7DA 1Z2KA 3AU1B 3DROA 2DQCH 4NGHH 3JBG7 4NN6B 4BK5A 1F42A 3MGTA 1WD9A 2OX5A 4Z5RA 3CPUA 5DZ9A 2G2PA 2MHAA 5CU5A 3GQFA 4Q4IA 5F9OL 4X6CA 2P5WD 2Y0SA 3DX7A 1KACB 1P5UC 1A3QA 1II4E 4ZPTB 5FGCB 2BSTA 4JY5H 3KJ6H 3X3GL 1G9ML 4N2KA 4RDQF 4JB9H 2PYFA 2FHBA 1ODAA 4HUVA 4OLZL 4AZUA 4AM0A 4WW2C 3KPLA 3BP6A 1RJZB 3BKMH 2J8UB 3RTQB 5BOJA 3WLBA 2WXKA 4HJ0D 4LSRH 2VXQL 5AKSA 3NP4A 2OMNA 3LKQA 1F6FB 4ZW5A 5I23A 3VXOB 2AEOA 1WUNT 5TK2A 1CICC 5I1IL 4AQEB 4DNLA 1THAA 3GLZA 4IRJB 3N1QC 4PRBA 4I48A 1XCWA 4JHWL 3X14A 1DVYA 3QDGD 1LO0H 1M57B 2X41A 4MD0A 4AVHA 1MFVA 2A73B 1I1FA 1T22B 1N0LB 4P57A 1A1NB 3ZHFA 4CL7A 2WTRA 3LXAA 5E5MB 2FQFA 3ARGD 1YLBB 1A66A 3SCMD 2E4FA 3SCMB 2B0SL 4YDJA 3OKMA 5FPIA 1OAYL 1BLIA 1QKZL 4U7MA 2VISA 2E7CA 1PX4A 1BAFH 4WEEA 3ARBC 4CC4C 3O41A 1GCYA 3C8HA 3BISA 3BW9A 1PJWA 4JFPB 4G6FB 1RK7A 3TXAA 4ETQA 5GGVY 2HFGH 5B39A 5GS0C 1AMYA 2H6PA 1X7SA 2F18A 4GS7C 2YGQA 4HKBB 3PJSB 1FPTL 5D71H 2PO6C 1VEPA 4OAWB 1U8JA 5EOTA 4UWQB 1C7TA 3ULAB 4DP1X 1JPFA 1V27A 2HKFH 1EK3A 4LLQB 1OARH 3RX5A 2WSPA 2VC2B 1NPUA 5HYJD 3T2PA 1NCIA 2B39A 4WO4D 3S3CB 5HYJB 5KANG 5KJRH 5T5FA 3LQZB 2XTJE 1E90A 2HP4A 4WTZA 1F4AA 4JKMA 4NQUA 1WZ1H 1KXHA 1SOKA 1PSKH 2W9DL 1PVHA 4JPIB 3FCGA 4R90L 5ILTH 3RVTC 3KLSA 4CVWA 3UEQA 2AW2A 4OI8A 5IQLA 2WD0A 4D9LH 2HLAB 1USQA 1YEDA 3K81A 4F57L 3G6DH 5CEZL 4H25A 1UATA 4Y1AD 3P2BA 3N2JA 1PJ9A 1JZGA 1SDAB 2YKLH 5GGTA 1EBPA 3DECA 1PLBA 1U8IB 4L4TE 2DQ6A 2EDLA 1SEBA 3KYOA 2GSGB 3L16A 4MJID 2TSAA 2EC9T 2WTPA 1YN6B 2H45A 4K9EH 4K9JA 4QRAA 1KLFB 3HI6L 3T0BA 5HVFB 4RISH 3KEDA 4JMNA 2P5EE 1F86A 3WUWA 4Y4HD 3NJKA 2XI9A 3MRGB 1HOEA 5I1CL 4EPSA 3ILQC 1OSPH 2F61A 2KBGA 3TO2A 3RWJB 3FTSA 1OAQH 5EBMA 4LGPB 3TWCH 3RILA 1CJYA 3ATBA 4JFXA 3ZE2F 5I0VA 2R4SL 4ELMB 1T7WA 1XGUB 2UY7A 3ULUF 3BSGA 3G5VB 2RBLA 1HH6A 4I13B 4I9WE 5E6SB 3RKDC 2W80C 3I2CH 4QKTA 4TTGA 2XPZA 2DBLL 3BUYA 2AZUA 4UNUA 3FYIB 2VKWA 1WS7A 4NRZB 5JIMA 4Y2LA 3UX9B 4UI2A 4JM4L 3MA9H 4HEPA 4XBPB 1MH5A 2H47C 5DC4B 1C16B 2JKSA 3IRPX 3MNVA 1O9VA 3G6AA 4JKLA 1SM3L 4LSVL 4QYAA 3CXDL 4U49A 5KYWB 4LSDA 3B2UC 5I30H 1VAHA 5BW7C 2R2HA 4AGLA 1T20A 1R3IL 4KTGA 3ZE0B 5E9AA 3S5ZA 2EIKB 2KI6A 3KJ6L 1XTMA 3NTCH 2HJKB 2W59A 1BVLA 4KV5F 3JV5A 4GH7B 3GHEL 2KUTA 3P4MA 2G30A 2FQGA 1GGIH 5DMGC 3K7UA 3QQXA 4OZHE 3MJ9A 1WJ3A 4AVKA 1JUFB 1AMXA 4ADGA 1WBZA 4YSUA 2OMUA 1JFHA 2VZOA 4MHHG 3WJLA 3DBXA 4U1MB 1DQDH 3LRSA 2OW6A 2AEQL 4PIBA 1HILA 2Z65C 3KJ4C 3FSVA 4HCRH 2I9TA 1IZJA 1GW0A 1Q0YH 4HOZA 2ZCKL 4I87A 5JHLL 1G94A 4FD0A 1YNTB 1QUNB 1XGQB 2F6AA 1IVLA 3NJIA 1TETH 3BQUA 5KN5A 2G2RB 3R0MA 5DC9B 3EUDA 3EYSH 1ET7A 5JOEA 1THCA 3APDA 2J1ZA 2FX7H 3AQZA 4KK9D 4TNVK 3UTZA 1AQKH 1MLCA 4BZYA 1JI1A 2Z4QA 5AYUL 2A6DB 1YC8A 4NZRH 5LNDA 2VC2H 5C97A 2VRAA 4OCLC 3NJXA 4AQAA 3S2CA 5B3JF 2YQ3A 4PJXE 3IBOA 4YNYB 5KVEH 4HHAB 1BPVA 5GGUB 1S7WB 4ZPVB 2ZJSH 1M2VB 5B22A 1SVBA 3CLWA 4PGCB 5CP7A 1F13A 2C9PA 5IB1A 5EG6C 4QRPA 4PW9A 1E5UI 1PNCA 3VRJB 5C86A 5I2IA 5DSCA 4BDVB 3ATDA 3O3AB 2H6PB 4O9HH 3VE0B 3UC0H 5I1KH 1FUNA 2VH5H 2Q86A 4ZOAA 4XO3A 3TIDB 4KQ0A 1YECL 2QVKA 3GSQB 5CJXC 5TPWH 4XCCH 3UMNA 2X09A 3R7RA 1MPAL 1WISA 3SOTA 2DD8L 4G1EB 1XF2B 5EU6E 3QNYA 5DUPL 1G7LA 2ATKA 4HV8A 3ZL4H 4AG4H 3NK3A 3CN1A 4GKSB 2YPLD 1F58L 3FU3A 2IIJA 3JWOH 5F8QC 5KOVC 4EN3A 4P2QB 1AR1B 4K7FA 1JRHL 1Z6JT 5SWZB 1UENA 1D2PA 4UV7L 1T2JA 1UD4A 3E2HC 3IDNA 1MCPH 3CFUA 3ARVA 3L2LA 1BJ1J 4ODXB 3SE3A 4ZAKB 1EXHA 1YPZF 2LFEA 4JO8A 4Y2OA 3AQDA 4J3TA 4H8PA 4JG1H 5KSBF 1IRAY 1KGXA 4A7UA 1ECYA 2DMHA 2EDNA 4W9DC 4AL8L 1A7PL 2B5IB 2QGCA 1P4BL 4N0UB 4YVNA 4NCC2 4TTDC 2WYIA 1NCTA 4B6ZA 4NN5B 1AXTH 4K5OA 1ZLEA 2P7TB 5AVSB 4ZAKA 2WWOA 4PJIF 2NZ1A 3CX2A 3F3HA 4HJUA 1JZ7A 5GSVB 3B1TA 1IAKB 1NCHA 4WK4B 3G5XB 1K2DB 5E2TL 5D1QB 3FC8A 5IW1A 1RXLA 3GEWB 2OR7A 1LK3L 3CDCA 3RVTD 2I7OA 2R1WA 3VXRB 3Q06A 5KEZA 1BYNA 2FR4B 1T1YA 4LEEA 1AVAA 2J6WA 1YQ2A 1ECZA 3QUYA 3ZW3A 3KHQA 5I5JA 4XI5D 1BM7A 5ABDE 2H0FA 3FK3A 3TIDA 4EIBA 2Q8AL 3PL6A 2XPGB 4HG4K 3VWKC 2ITFA 1A21A 5LNEA 1TSRA 5KG9A 4DESA 2YGNA 4NN7B 2GY7B 3RA7H 5T1MA 1IEHA 3MTRA 4U4BA 5CM1A 2HJFB 2OXHA 4Y4HC 2K45A 1UGKA 2VLKA 1OY3B 3SDCA 4YC2B 4F9PC 5DD5L 3TJPA 3PGCA 2AXGB 5ENWB 1MI5B 5FO2A 2MCPH 1QMUA 5D7KD 1W9XA 5E2WL 4PR5B 1OSEA 2UZXB 1BAGA 1UB5A 3MV8D 3P73A 4F8OA 3PL6B 2VLJD 2ZCLH 3LD8C 2WGXA 1J9CT 4N0FA 4XCEB 3QHFL 1SNRA 2AJZB 5E1HB 4PRIA 1O6SB 3UERA 5TDNB 3LZPA 1AGBA 5AYQA 1Z9NA 3HMXL 3MLYL 3MRQB 1I3RA 4GRLA 2HPOA 2O26U 1XH3A 2VSKB 4JZJA 4XHJC 1G7HA 1BIIA 1RLBA 2AQNA 5F88B 3TVMD 2Q10A 4G7QB 3CHPA 1X5JA 1L0XA 4WVRA 5ANME 5F1OB 3G6JE 2JMRA 1CUOA 2ZICA 2FBOJ 3JZYA 1O7SA 4ELME 5C0BB 3GXTA 3R19A 1NBQA 4R2GD 2HUHA 4ESKA 5ICXB 1KCVL 3HPLA 4PBVC 3VXSB 1KJ3L 4BH7A 2FB4L 3ABKB 3SE8H 4P9HC 4KRLB 1QLEL 3VXSD 4NKMB 2RFXA 2GG1A 4I1PA 2ZYRA 3TEZA 4LSUH 4R8WL 4JREB 4FQ2H 3KD4A 5IGXL 5L2KB 2BW5A 5AYTA 4AYGA 3BP7A 2DI8A 1UM4L 5IKCB 3GMNA 3REVA 1A2YA 3HCVA 5HTSA 2HX7A 3LZQA 2J1WA 1HXMA 2BS71 4GAYB 2HSIA 4G1MA 5IOPB 1AXSA 1DVTA 1UZ8A 3MOQA 3PF2A 5D6CB 4IGBC 1HDMB 4EUPA 2AV1A 4KUZH 3ZL2A 1JBJA 1KB9J 4DTGL 3QULA 2MRYA 3QCUH 1GKOA 4AMKH 3MBXL 4QHMB 3MBEC 4CMHB 2ITDA 1NOLA 2FO4B 3FF8A 5C0BA 1MCDA 1IAIM 4UQ2A 3RGHA 3U6XA 4HS6B 1BZ7B 2IBZY 1A7OH 3FFCA 4JFFA 4N6QA 4WHDA 3BWUF 2IO5A 3SPCA 4YO0A 5LWYH 1NCGA 5JO5B 3QEUA 3OMNB 1ZTXE 1P0SE 3PS6A 1YYML 3NRPA 2CDEB 4RNRB 3NDZE 4XMVA 3ZE1E 4CN1A 4KJWD 2CLVA 4GAJL 4N9GB 3CBJB 3CH1A 2VLMD 2E7DA 2V9QA 5K9OB 3BJLA 2A9AA 4HIQA 6PAZA 1HN1A 1TZOA 4ZQKA 1X4ZA 4PMFA 4BJLA 2XYBA 2MTPA 4NNXA 4WHYG 3QDHA 4QJ5B 4F5CE 3AQYA 4IKIA 4IOIA 3RWEB 1BOYA 5KVGE 2PN5A 4JFYB 2VAJA 2F5BH 2ARJA 3LKRA 1CZ8L 3NCYS 5E8DH 4HIXL 4CAGA 5ADOL 3DHJA 3NBNA 5E6ZA 2NXZD 5DTFB 3CBRA 1MCFA 4MVBD 2YPLA 1JGEB 1WBXA 4NNPH 5C6PB 4DVRH 4OZGA 2VLLB 4PJDA 1BVZA 3ALWA 3NP3A 1KFAH 1KN2L 3HZMA 4FKHA 4PG2C 5DJ6B 1MAML 5DFVD 2J88L 3BRFA 4Z7VB 3D39E 3MGOA 3V8OA 3MRLA 1A7QH 3HLAB 5IWLA 4KHTL 4NO3A 1RZJH 2X89D 1KPVA 3O6FB 2JK5B 4FHBD 3Q1SH 2JB5L 4N2LA 2GTZB 2NQCA 4ZFOB 4NUJA 4ZNCD 2APVA 3PABB 1G0YR 3QJSB 4WFFE 4MMYA 1SBBA 3L3DB 2GSIA 1G9NH 4V33A 2GK0B 2FX8H 2MQ3A 2Z4QB 5T5FH 1Y7VA 1CGTA 3V0GA 4FJYA 4F7CB 1UC6A 2YMOA 3E6HA 1FHGA 2OSLA 4LNRA 2EYSA 2Z6FA 4WI6A 5EH1A 3BZDA 1XIWB 3VI4F 4WI2A 1B6DA 3WY1A 4X0KB 3IETA 1BVOA 2TAAA 1NAKH 2J21A 3RUGF 3HMXH 3MLYH 2X4RA 4KI5F 1DO6A 1ZA3A 4KI1A 3II3A 3L5JA 3IDJA 3DIFA 3R8QA 3RWHA 1T83C 4TLTA 3UYRH 2XN9D 4JRXA 2Q86B 4AJWA 3FU8A 4PLOB 1TNNA 3DMMB 4XP5H 4PS7A 4QRQA 4QR7A 4DGUA 2XVKA 2XRAH 2DM2A 3IM1A 2J8UE 4M6AA 3FTGA 3BIKB 3HBZA 4IM8A 3TO2B 3EGXA 4WO0A 4XE5B 1CGXA 1ODUA 3VDCA 2Y7MA 5I15H 1XXDC 4MFHA 1CD1A 2HKAA 3PQYE 2R0KL 3F2LA 1N5YH 4ETYA 1FWXA 4K7FB 4H88L 1T04A 5D1ZD 4XODA 5AAPA 3I50H 1ZTXL 1CF1A 3TFKC 1CL7I 1KLUA 3PDGA 3RHWK 4N2OA 1A9VA 1NAMA 2GJ6A 2J4WH 1N3NA 3BUDA 3HG4A 3PLYA 1U95A 3DJRA 1OE1A 3EGDA 3VXMB 4X4ZA 5HHOA 4H2AA 1AC0A 3FQUA 5DQ9B 3B2DC 5J1AB 3VA2C 1PD0A 5BZXA 2QVMA 3QIBD 1INQA 4KKAD 4YL4A 1C8QA 2VMCA 1AGDA 3D3VD 4AH2A 4Z6AT 4X8JB 1KNOA 3QG7L 4XN8A 1MRFL 4BM7A 4Q9QL 4FI7A 5A43C 3GTTA 5ESQB 3FH8A 1Z0MA 4Z0XB 2P5EA 3RWFB 4Z7WF 1A3RH 1MKFA 4ZZKA 1Y6MR 3ELQA 4N3TA 5E7BA 5HYIA 1JZ8A 1FAKT 5D1ZA 4F8NA 3H3BC 2AVFA 3QI9B 2I07B 1AD0B 1SQ2N 3LKNB 1KJMA 4JKNA 4LARH 2QPUA 3WN5C 3JVGA 3QZOA 5L7XH 2CRMA 4JG1L 2ZOLA 2Y7QA 4XWOC 2L7EA 2VSDA 1K5NB 3ECWA 1GSMA 5DLML 5HHOD 1RPQA 1J0YA 4PGBA 4B9JA 1Z9LA 3WIFA 3JV0A 2ADGB 1SXCA 4JMXA 2JI1A 2P8PA 3FQTA 1XCTB 3GSVA 4XVUD 1L6XA 4XX1E 3FCTB 3BZFA 5G2NA 4AUYA 4G5ZH 3EOAA 1AD0A 3IDGA 4MAUL 3WNMA 2YWZA 3BN3B 3SDCB 4PRNB 2JE8A 4ONHB 2RALA 3BUYB 2BVOB 4YNYA 3HZVB 1NUNB 3RWFA 1KLUB 3MLTA 2ZP0T 1SLWA 5FA4B 2XZAH 3F7VA 1T0PB 4O02L 3MRJB 4PU2A 4DKFL 2DS4A 1FO0A 2ZUTA 3U7AA 4AEIH 3UC0L 1C5CL 4YDZA 3J2PA 1KV7A 4OBRA 3EYSL 1HQRB 3RVWC 1ERNA 3ISWA 4NYLB 4X80L 1XSOA 4AGMA 3AWFA 3OX8B 1P4BH 3IFNH 2ZUWA 2GT9A 2G75A 2YSTA 4ZTPL 5IJBC 4FXKB 5DK2A 3LH2L 4ONGL 1HI6A 4OJEH 4CNIB 2OQJA 4DEUA 2DWYA 3X1BA 4BFKA 2ZXWB 4HISA 4GB9A 3MLTB 4JEGB 1JYVA 3ME0A 3VTAA 4Z3FA 3U0WL 1AZNA 3KPOA 3L4ZA 1KJVA 1RI8A 4OF0A 2N7BA 3TNNB 5J12B 2PPAA 5FDWA 2VLKE 4Z5RB 1ASQA 5IB2B 4ZO9A 3O6LH 1NDGA 2CD0A 4M7JH 2XV0A 3HHRB 4CJ1A 1EO8L 4HFWB 4O02B 5ABZA 4HSAC 1EMTH 5DD0L 4LBEB 4PH8A 1CFBA 2H2PD 4AM0B 5DEGA 4XCCL 1GR7A 1Q1JL 4GQRA 4RCAA 3QIUD 2VLME 3HBPA 3OPZL 4ZW3A 3QUMH 2EAEA 4G6MH 4JFDD 3B8YA 1ZA3B 3EBGA 1R3JA 2HT4C 2NX5E 3QJOA 4UTBH 1JPFB 3VD7A 2CIKB 1TCRA 2FHFA 2XZCH 3IDNB 4XP9L 5CN3A 3BSZH 4A04A 4U1HA 5TF1H 2N0KA 3D0LA 3G5ZB 1IGYB 1Q0EA 4APXB 2P8LB 1IGCL 2PWHA 3HR5B 3E8UH 4ERSL 3KNBB 2WW8A 3N42B 4NNYA 4WNQB 1N19A 3HJEA 4HGMA 3SPJA 1MCWM 1QZ1A 2IOIA 4NQDD 1IGTA 1ZIBA 3RU8H 3LTVA 4CKVX 1AZRA 1DN0A 1R6VA 3VFMB 1KIUB 2C3GA 3QDME 4H0IA 1RK0B 1T6WA 2IWFA 3B2VL 4C56B 1WA2X 3TA3A 4OIFA 5FW7A 2HXAA 4ZNEE 5A7EA 5FUOH 1IC5H 4XAWH 1TFHA 2AAVA 2YUZA 3OKLB 1BOGB 2VQTA 2N3JA 5DHVH 2YOAA 1SHWA 2V5TA 1A7RH 3LOWA 3GJFA 1YYLH 3UABA 3A6CH 3UTSD 4P2RA 5CZVL 1NJ9A 4Y4HA 1OV8A 1J5CA 3G6DL 5CEZH 4F57H 1UD8A 4WEUD 5FX3A 3SY0A 1TCMA 1INDL 2ZSWA 3CZFA 1UCBH 3C5ZC 3NT0A 3PHAA 1I1AB 5CZVH 2XN9A 4OD3H 5MENB 3ARQA 4PV8B 5F89A 1T6VN 1P7QD 3V4PB 3CPLA 2Y6SD 1RUMH 2DBJA 1QSFA 3DV4B 1IQWL 3F12B 4IRZL 3BWSA 5D4JA 4TM9A 3TNMB 4MQXD 5E95B 4GIPD 2GITB 1CL7L 3EOBB 3ZT5A 3ES6B 5ADPL 3GHBH 3HKFA 4MDIB 5CJBA 4Y2DB 5HI4C 5D93B 2ZYIA 3VAEA 4BQ8A 1VFAB 4ODBD 2VITA 2PTTB 4L05A 4TVPE 3V4VA 5I30L 5KYYB 3MUGA 4L37B 5BZDA 2P26A 1KEGH 1ZPUA 4U6TA 4O2EA 3QISA 3KBPA 5B1JC 1AO7E 1JGUH 3WNKA 4QT5B 4JFSA 4YBHA 1FYHB 1HYSC 3ARXA 1G5GA 5G4OA 3SGEH 1DYZA 2VZTA 2WNXA 3GJEB 3N91A 2NLJB 3EO9L 3P9LA 3L1GA 1L0YA 1KFGA 1G7IA 3VD3A 5LGJA 2WVSA 2Y06H 1VCBC 4AV0A 4FQCL 4JY6A 4GKZB 4HMEA 3BAIA 3ALPA 4FFYA 3FFOA 4HETA 5ICUA 2WIIB 3UCQA 3X3FH 1WZKA 1CXIA 4J3WA 5FYLL 4E9LA 4CMMA 1X5AA 3L6FA 4M29A 4UQBA 1DQQA 1ZEAH 3P77B 1Z3GH 2O6CA 4P46A 3NZHL 2N7AA 1FO0B 4OH2A 2GTWA 3AU1A 2ZUQB 3DROB 4MCYB 5K39B 3CK0H 2NY6C 3RKDD 3SZKC 3GMNB 1NPJA 1CD9B 4NC1E 3IK2A 4JHWH 5FYKD 3F6JA 12E8H 5GXBB 3O6LL 2D3VA 4MZ2A 3D3VE 5D6CA 2F8IA 1RIHL 2CM5A 2FLMA 2PO6A 1EDHA 3UTPD 3EH5B 4LSRL 4H7VA 2XZQL 3GSUA 3SGKC 4PJFF 3AACA 2WQ8A 1LEKA 1CD1B 2W0LA 4D9LL 2OK0H 4HCGA 4EI5D 3WXVH 4NERA 4XCEA 1W2KT 1JPTH 2HKHL 2NXYC 2ZOKB 4EI5B 1DBAH 3CFBA 3BEWA 4V1DD 4N0RA 4LKXB 1SBSL 4A7SA 1VB9A 1I1AC 3SKNB 1AKJA 5B38G 2X4OB 1MF2L 4ZO6A 1BD2E 1PL3A 1G7HB 3HZVA 4Y16A 1WC7B 1S9WA 1E4XL 1WWWX 2YAHA 4G8GE 5IHWA 1BQRA 2ZWKA 4PJGF 1S7VA 1C9SA 1X7TA 4XP9H 1QLEB 4Y9FA 3MODL 1IM3B 3DC0A 3O4LA 1WDAA 5F96L 5I8CA 2VMJA 1OOWA 4A55A 1KGCD 2C34A 4HOMA 5ICYB 2HRLA 4F8TA 4R7DA 3C12A 3AS3A 4X8JA 3FB8B 3OKDA 2ZAHA 4I0PC 5EZJB 1CICA 1KXTA 1XEDA 1I8AA 4FMKA 3NFPA 1ZVHA 3IAPA 1K4CB 3PQYA 4WI0A 1FVCB 4JN2B 4BH8B 5H35A 1DFBH 2J6EH 3US0A 2R2BA 5F1SA 4I3GA 2FSEA 3BUQA 3KCWA 3EYOA 4MD4B 1ZLWH 2CGYA 4K23L 5LN8A 5ICYA 1OLLA 3BH9A 1W8OA 3KYAA 2AITA 1AGEA 5FCUL 1KB5A 4JM2C 3C5ZB 3C5XA 3MUJA 5ISZA 4MA7L 3K6NA 2W38A 3QXWA 4UILL 3VWKB 3HB3D 4UQIM 3MRKA 5DS8B 1JNHA 1F11B 2BNRE 3HRZB 5JZ7C 3IFNL 1IU1A 3ECBA 3KVQA 4Q9QH 1OGAD 1L9MA 5H37G 4J6RH 4P23A 3D50A 4NUGH 5CGTA 1P53A 3FQ2A 1CDUA 2IV8A 4XPFL 5KAQG 3UG3A 2VUYA 4OZ4A 1CFQB 4KZ0A 2XUWA 3TN0B 4JHAL 3G7TA 4TUOA 5D9SB 3V4VH 5CFAA 1UD5A 5EV7A 1QFWH 1FYTA 4JJ5A 2N0MA 1N0LA 2CHWA 3GSNL 4P57B 4JS7A 1ZAGA 1V7NH 4FGMA 2CJUH 5GGSA 4MB4A 4PJ6A 1JNJA 2R2BB 3WAJA 4K3DH 5GRJL 3ZKMC 4N9GA 4I0PB 5DJCA 3FHEA 4ZOBA 2VDML 2ALWA 1H3TA 4PJCE 1I1YB 3VXOA 1QRNA 3TBVB 5CLZA 3B9KA 4Z0BH 5MEOB 3GXFA 1IKOP 1AIZA 1K4DA 5CZXD 5TQ0H 1MIML 3WIHA 1DEEA 1X6NA 2MH4A 2XTJB 4LF3B 4B60A 1N5YL 2X1PA 2CQVA 2BY1A 3LV3A 5CEYB 4UT6A 4R84A 2OMBA 4Q52A 4FYTA 2BVQB 4XC3H 4ZS7H 3ROLA 4YDMA 4KKRA 4U6YB 2O61B 1RUQL 2O30A 5FCUH 3G08B 4ZMTA 3NK4A 1KV3A 1XHHA 3HC0A 2BXYA 3QUHA 4JKPL 4RFOH 4RMTA 5MEQB 5AOKA 4OSUH 5HHME 3LN5A 1HC1A 2E86A 1ZV5A 1E2ZA 5B21A 5EOQL 3FZUD 2OCJA 2R0LL 4FERA 4UBDD 3QORD 3N43B 3HIZA 4W4OC 4I5BA 1PIFA 3JUZA 4L3EE 3LIZL 3MLWH 5DMYA 2AI0L 4WY7H 2EIZB 1HT6A 1ZJAA 3U0PA 3U1QA 4MZIA 1I3RB 3UTSE 5BV7C 1MY7A 1FG9C 4JE4B 1E9OA 3GDBA 3KPSD 2YD6A 2WLKA 3MRIA 4LCUB 1D5BB 2IDUA 5LCVH 3WEOA 1NDMB 3ASOB 1DJIA 5A7BA 1S9XB 1YMHA 1PZ5A 2D0FA 2WLLB 9CGTA 3IJSB 4DEPC 1WG3A 1ZLSH 4JZNA 2EEDA 4I9XA 1U8LA 3O45A 2F58L 1TU2A 3SQBA 3D48R 3TPUB 4KU1A 1K85A 1E8YA 5L4FA 3EF4A 3U4EB 3N1MC 5D7EA 5GRYA 3FRPG 3NRFA 3WNPA 3V95A 3B1UA 4U3SB 2RJMA 5AALA 4OAWA 1SHMA 4B9GA 1U42A 2M8XA 1I7UB 1G6RH 4XO5A 4YK4B 2OAAA 1LEIA 4GLRI 4WWKB 3TH2T 4AIEA 1GL4B 4HFUH 5FGBA 4AZ8A 1F5WA 5C9JA 3N04A 4LCIL 1UJ3A 2K7PA 1GH7A 4UNIA 1PFOA 5IR1B 3QS3A 43CAB 3T0VA 2WBJC 5FO7A 5ETUA 4S2SB 1N5AB 5J6GA 4PP1D 5DJ8B 3FO0L 3O4LB 2CM6A 2K4AA 4JPVL 4OZHB 12E8L 4XXDB 4NO0D 2X42A 2EDEA 1C1EL 3FCSA 4IHBA 3VX0A 3O2DA 1AYRA 1CFMA 1PZCA 2E6QA 2GYSA 3NACL 4M7LL 5E99L 1AOZA 2ZX8A 3UBFA 4F93B 3QXUA 2ZIDA 2K3HA 4M43H 3CFQA 4LGSB 3EJJX 1S46A 2VZUA 1QG3A 1XL6A 2ZF8A 2PO6D 1A1MA 1VEOA 2VIRA 5FB8A 5DEZA 3RBGA 1J5IA 5LQBL 1LMIA 2A7BA 3O9WA 4NSKA 4PJ8D 2HVJA 2YPVL 2V3EA 3ZBMA 6CGTA 2E6JA 4F7PB 3NA9L 2JI3A 4NQXB 3DTUB 5C0EA 4N25A 3T8MA 3TF7C 1TUPA 5I1AA 2PCFA 4TRPH 5DQJB 1KTLB 1R0AL 2CO6B 5FA3A 1EERB 2PWEA 2DIEA 1MH5B 3Q6FB 2UWEE 4GQ9H 2JJSC 5E6RB 3F7VB 4Q9BA 4APQA 1HCFX 2NZ9C 3GNMH 1NUFA 4Z3EA 3WFZA 2PTVA 4AQZA 5DR5L 5C3IA 4WKZB 5DD1L 1DVUA 2G3MA 3P3TA 4H5SB 3WJJC 2XY1A 4XPGL 4LOVA 5BW7A 2F54D 2PPFA 2R23A 5JIDA 5EUKA 5I73B 5GS1A 1A9BA 2BSSB 5EO1B 1YQVL 3EYFA 1T7YA 2FX9L 3TZVB 5DDHB 3ME0B 4BFRA 2ODIA 3GB7B 5HPMB 3GJFH 2P1YA 3BQVA 1S8DB 1GC1H 4PRHE 4IYKA 4IMLA 4GT7A 3GI8H 1INDH 4KKCC 5AEAA 5HYSA 1UXMA 4K7PL 1NFKA 5ITFA 4FNSA 2OSXA 2OMUB 4WZ9A 1ADQA 1RSFA 2GC4C 4U1KB 5LQBH 1SJMA 3JV6A 4FHJA 1ICTA 4DCQA 1R75A 4QRPE 4I8DA 3KXFE 4X6DE 1JWUB 1WFMA 4M43L 3GKZA 4PJ9D 3ARTA 3O4OB 5F6HI 3UZVB 4BWWA 1A4AA 4DKAA 3RVXD 1OCWL 1ZS8A 2HFEB 1BJ8A 3DI2B 4PGDB 3GSQA 5FHAL 1S7RB 3D4YA 5IG7B 3ISRA 3IPFA 2LOEA 1T0NA 4D0CB 5LLIC 4GEIA 4J3OG 4XOCA 1EJ8A 3S97C 2PPEA 2WAQA 3QPXL 4PWGA 5DHEA 4OBSA 5JW4M 3OAUH 2R29H 5T8IA 4U1KA 1Q9OB 3M1BA 2X4QA 3P4NA 3QUMA 3HAEH 1OL0A 4M9OA 5ELIA 3O2DH 3PWUA 3ABMB 3NIDF 3RL2B 3IDJB 4PLNC 4GW5A 2BNRD 3QC6X 3IMSA 5E2WH 4PTUB 4QXTB 5EMYA 2BRQA 4HCRA 4P4RB 5E4IA 1WFJA 3S34H 3ILPB 3B5HA 3LKOA 3NIDB 4HXBH 4KUCF 4EIGB 3O6ML 4A1RA 4A38A 4YK4C 1EEZB 3QFDA 5IEKB 2G4EA 4Y0GA 4Z3TA 4P2CG 1G1OA 2YD7A 2VLJA 4G6FD 3KJ4B 1BG9A 2I7SA 5DHYA 1T03L 4PRID 5C7XL 4EVNB 4UQ9A 4KQ4H 4KXDA 1BSIA 3VXRA 3DHMA 2JCCA 4LAQH 1PD6A 5E9NA 5LCVL 4PUBL 4FQXB 4X98B 5LKNA 1RULH 2AJXL 1FFQA 4Z7UF 2W5PA 1IAKA 4YLBA 2X2JA 5IK3B 2NUTB 1X9RA 3QIWA 4DQOH 3DYMA 2LAAA 1YYCA 3M6DA 1T5XA 4OLXH 2WLJA 2BW4A 3DVGA 5KS9A 5TK4A 1ZPLA 4N8PA 3BRGC 1NGPH 1BGXH 1MEXH 2CZNA 4PRAA 4KKLD 5EOQH 2NW3B 3A4AA 4M1DH 4P2QE 3GS4A 1A6ZB 3V5KA 5IM7B 4BFIB 4G83A 4HJ0C 4Z8FH 2NYZA 4FNLH 2GBTA 3QHFH 2Z92B 5TGBA 3FQRB 3Q44A 1J48A 1XF5A 3L4VA 3V7MA 4Y1SA 3G5YA 4J3OC 5CIPH 1INEL 4JFXB 1C5CH 1J8SA 2RAMA 1PQZB 1QHQA 2PR4H 3VFSB 3OXSB 2BSRA 4XC3L 2G5BB 1U8NA 5DUBB 3SKOB 3EO1B 4X9HA 3DSNB 4WWOA 4MJIB 5A6MA 1QNZL