3AU0A

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
339
structure length
339
Chain Sequence
PVVNVADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 85
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A02
4MBRA 4F27A 2Y7MA 4FJ6A 2F68X 2Z1PA 4BBWA 1N67A 4MBOA 5CF3A 4LE8A 4LEBA 2YLHA 2Y7OA 3IS0X 3AT0A 1R17A 4JDZB 5IHWA 3IS1X 1R19A 3AU0A 3ASWA 2RALA 4F20A 4RMBA 2Y7LA 4LEEA 2Y7NA 3IRPX 4B5ZA 2F6AA 4F1ZA 4F24A 2VR3A 3IRZA 4JDZA 4JE0A 3V10A 5CFAA 4Q6KA 4B60A
chains in the Genus database with same CATH superfamily
1F18A 4AE0A 2IALB 1J9SA 3UIZA 4UMGA 4JCWA 3W0WA 5D7KE 3LRMA 1IC5H 5J5EA 2NY6B 3DOSB 2IPTH 1QD0A 1P1VA 1YCSA 4MASA 4Y2DA 1QPKA 5CEXB 1UQSB 3ZO0A 3X1FA 3HKZA 2ID5A 4TULL 3VGGA 5I73B 4BHUI 2YLKA 4XR8C 1CDUA 1FIGH 1A21A 5SWZD 4KRPB 5K9JH 4ESKA 2AFNA 4PRBA 1ETJA 1MQ8A 2VXUL 1HKFA 1UH2A 4MQSB 3A22A 1NTDA 3ESNA 4P2OC 4DHLA 3TN0C 1E7VA 2A1WL 3W3BA 2EXSA 1W6WA 2LFEA 4I4WA 4RRPM 4AYEC 4I0PA 2ZOUA 3CX2A 1ACZA 4F57L 4OJYA 4L23A 3MRJB 5E00B 5JO5A 2NYYC 2Z7UA 3BEVB 1CB4A 5D6DC 3BRGC 3KM2A 4PV9A 1UYWH 1LK2A 3S8WA 2B16A 1E90A 4PJ9A 4PYGA 2ZXCA 4V1DE 4TLTA 2I69A 5MENE 4PBVC 3CFMA 2APSA 2ARJA 3UYOD 4R6UA 4LARL 4PIRF 5FO8A 2F7OA 3PJSA 1GA2A 4ZX4A 2PWFA 3NIFF 4MX7B 4A7QA 2VR4A 1AZBA 3LQAL 1XTLA 4GSDL 4JDZB 4L2LA 3ECWA 3BEWA 1XD1A 1N6VA 1OAZH 4UTBL 4P59L 3OLEA 4KROD 2GY7B 4PJGB 4Y2OB 5K9KB 1J8HE 4P2RB 3ZYOA 5DD0H 3VFRA 5I1AB 3ABLB 1QPXA 2IF7A 1MAJA 3QDME 2Z4QA 2YXWA 3V8OA 4GP4B 4UQ3B 4XX1E 5MENA 3WFBL 5K59F 2M1KA 2XV2A 4X9HA 3X3GL 2IOIA 4YDVA 2ZOOA 1MDTA 4XCCH 2YRLA 2RIKA 5IVXB 4Y4FA 2AEPH 4MQXD 5TH2A 3D06A 4AL8C 1CURA 3GXUB 4YH6A 3TV3L 3QIUB 2I9LB 2VMDA 4AUUA 2A6KA 4ZW5A 1I9EA 1Z9NA 3VA6A 5JDJA 4YK4B 2EDLA 4L37B 3ZUNC 2P24A 1J8HA 1ZPUA 4UTAA 5DJAA 3CDCA 4S1RH 4JFEE 1E2WA 4WV1B 1IQDA 1A6VL 1BLNB 1G1CA 2VDML 1M57B 3D18A 5C0FA 4APXB 4JRXD 2GTQA 4AVIA 3DXAB 2NQDA 2E59A 2VNCA 2H9GA 3C60D 1MHCA 1ROCA 1TTGA 2HT2C 3QAZC 3LHAA 3ULAB 4NRZB 3V5HB 3OXSB 4XT1C 2P46B 5F7NC 1IE5A 2NR6A 4XOCA 3OMNB 5EO9B 3P73B 5D2LE 4HS3A 3IKCA 5EORL 1DBBL 3CSBA 2DJ4A 3OAYH 2EXWC 3C6LD 4L9LB 4Z7IA 1EZVX 3RVXD 4S1SH 4C83A 1BFVL 2FB4L 1V7ML 4KKCC 2QSQA 3K2MC 5I6MA 4W6WB 2XZQH 2XQYG 2WO2B 4UYQA 3T6QC 4GW4B 1KENL 3ELAT 3ZDZB 4ABUA 1FIEA 4PBXA 2HJFA 4F7TA 1F3RB 3NYKA 4MMXA 1NKRA 3RILA 3BT2H 2WINB 3IT8D 3RTQB 2ZZUT 4AH2B 5IROA 2E9WA 3QIWB 4PTUB 3OMZA 5D2LA 1VFAB 1HHKA 3IXTA 1IEAA 5TPWL 4MFHA 4X42A 4NQSB 2MPAL 2YQGA 4OUOA 3GSXA 2KKQA 4ZYKB 3BW9B 3L6FA 4UANA 1UWFA 2D2CC 2EUVA 1UXMA 3BQUD 2GK0A 3MYJA 5C0BE 4CNIA 1U8LB 3BGFB 1WFTA 4HS8L 3MLPA 5FAAA 4F92B 3FULA 4LCWE 3FCBA 4BCYA 1TQBC 2Z8VC 5TE7H 1UFUA 3FBQA 3PABA 5HDOA 1I1RA 4RAVB 1NCBH 3W82A 3IVKB 2F8VA 3QG6B 4YO0B 1RHFA 1YYLL 3VD3A 1PY9A 1I53A 3UAJD 3UBXA 1S9XB 1MY5A 5D1ZA 5LN4A 3WUWA 1NGWB 4LAJH 4QNPF 4YHIA 1BXUA 4FZ8H 1EUUA 4IIQA 1E3XA 1JGVH 4AUJA 2ZUXA 3RKPA 2ZX6A 4XWOD 1HCZA 1W6LA 4WTWA 4QHMA 3TWYA 5B3NA 2DWXA 4P5TB 1NDMB 1ZRUA 1C8PA 4YXKL 1DN0B 5E1IA 1AGFA 5C2UB 5BNXD 5JDSA 4HLZG 2R1YB 1CE6A 2IXQA 2WLIB 3VXUD 4LCWA 4KK6C 2HJLB 4J3OH 3QORA 2AJYH 2MEJB 3B34A 4GAYA 4AGNA 2EDKA 3ZL4H 1T22B 4JO3L 4A2DA 2XXFA 4ZG1A 3LH2L 2CHZA 3GSUA 4WQOA 2CGRL 3G6DL 4NWTH 3ULSB 2HRPH 2Z3FA 1W80A 2YD5A 3MRRB 4GOSA 3P2TA 2VE6B 3RAJL 5KYWA 3LPFA 1WEJH 4Q0XL 1FHNA 1RZFL 1ES0B 2FWOA 3PWVA 5IQNA 1IT9L 2B0SH 2BRRH 4QYAA 1CLYH 3CN2A 1IBHA 5HXMA 1MRDL 4L3AA 4Y4KA 1TR7A 3PP3K 3O3BA 1UB5B 2TRHA 3J8F7 2YMTA 3H4FA 3QJUB 1A9EB 4WHYG 3A6CH 1MCJA 4MDRA 3IDMA 2FX8H 4OZIF 2QVIA 4JY6A 4W6YB 1HEZA 4OBSA 5LHDA 3HE7B 1T7VA 4TV3A 3MCKB 1S4IA 4XTRC 2P5PA 4NLHA 1MFUA 4WWNA 3QUKB 1WZKA 3DTXA 5DVLA 3D39D 2I60L 1OTUC 1O9WA 3OG6B 2DDQH 1UGKA 1WE5A 2P43B 2P3YA 2Y1AA 4G6AD 4JPKH 4N2AA 1OT1A 4FQ2L 1ONQB 3GTVA 3Q9QA 4IQHA 5PAZA 2YJLA 4AL8L 3N85H 3MRPB 3MV8D 5AZEL 2E7CA 2F19H 4AQEA 3O6KL 4X5PA 3PJLA 2G60H 2PWDA 4OF6A 1YMMD 3ES6A 3ARZA 3IDGA 1M7IA 1QHPA 2VDKB 4M6MH 5IHUH 5IV2B 1CIUA 5D7SH 4EEEA 1J11A 4WWKD 1VFUA 5K1VA 3F7PC 2FHCA 4U6XA 3KPNB 2JQZA 4G1EA 5I6PA 1QSED 4PJFB 3SDDD 1JE6A 4Z0XB 3V5DA 3VI3F 3DOIA 3EGDA 4HJJH 4YZFE 2JIXB 4KUCD 3L3HA 4U1MB 5IKCA 3QRGH 4MXVF 3MJWA 4KKAC 3MSPA 3Q5OA 4GW1B 1T4WA 1X4XA 1MHEA 1GZPA 1X7TA 1JK8A 3BRDA 1RUPH 2KMWA 3QI9A 4GSXA 4P2YA 5B4MC 4XB8A 1IVLA 3SODB 5B3SB 3EADA 4OJDH 5IJKA 4O9HH 3CFJA 4DFHA 2HVJA 3GIZH 2VABA 3MJ8A 1ZE3C 3U0WH 2VRKA 2BX5A 3GO1H 2E3VA 2AQPA 2DM2A 5HYSG 3KS0J 3N0PB 1G7IA 1J1XH 2WUBL 5AOZA 3S9DB 3RZCB 5AVRB 5JPMC 1ORQA 5BQ7B 5IMMA 4AQZA 1QRKA 4N68A 2FIKA 3TO2A 3WFHB 3FSVA 4XB7A 2ZSWB 3CFDA 2W9LA 2AW2A 4CKVX 3F6IA 2A73A 4FA8A 4UNUA 1XMWA 3RVUD 5DJXB 3K8LA 3WD5L 3MRHB 4P57A 3IN2A 3OB0H 2G30A 3BJ91 3BXNB 5D7IF 4O2CB 3CFKA 4HUVB 3DVFA 3GUTB 2V3FA 1DQLH 4FNUA 1IZJA 4IRJA 4K73A 1XZ0A 2BWDA 1U92A 1J8RA 1H9DA 3EYOB 4EOWL 2P8PA 3FUFA 4AMXA 3STLB 3NN8A 3T2LA 4P4KA 1Q1JH 1E50A 1U8OA 4E9TA 3L5WA 2ED9A 2MMXA 3GGWB 1NANI 5E5UB 3NZ8B 3F6LA 5I8CB 2BVQB 5DJ8A 4L3FA 5JIKA 1AKJA 1DO5A 4UF7C 1G7MB 4POZD 2X4RB 5EU5A 2EIMB 3O9WC 4JO8A 4R26L 5DDHB 1MXDA 2YOCA 2EDBA 1F8TH 2OMZB 3X13B 1WPCA 3OKLB 4CMMB 1H6UA 3GPSA 3AUWB 4DNLA 1ZHBA 1U9KA 4S10A 2RH0A 5IJDC 1ADQA 1WUZA 4KV5F 4G9DA 4HQQL 5GJSH 3KPLB 5TDNA 2V2TB 1W0VA 1U8JA 2WUCH 2WIIA 3EO0A 3NACL 3IM1A 5TDOB 1UOWA 1DTUA 3OHXC 2P5EE 2YGVA 5B8CB 3INOA 4X6DA 1T1WA 3MLZH 5AKSA 1CCZA 5AD0A 2BP8A 3FCTB 1VZGA 1QW9A 5ICYB 4Z23A 3GEWB 1IC0A 1WZLA 1YDPA 4OF7A 1FNSH 5BUGA 2G2PA 1L0QA 1N3NA 3FQ4A 4QTHB 3U9PH 2VO5A 1OGAD 5C0GB 1ZGLP 4FXKC 1X6LA 2QSCL 3BHBA 1JGDA 2NYKA 3TBSB 3JVGA 4PMFA 4L5FH 3F12A 4N0FB 2P5EA 4PRID 4NPJA 4Y1AE 5M95B 4OJFL 1FL5B 5EUOF 4XMUA 1JI2A 1VFBB 1CS6A 4QXTB 4WKZB 3EGSA 2IH1A 1OW0C 4ZUVB 1O5PA 3CDGA 2VLKD 5DXWA 4FJYA 4XX1G 3QUYD 2FQGA 4DP8X 4NAQA 2HX7A 3GHBH 5DHVH 3F05A 1SJEA 4Z7QB 4LRNH 1BZ9B 2IAMD 4MKMA 5ACMA 2WXJA 1MHHB 2Q2EB 2JKNA 4G8IB 4N6RB 2CO1A 5AALA 3BUTA 5DTFA 5IJBC 3RIFF 5FM5M 1L0XA 1LJMA 2X7LB 3QZLA 4P2CG 4MAYC 5GS1A 4OGXH 5EU6E 2BSEA 1CXHA 4Y1AA 4MNQE 5MEPB 1NM4A 2AJUH 2CLRB 2G3MA 4WFFE 5I1LB 5IFAL 5KUKA 5J1SC 4Z7UB 4P9HH 2HMIC 1E28A 3NT0A 2H8PA 4TVUA 2DQDL 2APBA 5ECGA 1N2RB 2EXTA 3V8CA 1EAPA 5FUOH 1AZZC 2XN2A 2W65A 1T3FB 3U4BH 3ASWA 4M7ZC 3T3MB 1ZANL 5I6XC 4JKKA 2XIDA 1I9JL 1Z2KA 1WFMA 4U33A 3BCDA 3II1A 4XPAL 1Z5YD 5EU6A 4BYHA 1FDLL 5C0RH 4MNQA 4ILDA 1ECZA 3HTLX 4H5SA 5HI4C 4DVRL 2J88H 3FRUB 1DBML 2PUQT 1HSBA 1DQJA 4ODHL 4YHLH 5KVDL 1LO3L 5L8KB 4XGZA 4R97B 5BVJB 1F3JB 1TNNA 3I50L 5SWQA 3B5GA 2WXIA 2AEQH 1S7RA 2N3JA 3O6FB 5DJZA 1IRAY 4BZ2H 5IQMA 3GI9L 4F20A 2MQ0A 3FOLB 4HUUA 5ITFB 3SKUD 5JNYB 1O9VA 4PP2A 2P28B 2CDEB 2IQ9H 3QIBB 1N7ML 1XIWA 3JV5A 4GT0A 1CLZH 4Y5XC 3CSFA 2AI0L 5IB5A 3L2LA 1SXSA 3TT3H 4YX2L 1T5XB 12E8L 1YN7B 1QWNA 2CHWA 3PIQB 4ONGH 4XODA 3ZYZA 3L7FB 1QABA 1CG9A 4NZRH 2X28A 4PVBA 2EDYA 1YC8A 1DFBL 3O4LB 1KJ2L 4JPIA 4N20A 1A8ZA 1EO7A 1H5BC 3MRFB 4WEEA 4AMKL 4AENB 3KNBA 4LSRH 2Q8AL 4LLVB 3ZU8A 2FJSA 5E99H 4KFZC 4L8BB 1TTRA 4OZHB 2BS9A 3HZVA 3CIQA 4RGOL 5DJCB 1NIDA 2H2PC 4KJWD 4CDHA 2ZX8A 5DHVA 4JPVL 3HI6L 5I0YA 5I1DB 2Z35A 3ZDXE 4XPGH 2G2NA 2BW4A 4UNTA 3EDDA 4JM4H 3DJRA 4KRPC 5HHOE 4NO0A 3S4SG 3DECA 3D85B 5D8JH 4ACPA 2H4EA 3UGXA 1CFNA 4YDKH 3B9EA 5I1KH 1QLFA 2B1OA 1HK6A 4IOSA 1FAIH 3MKKA 2R4RL 2FYYB 4R7NA 1CYWA 1TEFA 3FUJA 3APDA 1G9NH 1KCUH 3B7TA 3RFZC 1BQKA 2BNRD 2EIBA 1MVFA 3WHE1 3S5LB 3IE9A 4E9LA 4J3VA 2VLRE 1XH3B 1E4XH 3EJPA 3GK8H 4FFTA 1XAKA 4WU5B 5G55A 3FPYA 2F18A 1DCEA 1I3UA 2FBOJ 4RX4D 2YK1H 4RGND 3IDYC 2Y36L 5HHOA 4OFYA 4IHOA 3BD4A 5FEBA 2NW3B 3OJDA 4XVJH 2WQAA 4Q6IA 5E8PB 3MACL 1BMZA 2GIMA 2EINB 1BF8A 3FW6A 3EOTL 5CLZA 5I0WA 4ODTH 2ED8A 3AU1A 3DBXB 4GBXB 3CQQA 1PG7W 2XWEA 1AG6A 3SQOL 1OZUA 3AS0A 3IXAA 3T65A 4FHKA 4MCYA 1HQ4B 1JWUB 3MLYH 4Q9QH 4KGJA 2VLRA 2NSXA 5K69A 3GC3A 1IJ9A 2XWBB 1MFBH 1A7QL 4XOEA 4WUUD 2H32H 1ZLEA 3H3BC 4JNXA 3VH8G 2WOBA 4G11A 2CK2A 3GHEL 4U7MA 3TJEL 3QNXB 1P9MC 2UZPA 4XNMA 3BH4A 4NZDA 3EUUA 5FGBA 5AW7B 4NC1E 1MCCA 2Q20A 1IVTA 3GRWL 4XAWH 2FATH 4QJ4B 5ILTL 3L3JB 3QH3B 2VMJA 2ITDA 2OPCA 2V9QA 4KKBD 5GPRA 5DD5L 3JWNC 4QY8A 2NZ9C 2EYSA 9PCYA 2DY2A 3OLGA 1I1AC 4BK5C 5MP6L 3ARGA 4LHQB 1QATA 2CLVB 3V6ZA 5C2BH 3MLTA 5CINH 2FT7A 3QNYA 4FLHA 3NTCH 1LO2L 4RDQG 4LCVA 4XO3A 1MH5A 5AVQB 4X9BA 3EHBD 4J3OG 3KPRE 1S7XA 5DMIH 3T2QA 1JPSH 1NBZA 3GZPA 4BH8B 1NFDB 4R2GB 2UY7A 3FDWA 5E5RB 1NGYA 4NYLB 1QG3A 5JQIB 3DGCR 4ZXBD 1S7WB 1P6FA 4Z3FA 4YDJB 2XPZA 3LS4L 4YFLF 2DQHH 3AY2A 4HHAA 2ZP0T 2WXPA 3R1GH 2KZ1B 2HRLA 2WLNA 4N90D 1XL6A 3HHSA 2LLLA 4GKSA 3OR6A 4JDEA 3VGEA 5BZWA 4L9LC 3ZW3A 1AIZA 2R51A 4TQIA 3JVFC 3SE6A 1NAMB 1YEKL 1IBBA 2CWRA 2HUHA 1UH3A 4B5EA 2CA4A 2FAUA 2OMXB 1R5WA 1UXWB 2VZOA 2OP4L 2FX7L 3O8XC 4MD0B 3S34H 4AVJA 3RX7A 2DM7A 2UZYA 3QHZH 1SHMA 3REWA 5HHMB 2B77A 3NESA 4PJ7B 4I0KA 5FHBH 5AW5B 1WVZA 4MB3A 1IAIH 2DIBA 3CFCH 4PWFA 3PGCB 2GSGA 5I75C 1H6TA 1D5IL 2X4PA 3KVQA 4D7PA 2ICEA 4LSQH 5J1AA 1CDIA 3QHFL 4YZWA 3IDNB 1G6RB 3NIDB 1ND0A 4X0KA 4JQVA 4X98B 5HHVH 2DZEA 3II2A 3DX4A 1R24B 2YEZA 4P23B 4HC1H 5SWZE 4LIQE 4AIZA 4R84A 5IVZA 3ZBMA 1YEJH 4RMUA 1FH2A 5AVXB 3ZE0E 3RB7A 4BGLA 4OCSH 5LCVL 4HVBA 4NXKA 2HVKB 3HNTH 3VJ6B 8FABB 4G2AA 2P5WD 4DZBB 1F2XK 4OZGA 3FQNA 4MJ2A 3MV9B 2VZVA 3CBRA 2Z7WA 2BC4A 4PI0A 1JZ2A 1WICA 1FVCA 2OL3A 2JJVA 1KPVB 2YPVH 3I85A 1JVKA 5FGCE 3DVNB 3O45A 5FA3A 2EYTA 1FH5L 2J1YA 1BZOA 2F1AA 3ARDC 3HS9A 4S1QL 5SWZA 5DEFB 4PJAE 5E95B 4JKPH 4NSKA 1RUQH 3GXPA 1QTPA 2F7QA 1K5NA 2X2UA 4FE9A 3U0PA 1SZNA 4DH2A 4WI0A 5JOEA 4Y8AA 2PN5A 3WELA 4FABL 4YXHH 1FV1B 3L45A 3OV6A 1UZ8A 1ZA6B 2DLFL 4HX1B 3MXVL 3WNIA 5D7JD 2AV1B 2DLEA 4RBPH 1PCSA 4DGVL 3WDIA 5ADOL 3FF7A 4FA6A 1IKFL 4FG6D 4LSPH 2WB1A 3BZEA 1INQA 4BQ6A 2D8KA 3GLEA 1QBLL 2I07A 3A4AA 5I9QC 4PJAA 2GTZA 2YD4A 4GFXA 3KW7A 3CPUA 5SV3A 3GINA 1OCRB 3MUGA 2W5PA 3DSNA 3NAAH 4LLAA 4YIQA 4TSAH 3WHXA 3UPRA 2R7EA 2J12B 2R0LH 2X4NB 4R0LA 4ZS7L 1SXNA 4XP9L 3KBFA 4NM4L 2J1XA 3DMMC 3EYVB 2BWIA 3HA0A 4Y4HD 3IFPB 4JHWL 5D2NE 4FXTA 5AZ2L 3P4MA 3VWJC 5AQ0A 5J3HC 2GJJA 3VXQB 4KO6A 3SEPA 4KZCA 2OMTA 3EDKA 1PVHA 2KUTA 3CSYB 3MA7B 3ABGA 3LDBC 3KXFD 1JERA 3FK3A 2AC0A 5GRXG 3GLDA 3HAEB 1WV7T 1JGUH 1NEZG 3WNOA 1DBJL 4JRXE 1B4JH 4IEFB 4U2YA 5DJDA 5EOTB 5I74B 3ESPA 4RAUA 3RWIA 3EIFA 2CO6A 2LV4A 5BMFH 3IWVA 4HC1A 3O6ML 1TQVA 4GXUM 4IGBC 3ROLB 3A4EA 4KK5C 1ORSA 3AG4B 5D2NA 5GGTA 5CCKH 2A99A 1B0IA 4QI3A 2F5BH 1LYQA 4KUZL 3Q48A 3LZOA 5GSRB 1MN4A 2EEBA 2W0PA 1YEHL 1BJMA 1Y6NR 2WBJC 4N2NA 1CO1A 1UM5H 5ERWA 3DYMA 5AEAA 4IU3B 4WJKB 4AKPA 1NIFA 4MDJA 4ELKB 1T5WA 4FNLL 1OL0A 4JRXA 3ZTDC 3GJFK 2APTA 4YGVA 3C60A 5ACZB 1XGRB 2YPVA 1J7VR 2FRGP 5IG7B 3L3OA 4DP6X 3LVTA 2OR7A 4I8DA 2OV0A 1RLWA 6TAAA 5LWYL 5CUSL 2MKWA 1JBJA 1CLOL 2BOBA 3S98A 2VRAA 2HH0H 1Z0NA 3X1BA 3C6LA 4HD5A 7FABH 1N64H 3QQDB 4A2EA 1JZ7A 2LVCA 3EZJB 5A6LA 3S88L 1CGSL 1L0YA 4W81A 1T20B 5DJYB 4G7YL 5BV7H 4P46C 2OYMA 2MCMA 3L4CA 4WDIB 5JHLH 4XOBA 1MCPL 2I27N 2GIYA 3U2JA 5ESVB 2IGFH 4FAAB 1R75A 1PIGA 4A1RA 3CLEH 1OV8A 1FNAA 4N0UA 2ENPA 4IJTA 3P3RA 3QNZA 4L8SC 1W72A 2VQTA 1EEQA 3VUAA 4TSCH 3NFSH 1SXAA 1RZJC 5KBMA 2K7QA 2XQYK 5IB4A 3V4UH 4KDTC 4ZQTA 2K3HA 1L6PA 1JYNA 3OQ3B 4XMTA 1I8UA 3BQUA 1KN2L 2YKKA 3QJTB 2YSSA 3DIVA 4LHUA 43CAB 2YA1A 3VXUE 4MJ5A 3MXWH 1RZ7L 4KKZA 3C09B 4M29A 3M1OA 3RI5F 4RMSA 5L88H 2W9DL 1AZVA 4HK3N 3U82B 4XX5A 1OE2A 3I2CL 2Y2WA 1FFPA 2CUHA 4RMRA 3ZL1A 1B90A 3FB7A 3UAJA 1HXKA 3W57A 2EUWA 2EDMA 3NZSA 5JW4R 3OAWA 5EZJB 1BF5A 2W0LA 2WQVA 4I4WB 1OTSC 4F37F 4I0PB 4WGVB 3HUJB 3M7OA 5EOQL 1TSRA 4P0DA 3EJJX 3TPUB 5BVPH 3LMJL 1FO0H 4QRPD 5CJOL 5JO5B 1BQHA 1K9TA 2FE0A 1WA1X 1FNGA 3J07A 3VXUA 3B8YA 3NIFE 4N86A 4XCYB 2JXMA 1CR9H 1GGCL 4PJ9B 2R0WH 3MNDA 4TUJB 5EO0A 3T0XA 3RL1A 5KTEH 1JZ5A 1RJZA 3C87A 4HPHA 2N56A 4J1UB 4Z7VF 2OQJA 2MOGA 3PJSB 3X14B 1VGEL 4WY7H 2RQ8A 3SPIA 4HHGA 4PJXB 2VOTA 3VG0H 3FFCB 3H42H 1QLEB 1R0AL 5D1QD 1IIIA 3BEWB 3BUPA 3D39E 3TBBA 4JANA 4KBPA 3RJQB 2PO6D 1G43A 5K59E 2V6HA 3U9UA 1SOXA 2ENSA 3HHRB 3DC0A 1X9LA 3P54A 4HPYH 3US9A 3TJHD 3MV8E 5MENB 4PG9B 2WIMA 4PJ5A 1A3RL 1U93A 4YDVB 5D1XD 1YMME 4N8PA 4B96A 4NCDA 4Y4FB 2BS8A 1XCWA 1ZSDA 2CGZA 5TH2B 1SPDA 3WE6A 1XD0A 2ZP8A 1U6AL 4QHNA 4DPCX 3UMNA 1QHOA 2FECL 5IGXH 1Z66A 3D39A 1QSEE 2WSDA 2IO5A 2A6KB 4OFDA 4QXGH 3MREA 1D5RA 4PS3A 5CAYB 2QV4A 1YAIA 4G1MA 2IH3A 4R4FL 5CXPA 1J8HB 4KX7A 4JREC 3SD5A 4K7FB 3GZKA 1IQDB 1DUYA 1E4XI 1NH6A 1Q0XL 1THAA 1FFRA 3NEEA 5EOCJ 1ZJAA 2PP8A 3VGAB 1WFUA 2QHLA 3H56A 1O5DT 1O9ZA 1MHCB 1KGCD 2IH9A 4ODVH 5F97E 5DC0A 2ZYIA 1W91A 3RNKA 3B2XA 4WTZA 3MOBL 3QDAA 4WWKA 3SYOA 3ET9F 5GZNC 3IKCB 3T8VA 1HZKA 5JXEA 3FTVA 4I9XA 5IQ9A 1MLCA 1AGCA 3I9PA 1E6OL 4HGWB 4C83B 1QSEA 3W2DL 5B1JA 3SDDA 2EDRA 1FC2D 3BP4B 3PXLA 5T5FH 1MREH 2H0FA 2XRAL 2LR4A 2H26A 3AGVA 1MWAA 3FO9A 5B3JF 4NZFA 2HJFB 3DX3A 2E56A 3GS4A 5HHNA 3T4AC 2E8YA 1FO0A 5K33A 3E6FA 5DUBB 3ZGIA 1TZGH 1QFOA 4NDMB 4IMLA 2BY2A 1PX4A 1Q0YH 3IXTB 1VB9A 2NNAA 3WEOA 4ZMXA 3N42F 1G4RA 4BWTA 3GSXB 3T0EC 5FYLD 2XWTA 3C8KB 4RESB 3L6FB 3MA9H 2QADC 4CNIB 2GK0B 1OCCB 3IMWA 4GIPD 3PYCA 4TTDC 5FFLA 1LXMA 4X6EA 2EDEA 3BSHA 5I5RA 1RZJL 5DK0B 4QNPE 1T0OA 3MRLB 5JORA 1KJMA 3PABB 2R2HA 1EFQA 3R8QA 1JZHA 5I26A 3P02A 3MQIA 3UBXB 3L54A 4HWUA 1A1MA 5D1ZB 3WUWB 1AO7B 1D5MA 5FKAA 1FBIH 4YHIB 4HOMA 3SE8L 1C08A 4IIQB 5I1JL 1MFDH 4WI7A 3E9TA 4QHMB 1AE6H 4FXLA 1NM9A 2WCSA 3D33A 1AGFB 2Q8BH 4CAGA 1KCVL 1ZT4A 1ZSHA 3FT2A 4HIQA 3MRKB 2P8MB 5CZKA 4F8PA 2EILB 3QORB 5T1DH 1F90L 2C3XA 1UWXK 5DT1L 2NYYD 4ZS6D 3L4ZA 3MLUH 3BT0A 1FYTB 1GRWA 4YFDB 2MTPA 3PU7A 5AKVA 3GSUB 5BRZE 3FAXA 2PCFA 3DRTA 1IAII 3K6FA 1SJVA 5DC4B 1YN6B 4K71B 5F7EL 3K5SA 4X8JA 2E27H 4MA8L 1GAFH 3SKMA 2FWOB 3KHOA 3PWVB 3Q6GH 5E4EB 3T8XA 1XSJA 1OGAE 1EERB 2OFQA 2QVKA 2CAKA 4OZIE 2ZWKA 1JNNL 4PV1C 1OD9A 4Y4KB 3RX9A 1I7TA 3IGAA 3O3BB 5E0FA 4L1LA 4MZ2A 5T5FA 1QBMH 1EEYB 4MJIA 3LIUA 5J6SA 3M46A 3LHPL 4IBUA 2K4AA 1IGML 3IDMB 4PRIE 1Q72L 2VM3A 1GIGH 3SPCA 4JY6B 2A9NH 3VSQA 5DO2D 4M7LH 1D9KB 2VLKE 3DTXB 4Q89A 2WSKA 4PS8A 5JOFA 1HCVA 1MCBA 4J2XA 4AW7A 1LD9A 1MF2H 2BOLA 4OZIA 1TZHA 4EAEA 4HJ0C 1TJMA 4DAGL 3DJ9A 1CFBA 1ET5A 1H9VA 2D03L 4FGMA 4DP9X 4PJEB 3L9RA 4S0SD 4UINL 1C7SA 2XXCB 4PRIA 3IDGB 2FD6H 4OGAD 1AJ7H 1M7IB 3VI3E 2EH8H 1SY6L 4MXVE 4H8HA 5ACLA 4GQ9L 2MCPL 2VLKA 4U6XB 4G1EB 1T66C 1NGZA 1SNRA 2CH8A 2ROXA 3EF4A 3QUYA 4LU5L 3VD1A 1PQZA 3V5DB 4N26A 4UV7H 4PV8A 1CQKA 2IAMA 5KWYC 3L3HB 2RB8A 5CIPB 1MHPL 2X4SA 4XCFL 4LSTL 4RMQA 1BFTA 3MNMA 2VXSL 1W8EA 2VL4A 1RU9L 1S46A 1TCMA 1GZPB 5IHBA 1JK8B 2VM9A 1YJDL 5FIEA 2HWZH 2WV3A 1FE8H 3HMXH 5FDYA 4RH4A 4NENB 1JZEA 1S5IL 2HVJB 1U58A 3LNFA 3MJ8B 2WXOA 3JT0A 4I1RA 1SF3A 2D7TH 2WAQA 2BXZA 2Z31C 3IJ8A 1SLXA 2OI9C 4U3XA 1E8YA 1TO4A 1WZ1H 1DJGA 1MELA 2XXMB 3VFPB 1G7IB 3V5KA 1L7IL 2EQDA 4HT1H 3MRNA 4YXLL 2ZAGA 3PL6A 3SKNA 1SOSA 1AHWA 5DMKB 1ORQB 5I71C 2NXYC 5CJXA 5IMMB 4DP4X 3VA2C 2FIKB 4NUJA 1MRFL 3QUXC 3U1SH 1I1FA 2OR9L 3TO2B 5L0QB 4ZMLA 3CFDB 3FCUB 4N8UA 1ZHNA 5LDUA 4OLYH 5D7IE 5A2JH 1E27A 5EIIA 1KN4H 2X4QA 5JUEH 2A73B 1UT9A 3APNA 2WQUA 4HPOL 4XI5D 4I18B 4LMQI 1J5OH 3FO0L 2B5IB 3I75A 2DD8H 5FX3A 5DCCA 2XPGA 3CFKB 2C9RA 3VTTA 1UA6L 4IRJB 4KTDL 5MI0B 1XZ0B 4WI2A 1U92B 2BM3A 4CKQA 2P8PB 4H88H 4G6FD 2XVLA 3QEUA 5DRNA 2EZ0D 1OWWA 3I6KB 3NN8B 4P4KB 3V2AR 1U8OB 2X1PA 2X5PA 5E8OA 3WY1A 3LZPA 3LNEA 3D2UD 3MRMA 1Z9SA 2YAOA 5DJ8B 3LKOA 1IAMA 5D7IA 1F2QA 1AKJB 4EI5D 3B2VL 5EU5B 4HFUL 2IAND 3BZFA 4OSUL 4RCAA 4NUPA 2DEYX 3VXNA 5J6HA 2DMGA 2H6OA 4A68A 2ZCLH 3QYCA 4KV5E 3DETC 2R29L 5LQBH 1S5HA 1XBDA 4FI7A 1MZZA 2X3AA 3ILPA 4EZKA 2BNRE 5JHBA 3C5JA 4PS4L 3BMVA 4WU7A 3VDCA 5TDNB 2XA8H 4CSZA 1W0VB 1U8JB 1TPXB 2B1AL 2WIIB 3EO0B 3SBQA 4LLYA 3PF2A 1WBXB 4M93C 4M48H 4NO3A 5GS0L 5LLIC 2RGSA 1MNNA 3QQ9C 1NCAH 4RGNE 5CD3A 5BO1H 1E9PB 3L2NA 1T4KA 3S5LG 3OKMA 4MDIB 4X6DB 2PYED 2NCEA 1T1WB 2X88A 5AD0B 2OMWA 2BP8B 4PSRA 2I9TA 1DJYA 1HX0A 2GW5A 3LZNA 3EBAA 1F11A 3HBGA 3B83A 3QPQC 4N2FA 5EC2B 5DD3H 5D96C 3WFEH 5EULV 1N3NB 2OBGA 3DDGA 2TRYA 1QYGH 2BNRA 2O61A 5TD4A 3BZ5A 1V05A 4JFZL 1DBKH 2YARA 4WUUE 3BHBB 4P4RA 5EHFA 2QMKA 5EUOE 5IB2B 1TQTA 1OARH 4RX4A 2AKRA 3OAYK 2AK4E 2P5EB 3LRGA 1U4EA 1MY7A 5CHNA 1UADC 3MJ9A 2DLTA 2G3XA 1GKEA 3KWVA 2FH6A 2IWEA 3UDWC 4LBEA 4DT2A 5AYUH 5JW3H 1L4IA 1EQWA 2QR0B 1A3LL 1L7TL 1QSFD 5ESAB 5FOJA 3GKZA 4JO4L 1SDDA 5BZDA 4AYID 3IAPA 3UAAA 5F88B 2BOCA 3RUGB 2JJTA 2BSTA 5DTFB 4W4NA 5EUOA 4RFNB 4WUUA 4XPTH 4M9OA 1P5VA 5EU7C 5HI5D 4PRHA 5GS1B 3IB4A 2B1HH 1EO8L 3K1DA 4HJUA 3BVTA 4Y1AB 2XPYA 3ZTEA 4ERSH 5HGBA 1PS3A 3BLBA 4W9HC 4Z77A 4KMTH 3PLYA 1MLBA 4NC0B 4HXBL 1E28B 1IGTB 3ENEA 2H8PB 2BK8A 5DRWA 5E6ID 4NUQA 4YSEA 2BFGA 2QKSA 4N90E 4PY7A 5EPMA 2ZCZA 5K1JA 1H19A 1EAPB 1UM4L 3HFML 3CFNA 3HG5A 2BERA 3JV6A 3K91A 4FQQB 1S7UA 5GRVK 5L4FA 2LU5A 3IRZA 5F89A 4P5KA 2W65B 2VZTA 3VRLF 4GAGH 5BRPA 4NFCA 1L9TA 1MIEL 1S8DA 2XIIA 1JI1A 4B9GA 2JK5A 4BA8A 2FL5B 3QJFA 3COOA 1HT6A 1AOHA 1IAOA 4UQBA 5EEZA 1BEYL 2E9IA 2HLAA 4ZXBA 3M1BA 4H5SB 2EVJA 4HIXH 3GS7A 1ACYL 3LZFH 4EIBA 3J2PA 4AJWA 1DQJB 1HYRC 2VAAA 2VSDA 1T7YA 1GL4B 2PR4L 2XHNA 4KTGA 1OSPL 4LBAA 4XGZB 1ZXKA 5EA0H 5C09D 3WS6A 4RZKA 2MFNA 2F08A 1S7RB 1ULVA 1MJ7H 4M6OL 5DJZB 4C58B 3OPZL 3KBHE 1I9RL 3UTQB 4XNYL 1MJUH 1RD6A 1XIWB 2AABH 1RP9A 4R5TA 4AW4A 1AQHA 4FKKA 3FHQA 5IB5B 1EMTH 2UXGA 4TL5A 4UT9A 1JK9B 3GMNA 3QDGE 1JSYA 2Y7QA 2GQHA 3HBPA 2ZXWB 1FQ9C 2P5WE 4J23A 2MPVA 5I16B 3DJTA 3O9WD 4WTQA 4I2XB 4JPIB 2EC9U 4YL4A 3F85A 3UTTA 4WNQA 4Y2DC 5GRUH 3OMIB 3DX7B 4BFNA 1VFOA 3HZVB 4X80H 1CLCA 4ZOEA 3RDJA 2QT6A 5C0EA 3P3YA 2QTEA 2Z35B 3B3IA 4FTVA 3P0YH 1KSRA 5E2WL 4NO0B 2EJ1A 2QQKH 3BKYL 2KDGA 1CFNB 2VJ0A 2P5WA 1WFNA 3B9KC 1F0LA 5E5MA 1QLFB 1JFHA 1E65A 5E6SB 1F6LL 2GY5A 3S8FB 4FQLL 3QUMB 4LSVL 1JYXA 2Y4SA 4A7GF 4XXWA 1EX0A 1OB1B 1BHGA 4Z7OF 1NC4D 2J4WL 1G9HA 1MFEH 3DV4B 4DZ8A 1TZIA 2GJ6D 1S7VA 2QSVA 4ZFGL 3W39A 2OZ4L 1KWGA 3LEXB 3L4YA 1Q94B 1GXEA 1UJ3C 4Y19D 1RY7B 4WHTB 5DJ0A 3OJDB 1Q9OA 4L0YA 4TNWF 5IMOB 1FPTL 3WE1A 5IY5B 1AVAA 3D69A 5DURB 3AU1B 2K4WA 3BPOB 3FT3A 4LCYB 1EUTA 2VN6A 1N10A 2C3GA 1JV5B 5DQJB 1HOCA 3Q44A 5D7JA 4MCYB 2X6VA 2LTQB 2JQAA 3DDFA 1T03H 1QSVA 3HNVH 3KXFE 2VN3A 2YGOA 3ECBA 4BFEA 1TO5A 35C8L 4ZX6A 4UQIM 3CAFA 3GMOA 4FX5A 1C1EL 1NBVL 3AAZA 1HFUA 4NBZB 4P2QD 4XNMB 5AL0A 3T1FA 1PSKL 1YMHB 1R9FA 5DF0A 1AXTL 4EBQL 2ITDB 4Y4FC 4M1GL 4C47A 4Y4HA 4QY8B 3UADA 2EYSB 5HD8D 2QZ5A 2AITA 4FHBD 4W9IC 1VGKB 3V6ZB 1DJHA 4HH9A 2QGBA 4Y16C 2FUQA 4HKJA 1MH5B 5J4MA 4H1LH 4CN6A 2FQDA 1S7XB 3KXFA 4LVHB 4XP6L 3T6WA 1NBZB 1R5VA 3OB0K 1NA8A 3BKCL 1EAJA 1XXDC 5IREA 1OSYA 3UO8B 1NGYB 1QLRA 1S9WB 3HI1A 3V0WL 2WYIA 4HHAB 4XMXA 4MXQC 2Y7NA 5JHDB 1ZAGA 4KRLB 4PRPB 3QK0A 3LEYL 2NR6C 2YMXL 4QRRA 4IKNA 2G3NA 4GKSB 4JDEB 2ZE0A 4OF5A 5BZWB 3MTXA 4FL4C 5DHYB 2VDPH 1D6VL 3BP6A 3QULA 1H3WM 4ZD3L 1EGJL 1YZZA 1R5WB 3VXMB 3GSQA 3LQAH 5IQOA 4GSDH 2XZAL 3A3YB 3QS3A 4KUCF 2UZYB 2ALAA 4IU2A 3REWB 4MMXC 3ZE1B 2MNWA 3VNZA 3WMQA 3ROOA 4LEEA 2PCXA 4OCWH 1CN4A 2DWYA 3RA7L 5IROC 2GSGB 2EC9T 1BVNT 1OHZA 1AD9A 2GT9B 3WFBH 2E6PA 2X4PB 3US1A 4F27A 1AC6A 4D7BA 1TYRA 4O02H 1T7WA 1FI8C 5DVMA 1KGXA 4WF7A 1CU4H 1UCBL 5E70A 3NPSB 1ND0B 3WNKA 3ZHKA 1VEOA 1DEEA 3TV3H 2D3VA 2BSSA 4JZOA 4C8XA 2R69L 2D7OA 4YDLB 4PWJA 2G5BB 2Y3AA 2XY1A 2J57A 4AIZB 4C59B 3MROA 1CBJA 5IVZB 4QJ5B 1Z1WA 2PTUA 2NNRA 3ESOA 3ZE2B 3NSYA 3NCFB 3FQNB 3AJ7A 2JKXA 4OZGB 4BFRA 5CFAA 3BWAB 1YAZA 5IFHH 2BLFA 3NQIA 3ZHFA 3VFWA 4IIQC 1MCRA 1S7TA 2CK0H 1FVCB 1LVEA 2OL3B 4Z0BH 4QRPE 4CBPA 1EIBA 2X09A 1HC1A 2W80C 4WFHD 5EORH 1NICA 4WW1B 5FA3B 1MEXL 3O45B 3ZKMD 2EYTB 3AXIA 4NZTH 5SWZB 5HGAA 3L7EB 3FB8A 2ALWA 4NSKB 3CFBA 1JVLA 2BHYA 2W92A 3AWFA 3IJHB 1K5NB 1S3KH 3B8SA 3VXRD 2IWKA 4QGTA 4MAUL 2RJMA 3ABMB 3QB7C 2ESVD 4HEPA 2EADA 4KWUA 4FFYL 3A47A 3DSFL 3PV6A 1N68A 5DI8A 1UOKA 1UZ8B 4PUBL 5D1QE 5E9DB 4G7RB 4KK8D 3RE0A 5C92A 3FZUD 2R1XA 1OCZB 4QRPA 3T2OA 1E0OB 3FF8A 2NY7H 1WO2A 4OQTL 5TPWH 1Q9KA 1INQB 1KTKE 2FH8A 4LZKA 4FCAA 2I07B 3MBXH 1HSAA 2VDNL 5LB1A 4PJAB 4P2AA 4Y4KC 4OM1L 1EBAA 1PL3A 2Q0ZX 4BUGA 1H8NA 4YIQB 3DSNB 5D1XE 5FYLH 1F3DJ 3QPKA 4OI9A 1K8DA 5EIQA 3LAFA 4UTBA 2FQFA 4H7VA 4TXVB 1G1OA 4FYRA 1YYLH 3P4MB 3ZMRA 4A39A 4KROB 2PO6A 4HYTB 1FNEA 1OF2A 4G7VL 4PJBB 1FLTX 4HIHA 2OMTB 3ORJA 3OXRA 2E47A 5J1TC 1C5DA 4BUQA 5GHWH 4UQ9A 4EQ3A 1E40A 2MOVA 3QCVL 1U8NA 3JBG7 1DEDA 1OTTC 1ZY9A 4FXGA 4B27A 3KJ4C 3RJOA 1JCVA 2R23A 4XP5L 4JZNA 4RAUB 1KGCE 5D1XA 4YXKH 3RWIB 2CO6B 3RWFA 3SPGA 5IJCC 2JNZA 3ZKXB 4GG8A 3QDHA 5E51A 2YWYA 3FT9A 3BJLA 1O6TA 1RFDH 1B2WL 1IC5L 4PVLA 5D2NB 1BCIA 4LQ1A 2IPTL 2YPKA 4P3WA 1CFSA 3FUHA 3IFLL 3LH2H 5EFIB 2X6MA 3B9VA 2PPDA 2H2SD 3G6DH 1IEHA 5ERWB 3DK2A 4QRQA 4TNGA 2PW2B 4MDJB 1RZFH 4TNEA 1FJ1A 1PPIA 3S35X 1T5WB 4ZNEA 4JRXB 1RJLA 4GUCA 4FCHA 4OLVH 5K9JL 1BJ8A 4W68A 4XMKH 2CZNA 4N2DA 3C60B 4YGVB 3UFIA 2GVYA 1GOFA 1MRDH 4F58H 3L3OB 1EO5A 1HZHH 3QI9C 2WQ8A 4ZSOE 4MJHA 5AAMA 2XWDA 1IO4C 2HJKA 4KK9C 2HCZX 3AQYA 2BOBB 1C5CL 3ARFB 3C6LB 3FRPA 2ADIB 2WTRA 2AMUA 4J3OC 2ADYA 4RRPA 1UEMA 5FYLE 1T04A 4AQAA 5GZOC 5FCSH 1T6VN 2CJTA 1N8OE 1R3LA 1OAYL 2MKLC 3NJNA 1OE3A 1UYWL 3PGDA 1ZT7A 1BJ1J 2BIMA 3PP4H 5L0QC 4LPXA 4N0UB 3NJJA 4ETYA 1CF1A 2KLSA 4JFDD 4FQ2H 4ZSOA 1W72B 1QZ1A 3GSRA 5TF0A 2YGPA 3BDXA 4JG0L 4B7IA 1JZ8A 5AZEH 5DRXA 4GIOA 3U2IA 5IB4B 2EYRA 5G2NA 5KSVB 2HTKC 5CJBA 2X4UA 1S9VA 3QXDA 3TA3D 1J0HA 4JFOB 1ZIBA 4LHUB 4XNUL 4RQQA 1J05A 5DD0L 3OJMB 4MJ5B 4P4KC 1BFOB 4JMXA 4LFHD 1RULL 3W9EA 2J43A 3F64A 4OZFB 3V4PB 3ZY7A 4HSQA 4PBDA 1HHJA 3ZIMA 1FFPB 3FB7B 1NCJA 1VLXA 1M05A 2X1QA 4OD3H 3T6ZA 3ARDD 1QSZA 1I9IL 2F8IA 3G9AB 3IRCA 1A4JA 2YD6A 3UP1A 1QO3A 1Q9WA 1TMCB 1U91A 2WO3B 4I3GA 3FAWA 4Z6AT 3ISRA 4P2OA 4Z7VE 1BQHB 4AGMA 2EXYD 2G75A 1BPLB 3VXUB 1BYNA 1K4CB 3O2WH 3WO3B 1T2QL 3DURA 2NLJA 4NN6B 3OJVC 5EO1A 5EO0B 1VSCA 3RL1B 2WUBH 1RJZB 4N5ED 1E8ZA 3L5HA 4JFFD 4NCC2 3SE3A 1PX3A 3WOVA 2AXFB 5D6DA 1OXYA 4BM7A 1AP2B 2E75C 2WLJA 4YBLB 1RXLA 3K0YA 2J8HA 4S1SL 1CTNA 2UUDH 1OB0A 4JANB 5AVVB 2AZAA 5C0CB 4GI8A 5ELIA 3WD5H 1HQRA 4Z7VA 3TIDB 3P30L 2Y5TA 2AQNA 4U3CA 5G5DB 4HJTA 2X3CA 4HKBA 1REIA 3QAQA 1AC0A 3KGTA 4G9FB 4PJ5B 2P4AB 1GW0A 1U93B 3JVGC 3AXLB 1TENA 2VXTL 3L95A 5ISZD 4M5SA 1ZSDB 4GEIA 1ZEAH 4Q56A 1UTDA 4ZMNA 5DHDA 3BWZA 4Y0GA 3D39B 3TM6A 1JHTA 3OF6D 2YPLD 4G1MB 4LKCA 1A65A 2GJZA 4K5MA 3D12B 3JSSA 3L3IA 3VSTA 3WKPA 5HVGB 1UZGA 1SMOA 4FHJA 2R8SH 5KS9E 1EJOH 4TM9A 3D9AH 4KK5D 1OY3B 4QOKA 4DKFH 5F1NB 2BCKB 2DTSA 4MZRA 3MLSL 2CM5A 4G8GB 4RFNC 3IETA 4LPVA 4FFWC 4E5XB 1D3CA 5GS1C 3GM0A 4ZODA 3RNKB 3SKOA 1AXSB 4KZDH 3Q8FA 1EJ8A 3NACH 4F7PB 5HP5A 5IQ9B 5B3JE 4H13C 1MLCB 1JUFA 2BH0A 2V5RA 4H20H 1JGVL 4GFTB 5D4JA 3SDDB 5CS7A 4AMWA 1MCLA 1UHVA 4HK0A 2H26B 1MWAB 3FO9B 1UD8A 3HC4H 2FHFA 1BBDH 3LQMA 2D7MA 4BE5A 3C5ZB 4P46D 2AJYL 2FO8A 4EPSA 1ZWIB 3ATEA 3CZNA 1B3IA 2BJMH 1E5UI 3HW7A 1DQML 1JGLH 1G7JB 4J3SA 3W56A 5EDSA 4IMLB 2DM4A 1UEYA 3IS0X 3GM8A 2QSCH 4DP1X 3QZOA 5IVOA 3NG5A 3SDAC 3B2MA 2N7SA 2NNAB 1ZDQA 5HJ3B 2HRPL 1TDQA 5GXBB 1WEJL 5DFVC 5EMYA 2XWTB 5FECA 2DKUA 3CXFA 4MHHI 4NHCH 5FB8A 3LS5H 5AVSB 1CDBA 2B0SL 5CZXD 3HG1D 2BRRL 2X40A 1HESA 2YAQA 2OJEA 3TIEA 3UTZA 2ZUTA 1QTSA 3QYNA 3RLSA 2YJQA 4X6EB 1QBAA 4YSRA 1TVBA 3UYPB 3PFUA 3NSXA 5AUMA 2WB7A 1JD7A 4MQ7A 5JORB 1KJMB 2R2HB 3PDOA 1C9SA 2UZXA 1QFUH 5CJ8A 2IANE 5HJBA 4DO6A 1A1MB 2QHRH 1USQA 1R3HB 2FX8L 1RPQA 2A83B 5EU3A 5I6NA 5FGRA 4IJ3C 4RBPK 3WTVA 4L3EA 2JE8A 2HVBA 5FKAB 5HPOA 1C08B 4P99A 4MHHG 3FFDB 1DVUA 3CJJA 4GKZA 2DJMA 3N40P 1T0MA 5B38A 2VJXA 2O6FA 3AABA 3EF7A 3RVWC 4PCTA 3STZA 1CTOA 4H1LG 4ALAH 1A5FH 1B6UA 4JPKL 1ZT4B 2NY5H 4V2BA 3D2UA 4WNSA 3X1NA 4GG6F 4YBQD 1RJYA 3N85L 4PB0L 4BBWA 4DN4H 2FT6A 1OD7A 4RLDA 3UTPD 3ZHNA 3KYNA 4JPQA 3TBVA 2F19L 4EI5A 2VLME 3IAGC 4GH7B 3QWOA 4NFBA 5C6TH 1DQKA 4FYSA 2QFPA 2G60L 2PCFB 3DRTB 2E86A 2ED6A 4KXDA 3EH3B 4HIIA 5D7SL 3VWKD 1OSZB 3SYAA 4YNYB 4MB5A 4ZW3A 4JFVA 4X8JB 3K6SA 3QQXA 4WK4B 2PXYB 5CU5A 1FDLH 4KXAA 4F7MA 1A3QA 3T8XB 4QWWD 1WTLA 4HJJL 5KANI 4ZUTA 3SBWA 2ATPA 2BS71 2H5UA 3QRGL 3UACA 1AR1B 1RZGA 4PJCF 1A4AA 4ODHH 3U9WA 4BV1A 1KIPB 2D3LA 4P9HC 1I7TB 3IGAB 1LO3H 5E1QA 1YECH 1KC5L 2YAPA 4MJIB 4JVWA 4X7TA 3B1TA 2MHAA 2O72A 2V5TA 4P5SA 1FLRH 3DX2A 3GI9H 2PYEA 4O9HL 4FNRA 3GIZL 1IX2A 4JZJB 2AEOA 4Q6IC 1M3IA 3U0WL 3N50A 3VFMA 3GO1L 1QSFE 3N44F 3KEDA 5D6CA 5EZPA 3EFOA 5JOFB 3QRBA 2AI0H 3LN4A 4K7PH 3QA3A 4N9GA 1YEWA 4YX2H 1UM6H 3WJMB 1CXEA 5F9OL 12E8H 1TZHB 2W9EL 2IWFA 2G2RA 4NPKA 2LTQC 3GSWB 1FGNH 1PG7X 1MCWM 4NUMA 5I0XA 3QUHA 2VW4A 1DFBH 1JTPA 1YNKH 4I5BA 1YPZB 4AMKH 3L9RB 4Z7NF 1GC1H 2EC8A 5I1IL 5HDQH 2C9PA 4CVZA 3CZLA 2OM5A 4HZAA 4PD4J 1WGVA 5DO8A 4F2ME 5FGBC 3ZSSA 4BRVA 2ZX7A 1NGZB 4PP1C 4LXFA 1YUHA 1L3NA 3SZKC 1DQLL 5B39A 1IFRA 2IDSA 3VFSA 4HUXA 3F7KA 3KPOB 4C55A 5GZND 4ETQA 2A38A 2X4SB 3VB9A 3T5WA 2OMVA 3ARGC 3V4VH 4NJAL 4KTEL 5D9SA 4GO8A 1AD0A 4A67A 1P4UA 4GIAA 1NCTA 4FLOA 5BS0D 4IRSD 3O2DL 4FADA 2CCLA 3T8MA 3FUIA 1H6FA 1NC2D 4LVOC 5KVDE 3GTNA 1WJ3A 3IF1A 4O5LH 1H15B 4F2MA 4NC1C 1F8TL 5C08D 2XA3A 1M2VB 3GLAA 4M6NL 1GGIL 1F4XH 3MRNB 1DANU 2KC0A 1RK0A 3LKNA 3PL6B 5CJQH 5C09E 3C2AL 3LPWA 5KJRL 3V0EA 1X6NA 2NUPA 4NUJB 1I1FB 3NJKA 2OULB 3QJHA 1JV2A 1QBBA 5LVEA 1E27B 2WUCL 2ZX5A 5EIIB 3EH1A 3SQOH 3LZLA 2B3RA 5JPMA 2MWCA 4JFTA 4WHDA 2BVPA 5BO0D 5F6HJ 5HYQB 1G9NC 3WMPA 4KX8A 3LX9A 3S3DB 3ETBF 3MLZL 4C4BA 1UB6A 2XPGB 2V3DA 1HINH 4F1ZA 3LKRB 5CP3H 5A7EA 1DFXA 3GHEH 2QTVA 4Y9FA 4N8CH 1B0WA 1FNSL 1RZ8A 4WSJA 4BCXA 3QEUB 5DRNB 1BWWA 2BZCA 2ICEC 4ACTA 4DUWA 5C3IA 4XNAA 3JWDH 1PY0A 4K9EH 3ZX1A 1Z9SB 5DD5H 2JJSA 3KYMA 3LKOB 4W9GC 5D7IB 3TO4D 4GXFA 4H2CA 5MP6H 4U6VH 5FW6A 4L5FL 1G7QA 4KRNA 3FUNA 4PWGA 4HU8A 2YD1A 2Y7LA 5D5MF 2WCPA 3AFLA 4H2AA 1YY9C 3VXNB 2LGNA 5DZPA 4DP5X 5J6HB 3BUYA 2N4IA 4N2EA 3HRZB 2Y72A 1D6EA 1LILA 1KJ2A 2NDFA 1CLVA 1P2CA 2RFXA 1TCRB 3O9WA 1OP9A 1J9TA 4QXVA 2CMRH 2XT1B 2WXLA 1DP0A 4LRNL 4URKA 3NOIA 3C5JB 4WU7B 5GS0D 3K81A 1NCWL 2X6AA 1PD0A 4QRFA 4GLRH 2GJ6E 3IYLW 2AF2A 1TYJA 2K8QA 3BWUF 4LLYB 1AACA 4HCRH 4NO3B 1R3IH 4UT6H 1F4HA 1NOLA 1YEKH 5GJTH 5EBLB 3VDAA 3FQRA 4Y19E 1T4KB 1QPPA 2XDHA 4OGXL 4U6TA 2OLDA 3OKMB 3E2HC 1CJYA 2OMWB 4NNPH 2AJUL 2I9TB 4K8RH 1LNUB 2XCMC 1F11B 4GMTH 2JMRA 2CHNA 4P9HL 4HOZA 1DQQA 3DNKA 1JGIA 1YYCA 4XBGA 1NC4A 4NHUA 2YA0A 4ZMZA 4WFGD 1ZLDA 3H7BA 2H6UA 2GJ6A 4ADJA 3CWGA 1L3WA 3U4BL 5LN8A 3TVMD 2AKRB 2WXQA 3LPOA 4PREA 5KJ4A 5F3HA 1BD2B 4KOBA 3MFFA 4HJ0D 1IBZA 4P2QE 2OMNA 3CZFA 1KBWA 4LBEB 4K2UH 2J88L 5L2JA 4WI4A 1TTBA 4M4RA 1UA7A 3Q2CA 4R0LC 3EJTA 2AGJL 4J8QA 4WWID 4DKTA 5BZDB 4V2CB 1HL4A 4JVUA 5LCVH 2Y6SD 4GI6A 2BOCB 3GBEA 2DWDA 2GBAA 1G9EA 2BSTB 4HS6A 4KROC 4AEFA 3ZQWA 2DW5A 4BZ2L 5CP3A 5KN5A 2KQMA 2V7HA 4N2OA 4BSJA 3LXCA 4RGMB 3NFNB 2IQ9L 5TGBB 2XTLA 3AVEA 3QHTC 4PRHB 4Y88A 1CLZL 2J2ZA 3GRWA 1XB6A 4JLRB 5HGBB 5FXCH 5F7FA 5JLZA 1K2DA 3B56A 4Z77B 1HJBC 1DANT 1IC7L 3BDBA 4MAYA 4HSCX 3VRLE 4KXZH 4MQXC 4ONGL 4PY7B 1D5XA 4NZRL 1OVZA 3ZTCC 1HI6A 3JV6B 2D9QB 5D2NC 1MAKA 1S7UB 1BAFH 3Q9PA 2H7WA 3VNYA 1N19A 4P5KB 4LSRL 4PCKA 4G7SB 4FABH 4OTXL 3EHBB 4DCQA 3PQYD 5E99L 4IM8A 1D2OA 1WT5A 2JK5B 4WK0B 3CMGA 4NOBA 3MXVH 4HKZA 1IAOB 2ICCA 32C2A 2BPBA 2H6PA 2NXYD 3MNVB 3MX0A 4I3SH 4X5QA 5JW4Q 1H6EA 2K6WA 2XACC 3M1BB 4TLSA 4XPGL 4OIIH 4ZTPL 4ZXBB 4X4YB 4JM4L 5ADOH 1RV6X 1OT2A 3C60C 3Q3GA 5D8JL 4MJJA 3ZZLA 1NIAA 2QFRA 4YDKL 1KACB 1ID5I 3HN8A 1EPFA 3RVXC 4AK1A 1JHLL 1XSKA 5KW9L 4ZS7H 4NM4H 3FTSA 4BDVA 4GAAA 4LLDB 5IHZA 3NK3A 4OM0L 5AZ2H 4KVCL 2IOOA 3NSDA 1BMGA 3J27A 4PR5B 1XMEB 1QW8A 2Y7QB 1CL7L 1GYCA 3HMWH 4XNXH 4DSYA 2X2YA 3H1ZA 2XJLA 2DJSA 1BQ5A 2HFGL 1H0DB 2B59A 1ZV2A 2CGYA 4JFSA 3UTTB 4NFDA 2BXYA 3KYOB 3MLYL 3O6MH 4WFHE 4FXGC 2V8MA 3BQUC 2R2EB 1MFBL 4RSYA 3PAYA 2E5EA 4O51A 4A38A 3KDPB 1BZQK 3CNKA 3SE9L 1A9BA 1PDKA 1E4WH 2FYVA 3B3IB 5LCVA 1CGYA 2IV8A 4FTVB 3ME0A 4PD4K 1YEHH 4TS6A 1B0RA 1HKLL 1U36A 4PJ8D 4XN7A 4MBRA 3VXRE 1XGTA 2OMUA 3KH4A 1PAMA 4NNXA 2P5WB 4FNLH 1CXKA 2WLMA 2ESVE 4XAWL 4XN9A 3I6LD 2EVIA 1TMQA 4QRTB 4XWOC 5C2BL 5CUSH 5SWSD 5CINL 2D31A 3NTCL 4OB5H 1S7VB 1HCFX 1CXFA 3VM7A 3CDFA 2HT4D 2P7TA 1JPSL 3G04A 4N2HA 5DMIL 3S88H 4HALA 1WAEA 1R5IA 3HLAB 4G7YH 2APWA 1GR7A 5H37A 1TZOA 5DJ0B 1Q9OB 2QQNH 4CC1A 2WXKA 1JYVA 2A2QT 3QEQD 4OQ1A 3VXRA 4A7GA 1FFOA 3RGHA 3X12A 4XH2A 1UT2A 2DQHL 4DIXA 4QPEA 1N67A 3L4UA 3D69B 1PY4A 4AKOA 2ESVA 3R1GL 4K3EL 3FT3B 2NY1D 1NGQL 4G8EA 5J89A 1YEEH 1HOCB 2ZF9A 5EV7A 2NSMA 4MVBD 3T4YB 4FLQA 1P84K 4DEUA 5ID0A 5I6OA 4D0BA 2NW2B 1J5HA 4PLKC 1P1ZA 4PGEB 3S34L 3AAZB 4Q6KA 4JY5H 3MJ7B 1KN2H 4HWZA 2KLTA 3QHZL 3U6XS 3U36A 4A6YB 4AITA 5BV7C 3NZHL 4X7SH 2X0VA 5FGSA 5FHBL 1IAIL 4P48A 3CFCL 3LN9A 4UDUB 2EIZA 4R96A 2VXVH 1O0VA 3MLWH 4NQDD 5KVFH 5C0AB 5C9JB 4LSQL 4UQCA 2AANA 4HH9B 4J6RH 4OAWA 1HOEA 1SLUA 5J9PA 4QHUA 3KXFB 3WO4C 3EOAA 4G6AC 2VRQA 1HHGA 1R5VB 1E7UA 3CXHK 3HCVA 4BK5A 5IW6A 5A16A 4F33B 1JXGA 4H4NA 5M7QA 4OR1A 3HI1B 5CJOH 1M71B 1YEJL 4OCSL 3ZKSD 4UM9D 4FP8L 3VFVA 1FZOA 4WI8A 2HLFD 5KG9A 4WWKC 4ATTA 1VEMA 2BIIA 4QRRB 4BCZA 1DO6A 3SCMB 1KJVA 3RDTD 4BSVA 1DJXA 2ATAA 3BP6B 2XV6B 4N2LA 1KCRH 3QULB 3RIFK 3RWHA 3SDYH 3SDDC 4F15C 5E4IA 2VMEA 4KGLA 1RZPA 4G59C 2XZZA 3GSQB 4ZTOL 3FYEB 3TEUA 1A1NB 4YSDA 2Z7YA 3NP3A 1N18A 2YOAA 3SHSA 4F3FA 3WEMA 4IU2B 1IAKA 2UWEF 2X12A 3F7LA 4JKPL 3ROOB 3H85A 2X9YA 2GHZA 3BZ4A 3EYFB 4JFDE 2ZUWA 1CDGA 1TU2A 3ZLQC 2X4OA 2QGEA 3EZ8A 1AD9B 2N59A 4CN4A 1G0XA 3DOHA 2VLJB 4ORZC 2R2BA 1C7TA 1GPOH 4UZUA 1A3RH 3H9SD 2HN7A 3AT9A 3EBIA 1MI5B 1G9ML 4CJ0A 3P40A 3LQZA 5E2VH 3IJ9A 1U6AH 1DEEB 1IFHH 3CVHH 2BSSB 4LAQL 4JZOB 4BK8A 5FLUA 4KVPA 4ECNA 1ZLVH 2NT1A 3MROB 4DERA 5KVEL 2AVFA 2C1OA 2J1KA 3NGBB 4ZDHA 3B9AA 2X10A 1PZCA 4JFDA 3BQVA 4QKTA 3DRQA 3NAAL 1N4XH 2Y25A 4TSAL 3H9YA 1C12A 3PWJA 4JHAH 3WIFA 3H2WA 4Z3IA 3OR7A 1B6DA 4OZFG 2MNJB 3NIGB 3VFWB 5E08L 1S7TB 2JTYA 4OV5A 3UJIH 1EBPA 3TA3A 1A6WH 2Q76A 4U1GB 4PJIA 2AQSA 1FZMA 4B97A 1NMBH 4DP0X 2YMOA 1FVEB 3W2DH 4UI2A 1J8KA 5HGAB 4LOUD 1IGFH 4LEXH 3S5ZA 1RVFH 4I77H 1PZBA 3FB8B 4JFFE 1B4JL 3RVVD 3ARDA 4POZC 2VUOA 5GS2D 5BMFL 5EF1A 2XZCL 1TNMA 4EN3C 2WWMD 1M7XA 5BJTA 8CGTA 3QUZD 2ZG3A 5DI8B 2HFEA 4PLJD 3GXNA 1CDYA 2E7BA 1LWHA 2F5BL 1C16A 5DD6A 3DI2B 5GS3A 2B4CL 5DJ6B 1Q9KB 4B53A 1KBGH 1UM5L 5D7LE 1ZLSH 5HHPA 1ODAA 2PW1A 1HSAB 3VG9B 4JFFA 3IMRA 1KEMH 4EDWH 9CGTA 2VC2H 1CFQA 2EEAA 1RJCA 3BGAA 4EE2A 4LSUH 4XNZC 3CZJA 1K8DB 4JQXA 4MA1B 3D50A 1E9QA 1F97A 1UGNA 4WSKA 2CJUL 4LLQA 5E7FA 4V1DD 2HH0L 7FABL 4YHZH 5JTWA 3O0LA 2YPLE 2F58H 1QA9A 4NRXA 4JFPA 1OF2B 1XB3A 2EDJA 2D7QA 3CCHA 3S36L 4JHVA 4ZW6A 5BV7L 4QDGA 1XO8A 4DPBX 5T8IA 1C5DB 3DMMA 3VRIA 1YQVL 2ZCHH 2APFA 5JHLL 1X5KA 3JTTB 4KKNA 4GLRI 5F9WC 1A4CA 2IGFL 5F0JB 4Y16D 1O6VA 1KYOK 1A4BA 3BPNC 3CLEL 4XVOA 2R23B 5D1XB 1CXIA 4JZNB 2R39A 5ISZA 2AP2A 3MLVH 4C57C 5HYJA 2Q7YA 3ZOAA 1BXAA 3QDMD 3CLFH 3T6VA 4M8QA 3E3QE 4L1HA 2OX5A 3FT4A 2E9GA 3OF6A 2YPLA 3CFTA 4MXQD 3TLRA 4E5XG 2YPKB 3QUYC 1CFSB 1QEWB 5JW4N 3M6DA 1RIHL 2VDMB 1HIML 4K55A 2IAMC 3DO4A 4QAMB 3X1GA 1GVIA 4OCXH 2YR3A 2J5LB 4W93A 2NX5A 3V0VB 5E6YA 3MXWL 3MUY1 1RJLB 3ZZQA 2VITA 4IDJH 4ELDA 2WBJA 5L88L 4MNHA 2CO4A 3ALXA 2QKIC 4FG4A 1JNNH 3FMGH 4RDQF 2GABA 3N9GL 4W9JC 3S37H 2NNFA 5CGYD 1ROWA 2HJKB 4I1PA 1AS6A 5DGRA 4KQ4L 2EIDA 5L4MA 2GFBA 3L3GB 3FRPB 3CDYA 3WKYA 3LHPH 4R7LA 4KH9A 2OW7A 3FNKA 5EUKA 1FL3B 4QTIL 3V6FB 5BVPL 2DS4A 2J1ZA 2Z92A 1R3LB 2P49B 3EDFA 3HG1E 3N91A 3A6OA 4I3RH 4O58H 1AHWC 4E2OA 5HPMA 5CJXC 3QPXH 2YWZA 3POHA 1XBRA 3PGDB 5HDBF 1ZT7B 1XEDA 3G5VA 1J0JA 5F7DA 4P46A 4UIKL 1PYWB 4O2FA 2R0WL 2YN5A 5KTEL 3FB5A 2XVBA 1DBAH 4XBEL 1UH4A 4ANWA 4DK5A 3GSRB 2LVEA 1NAML 4CW1A 3W5NA 5DRXB 2EYRB 3BUBA 3LXUX 1AY1H 3H42L 4KXZI 2X4UB 1S9VB 3QXDB 5CKAA 4ZFQA 4Z3EA 4WENB 4M61A 2EUXA 4DUVA 4N25A 4Y9CA 3UTSD 4RQQB 1J05B 3ATBA 3C2SA 4GQ9H 3IU4H 3MOAH 4LU5H 2Z91A 4HPYL 3W9EB 1BXVA 3KBPA 2K9FB 1AQMA 3UTPE 2P1YA 5C6PB 1HHJB 5B7FA 1MHPH 4XCFH 4AYGA 3GMMB 5DYFA 2DQMA 4WCYL 1UATA 4MNGE 4G5ZL 1S7SA 2ZPKL 4HD9A 1Q9WB 5C3TA 1BQLH 3LY6A 2EDOA 4L4VE 5HVHC 1U91B 1BZ7B 4JE0A 5LXVA 4R4BA 5IGXL 3HBZA 1YQ2A 1MCSA 1UOLA 2F74B 2ZSVB 5A2FA 4CU6A 4P2OB 4QR7A 2XTJE 2O1AA 3TN0B 4JDVB 1IBGL 1FUNA 4HG4K 5CGTA 4KJYA 2G75B 4NO2A 2NLJB 1E42A 1Q0EA 5EO1B 2IJ0C 3HZKA 3F7RA 4IHBA 4YXLH 2KI6A 4GRMA 3WSQH 3TT1L 3H6JA 5DA4A 1P7HL 3CD4A 1UFGA 4LNVA 1KIQA 1VESA 3MRCA 1MRFH 3ARED 4ODVL 4MRBA 3PUCA 4AXWA 3OZKA 3VWKA 1CWVA 3SZ6A 3CFUA 4LF3A 1WZMA 1VADA 1KXHA 1UVQA 2LLNA 1Q8MA 3LXAA 4HPOH 1BW8A 3FXIC 2OSYA 1XB8A 1HQRB 1MREL 4Z7VB 3SDXB 2Y5TB 5IFJA 3L1EA 4KJQD 4ES8A 2UYLA 3ZZ1A 4I7ZC 4HKBB 2H3NA 2KZWA 1RK1A 2JKIS 1H3XA 1KCBA 3OGCA 4M3JA 4WO4C 1XTMA 3QQ4A 1SYSB 1KLGB 4QTFA 1MW2A 3LKSA 4RGNC 4U7KA 3H0TA 2W8CA 3HE6C 2OCCB 4B9YA 2X9WA 2NQCA 2DLGA 4JGNA 4WGWB 5KJ7E 1D5BB 3BFOA 1PFCA 3II3A 4LKCB 2ITFA 4HAKA 3BO8A 4PHZA 3MA9L 3TFBA 5G4NA 4YUEH 4QOKB 5L8LB 2K70A 3BN3B 4KKLD 5LBSH 3T71A 1PLGL 3MUJA 2JKWA 3AITA 3IETB 4I48B 2J1WA 1SXBA 5F93C 1SY6A 5I0VA 4A2MA 3CQPA 3TBTA 4RGMC 1N0LA 2ADGA 4OF3A 1I7ZA 3SKOB 1TG8A 2B1AH 4GAFB 2EE2A 1UKSA 3OZLA 4X5XB 1FBIL 1JUFB 5C08E 3QAZB 1KOAA 1QZNA 2J44A 3WY4A 1IGYB 3MZGB 1MFDL 4KKBC 3WKQA 4DOHE 5GZNA 3OKYA 1BQUA 1AE6L 1KLUB 3EXJA 2VDLH 2HX8A 2Q8BL 4ZMVA 4GSUA 5GZOD 2X9ZA 3EHBC 3N1GC 5T1DL 5BS0A 2ARJQ 1HL5A 2HRGA 1KGWA 5E5LA 1TLKA 3IAQA 1EHNA 2ZIDA 1M2OA 1NC2A 2FBRA 2XX0A 2ZKWA 1MOEA 4KNTA 1DVFD 2ZOTA 5J8OA 1G0YR 2SODB 4NUGL 5C08A 1UUNA 1XWVA 2E27L 5EEVA 2VW7A 1E4KC 1GAFL 1ZGLB 2CUAA 3Q6GL 3WI9A 4NS0A 3ZDZF 5GGRY 2OJEB 3TIEB 1MCKA 1A3LH 3N1PC 1TVBB 4Z7WB 3EG9B 3GMPA 5AUMB 4MQ7B 3K3QA 3PDOB 3F3HA 3BVXA 5K9QI 5EU3B 1UACL 3RIKA 1TQBB 5FYJD 4JO2L 4L3EB 3VW3L 4FYQA 1BOYA 4GG6E 1LK3H 1Z9OA 4DK6A 3D3VB 4MGXA 2UXVA 5T33L 4M7LL 5HGHA 4GKZB 3GLZA 1Y18A 2EVHA 1T0MB 2C4FU 5B38B 5KZCD 1SMDA 2C9QA 3QQ3B 1MF2L 1LO5A 1EZUA 2Y1VA 3LXBA 3TNMB 3WXVH 4URTB 1KFAH 3D2UB 5IEKA 3K0WA 4LOVA 3TO4A 1SGKA 2NY6D 1OQOA 1X5GA 3DPBA 1M7DB 2GTWA 1R3JA 1UM4H 3K72A 3L5JA 5DZOA 3HFMH 4UM8A 1XGUA 3TBVB 4EI5B 1RZIA 4DGUA 1ACCA 4E9XA 5IOPB 3QWOB 1NCDH 3UC0H 2OSLA 4PVNA 1WS8A 1ZK5A 2R29A 5D93C 5AOLA 1MIEH 1AJ7L 4KVNH 4CGTA 3L3KA 4PY8I 3MGTA 4HIIB 4GG6A 4PJCE 5HYIA 3K6SB 3NRFA 2OCFD 2ODIA 2YA2A 2PETA 2XKNA 4EDXA 4F7MB 4NNYA 3WLBB 2LAAA 5HYFA 5KSBB 2GHWB 2WVVB 3DX6A 3M17A 4UV7L 4W9EC 3RL2A 4Y5VA 3KPMA 5H94B 3ZRFC 1RZGB 3RI5K 4LPWA 4WFGE 4XXWC 3T0WA 4ODSL 4GT7A 1FVDA 3RGVC 4RWHA 1OSPH 3KJ6H 3MMEA 3OZ9H 3Q8EA 5AVTB 4M7KH 4X7TB 1M6OA 4YHPA 1V10A 4M6OH 3FTUA 4Y1SA 3HMXL 3OPZH 2MNUA 2PYEB 4F37K 3LV3A 3WL9A 1XGPA 5CZVH 5ALCL 3FC8A 3PNWB 4PJCA 3Q01A 4EUPB 4G42A 5CBAA 5D6CB 4TKWA 1PKOA 3LN4B 3QA3B 1BOGB 4UAOB 4HT1L 4Z7NE 1GW6A 4IOFD 3QJQB 4BHUA 4ENZA 2HFFA 3BLKA 1X5IA 1BA9A 5D7JC 2G2RB 1GY2A 2V17L 3L9YA 1P0SE 2H47C 4YDIL 3TVMA 4FG6C 5FYKU 2HKHH 3LEVL 4I5BB 3QE5A 2EEXA 4OLYL 4POUB 1U8KB 3CUPA 2N1TE 4JN1H 2EE0A 2VSKB 5KYUA 5KBLA 4P2RD 5T1MB 3B2PA 2O30A 1P6AB 1P7KA 2D3NA 3ZQXA 1J5OL 1HZLA 2YD3A 2DD8L 2ITEA 4H8UA 4FFWD 2DTMH 4IBVA 1YUHB 5B39B 2I85A 5E2WH 5EBWA 4CSTA 7TAAA 3VFSB 1F5WA 4UYPA 3BKYH 4Y4HC 3LD8C 3K1KC 4AEIH 1ET8A 4ETQB 1M4KA 2K78A 1T80A 3BE1L 1EA9C 4JX0A 2A9CA 4PRAA 3BVUA 2X38A 4HUWB 1TQCC 3QIUD 3CSGA 1AD0B 5H4YA 1FCCA 4TL4A 2PNDA 4FQLH 3EFFA 2E74C 1IIKA 5IMLA 1YG9A 2J8UF 1TETH 5H2BA 4Z5RA 3ZHDA 3C08L 4F2MB 1XCXA 3D25A 3MVSA 4F8TA 2WQXA 1Z7JA 3U0TA 3DXAD 2OTUA 5HBBA 1RK0B 3LKNB 2Z31A 4B9IA 3LZQA 1N59A 4ZFZB 1W0YT 2NUPB 3PQYA 2XWXA 2XA8L 4U05A 3O3DB 5JPMB 1BVLA 4XPHH 1XGZA 2N7BA 3H6AA 4M48L 4GQPH 2XYBA 2GSMB 2AHIA 1B9KA 2A7BA 1U8IA 3QWNA 3AGWA 4FKEA 2B3IA 3QR0A 2C4FT 3OKOA 1UB6B 1I8MA 4X99A 3VFUB 2HTLD 3RTQD 2L3BA 3RYMA 5DD3L 1GOHA 1RZ8B 3QIWD 2XQYA 1QYGL 4MKTA 5D5ME 3WNPA 5D4QA 4ZUSA 2P26A 3C9NA 4EBQH 3LRLA 4M1GH 5GGVL 1VENA 5DJ2A 3UPCA 1DBKL 4DO4A 3QJZA 1OARL 1GSMA 1G7QB 1MG2C 4KY1L 4UU9A 4KRMB 1BEXA 2UUDK 3MI6A 3B9DA 3IJYA 4NN5B 3TV8A 1NOAA 4XP6H 4BQ8A 1D6EB 1FF5A 3BKCH 2WXRA 1KJ2B 4GAJL 1R17A 5AYUL 5JW3L 1BVKB 3I6LE 1RUKL 4NQQA 2OA9A 3O9WB 2V7NA 3V0WH 2DM3A 1CPUA 4X4KA 2AJZB 4YEEA 5ANME 2V2XA 5D5MA 5B1AB 3ECQA 4D0DA 4CGUB 4U1GC 2YMXH 2D0HA 2JKJA 4N22A 2DIAA 4NP9A 4LVNC 4WIQA 4O4YL 5I1EH 2LLGA 4XRCB 4HISA 3QG7H 4XPTL 3DV6A 3BPLC 4X4XB 1TLMA 2B1HL 1T6BX 4PJ8A 2VLLA 5EOCL 3QEQE 3MO1A 5TQ0H 4ERSL 2IH8A 5C8JB 1I1YB 1NWOA 1CYGA 5IP4A 2XG4B 3KZ8A 1I8IB 1GTFA 5GRJL 1MCOH 1LEIA 4R5VA 5TK4A 5GGRA 1SQ2N 3RA7H 4XBGB 1NC4B 4NHUB 1NPJA 5SWSA 1FWXA 1WUNT 2OZ4A 4MD4A 2ZYRA 4GAGL 2XWRA 4PREB 1AI1H 2W60A 4NERA 3CZFB 4HAFA 2E76C 3LNDA 4M8RA 2DMBA 2V3EA 5L2JB 3LZFL 3ZR5A 3LH9A 3LQAC 1CICD 1AOZA 1XF2A 2JCWA 4NQDE 4KKRA 3GBML 4DVBA 3UDWA 3TCLA 3WUZA 4EIUA 5D1QC 5EA0L 1TT6A 3VQ1C 3EGXB 4HS6B 3DUSA 2PO6C 3HZYA 3DHJA 4LSDA 4QLRA 3M7FB 1G7LA 4NJ9L 5KN5B 3QXAB 3BKJL 2WGNB 1MJUL 3TJHC 2BHZA 2Z1PA 2C26A 5E56A 2J2ZB 5E1GA 1DVXA 4X7DC 4GXVH 1RMFH 4DGWC 1EMTL 3DUHA 2ZOLA 3A0OA 3BGMA 1MEXH 1KGUA 5JLZB 1HNYA 1K2DB 4K3JH 4K94H 5DYOA 1LMIA 1NGXA 1YSOA 4MAYB 1ZD6A 3L1FA 2X9XA 4NQDA 2FEEL 4U49A 3SB3A 1LE5B 1RHHA 1HI6B 1PLAA 3QO1B 2GG1A 3CZSA 3QXWA 1EDYA 3AG2B 2KPNA 3QARA 3KHQA 3WGVB 4AGPA 3DSFH 2EDFA 4UDTB 3HC0B 1N6QH 4OCNC 3BH9A 4HKZB 2ZUSA 3MX0B 4NRYA 5IBUG 2H6PB 4K15A 5CN2A 5DU7A 3L17A 2JIXD 3Q2LA 3P0YL 4Z7UF 4M7ZB 1F58H 1X9UA 1WSST 5DZLA 5FR3A 1JXDA 3EO9H 5I6XB 4JQIH 2H0PA 5FOBA 2CDFB 3MRIB 3KPPA 4B50A 5FDWA 2CXKA 3B37A 1OSEA 3A4FA 3G5ZA 4K5OA 5C07D 2W0FB 3RDTA 1EGJA 5AAWA 2XC8A 3CMOH 3H9SE 5AB1A 4JKWA 4L18A 3GBDA 2XETA 1DVYA 1L0PA 4ODBD 1FA4A 1T1ZA 4A2HA 4UT7H 1MFEL 4LCIH 4BDVB 1M7UA 1ZHKA 4LLWA 4BXSV 4L8CA 4JJ5B 1H3GA 3ELQA 5SX5H 5JZ7D 5L7XH 2C3VB 1KPUA 3EYQD 4WAFA 3ZIYA 3VTAA 1A14H 3NJIA 4FQJL 1VZIA 4P07A 3RNQA 3QCVH 4QYOA 4QXUH 4PWKA 4Y5XB 5JPNC 1U95A 4NBYB 1BREA 5HYSA 2VSMB 3PHQB 1F4AA 4XN1A 2B59B 1I75A 2VJ8A 3HPJA 3H9SA 2KL6A 4X2UA 1T0PB 4HXAH 4PSPA 4PW4A 4XBPA 2R69A 4XMPH 4M56A 3S2CA 1X4YA 1B2WH 1A6PA 1T03L 4AJVA 3HNVL 4LCUA 1FHGA 1H5BB 1A9BB 1AGDA 1HAWA 1PDKB 3MNWA 3IFLH 1B0RB 1YEDB 1XF3A 3EJSA 2XOTA 2ZXEB 3FQYA 3B2DC 1XGTB 2OMUB 2PMZA 3GSNA 3HR6A 2B7DT 2VDQH 4NNXB 2R0ZL 5C97A 3CH8A 3NSCA 4MYWB 1S9YA 3X3FH 4NKQB 4OVVA 2BP0A 2WNWA 4MD5B 2Q5BA 1A6UL 4BELD 4IBYA 4OZHF 3Q2WA 3B9KA 1Z9MA 2E9JA 3OB8A 4WEUD 3DIDA 1C5CH 2GCYA 2D31B 4FJ6A 4YR6A 1Q9LA 3G04B 3RFZB 2GPZA 2ZD0A 4LP8A 1XT5A 1R5IB 4PFEA 3SE4C 1VKXA 1JZDC 3BDYH 1IE4A 4E41E 5DEGA 1B0GA 3BKMH 2VDRH 3UG3A 1DLHA 2N0MA 2C5DC 1OAYH 4GW5A 1OGPA 5B22A 3SE3C 3VXRB 1FFOB 4FFYA 2DF3A 2L7UA 3TPKA 4ZS6C 1BBJB 4XH2B 3T77A 4Z7OB 1F6AA 3F58H 4ZPVA 3IDYB 3RVTD 1XGYH 1UJ3A 3T3PB 4QHLA 1I3RA 1WBYA 2BSCA 3CBJB 4G8EB 4EF3A 1R6VA 1MIMH 4OQTA 2CO2A 1BVOA 2VDPL 3GSOA 5MEOB 1CF8L 2VKXA 4JG0H 1AZNA 4DP2X 2NQ3A 3ARBD 4JUSA 2WZPD 1PD6A 4D0BB 4N4YB 1MAMH 4PRNB 4V11A 5C0JA 4YSAA 3V6OE 5MERA 1PLCA 1HXYA 1OAXL 2CBMA 1XR8A 1EJFA 1QUNA 3AUVA 4HWZB 4QHKJ 2WD0A 4N2BA 3MV7B 3U36B 4XNUH 2ZICA 1OE1A 4OCWL 1RULH 2JI2A 1JZJA 4R96B 1X5FA 4V1DA 5DO2C 4KZEH 3TEWA 3PWLB 4NKOB 3BFWA 1KXTA 1I9IH 4AQ1C 4O02L 3TNNA 4PJHB 1CU4L 4MBOA 4QHUB 5ETUB 1SDYA 2Y1ZA 1KTRL 3EOAB 3K8MA 1I1AB 3HCVB 3TYFA 1T0NB 1SBSH 3V6OA 3INUL 4UQ2B 3GIVA 4Y16A 3G7TA 3TEXA 5F1SA 1XV8A 4NQXB 2VERA 4JGUA 4OY9A 2WXHA 1XF4A 4IIZA 4LSSH 4AJ0A 1R3KB 1T2QH 3QDMA 3Q1SH 4OGAC 4J4PD 2NDGA 3HHMA 1G84A 3NCCB 4HZLB 1AG0A 3HR5A 3U1PA 4LHJB 1KJVB 1TJHH 5IFHL 3THMH 1NJ9A 4BSVB 4X6FA 3K5RA 4HZ1A 2ILLA 4NQCD 1CK0H 2UWEE 2VAJA 2APVA 2CK0L 3E0GA 3KYAA 3RWHB 4Z0BL 1BZ8A 1LO0L 4R83A 4CMHC 5AW8B 5GGQH 5C71A 2PCPA 3KVDD 1XR9A 2G4GA 4XMVA 1JWMA 4X7CC 4NZTL 4KDVA 4M62L 2OK0L 2BHUA 1N12A 1IAKB 2WBWB 1K4DB 4FMFA 4HUKB 5AW6B 3CDZB 3P30H 2DPKA 3M07A 3BZ4B 1LO4H 4JGJA 2OMYA 3O8XB 3PS6A 2X70A 1TU2B 4GNKB 4OZ4B 3IJEB 1KYAA 1S3KL 4JFEA 2X4OB 1E6JH 4NM8L 1MRCH 3LOWA 3BIKA 2VXTH 1FL6A 2UWEA 2BVTA 3WFDH 1WCBB 1B4LA 3P4NA 4GKNA 4XZUB 5I75B 3P9WB 5JR1H 3UTSE 2DV6A 2NY7L 4JY4B 4XO8A 3BZDA 2C9AA 4Z3GA 3AG3B 1CXLA 3MBXL 2C1OB 2WQRA 1BF2A 4ZDHB 3TS8A 1WWWX 3FN0H 3L1GA 5FYLL 1PNDA 4F2FA 1KF9B 4GUQA 3PWJB 4XI5C 3MLSH 4UOJA 2QV2A 5HGDA 1KY6A 3OR7B 4OLZL 1AZRA 3ZT6A 1LE9A 5E2JA 2J55A 4CA4A 4OV5B 2Q76B 2GAZA 5T5NG 3BISA 4GQRA 2VKWA 4PJIB 1FZMB 3IDXL 3TGXA 4P06A 1DLFL 3UTSA 4C54A 4P9MH 4BH7A 1J12A 2DQTL 2EZ0C 3EJYD 5F7AA 4HMEA 5GHWL 1S78D 1OCOB 4L29A 4RWYH 5AOIA 5C0BA 4KAQL 4NAMA 4KQ0A 4EI5C 3ARDB 4JUTA 5AKRA 4HCGA 4N9OB 4NN7C 2VL5B 4NZ8A 2CKBH 3WIAA 5T1JA 1RFDL 4P5MB 1DQMH 1T1XA 4J28A 4GUOA 1F4YH 2YAEA 3WGUB 4LPTA 5T1LB 1C16B 2YAHA 1IQWL 5DD6B 3D85D 4FZEL 4JHBA 1TKWB 3BRFA 1KTDB 1E5YA 1KT2A 3ZQ9A 3SBWC 3OAZH 4PTTB 5HHPB 3HI5L 2PW1B 1U2YA 5ABAA 5CN1A 2XU9A 4BIKA 4JFQB 1XH2A 4KNSA 1CFQB 1O7VA 4OLVL 1H8OA 4XMKL 3S4SA 2HPOA 2J71A 5CJ5A 2WP3T 3QUML 1GSKA 3AREA 4F58L 1MCIA 1HZHL 4PLKD 4LOFA 3KG5A 1G1YA 1E9QB 5I9QB 3MN8A 2YGNA 1P7QA 3NCYP 4LLQB 4EJ1C 1GZHA 1OF0A 3T0VA 4M43H 2XYCA 2UXFA 1UKQA