3AU0A

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
339
structure length
339
Chain Sequence
PVVNVADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 85
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A02
4FJ6A 4LEEA 3IRZA 4JDZA 1R19A 4JDZB 4LE8A 4B60A 3AU0A 4F27A 4BBWA 3AT0A 2F68X 3IS1X 2Y7MA 5IHWA 1R17A 4MBOA 3IS0X 4RMBA 4F1ZA 2Y7NA 4MBRA 4F20A 4JE0A 3V10A 5CF3A 2Y7OA 4F24A 1N67A 2YLHA 2F6AA 2VR3A 2Y7LA 2Z1PA 5CFAA 4B5ZA 2RALA 4LEBA 4Q6KA 3ASWA 3IRPX
chains in the Genus database with same CATH superfamily
3OHXA 4P2QD 4EI5C 1FVEB 1R0AH 4QYAA 3FT2A 4OW6A 2GYSA 1ZPLA 1AMXA 5K9KA 2FZ3B 1I7ZB 2MKLC 3LNEA 4M4RA 2YAMA 4W6WB 4F58L 2NY2D 3KEHA 4DQOH 1U3JA 1YEGL 2WZAA 1OTUC 3L3DB 1E2ZA 5HI5D 2ROYA 4FQJH 4RMVA 3LB6D 3MOQA 4TXVB 3UBFA 4TKWA 5KBPA 5DRNB 3SYOA 4Z7NE 4Z3HA 1NGQH 4OLVL 5KSBF 1T0PB 4PHZA 1INEH 1GZQB 1T1YB 2VJ0A 4KDWA 2WO2B 4OD1L 4LPUA 4QXWA 1SMOA 3T65A 2NT0A 3LPPA 2YD0A 3BCFA 3MRLA 5GRZA 1OOWA 1XGTB 2E47A 3MRRB 2EEXA 3BPOC 4L1BA 4ZXBD 1Q4NX 4OZFA 2OMUA 2J88L 5LKNA 4YNYB 1U93B 1HAUA 2Y2TA 3EO0A 3FBKA 3DROB 3LKPA 2AVGA 3ERXA 1UZ8B 4FQ1H 5DJ6B 1QSFD 4KWUA 3ULUL 2X2JA 3EGXB 4HS3B 4CNIB 2P5PA 2A6JB 4P5TA 5HYFA 3CVHL 2DQDL 2ADGA 4JM4L 4OF7A 3KYMA 5BUAA 4MXVF 2GCYA 3MPCA 4FCHA 2IALB 3GBNL 1N10A 2DY2A 1EGJA 1XF5A 2BDNH 3MLTA 3B7SA 1MCEA 1IZKA 1NAML 2FWSA 5CLYA 1TQVA 2IJ0C 1YEWA 2E8YA 1UM4L 4JZNB 3HRZA 3QUXA 3H6AA 3P2TA 1Z5LA 3LRMA 1A6VH 1X7TA 4MX7A 4PV8B 5C3TA 4DP2X 4A2DA 3PP4L 3T65B 4AEHL 2OL3L 3UPCA 2F7PA 4K23L 4ZX5A 5B1AB 3P02A 1G7LB 2OMUB 4RSYA 2PO6D 3LKPB 1QTSA 1YVLA 2CJTA 2UX7A 2NSMA 3GKZA 5IJKC 4PRBB 1AQDA 2VE6A 1KBGH 2IAMB 2J8OA 3CTTA 5L8JB 2P8LA 2H0EA 3VH8B 3WUWB 4P5TB 1H15B 4CC4C 4LCWA 1XXFC 1E5YA 4W9KC 5ANMB 4NT6A 1TJMA 1D5IH 2GT9A 4KRNA 2FEDC 4MZRA 1S7XA 4UF7C 1MZZA 1A7NH 4A2GA 2UXVA 2VZTA 1N59A 5HVWA 5I1GH 4XCEB 2NQDA 4NLHA 1AC6A 4PJBF 5E6UB 3NFSH 1U3ZA 4R97C 1XBDA 4Y4FA 4U0QB 5A40E 1AD9A 2JKNA 3MRQB 4ZS6C 4XT1C 3VFSB 4FZEH 4J5VA 4EAEA 5FWQA 3ZTCC 3VXUE 3HBQA 4QWWC 4J23A 4WI9A 3UZQB 5JQIB 3GGWA 4OSUH 2VAJA 2CR0A 4JY4A 4NO3A 1NIBA 1QX1A 2Y5QA 4HFUH 1J5DA 4ODUB 4BINA 4OFPA 4K3GA 5I1AA 1FZMB 3RBGA 3PP3H 4Z76A 1D2OA 1NDMA 3I2CL 5T1DL 1XHHA 2X05A 5I16B 2ALAA 4B9KC 1IO4C 1XGRA 4GQPH 1I9RL 1AQDB 2VE6B 1E67A 4WFGD 3BN9D 4F15B 3LPGA 3K80A 5JORB 4ZYKA 3STLA 2F54E 5IWLA 3I6SA 1NSNL 1T20A 4IRJC 3JYBA 4RGOH 5KVEH 4LCWB 2FYYA 4E5XB 4J2XA 1INQA 2JH2A 2GT9B 2DJSA 3VI4B 1UJ3B 4JN2A 3F7VA 1IM9B 2VABB 9CGTA 5GRYA 1HYSD 4CJ0A 4TNVF 4DTGH 3FZUD 15C8H 2X0UA 2FD6L 4WV1B 4MD0A 3FC8A 2D3LA 3TU6A 4ZBJA 4KJQC 4L3CB 4UBDD 2IPTH 4B97A 5LGJB 2X40A 3FHEA 1V3LA 1WUNT 3KPMA 4Y16D 5FGCE 3SKUD 3ZDZE 5FOBB 4JY4B 1U8JA 3EYVA 4FG6C 1L7TL 1DZ0A 1QRNE 3NEOA 4HV8A 4FQCL 4YE0A 4OGAC 5KSAA 3IU4L 4YHLH 4XGZA 3WEMA 4WKZB 4AM0Q 1NMAH 4JO2L 5DJCA 5I1AB 3CCHB 4ZMNA 4Z76B 1NDMB 2BWDA 4LIQL 2R0ZL 4H8WL 3WTSA 3CFEA 1XGRB 4FI6A 4LEBA 2WYZA 3FT4A 1G1CA 5HHOB 3GM0A 2V5TA 4G83A 3UTSD 2ZWKA 2VXVL 1S3RA 1NCBL 5F0PB 4MKMA 1BQSA 2B59A 3VXRE 4DVBB 1WEJL 3FB8A 1PJWA 3DNKA 4BBWA 2OM5A 2XKNB 2YGQA 3IXAA 3ECUA 3DX9B 3F7VB 4QHMA 4LCCA 1OF2B 2EABA 1AO7D 3VNYA 2PXYD 4ILDA 5E7FA 2VL5A 1QSZA 4N22A 3VB9A 2C4FU 3BP5A 1WIUA 5DQJA 3KEDA 3DMMC 3L4TA 3TA3C 2HFTA 1MJUH 3QWOA 2ZJSH 1EEUA 1OQXA 1RZFL 5GJTL 4U3SA 1U8JB 1YY8A 5D7IA 5E1AB 3EYVB 2VLKD 3FRPA 1S7TA 2COQA 4HJUA 5IF0B 2WVTA 4LLQA 3RWEA 1A9EA 1FL3A 1T0MA 4M9OA 4UZGA 3RWCB 3VW3L 2EXTA 4XH2B 3HZVA 1NC4D 1FFRA 1IBBA 1JVOA 4AW7A 1RZGA 5KSVA 4N90D 3SZKC 5JYLA 1DQML 5D96B 2JWYA 3UMNA 3ESUF 3F12B 5ISZA 1WFNA 5ACZB 3BZFB 1EJ6A 4JHWL 4JDZB 1EEZA 3IAGC 1SHSA 3NABL 3V0AC 3VFMA 3IDXH 1MJ8L 3B3IA 4HKBA 5HY9B 5EEVA 1PZ5A 1QUNB 4QHMB 1YMME 4DGIH 4DZBA 2BY2A 5FCSH 2EDHA 3DGDA 4XMVA 2A74B 2WLMA 3IFLL 3BP5B 1EXHA 4XO4A 4IRSA 4ODTH 5I6KA 1MFEL 3HKZA 3TZVB 4QTHA 4WI6A 3FKUS 5JHLL 3HE6A 1CYGA 2C3WA 3FPXA 1O7VA 3CDYA 3HC4L 4JHZA 1EQWA 2VERA 1S7TB 1ZVNA 4WNJA 3WS3B 2XRAL 1WGVA 1A9EB 2MOVA 3BEVB 3L5WB 4LLQB 4YDVA 2VISA 1BJ1H 2VN7A 2WLLA 3G04A 4V1DE 1M53A 5BVPH 2OAAA 1G7JA 4W68A 3GTTA 3A0OA 3ABMB 5C0AE 4CVXA 5I71B 4CVWA 2OTWB 1L9NA 5ISZB 4Y8AA 2EIMB 4Y9BA 5LNGA 1TTRA 1NANI 2I60L 5DC4B 5H2BB 1Z5HA 3P4NA 3VFMB 4JZJC 3GLAA 5EO0B 3UZVB 2UYLA 1OAKH 1OB1A 5I18H 2XIBA 2VW6A 4GPVA 2ZOKB 4ZODA 3D0AA 3S35H 4X6FB 2YD2A 1U91B 4IRSB 4Y4HC 3F58L 2HJFB 4N5ED 3PWUA 4QTHB 3HC3L 4OUOA 4L23A 1WWAX 4GKZA 4UIKH 2NY3D 4YHZH 1BD2E 4ZFFA 2R39A 1EUUA 3KS0J 3F7PC 5EU6A 1X5KA 3P3TA 2ZCHH 3HE7A 4RBPK 4M56A 2BHYA 4MDJA 3TTSA 1YN7B 4GT0A 1F13A 2WLLB 4YSSA 4PJIA 4RDBA 3QDGE 3JWNH 3SE9L 1RIVH 1X5YA 3PNWA 4ZMVA 4KQ4L 4P2OB 4WWKA 1P9MA 1KDIA 5DHXB 5AOKA 4KI5F 4NAJA 5MERB 4JPQA 3RIKA 3T6VA 2FNWA 5AW0B 4Y2DD 3P4NB 4FYSA 2UYLB 1J10A 2BFGA 1CFTA 5GGUA 1EAJA 1F3DJ 1E7VA 2AAAA 3Q8AA 1W6WA 5DJ0A 3U0WH 4PLJC 3RDTB 1BAFH 1NPUA 3IMUA 3KYOA 2OA9A 1LNUA 4XC1H 5KYNA 2IXQB 5DVPA 4S1SL 4TNGA 3UP1A 4G5AA 2X38A 3PWUB 3QQ9C 3AXLA 4KRPC 4DO4A 3ZN6A 5FFGA 3DPBA 2DQTL 2PPFA 3P9WB 4RRPM 5HDRA 4AYID 3ML9A 4NEHB 4RX4D 4UM9D 1MAML 3DBXB 4ZFFB 4NXSA 2WB7A 4FERA 2WW8A 5EU6B 2HX7A 3TURA 3OJ2C 2HT4D 1FL6A 3RL1A 2WXQA 4MRBA 3HUJE 1YEIL 5CGYD 1BW8A 1KGXA 1YCSA 1UOKA 1PKQB 1AP2A 4G7SB 5HGHA 3PNWB 1JI2A 4NPKA 3UCRA 1NICA 5D2NC 3GHEL 1VGEH 4HWEL 4N28A 5DUML 1CVSC 1ZLWK 4MS6A 3AFLA 5D7LE 3GBMH 4G7QB 1IV8A 3ZK0A 4D9RD 3GIZL 3KNBB 4PYHA 3GINA 3OAWA 4PCTA 5E8NB 3F62A 1VKXA 5DJ0B 1MFMA 4NUGH 4WUUD 3R0NA 2QSTA 5INCB 1S9YA 1T89C 4ISVA 3SE4C 4AV4A 3KYOB 4OI8A 2DI9A 2B1OA 2QVIA 4G1EB 5GZNA 3P0YL 3IDNB 1Q94A 4G1MA 5IFHL 3SO3B 5HI3C 3AXLB 3KLKA 1CFVH 3GSQB 2IVFC 1RZJH 4R7NB 3LS5L 3VDBA 1T03H 4N2DA 1BIIB 5I0VA 1S7VA 3IU3A 1LILA 1E2VA 3WKPA 1KIRA 3BXNB 4XPGL 1DBBL 4Z18A 2BVYA 3MJ9A 2YJLA 4I9WD 2GY5A 1FL6B 4KKRA 5DUBA 2HZHA 4L2LA 4LZKA 1B2WH 4LSSH 1Q38A 1URIA 2RTTA 1P4LA 4J3UA 3GMRA 5TD4A 5D1QB 2C3XA 3QI9C 1GYWA 4JFEB 5TE6H 2MEJB 2EDMA 3UJJH 5FEBA 2H1PL 4CW1B 2IOMA 3FUFA 2G2PA 3BC9A 3ECBA 4FZ8L 4YL9A 1JZ2A 4R5TA 2F8IA 2NNCA 5I6LA 3V52L 4DPAX 1VKXB 1OGTB 3AY4C 1S9YB 4JLRB 3IWVA 1JL8A 4XMZA 4WTWA 3OLEA 1SJHA 3QFJD 1E30A 2IH9A 4K71B 5FA4B 3OZ9H 1Q94B 2C9XA 3WD5H 2H41A 1CDHA 4G1MB 1WHOA 1BBJB 4FFYH 4NKOA 4Q6KA 1D9KD 1TCRA 4EPSA 4F7CA 3UC0H 1X4ZA 4LKXA 1A6UH 4KV5E 4LLMA 4FFZA 1HNYA 3PIQA 5GS2D 5F0JB 4GAGH 4NKIL 3ZKQD 3DOIA 1S7VB 4TUOA 5C92A 1EBAA 4NIKB 4S1RL 3KLQA 2Q76B 2WOBA 2NY0B 2VKXA 2WBJD 5CJXA 1W72L 4OZHF 2BCKA 3THMH 3LKQA 5DUBB 1SJEA 5DZAA 3ZKXB 4MS8C 1FIEA 3MCLH 1UH2A 2I24N 2W0FA 3L4XA 5HI4D 3ZDZF 2CKBH 4AXWA 5GGSB 1P4LB 3HG5A 2Z1PA 1LD9B 1N68A 1ZHBA 2C4XA 3F65A 4PP1D 1R24B 1UKSA 1E5AA 4HF5H 1KGJA 5J89A 1QKZL 3ECBB 1H3WM 3ROOB 2F1EA 4I0PB 4PLKC 3VGBA 3ARPA 4YUEH 5GSVB 2XIIA 4R5VA 2JLLA 3B9KD 4JPSA 2PR4L 5DVKA 2DI8A 4DUWA 3ARDA 2BPBA 5JPMA 1P5UA 1FL5A 2WINA 2MPAL 3IMBA 4NKOB 4Q52A 1LQBC 3NCYP 4LLYB 5EF0A 4U1JA 4KQ3H 4JNXA 1MFCH 3FXIC 3PIQB 4HIIA 5DEFA 1E9QA 2VXTL 4PGDA 4JUTA 1IEBB 2XQYG 2NNRA 2CRMA 4TUOB 1ZEAL 4AYDC 5T1KA 1A3LL 4H0GA 5AZ2L 4UQ3A 2E86A 1Z32X 3CHRA 1SJEB 5CP7A 3ZKMD 4JDVA 2LHAA 4NP9A 3FTWA 4IGBD 3PL6A 3NJKA 2CBMA 2AQNA 1UA7A 5BJTB 1HS6A 4TSCH 4WHDA 4ZJ9A 1NBZA 3QQNA 3V6FA 1Z3GL 4UB0H 5FW7A 1DQJA 2Z91A 3OKDA 3BN9C 5HDOA 3VI3A 1CK0H 1U8NA 4HULB 1INDL 3HB3B 4O2EB 4PW3A 4AC4A 3QUMB 5DXWA 1EZUA 3HZMA 1C08B 3IJ7A 5D7JC 1JNLL 3RVXD 5JPMB 1FL5B 2WINB 1OK8A 3TVMC 5CEZL 4G8FB 2IEPA 2WVSA 4WW2C 3AUVA 3D4CA 4L3EE 3U25A 3FAXA 4ZMLA 1SFHA 3EFFB 4DERA 4ZNCD 1FFQA 3FZUC 1YEFL 1G6RH 1L0YA 4D94A 1THCA 5T1KB 2COVD 2XTSA 4Y2NA 2YOCA 3EDDA 1I1YB 2XG5B 3IETB 4OCXH 5CP7B 4ZW8A 1VJSA 2Z34A 1PF3A 3V8CA 3CDCA 4X6EB 3AS0A 1KGCE 2L7JA 3KPLA 1UD8A 4UTBA 3PL6B 5IJCC 3BH4A 2J1ZA 3K3QA 4AH2A 2QL1A 4K7FB 3S35X 2AXGB 2DLFH 5ICZA 4NQDE 2YLHA 3QUYD 4JDEB 4LIQE 5BOJA 4U2YA 3W38A 1RK0B 2OK0H 3VI3B 4GO6B 1DSFL 4KROB 4XZUA 4MWFB 4PJHF 2XYBA 3MUY1 4LT7A 3K0YA 1X9LA 2FL5A 3QEHA 4BWUA 5HHQA 3IPBA 1FGVH 1KPUB 4DETA 1OP9A 2QR0A 2D9CA 1SY6H 3LAFA 5IIEB 3LTVA 4YL4A 1D7CA 3PPEA 4D0BB 5GS1B 2VIRA 3MCG1 2O5ZL 1N6QL 4U6HB 2J20A 2CUIA 3HI6H 1DVZA 4P5TD 1G0DA 4K94H 2ED6A 5IB2A 3P77A 1FWXA 3G5ZA 1DVFB 1KACB 5GGRB 2Q3XA 1ZGLM 2AEIT 5TE7H 4ZNEA 5E8DL 1CC3A 2MHAB 4I87A 4RRPG 4XOCA 4EO5A 2BRRL 3H3PH 4ZSOB 4A38A 3KPLB 2LU5A 2JELL 4NZTL 4X6DE 3DJSA 3VG9B 5ADOL 5IZ7A 1CFBA 4AH2B 3KDPB 3T71A 4GI8A 4KAQL 1EANA 3QUXD 4ODSH 3TJPA 1HHJA 3D05A 1IC4H 1T4KB 4LFHD 5ICZB 1RJYB 3AGVA 3TGXA 3A6BL 1UB5B 4ZTOL 5L7XH 5K9JL 3HS0B 5B1JA 1RJCA 4F93B 4AW4A 3GMLA 4XZUB 1MCFA 3R18A 2FL5B 2XV3A 3QEHB 5IMLB 4ERSL 2EE0A 3X12B 4BFKA 1VHPA 3N6YA 2P8PB 4YXKL 5SWSE 2EP6A 3WY4A 1FFNA 1YG9A 3OG6B 1ILUA 3QDJB 4ZUWB 4PVNA 1HIMH 2VLJD 1YQ2A 5I6OA 2PR9A 5KSBA 2R8SL 2VLRB 1PIFA 1JE6A 1RIUL 1AVAA 3QHFH 3MNDA 4LHQB 5DQ9B 2EE3A 1DSYA 4R8WH 4AYGA 4KMTH 2NPLX 3NIFB 3G5ZB 1G6VK 4KZ0A 3RE0A 4WO4A 2EACA 3A4DA 4W9LC 3C5ZA 4MZ3A 4QRQB 2VAAB 1F45A 2AMUA 2R0WL 5E9DE 3VGEA 4Y4FD 2GJ6B 4L5FH 4PJEF 2EIZA 4WENB 3D0LA 4TLTA 4XNDA 4LKCB 4YAQB 1ZVYA 4WY7H 5EU7C 4I7ZC 4GI6A 2NR6A 1HT6A 3K81A 1CBJA 3FQRA 4A55A 2VL4A 4WFHE 4RDQF 3BSZA 3I6GB 4K9EC 4E9RA 2XWCA 4APQB 4QD2E 4WWPA 4N2BA 3P9LA 3L3GA 1T22A 2HWZL 4Y4KB 4IW4C 4TLKA 5DJ8A 1EEQA 3A6CL 3FTUA 1FC2D 1ZVSA 3NQKA 4HETA 3U2JA 1ZT4A 3GMLB 4G6FD 2V8LA 3E0GA 1XD1A 4NENB 1M1SA 2ZXGA 4U1GB 4U6XA 1EUTA 2F8OA 2WWKT 1CGXA 1TTUA 3ZE2E 1T04A 2GKIA 4EMZA 2K6YA 3GZKA 1X5XA 1Q0XL 4XNMB 1JGLL 3CZGA 1ODUA 1QR1A 1R5VB 2NLJB 5KSBB 3N41F 1KFGA 5CR1A 3QW9A 3GBDA 3OLDA 1T6WA 1JPSH 1IC1A 1KBKA 3S3SA 3FCTB 3ULVH 1GZHC 4WO4B 4NJAL 3FQNA 3IDIB 1VFUA 2G5BA 4UINL 3V5HB 3QCVH 5CJOH 2HUEA 5LBSH 4KRLB 3GKWL 4P2CG 1HU8A 1TZGH 3D0LB 3VGGA 5IEHB 4PS8A 2X87A 2NYKA 2E3VA 3DPDA 4PJ8C 1GZPB 3I6LE 5IB4A 4KZDH 3FQRB 1MVYA 3LSOA 1CXFA 4K7PH 5F7LB 1YLBB 4HS6A 2NY5H 5JUEH 5F6HJ 1UT9A 1YN6A 2X28A 1LEKB 3L3GB 1T22B 2LW3A 2I26N 3FCSA 1RZKH 2PTUA 3MV9A 3O3UN 4PJBA 5CLWA 5KSAD 3S0PA 5I6XB 1Q9WB 2O30A 3TV3L 3L3OB 4FABL 1UD5A 3B1TA 2EIKB 3O11B 2V9UA 4G71B 3C6LC 4HLJA 4JANA 3V10A 5F3BB 4WI7A 4Y2DC 3O2WL 4P23C 1X5GA 4DF9A 2ISDA 2X6CA 4RAHA 3UAJA 2VZOA 1JRHL 3ULUF 3ZO9A 4FNQA 2H0JA 1V7MH 1BZQK 3MUGB 3DRQA 3G5YB 4WHYH 4Y2LA 1PSKL 4G82A 3AQXA 4QCIB 2XKUA 1OAXH 2NX5E 3HS8A 3FQNB 2F7RA 5F7BA 1NCGA 5GRJH 2AV7B 2XQBL 4OCYH 5GSRB 5IQNA 4BFRA 2EECA 4KDVA 5MP6H 3TT3H 2LABA 4I18C 3H9ZA 1DL7H 3MLSL 2E8ZA 2XPYA 5T3XH 5I5JA 5IB5A 1L7IL 4YZWA 2HKHL 5IOPA 4CSSA 2XA8L 1AS7A 1BXVA 1DLFH 1F3RB 2QADB 1MH5B 3BW9B 2NSXA 4AQ1C 1WBXB 2DWSA 3FCSB 1W0WB 3JWDC 2C9VA 3EJSA 1DHKA 2EC9T 4LVEA 4PLNC 2L7QA 3L54A 4TPRL 2PCFA 2FT6A 1MWAL 3EJPA 2WVVB 2H5UA 2DBLL 1JWSA 3FHAA 1J9TA 1ZTXL 1JGVH 1UCBH 1CDIA 1R4XA 5CKGA 2JQAA 2QQKL 1Q0YH 2A7BA 1YEKH 4QYOA 1VADA 1GS7A 3UGEA 1X4XA 4KVCH 3L9BA 4DAGL 3WKYA 3DHUA 3LKNB 3K5SA 2VDLH 4HCIA 5C07E 1C7SA 1RULL 2YXFA 3CSPA 1IGCL 3VMNA 4Q6YA 3U82B 1SOXA 2BX5A 1SYSA 3DYMA 4BZ2H 3WIHL 3QJZA 3N40P 5DD0H 2HVJA 1E6OL 1CL7H 4AGLA 2WUCL 5IY5B 3V0IA 3CE1A 4WW1B 3SE3C 2CLZA 5AAWC 2LFGA 1RZ7L 2YD9A 3ISRA 3HE6D 5IB5B 3DA0A 1L9PA 1N0XH 4MB3A 2YRLA 4M7JL 2CKBB 1MVUA 2XV2A 5LVEA 4FXLA 5DYOB 2EDQA 3F8UB 3B7RL 5F93C 2QTEA 4LCUB 1JHTB 3Q1SH 4ZAKA 4Q97A 3QSKB 4NJ9H 2XWXA 3WTTA 2PCFB 4PGBA 4C4KO 4XPHL 1KTDA 1JWSB 3L3JB 1ZKAA 1XGYL 2B2XL 3CFKA 1TNMA 3NJJA 1FORH 1HHGB 2I07B 3HHRB 4FXGC 1PX4A 4C55A 4F33B 4QYOB 1VADB 2GBAA 2RA1A 2DW5A 1MPAL 1OGAB 2EC8A 3ASOB 3EOTL 5FYKD 3DI3B 4ZOBA 3UBGA 1SN2A 2KC0A 4R7VA 3EZ8A 3HG4A 5KYXA 3SO5A 3W2DL 1JNNL 1CVRA 4APXB 2EEBA 2FAUA 4OZFH 4FYQA 1HH6B 4NO2B 5L4IA 5I8EA 2Z0BA 1VRSA 1JJUA 3JV6A 1GKEA 4J4PC 2V17L 4NNYA 1KEMH 2ITCA 4A2FA 3KGSA 4DP5X 1LE9A 4XO8A 2Q8AH 5C0CA 5AB0A 4HUXB 2AJSL 1TFPA 2CLZB 4O2CB 3CBJB 4PBDA 5HDQH 2E6PA 3OKOA 5F1OB 1NGPL 3DXAB 4UMGA 1JWMB 3T5WA 2X7LA 3VYNA 3HG1B 1GAFL 4WFFD 1KPRB 5A43C 3HE7D 4ZAKB 1CGTA 1DBAL 4M48L 3VSUA 2FJUB 2BW4A 2RQ8A 3H7BB 2WNGA 3QR1A 1PDKA 3LEVL 5HPOA 1J48A 3IFNH 3MX0B 3CFKB 4HP5A 5F7HA 4D0DA 5IB1B 3OMIB 5HXMA 5JOPD 3KYNA 3N1FC 5AW1B 1DQLH 2J8UF 4WWKD 1R47A 2WXHA 2XPGB 3QQDA 1VFMA 4O9HH 5A2IH 3Q2LA 3ZDXF 4OCLC 4G5ZH 5EZLA 3H2PA 4XVTL 3I6KB 3X3GH 3KR3L 4OKVB 2JI3A 1QYGH 3AS2A 1IIKA 4WWID 3RGVA 3AQZA 4JFYA 4N8UA 2B1HL 2RALA 3CX5J 5FYLD 5I8EB 4N1CA 3CMOH 4H7VA 5T5FH 4B6ZA 3BESR 3JV6B 2APVA 4I77L 1M6OB 4DH2A 1LE9B 2ITCB 4P9HC 2WKLA 4X7TA 1KBPA 1RSFA 4YBQD 2B3IA 5F9AC 3VYPA 1J0ZA 4B9CA 1KYOK 1NDGB 1EXGA 5EOQL 1ZHKA 3ZKMC 4KK8C 1DN0B 3NCJL 5D7KD 1AZUA 4OCMC 4DPRA 1FZKA 2X7LB 4F1ZA 3FF7A 5M7QA 1KC5H 4FMFA 2RGSA 5L2KA 3P4OB 3NGBB 4X6DF 3UAEA 3D06A 5D93B 5CHNB 3DIDA 4U1SB 3TCTA 43CAB 5D9SA 1AH1A 2W0LA 2A3TA 4GAYA 1OLZA 4D0DB 4M6NL 1U3YA 4TS6A 2G75B 3KYNB 4BH8A 4OU3A 2W9LA 4H44C 3WGVB 4LVNC 3NSYA 4GQ9L 5F8QC 2JTDA 2J56A 4YPJA 3SODB 3HI5L 2FHBA 1QNIA 4I2XE 2BFVH 2AK4D 3JV4B 4PIBA 2HKAA 4CVZA 4JQIH 2CO6B 2D4DA 1WITA 3BH8B 2NNXA 5I66A 4FQIL 5GZND 1YECL 3P2DA 1WTGT 4BK4A 1X7QA 5EORH 4Z3EA 5CGMA 1GYVA 3CZLA 5GRXG 4X7TB 4BELD 1CIUA 4Q9RL 4ELME 2DB8A 4J3OF 5FLUA 2GITA 3W9DA 5E5MB 3TFKC 2CDEA 2OSYA 3GEWB 4M8QA 3WFDL 1KY6A 3LDBB 1WAAF 4QOKE 1HX0A 2VGLM 4U3CA 2XXCB 1URLA 2P5EB 2CRZA 1BZDA 4MJ2A 3EDJA 1G5AA 2ZNWA 2WIMA 2K6ZA 4HFWB 4JKPH 2AJUL 1XR9B 5EF3A 4NDMA 1L9OA 5C0JA 3AJ7A 2DQGL 1YRKA 5GRVL 3IJHA 4GAYB 1HTYA 2QMJA 1FV1A 4MMYA 1CLOH 4RZCB 4MDIA 3SE8H 4I3RL 1BM3L 4OR1A 4XPAL 3L5XH 1PD0A 2IGLA 5BRZB 3M46A 2KYIA 4OF3A 2HG0A 5CU9A 5LHDA 2NY7L 3L7FB 3RWJA 3GIVA 1EHNA 5JQ6H 1IAMA 2WK2A 1MWOA 4IM8A 3WO4B 3KVQA 3NACH 4P5TC 4E42A 2V8MA 4DEWA 4AV5A 5HJ3B 4ZPTB 1FZOA 3C6SA 1AS6A 3KBFA 1U0QA 2D7PA 1QLEL 1WT5A 5HYSG 1OTSC 4O02L 2CA4A 4BHUI 5AB9A 2E75C 4FLSA 4RNRA 4PYGA 4M8QB 5GRUL 3LQAC 3FH5A 5E4IA 2OMTA 3GI8L 4TQ8A 1MREL 1JXKA 5A2LH 1KZQA 1DBJL 5DQDH 3K6FA 4ZX3A 4HHGA 2Y6TE 3UYPB 3SKNB 3N44F 4X4YA 3WHE0 1T2XA 2ICEA 4BGDA 3H8NA 2MSPA 5L4MA 1HHIA 2QQNH 3ZX1A 1VERA 1FV1B 4MMYB 5DWPA 3IDYB 1OLLA 1H3PL 1DVYA 1OQOA 2BVQB 3EYOA 3QNYB 4MDIB 4OFYA 5CEYA 4NZFA 1KCLA 3H1ZA 3EAKA 3QEQE 5CN3A 4AMKL 4I0KA 3ZU8A 2YRPA 4K5LA 1YYLH 3RWJB 4F15C 3VXUA 2XZCL 4JL1A 3BUIA 3JUYA 2XKSA 4R4NC 2AV1A 3O6FA 4EZLA 2NTSP 3ALWA 4P2AA 4ACTA 3ARDD 2QZQA 2QQLL 3KXFB 2G3ZA 1UJ3C 5CXPA 1WLHA 2ZAIA 4XMLL 1KT2A 3FU3A 3T8VA 3JSSA 4A1RA 4IIQA 3CAFA 1IBGH 1XCTA 2AJYH 2WB1A 2ZXEB 1ZS2A 3FUIA 4B7LA 4Z78A 2X1XR 5H4ZA 3WFHA 4YDLB 1RHHA 1MCSA 4ZD3H 2OW6A 2W88A 2PP8A 4BFNA 1XCXA 3TWYA 2OJ1A 1PG7H 2FJFB 1COBA 4LCYA 3QXDA 1FYTB 3VXNB 4BE6A 2RD0A 1WGOA 1MF2L 2YAQA 1DYZA 1GGIH 1YEJL 2JKSA 1YUHA 5E2TL 3SDDB 5J57B 3HEIB 5C86A 3EH3B 4TRPL 3UO1L 2JKIS 1IC5L 3FHQA 3VXSB 5GIRA 1ORQB 4OCRL 4FNTA 4B9PA 2J43A 3DX1A 4ZDHB 2X4SA 1KCSH 1GKOA 1KJ2B 5TGBB 4XOBA 1TMCB 5BV7L 2H7WA 2ADIB 4CBZA 1S9WA 2H1LM 4RCAA 2XU9A 4M4PA 4OZHA 4YJZL 3VXUB 2IH1B 4NZJA 3O6FB 1KLFA 1JGEB 5IWLC 3CXFA 3E9UA 4U1KA 4X5WA 4W4OA 3ALPA 1QLFB 1A6WL 1U8OB 3QQ3A 3QXAB 1IBDA 1IAKA 2NW2A 3GSWA 4AUUA 2ZX6A 4ZO9A 1QRNA 4OCNC 4KKZA 2IQAA 2X4PB 3P4LA 3OMAB 2OV0A 4HISA 1JWUB 3H9HA 2Z31B 4S1DC 2IPUG 4JO4H 2MRYA 4Z78B 4GAFB 5KANI 2EICA 1RHHB 1CZ8L 5GRVK 2B5IB 3L16A 3OAUH 1LEGA 3ZHFA 8CGTA 1BF5A 5TE4L 2E6QA 5C70A 2JV6A 4WAFA 3VFVB 3X1EA 3QZWA 4W9DC 4A63A 4N6RA 4AY0A 3KLDA 3U2IA 2PCXA 1WS8A 4W9IC 1IEAB 2G2RA 1YUHB 4WUKL 3VXRA 3WCYA 1JK8A 4IHOA 3BFOA 1GMEA 2FGWL 1KV3A 2ENPA 1KB9K 1VFBA 4UM8A 3UERA 2VDQB 4PUBL 4OZHB 4UOZA 1BVLA 3FUJA 5D96C 4DHLA 1A64A 3MBWB 1RPKA 5DZPA 1UGNA 3P9MA 5FX3A 3QO1A 2YC1A 2ZT9C 3V4UH 1BEXA 3GRBA 5A16A 5I30L 3CQQA 1GSMA 1EDQA 4X7SH 2NT1A 4TSBL 3JVGC 3GSWB 4DGVL 2VDLB 1XL6A 3IVKA 1XMEB 4HX1A 1MG2C 4WJ5A 1KTLA 1M9WA 4G8GD 1JDDA 2A74C 3H9HB 4KTDL 5IQ9A 3FTGA 4LPYA 4FDWA 1G9NC 4JRXB 2XFXA 5T1DH 3TBCA 4DKEH 5E5LA 1W6LA 5I1IL 2V7NB 2WD0A 5FYLH 2X42A 4OIFA 3TZVC 2EXSA 2Y36L 3BT2H 4AZ8A 3MLXL 3X11A 4UV4H 2DZEA 1LEIB 2J55A 3S5ZA 1SLWA 2EDWA 4N6RB 3SPCA 3ZZQA 4AQAA 4J3XA 1CGSH 2Y69B 3UC2A 3UTTB 2AZUA 3PQYE 1WTLA 5F89B 1CG9A 5DR5L 1AI1H 1FFTB 1JK8B 3UBXI 4XO3A 4NOBA 1YMMA 3L1OH 5CMAB 1HZKA 3PWLA 2XUWA 3BLBA 1A7PL 1ZTXE 3BKMH 3L5HA 3MRGA 4JFFE 4KY1L 4XAKD 1K5NA 5LWYL 2IANE 4BSJA 4HC1A 4TTDC 5DEJA 2N01B 2XVBA 3I9PA 4PJ5E 3MRJA 5GS0D 5I71C 5D70H 1M3IA 3U9WA 5FR3A 1F2QA 3P9MB 1OAQH 3V4PA 2ZP9A 4WTQA 4YQXH 3S9DB 4KKAD 1A9BB 3ZUNC 2QDVA 5IFJB 3RBSA 5EOQH 3DIVA 1QFWH 2DWYA 4PRHA 4DKDC 5AZUA 5EWIH 4LCIH 3I50L 4MFHA 3V0GA 1T1ZA 4YS4A 1TTFA 4V1DA 3PRZA 3SBQA 2R1YA 3EDKA 3GZQA 2XFXB 3Q6GH 1DVUA 2AQ1A 4IRSC 4NYLA 3AWEA 1JZIA 1HXMA 2L4OA 3C5ZD 4JHVA 5C0AA 2OTPA 3EFDL 4FHJA 5IT2L 3GDCA 2GFBB 2IBGA 3QZOA 4HWBH 3W37A 1MLCB 4JG1H 4AQAB 1RJLA 4XWOD 3SJVB 2FWUA 2J1XA 3MNVB 4JKMA 3GTVA 2NR6D 1CG9B 4XNYH 5HVGB 5D1ZI 4M3KB 5DVMA 7CGTA 2MMXA 3RVTC 4M6ML 2D7TH 3C5SB 1YPZE 4PWJA 4YHOL 4FQLL 4PGJA 2CKNA 4K9EL 3AWGA 1AR1D 3MJ9H 4MLSA 4XBPA 4P2OC 2X41A 5J56B 1NWOA 4JFOA 5LCVA 4N8PA 3DX4A 2AEQH 4N2OA 3LH2H 1RZFH 1HILB 2JCCF 4IBQA 5ALBL 1BD2A 2XWDA 1E9OA 4KOCA 3W0WE 3CSGA 5HHPA 1CTOA 1OB0A 1LO0H 2WGNB 2YGOA 4LP4A 4PRHB 1KB9J 4LSTL 4OGYH 1UQSB 4PY8J 3JTTB 5D4HA 5DEZA 3MVSA 3TBBA 3IJYA 3MREA 4Z6AT 1T1ZB 2FTAA 3VRIA 4PRID 3HNVH 5DT1L 5T1JA 1L9RA 2D31A 5H94A 2R1YB 1J5CA 3MRIB 2Z8SA 1SVZA 2UY7B 1YDPA 4NYLB 1DFBL 1XH0A 1HXMB 1V55B 2NZ1A 4P3WA 3HBGA 2YUXA 1JBJA 5AVVB 2W9DH 4PJHB 5C0AB 2WQWA 4QHPA 5GGQL 1DZBA 1UZGA 2PKDA 3FOMA 3KWVA 1ZGLP 4HXBL 1R3JA 2XCMC 1RSYA 4PJCF 4PJ6A 4YIQA 2LGNA 4F2MB 1BAWA 3GSRB 1QFUH 2X4RA 5D4JA 4XXWA 2FE0A 5DHVB 3LS4H 1EV2E 3NIGE 5CNHA 3QPXL 4LESA 3VWKD 4A2MA 2V2WB 2OZ4A 3OJVC 1OWWA 2IBZY 5C0BE 3MV9D 4HGWA 1FYHB 4WWKC 1P9MC 4IBYA 3P0VL 5CLZA 2A6IB 2F2HA 3X14A 3TWCH 4AM0A 4MQSB 3NFPA 3LEYL 4XTRD 4HOMA 2X6BA 2B15A 1JK9A 3UAJD 3M45A 1U3HB 3S5LB 2YD3A 3Q43A 3TF4A 1GCYA 3IJYB 3RG1C 4MHHI 4U6TA 4X8CA 3QIUB 2ZWSA 3S88L 3HUJA 4LSQH 5DK2B 4XPFH 1OGSA 3QZNA 4EKXA 1E4KC 2YARA 3UJTL 3KZ8A 2LR4A 4PMEA 4ODXA 1JF1A 2VLME 2JQZA 3G7TA 3AACA 3F01A 4BRVA 1M6UA 3ILDA 4Z1PA 2VDNL 5ABAA 1SM3H 1KELH 4YIQB 3GPEA 4JM2F 4ONOA 5D7LA 3HAEG 4MA3B 5FYJD 3V0VA 3N55A 4P0DA 4JG0L 1NFKA 1HHHA 1KTJA 2CCVA 2IDTA 2EH8L 3R19A 4NQSB 2GTWA 3BP4B 2FX9H 4JR9L 4X9BA 1R3IL 1AD0B 3HR5A 2MCAA 4QLWA 4OJYA 1HL5A 4YXLL 4FTVB 5FM5M 3VRLE 2IWEA 4PJEB 3X14B 3T2NH 1XH3B 1W8OA 4AM0B 2WNXA 2EQDA 1AGEB 5D2NE 5HBBA 1CN4A 1JK9B 3QJTB 3QCUH 4RWYL 2Z7ZA 4HSAC 4EUPH 1A4BA 2BIIA 1G1KA 3VWJB 4WF7A 1OPOA 1Z2KA 5JW3H 1S5HB 3K6SA 2CBTA 1NEUA 3D52A 1IQDA 2AF2A 3WSQH 4F8TA 5B38G 4PJXE 2NY6B 5EPMA 2IADB 1FLRL 4K71C 4LDLB 1DQDL 4NM4H 4MAZA 4PG2A 1YO4A 4ODXB 2QGDA 4BCZA 2N7BA 1T1WA 4FG0A 2Z4TA 3KPRB 1EAPA 4NAQA 1YNLH 3WS6A 1KOAA 2XICA 3Q06A 1LE5A 4KKBD 3FO0L 5AOJA 2WLYA 4XX5A 2OULB 4QRSB 4RMTA 4AMWA 1E4XL 4KJWD 2NY0C 3E3QC 2K1MA 4OLYL 3BOVA 1V3JA 3N41B 1AHWB 1SXAA 1AY1L 2C1PA 5FUOL 3ZKXC 2CO3A 3P11L 2MOGA 4S1QH 4KJPD 4L8CB 3CVHA 3FN0L 3HS9A 4GXUM 5JXED 2R7EA 2YAPA 2I69A 1PY0A 3U2SB 3HR5B 3TEXA 4MXQC 4KXAA 4DP9X 3SKJL 1D6VL 3BJ91 1KIQA 3N85L 1FNEB 4ZT1A 4PJ9D 1QHQA 3A22A 2FO8A 1NCWH 1MAMH 2R69L 2Z35B 3ILEA 4M5ZL 2EH7H 1KIPA 1NAMA 4LPWA 2EDTA 1XCWA 1OAUL 2NNFA 5HPMA 2ARJB 4I0PC 3PHAA 4PBVC 4M61B 2VW4A 1IQDB 4Y9CA 5IMOA 5IBUG 3A3YB 3BKCH 1XZ0B 3D85A 3EO1B 4JFHD 4K5OA 3WJJC 5CF3A 4LSUL 1H8NA 3TO4A 4EEEA 4M1CC 3QDMB 3U46A 2G60L 5DD3L 1CFSA 3T4AB 4DKTA 1NLBL 4D8PA 2OL3A 4DP1X 1L0PA 1M7DA 5D8JL 4KTEH 4MJ5A 5E4EB 1FZJA 3IDJA 4OF5A 4AIEA 2LTQB 4UDUA 4R7DB 1RK1A 5LQBH 5SV4A 1ZS8A 4ZW6A 3PGFH 5DLML 5DVOA 1MDTA 4QAWA 3FQXA 4U05A 4Y5YB 5C0CD 2E27L 4FD0A 1T7VA 2C1PB 1MCPH 1QBMH 1JZEA 3IXTB 2VT0A 1BM7A 3CVHB 4JN1L 1E8WA 5DJXB 2ZUQB 2EDDA 4QXGL 4LARH 1TQWA 1OAYH 1VLXA 2F53A 4RA3A 3UAAA 3OV6A 5DMKA 1MNNA 4UWQB 3ZW3A 3LPOA 2VR6A 4A7UA 2JMRA 2WQ8A 5E56A 2X1QA 5ITBH 2R29A 3OR7A 4OM1L 4ODHL 3EJQA 1CICB 3MV7B 3US9A 3R0MA 1X4YA 3ZY7A 2UVFA 1S9XA 3OJDB 3HB3C 4YH6A 3QJQB 1F11B 3OKLB 4UTCA 4G9FE 4UT6H 1L6XA 2FJGA 5GS0H 5JPMC 2CCLA 1BQ5A 2HB0A 3RGVD 3SPHA 1CFSB 3U0TB 3WNMA 5I28A 3MRKA 4D8PB 1HZHH 4NQXA 5SWZE 3NZUA 1M7DB 1MJ7H 4MJ5B 1L0XA 4EE2A 4C56B 1HJBC 1I8IA 3WHE1 2FWOA 1OP3K 2ZG3A 3HC0B 3Q8EA 2IGTA 3WFCL 2EDNA 1O75A 1ZS8B 4WIQA 3O6ML 3P54A 2PYFA 3Q13A 3CHPA 1XGQA 4Z7UB 3V4VH 3VSTA 1IGJB 1DJSA 3B2UD 4P9HL 4EF3A 2Q7NA 3U4AA 4GMSL 1T3FA 1D5BB 1OCZB 3ML8A 2Z0UA 3T4YB 1MUJA 3PL6C 2WMPB 3QEGH 1BVNT 3B2VH 1XXDC 2F18A 3FTVA 4F37F 5L2KD 4IBVA 2F53B 5E6ZA 1T5KA 3PNRB 4AYEC 1MQKL 4L3EA 4D0CB 3OGCA 25C8L 2Q5BA 5DMKB 5KG9A 2JK5A 2EE2A 2Q3ZA 4P48A 1NBVH 5GISL 5F0MB 4HH9B 1OF0A 1JNJA 5LN8A 4D9QE 5TQ0L 5BXFA 1YNKH 5KS9E 3V55A 3UDWA 5J11B 4KROC 2O61A 4HJIA 4TTGA 1YC7A 5DFTA 2FJGB 3G6AA 3MCKA 3O0LA 3HG2A 3MRKB 3TH4T 2ED8A 3TYGL 5J06A 1MRCL 1ZJAA 1Q0EA 2H2SC 3CFCH 1I8IB 3G9VA 4YDIL 4FQ2L 3V4LA 5CAYB 4NQDA 1RY7B 2CNZA 1DVFC 3OX8A 2J8UA 1G9MH 3B5HA 1KV7A 4E9TA 4NUPA 4MNGE 1EERB 1OW0A 2P3YA 4HW6A 4LVHB 2HAZA 3NQIA 4LLWA 3VG9C 3IS1X 3PWPB 1OIOA 3OLIA 3OGCB 3JQOB 2JK5B 5KG9B 4JO3H 3MLYH 4KZCA 5TDOA 5MENE 1TMQA 3JZYA 1UADC 4M7KL 1YPZF 3HPLA 2WJ5A 4FX5A 4XWGH 5DTFA 4YXHL 1UEMA 5E2VL 1J8RA 3QUZB 4O51A 5CN2A 1RK7A 1A3LH 3HS0C 2JCWA 4GSDL 4AJWA 1NUNB 5I0XA 4H1LH 1SXCA 3CN1A 2X4QA 3VXQA 3CHSA 3FCUB 3H9YA 3IE4A 4UQBA 3C75A 1F4WH 3O0RH 4MNHB 4X6DA 1NLDH 2C8NA 1EHAA 5GGTA 3CDZB 3D1MC 1FPTL 3PHOA 2BZ7A 4L8SA 4N3UA 2YSSB 3V7AG 2XPZA 3WMSA 2NQ3A 2MJWA 4GMTH 2NUTA 1KCKA 1VAHA 4XBGA 1OCCB 5T5NF 3CN4A 1G1YA 1ETA1 2J8UB 2QV2A 2W59A 5DZ9A 2O6FA 1JVKA 3ZDXB 1BG9A 1M7IA 5A2CA 3IJEA 1NTDA 4FYRA 4XRCA 4ICXA 1S78D 3KBPA 4ZX6A 4AC2A 3IGLA 1NPJA 3JWOC 4J8RB 5DS2A 5SWSA 2KZWA 2I5YL 4KXZI 1A6PA 4R4FL 1OP4A 3M8OL 3H85A 3UMTA 2J1YA 4APQC 5E94B 4AT6A 3BX7C 3D4YA 4GQRA 2YD4A 1KGWA 4YDNA 3Q5OA 4JG5A 3X1GA 4Y4KC 3NIGF 5K39B 2A6KA 4DT2A 1JZ8A 4POZD 5DJ2A 4MAYA 5JHLA 4NHCL 2ED9A 4U1GC 2X4QB 3BVDB 1FC1A 1NCNA 2JB5H 3LIZL 3DSNB 2GJJA 3TASA 3T6QC 3PF2A 4PRPB 3HNTL 3IB4A 1KGIA 1QSVA 4LL4A 1I1CA 4L8SB 4U3HA 1ZLEA 2VN5A 2CJUH 4JFXA 3BN3B 2D03L 5EEXA 3VFNA 2HJLA 2BOCA 2NUTB 3KVDD 2I9TA 1QNZL 1HXYB 1X6NA 2KZBA 4UV7H 4XBGB 5BVJB 1NFDF 1Q1PA 3DTXA 4OJEH 4JVPA 4WO4C 4LL9A 4Y9GA 3D30A 1MRFH 3NSFA 1M7IB 3KDMB 1B3JA 1P84J 5FHBL 3X1BA 4DZ8A 3CVIH 2XYCA 5TTRA 4YSCA 1S9VA 3DBSA 2OW7A 2DQMA 1G7MA 3ZMRA 2VCOA 3GO1L 2FRGP 2JXMB 4LRNL 3U9UB 3VCLB 1R19A 2F74A 4G2AA 3I75A 4JKKA 5F7FA 2F54D 5E1IA 3B56A 4LP5A 3FUDA 4AT6B 2QELA 1HSAA 1E4WH 2V9QA 4GO9A 4AQEA 2WP3T 4PBWD 2ENQA 4WGKA 3EYQD 3KMDA 5FO7B 4IQHA 2A6KB 2E5EA 3MR9B 5DJ2B 5BCAA 5I6XC 4LOUD 2HXAA 2JIXA 3L3OC 4TNFA 2QHLA 5KAQG 3RFZA 1RUMH 3G08A 4LU5H 2PW1A 3EHBB 4KZEL 1NBYA 1E6JL 4M43H 2H3KA 3D2UB 4MD4A 4WI3A 5CBEB 3OXRA 4RAVB 1NCDH 2IFGA 3CD4A 3RVWC 2FT7A 1P4IL 2ZQKA 2OMNA 1QRND 2WXNA 4ZTOH 5CBAA 5K9JH 3LN5B 3T0DA 2P24B 2NY1B 4GI9A 5B8CA 2JE8A 3I3DA 4PJGE 5FECB 4BFJA 1UA6H 4HGMA 4WVRA 4ERSH 4LL1A 1CD1A 3GUTA 1R3LA 3F7YA 4XX1E 4QTFA 4OD2B 5AG8A 2XZAH 5JOFB 2H32H 3L5JA 2QADC 4CVUA 3VXRD 4AQEB 2XFGB 4JB9L 4JFTA 1UWXK 5CD3B 1H0DA 1RPQA 3GRGA 4K8RD 1KFAH 1NC2A 4TUKL 1AG6A 3I85A 3KPOB 2EIEA 1LO3L 3D4ZA 1IGIH 2AZAA 1YEHL 4YDKL 3CFBA 2QEJA 2C1OB 2X3CA 1HQ4A 2NXZB 3G08B 4FQHA 5LAXA 3N44B 5D6CB 4Z7WB 5JXAH 3O45B 4WHYG 4NQVA 3IPEA 4XNBA 5I1JL 1PZ3A 2FQDA 3UCQA 5FWRA 2EUZA 3O9WA 2BMKA 4HYTB 3NZHL 1IU1A 1RUPH 1XV8A 2AJXH 5F7NC 1FRGL 2ZWZA 3HCVB 3K72A 4X83A 2WQVA 5IJVA 4D9LH 5A7EA 4YFEA 3QXVA 3GUTB 3U0PB 1ETZA 1R3LB 5F88B 1AE6L 1EZVX 2Q8BH 3EYSL 1G9NL 1N64H 3CK0H 1J5IA 2WAQA 4F57L 1KPVB 7FABL 4F9PA 3FRUA 3UYRL 4JCLA 4YHIA 1D5ZA 1V5JA 2W1NA 4K3EH 3F7KA 2EDXA 2BSED 2R4RH 4GS7B 1CFQB 4LASL 3GMPB 3A21A 5C07A 2WM0A 2IDCA 2ZD0A 3FQTA 1YMMD 4HKXA 1LWHA 1P6AB 5HYJA 3JTBA 5EZIL 1QHOA 4ICWA 4XBEH 1SBSL 1CDGA 2VLLB 1CI5A 3GXNA 1HQ4B 5DDHB 1T7YA 2JJTA 4KKCC 2OYPA 1MFBL 1FNSL 1RP9A 2KLRA 3ZL2A 4XNXH 3HW7A 3PGDB 3DX2A 3VTMA 4E0RB 4BZ1H 3O9WB 5F96L 1SPDA 3Q2WA 1UOWA 1MAJA 5DVLA 5BZDA 3K72B 1JZDC 4X98A 3SOBL 2WTRA 1MVFA 3L48A 3CFMA 4QR7A 3N42F 4B60A 2YLKA 4V1DD 3KLHD 2B4CH 1KCRL 1FJ1A 4XVUD 2JKXA 1OP5K 4HBQA 4KJWC 2DQHH 1OAJA 4YHYB 1I7TA 2HFFB 2K9FB 3DYPA 1RURL 1I85A 3T3PE 3UGXA 3IGAA 4LDCA 1K9TA 4H13C 2A0LD 4Z0XA 3GXMA 1HINH 4N8CL 4NQEB 1PSKH 4OJFH 5F7UA 4OF8A 2OPCA 4OCSH 1TZHA 4ZAKC 4H88L 3BRFA 4GG6E 2YGNA 2OX5A 4IKIA 1DJXA 1N18A 1WCQA 4GKSB 3SKOB 4XMXA 5HYJB 5JR1L 3EJZC 1T2QL 4BHUA 1HNGA 1CFNB 3GMNA 1GA2A 4MXWH 4YE4H 5TQ2L 3FN3A 1AGDB 3II1A 1W72A 5LG1A 3TNMA 3FUNA 5T8IA 4XN2A 3CQPA 2W80C 2VW7A 4YSQA 3BHBB 2CGZA 4CUCA 2CNYA 3WXWH 5MEQB 1BD2D 1T0NA 4OZFG 3O8XB 4BGLA 5KBKA 5E6IA 1IAOB 3P73A 5BZDB 1IB5A 4O58H 2WTRB 1JP5A 3V5DB 2VDOL 3GLDA 3A24A 4ZZFA 1QA9B 1J05B 2UZXB 3QDGD 3RPIB 3DDGA 4PLOB 3EXLA 4ZK8A 2B08A 3TBVB 2YXVA 4DKAA 4L0PB 3UGUA 4YBLB 4ABQA 5DRWA 4HUMB 3ATDA 5J12B 3IGAB 3QARA 4R7LA 4Z0XB 4R7XA 3R8QA 4GLRI 1CLYL 4L29B 4DQOL 4ZI8A 2ID5A 3K8MA 1PZDA 5I17A 1W0VB 3K5RA 5PCYA 3ZR5A 3NGBC 2ZG1A 4FQJL 5TDPB 5F2FA 1XF3B 3NSJA 3V0WH 4U4IA 3NG5A 1VFAB 3L3KA 3RWGB 4ZMOA 4XCNB 4YX2H 3GMNB 1GHFH 4QRUB 3MROA 4KVNH 4ZQTA 2CHNA 1INEL 1W72B 3GXDA 3MNWA 1TXKA 1LK3H 3J2PA 3V5KA 2LE9A 3CSTA 3L6FA 3HVDA 5DJYA 4L4VE 3I3EA 5HYQA 2EZ0C 5E6IB 4AE1A 1GOHA 4FQ1L 3EFOB 3MLVH 1LP9E 3T6ZA 5A1AA 3QAZB 3HN5A 4ES8A 3DHMA 1ZHNB 5EH1A 4AJ0A 4U1MA 5DMIH 5B4MC 4K3JH 1TJGH 2EC9U 2FR4A 2ZF9A 5DJAB 4P46A 4Z3TA 2RFXA 1P2CA 2WLHA 4IMKA 5CCGE 1UM6H 4MZ2A 2JCCA 1MPAH 1ZE3C 2OI9B 2Z7UA 3LDBC 4MA1B 4F7EB 3S3PA 5D7LD 2BDNL 4I2XA 4P4KA 3MKGA 4DKFH 2J5WA 2H1XA 5AZEH 4UAOB 2D8KA 4ORZC 1NANH 3JYCA 4UQ2B 1ML0A 3BGFB 2XV6B 1A6VL 2ZYRA 1FH5H 3BAKA 4ELMA 4EI5A 3LRSB 3S37H 4H1LB 3RNKB 1LWJA 4PJCA 2VDPH 4QOKA 3GSVB 3KGRA 1PAMA 4YGAB 4KRMB 1QBAA 2NNAA 2FATL 2APFA 1KBGL 3GRWL 3TEWA 4A6YH 1JPST 3QG6B 1NAKH 2R1XA 3WO4C 1WA0X 4U1MB 4AMXA 3D50A 2CO7A 5D2LF 4B41A 3K46A 4XB7A 3T1FB 2WXKA 3JV5A 1NWPA 1D5IL 3ES6A 4YSEA 4KI5C 1V10A 3S96A 1A7NL 1P5VA 2JCCB 4YC2B 4NZRH 4AV0A 1WISA 5I1GL 4IOIB 5LDSA 2UZIL 4OIIH 1BOGA 4V33A 1A3RL 1EEYB 5FA3B 2H2PD 3WJMA 4B5EA 1JYNA 5F97E 3BPLC 4FYTA 4P4KB 2ZYIA 4R84A 3U7AA 4BKLB 1UG9A 1GCFA 3BVNA 3ELQA 4FZEL 1TSHA 1R5IB 1P69B 2CQVA 1NGYA 1KJ3H 1Y0LA 2BIHA 4OSUL 4FF9A 2N4IA 3FB5A 3CU1A 2XX1A 4FTDA 4XODA 4IJ3B 3VMPA 2GHZA 4HLZG 4ZUSB 4YPGB 1ADQA 2V0AA 3IDYC 4HFUL 3APCA 5EUOF 2DM2A 3MLWH 4N24A 2NUPA 3LYRA 1TYEB 2R15A 4NHUA 2NYYD 4PJCB 1AQHA 4FQXD 4XAWH 4JM2A 3DUSA 4MCZA 2MWCA 1FSKB 4K8RH 4LK4A 2FEEL 4MNQA 4FRWA 5CU5A 1HEHC 2R1XB 3D85D 2TRHA 1CPUA 3UZEC 3TO4D 3ULVC 3ME0B 5KVEL 4RGOL 5ANME 4HIHB 1WT5C 3BZ4A 1SOQA 1P5VB 2G9HB 4PVMA 5I1CH 4IU3A 3NVQA 1BOGB 2XWJB 4GW5B 4KX9A 4WI4A 4YDLC 2OR9H 4WQOA 3QEQA 4P57A 4PJGF 3GSOB 2B8OT 15C8L 5EU4A 4DTGL 1KWKA 4F5CE 4HJJH 4NUQA 1KUMA 4WHTA 5IJKA 2IPTL 4NKDA 3U6RA 1ULVA 2NY5C 3TBSA 1QUPA 5IF0A 3LCYA 3FB5B 3MJ7A 1Y18A 1RZKC 1MCIA 2FSEB 2B1AH 1ZDQA 2XWTA 3FRPG 4P06A 5B39A 4P07A 3WLWD 4QRTA 1EFXB 4I4WA 4JM2B 4MCZB 4YHLL 1F90H 1CXKA 1NMAL 3CHOA 5G2NA 2ZNXA 4LPTA 5I0YA 1AHKA 1U95A 1PX8A 4ODBD 4LGPB 3FOLA 1HE7A 4MNQB 3RTQD 2Z9TA 4LP8A 3O6FC 2AJUH 3WE6B 2QFRA 2Q6WA 1II4E 1WWCA 2DQGH 3ELAT 3WN5A 5K9OA 5GGRY 2VDKH 1HI6A 2QMKA 2HX9A 3QO0B 1TO4A 2XOTA 3QRLA 4LCWE 4RETB 5IQMA 1ZY9A 3DOSA 4H0HB 2Y25A 2MTPA 3VI4E 4FA7B 3ARFB 3WNNA 3LHPH 1MRDH 2Z31C 1TEYA 1DUYA 5I2IA 4BEIA 5JW5A 2BY1A 3FPYA 4IU3B 1M9SA 4OFIA 5KYYB 4A2HA 2IDUA 2E7HA 1RJZB 4P57B 5SX4I 3X3FH 2OMVA 2B5IC 5H4YA 2YAHA 1H6EA 2E0PA 3TJHC 2NY4D 3LKOA 4RA0C 3BDXA 4MYWB 4RLDA 4NKDB 1HCZA 2DLGA 3LEXB 3C60B 1MJUL 4PY7B 4C57C 2ZJSL 5L88H 1FIGH 3MJ7B 1P0SE 4ZZKA 5KSUB 4IRJA 5B39B 3H2QA 4L3ED 3QC6X 2BERA 3MBEB 4LOUC 1ACXA 2OXGA 1P7KB 2P43B 4OTXH 3ARGA 3P3RA 2F7QA 2BWIA 1HZLA 3CXHK 3T77B 3FOLB 2GEQA 4Q74A 4DP0X 4B0MB 1DBJH 5BRPA 1UWEH 3O2DH 2R59A 1PQZA 5HHOE 3RZCB 1J1OH 4I48B 2Q6WB 3WN5B 1EPFA 2Y3AA 4FJZA 5K9OB 2O72A 1KGCD 1N9PA 5C09B 1AXSA 1KYFA 1RQ5A 4PWHA 5SV3A 3DOSB 3IDXL 1F6FB 2VUOA 4LEOA 1MY5A 4PTTA 3WKNA 4HJEA 4GO8A 2AQQA 5I2IB 1DUYB 3H0TA 3QHZL 2PW2B 4DGIL 5JW5B 1MSPA 2CO1A 2DTMH 4NQDD 3RWHA 2F8XC 2WXPA 4AMKH 3WKQA 2OMVB 2N0MA 4XNUH 5CJBA 4YHNB 5E0FA 5JMOC 4BKTC 3KPSB 2CSPA 4ODTL 4HCRH 5FUZH 5FO9A 3AWFA 1D5MA 3T3PF 2DYSB 3FH8A 2BSRA 3MRDA 3PP3K 3GT6A 3O3AA 2GPZA 2AERT 3TH2T 1H8SA 2GBTA 4MTMA 1MI5E 1XFPA 1XAUA 1WAPA 1E28A 2OXGB 4E41B 1ZT7A 4RGMB 4U1IA 4OZGB 4TN9A 1ZANH 2VOTA 4BUQA 5BVPL 1OSZA 2IQ9H 4JAMA 1SYVB 4ENZA 5FLVA 4G7VH 5J3HC 2WCGA 3TA3A 4GBXD 4KITB 3GS0A 2YGPA 4U1HA 4OB5H 1AIFB 2EYRB 2ZSVA 3QAQA 3CDGA 1AXSB 5ESQB 3IN2A 1U92A 3HIZA 3BUYA 2ADJA 5I18L 1F4YH 1X9UA 1LVEA 4LEOB 4CADA 3BKJH 4RMQA 3UTPE 3ZKND 2ATKA 2GY7B 5DEGA 4ELKA 1F42A 3B1UA 4AJYV 1TQBC 3QA3A 1D7FA 1A7OH 1GGUA 2J6EA 4JFFA 2WKGA 4MBOA 3S35L 2IANA 1F3JA 2KI6A 4NQCA 4PJ5A 2BXZA 1U2HA 1DE4B 4G43B 2LT9A 2FYVA 5FO9B 1AJ7H 1D5MB 4UOQA 1LHZA 1X5HA 3UTQA 4NCC1 4UIKL 1D5XB 3PWVA 4YHZL 3SBWA 2WO3B 5SWSD 4TQHA 5EEYA 3FF8A 4JFDB 2JKWA 1CD0A 1I1AB 1PLBA 4JDTH 1Q1JL 2C3GA 2ZCHL 4HWZA 1NEZB 1RKRA 1ZT7B 1BBDH 3WIHA 4ZMQA 3AT0A 1Y6NR 2ADFH 2BVPB 2OSLA 4IKNA 5IM7A 1G9HA 2DQCL 3MRCA 4J3OD 4PGZA 4V2CB 1K72A 4KNTA 2WZPA 2CWRA 4MAYD 5E9DD 3ROLA 5ISZE 1NGZB 3QUKB 4U1HB 4X0KA 1M71A 5HHNB 2EDJA 3BAIA 3VM7A 2ZSVB 3CDGB 5G4NA 4QY8A 1G7IB 3BQUB 4WJKB 1U8HA 3WMPA 3BSGA 1A7QH 4WFHD 1MWAB 3U0WL 5DEGB 4ELKB 1YPZA 2BJMH 3BZEA 4TUJA 3QA3B 4Q7DA 3VFWA 1BAFL 1ES0B 3T0VA 4XVUC 3DGGB 1WBZA 1WUZA 3H9SB 4XC1L 3RLSA 4AUJA 1F3JB 4NQCB 4GQQA 4UT9L 1HC1A 5JPNB 2BRQA 3UTOA 3EOYG 3RUGE 4KX7A 3W0WA 1JFQH 4DN4L 4OV5B 4ZUVB 4F7KA 4JZJA 5I75B 1J8HB 3GXUB 5D5MB 3PABB 5AAPA 4J6IA 3D39E 2CUAA 2FECI 2YJQA 4NKQB 4OUUA 4UDTA 3IFPA 2OSLB 3B6SA 4Y5VA 4AKQA 3BVUA 2D2CC 4UILH 1DUZA 3MAWA 4NUJB 5H37A 2WZ0A 1HDMA 3ABKB 5KVGE 5JIQA 2JIXD 3Q0HA 5ADPH 2DQ6A 4C83A 4BCXA 2FO1A 2J6WA 4X0KB 4LHUB 3BWZA 1VGEL 4XN5A 4X8XA 1PW3A 4EN3B 3I6LD 3V9CA 3GBML 1U3HC 4NOFA 1U8HB 2B0SL 3QJHB 5T1MA 5D4QA 1V7NL 3QIUC 3K74B 4NUGL 4BV1A 1ASQA 4IRZH 1MHEB 4KY1H 2A9CA 2JKJA 4XHJC 1KIUB 5C0BA 1SHMA 1RVFH 1MLBB 5DRXB 3NUKA 2OJEA 1B4JH 1CFVL 2MH4A 1RZJL 3MZGB 5E6RB 1F0LA 1AS8A 1J0KA 3W0WB 1T03L 3K2IA 2Q7YB 3SPJA 1PVHA 5EU6E 4KJYA 4A68A 2L0DA 1IVTA 3PJSA 5HGBA 2MQ0A 4OUUB 3CXDH 2I9LB 2KDYA 4LLVA 4QGYA 5FCUH 3ZRCC 1B2WL 3B6SB 4LSSL 4Y5VB 2C9RA 1PKQE 5EG6C 5KBDA 2NX5D 4ALAH 1ETB1 5DZOA 1DUZB 5DFVD 1NC2D 5TE6L 4DESA 1HDMB 5IT2H 3MRFA 5CLXA 1SDDA 3UJJL 3L1EA 1A5FH 3S2AA 3TCXA 2LAGB 2E76C 4EBQH 2WBWB 5F1NB 4AVHA 2Y7NA 1FVDA 3BAEH 2ZCLH 2FH6A 2EVGA 2IGFH 3VWJC 1FHGA 4K15A 4G11A 1L3NA 4G8EA 5FW8A 1TUPA 5FKPA 2YD6A 4X8JA 5AW5B 2NY6C 4AYMC 2R29H 5KVFE 5FB8A 3ZRSA 4C8XA 4RFEB 1F86A 4B95C 5DD1H 1AHMA 3O3EB 4KGLA 3OZ9L 4XPBH 3WD5L 1U8IA 4FFYL 4IEFB 4XP1H 3UC0L 1A6UL 1N0LA 2ZWLT 3EF4A 5AVUB 5D2NA 4GAGL 1RZIA 5CZXD 3VGHA 2G5UA 4I0CC 1SN0A 5LBVA 4KC3B 1AHWC 3TPKA 3ZDWA 4YDJB 3THML 4WLCA 3OBAA 1NFDB 4PJXA 1ED3B 4LLVB 1MCLA 4ONGH 1D6EA 2WCPA 1T89A 5EOCJ 3QPQD 4JO8A 3MCLL 1SEQL 2PPDA 1A0QH 2CKBL 3WHXB 3FQUA 5C07D 5D1QE 4JFEE 3MRFB 1SDDB 4R96B 1HWHB 2JSFA 2BIQA 4NM8H 1OM9A 5I76A 2D9QB 4ETQA 4Y88A 1IAIM 3FUEA 4KKPA 2OP4H 1OTTD 2X0VA 4G8EB 2ZX8A 4ANKA 2VC2H 2P80A 5IROA 5A3IC 3PXLA 32C2B 2LU4A 1A8ZA 4JY6A 1R46A 4X80H 2DBJA 2CPCA 5IHLB 4AEIL 5I24A 5DMGD 2X70A 3L45A 1TJHH 3EIFA 3QI9A 2DYPA 5E4EC 1U8LB 4KQ3L 1MFCL 3KWUA 2LTQC 3WS6C 3F2LA 3PV7A 1AZVA 1RZIB 4AIZA 3GB7A 3QNZA 4UIMB 2FJHB 1NIEA 2AXWA 3ULUC 5HJGA 2VSDA 2H8PB 4Y5YC 2YQ3A 2HLFC 3E3QE 2HRPH 3POCA 2VMFA 4JMNA 5E9NA 4LAQH 3AY4A 1IM3A 4JBSA 1MHCB 2YSTA 1JDCA 4X5QA 2ZE0A 1WA1X 4KH9A 8PAZA 2OMZB 1BJ1J 1QLRA 4O02A 4XCYB 5I1KH 2FLBT 2DIBA 1NMBL 2H6UA 3EOAA 4TSCL 4M00A 1TZIB 2W60B 3D51A 2OR7A 1CICC 1MCJA 3N0PB 4UB0L 3N04A 2XN2A 3K2UH 4JG0H 2UXFA 1JUFB 3MYJA 1HCVA 1CK0L 3QIBB 4I3SH 4DGYH 1OP3H 4XN4A 1OT2A 4JY6B 4M7ZB 2NCEA 3TO4C 2VDKB 3C9NA 1J9CT 1O7DC 3IPFA 3EJYC 1MIEH 3WEAA 1NGWB 3PGCB 3VD3A 1NM4A 5J0BA 1LM8V 2ESVE 3DX7B 3TT1H 4QJ5B 1N12A 2EDOA 5GGTH 3EGSB 2CMRH 4KUCF 4P05A 3TPUA 2AC0A 1U8KB 1I1FA 4RWYH 1G6RL 3DURB 4TQPA 3RTLA 1TLMA 5C2BH 1CE6A 3PUCA 4P99A 1BYOA 3S6CA 3A23A 4OCXL 2FGZA 1IM3B 5DURD 1DO5A 1DFXA 4NBXB 3MDJA 5K93A 4QXTA 4RFOH 2DQJL 1QLEB 3CWGA 2XQ0A 3VXOB 1KCUH 5SWZA 4QRRB 5EMYA 3NFNA 1Q9KB 4LCVA 2XNAA 5AL0A 3EOAB 2DLFL 2XWBA 2ZZUT 4XOAA 4PD4K 3ZVVA 5E08H 3MI6A 2FQFA 5CM1A 2OK0L 4MYPA 3WU1A 1KNOB 1DCLA 3OKNB 1Z9LA 1DVQA 1ANUA 1AOZA 1GY1A 3OJMB 3T04D 5FC9A 3TBTA 5C0IA 1HWWA 2BP8B 2Y6SC 3C9NB 4RAUB 3AROA 1FGVL 4IU2B 1ADWA 1VGKB 2HRGA 2UWEF 4FQQA 1SY6L 4Z7IA 3GJFH 4NO0D 4IBTA 1REIA 1QEWA 4M8VA 4LSVH 4H8PA 3FU8A 4X5XA 5DGRA 1F41A 2BHUA 3R7QA 5IMLA 3HI6L 3TPUB 3GZPA 4M5ZH 1I1FB 1UJTA 3AQDA 4K94L 4X6CB 2B9AA 4P46D 5KS9A 1AZZC 3U36B 1ID5I 1WS7A 3ULSA 1XSJA 1N8ZB 1CE6B 3KJ6H 5TE7L 5F7EL 4LVHC 3WTWA 2VXQH 4NNXA 4GRLB 5C0EA 3H3PL 4XMWA 3VD1A 4HZ1A 4P4KD 3L5IA 3TIEB 4GUQA 5D7JA 3FT0A 4BJLA 2KPWA 5KWYC 4XMTA 1DQKA 4WW2A 2W92A 2NZ9C 1IC4L 2N3JA 1OCRB 3KHOA 1BEYH 3QUZC 1GJIA 2XWBB 4DNLA 5CLTA 4XO5A 4EI5D 2VQ1B 5L7XL 1SJMA 4MNGA 1N26A 3L2MA 3T6XA 4QOKD 1A6AB 4FL4B 1EK3A 2ZF8A 1C16B 4ZG1A 1DDHA 1IILE 5J4MA 2CIIA 4B53A 4YEFA 2AHIA 1HIML 4JPKH 5MENA 3CC1A 3EOBA 1B4TA 1HWGB 4WU5A 5HTSA 5BV7B 4QT5A 3CVDA 1I8MA 1CBVH 3QHFL 3CVCA 4OM1H 1AKJB 1RMFH 2FNBA 4KMTL 4R8WL 1MW3A 4QHUB 1RZQA 4TLSA 1S2EA 3VQLA 3OKKA 3IF1A 5JLZB 5C0EB 1I7UB 4L5FL 1B2YA 2OXHB 4ZSOE 3I02B 3RUGF 4ZFOB 4GY4A 5I0DA 4WY7L 5F21B 2W07A 5KYWA 5GQBA 3MCYA 4RMUA 1U8PA 2JJSA 3BISA 1E27A 1BYPA 4BSWB 2LVEA 1N19A 3GJEB 2H45A 1NUDA 4Q4IA 3G3LA 2YKLH 3TNNB 3LZLA 1M2VB 2BNRA 4AEEA 1AXIB 5ICYB 1JTPA 2BOLA 4OFQA 4FS0A 2D3VA 3SDCB 5KZCD 3MUUA 2Y5TA 5F3HB 2Z4QA 2GK0B 4KQ0A 4L8SC 1PZCA 4K3DH 3QDJE 25C8H 3ZKNC 1R3HA 1A1NB 1NIFA 2BHZA 5DK0A 4WU5B 4PB9L 2BP0B 2VLRE 4AITA 1F2XK 4MQ7B 5ID1A 1I8MB 1JPSL 2E4FA 3NIFE 3SCMB 3WNPA 3TX4A 3ULVL 4L4TB 5JTWA 1YJDH 3G5VB 2EYTB 3OKKB 3OKMB 2Y23A 4OZ4B 3IF1B 2CALA 3QCVL 3QEQD 5CJOL 1SGKA 2GJ6E 1U8MA 2B16A 2YRZA 3MMEA 3II3A 1TZGL 4N0FB 5BRQA 2CLVB 2WYHA 3F6IA 2XVGA 1X44A 4KZDL 1ZK9A 5KYWB 1AGBB 5D2LA 3H54A 1U8PB 4K7PL 5A7BA 4XOEA 1XF1A 2NY5L 3L95B 5JUEL 1E27B 3A67H 3JWNE 4J3OC 2OS7A 1JV2B 1QSEB 1RZKL 3E38A 2FEDD 1NCCH 2A1WH 4MAYC 1ONQB 3ARVA 2BNRB 4B9GA 1JCVA 5E2WL 2ITEA 3PV6B 2F19H 3DETD 3WG7B 1NGXA 2YD5A 4PGCB 5D1XB 3DVNB 4ZS6D 3EHBC 3K2MC 1B0RA 2K0RA 1R3HB 4QWWD 2HN7A 1XF2A 2VH5H 5DK0B 1KEGH 5AOIA 5KSBE 1V7ML 2XN9B 4FFWC 1F8TH 1IGYB 4ZFZA 2MNWA 5EDXA 5FGSA 3VFUA 1AC0A 5DZLA 3IM1A 1KB5H 3GHPA 1XGUB 1OAXL 3SDAB 2NY1C 4M1DH 3FB6A 5GRJL 1VZHA 2B9BA 3EG9A 4M62H 3MMEB 5KTEH 1PZ2A 5MP6L 3TT3L 3MUJA 4NQUA 1DL7L 5HD8C 5T3XL 5D2LB 2Y07L 3D48R 1DLFL 5LXGH 4IRJD 2VNCA 4W9ZA 4ODVH 3DO4A 4DO5A 2EDLA 1GZHA 4ZPVA 2XVLA 4N26A 1T5XA 4PV1C 4F7MB 4JFVA 5HGDA 4P2RB 2X10A 3ARGD 4PJGA 4BWTA 3VX0A 2ALWA 5IGXH 5LDUA 2NXZC 4B27A 1BWWA 3J7HA 1W16A 2EINB 3X2QB 1UCBL 4HEPA 2I5YH 4PJ8A 4KJQD 2A4EA 3T2LA 1OSPL 1YEKL 2HN7B 1XF2B 5IW1A 4TV3A 4IBZA 3SYPA 3DIFB 4KVCL 4G42B 1JXFA 2GUOB 1UXSA 2C3VA 4JFUA 5EUOB 5A6IA 4FG6D 2ZCZA 2IPKB 2VDLL 3GMMA 5B21A 2EE9A 5T33H 3BZDA 3RDJA 2FIKA 2N7SA 4OGAD 4ZOAA 4BZ2L 3DX3A 3LIZH 5DD0L 5EBMA 5CEXB 1TT6A 5IMMA 4ABWA 4UQEA 5ICUA 3VMOA 2CJSA 1CL7L 3DECA 5IQ7H 2WCSA 1E9PA 1FO0H 5T3ZH 3ASWA 3REWA 4M93C 4L2YA 4MD5A 3MYZA 4MJHA 1AYOA 1N0XL 4G7YL 2R83A 4GS7C 1GGBH 4MKTA 2PYEB 4P3DA 3N3EA 4ZPVB 3F5WA 5IVZB 4NJ9L 3H4HA 3U6XS 3INUH 3MRBB 4BXVA 3IWUA 4PJGB 4X99A 3B9AA 1I8KA 3HTLX 4Y7MA 3D69B 1TVBA 5TF1H 1IX2A 3P2BA 4K9JA 2L8AA 1A47A 4LOEA 1BQLH 4DCQA 1FORL 1ERNA 4I18A 3DMMD 1ACYH 4QRPE 4KK9C 1J9SA 3AXIA 4P04A 3TA3D 4HUWA 1OL0A 3AU1B 3COOA 5GGVY 3SN6N 2APWA 3O9WC 1OP5H 1WFUA 3L7EA 3PQYD 5F70A 5F9DC 3HZKB 1UD2A 3U7YH 2KS0A 4AQ1A 2BVEA 1HYRC 4U31A 4GINA 4MVBC 4ZW3A 5IHUH 5IEKB 3DV6A 2YQBA 2TRYA 4JFFD 3TYFB 3V0FA 4ZFQA 4E9WA 1JOIA 2IAND 5CZXC 3BT0A 4GUPB 5IMMB 4PJ5D 2G4GA 2PWHA 4PJ7F 5AOMA 2V7HB 5AEAA 1L9MA 1KEML 4YHYC 2YPLA 2Q8AL 3FFCB 4NXKA 2XJKA 1E9PB 4LF3B 3REWB 3PFUA 5AKRA 3ZZ1A 4MD5B 3VACA 5HDQL 2QSCH 4S0SD 3GMQB 1MCCA 3QORB 2CR6A 3QFGA 2P8MB 5IHZB 4YMPA 2J1KA 3I84A 2DMBA 3ZTNH 3LD8C 2A83A 2GEEA 3QPKA 3EGDA 1IEHA 5DSCA 1BYNA 3MJ8A 4GYBA 3IFNL 1TVBB 3K4ZA 1I7RB 3BP6B 2UZPA 5BUGA 2DPKA 1MY7A 1DQLL 3FSOA 4O9HL 4HUWB 3SE3A 3NJIA 5AAWA 1OGAE 4Z3FA 4G5ZL 1P1ZA 3O8XC 3NCEB 4K4KA 3X3GL 5TH2A 5DMGC 4DPBX 4NN7B 1QYGL 2ATAA 3O2VH 4NP4H 5KW9H 2EKSA 1WVZA 3T2OA 3QNXB 4GEIA 3DV6B 4PJFE 2PPCA 3IBOA 3CMOL 3HR6A 3FQYA 5T5FL 3NA4A 4HK3N 2A73A 3HJEA 1PGRB 2W38A 4YBLC 5F8RC 5FOJA 5L6YH 2YPLB 2FX8H 4G6AC 4X0NA 2QQQA 2X4NA 5FGBA 5J12C 1DJHA 3AMLA 3T2PA 3LZRA 4EVNB 1EHKB 5JZ7C 4XXDA 1A3ZA 3DXAE 4GW4A 3W0WD 5I1DB 3U4BH 3WEXB 1T4WA 4KNSA 3TIDA 4A66A 4BCYA 3HG1E 5MEPB 1KC5L 1ZDSA 1A66A 2HPTA 3NCCB 4ZMXA 5E8PA 3W81A 3WLBA 1RZPA 1N7MH 2Q86A 5EO1B 4PREA 2P5WA 5EU5A 2D7OA 5KN5A 4PJAF 3KCWA 4J4PA 2BW5A 2LOEA 4FA8A 2R2CA 1TIUA 1XGPB 4AYSA 4Y4HD 4QHLA 3LRGA 2EJ1A 4KGJA 4FKEA 4L1HA 4LGRB 2X1PA 1MHPH 5J9PA 5TH2B 2L7UA 1TEFA 1UB6A 4HXAH 5E6IC 3IBEA 3KWWA 4KK5C 2BP3A 2BFVL 3K4DA 2EKSB 3QAZC 1PNCA 3AADB 4JQIL 1SBSH 1HH9A 2AXFA 1C5BH 3HI1B 5HYIA 1JS4A 1RU9H 2IV8A 3IFOA 3QIWB 2Z6FA 4XVOA 2F58H 5C0BD 5EORL 1TJIH 2MQGA 1ZWIA 1FVCA 2W91A 4J3TA 3OF6A 4LLUA 2OI9C 5G4MA 1I82A 5HHVH 5EN2A 4MA1C 2GTZB 1DBKH 3AG2B 3T8XB 4HPOH 4L4VA 3RP1A 3LQMA 3NZ8A 3Q8FA 3TIDB 2XXFA 1KG0B 4CU6A 1ZXQA 2X2YA 4XP5H 1RUQH 3R06A 1P6FA 2NXYB 3C8HA 1QBLH 1JDAA 2QHRH 1JZJA 1DJIA 4JKPL 3D3VB 5E8PB 4EIGB 1TZOA 2RAMA 4PLJD 3WLBB 3BGFC 1G4MA 2XY1A 2YOAA 3ZDYB 5C0DA 1GVIA 4XNQB 4YGVB 3L3IB 2P5WB 4JPIB 3M7FB 5L4FA 1RZ8A 2PP9A 3AREA 2VLMD 1OANA 2VZSA 1FVEA 3AU0A 4LEXH 3EO9H 1CLOL 3QQ9D 4HU2A 4PW4A 4KRPD 2VRKA 3SE8L 4FLQA 1I7ZA 4RIRB 1JZ4A 3L5XL 4DOHB 2SODB 3NCFB 4OLUH 3L3DA 5CJQH 4YK4C 1LJMA 4B9FA 5JQ6L 1CB4A 1QATA 2ZPKH 5DRNA 1BZ7A 1SMDA 3L17A 3IFOB 4P46C 3FAWA 1EHLH 1CGVA 1ZWIB 4IMKC 1FVCB 1GZQA 1T1YA 3HLAB 4LSRH 3IN0A 5K33A 3UEQA 4YC2C 3NIFF 4LPXA 4ABUA 5ESVB 3ARTA 1ZLUH 4ZW7A 4P4KC 4YNYA 1LO2H 2WSPA 2HLEB 2P5EE 1UZ8A 5MHSE 2R23B 5DQDL 4PSRA 2BVUA 4WZ9A 2DM7A 1JHLH 5C0DB 4HS3A 4IJ3C 3J8F7 4AGOA 2A6JA 1QWHA 2SEBB 5HHMB 4U1NB 2QQNL 3AREB 3FFDB 4HZLB 4DEPB 2ED7A 3CUPA 4NPYA 1IAII 3HN3A 2Z8VC 2J8HA 5HI3D 2EUVA 3NZSA 2IALA 4NFDA 4N1HB 1FSKC 1PLGL 5BRZE 1CLYH 4PG9A 4W9GC 4TNEA 2JKRM 1J88A 3ZIYA 1UA3A 3GM8A 3LRHA 1YYLL 3O4LE 2HG5A 4MA7H 5IVOA 5IROD 1Y7VA 3FCGA 1DDTA 4JZNA 3RY4A 4ONFH 1BZ7B 1RIHH 3EJUA 2DI7A 2OMYB 2CXKA 1P7HL 1EX0A 4PV8A 1A1MA 3QI9D 1QWUA 2DYPD 2EAEA 4LDEB 4PGEB 3TS8A 4KI5E 1IBGL 2F5AH 2AJYL 3EW3B 3WV0A 1URZA 1ZIBA 1G7LA 4ZFGH 3FSZA 4YSPA 4ZD3L 5D55A 3WKMH 1GYAA 4PRBA 2IAMA 1PG7W 1PG7L 2QVFB 3QZWG 5B3JF 3GSNH 2IOIA 4YLBA 3ASNB 3VH8A 2FB4H 1GGIL 2YHGA 3WUWA 4HOZA 1H15A 5J13B 3OMNB 2AQTA 4LPVA 5ANMA 5ES4B 4JHAH 1XSOA 3CUPB 4NPYB 4LSPH 4M5YH 3ATBA 4JM2C 2WLIB 4XCEA 4FJ6A 1Z6JT 1KCSL 4PG9B 4F5CA 2Q2EB 3MRQA 3VFSA 4ZO7A 4N86A 2HG5B 5JO5A 2P1YA 4YFDB 3UZQA 2EYSA 3HKFA 3VU1A 5K1JA 4MS8D 4K55A 2MOQA 4X6BB 3KXFE 1IBZA 4X5RA 3ULVE 3WELA 5FO8B 1TNNA 1A1MB 4HAKA 2V5SA 1USZA 3DOHA 1TFHA 5IR1B 4YEEA 1CD9B 4ODUA 2QGEA 1FZMA 4JO4L 1SQ2N 3ZE1E 5I16A 3BYYA 5HYEA 3OAUL 2YWYA 5T1LD 2FATH 2FLRT 1MCWW 1MCWM 2J6EH 3GRWH 3C60C 5JORA 4PLKD 1F58L 1FYTE 5C0NC 2DLEA 4G9FD 1T7ZA 4E5XA 4F9LC 2NW3B 5SWZD 3MBEC 5ESAA 3ALXA 3VI4A 1UJ3A 1BPVA 3D33A 1HESA 4FOMA 1QI3A 1IM9A 2N7AA 4AIOA 3VXSE 2VABA 2QDWA 3OB0K 3QE5A 2UZIH 3W82A 2DICA 1A3RH 3V6OE 3DETC 2FWLB 5I1EH 3HRPA 4WV1A 4Y2OB 2OR8A 4F8PA 4L3CA 5CZVH 5JO5B 3RZCC 5LGJA 5E1GA 3V4UL 1E4HA 4M03A 2EYSB 3WN5C 2QSVA 4OVVA 2VR8A 3AXHA 5FOBA 4X7SL 2P47B 2X2HA 4L8DB 4C54A 2QJDA 1M56B 3GWJA 4WKZA 4Y9EA 4D9QD 1HQRB 3CCHA 1FFOB 4DKEL 1IRAY 4WI2A 2L04A 4OFVA 1ND0B 3RKDC 5FYLL 1SHWA 5HHOA 3BT2L 3VJ6B 1KYUA 5T3XE 2XG4A 5IB3A 4UV4L 5EOTB 1CGSL 1OD7A 5AUMB 5D7JD 2OYLA 4DVBA 4K3HA 3TVMD 5K1NA 5ESAB 2XKNA 1A4CA 1AI1L 1TLKA 3SKMB 2D7NA 2GJPA 3DX9A 1L9SA 1OF2A 3H42H 3L1OL 1QI4A 4RGMC 3ARGC 2YMXH 3S36L 2YXMA 3NRQA 4P59H 3BKML 1KZYA 2A77H 3PE9A 2O5NA 4G72B 2QBWA 2OMXA 2HP4A 4OZHE 3SPVA 3LV3B 3RHWK 4UZSA 3SGKA 3ETSA 3Q9PA 5D70L 3BWUF 1AFVH 3VA2C 1OAQL 4YQXL 4NX0A 1LDSA 2I7OA 4OLXH 4WKXA 5I19L 4LSDA 3LXAA 2VXUH 5E1AA 1XH1A 3MA9H 1QFWM 2A4ZA 1QFWL 1MI5A 2ZX9A 1JPTL 2FK9A 4LBAA 4UOW0 5FGRA 5MEND 3RWCA 5CIPA 5EWIL 4LCIL 2WXOA 2B4CC 4XH2A 3FNKA 4ZOEA 2HMIC 1Y6MR 4ZX4A 2EUWA 3HMWH 4F2FA 4PJFF 4JRXE 5D71H 3Q6GL 4UOJA 4FNSA 2APSA 4I3GA 2DMKA 2XG4B 5IB3B 3MRHA 4HWBL 1G7HB 3F12A 5ACZA 4JG1L 4URKA 3BZFA 5BOPA 3I9IA 2OCFD 2CHZA 1NUGA 1KXQE 4JDZA 3E2HC 3UTTE 5B3NA 4AZUA 4M3JA 1I1AC 2W0KA 3JVGA 4XNYL 3WNOA 5HY9A 2BCMA 1DJZA 1XEUA 4B3VA 1QUNA 2D7TL 4MJIB 2A74A 1SUJA 1WHPA 2D0FA 2OMXB 3MJ9L 3SPVB 4X4ME 2IMMA 1MFDH 2WQSA 1O6VA 3QXTA 3TZVA 3EJRA 2APXA 3W3BA 2AEQL 3KWTA 4I5BB 3LH2L 1KLUB 2EE6A 3BI9X 1YA5A 3BQUC 4RDQG 4AE0A 3WS3A 1LO0L 1MI5B 3BEVA 3L5WA 4OGYL 2LU7A 4A7QA 5BS0B 4L0ZA 5CIPB 3SYAA 3HNVL 3WIFB 4GIOA 5CCKH 5IKCB 3OKYA 4MBRA 4W70A 1HHKA 5KYUA 1UWYA 3NJHA 2ARJQ 5JPNC 2W9DL 5LB1A 5AW4B 1S7UB 2OTWA 3MRHB 2J2ZB 4L1LA 2UWEB 4IBSA 3SBWC 3SJVE 4DO6A 3BGAA 5H2BA 1EO5A