3AU0A

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
339
structure length
339
Chain Sequence
PVVNVADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
total genus 85
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A02
4B60A 4JDZA 3AT0A 2Y7NA 4BBWA 3IRPX 4B5ZA 4Q6KA 1R19A 4F20A 2Y7OA 3AU0A 2F68X 2Y7LA 5CF3A 2F6AA 3IS0X 4LE8A 4F1ZA 3IRZA 4F24A 2VR3A 2Z1PA 3ASWA 1N67A 4MBRA 4RMBA 4LEBA 4MBOA 2Y7MA 2YLHA 3IS1X 4JE0A 4JDZB 5IHWA 3V10A 4FJ6A 2RALA 5CFAA 1R17A 4F27A 4LEEA
chains in the Genus database with same CATH superfamily
4G5AA 1P1ZB 4Y5YA 3FQTB 4JO2H 4KI5F 3S3JA 1NAMB 3G3LA 1DBML 2JNZA 4AE1A 3P0YH 3WS3B 3FN3A 3SDYL 3CH1A 5D1QE 3MRCA 3ABMB 3THMH 4R4BB 2VDQL 4JHWH 2CD0A 1Q9LA 3TF7C 2YOCA 1NUNB 2NXYD 3G6DH 1AACA 4ILDA 1S78C 2GAZB 1DVFC 3QCTL 3KPQB 3VD2A 2BNQE 4HUKB 4JGNA 4X9HA 1IU1A 2F2HA 2EO1A 1WCBB 2NY5C 3TPUA 4AQOA 4X7CC 2F58H 2NX5D 6FABL 3TEYA 4ZJ9A 1IM3A 4CGTA 5IROD 4G6FB 5IBLD 2VLLA 2E0PA 4YHML 3QYNA 3VRJB 2YD9A 2JQMA 2NOYA 3S3DB 1UQSB 3BPCA 2YPVA 3L1GA 3SJVA 5C0FA 4NB7A 5IESH 1G4RA 2LV4A 2P5WA 4GT7A 4CN1A 4YL4A 4PJ8A 1V5JA 1FO0A 3LKNB 4ZW6A 1RZPA 4KC3B 3ZT5A 3RVUD 4GRWF 5D2NE 5LCVH 1J9TA 3BIKA 5J89A 1MFCH 2MMXA 5AKRA 1M7XA 1G1OA 3LYRA 1QR4A 4HJGB 4PSPA 3QORD 4F1SA 4ZZKA 4M62H 2DLHA 4V2CB 4OI9A 4BKTC 4RAVA 5KZCB 3MXVL 5CBAA 4PQXA 3MBXL 3HOGA 3MOAH 2QGDA 1M56B 1RIUH 1JK8A 4YGAB 5TH2B 1MHHA 2CCVA 2YXWA 4X80H 3U7AA 4PJEA 2X4UA 2HTLD 1HK6A 2CR3A 1T5KA 3JTBA 4F7CB 3O9WC 2D2CC 3GJEB 3KLSA 3WIHH 5L8LB 3ARGA 3CUPA 2VRAA 2VE6B 2R83A 3MYJB 3TF4A 2OCJA 3PQYE 4LRIC 5I30L 4P2QD 2EE0A 4PJ5B 2C3WA 2NY3D 2CLZA 1MCCA 5F9AC 4P46C 4QUOA 4JVPA 1ITBB 1JVLA 1J48A 3SY6A 4DT2A 5CLWA 2OR7A 1EBAA 2Z7ZA 2NR6D 4BFIA 4PRHE 3O41A 1OANA 1QHOA 3FN9A 3VFTA 5I19H 1Z1WA 1IAKB 2QLYA 1OB1B 4WWOA 3DPBA 1NSNH 4IRZH 3MCKA 5DT1L 2R8SL 2W65B 2R2EB 1R5WB 3ECBB 5GRZA 4OT1H 3VQ1C 2ATPA 1MNUH 1AO7D 3BLPX 4AV0A 2ARWA 3DX8A 3R8BB 2UV3A 1UTDA 3RL2B 2WXMA 3CPUA 1EIBA 4WUUD 3UACA 3OG6B 1A14H 2XFXB 1QKZL 3MPCA 2OMTA 4KITB 4FQHA 5GZND 3N40P 3Q06A 4JZNA 3HPLA 3STZA 1Z2KA 4IRJB 3MJGX 5GPRA 5SV4A 2R1YA 5DVLA 1P6AB 3SGDI 4YSCA 2IDTA 4RWYH 2QMKA 4AMXA 4WIQA 1AI1L 4XCYA 1LWJA 4JHAH 4UM8B 1EAPB 1KIQA 4PRPE 5IQLA 4NKQB 5AOIA 5C0BE 4CW1A 5IHUL 2MQCA 4NRXA 5FA4B 3LZNA 2IPKA 2XWBA 2YK1L 2P5PA 3L08A 2F9BT 3EF7A 1MCPH 5AVZB 2OV0A 4I0PC 3HZMB 5DFVD 2G2RB 4LZKA 4PJCE 1G7PA 1T04B 2JCCB 2KDGA 1OP4A 3IJHB 4B5ZA 4KDVA 2VZVA 3BP5A 3FQ1A 3ARQA 4O51A 1CF8H 3EG9B 3N50A 4TNGA 3SD2A 3MLTA 4XRCB 4YS4A 4TQ8A 2OL3B 4X0NA 1Z9PA 4OQTL 1D6EA 2UXVA 2KLTA 4LHUG 4PLJD 1SJHB 5E6ZA 2FEDC 5HDLA 1OAXL 1MUJA 1ZLVH 4NNYA 5C9JA 1UC6A 4YC2C 4HDIA 5I6KA 4O9HH 1YYML 4F8OA 5B3NA 4U1NB 3UC0H 4D9QD 3SE3C 5I5RA 3PAZA 2Y6SC 3G5WA 3QNXA 3RDJA 2G3MA 3AY4A 5GS0C 1I9IH 1AO7E 5AG8A 3ULUC 1HZLA 3QS3A 1DQJB 2YFOA 1XEDA 3D1MC 3EYUH 3QEQD 2X2HA 3TA3B 3BGFC 4WUUE 4G3YL 1AAJA 1U8LB 1JZFA 3DX9A 1XTLA 1WV7T 4J2XA 2BP8A 3MRIB 1G4MA 3VXSE 5EBLB 3ARDA 1OL0A 2BSED 4BQ6A 3IDIB 3EIFA 4CL7A 4X8JB 3F00A 3O2WH 5GGVY 2A9AA 3PWPA 1MVYA 3RIKA 1HYSC 3DGDA 1JNNL 1LO4L 1NCOA 2XWZA 4G9FE 3K6SB 1MJJB 1MWAB 1TO4A 3MRLA 5HI3D 1JZ4A 4PJIA 4QRSB 2HN7B 32C2A 2XICA 3QEUA 3N0PB 5G4NA 2JKIS 5ITBH 1ETJA 4QOKA 1UJ3C 4ZXBB 4KTEL 4DKFH 4XC3L 3HC0A 2YKLL 3ECQA 2Z35B 4UF7C 5AVSB 4QHPA 4XCNA 1ZHKA 3RZCC 3PWVA 1FIEA 5CLXA 3AU1A 4EUPA 3ZR6A 4OZFH 5JO5B 1U8KB 2NY4D 1J87A 2DKMA 4RMUA 1T0PB 1WFNA 1S7TB 3K4DA 1IC4L 3HG1B 3Q48A 1F2XK 3MV9E 2RALA 3NJIA 4WLCA 2J8UF 5BPPA 1CIUA 2ZUWA 2BRRH 3U6XA 3W9DB 4O02L 1I8MA 1CDCA 3BQUA 2YXFA 2YPLE 2PR4H 3ZR5A 3RKDD 1IARB 1EDHA 5CMAA 1BX2A 1AJ7L 4YMPA 1Y1DA 3VQLA 1KTCA 4PRID 4JY6B 3TYGH 3UBXI 1EXHA 3BP7B 1E5YA 5EV7A 1GGYA 1KIUA 4OCMC 3KH4A 4MLSA 4Z78A 5AVYB 3FQ4A 1IKNA 1CICB 2WTRA 3CX5J 1K4DB 2F53D 3FPYA 3RE0A 2AI0L 2I5YL 3H9SE 5IHLB 3I6KA 4M7ZC 1UYWL 3EOTL 2AJSL 3BKJH 3QZWA 4Y5VA 4IU3A 2M1KA 5C08E 4D9RD 1ZCRA 4QGTA 1FGNH 4QAMB 3OLEA 3RURA 1T21B 1OAKL 3D09A 3VD5A 1XCQB 5DJZB 5EUOF 4EI5A 3ZGIA 1MJUL 4J8RB 3CZSA 4ZS7H 5ICZA 4XTRD 1EWHA 1XR9B 1SYSB 1QX1A 5MERB 3K8MA 1YZZA 1VCAA 3GIZH 1GGCL 3V0JA 5IM7B 4ZFZA 4F37K 4XO3A 1A1MA 2RBLA 4CSZA 4WHYH 3FHEA 4XE0A 2MCG1 3KPNB 2WP3T 3NZSA 3OR6A 2EKSA 4GJTB 2WLNA 2AKRA 3CSYB 4IOSA 1X5ZA 3PGCA 2EDEA 5LNEA 3KEDA 1A3LL 1YUHA 1J1PH 4HJTA 4LLUA 4NKIH 4S1RL 4EI6A 5D6CB 1FHNA 1ZGLP 5IK3A 5CXPA 4AZUA 1IGMH 2NY6D 2NQDA 2WLYA 1HEZB 1T66C 2YAHA 4UZSA 2G75B 4Y4KD 4BFEA 2AS5M 5I26A 5KVFH 2EC8A 4U1GB 1ILSA 1HHJB 3FT1A 1HZHH 2ZOKA 3DK0A 5ANMB 4AYID 4QXTB 5L7XL 3HNVL 5D4JA 3V0IA 5JOFA 3K4AA 5IFJA 2KQNA 3I9GL 4UDTB 5IWLA 4XX1G 4NQDA 2WWMD 4D9RE 5JLZB 3LXAA 3FB7A 5FO7B 5ILTL 2WJ5A 2AITA 3BZ4B 2EYRB 4QHNA 1SHXA 1YY9D 2PPAA 1NCNA 4X5XA 4EKXA 3FU9A 3TT1L 2X12A 5DRZA 1YC7A 3NZHL 3T0EB 2CALA 4XOAA 5BXFB 3GM8A 3S96A 4QO1A 4Q2ZB 1MVUA 1XIWB 3P3RA 2APFA 2YZ1A 3U2IA 4GW4B 5I17B 4IBWA 1PKQE 3UBGA 1E5CA 5L2JB 5F7HA 4AEHH 3DIVA 2X89D 1SHWA 3LEXA 1QPXA 4YLBA 3BAKA 1A7RH 2Z7UA 4C56A 1ADQA 3HI5H 2P52A 4JQIH 4ANKA 3KM1A 5FCUL 3INUL 3RWGA 5AOLA 5AYUH 3V0GA 5F96L 5DD5L 3DURA 1O7VA 3WFBL 4DVRL 3ML8A 4H8WL 4LDCA 4FXGB 4Y2NA 5GGTL 3FOMA 2A6JB 2JF1A 3NDZE 1AY1H 1KCVL 4M5YH 4PMEA 2A6DB 3NRPA 1CFBA 4G8EA 4UOZA 2ADJA 2XCMC 5KBMA 1NFDF 2W9DL 2XHNA 2QSCL 4D3CH 2Z1KA 2ZP9A 3O4OB 1JERA 4IGBD 4R96A 5EIIG 4IDJH 3L3IA 3V7AG 4HLZH 2GY7B 4KMQA 4MZ3A 2XYCA 5ISZD 4EKJA 2FX9H 1PAZA 4MMZA 4WW2A 2E7CA 4UNIA 4ZQKB 1YAZA 2ZOWA 1RLBA 5DO2D 4I88A 3F7VA 3MFGB 3PNWA 4PJAE 2H2SC 4QXUL 3PDDA 1YMMB 5M95B 2CJTA 5E9DB 3T4AB 1BXXA 2P7TB 1RHFA 4KFMA 4P9MH 1FL6A 2EXYD 5CWSB 3KPSE 3CFDB 4KFZC 4GAJH 3E9UA 4I8DA 4Z9KB 1FVEB 4HMDA 3NJJA 1IKFH 5TE4H 4FQXD 4XMZA 1PVHA 3WLBB 4UMSA 3MLVL 3U6RB 4MD5B 3HAEG 3ILQD 4WTXA 2N0KA 2WNXA 4LLVA 1FAKT 2ZWNA 1MCBA 4M3HA 4GAGL 4LLAA 2H1XA 4LF3B 1BZDA 3GMNB 5BQ7B 2O30A 4WFHE 4R3SA 1EPFA 4H0GA 2F1EA 4OJYA 2BY2A 4N22A 1QATA 1ZT7B 2HPOA 2VQTA 3OC8A 4PBXA 2COQA 4ZODA 3LKPB 4FLRA 1JPSL 4WGKA 3NH7L 5DD0H 4X0KA 3M88A 3CXHJ 1INQA 3AXLA 1S9YB 3BVNA 2CM5A 4JRYB 5ISZE 3OLIA 4YGVB 4MAYA 1Q38A 4XH2A 1DVYA 1HXYA 1TVHB 3D3VE 4PIRF 2K9FB 3V6OC 1ZT4A 5DQDL 4OH2A 3G6JA 3M45A 3VFRA 4EOWL 2VDQB 1M6OA 1KBWA 2R0WL 3HHSA 4UQCA 4YPJA 3IFNH 4DSYA 4LESA 5DR5L 3FCSB 3OMZA 4O00A 2QADB 5CU5A 2AEQL 1E30A 1J10A 2P80D 1DQLH 1FFNA 1K4CA 4P23C 4XMWA 4FG4A 2VDOH 2P24B 4YQXL 3WNKA 1J1XL 4HAKA 2FIKB 1FORH 3GMOB 2AJVH 1KWGA 5HI5D 2HT3D 3V55A 1QSEA 3ZYOA 3APNA 1XL6A 4BZ2A 2W59A 3NTCL 1RFDL 1YEFH 2PCFA 3I9AA 3ZYIA 3RU8H 2ZKHH 4PS8A 5L2KE 3D4YA 1HXKA 4N0UB 1CFNB 4PJBE 1HT6A 4ORGB 1VHPA 5DHYB 1KGJA 5KS9A 2OYPA 4ZFOL 3HE7C 5L6YL 2D3NA 1QRNE 2N3JA 2YQ3A 4ZW7A 5DMIH 4NOBA 3MXWH 4BQ9A 2YMXL 3WNPA 5EN3A 3ZTCC 1D5MB 1HOCA 4A66A 4ZYKA 1WWCA 2IDFA 3GJFK 3MRPB 4X99B 1XF3A 4GMSH 2DQTL 1WVZA 4UILH 4UTBL 3H0TB 3RDTC 5H4YA 3WAKA 5C1MB 1KYOJ 3EKCA 5DYOA 4ODUB 3AGWA 1NBVH 4AG4L 4JPQA 2QPEB 2NNXA 3VJ6A 1F3DJ 4NQCB 4QRTA 2NMSA 4V11A 2IGTA 1RCYA 4R7NB 3UX9B 5DJDB 3LQZB 1UB5B 2IMNA 4M02A 1H3XA 1QSFB 3QNFA 4XXCA 5CINL 3UDWA 4V1DB 5GGQL 4GP5B 1CVSC 2ADIB 3G04A 2Q8BH 3BD5A 2QBWA 4F7EB 2FGWH 2J44A 5IVNA 5EEUA 5F9JA 2VN6A 2DQFA 4PGCA 3MTRA 4OJAA 5L8KB 3GSQA 1BD2E 1UXSB 2XTJB 4ZPTA 4CMHB 3ERXA 4BA8A 2EXWC 2E9JA 3HNSH 3VXUD 1K8DA 4MJ4A 3RQ3A 5I5MA 3T1FB 1B0IA 4JY4B 4XMKH 3K46A 4YE4H 1ESOA 3F8UB 3QCVL 1O0VA 4IK6A 3ZDZB 2XG5B 3BW9B 3ZL4H 4NRZA 1NICA 3FU8A 3IVKB 3RY4A 5E2TL 3IF1B 1XMWA 2BOBB 2C9QA 5H35B 4TM9A 2WNKA 5CJ5A 4F5CA 1WIPA 1JZJA 1CTMA 4PPTA 3SY0B 3JVGA 1VFBA 1GHFL 4KDWA 1MF2L 2GBUA 3QDJE 4L5FL 4OTXH 5CCHE 1QBBA 5T5FL 2CPUA 3FUKA 5EA0H 2OSWA 1DSFH 1E8XA 1YJDH 5TQ0L 1W91A 4NZTL 4HJ0D 5ID1A 5G4OA 2ZAIA 1FLRL 3JWOL 4P4RA 4XI5C 1FNEB 2D31A 4OF6A 3WY1A 5CR1A 1JCVA 3L4CA 3RWJB 2Z31B 4UWQB 2A9CA 3MRQB 1KYFA 4ENEC 3BKYH 1ULVA 3EDEA 3MC0A 1P9MA 4APQA 3HCVB 1PW3A 4JPIA 2F54A 5J9PB 5HDQH 3BH9A 2H3NA 1BVLA 4KK9C 5ANHA 5HYSA 4OZGE 1SXSA 2Z9TA 4CBPA 1NQBA 2DH3A 2KMWA 4KI1A 3SGKA 1JUFA 1QD0A 2AXGB 4NSKB 3BT2L 2JE8A 5TE7H 1EUTA 5LBSH 2L7EA 3T8MA 2DQHL 2OMYB 2F61A 4GFXA 2DH2A 4A37A 1O7DC 4P4KA 5L88H 5CJXA 4UT7H 3GSVA 4NQSB 1OGAE 4JO2L 4KKAD 4RMSA 5TF0A 3S98A 3BC9A 1C9SA 2YD0A 1N64H 3WEBA 1LE5A 4M6OL 3CN3A 5E8NA 1SY6H 1Y7VA 3OAZH 3HIZA 3QUKB 3FO0H 4JFDD 3JT0A 2VH5L 4G43B 4K8RH 5CD3B 5KBNC 5KTEH 1NUGA 4LB8A 3HG5A 1ZHNA 3RB5A 3MJ6A 2LQRA 5CILH 3VDCA 2Y7QA 2XWDA 4JRFA 4OFYA 4YHNA 1E4JA 4EN3A 3KXFE 5JW4R 4Q6IB 2FBJL 2IJ0C 3RBSA 3QE5A 2GIXA 4FFZA 1MFMA 4N2IA 2RB8A 5F7EH 4OVVA 5DZLA 4Z7WA 4PP2B 4G1EB 4PB0H 1R17A 3O2DH 3DTDA 2O5NA 3KCPA 1NL0H 4ETQA 5D1ZD 5TDOA 1KXTB 2IAMB 2W0PA 1QI3A 2ICEA 3OMNB 3A24A 3N1FC 1P1ZA 2HJKB 4LCCC 1OD7A 3CFTA 4Z7UE 5AVQB 1ASPA 1J9QA 1NAMA 3NA4A 4UT6H 3DIDA 3DRQB 1NKOA 2BSRB 4R4BA 4R7VA 5BOJA 2LT9A 3FB6B 5JHBA 7PCYA 1FBIL 2GAZA 3A4EA 2EYTB 1NGXB 3T6QC 4K9EL 3S6CA 2IQAB 5C2BH 4Y4FB 4NP4L 1JDCA 1OGPA 3D05A 4OM1H 4KZDH 3F7LA 1F97A 4Z0XA 5I1GH 1WFIA 3BEVB 5AW9B 3DVGB 4R5VA 5HGDA 1ZLEA 1G7JB 1RERA 1GS6X 1TFHA 2F1BA 3DX2A 5CFHA 4POZD 1T2JA 5HDBE 4A2DA 1UQSA 4IU2A 3K80A 1HVXA 2BVPB 5BVJB 3GMQB 5AUMB 2C1PB 3WTVA 3RWCB 1OF2B 1D5RA 4QY8B 4NNPH 3GRWA 2MCPL 4IS6B 1PD1A 1Z9OA 4FYRA 4JO1L 4J3BA 2ODIA 1CK0L 2FX7L 5I19L 4HJGA 4C55A 3QRBA 3PDOB 4ZNCD 4JG0L 3ZE2B 3DI2B 4BDVB 1E3ZA 3FTUA 2YBGA 5IQ7L 1NOFA 5CEYB 1KGUA 3MLRH 4CVWA 4QXGH 1B3JA 1EEZB 4K5OA 5AW8B 1SMDA 3DJTA 5F7YC 4FMKA 5TH2A 4R2GC 5AB9A 2CBQA 5D7LA 35C8H 2QKIC 4KU1A 3VVVA 3EH3B 3D18A 3QS2A 1DFBH 2BY1A 1SDAB 4XCEB 5D71H 2P28B 3UAJD 3C2AH 3NAAL 4XT1C 1WGVA 1F8TL 2C1OB 1GY1A 4OV6F 1L0PA 2PTTB 3TBSA 1J0YA 1N12A 1UUNA 4O2CA 4L4JA 3DXAE 3AMLA 2VE6A 3QO1B 4B9PA 2IFGA 1G6RH 4FFVD 1LHZA 1RZKC 4PJ5A 4NENB 4PVMA 3ABKB 2ITFA 3QJFB 2OMBA 1AZUA 3TVMD 3WIIL 4OFQA 4FNLH 1AR1D 1SJVA 2UX6A 3TH2T 2DQEH 4I9WE 1IAKA 3GSUA 4S0SD 4HUWB 4LRIA 4XO4A 3V5DB 2F19L 3OVUB 4P46A 2D7TL 5I15H 1R5WA 3SYQA 4HT1L 3F7QA 3GNMH 3L5IA 5FUZH 2DLTA 3RL2A 3CX2A 2XQBH 3OXSB 3N85L 4PCSA 2EQDA 2WC7A 4PGBA 3GSNB 4TLSA 3MRMB 3ARBC 1WDAA 3S0PA 2E9WA 4ORZC 4IRJA 4APXB 1A64A 3LZOA 2EVFA 1B9ZA 7FABL 3CVIH 1RIVL 4XPFH 3RVWC 4WFEE 1KGCE 4JFFA 4UM8A 1DN2A 1EAPA 3VCLA 2O93L 1CT8B 1I1RA 4FZEL 5FA4A 4K8RD 1ORQB 3PPSA 5AAWC 4BD4A 3QZLA 3FU7A 1QUNA 4DIXA 4TOYH 5HJ3B 5A6IA 4R90L 3HZMA 5D5MB 3DMMC 5HBBA 1T04A 2JCCA 4AKQA 3IJHA 2J88L 3GF8A 1F5WA 2WIMA 4NQUA 1L5GB 5JW3L 4JDEB 4N8CH 3OKNB 3QO0A 2PW2B 2ZKMX 3EG9A 5DUPL 4F58L 3DROA 4XRCA 2R9HC 4FI6A 1WA0X 2OL3A 2QPFA 2IOOA 4EVNB 4ONOA 4UNUA 4W9KC 1SJHA 4I0PA 3ZDXB 3L5XL 2NTFB 4X6FB 3CXDH 4U1NA 4Y9GA 1Q0YL 3HB3B 2FECI 3B34A 1YA5A 2X2IA 4E9YA 1IEBB 3VFMA 4F2MB 4I5BB 4ODWA 2IH1B 3S8FB 4LSUH 1ORSB 3ASOB 1JZHA 3R1GL 3TJEL 1DQKA 5DUBB 2NRDA 3OD3A 5IJKC 2H0PA 3FQWB 1DZBA 1X5GA 2HLFC 3MKGA 3QUXB 2ZCZA 4POUB 5EBLA 5FWRA 5HVGB 4I48B 4D7BA 2X41A 1GY2A 4KI5C 4BH8B 5INCB 5LWYH 3PP4H 1EZSA 3BN9C 3WGVB 3FMGH 3MV8A 3W9EB 5FUCE 2ARJB 5LNGA 1QFHA 5SX4H 1VACA 5KYXB 3UZQA 3CIQA 4JQVC 3QJTB 3VXME 3K6SA 2WLJA 1MJJA 4UQ3B 1MWAA 4IBLT 3WO4C 2DAVA 2EJ1A 4QRSA 1YEHL 2HN7A 3H42L 2PXYB 2BZ7A 3BUBA 3U25A 4LNRB 2AQTA 1S7SB 1KXHA 4WFGE 4ZXBA 4XMPL 2NY2D 5C0EB 2CK0L 2NZ9C 3FUIA 3P02A 2WVTA 5FGRA 1JWMB 2YUZA 2Z35A 4NYLA 4WI7A 4HBCL 5HHVL 1FGNL 3DIFB 4WUKH 4DGUA 3S2AA 1WF5A 3E2HC 3WFCH 4DEPC 1CFVH 5JO5A 2HVKB 5J13B 1RPKA 2IWEA 1CBJA 1GW0A 4IBVA 4FXKC 4XN1A 2XWRA 3T77A 2XN0A 2FIRT 3W9DA 3DBSA 2UYLB 3VI3F 3IMVA 3L7EB 3T3PF 3RZCA 2A38A 3W11D 2DQMA 5B39G 1H0DA 4NX0A 1YC8A 4ABWA 1VCBC 1S8DA 2VXSH 5DEFA 2EDJA 4GXVH 1BW8A 3KJ6H 1SNRA 3HN8A 3BP7A 3OG4B 3US0A 3L45A 2BP3A 3O3UN 3HG2A 1R46A 4JM2F 4YBLC 4XP4H 2AP2A 2JCWA 2JTYA 5DSCB 4KNSA 1CICA 5I74B 1U6AH 2G5RA 5C09B 4OCXH 3QHZH 1E2VA 2WSDA 1WO2A 2WXFA 2X10A 3LN5A 2VAAA 3ARFB 3U7WL 2YN5A 1ASQA 4F7MB 4GAYA 2EDBA 5FYJE 2QZ5A 5DF0A 1T21A 1XCQA 4ATTA 2BP0B 2COVD 1J88A 4J8RA 3L95A 4NZ8A 4AV4A 4UQAA 4J3TA 4AGNA 1IBDA 5BQDA 1QFUL 3KS0J 3MNWB 2ICWB 5DVOA 1XR9A 3S9DB 2JB5H 4XCNB 1F4WL 4FFYL 2Q86B 2ZSVA 1ZHBB 3II1A 4HIHB 4BKSC 3L3OB 1SF5A 5IM7A 4Y2DD 1RIHH 2A1WH 4L9LB 4XCFH 4TVUA 1N8ZB 2WK2A 3TCXA 3VSVA 4NZDA 3GM0A 4F9PC 4P49A 2YD6A 2WUCH 3KPNA 4ZFOB 4IRSB 1F4XH 1FVDB 2CKBH 4UT9L 3I2CL 4U1KB 3RWEB 5D4IA 4FULA 3CMGA 3MV7E 1YQVH 3MRHA 4U7SA 5K33A 3FPXA 1AE6H 4BFFA 4X9BA 5D6CA 3KLQA 4P5MB 5ABZA 4G6KL 2MH4A 2HT2D 1QSZA 4AEHL 1U3HB 1HEZA 4B9FA 2OSLA 3DJ9A 2G75A 3CVHL 4Y89A 4XB3A 5F3FA 3EO1B 3O3BB 3GBLA 1AP2B 4B60A 1HHJA 2BIHA 3B2VH 4KK5D 1EHXA 5F9OH 1F0LA 3IU4H 2E27L 3SKJL 4QXTA 4ZOCA 3F62A 1BQHA 1JHKL 3DC0A 3PUUA 4UDTA 5D4HA 3FN0H 3SDXE 4BEIA 1D5IL 3QRFM 2QHRH 4JKKA 4XNQA 2ZUTA 4LEOB 5E4OA 3C09B 3C6LB 3MGTB 1HESA 1M42A 3U1SL 1V55B 2NY1C 2A2QT 3NJHA 5FO7A 3BZ4A 2EYRA 4FGMA 3U79A 3SOTA 1XGTB 1OWRM 3V10A 5C07B 5AAPA 4AEIH 1MCQA 2BMKB 3WKMH 4AQ8A 1E8ZA 4JG1H 4BSJA 1YY8A 3FAXA 5BXFA 5CZXC 4OJFH 1CE6A 4Q2ZA 2CO7B 1FZKB 1EO8L 4M5SA 1C7TA 2V8MA 1VPOH 4Z8FH 3P2BA 4GW4A 2JI1A 2Y4SA 5I17A 4BQ8A 5AW0B 5L2JA 3MNMA 2BHFA 5EU6B 5HGHB 3JWOC 4V33A 2WZ6A 5B38G 4NUQA 3TT3H 4MCZB 2CBMA 1XH1A 3HLAB 4LSRL 3QBTB 4UQ2A 5E00B 2W9EL 3VQMA 1GYUA 1FCGA 2OR9H 3MFFB 4PJGE 3WTXA 2YSSB 3OZ9L 4I77L 4LIQE 4ABVA 1IAII 1IFHL 5DLMH 5A2KH 1MCJA 2A6DA 3D4CA 3SYPA 4HKZA 5EC2B 5DZNA 4LVEA 2X2JA 4G7RB 2CJUH 3MRGB 1DQML 2XZQL 4XNYH 4P2RD 2VNCA 3EH4B 3NJXA 5CHNA 3RVTC 1G5GA 2WXOA 3AC0A 3NFSH 4F57L 5MENB 4P2OB 4PJFF 3C9NA 4MKTA 5JXAH 3QHTC 4WJKB 1KJ2B 2ERJC 1QW8A 1USQA 1J0KA 4ZQKA 1DLHB 3M86A 1VZGA 1VJSA 1EAOA 3BVXA 3DTUB 1GIGL 1ZTMA 3EUUA 3K4ZA 3LTVA 5DVNA 1YMMA 5F6IB 1UHVA 1ZIBA 3QXTA 1TSHA 2WZ5A 1BZ9A 3CFDA 5C0JB 2WBJC 3JWDH 3QEQB 1CLOL 5JHMA 2R56L 4MNGE 5L9DL 2VN7A 4BQBA 5E94B 2AQNA 1BLIA 5SWSE 1OAUH 1MI5B 4TULL 5CUSL 3IFNL 4AQ1B 5KSBA 3WLBA 1GRWA 3RUGF 5AG9A 4NO0B 3U6RA 4PV8B 5FKPB 1M05A 2DQCH 1UENA 1A7OH 4UNVA 5DJ0B 2J8UB 5CEXB 2FH8A 3UIZA 4AKOA 4LF3A 2VUKA 5ADPH 4YEFA 2LAAA 4J2QA 2P46B 3NT0A 2CU9A 3GRGA 3TTSA 1HHKA 3QG7L 1FORL 4RGNB 3TBWA 4X4ME 1ZT7A 1V3KA 4S2SB 4KJQD 4XNXH 3NZ8B 3LKPA 3MRRB 1E7VA 3OPZL 1WAAE 3HBPA 3CHSA 3DWTA 3QJZA 1IVTA 3UC2A 2X05A 2XTSA 2OSXA 4F8NA 4K9EC 1HAWA 1RUMH 1S9YA 2DJSA 3IJEB 4JEGB 4PJHB 1A02N 2IAND 1X9RA 4JRYA 4YGVA 2Y2WA 5CGYD 1TVHA 4MXQD 1SOXA 1NPNA 4D0BA 3BDXA 2AJXH 4P5SA 1MHPH 4OGYH 2Y22A 2GJPA 1DBAH 1I7RA 1UD2A 4G7YL 4OZ4A 1F4YH 4DGVH 3B2MA 2EE9A 4UILL 4Y9FA 4EBQL 3FCSA 5EUOB 3QVAA 3K91A 1NBVL 1DJXA 4K9JA 4XXWA 3MLSL 2E76C 3TU6A 3GBMH 4XP6H 3ZE0E 1KJVB 1L6XA 1P84K 3IMRA 5IVXA 3QCUL 4XBMA 2IWGA 2ADGB 3C60D 5HHOD 2FIKA 3ROLB 3WUZA 3GMOA 4AV5A 5A40E 3ESNA 4PWGA 4KTDL 3EGXB 1A2YB 3AUWB 5CLZA 3IS0X 2Q8BL 1QTPA 4LCUA 4GSRA 5DJ2A 1A7QH 1E7UA 1X5LA 1ZSHA 1BYNA 4ZMTA 1HHGB 4P23A 3IFPB 4NWUL 1LE9B 5IF0B 1CFNA 4WI0A 4MA7L 4ORGA 3D39B 5DHYA 4Z7NE 3LMJL 1MFBH 3U2SB 5IG7B 3IGFA 3F58H 5ERWA 2VC2H 2QR0B 4GAAA 4YE4L 1ND0B 5E7FA 3CDZB 3LV3B 2XN9E 4GQQA 5JOPE 3VFGH 3TFKC 2EDFA 2GBAA 3V9CA 2NW3B 5IQ9B 4NN7B 5E6SB 2GTWA 4Q0XL 1TLKA 4BINA 4F20A 2GITB 2IANE 4L29A 4W9ZA 5FLVA 4LP4A 1OGTB 1ZLSL 5I1EH 1GPOL 4H88H 1U0QA 4JHBA 3CFJB 4LCWE 5B1JA 4HWEL 3RA7H 5CBEB 3WY3A 5IJBC 3HE7A 1P7QD 2JELH 2ZJSH 3BP4B 3GXMA 4C4BA 5IHBA 4NQCA 4ODSH 2NLJA 3LD8B 1FJ1A 4R7NA 3QFGA 3GSOB 2X4TA 5DJDA 1IVLA 3U7YL 1XBRA 4HWBA 2Z65C 3LQZA 1UB5A 3QFDA 5AQ0A 1EEUA 1F1DA 1QSFA 2AXJA 4JFOB 2D7MA 1GZHC 1XFPA 2F7QA 2HX7A 3HTLX 4RFEB 2C26A 1NCAL 4LSTH 4V1DA 1VEPA 1E5AA 2ADIA 4H1LG 4Y4KB 4NQTA 4F7EA 3CFCH 1G9NH 3MV8E 4U3CA 4BK8A 1I9JL 1UXSA 5KBKA 1TZIB 3TYFB 1IIKA 2AEIT 3KPRE 4EIBA 5KOVC 4R8WH 4BSWA 2V2TB 4QHLB 1NC2D 3O3AB 1JHLH 1IKOP 5I0DA 2AERT 2XG5A 2YC1A 5F89B 2Q7YB 1EGJH 3IVKA 5E2JA 5DK3A 2CO6A 4PJ7E 2PWEA 5T3XE 1A4BA 2BOBA 2VXQH 2IIJA 3BAJA 4JHZA 1E4XH 4Z18A 1QWHA 4N0FB 4OB5H 3JYBA 1HL5A 1MPAL 1J05B 3SY0A 3VUAA 3CHRA 1RUPL 2CO1A 3LNEA 5ALCL 3STBA 3CFMA 1YNTF 3EHBC 5DJ6B 3UTSD 1N64L 4PW3A 2P5EE 3AS3A 5DMGC 1DBBH 3K8LA 2CE6A 4BSVB 2VLKD 3SDDD 1KJMB 4AC2A 1LL1A 43C9B 2OP4L 1JGLH 4H2CA 2UY7B 1FNEA 1QBML 3MVSA 3PJLA 1YQ2A 1RZFL 2Z31A 3PWNA 3L3JB 3CZUB 3SODB 4N85A 2BIOA 4XMVA 2ADFH 4N5ED 2Q8AL 1ZSDA 3HCVA 4W9LC 3RWFB 3D0VB 2CLVB 4TNVF 2EINB 2VDMH 2WB1A 4B9ZA 2EIEA 5KVDH 3TFBA 4OQTA 1P5VB 5CJ8A 4NSKA 1IC0A 2OW7A 4PS4L 5JXED 1QTYT 1VF5C 2GY5A 3UMNA 2JJSC 3WXWL 3ABGA 3GK8H 4A2GA 5ICYB 1MRCL 1JZEA 1V7MH 2OMYA 2GBTA 4HXAH 5I1DA 2HYMA 4UDUA 2VQ4A 3WYRA 4X6CB 5EC1B 4FADA 2DI7A 4E0RA 4NQSA 2JKNA 3A4DA 4Y1AE 3RGVD 2WYIA 4OZFB 4XBEL 2AK4E 5AVTB 5A43C 5A2IH 4A68A 5KJ4A 4WCYL 1Q72L 5BS0D 4RA3A 3QUKA 2V2WB 3MROB 4QTIL 5LAXB 4MCYB 5CD3A 2AGJH 3SPGA 5IT2H 1VIWA 1Y0LB 1UFUA 3KGSA 1W0VA 2RCSH 4XX5A 3BVUA 1INEL 4WQOA 5LKNA 3EOAB 5I1GL 1L7IL 2XZCH 2WO4A 1YN6B 1U8NA 5D7JD 3CK0H 2V9QA 4OSUH 5K1JA 4Q6IA 4G70B 1HFUA 1X5MA 3PIQA 4FQXB 4LL4A 2B9AA 2HRHA 3O0LA 4KKZA 4PJCF 2YAEA 4OGAC 1A25A 2X3AA 2ATKB 4JPWL 1LO3L 3VXRE 3KYNB 3UAFA 2XVKA 2IAMA 4EZMA 3LSOB 1NC4D 1RXLA 2NSQA 2QTVA 3S4SB 5GJSH 3ULSA 3TOPA 4YX2L 3HC3L 3SEPA 4AYBA 4TL4A 2CXKA 3DRQA 2APWA 3D4GA 3GZPA 2BSRA 3P2TA 3QIWD 3UZEA 5BOZG 1FNLA 3AS1A 4GH7B 4KOCA 5EOQL 3QDHA 2H1PH 3LQAL 3FB6A 2UXTA 2EYTA 1NGXA 3EDDA 4O02A 4HSAC 2DI8A 2XY1A 2IQAA 1VKXB 4Y4FA 1P4IH 1KYUA 1W80A 2WKOF 4LCCA 2XZAL 4P07A 1Z5HA 1QLRB 1CL7L 5E2WH 5K59E 5BRZD 4K5NA 4X9GA 3BEVA 3UJTH 1ACYL 1PU0A 1MRFL 1WK0A 1VSCA 2J72A 3CAFA 2ROYA 3HZVA 3MYZA 4WWPA 1F58H 5KVGL 2AQ3A 2WP3O 3ZRSA 4WAFA 4C83B 1XSIA 4WKZB 5D6DC 2YPVH 1BMWA 4JKNA 2R15A 1G6RL 2VERN 5ESAB 2BVYA 4MB4A 3GMQA 3AQDA 4DETA 5AUMA 2C1PA 3LH2L 3LN4B 3O8XB 3O6LH 3RWCA 1TPXC 5F88A 1NFAA 4HUUB 2GIYA 4PRNB 5EZIL 5DURD 1DJZA 3PWUB 4WHDA 2Z92B 1XZWA 3MUUA 1BQRA 4E5XG 2NQCA 4J27A 3PDOA 1PZ3A 4W1TA 4BDVA 1TQWA 1EEYA 1WZ1L 4ZUTA 4N86A 2PKDA 3N1PC 3BPOC 3F04A 4YPGB 5I15L 4IKLA 4TTDC 3MJWA 1TVDA 3AJ7A 4XPTH 1ZTXL 3SKNA 1EEZA 1WIUA 1XH2A 2VDNH 4R6UA 3UG5A 4JRXE 5F3BA 2XQBL 1X7QB 2C7FA 2DEWX 3CU1A 4ES8A 1N6VA 2XC8A 1H6EA 3T71A 2FJFB 2MTPA 3EW3B 4DK3A 2ZQKA 3MKKA 3TBCA 1LEGA 2ZX6A 5D8JH 4WNQA 4RISH 1ZA3A 3KWWA 2J5WA 2AFNA 5CCGE 3RLSA 4HGWB 3R7QA 4XNMB 2QKIA 3QHFL 1WWAX 3NGBC 1CN4A 3L7FA 1RD6A 4QRPA 3TN0B 5FV1L 4BWTA 3RPBA 4TMPA 1M2VB 4XVUD 1BBDL 1I4FA 4MS8C 1C8QA 3WJMB 2AC0A 3D0LB 2XN2A 1C5CL 1ETZB 2IQ9L 3ESVF 2R2HB 1GS8A 1T0MB 1WS8A 3U0WH 3D33A 1JGDA 4RFNB 3F5WB 5CEZE 4KQ0A 4XN8A 3MRBB 3F85A 3OXSA 2E3VA 4N0YL 4ZAKB 5E1AA 3KLAB 1FSKC 3K3QA 3MRMA 4WO4D 2QVKA 3JWNG 3DVFA 3PS6A 5DJCB 2PMZA 3VI4A 1PG7L 4JDZB 4APXA 3L4VA 5JHDD 4DN4L 2ZOUA 4M4RB 1KCSL 1CT8A 5E95B 1H6FA 3WKNA 3FQRB 1ORQA 3Q44A 5FHBH 1RJLB 3ARBA 2Z8WC 4G42A 1KMGA 5CCKH 1LEKB 5DD1L 4XVTL 3GBEA 3T0DA 2K8QA 5IEHA 4OFPA 2IH9A 1L5GA 4JDEA 3OKNA 3G5YB 4BK4A 4JZJC 4N5UA 2EIBA 5LXGH 3DVNB 4EVNA 2ZWZA 5LDUA 3FQUB 1JZ6A 5GGTA 1IGTB 1A6TB 2Q2LA 2AZUA 3FUHA 2FZ3B 4KNUA 1AZCA 2UZYB 3KPOA 4X6FA 5IB3A 2EH7L 1FNGB 1TQVA 2GFBB 5MP6L 4IJ3B 3V6OE 1U41A 4JANB 4RWHA 4FABH 5JA8B 4M6NL 5KAQG 1IEBA 4F2MA 4LSPH 3QDGE 5E5RB 3NPSB 1U3ZA 1NDTA 1TZGH 3NIGB 5ICXA 1GAFL 4P8QA 1BV8A 1PZ5B 4Z7OE 5DUBA 5JHAA 3B8YA 3ZBMA 3FQWA 3GB7A 5HYJB 4RDQG 3MLYH 3QC5X 1MY7A 4I48A 1ZEAH 1OWWA 5INCA 1KELL 3MA7B 2DLFL 1KJ3H 3E6FB 1HCZA 1UFGA 2R1WB 1CBVL 1TJGH 4XP9L 1CU4H 2ARJA 5DK2B 5E8PA 5HGGS 3HBZA 1NBYB 2J2ZB 3GMMB 3T2QA 5IJKA 4UQ3A 3B5HA 2F5BH 1Z9MA 3SZKC 3EZJB 3OMIB 5IW1B 2V3DA 5DZ9A 3BVVA 3U82B 3BAYA 2HJFB 2K4AA 2MWCA 2O6DA 2PXYA 3MZTA 4KKCC 4OCXL 2P5WD 1J11A 4N0CC 4PJ8D 4DP0X 5C0EA 2M8XA 1A9EB 1BG9A 1JWMA 1G7IB 4KROD 3QEGH 4EUPH 3DIFA 2W81C 4AQZA 1FH2A 3Q6GH 2DBLH 3H4FA 5LO7A 4IHOB 2Y24A 2VDOB 3L3KB 2HVKA 5HXMA 4MJIA 4FQLH 1S7UA 1MVFA 4G71B 3FQNB 1S3KL 4WWKC 2R4SL 5FOBB 4L2YA 1I8UA 1L9NA 4QXWA 3VACA 4X7EC 1J5OL 1U8IB 5TPWL 5LGHL 1VFAB 4L0YA 4X5WB 2UYLA 3ELAT 3ZK0A 5LQBH 3EFFB 2ZUQC 3L7EA 1E9PB 4XCFL 4OCRL 3NG5A 3O4LB 5LAPA 1HE8A 4L1BA 4Q58C 2B39A 4E41A 2CIKA 1IGFH 5FGCE 4WWKB 3IDXH 1YNLL 2J57A 1RULH 2Y69B 4Z7VE 4PJAF 1QOKA 4F8TA 2Q3ZA 3LPGA 3ARGD 2CDFB 1MFVA 5DSCA 5T3ZH 1XB3A 3DBXA 3HHMA 1HCFX 3GBNL 3ARUA 3A21A 3KW8A 5C09A 4GFTB 3TO4B 2VDPH 2BSTB 3FOLB 3UYRL 1KBGL 2UY6B 2ZWLT 3QIBC 1F42A 3OKLB 3ARFA 3O3DA 1BFOB 3N43B 4CNIB 4NNXB 5FO8B 1AANA 4F7MA 2K3TA 4OZIE 5SWZE 2PCPB 3O6MH 3QK0A 4YNYA 3QC6X 3QZOA 2P8PA 4AH2B 3NA9L 5I66B 1DYZA 4PJXE 4W9EC 2BP0A 1SQ2N 5TF1L 4GLRI 3QJSB 4LLQA 2P49B 5JYMA 1I8AA 2ICWA 5HDWA 1XXFC 2N7SA 3AADB 2Q86A 3RNKB 1NTDA 1ZHBA 3QXVA 4CMMB 1S9KC 3MNDA 4GSQA 3JV0A 5CIPH 4L9LA 1N8ZA 2JK5A 3NSDA 3V4VL 1PLBA 1TJIL 4ZFOA 4IRSA 4JR9L 3WKML 2QDWA 2A9NL 2X53A 4B7IA 3FH7A 1FVDA 2Y9RT 1FYTD 4NP9A 5AB0A 1SHSA 3RWEA 2CUMA 1UXWB 3FB5B 3DDFA 4LVHC 2FWUA 2GTQA 4YHZL 4L4TE 2FCBA 2R29L 3GEFA 4L8SC 1KB3A 4ZMQA 2VDRL 2YQBA 5KVEE 4UTBA 2DQ6A 4JFZH 1TTAA 1BJ8A 1UVQA 3V9FA 1U3HA 2QPSA 3DHJA 2FR4A 3MGOB 4H44C 3RILA 4LMQI 3V79C 4MMXB 2ED9A 1WIOA 3NSFA 3MN8A 4KQ4L 2A6IB 3FBQA 3O81A 1XF4B 3EJPA 1KCWA 2FT8A 2G5BA 2VMJA 4RX4A 4F33B 5LG6A 5EZPA 2XV2A 4MJ6B 1R3LA 3GHEL 3L17A 4LEOA 5K39A 1A9BA 3MGTA 1O7DE 5DLML 3TVMB 1IQWH 3S5LB 5FECA 5GJTH 3S2CA 5D70L 2Y1VA 4KZCA 5AVVB 5FW6A 4U3SB 4ZMNA 5C07A 4P59L 1R3JA 2YUWA 2BINA 3A6OA 3PL6B 4FF9A 4XNYL 2FE0A 3WEMA 1VB9A 4JFEB 3QYMA 2TSBA 2C9SA 3LRSB 4JKWA 4QIRA 5CP3A 3FHQA 1ZK5A 1HINH 1J8HA 2CGRL 3APCA 3O45B 3NCYP 4PJBF 1BF5A 3KD4A 1RLWA 1P5UC 3GLDA 3OXRB 1VFMA 1ZJAA 1Y6MR 3N44F 4JREC 1OTSC 4PY7A 5EU6A 3ARDD 5HGHA 1MDTA 2DYRB 4TV3A 1N5AB 3CLEH 5F6HJ 3TIEB 3BWAB 3HMWH 4MCZA 2OLDA 3PWPD 5D1XC 4UTAL 5T5FA 3X3GH 2EUWA 4Q6KA 4YJZL 3D8MA 3WXVL 1L9TA 1UT9A 4U6HA 5E00A 3TL5A 4EDXA 3MFFA 4L4VE 3N42F 2YD7A 2EDDA 2WUBL 3VFSB 2YSSA 4CC4C 3ARZA 3G5ZA 5B8CB 2B0SH 4Z7AA 4JDTH 4QOKD 2IALA 2DZEA 2BCKB 1A6AA 3MO1A 2B7DT 1MY5A 2JJTC 3DUSB 4N90D 1NGYB 2X28A 4W68A 4L05A 4ANVA 3QNZB 2EEBA 3F7PC 4YHPB 5T1MA 1NCDH 1SXCA 2ODHA 5MENA 1UXMA 5FDYA 1N70A 1BZQK 4P2OA 4XMLH 1CD8A 4YHIB 1QR1B 1KJ2A 5HHPA 4N2DA 3J8F7 1H6UA 1PCXA 2MPAL 4X4KA 3WJJA 3LKQB 4GKSB 3BQUD 3PJSA 1R4XA 4LPYA 5GS2H 1F86A 1AYOA 2WD0A 3BDYH 1AQHA 1T0OA 1CMOA 1OCWH 1MIML 5C0JA 2WW8A 4ZTOH 1FFQA 2AJXL 3MREB 4MXVE 3H6JA 1X5YA 4FTDA 5E94A 4DGWC 3V0AC 1HX0A 5C0GB 1MI5A 2CO4A 2X9YA 3T4YB 4AQ1A 5T3ZD 1A3RH 2F7PA 3BXNB 1PSKH 3KG5A 2LLNA 3L13A 4M7LL 4NO0A 3DX7A 5D2LE 5DUJA 5E2UL 3HNTH 5FKPA 4JPKH 2J8UA 2BIIA 2CUAA 1U2CA 4N2GA 1V54B 4K07A 4WTQA 3ZDYE 2RIKA 3ASWA 3ME0B 4N2OA 3T3PB 3VI3B 1MCOL 5AWNL 4ALAH 1LQBC 4QRAA 4E68A 4BWUA 2AK1H 2WXIA 4EI5D 4LBAA 3HAEA 2EIKB 4PI0A 4HGMA 4N90E 1JNHB 4S2SA 3X14A 2ZKYA 4P5KB 1ZA6B 2CJ3A 1MRDH 2GJ6B 3MRRA 3P2DA 1TMQA 3VFOA 4LDLB 2ESVE 2NUTB 4JM2B 3LQAC 1FNSH 4C8XA 4DN3L 4ICWA 4OZGF 4R4FH 3IJEA 1ETA1 1MCIA 3QPKA 3R4DA 5BO1L 3ZKMC 4AOFA 3F6IA 1WE5A 3HZKB 1I8KB 2BLFA 3F58L 3K2UL 2HVJB 1A7NH 4MZIA 3ZRCC 3BGAA 1NBCA 4G8AC 3I6LD 4XAKD 2PO6B 1A4AA 2IDSA 4NIKB 4DJMA 2WNGA 4RETB 2JV6A 2Q3XA 3UJJH 3WTYA 2ZAHA 5EUOA 1F4AA 1DLFL 1FV1A 3LJ3A 3HR5A 3RA7L 1YNKH 3WL9B 4IYKA 4AENB 1WPCA 3P40A 5INDA 3AT0A 1OOWA 3PAUA 4K3EH 1KJVA 4XMTA 3H53A 1CDGA 2ZOOA 2WCPA 7CGTA 2ADGA 1T3FA 4GW5A 2QZQA 2DQDL 3HI6L 3ROLA 1ZD6A 5CP7A 4XO8A 1G6RB 3QXDB 4BZ2H 1IGIL 4X8XA 4ADJA 4CKQA 4NQDD 3HMXL 5FO2A 3HEIB 2BY3A 3HZYB 4NN6C 1LQSR 4QHUB 2V9TA 5B7MA 3ZYJA 3C08L 2CQVA 3HN3A 4U1HA 1ZLWH 3IFPA 1T1ZB 3QZPA 4G6MH 2VLJA 2WKLA 3B9VA 3S35L 3D39A 5I1IH 1TQCB 1HN1A 3U2SA 3FT3B 4YSQA 4R8WL 3ULVE 43CAB 2QR0A 3O3EB 1ND0A 5ESQA 1WBXB 4IRZA 3QUYB 4M6ML 2XN1A 3KLHD 3GI9L 1JVKA 3GINA 3LH9A 3IFLH 5DJXA 4GSDH 4Z7UF 2GITA 4RFOL 4DGYL 3C5ZC 5CO1A 5JYLA 2VR9A 1JP5A 4F2FA 2WSPA 1OGTA 4LEXH 1E4HA 4ZFFB 5EG6C 1QYGL 5IUSA 3FKUS 1EZLA 1JDDA 4HA1A 3B9EA 1WBYB 3SQBB 3ZQWA 2YD5A 4UYPA 1GMIA 2VR8A 4C56D 2AJZB 2OJEB 1BM7A 1DBBL 3EYQD 3OHXC 3B9KB 3WIFA 1P84J 4DWHA 3PY9A 2NY7H 4NUJA 4BK5C 3OKKB 1AHWC 4RFEA 3TBYA 2YMOA 2QPUA 4PYGA 5EFIA 5B1AB 1AS8A 5HDBF 1ZT1A 4M5ZL 4CC0A 3VXTB 4WHYG 4OCYH 5GGUA 1SGKA 2FWSA 1ET8A 1UWFA 2YIHA 4I1NB 4M48L 1BWWA 3ZKXC 3UH8A 3QR2A 1OCRB 2GSIA 4FMFA 1GZHA 3BSHA 3IN2A 1AHWB 3O3AA 4DOHB 1XX9C 3TBVA 3HFMH 5F89A 1AYRA 5DS1A 3G7TA 2V5TA 3KLKA 3GK8L 1OAQH 3SQRA 2XPGA 2Y23A 3AS2A 4K94L 2BSDA 4J6RH 4N0FA 1WFJA 2FSEB 4OLUL 5DZJA 2IF7A 4O5LH 5FYJH 1BFVH 1LO2L 2XQYA 1TQUA 4KJWC 4B41A 4YDIL 4TVPH 1MH5B 2G9HB 4EI0A 1NFDA 1VADB 4BSVA 1KJMA 2ZP8A 3F12B 3LVEA 4M8VA 43C9A 1IEAA 5IT2L 25C8H 2NT0A 4PJFB 1Z3RA 1DQDH 4JFXB 5F1OB 2ED7A 1MJ8H 4GI8A 2AJUH 2VN4A 4IIQB 4J12A 2BOLA 2EE6A 2ZCKH 1N0LB 2CLVA 4GRLC 3MRFA 1EJFA 4H13C 1A4JA 4GYBA 3AWFA 4KXZI 4LQFH 2AEPL 4F91B 1JXFA 5HJDA 1NOAA 1P5VA 3EO0B 3QUZC 2QQKH 1ACXA 2AABL 4YZFE 5ICYA 4U1MB 4U1JB 5FFOA 1JMXA 3BZ5A 4N6RB 5F3HB 3L9RB 2YD8A 4J7RA 3L6FB 3AW5A 3RUGB 2NXZC 1IJNA 1E4WL 4FZ8H 4OZFA 2ZCHL 2BS8A 2XWTA 5AW1B 4UQDA 2G0LA 5IFHL 5E4IA 4ZNEA 1K85A 2KS0A 3KNBB 5G2NA 1ZWIB 2ZF8A 1A6VL 3MROA 1FFPA 5AZEH 1NZRA 5A6MA 1KCRH 1XGYH 1W8NA 1MFUA 3F05A 2L3BA 5E2WL 4PVNA 3N06B 5ITFA 4ONGH 4KDTC 2YO3A 4MMYB 3ZSSA 5F7NC 2EEDA 4YIQB 1NMCB 2ZX7A 2QV2A 1ODUA 1YN6A 3QXAB 3VG9B 2X4OB 2VDLH 3L2NA 4XOEA 2C7UB 4J23A 3M46A 1A1OB 2A6KB 2J5LB 3FT4A 3GWJA 4ZUUB 4DZBB 3KH3A 4FFZH 4NO5B 1DANT 3WFDL 2VT0A 1N5YH 2WYTA 1PKOA 5GRUH 3ZY7A 1E6OL 2PW1B 4TPRH 1QSED 3O6LL 4PGDA 2VRKA 2BNRB 2C9VA 2FD6H 3FO9B 4NUGH 3VXPB 4GP8B 4QI3A 2EZ0C 2GI0A 3LSOA 1OT2A 1UWEH 3CDYA 1AMYA 5IR1A 1NAMH 3KWTA 4FFTA 3MR9B 5JPMB 1Y07A 3NCFB 4HKXA 3EJSA 5E56A 3U4BH 3TURA 4HS6B 1D7CA 2YD4A 4G8GB 3RGHA 3V5KB 3D25A 3QAZC 3M1OA 5IIEB 4G7VH 1KIRB 4HF5H 3VXNB 2FX8L 2B77A 4LIQH 4KRPC 2LR4A 1CD9B 1ZHLB 3O6FB 1WFOA 1QLRA 4HKBB 3ALWA 3UJIH 2GSGB 5FYJU 1CYXA 3MLPA 4NCDA 4ODTL 1SFDA 4ZI8A 2VO8A 1H3WM 3HR6A 3LRMA 4DTGH 4HQQL 2VR7A 4XX1E 1A4KA 1U8CB 1KCKA 5JUEL 3VYOA 3NABH 1AGEB 2FUQA 4C83A 1OPGL 1FZJB 4ANXA 4LOUC 4XP1H 4HPOL 5JPNB 4WI6A 4TNWF 1X4XA 2NY5H 2YUXA 3MCLH 5FYKH 1TSRA 4DPBX 3LN4A 3O8XA 2X0UA 2AJYL 4Z95H 1KB5L 4PRNA 3V8CA 2ZXDA 3QI9C 4J3SA 5F7UA 2DLEA 4Y0GA 3P30L 3BAEL 5D6DA 5K9OB 4K3DL 3H56A 4GMTL 1HQ4A 1KCBA 4W6WB 1ONQB 1X3DA 3BUIA 5D1QB 3UCRA 3FQXA 3BUTA 2J1ZA 4AT6A 4YPGA 2X09A 4YLCA 3UZVB 4Y16C 3QA3B 4FFYA 2BNQB 4I4WB 4TUJB 3X1NA 1XCTB 1WLHA 2ENYA 1JZ3A 3NCMA 4DZ8B 2ZSWB 4WSKA 2BSSA 2FJFA 1ZIAA 1TG8A 1L7TH 2I25N 4IIZA 5GGRB 1H3TA 5D2NC 1BREA 4LARH 2APBA 4UT9A 3BQVA 4KAQH 4JM4L 2VSKB 5FWQA 1GGTA 2KDYA 2UZXB 5T33L 1A5FL 2V5SA 2VXUH 3RVVD 3UL4A 4CKVX 4HGWA 1QNIA 4WFFE 1TJHH 4X98A 3RIAK 3OTTA 4AC4A 1T0NB 2CLRB 4Y5XC 1CDIA 5KG9B 4NPKA 3Q7JA 4HH9A 2ED8A 1K72A 1JK9B 2QGBA 5D2NB 5D72L 3TN0A 3CVHA 5TGBB 2E75C 3NEOA 3V7AE 2DWTA 2YWYA 3V4UH 4K71B 1EHLH 3DSFL 3US1A 4APQD 3DJZA 3D0LA 3E80A 2F54D 1GYAA 2FATL 2NXYC 5JQIB 4X6DA 2MTAA 1DCEA 3CC5B 1NLDL 3FUEA 2R2HA 4N2KA 5CGTA 4U49A 5T1DL 1MQKH 5CZRA 4G11A 1T0MA 1BVZA 3NFNB 1G9ML 4ZUVB 3F5WA 4DEWA 1WT5C 3EJQA 3MRBA 2VW7A 5IROC 4ZAKA 2QQLL 4FRWA 3KLAA 2EVHA 5HI4C 3MACH 3JWNC 4JDVA 4NRYB 3IRCA 2V7NB 1NC2B 1HKLL 4P4KD 5DCCA 4GPVA 4N24A 5DJCA 5KJRL 3LS5L 4JDZA 1AQMA 3CMOH 3RP1A 4WHTB 3NRQA 3SGEI 3U36A 4YHOL 1X9UA 3IJ9A 2EDYA 4LPUA 1OSZA 3PQYB 4M4RA 1NANI 1Z5LA 3T3ME 4DP6X 2QLVB 3GMRB 1ID5I 3FQRA 4X6EA 5T5NF 1RJLA 1ACCA 2YSTA 1LEKA 4FQ2H 2R4RH 2WQSA 4PRHB 3QORC 2R0KL 4NLAA 3UTSB 4B9JA 3AG4B 5J1TC 4AVHA 2EEXA 5TFSL 4JFTA 4OFYD 3G5YA 4EN3D 5DRWB 3SDDB 1KCUH 5I18H 3NIFE 2OL3H 5FYKU 5C0IB 1N0XH 1PIFA 4OGZA 5KYYB 3FQUA 1HZKA 2XXGA 3NJVA 4PUBH 2R23B 1IGTA 2WBXA 3DO7A 3MJ9H 4FNUA 2UZYA 1Z3GL 3RX7A 2DOCA 3SDXF 2GFBA 3EJTA 3FZUD 4WF7A 5C6WH 5HGBA 4C47A 3VGHA 4Y4HB 5TDNB 4N2EA 3CG8A 3TX4A 2RTTA 4G1MB 1NGQH 5I1JH 1P4BL 5JW5B 1U8OB 1BGXH 4M3KB 4FAAB 2J1KA 2NSXA 4ZUSA 4X9IA 1PZ5A 5C71A 1SN0A 2YLKA 2LHAA 3U0TB 5HYJA 5C0BB 2WTOA 4X8GA 3EBIA 3CQFA 2RFXB 1SN5A 4J3VA 5LUMA 3RHWK 5BW7C 3NSCA 3MA7A 4EIZC 4Z1PA 1IE5A 5GS0H 1MIEH 1X5KA 1OGSA 4M7KL 3ULUH 2R1WA 4PJCB 1FRGH 4MNQE 4NJ9L 4FQIL 1UCTA 1NBYA 1WS7A 1T1XA 1YHPA 1X9LA 2J2ZA 3M6DA 1VDGA 3GMMA 4UUJB 3VNYA 5J57B 2D4DA 3GPSA 3WGUB 3Q8AA 1AKJA 3ZTNH 2J43A 2MOQA 4MA1B 2HJFA 3OAUH 1UZ6E 4KZ0A 1F90H 4OLZL 2OI9B 5FKAB 4BXVA 5I0XA 2V17H 5FYKD 4HULB 2XKSA 2R0LH 1MW1A 1S7QB 4FN0A 3RWHB 5HYQB 4ZMZA 1GYCA 3M7OA 1DDHB 1IBBA 1FNAA 3DNKA 8FABA 4EAEA 4PJGF 2FYYB 1RVFH 4CA4A 1IZKA 3R0NA 4MDIB 4R26L 3L3KA 3RFRA 4ZFGL 3NACH 2CBOA 1T7WA 4YXKH 3B6SA 4NQEE 5KZCD 5FOBA 3FQNA 4Y19E 3EBAA 3WENA 5AOZA 4XC1H 1VFAA 4L3EE 1NH6A 5ESVB 5K93A 4EIGB 2F5AL 1GJUA 3O4LA 3GKWH 3HC4H 2ZXAA 5D7LD 3GDCA 4ODHH 4LASH 4WWKA 2EIMB 1LO0L 5CZVL 2C9RA 3EDJA 2VC2B 1WEJL 2F1AA 2X4NB 1E28B 4L8DB 4BRJA 4IBSA 4AIZB 3AREB 4LVOB 4M43L 4LP5A 2VLMD 4BE6A 1CE1H 2R7EB 1CXLA 2EACA 2XX1A 3QUML 1XAUA 3TO4A 5B39A 2FLRT 1I3UA 4PJ5D 5D96B 3FOLA 2BSTA 1KC5H 2FECL 3FTVA 4MAUL 5BRZB 4Z7QE 1EH9A 2VLRA 4CNIA 1CXFA 4NNXA 5E4AA 4QAWA 3I75B 4RNRB 4FOMA 3QAQA 4AH2A 5GS1C 3ROOA 5I75C 3BFOA 4M1GL 4W70A 5I66A 2YAPA 4LP8A 2LAGB 3BX7C 1M1SA 3I50L 3ZT6A 1NINA 3MV9B 1AOZA 4KGLA 2Q76A 4HIXL 4N3TA 4P46D 3QIBA 4XVJH 1AXTL 1GMEA 3RNKA 3W0WA 5DURB 4CMMA 1IQWL 3ZTJH 2YPLB 3N41F 4GS7C 3SQOL 1IT9H 3NSXA 1RHHB 4PBDA 3QRGL 1U8JB 5GGVH 4LGRB 4S0TD 2CSPA 2GK2A 1S7XB 3CFKA 1I9RL 4H8QA 2PYEA 3FT9A 1OP5K 1RH8A 4N3UA 1WAAF 4QJ4B 4IRJD 3B1UA 1PJWA 2YS4A 1UXWA 3FB5A 1NAKH 3L81A 1KLGA 2IPTL 4XNZC 4GS7B 3S36L 5FO9B 5EZLB 1RJCA 2YGQA 1I8IB 4JFFD 3RNQB 3SO3C 4ZZFA 4FI8A 1R5IB 3H9SB 2ZOTA 1JPTH 5IFAH 2C9UA 1E5ZA 2DEYX 5C08B 3MGOA 1AGFB 1U3YA 3HMWL 5SX5K 3UP1A 2NY4C 2XNAB 3PDGA 4K3JH 4UTCA 2V2XB 2CDEB 5LJYH 2A6IA 4LVNC 5L8JB 3ZUNC 1QEWB 3BN3B 1XF4A 4HK3N 2J6EL 2CHNA 4L8SA 2EH8H 2FO4B 3C5SB 4F33A 1RL1A 4MJ6A 3BWUC 2WXJA 1T2QL 2XXCB 3QNYB 3ZE0F 5KUKA 1IGJB 1AC6A 3V52L 3RKDC 3S5LA 1GZQB 4I0PD 5JA9A 5TDPB 2A73B 2FNWA 3QQDA 1KNOB 1SJEB 1HH9B 2H41A 3FFCE 3MGAA 4LU5L 1M57B 3PL6A 2PYFB 4G5ZH 4K94C 5J1AB 5D9SB 2JB6A 4E42B 5BUAA 1U8PB 2VDMB 3PGFH 3LRSA 2H8PB 3ARYA 3O45A 1GGIL 3IAQA 4Z7NF 3TNMB 5A16A 5IVOA 1Q9KB 1NM9A 2VMCA 1N5AA 1Q1JH 3BWAA 4HEME 4PCTA 1I7TB 2SEBB 3ULUD 1XB6A 4R0LC 3IPEA 1CGSL 4FHJA 1P5UA 2E59A 4UI2A 3KBPA 3QG6B 4QRRE 4ANWA 4PWHA 2EILB 1MFEH 3S5YA 3D85A 1UWGH 4UB0H 2VWEE 5GRVK 4X9YA 3SDCB 3T6XA 4HV8B 4JHVA 4ZXBD 3X13B 1HL8A 3DUSA 1YEJL 4QWWD 4PS3A 3H7BA 5D1XA 3KL0A 2CHDA 4QTHB 5C70A 3CFEB 5BV7L 3PG2A 3QNZA 1F1GA 1W9XA 2DQJL 4U2YA 3N2JA 3DYMA 2QVFB 4F37F 4CC4A 2JSFA 4YHIA 3MLWH 3HG1D 2G2PA 1HH6B 4LPVA 1NPUA 2ZKWA 2JKRM 2AQPA 5DS8B 4JQXC 4JVWA 3GO1L 3UTZB 1HHIB 4OIIH 3RY6C 1BOGB 2PPCA 2Y2YA 3RZCD 1DO6A 2BWDA 2EO7A 2R2BB 2ZX8A 4Y5YB 5E5MB 3CH8A 4GLRH 2R0ZL 3RX5A 1DCLA 3GHBH 3MRCB 4PJ7F 2PN5A 4RGMC 4Q74A 1NCBL 1OKEA 2WWMC 2XKUA 5C0GA 5DJ8A 4FLSA 1CICD 1N7ML 1YY9C 3GLZA 3IDMB 3UP6A 5CEZH 1NJ9B 5KJ7E 3BH8A 3N04A 1R47A 1IM3B 3ET9F 2CPCA 3KVQA 3GMPA 3M8OL 4J3XA 5EOTB 5I0WA 4JFSA 3ILPA 2IPUK 2VZ1A 3G9AB 4XVOA 1UT2A 3ME0A 3VI3A 4MXWL 4BHUA 4FQJH 2JVUA 1OAJA 3HRZB 5I1HL 3SJVB 2LVCA 1YEIH 2O6EA 2HB0A 4B95C 1JNHA 1LD9B 4PJ8B 3T1WA 2ZXCA 2GJ6A 2Y1YA 2W1NA 4KZEH 3QWNA 3I6GA 1C5BL 4JM2A 1CZ8L 1LILA 4UINH 1UA7A 2FO8A 4AGMA 2I7SA 5C0AE 1SFHA 2DTSA 3AQYA 3KPSB 3HZKA 1DBMH 3D34A 5DGQA 1C16B 3US9A 2HVJA 4RAVB 5E6IB 3SDYH 5CBAB 3SOBL 2NNFA 1SVZA 2WLIA 4AQEB 1IAIL 4I18C 4X6DE 2PO6A 2CCWA 2VDKL 1U30A 3AT8A 5FOJA 5KVMC 2ID5A 3L1FA 1LP9E 3WG7B 2VDNB 1MHHB 1E5BA 4LEXL 1CXEA 5J11B 4YWGL 2CMRL 3WL9A 3RY5A 2D3VA 2RHEA 2E7LA 4KJYA 4X83A 3VGFA 2DWXA 1BXVA 4IGBC 3TZVC 2FQEA 4OU3A 5TJWK 4PLKD 1TZ8A 3FT2B 4G8FA 3L2MA 4W9CC 3AVEA 2R1XB 4G83A 4FTVA 3X12B 4JK0D 4AUUA 3IGAB 1G6RA 5DO2C 3QXDA 3TA4D 2CR0A 2CLZB 1FPTL 1T66D 4W9HC 3I9PA 5CNHA 9CGTA 2AEOA 2B1AL 1B4LA 4NGHL 4B96A 1MAJA 2EXYC 5I82A 3O41B 3TZVB 1T1ZA 1B4RA 3UTPE 3VFTB 3UEZA 5JQ6L 5EEYA 2FJSA 1OSPL 4MJJA 1QFWI 43CAA 2BVEA 3MXVH 3O3EA 3H9YA 1WBXA 3U30B 3MBXH 3QUYA 3M1BB 2ATPB 4XBPA 2ALWA 3T2LA 3DUUB 3DX8B 3IXAB 5J6HB 1UJTA 2X70B 5HPOA 4UOQA 4XPHL 4WI5A 1PJ9A 2OMTB 4NCC1 4P57B 1IC7H 5HHQA 3FH5A 2KZWA 5F71A 3SCMB 2Q9OA 4Y9BA 2OJEA 4FNRA 3B9KA 1SBSL 3C5ZA 4NN5C 1ZLVK 1KIQB 3GC3A 3SDAB 5K59F 4Q9QL 5I30H 4CW1B 4NRXB 2IGLA 2V3EA 5GHWL 4F15C 4YDLB 3W1ZA 2RA1A 5ANME 5CLTA 2XQYK 3A3YB 1G9MC 4N9GB 1G7PB 4PJBB 2UWEE 2H26A 5KSAC 5H37G 2V37A 3OHXA 2B59B 2N1KA 3N44B 4Z7IA 3BP5B 1QRNB 4O51B 1DQTA 3MLTB 4FL4B 1AHWA 3GI8L 5DT1H 5DHVA 2R8SH 1D6EB 2NNAB 4DAGL 3AQXA 5E8OA 3ZYZA 1UD6A 3AWGA 4QRBA 2B15A 4KUZH 5C9JB 1XTMA 3FRPB 3E3QE 4HDIB 2E74C 5J4MA 4MA8L 1VGEL 4J3OH 1QKZH 3T0EE 1YMMD 2FSEA 5IMKA 1QW9A 4QKTA 2YA0A 4XBGB 1NMBL 2O5ZL 4ZFQA 3JV6A 4YN3A 1LNUA 4K7PL 1EHAA 4OFDA 3CSTA 2HT3C 5F1NA 2G9HA 1AI1H 3HG0A 4NXKA 5GSVA 5A2FA 3DX9B 3QFJA 3F12A 2W0FB 2H2SD 3DGGA 5IHUH 1W0WB 3ARDB 1I1CA 2DQGL 2WQUA 2NQ3A 4OLYL 1B9KA 2YK1H 4PJFA 3CXFA 5EU4A 3SE9L 4HJ1A 4PM1A 3GLAA 3B9AA 1BD2B 3B43A 1TZHB 5HHPB 4OZHE 4U0RC 2L7JA 2OR8A 4OQTH 4Y2LA 4LOVA 3S3CB 4QOKB 2V9UA 3OR7A 5KVEH 2X6UA 1OAXH 2PNDA 4L1SA 4PREB 4LL1A 1YYMH 5F3HA 5GS3A 2DQUL 4EUPB 3AU1B 3GTTA 4J3WA 3RUGA 2QHLA 4JNXA 3QDJB 5M94B 2BFVH 4JRYD 4PG2C 1I85C 2OULB 1HNGA 3BESR 3PHSA 5DC4B 1T5WA 4Z23A 1ZWIA 4HF5L 1DBJL 2NCEA 2ZICA 4PWEA 1I8MB 5E9DE 3AB0C 1JMZA 2XJKA 3NFPB 4H20L 1IZJA 2QADD 1SDYA 1R0AL 3FSAA 4GG8B 3FJTA 4I2XE 5FHAL 4YIQA 1L3WA 2IDCA 5GRJL 4A04A 4FQPA 2JKWA 1JNNH 3QXAA 4NDMA 5GRXG 2O5XL 2EDNA 2X4OA 5C6TL 1SJMA 4ZUUA 3WUWG 1A1OA 2A6KA 4PJDE 4UZGA 4DZBA 1C5DA 4FG0A 2IGFL 4GO9A 3UTTA 4BFJA 1JS4A 5ACMA 3KJ4B 3EJRA 3RJQB 2ZWYA 5AYQA 2Y1AA 2Y25A 3WN6A 4KTEH 1AS6A 1TJMA 4KDTA 2VDPB 3FO9A 4XC3H 4Z95L 3TCLA 3NIDE 2YKLH 1UH4A 4EN2A 3CSPA 3P11L 4AYDC 4P23D 1X4ZA 1PAMA 4B27A 4U6YB 1J86A 3QIUC 2XUWA 4LSQL 3RIFK 2FL5A 1IC4H 4HS6A 2X6AA 5ICZB 4G8GA 3FF7A 1GYVA 5IIEA 4Z3TA 1KIRA 1SPDA 4O02H 3VXNA 3EJJX 1Z9SB 2WXKA 1MFAL 4ZFZB 5CLYA 2GPZA 5CIPB 1ZHLA 2YPKA 4DPCX 1A1MB 2IH8A 3O6FA 4HKBA 2DJUA 3RTQC 1BEXA 1QBLL 2GSGA 2OZ4L 1JTOA 2GJZB 3QUGA 1QMUA 3GZKA 1JE6A 4XNBA 4DCQB 1AJ7H 1CGXA 3HE7D 4Z7OF 4NQCD 4FLHA 1U8CA 2AKRB 4PBWD 3PGCB 2JIXB 3VGAC 1AGEA 2Z7WA 1RSYA 5E1GA 1PG7W 5IQNA 3DYPA 4LLUB 4EI6B 1G7MA 1QSFD 4L1HA 4QJ5B 1U8QB 2AI0H 2I5YH 3NDYE 4V1DD 3TCTA 1F6LL 3EOTH 2AJSH 1RZ8A 3HLKA 3FUJA 5MHSE 4R7DA 5I73B 5HVHC 3CFBA 5FEBA 4KKAC 3I85A 5DHMC 2ZOKB 4Z7UB 3VGAB 2W95A 1VRSA 2FGZA 3S34L 5DMJB 1OAKH 1KG0A 1T80A 1WAEA 1ONQA 2EKJA 1YPZE 5D1QA 1MJUH 3R18A 1S9XB 4NQDB 3CU7A 3CPLA 3SE8L 3UZVA 3PABA 2CXGA 4QHNB 1HDMB 1GGCH 2BNQA 2VISA 3QI9A 4I4WA 1XCTA 4N0UE 4TUJA 4JO3L 1DBKL 4X5XB 2F68X 1ZLUK 4E5XA 2IWKA 3FS9A 3WTSA 2BS71 5DRZB 3WO3B 2EXWD 3V4VA 4A7UA 4J3OD 5LN4A 1OQOA 2TAAA 1EEQA 5HDBB 4NBXB 1KLUA 4Y16A 1MVUB 1XT5A 2UZXA 2IEPA 2IO5A 3LRHA 4ZOAA 4H0IA 1A3LH 2KQMA 3OWRA 1B2YA 4KKBD 2R29A 4MWFB 1T0NA 4HLEA 5D1ZC 5KG9A 1J1OL 4R4ND 3NJNA 2WMPA 5G5DA 4Z7VF 5D2NA 2YARA 2Z31D 3ESPA 5TGBA 3V8OA 4C56B 3MMEB 5L7XH 3HNVH 3NCYS 3RWGB 4ZOEA 5J6SA 1RZKH 3REVB 3I9GH 3JTTA 4JN1L 4FKKA 5IQMA 5B1KA 1EK3A 4GI6A 3T6ZA 2L7QA 5HHNB 4OF5A 2EDOA 5CS7A 2E6JA 3FOMB 4OZIF 1YNTA 3T2NL 4MCNA 3NFNA 3B3IB 5ILTH 1JCKA 3MJ9L 5HHXL 4O2FB 4G8EB 1DSYA 4LSSL 2ADJB 2XTJE 4H26A 4ENED 4PJXF 5A2CA 3TLRA 3UBXA 1HL9A 1OARL 4JCMA 3TT1H 5I8KL 4E9LA 3NZHH 3IJYB 4NRYA 5H4ZA 5E6RB 3ZDZE 4R96B 1XSOA 2FUTA 2VSMB 3L3IB 4NERA 3DXAB 1BGXL 5KN5B 4WHTA 4MMZB 4WW2B 1EDQA 4RIRA 2A0LD 4XWGL 3PQYA 5IB4B 5F9WC 3A4FA 3VVWA 5IROA 2I27N 3F7VB 3PNWB 1N6QL 1CWVA 4YR6A 1S4IA 4FG6D 2B08A 5GS0L 3FYEB 4KJPD 4PRHA 3T0BA 2HFFB 4KTYA 1GL4B 3BVDB 5HHMD 3VD4A 1URIA 4AXWA 5FCUH 3INUH 3TJHD 3DHMA 1ZDQA 4UTAA 5BV7C 5F96H 5DD5H 5KYNA 4DVRH 1ZOXA 3HG3A 3H3KA 1WTGT 4NPYA 4E9QA 4RAUA 4PLNC 2UVEA 1F90L 5GGTH 5TE6H 4TQPA 5GQBA 4RRPM 3T0VA 2J4WL 4AYSA 5T3XL 1KCVH 4LLVB 3QORA 4PD4K 5IV2B 1MEXL 4YSTA 3UAJC 4KKPA 4N8VG 3MCG1 1TIUA 1RJYB 1M4KA 3IU3B 4IKKA 4S1DD 1EERB 2W9DH 2IAMD 2QSCH 3MODL 4Y4HA 1RVFL 3JZ7A 5FCSH 3QJOA 4M1DL 2W91A 3UXFA 1RURL 5DMKA 3FULA 5JW5A 4FFVC 1JZ5A 4FTVE 3W57A 3AS0A 4P3CL 4PRPA 3D51A 4B53A 4TS6A 5C0BA 4OF0A 5DZOA 3TP4A 4M6AA 2B5IC 2RFXA 4QXUH 1INQB 1G87A 4XMXA 3K0YA 4Y4FD 1DANU 5L0QC 3KDMA 1RK0A 1AR1C 4JJ5B 4HOXA 4PJCA 3VW3L 4MAYB 4XH2B 3OAYH 2VN3A 3EYFB 4Y9EA 2GUOB 4UUJA 5JDSB 3VFRB 2N0MA 1M6OB 1S2EA 1KYOK 2KLRA 2EIJB 2ZG2A 3HHSB 4HUNB 4XWOD 4ZO9A 2B5IB 1ET7A 2VZTA 5BW7A 1KT2A 1ZTXE 3W5NA 4IQHA 3MLVH 5JW4M 2KKQA 2QTEA 4XB7A 1XB8A 1BBJB 1HILB 1KDJA 3MNZB 1HJCA 1S7QA 5HYQA 4GAGH 2FJHA 4K55A 5IJVA 3IDYB 4XOCA 1AXIB 3E0GA 3POHA 3BZEB 3G9VA 2WINB 2FYYA 3QJVB 1WC7B 4MDIA 5AZUA 3VD0A 2WKOA 5H8DA 1AO7A 5EN2A 1QNZL 3UO1L 4GUQA 4WUUA 1I7UB 5DGRA 3CIAA 4XVJL 1JPSH 4N2NA 1LJMA 1MN4A 4P05A 1FDLL 2KZBA 3VXSA 1IT9L 2RMNA 1L9PA 2CJSA 1FIGL 1KOAA 2IMMA 1AG0A 5D7HA 3X1EA 1S7VB 4W4OC 5EOCH 5KS9B 1JRHI 1BP3B 2A5UA 5D7KD 5G4MA 3W38A 4CVUA 1T1YB 3BJLA 3BMVA 4G9FA 3ARSA 3VXMB 5HY9B 1RZJL 3EGDB 4GRWH 4Q7DA 4AJVA 5DQDH 4EOWH 1TITA 4L8DA 4R84A 4GQPH 3IDJB 4I3SL 3O2VL 4AIZA 3AREA 2NNRA 2R0WH 2A9BA 4JFUA 2YEVB 1XF3B 4R2GD 3QQ9C 4G82A 3BGMA 5DYOB 2AEQH 4FMVA 4QYOB 4D7PA 1CG9A 4L3FA 4QRPD 1K6QL 4MXVF 3VJ6B 4QRTB 4NBYB 1DQQB 1BVKB 5EZOL 4RNRA 1HSBB 2WNWA 1A3ZA 1PY4A 3MX0B 2OA9A 2I69A 2MKWA 3JTSA 3NJKA 2B1HL 4KPHL 4YQXH 1JV2A 5D2LF 1J1XH 3T0WA 1HIMH 3MV9A 4RAHA 4N6QA 3G04B 3NTCH 1PX8A 3CLFL 1RFDH 3HMXA 4JMNA 3ZDYF 3H6AA 1VFUA 3FU3A 2X9XA 2YPLA 2IOMA 2GIMA 3KPMA 3MCYA 4TSCL 4Y8AA 5EF3A 3DSNB 3DKHA 3GSQB 4ZTPH 3ZE2E 3DARA 4FLOA 4ZPTB 5PCYA 1S7XA 5L6YH 1K8DB 4KUCD 5C7XL 1MJ7L 5ALBL 1XL4A 3RZWA 1EZVX 4JBSA 5I16A 5IBUB 2YMXH 4NOFA 3OMAB 3VWKC 1R6VA 4AQAA 2ICWJ 3U9PL 2CA4A 1HXMA 1I8IA 2WJ7A 2XT1B 1N8OE 4JM0A 4UTBH 3WKYA 2DWDA 1R5IA 3H9SA 3CHPA 3K2KA 3NN8B 3W81A 4OFVA 3LZRA 1MCRA 4AG4H 5CU9A 3WN5C 4E9XA 5C08A 3ARBD 3VFUA 4HALA 1AD0A 5HYIA 4RQQA 2QSVA 2PPEA 5E23A 2CDEA 5E03A 1JGEB 4XPBL 3POCA 3OJVC 4JO4L 2OS7A 3RVWD 4M00A 2VMDA 2FO4A 4NHUB 5I5IA 2DLGA 5ID1B 4P4RB 4QR7A 3ZZQA 5GGQH 3QNYA 1CFMA 5FUOL 1IGJA 1WUNT 4UB0L 3VI4F 4ADGA 3RKPA 3PHQA 3IMUA 3AQZA 5HD8C 3EJCA 1THCA 4RLDA 1SJEA 3EBGA 1FE8L 3PHOA 4JPIB 2F54B 2M26A 3NVQA 1U91B 5FGBC 2PYFA 2RD0A 3HB3D 5J1AA 3OAZK 4OLXL 1K3IA 2H3NB 3BH9B 1BVLB 3TONA 4E42A 5CP3H 2R9HD 5HYSB 3R06A 3QCVH 4V2BA 2H8PA 4LPTA 2JKSA 4F2EA 5ECGA 2H0FA 2KT6A 4BXSV 3TNMA 1Z9LA 1O9WA 2YXMA 4FNTA 1Q9KA 1U58A 3ULVF 5D93C 3QWOB 4EJ1C 4BFRA 1WTLA 1AD9A 1GHFH 1OHZA 3IDUA 1MF2H 4L5FH 4PTUB 1PDKA 1L0YA 2F53A 3L48A 1CLZL 5E8NB 3SDXB 4X4ZA 1C12B 3ZL1A 3QG6A 1DUYB 5TQ0H 3U83A 4CN6A 3A6BL 2HLFD 2FVNA 4NZTH 5I23A 2ZXGA 1KZYA 1FLRH 3JWOH 4KI5D 4AGOA 2PXYD 3APMA 4Y2DC 1XGPB 5D5ME 1LMKA 3SDCA 1ZHNB 4HV8A 3X13A 3BN9D 4GW1B 2KLSA 2CHWA 4PTTA 4R0LA 3O6KL 3QDME 1NGPL 1RU9L 4QTHA 3F64A 1WZKA 5FYLD 3W82A 4F9LC 4YHNB 2VDLB 5EHFA 2QEJA 1M71B 4FQQA 5CD5D 1E43A 4MJID 5EO1A 1PGRB 4M93B 4WGVB 2BFGA 3BT2H 2YKKA 3KCPB 2NZ9D 2ZT9C 1PZSA 5DS8A 4YSAA 1PKQA 3CDGB 1UM4L 2QVTA 4B6ZA 3UTZA 1HHIA 2A74B 5TDOB 2WXLA 5D4QA 2J1XA 4KK5C 2ICEB 2OMVB 4U1IB 1PIGA 1NDMB 2R2BA 4C4UA 2NTSP 2HG0A 5E5MA 5IQOA 1TQBB 2K70A 4OCWL 2ZF9A 3NESA 4M6OH 4NFDA 2IADB 3Q8EA 3PPEA 1E3XA 3OB8A 4PJGB 2H0EA 2VH5H 3NK4A 3RY6A 3FCBA 3SD5A 4G59C 1GR7A 5GISL 1IAMA 3PYCA 4X6BB 4TN9A 3IDMA 5C09D 2VR4A 1NJ9A 4Z0XB 4JKPL 3I02A 5EOTA 3ARFD 4Y8DC 4XN9A 5HGDB 3FW6A 3MUGA 3VFVA 2FB4L 2K7PA 2CH8A 5C0CE 3MZGB 2FLBT 2FBJH 1DVFB 4PWJA 3CTTA 4QRQA 3HRZA 4D9LL 4IU2B 4IHBA 3X3FL 2XG4B 4MZ2A 3HAEH 1XEUA 1BCIA 4HCIA 4ODBD 2X6BA 1LD9A 1N59A 1PD6A 4M9PA 4PRDB 2PABA 2ZKXA 3HVDA 4PJAA 1Z0NA 1C1EH 2DIAA 1KGWA 1Q4NX 5E4EC 4GO6B 4U2ZA 1HSAB 2VUYA 3KPSA 2R27A 1BFSA 1C16A 1J7VR 2QQNL 4IRSD 1R75A 5E6IA 5AAMA 1N6UA 4AQEA 4YZFF 3ENEA 3AXHA 4FERA 5SWSB 4BBWA 1FBIH 4K9EH 3MRJA 4AYEC 2CO3A 5FW8A 4NP4H 5D7LB 1CD1B 1WZLA 4QMEA 3D18B 3TXAA 5K69A 1U3HD 4HKJA 4YBQC 5JHLL 1IC7L 1JGIA 2D3JA 4I18A 1LMIA 2DRUA 3FFDA 3TBSB 12E8L 4O2CB 2X4RB 3FT2A 2R1XA 2UX7A 3X12A 2NX5E 4RX4D 3IGAA 3IRPX 1SJXA 1LTXA 4PIBA 3C6LD 4ELKB 2FJUB 2ZG3A 3JWNE 4UOW0 3MLXL 2MCPH 4HWNA 4IGBA 4UM9B 3TZVA 1UEMA 3O9WB 3FQYA 1RPUA 1BQ5A 1FCCA 4JO1H 3B5TA 4J28A 1CK0H 2FX7H 5ISZA 1E40A 3LVTA 5C07D 3GSUB 3D3VA 4JG0H 2LU4A 1J5HA 4P46B 3H3BC 5IQ7H 5DC2A 1WD9A 3M1BA 4X7SH 1J8HD 1NBQA 1B4JL 3DUUA 3IXAA 3TNNB 1GKOA 5J6HA 4KUZL 1KPVB 5IUCA 2X70A 3QZWG 1Q0EA 3A6CL 2FHFA 3STLB 3SYCA 3SO5A 4PGBB 4P57A 5EU6D 1H19A 1UACL 3NAAH 3ZE0B 1F8TH 3SCMA 5CZXD 5BMFL 3S7GA 1L9RA 1UZ8A 3H1ZA 4JFFB 3SDAA 3VCLB 3Q9PA 1TNMA 4JKLA 2BO0A 2IV8A 1NCCL 1DVSA 3FU7B 2QSTA 1QUNB 1WH0A 3IE4A 3VXOA 1I7ZB 1UT1A 1C08A 1ZV2A 2GG1A 4K7FB 3WIIH 2GW5A 4N9GA 5L2KA 5CGYC 4PJBA 3KE0A 4MD0A 3ULAB 2B59A 4P2QE 4JGMA 1QRNA 2IFFL 3QO0B 5DC9B 4E9VA 3DROB 4OGQC 1XSKA 2XN9B 5T1LB 3T65A 2F19H 3N91A 2D7TH 4NT6B 5MEND 2NNAA 4P2OD 5BZDA 2Y5TB 2OM5A 3L4WA 1JYNA 1A4CA 3NEEA 5KVEL 4I0PB 4HT1H 2VXTL 4KK8D 4O58L 3ZJAA 5KSAA 3FRPA 1PL3A 2XTLA 3N85H 5KOMC 3LZQA 3CQQA 3L9YA 3VFMB 4XBGA 2BFVL 3C60C 3RVTD 4LEEA 4ODWB 2UZPA 2HKFL 2F8IA 7FABH 2Y7NA 1RIVH 1S9WB 4J39A 2Y6TE 5DQ9A 3D2UB 2XWEA 4YC2B 5E0QA 2W0FA 4KX7A 4FZEH 1MI5D 1W0WA 1TKWA 1IO4C 5IB5B 3LIZL 4GXFA 4NO0D 3L4UA 4R90H 3MV8B 4JGUA 5FAAA 4F80A 4D8OA 4NKMA 3NJMA 1BD2A 2V5MA 1IQDA 1TZHA 1VACB 2J88H 3BGFB 3IN0A 4TKWA 1L6PA 1Q9OB 5DEJA 1KGIA 3UZQB 5JW3H 2VCOA 1ML0A 3ESMA 1WD8A