3AU0A

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
339
structure length
339
Chain Sequence
PVVNVADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Clumping factor B
total genus 85
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3au0A02
4LEBA 1R19A 2Y7OA 3IRPX 4F27A 3IS0X 2F6AA 4B60A 3AU0A 2RALA 4JE0A 4RMBA 4MBRA 2Z1PA 2YLHA 5CF3A 2Y7LA 3IS1X 1N67A 2Y7NA 4JDZA 2F68X 3V10A 4Q6KA 4F24A 3IRZA 5IHWA 4LE8A 2Y7MA 3AT0A 4B5ZA 4FJ6A 1R17A 4JDZB 4LEEA 4MBOA 4BBWA 4F20A 5CFAA 4F1ZA 2VR3A 3ASWA
chains in the Genus database with same CATH superfamily
4MB5A 2NW2B 1V3MA 5FW6A 5I1JH 1TR7A 2OL3L 2DYPB 1QFOA 1K4CB 4V2CB 3Q5OA 5B7MA 1AFVH 3VNZA 4LXFA 5EN2B 4AEFA 3VUAA 1U8CA 3M1BA 4OCYH 1KTRL 4HXAH 4L9LA 2LFGA 3WHXB 5DZJA 2A73A 1FZOA 4PRDB 1QHQA 1FFPA 5AOIA 4P2CG 1DVZA 1P9MC 3RFZC 1B2YA 3LV3B 4NQSA 3HS8A 1JZFA 3H7LA 4WTZG 4ZUUB 4LLMA 3HLKA 1SMOA 2YQ3A 1JHLH 2AGJL 4Z6AT 1FL3B 5FDWA 4DJMA 5FYKL 4P9HC 2B1AL 5IBTL 4PVLA 1DSFH 5DFVD 3RKDD 3W82A 1YRKA 2F7RA 1NCUA 2YMXH 4DZ8B 4YL9A 5IB4B 1D5XA 4G80B 5BOZG 1JNNH 2P5EA 4FXTA 4UU9B 4B7LA 2FX9H 3PWPB 5EU3B 2JCWA 4XRCA 4PLKD 1HILA 1S7RA 1UXWB 2XACC 3BJ91 4LHUD 3QQ4A 4OCSL 4WWKA 4O02A 5F7BA 2D0GA 2GTWB 3KLAA 2MCPL 3V0VA 4KTEL 5I71B 3CXFA 1A6UL 1FVCA 4NQVA 3IRPX 5D4IA 3DV6A 4HPOL 3VXQA 2MPAL 2ZXAA 2YOCA 1KELL 5AZEH 5L2JB 4K94L 2UY7A 1NIBA 5I6MA 5AAPA 2PTVA 4K71B 5L4IA 1AXIB 3BQUC 3FKUS 2JKJA 1DN2A 1JWUB 3P02A 3S3JA 5JLZA 1FV1A 3QEGL 2PTTA 4ZOCA 3FONB 5GSRA 4UTAL 2C9QA 3HPLB 1NDMB 1D6VL 3GNMH 1RK1A 4PRHB 3TEXA 5GJSL 4ZFFB 3TBTB 4PRIB 3BPCB 1QG3A 3C6SB 4J1UA 3TJEH 1ZAGA 4WW2B 3GXIA 1EIBA 2IAMD 3U46B 2UVFA 3HMWH 4OF3A 4QY8B 3TA3B 2QGBA 4YXHL 2I07B 3QDGD 4FLHA 2AMUA 3EHBC 3MLWL 1TJIH 2PLTA 1KWKA 3BP5A 1U92B 4HG4K 3VWJA 4CN6A 1OTUD 2V5MA 4ZNEA 1L3NA 4M43L 3QDME 2A6JB 1CT8B 1BVNT 4FQ1H 5LGKA 2XBTA 4U1NB 1MCOL 4G5AA 5A1AA 5ID1B 3MU3A 3G6AA 3OKOB 4Z3HA 4AG4H 4X2UA 1JN6B 4X6DB 4Y8DC 1UM6H 4MTMA 4ODVH 3SE8L 5KYWA 1GY2A 1PX3A 5DRWB 2OJEA 4QRUA 4Z7UE 2R0LH 1EAPA 5CEZH 3MLRH 3MA7A 4BQ6A 1F90L 1KB9K 1NBVL 4L4VE 3UDWC 5EA0H 2GUOB 4HT1H 2OULB 2K8QA 2MNWA 1JIBA 3C6LA 2VLJD 3QIUD 4X9FA 4B9KC 3LS5L 3CVHH 5E9AA 3VXNA 3VB9A 3ZRCC 3N1MC 3FU3A 4PB0H 2C4FU 3FT4A 1UADC 2KMWA 2QQNL 4WK2B 4XWOD 2XFXB 3KWXA 2EABA 5EC2A 2E76C 3IKCA 1E9PA 4HJUA 3KPNA 3PABB 3QJOA 4LCUB 2V8LA 2BVYA 4F58L 4G3YL 2EDMA 2G9KA 3MGTB 4IGBA 3U9PL 1F97A 3OGOE 1EZSA 5JDSA 4ELMB 2VR7A 4CRPA 2MEJB 1T03H 5CIPB 3S48A 4H20L 2AJSH 3GUTA 2R8SL 2BVOA 4LLUA 3DWTA 4XVOA 1XT5A 4OLZL 1JHTA 5EZIH 4M3KB 2BP0B 1NC4B 3GMMB 2FNBA 1TJHL 4JZJA 1MHCB 3AADB 3C2AL 3WIIL 1F3DJ 4FQXD 4AMXA 5LQBH 1WQVT 3FRPG 4PV8B 2NY6B 3RPKA 3SE3C 3EGXA 2QFPA 1C5DB 2WZ6A 4GUCA 1F3RB 1LK2A 4LHUG 2FIRT 2ZNXA 5CZXD 4QXGL 3OPZL 4ADIA 2WYHA 4OGXH 1LO0L 2V3EA 5TE7L 1F6AB 1HE7A 2O6FA 1T0MB 5DK2A 3SBWC 3C12A 3NJNA 4TL5A 3UYPB 4OCRL 5C6TH 3V9FA 1BZ7A 3N2JA 3N04A 2AXJA 3T09A 3ISRA 2UY6A 4EOWL 1JK9A 2CCLA 4JCLA 4PGDA 3UOAB 4IDLA 3LEXB 1DUZA 5KSAA 3B2VH 4IBSA 4QTHB 4XN9A 3RTQB 4A1RA 3G6JE 3BFWA 2FGZA 3MJWA 5F9JB 2BRRH 1DTUA 2J4WH 3REWA 4LPUA 2PO6D 1ETZB 1HOCB 4XN5A 1QACA 2BX5A 3MBWA 2WVVA 1KPRB 4LOVA 4QYAA 1IKOP 1D5MB 3SQOL 4X4KA 3CMGA 1MJ8L 3MUJA 4ZX5A 3TEYA 1CFTA 2GIXA 1I85A 4R83A 4TTGA 5E1AB 2QQLH 3L5IA 4MD0A 2QVTA 1MLCB 1G9MC 1XGPA 1MDAA 2AEIT 2BNUA 3K2MC 1I8IB 4LGSB 1INQB 4CILA 2KZWA 2VR5A 1I9RH 3QG6A 5AKSA 4I0PC 4A2FA 4HXBL 2W81C 1SJXA 1QBLH 2ZYSA 1UJTA 4ISVA 1N59A 4JRFA 2H0PA 3K1KC 3PWPD 1A8ZA 3WEMA 1F13A 5FYKD 2R23B 2O5YL 4K3DH 4X5RA 1EHXA 2UX7A 4F80A 3QXDB 1LNUB 2IJ0C 2ZSVA 1S6NA 2BVOB 4EZMA 1TZHA 1NCBH 1JYXA 2ZCKH 3VXNB 4PWKA 3ZKXB 1CU4L 5DURB 4J3WA 4PJ5D 1VF5C 3IJHB 4Z7IA 3QI9C 3P9MB 4FHJA 4GSXA 3ATFA 1BVLB 2N7BA 3TO4D 4RFOL 2YAOA 2OMTB 2R9HD 2YBRA 5BMFH 1MW0A 3H9SB 4UMGA 4XMVA 3O3DB 4A67A 2ZF8A 1AIFA 3K72B 3NCMA 5F2FA 5FB8A 1NWOA 2WUCL 1I7RA 4IBQA 5SV4A 5CGBA 5KJ7E 3IFOB 1OSPH 2E7MA 5JA8B 4I3SH 3IVKB 1D5IL 4W9HC 4YSUA 4DNLA 4U1KA 5DUPH 3VXMA 4HPYH 3V7MA 2D9CA 3HZVA 4G8IB 3V0FA 1X6NA 5DJ2A 1ZWIB 3QJVB 4JJ5A 4MJIE 2D8KA 3AWEA 2HX9A 4M5ZL 3OAYH 5FDYA 3FQWB 4G9DB 5SWZA 1DQDH 1T89C 4E9VA 5HHXH 5IGXH 1BAWA 3P4OA 4P57B 3IGUA 1QASA 3QA3B 1YEKL 4IK7A 4UT9H 4X6BA 5CJ8A 3GTTA 1A9VA 1A9BB 4PRIA 5CCKL 3VSQA 2DJ4A 2GSGB 3CSTA 5JOFA 1PVHA 3HMXA 4N8CH 4PU2A 3KM1A 2IMMA 1C12B 3GD1C 3M46A 4TOYL 3L5WB 4JFXB 4XPAH 4AEIH 4DTGL 2PYFA 5KN5A 1HNYA 1RVFH 3MLPA 1LMIA 3QNYA 1P6WA 3TPKA 3VI3A 2YPVL 1ZT1B 3CFBA 3NCFB 3HG5A 1XBDA 5IB1B 2LLLA 1G7IB 1I3GH 5IOKA 4G9FB 3NJMA 2CDFA 1FPTL 1L6XA 2ENSA 2KPNA 1FFNA 2VSMB 3D30A 5ESAB 3DJSA 4NO0D 4J3OH 4GRWF 2OYMA 5JZ7C 3RY5A 2WANA 4RSYA 3ZR6A 2WBXA 2IDFA 1EGJL 4KKBD 5I1HH 2AQ3A 4PJFE 4YN3A 3UG3A 3OR6B 4G9FD 1CLOL 5KSAD 1VB9A 1FNLA 3FQ1A 4UUJB 1FNGB 3BZ4B 5E8NB 1I8LC 4AM0B 2GJRA 2KLSA 2TRHA 2DLGA 3W1ZA 4A7UA 4ZW8A 3QHZL 1E4XH 1UACH 3GLZA 4DW2L 1J1OL 3GSRA 2VKWA 3D50A 2ZWSA 4GLRI 3D2TA 3WFZA 3S8WA 1MLCA 1S2EA 4JMNA 2GKIA 3NMEA 1BIIA 3HAEG 1QTSA 3IAPA 2EVJA 1R3JB 4ANKA 4X4XA 4Z0XA 3NCYS 3CVBA 1HXKA 3ILQC 2WYTA 5E1HB 4PS7A 4ZO6A 4LLWA 3AREB 1NDGB 3O6ML 3ABLB 1RUKH 3DRQB 3IDMA 4IIQB 3AB0B 1DQLL 2YOAA 3K3QA 1OSYA 2ROXA 3QFJE 4G6AC 2R4RL 3IU4H 1AIZA 1F6LL 2MOQA 1KJVB 1T1XA 3JTBA 2VRKA 1HSBB 3H85A 3NP3A 4KY2A 4ZSOA 4TQ8A 4EDWH 2XRAH 1UH4A 4HS8H 4FQCH 1G5GA 4WEMB 4X6CF 4UBDC 5HDBF 1YQVL 3W5MA 1HX0A 2IALB 2VIRA 2BSTB 1QD0A 2I26N 3QZWG 3RTQD 1L9SA 3G5XB 5IG7A 3EADA 4GSQA 5JPNA 1E7UA 2W92A 4A6YH 4AQOA 2VNCA 3BN9D 3RUGB 2XZCH 3VFWA 5D6DC 4AYEC 4AYFA 3CFDB 5E9DB 5LAXA 3M17B 4HJJL 5KYNA 5C92A 4JCMA 1FAKT 1J0KA 4PCSA 3BZEB 4OZ4A 5JOEA 1YQ2A 2HKHH 1BYNA 4Z7WA 4DKEL 1LO2L 3EJUA 2W07B 5ALCL 3H53A 2E47A 4YLBA 2BIIA 3JVGA 3MX0B 2YR3A 4YHLH 5DRNB 1U8QB 2L8AA 5IBLC 4P59H 1R46A 4G5ZL 4J8RA 5CZRA 4R7NB 4V1DB 3KPQA 5DD5H 1CLVA 2DD8L 5HYJE 2KKQA 3MRIA 5GRUH 1UKQA 2AZUA 3WLBA 4WUUA 3NTCL 1AD0A 4BRVA 1UWGL 4Y5XA 4K8RD 4OLUL 4PJ8B 3HG2A 4NC1E 2LR4A 5KVFE 1ITBB 1C08A 2WQVA 5J7CC 4PJ7F 4PJXB 1CLZH 1DUYA 4N1HB 3IM1A 4DZBB 4L5FE 4MMZC 5J1TC 4LMQE 1XD0A 4I48B 3GB7A 4N2LA 3TVMC 4DSYA 4YBHA 3LJ3A 4FLOA 2Y7QB 4Q6IA 3MTRA 1BVNP 3VACA 4B3EA 5L0QB 1KLUB 3UZVB 2A6JA 2AFNA 3AAZA 2OXGA 1XL4A 3GO1L 3V5DB 2FWOB 3DNKA 3SKOB 2BSRB 1K3ZA 1JZ7A 1SOKA 4LVHB 1X4ZA 4HWZA 2TSAA 2X70A 1AZZC 3SKJH 3HRZC 4R90H 4JRYB 3JV4B 1CL7I 3UCRA 4F15B 1ZHKB 4YSEA 3VI4B 1UQSB 2OSXA 4XVJH 4GRLD 4D94A 2YXFA 1NLDL 2YK1H 3MRPB 1Z9OA 3NFNB 3Q5TA 4PRNA 3T71A 1EA9C 5E2VL 5I16A 4NP4H 1UOLA 2VXQL 4LNRB 4Y9CA 3S2CA 1WGOA 1GS7A 4M7LL 5GS0D 2XETA 1WH0A 3EO0A 4GSDH 4NZTH 1KGUA 4ZO7A 4YK4B 2DMKA 3CFCL 5GS1B 1EFXB 2NQCA 4MLSA 5C0BD 4P4RA 4L8BA 2L7UA 2GYSA 3JVFC 1M1XA 3FFOA 3OLGA 3KM2A 5HDWA 2UZXB 2XTJB 4OT1L 1YEHL 1FE8H 5IEHB 4M8RA 4QRPA 4YE4L 1K8IA 2BP8A 2VUOA 3FOLA 5HI5D 3BXNB 3ZW3A 2OXHB 4BHUA 4NQCB 2WZPA 3BPNB 1NC4D 4JGUA 1HEZB 4KZCA 2FYYA 1WAAE 4X4YB 5KYYA 2BSCA 3IT8D 4G7YH 4JM2C 1JYVA 2EICA 5L2JA 1CICB 2YD4A 4GSRA 5KSVB 3QDGB 1D5XB 2NY1B 4G80A 3S34L 4WUUB 2Y6SC 4N9GA 2NNAB 2E75C 1R0AH 2UXVA 5A2KH 4BH7B 1BM3L 1ZPUA 1IL1A 1BFOA 1L7IH 1LDSA 2NTSP 2Z0BA 1DBAL 1O75A 2D7NA 5C09A 1JZGA 1BFVL 1XAUA 3O6KL 3IFPB 4PRHD 3QQNA 4QLRA 5TQ2H 4EUPB 4Z7QE 5LNEA 4I3RL 1V05A 1BM7A 1EJ8A 4KFMA 2YC1A 4WRLA 4ALAL 5E5MB 2QQQA 5J12B 2HUHA 3QYNA 3B9AA 1F00I 1R3IH 3ZZ1A 4FJ6A 2CWRA 3C60C 3MRQA 3KD4A 4EN2A 5D1ZC 2BNQA 2WZ0A 4LK4A 3ORJA 1D7DA 3KEHA 4XTRD 4P9MH 3QNXA 5KOVC 4K3EH 3NBNA 1XB3A 1GZPB 3JT2A 3KGTA 4P0DA 1AGFA 2FIKB 2KDYA 3AACA 3KAAA 4Z76B 2OZ4A 4P8QA 4AYMC 2D3VA 5I9QC 5CEXA 1KCVH 1ZLEA 4XAKE 4ZFGH 4JM2B 2N59A 4PRNB 3V5KB 2CJTA 1NEZA 5I15L 3BVNB 1ZTXL 4F2FA 3LIZA 1QI3A 3MRGB 1XGTB 3KPPB 1INDL 2O30A 1XB6A 5TDNA 3SDAB 8CGTA 1E42A 1Z5HA 2YAPA 3E8VA 5JO5B 4QHLA 4YGVB 1KPUA 4P4RB 2DBLL 1LWJA 4URTB 1WBXB 4QXWA 2OXGB 1C9SA 1CYWA 2R15A 2OR7A 3VI3F 4HEPG 2J5WA 4W4OA 4YK4C 1F4WL 2IVFC 2A7BA 1QATA 1K8IB 2BP8B 3FOLB 1IQWH 4PRID 3OM3B 2ARJA 3F01A 1J8SA 1F1AA 5HD8C 4UOZA 3QC5X 1OAQL 1JZ8A 3AGWA 2V3FA 4WI6A 3DDFA 2NSXA 1BHGA 4FEIA 4XR8C 5BRZA 1UWEL 4MAYA 1F4XL 5H37H 2MCMA 4BQ9A 2D03H 3NCJH 1ZV9A 4RA3A 4AYGA 5K59E 2EQDA 5E2WH 1B9KA 1EANA 2DN7A 2WCGA 3FRUA 4OZGA 2YD3A 3SO3B 4ZFOL 5KVMC 1KEGL 1UCBL 3J27A 3UABA 1H6EA 5SWSD 3NCBB 3WN6A 4CVWA 2IEPA 5DZVA 4Q2ZB 5FYJU 3NA4A 4LOUC 5I6XB 1FQ9C 5IM7B 1K6QH 1DSWA 1N0LB 2J1XA 3C08L 3FCTA 4NIKB 1Q0YL 1QFWM 1WLHA 1LO4L 2HG5B 2ED7A 1CYXA 4M5YH 5LCVA 4AQ8A 15C8L 1TJMA 1FG2A 3P40A 4I0PD 4PRAB 3I02A 2XCMC 5J06A 1YYML 1SDYA 2TSBA 3ZDXB 2FLBT 4NX0A 1HYRC 3SD5A 2CPCA 3MJ8A 3DX7B 2ALAA 4GRWH 1DP0A 1MUJA 2A1WL 2R29H 4NPKA 5FGBC 4M8VA 1CI3M 1TTBA 4FMFA 5T1KA 5FYJL 2GITB 3VGBA 5HHOB 1DDTA 5I8EA 1H8SA 4KDVA 2DWYA 1CGSL 1HOCA 5IT2H 4PJ5A 1JZHA 2B5IC 2O5ZL 3R19A 4H8WC 4W9DC 4DK6A 1CR9H 4Y5XB 5KVFL 2EXYD 2UXGA 1RZFH 3TCLA 3LKNB 3V4VH 1P0SE 4HIEA 3OQ3B 3ROOA 1GH7A 3V4LA 4J39A 4XP9L 3MV9A 4I4WA 2F54B 4GQ9H 3Q6FB 2X2UA 4CMHB 1TZIB 2ZUQC 5KSBA 1CPUA 3S5ZA 4YSSA 4ZTOH 1M71B 3IJEB 1S46A 2Q3ZA 4KI5E 5FW7A 3QI9A 4NDMA 2AMGA 1XV8A 1KNOB 3MA9H 4MMXA 4P3DA 1FNSL 1KENH 2XWZA 3FO1B 5LBGA 1KUMA 3O3BB 4HIXH 1L0XA 3WXWL 2YARA 5D72L 1OANA 4LIQE 4APQC 4FJYA 2J2ZA 5C07B 3ZX1A 1VGEH 1HXMA 1UJ3C 4ZZFA 2LU7A 4JY4A 3RWIA 4GKNB 3P30H 2P44B 3I3EA 1RMFL 4GKSA 1FNEA 3X14B 1HCFX 2OR9L 3W38A 1F11A 2XN9D 2V2WB 4OCMC 2X1OA 4G7RB 4F9LA 3U4EA 3IXAB 1LVEA 4JZOA 1T21B 4AL8L 1A6PA 2ZUWA 1FGVL 3EYFA 3IPBA 3O9WB 3QPKA 4L8DA 5FO8A 2H6PA 4P23C 3BXNA 3DBXB 1AMYA 3S7GA 1HJCA 5KZCD 1QPXA 2JCCE 4MMYA 1OB0A 3L3IB 4R7LA 4MQTB 5E8OA 3ZTCC 4BZ2L 5EIIA 2XXGA 2EIEA 3TTSA 3LRMA 1DVFB 1U3HC 1EZUA 2A4ZA 4B9GA 4YEFA 1TTAA 3Q1SL 1U93A 3GLDA 4HZ1A 1UJ3A 4CDGC 2YUXA 3I6KA 2EC9U 2JKRM 2ZXEB 4LEEA 1J5OL 4DP6X 2CKBH 3W2DH 4N2GA 1F56A 2K8MA 3GI8H 3FBQA 4N2OA 5FFLA 4BCYA 2WXKA 4OF7A 4JO4L 3CSGA 1CBVH 1RIHL 2JB6A 1ETB1 2F53D 3WNIA 4XWGH 5JXEA 4M9PA 4AK2A 1P4UA 3LN4B 1A5FH 3CFBB 3U6RB 3IAQA 2L4OA 3MJ8B 4DAGL 4Z7OB 1JWSA 3G9AB 3VFRB 5KANG 2PYFB 4YBQD 3A4AA 1FRGH 3U9WA 2DQCH 3P0VH 3SCMB 1OHQA 2VL5B 3DIDA 1R17A 2D0FA 4XP1L 4CVXB 2KC0A 3W9EA 3S0PA 1OOWA 2BS71 2XTLA 4LL9A 3OR6A 3TYFB 5FUCE 1JRHH 3VFGL 4G8GA 3FHQA 3UTSB 2J2ZB 4GOSA 2YPKA 4JPIB 1EO8L 1DJSA 2ZUYA 4HQQL 4N2IA 4P2OC 4ZUSB 2G9HA 5FKPA 2NLJA 5L7XH 4UV7L 4AIEA 3O8XD 1UYWL 4L2LA 4HP5A 2ALWA 4HUMB 3ZDYB 4KHTH 3V2AR 3NIDE 2JCCA 3MRDA 4MJ5A 1E43A 4MAYD 3DROB 2JXMB 2KQMA 2JQMA 1KNOA 1ZVSA 4MMXB 3OJDA 4UI2A 3TYGL 5L9DH 2ATPA 1G5AA 2J8UF 2HUEA 3HLAA 3IJEA 4HLZG 3CX5J 4HMDA 3WIFB 2F5AH 4JO8A 3EBGA 1NDTA 4XGZB 5E00A 2WNKA 3MV8D 3PL6B 1QQDA 4WHTA 4JPVH 5TQ0H 5C2BL 1H19A 2GI7A 3KWTA 3LZNA 3MOAH 1GAFL 4QOKE 4IKLA 3IWVA 1N68A 3HC0A 1ZDQA 2ENQA 3IDMB 1YDPA 3JT0A 3SDCA 2MQ0A 3P9LA 4U6HA 4Z7OF 3WTSA 5I0ZA 5F9OL 4OV5A 1KT2A 4JHZA 1WHPA 3Q2LA 2X40A 4A2GA 1B2WH 5DI8A 3RWGA 3KGUA 1EHLH 1F4YL 4YXKH 1O0VA 4WHDA 2OMUB 2PNDA 4JQVC 2ZG3A 3V95A 2V37A 3W0WA 4R4FH 5K69A 1FLRL 1IKNA 3MNVA 2VLLA 3BH8A 3L5JA 1HESA 3EOTH 4D2NA 2N4IA 4TUJA 2BHYA 2I9TB 4JZJB 4UQ2A 3RL2B 3T65B 4GRWE 3VXSA 4XVUD 4EZKA 3QEQB 1E3XA 3HW7A 2BNRA 1CE6A 3PDOA 2BWQA 2IWFA 4D0CB 1HHKB 1MCPH 2K9FB 2VAAB 1TSHA 4PLOB 2QKIC 3UBFA 1CFQA 5C7XH 2XTJE 1T1WB 1SJHA 1U42A 3CFMA 4LFHD 3N41F 2XBDA 2PP9A 1KLFB 3BHBB 5TJWK 4UNVA 2VITA 3ZL4H 3QRLA 3LEYL 3H3PH 4LCUA 1JHKH 5E1AA 4EIGB 1RIUH 2BSED 3GJFK 5C71A 4D0DB 2K7QA 1E9OA 4CMMA 1G0YR 3F7LA 4PJXF 4EDXB 3D5OF 3UIYA 4M02A 4A7TA 2ICEA 3FSWA 5AKVA 2JJSA 5H4ZA 4TQPA 3NH7H 4HWUA 4ZSOE 5DT1H 2OP4L 4X6EA 3HI1B 1BOYA 1GIGH 3WKYA 3HRZA 1CTMA 1GIGL 4XXDA 3QUML 5CSZA 2Y7NA 2J43A 5EF3A 3NH7L 5GRXG 1RERA 5A3ID 4NWUL 4C58B 3KBEA 3K8LA 3O3BA 5I6XC 2E6PA 2FATL 3AXIA 2DDQL 3MV7D 3NFPB 3DBSA 5ILTH 1NICA 2CA4A 4QRSA 4XBGB 3A6BL 5GRYA 3WUWB 5EBGA 1BFTA 4B9ZA 2IIJA 1ZHBA 3N42F 2NRDA 5DQ9B 5C3TA 4H2CA 5K9QI 1RIUL 4XN8A 1CB4A 3H3PL 1C1EL 1Z32X 2ATPB 1YAZA 3PQYE 1NCJA 3WS6A 5I1AB 2DQEH 3M88A 5KS9F 2WSKA 4JKNA 4V1DD 1Y18B 4Y5VC 2XKNB 2BO0A 1ZGLM 4MDJB 4Z7NF 4MAZA 3WNLA 5I28A 5C7XL 1ED3B 4QNPE 4P2QA 2CLVA 3TA4D 3KMDA 1QW8A 1MCPL 1VACB 3D0LB 5HTSA 4I2XE 2W1NA 4XMWA 3T0WA 4XTRC 4AW4A 2DQFB 5T1DH 5T3ZD 1SEQL 3MNMA 4UQAA 3EJYC 3Q7JA 4ZT1A 1NA8A 4M6NH 5E6YA 3ZKNC 1OWRM 5CIPA 4PJAA 3QQDB 5AVUB 1J8RA 3P0GB 4HAKA 1EMTL 1U8NB 2BNQE 4LLUB 1FBIL 1BBDH 4POUB 3KVQA 2ZT9C 1N19A 1JNHB 3GBML 2R8SH 1J1XL 5DVLA 2OMZB 2Q20A 2P1YA 1Q0XH 3QDMA 3QUMA 4DUXA 3OKNA 3U1SL 2X4OB 1E3FA 1NCOA 4BEIA 1EHLL 5IHLB 3G08A 1B4RA 1C5BL 4OJDH 3LH2H 3K6SB 4P5MA 3MLVL 2E46A 2YWZA 5DA4A 3RX7A 3EGSA 3GMQA 4ODWB 4ZK8A 3B1UA 4CSZA 4NQCA 4ZDHB 3INOA 1QSED 1CDIA 1QUNA 4KGJA 3RY6C 3ARQA 8PAZA 1Q72H 1PG7X 4UYQA 4S1RH 1UD5A 1OF2A 3G6JF 5J1AA 1TSRA 2BOBB 2HVBA 1AKPA 1U8JA 3MOAL 3FUJA 4ZAKD 4I9WE 3TO4A 1WS7A 3NCCB 2HG0A 4FGMA 3ZSSA 3OHMB 4K2UL 5IQLA 3L9YA 4HOWA 2BSBA 4UIMA 2BSDA 2GEQA 4JFPB 2FJFA 2D3NA 1BGXL 4JM2A 2H1PL 5IR1B 1BD2E 1BZ8A 5F0JB 1ZLWH 5F3BA 2YD7A 4XHJD 1J1PH 3TZVA 5HDOA 1A4BA 5D1XB 1I7UB 1OKEA 1A7OH 1CT8A 3Q8EA 4R2GC 4YVUA 3QK0A 5KAQF 2Y1ZA 3H54A 4UV7H 1P7QB 2HVJB 3IB4A 1U41A 2ZYHA 3IS1X 2M1KA 1GTFA 1KPUB 1NQBA 4XB3A 4UWQB 4LSPL 1NAMH 3EBAA 4H0GA 2JKNA 2F7QA 5GIRB 4Z7QB 3HPLA 4X8GA 1VHPA 3R06A 4L8SA 1NEPA 4ZUTA 1NFDA 2L7JA 4OGYH 3DX8B 5C9JA 4L0YA 5KJ4A 2VSCA 3D18A 1BOGB 2VDKB 4KK6C 1Q1JH 4JM2F 3BPCA 2NX5E 1NFIB 3C6SA 3NJIA 4FZ8L 5ABAA 1U8IB 2AS5M 4LPYA 3V5KA 1UWYA 3ATBA 5DVNA 2VRQA 2ORBL 4HOMA 4ZS6C 4HDIA 1DQML 5H37G 4PJBA 3PQYD 3GK8H 1LQBC 3NQIA 2OK0L 1AOHA 2YUVA 3HPJA 5IB4A 4WK4B 1RIHH 4LDCA 4KNSA 4LRNH 1NUNB 1MJUL 1L7TL 2PCPB 3L6FA 4RDBA 3RA7L 5CR1A 3QAQA 3V0VB 2DY2A 1QLFA 1E5UI 2ZUXA 1FIGL 1HHGA 3C6EA 3W57A 3O4LD 3QQ4B 3W2DL 4WI7A 5EEXA 1GS8A 4FXGB 4WTQA 1SYVB 2RIKA 3QB7C 4QO1A 4P2OB 4XCYA 4BWTA 1W72H 4PJGF 3L9RB 2PPCA 4IBUA 2EKSB 3SDDC 1W2KT 1YVLA 3C8DA 4MNQB 2WXFA 2CJ3A 3VDAA 1KFGA 2C9AA 1WITA 2E74C 4XAKD 1NCNA 4OJEH 5EG6C 3F8UB 1P4LB 5DDHB 4B0MB 2UYLA 5EIIB 2I9LA 1UM4L 1N67A 2F9BT 5EZOH 3RFZA 2DWEA 2WBJC 3I2CL 4AKOA 3BZFA 3F7PC 1U8MB 1G7QA 1MEXH 4L4JA 5IG7B 5IHWA 4Y1AE 4TVPL 1XCTA 4AL8H 3QORC 3F7VA 4XPGH 5F7NC 5FK9B 4LOEA 4L3EA 4IU3A 2JJUA 3QO1A 4TL4A 1AO7A 2WBKA 4Z7VA 1XZ0B 3VGGA 3TNMA 3Q6GH 1CGVA 1MHHB 4TVSa 5AYUH 1ACCA 4BSVB 2DQUL 2C1PA 2V9RA 3P30L 3BP4A 4GW4A 2P4AB 2Q10A 3GKWH 1JCVA 2WVSA 3L48A 4PJAE 5C0JA 5DZAA 5FFOA 5JORB 3KYKH 3HB3D 4MYWB 2WO3B 3ZE1F 1LO3L 4UNTA 3R1GH 5CJXC 3L16A 1TPXB 5D72H 43C9A 3W9DA 3TT3L 1IGYB 3VYPA 4UT7L 1X7QB 3LPFA 5DEFB 3G5WA 2R0WH 4D8PB 1ACYH 2PUQT 3VTTA 4YHPA 1S7TB 1KYFA 1IGIL 3MA9L 3R18A 2ITFA 2ZQKA 4YPGA 5FS5A 4PVBA 3V7AG 1C08B 5CO1A 4ZTOL 5I76A 1M56B 2HT3D 1KB3A 3ZQWA 1E6OL 4C4KO 3TNNB 4GQ9L 2I7OA 3HPJB 4WWPA 1FWXA 3HHSB 3B3IB 1E4WH 3RNKA 1WIOA 1UEYA 4ZYKA 1O7DC 2XUWA 4RMRA 1TQVA 3VWKD 3AWFA 5C08B 2NNXA 3HE6A 4FZEH 1P5VB 1JI1A 5D1ZD 2C3VB 3U25A 4OZIB 3EYVA 2O5ZH 5F1NA 1CGSH 1A6VL 2FB4H 4MA8L 1ZK5A 4B95C 1OP5K 5BCAA 3C5SA 4NPYB 4DKFH 4Z8FH 3UL4A 1CICD 2G75B 3RDTC 4X6CE 1HSAA 3ARXA 3BUYB 4HWBL 4UB0H 3U7YH 1RK0B 3E6HB 4HUUA 1D5BB 4TQEL 5IJCC 1NM4A 2GJ6D 4F92B 2Z4QB 2VDRL 5DZOA 5C0EB 4TUOA 3K80A 1BA9A 4GLRH 15C8H 1BMWA 4JKLA 2CUHA 5D96B 2DMHA 3A22A 3TP4A 4AWJC 4WI3A 3LKQB 1NTDA 1KG0B 1A0QL 3EOBA 4N0CC 1K6QL 4X98A 1E5AA 4XOEA 4WI2A 3UBXI 3WJJA 4PCYA 4RGOL 3OX8A 1GOHA 2BVPB 4M43H 4QOKB 1S9WA 4AYFB 1FL6B 2B5IB 1WDAA 4I18B 3QCTL 4JQXA 4QF1A 4UDTA 1KB5A 3GHEH 4QTFA 4GYBA 5IB5A 1QI4A 7CGTA 2D03L 2L7EA 3NCJL 2A38A 1AGFB 2FIKA 3KLHC 3K2IA 4KUZL 4Z95L 2OYLA 3V5HA 2DWEB 1OAQH 4FNPA 4KPHH 4L48A 5C1MB 2D3JA 3QG7L 3CFTA 4S1QL 1U8JB 3B34A 4YLCA 2C9XA 5D2NA 2BPBA 5FYJD 4ZFOA 3SSGA 4FP8H 3ESVF 4RA0C 4YJZL 1S9YB 1QVOA 2ADGB 4GW1A 1MCCA 4YWGH 3L95A 1DDHA 2I85A 4LLQB 5D7KE 1J5DA 5C0RL 1P5VA 3IAGC 1UXMA 1I7ZA 3VU2A 1J0YA 2YJLA 3BGAA 4UZGA 3ZY7A 2X6MA 2XYCA 5DS2A 4PJ8D 3CFNA 2HVJA 7TAAA 5C97A 1Q9WB 4YZWA 1I8IA 3A0OA 2YD1A 5D7IE 4Y2NA 2W0LA 1T7VA 2DLHA 3IJSB 3LRSA 3FYEB 3KPSD 4KO7A 1TTUA 3VGAB 1EEZB 5BS0B 2MQCA 3CFQA 4MRBA 4NZDA 3RIFK 3ULVE 1M53A 1QRNE 2H26A 1U95B 3K6DA 5DO8A 5IK3B 5FPIA 3MUGB 3C5ZB 4FL4C 4PRDA 1HN1A 3QEHB 5CP7B 2Z34A 5JYMA 5J11B 5HGDB 3IDJA 4YWGL 4Z7WE 2VLKE 3B8SA 1IGFL 1WFNA 5G4OA 4NRYA 4AEEA 1MWAA 3H42H 1RP8A 2WNXA 2QADB 5DJAA 1PYWA 1BFVH 2HJFB 3CH1A 3D34A 1VDGA 1OGSA 1TZOA 4K7PL 1Y6NR 3QJTB 3REVB 4YDLC 4S1QH 5I23A 3QG7H 1X5AA 1BM3H 1H5BC 3VH8A 3HI1A 4ODSH 4PJCE 1V7MH 1YN6A 1R0AL 3BPLC 2QVFB 4L18A 1I85C 2YUZA 4U7KA 1OGAA 2X6CA 4ZW3A 4WWOA 1A4KA 4PMEA 4ZFZA 1WD9A 4IOIA 5F1SA 3VYNA 3AJ7A 3B7TA 5FA3A 5T1LA 2A6IA 4G7YL 5CINH 4FADA 4XMTA 1NCCH 3D2UA 3QCTH 1EDYA 3QIWA 2B39A 3QZMA 2YA1A 1CICA 2I9LB 4FNRA 3DHUA 3OF6A 3PQYB 3B4NA 3P9LB 2R83A 1NFDF 3MFFB 4HUWB 2VE6A 3GM8A 4JFEE 4J6IA 4KMTH 5HJGA 4YE4H 3WE6B 2ED9A 3GXDA 5CMAA 4AIXA 3E1ZA 5HHMB 3CZKA 3BCFA 2C8NA 2FJHA 1A0QH 2HT2C 2XFGB 3DX6A 4K8RC 1WAAF 3IGKA 5IOPA 4HGKC 2OW7A 2ZKYA 1E9OB 3CFCH 1AGBB 5J1SC 3UPRA 1S5IH 5F7FA 4OAWA 3TT1L 2VDRH 2P28B 3NRFA 3V6OE 1E8ZA 3WGUB 3OR7A 3GT6A 1HCVA 4DP0X 4C56D 3L3KB 4FABH 3A67H 2MRYA 1NPJA 4IRJA 4ACPA 3D39A 4L4TB 1BZOA 3QORD 3VYOA 2A0LD 3VWKA 4IRSC 4UM8B 2X42A 4XVJL 4B9CA 1G7MB 1RKRA 1OP5H 4D9LH 4R90L 3FUFA 3ZDZF 1D5ZA 2YGOA 3DGGB 4MKTA 4AEHH 1OCZB 3F5WA 2H6OA 4TQIA 5B22A 4PS8A 3GO1H 2X5PA 5GGVH 1YECL 3V55A 3UC0L 3K6OA 4GG8B 2O26U 2YN5A 3OWRA 1E4WL 5F3FA 1WUNT 3JV0A 4YXLH 1RUAH 3NA9H 4W68A 1XGRA 2B4CC 1T4KB 1KPVB 4TUKL 4M6OL 1G1OA 1B0RA 4B9PA 1U91B 1A3RL 4YBQC 3GSOA 3ZMEA 4YBLB 4YL4A 5AAWA 3EFFA 3S5YA 1IGIH 5DJCB 4Q9CA 3Q05A 2VWEC 4JKPH 2PCFA 4FJZA 4MB4A 4AQ1A 2R0WL 4RMTA 2X7LA 3TT3H 2DD8H 4ZUUA 4JN1L 4PJ8A 2A9MH 4YHYB 2PCYA 4P59L 3AREA 2X09A 3WJJC 4XWOC 1LO3H 4KTGA 3TA3A 5ALCH 3KEDA 3LHAA 1JPGA 5EMYA 5HVHC 2FO1A 1JD7A 2WB7A 3Q8CA 3QUYB 1HXMB 2AXHA 4TKWA 3RX5A 2QTEA 5I2IA 1WA1X 2YRBA 3D39E 4OIAA 5DO2C 2Z8SA 3IJ7A 2D31A 2X2HA 2FH8A 3DRTA 4PAZA 1WG3A 3LAFA 5DJ0B 2PPFA 3ZLQC 1URLA 1AXSB 4LPXA 4L8DB 4XPGL 5FO8B 4MMZB 1MEXL 2XRAL 1ZV5A 2Z4TA 3EYOB 3L3OC 4HS8L 1JVKA 4Q9QH 3W56A 3I2CH 3ILPA 1TLKA 3VFVA 4M6AA 3JV6A 3TFKC 2VMEA 4LF3A 2G2RB 4YFLI 1XZWA 4LPCA 2AK1H 5ABDE 4JGNA 1DQLH 4XOCA 1RUKL 4K15A 2EDHA 5DMGC 1H3GA 2YS4A 4H1LH 1OZTG 2BOBA 1DVFA 3PQYA 1TEFA 2HFFB 4YDMA 5JDJA 1M4KA 1X9RA 1UZGA 5J5EA 2AXFB 2P45B 4U1LB 4K23H 2BSEA 3SPIA 4LT7A 4HGWA 3VXUE 3U6RA 4CC4A 1JRHI 4ZMWA 1PFOA 5AEAA 3QHZH 2JKTM 2OK0H 1U9KA 3GK8L 2UY6B 4S2SB 5GS0H 1X3DA 3QAZB 4OD2A 1NLBH 4Z3EA 2XA3A 1E8YA 4NLAA 2ORBH 2EVGA 4PJIA 2HX7A 1I53A 1OT1A 3GJFB 4ETQB 1YUKB 5B3SB 4BFJA 4W9FC 2F5BH 4K71C 2CIKA 3DVNB 1RURH 1MI5E 2GQHA 4KHXH 5D9SA 4JRXA 4X8XA 2FH6A 4FFZA 4WFED 4Z7UA 1R5WB 4RQQB 5AYQA 2Y7OA 1FPTH 4Z5RB 1NAML 1E0OB 2G9HB 2LVCA 4HD5A 4PV8A 5H94A 1ITCA 1UD6A 4M1DH 3BEWB 4QMEA 5KBKA 5F8QC 4HKZA 2XV0A 4JGJA 1KXHA 1YEDA 2VR4A 4LMQI 2DMGA 4B41A 4XPAL 1OLZA 1WBYB 3RIAK 3BMWA 2NDGA 3ZRFC 5HGHB 3FFDB 4PI2A 4Q97A 2OLDA 3APMA 4N8CL 3AS1A 4R4BB 1JDDA 2QSCH 5ACLA 1P9MA 2EIZA 1BGXH 3WNOA 4DCQA 3ZTJG 3V4PA 2E7DA 3NEXA 1II4E 3EAKA 3X1EA 2F15A 4LB8A 2JKWA 3L3OB 3L9EA 4BQCA 3IJ8A 3BP6B 3L2LA 3BZ5A 3ROLB 1PCXA 4DP8X 3IKCB 3WHE1 4H5SA 5TK4A 4HEMA 1SHMA 4KROC 3AUVA 2BOCB 4IRZA 1PZ5B 3S4SG 4BFEA 2H32B 3AS3A 1NPUA 3MAWA 1J7VR 5DUPL 1IV8A 3UTPD 1SXSA 4I85A 5HVHB 3SDCB 2WUCH 4Y1SA 3FU6A 1W80A 1AQKL 3GXTA 3LH2L 3NCXA 2GBTA 5AOKA 5GS1A 2QR0B 1PZBA 4RMSA 2XWBA 1Q9KB 1RHFA 4XO8A 3EJTA 5JR1H 1IBDA 4HGMA 5F1IA 1Q0XL 3UTTD 1J1XH 4D0BB 2FUTA 2C7FA 2C1OA 1A1OB 1BBDL 1J5HA 1FBIH 3FUMA 3B2PA 2WINB 4JQIL 1MNUH 2QHLA 1IE5A 1CU4H 3NCWA 5F0LB 1PZUB 2O93L 1HI6B 2JFCA 4IYKA 2ZCKL 4DP2X 3S4SB 1NCBL 3NAAH 3CV5A 3VMPA 1EXHA 3ZL1A 3FQNB 2VMJA 1HHKA 3LZLA 3OZ9H 2FQDA 3UBXG 2H6UA 1ZTXE 3TBTA 3FN0H 4QHMA 2UV3A 2WVTA 3QXWA 4AL8C 3U46A 1CFVL 3U2SA 4HXBH 1ZXQA 4P48A 4PFEA 2H1XA 5F3HA 3R4RA 1F58L 2R39A 4X4MA 4LASL 3H3KA 1AXTL 5C09B 2DQEL 3VFOB 5EN3A 2IGLA 3RVTD 4NZFA 4LHJB 4HHAB 1J12A 1DL7L 4MAUH 5EUOB 1I8MB 2BXZA 3A6BH 4R4BA 3UH8A 1JGUL 5I8OL 3Q0HA 2VZVA 4HIIA 2FT7A 2DDQH 3E38A 1H8OA 1U58A 4MD0B 5LLIC 2BNQB 3L3JB 1E50A 4MJ2A 1KJ3H 1NAKL 4PGCB 1WBXA 2C3VA 3QUMH 4NAMA 1EERB 2NTFA 5AWNH 3DJTA 4OZGE 2BIQA 2B15A 2LT9A 2WGNB 3FQUA 4N0RA 4NKIL 1OW0C 5FA4B 2EP6A 2ESVD 2NY4D 2VLRE 3KR3L 5DT1L 3SDDD 3VXMB 1NUDA 2ETWA 2DTMH 1AC0A 1HAWA 4XP6L 4ZPTB 3HUJB 3SODB 5LNDA 4PRPB 4LVEA 5E2UL 3T0ED 4OFQA 4X5WA 5IHHA 5JW5A 4JNXA 4U1HA 1XGTA 5CJXA 3UROR 4WW2F 2GHZA 3N40F 5BUGA 4A55A 1RJZA 4FHBD 1G9ML 3LOWA 1JHKL 4L2YA 5ETUB 3LEYH 2R2BB 3DARA 5FFGA 1DE4B 2BIOA 2J72A 2CNZA 2HJFA 5C0EA 4W93A 4F91B 3NEOA 3KPTA 2BVUA 1CJYA 4FI7A 2FJSA 4Q4EA 3GMRB 2VR6A 1XAKA 5AL8A 4BFOA 1EO5A 3PP3H 4F9PC 4UOW0 3D39D 4TSCH 4NPYA 1TQBB 2E9WA 4A39A 1A02N 4KRMB 4XPBL 5D2LF 3UX9B 2BP0A 5CBEB 3MJ6A 1ORSA 4Y5YA 1FLRH 2WLIA 1OHZA 4B96A 3AUWB 4R4FL 5IK3A 3NCEB 4XZUB 3WO4B 4AYSA 3AMLA 1XH0A 3TASA 2BIHA 3U9PH 1M9WA 5AAMC 2FWUA 1JPSH 4D0BA 2XV3A 1GGTA 1CGWA 4JVWA 2MH4A 2CD0A 3GMOA 2QQNH 4HISA 3IXAA 3FQTB 1GYAA 3A4FA 4OU3A 4G42A 5GZOC 2MKLC 4W9CC 3NZSA 4WKXA 5EBLB 1A66A 5EA0L 4P5TA 1NBVH 2AXWA 3CCHB 3O2WH 4PJDE 1KTDB 3ESOA 1OGAD 2F54D 4PGCA 4HLEA 3FQ2A 2E27L 2XSKA 3VJ6B 4BFIB 1HS6A 1RHHB 3BD3A 3QNFA 4UAOB 1ZKAA 3WHE0 1SM3H 2R69L 3BYYA 1PX8A 3GFUA 3PAYA 5B1JC 2W38A 4M8QB 4PY8I 5HHME 1KCRH 1G9EA 4U6YA 4LZKA 4EIUA 4RIRB 1WZLA 5DZ9A 1QP1A 1MCOH 3PHOB 4NN7C 5I0WA 4CC4C 3FO1A 2YRZA 4RESB 2A9BA 4MQSB 3BD4A 1YNTF 1RLBA 3QR1A 4I9XA 1I7TB 2AKRA 4D7PA 4JPQA 4NRZA 3MLWH 1U91A 5EU5B 4EPSA 4JY5L 3MOQA 2WWMD 1JZIA 1BXVA 2Y23A 3MX0A 3WNMA 3N43B 4OCXH 5PCYA 4Y1AB 4GXUN 1JRHL 3BZEA 1B0IA 5DLMH 4JFYB 2OI9B 3U36B 4HV8B 4KH9A 5HYSG 2Z35A 3HUJA 4DERA 2NCEA 4BFFA 4XP1H 5J9PA 3WJLA 1B3IA 4Y4HB 2A3TA 5CFHA 2EAEA 2FX8H 2GSIB 3KHOA 4MJIA 3HVNA 3L8QA 1NDMA 4OD3L 4POYA 3QARA 5JDSB 4DZBA 3EBHA 1NAMB 5IJKC 2CJUL 1DBBH 5C07E 2P46B 1OOAA 4XH2B 2I25N 4N0UB 4XWGL 2QPFA 3BVWA 4JFZH 2DJUA 2DEXX 5EBWB 3RG1C 5I17B 3MR9B 2MPAH 1WUZA 1CBVL 4U1SA 4HUNB 3MTXA 3AS2A 5CR8A 4XNAA 3HHRB 5E9DE 2BP3A 5C0IA 2WQAA 4YHMH 1A3QA 2VLRA 1VGKB 4KTEH 4AUUA 3T6WA 4D8OA 1ZOXA 3RWDA 3CFKB 1WP6A 3IN0A 2GHWB 1AGBA 2DS4A 3D08A 3JV5A 4JFTA 3NT0A 1VZHA 3RWHB 5FUZL 1G1KA 2EUZA 4FQPA 4Y16D 3CHXA 5L4FA 2ITEA 3WY1A 3ARWA 1JNNL 3MVSA 3KPOB 3O4OC 1BJ1H 3W39A 3WKQA 5A43C 5KEZA 3F6IA 4QRTB 5HYJB 5ISZD 12E8L 5AVZB 3WELA 2SEBA 4Z7WB 5E6IC 3WS3A 3LNDA 2YFNA 2FYVA 5F6IC 2AGJH 2J20A 2NYZA 4HLJA 1FGVH 1SEBB 4GXFA 4U7SA 1YO4A 4TSBH 3EO1A 2E7BA 2XV2A 3TF4A 2AJYL 2OR9H 4BKLA 3LPOA 1GC1C 5I1IL 2LAGB 1MIEH 3J07A 4FLQA 3VTMA 3AGVA 5CNHA 1SGKA 3N91A 5J0BA 3BP4B 1VCAA 2ZCZA 4GW4B 4QCIA 4GH7B 2F1EA 4PY7A 5E5LA 1OP9A 4NPJA 4RDQG 2Z31C 5DMYA 3FTWA 4KC3B 3PWPE 5I1JL 2AC0A 4J23A 3S5LG 2WAHA 2IQ9H 1C8QA 4JPWL 1OALA 2EIDA 4JY6A 1MFUA 1JK9B 4HIXL 4KFZC 4PGDB 3WXWH 2AABH 1ZT4B 1E9QB 3OGCA 4MXQD 3OMIB 1KENL 2ESVB 4M6ML 1FNSH 4AQ8C 4C59B 5C0ND 1MFCH 3GLAA 3RFRA 1IAMA 4L3EB 1IFRA 5E8NA 3OJ2C 4X6BB 1DEEA 2YQGA 5LWYH 3GLEA 5JHAA 1UTDA 5I75C 3SGDI 1CN4A 1KLFA 1MCIA 4I89A 1KB5H 1BZDA 1P1ZB 2K3TA 4P5RA 2UZIH 4Y88A 5IFJA 4OUUA 3VAEA 3WTXA 3N06B 1DFXA 1E4KA 3GC3A 2AABL 1RZFL 5ACZA 4KQ3H 2Q86A 2PN5A 5IT2L 2Y07L 2ZKXA 3LKPA 3QJZA 3AM8A 1A2YA 1SJVA 1N6QL 3CU7A 5FAAA 3O45A 5AAMA 3MNVB 2A1WH 1MCBA 5BO0D 4MNHB 1YN7B 2V5RA 3QDJB 4C4BA 4F8TA 3Q44A 4NERA 1MIEL 4A2DA 4LGRB 5E4EC 1VEPA 4L3EE 1PD1A 1S7SB 4N2NA 4WUUE 2AJYH 5JXED 4PYGA 1QFHA 3HEIB 1PDKA 3DO3A 2WQRA 3LSOB 1IGJA 3AITA 4JAMA 1A3ZA 1ZA6B 2PWGA 3OJVC 2FVNA 4NCC2 1G1YA 4UQDA 3EDJA 2XBZA 2AQQA 1TQCC 4NM4H 5D6CA 4DFHA 5KSAC 1LO4H 2H32H 4RVBA 2GUYA 3MRRB 3C08H 1NBZB 4JVUA 2GPZA 3B7UX 4OB5L 4QGYA 3RL1A 3DHJA 5DI8B 2YD2A 4ZG1A 5KYUB 5CILL 3ZE0E 2JV6A 4XODA 3SOTA 4NNXB 1TKWB 3SJVD 5CBAB 4DT2A 2NQ3A 2JMRA 2MKWA 3NN8B 4FKKA 2GFBB 2VJ0A 2R1XA 4HD9A 3PV6A 4W70A 4JRYD 4MXWH 5AW0B 5BZWA 1UCBH 5BS0E 3K72A 4LSDA 1AR1C 3CLFH 3HC4H 4ZRGA 1J48A 2W9DL 3QXAB 1ESOA 1LGVA 1WRFA 5FYJE 1CXLA 2H32A 3O6FB 4TNVF 4G72B 1JZJA 3ARSA 3O6LH 2VXSH 3CZFB 3H0TB 4RGNC 2G2RA 8FABB 2Z4QA 4YUEH 2OAAA 1E28B 1JV2A 1VADA 2YZ1A 1K5NB 3K0WA 4GEIA 5EU7C 3R7RA 3VQ1C 2BVQB 4JJ5B 4Y2LA 3BPOC 1CK0L 1DUYB 2EO1A 2FJFB 4EI6B 1SUHA 4PJGA 5GGSB 2NCMA 4Y2OB 1F4WH 1A7RL 3OKNB 4OQ1A 1DBBL 1NMCC 2WTOA 5J13B 4JO2H 1XIWC 5DFVC 3RKDC 4OD3H 2FX8L 2VWEE 2DBLH 2YA2A 2UWEB 5BRQA 4AVKA 4L4VD 4A7SA 5CS7A 3MBEA 3U7WH 4PD4K 3FCTB 1VIWA 3DI3B 2F74B 4NO2A 1TU2A 1NWPA 3V6ZB 4QKXB 4AGLA 5G4NA 2ID5A 2DLEA 3GJFH 3V0HA 5DLML 1JZ6A 3W11C 1INDH 1ONQA 3KLDA 1UOWA 3GSQB 4XB7A 1ZT1A 1N4XH 4JY5H 4RDQF 2EC8A 1U3YA 3QDJD 4Q56A 3L3OA 1A4KB 3KZ8A 3UMNA 2B1OA 2OYPA 1S8DA 1C5DA 5KYXA 4LSQH 1H5BB 3GPSA 4L29B 2ICWB 2D2CC 2WKLA 2XWRA 2Q6WB 1AZVA 4KKPA 4U05A 3P4OB 1Z9PA 1ZHNB 3VFTA 5TE6L 1I8AA 2H3NB 5GQBA 3WNKA 4FFYA 1KCRL 3WE6A 3JWDC 4NUMA 3NJFA 3FT2B 3RU8H 1MHEB 3SCMD 1F3JB 3HN8A 1SF5A 2ZXGA 3SY6A 3QO0A 3BWSA 3O6KH 5D1QC 1RPUA 1DBAH 1EHNA 1KV7A 2M2DA 3TWCL 4FQ2L 3DOSA 1L7IL 5T1KD 1D9KA 4QAWA 2VLRB 5DUML 4PJGE 3ALWA 3O41B 3S34H 5K9JL 3D87B 3O9WA 4LSSL 4WI0A 2WXOA 4HS3A 1YMHB 2DI9A 4XCEA 4GBXD 2Y2YA 3E2HC 3NJVA 3DX0A 3QIBB 1FN4A 1NUGA 2OMVB 5MP6L 1JPSL 4RFNC 3B3BA 1ZV2A 1S78D 2D7QA 4RX4D 5LBSA 4HX1B 2SEBB 5A7BA 3VFNA 5TH2B 2NY5H 3ZHLA 1G4MA 4WK0B 3GXFA 5EWIL 4IKKA 1OTSC 1Y1UA 2QGEA 1BZQK 2FBOJ 2V5SA 5CLZA 3MRRA 3KWWA 2X2YA 4XPBH 1N64H 2LV4A 2B16A 1BBJA 1NEUA 1OPGH 4QT5A 4M1CD 3I9PA 4M7LH 2Z7ZA 1U58B 1M7DA 4YQXL 3T3MF 5DU7A 5FWRA 4WV1B 3PIQB 3KPNB 1VAHA 4CVXA 4FD0A 1WBZA 2MNJB 3NDZE 3OR7B 2WLMA 3X13A 5C0CD 2O61B 5D8JL 3BUPA 1QSFB 3LY6A 4FFZL 4N2EA 5E0QA 1OAJA 4WTWA 2FHBA 4TXVB 5HI4D 1IARB 4QHNB 3MO1B 3L1FA 3QZNA 1E28A 1T1XB 3KJ4C 4FYQA 3SKJL 1PPIA 1JZ2A 1KPRA 4LGPB 3BVUA 5AVRB 1ILSA 4YC2C 3U6XS 2KLRA 3L4XA 4G8GD 4H44C 5GISL 3REWB 3VRLE 4CKVX 4XO5A 3ZN6A 5J3HC 4CVUA 2QV4A 4XP6H 5FOBB 1DQVA 1AC6A 3PP3K 4JZNB 1N5AB 2DPKA 2XQYG 3KR3H 4H1LG 2FO4A 4NKIH 2FTAA 5I24A 2YBGA 2R7EA 5AWNL 2AK4E 1GGIH 3G9VA 4U31A 3FQXA 3RLSA 1NAKH 1KJ3L 1F8TH 4M4RA 5T5NF 3MUY1 1BEYL 2X7LB 3II3A 1KTLB 3NTCH 4XZ4A 4NC2B 1BG9A 1XEUA 2F53A 3CDCA 4LHUA 5BXFB 4YEEA 3V9CA 4HUUB 5DD5L 1HYSD 2E7HA 5JUEH 1DL7H 3NG5A 1KTBA 2TRYA 3DPBA 2EYSA 2GW5A 1N26A 3FOMB 1TLMA 4OV6F 2F7PA 2B1HH 4KZEH 1AXTH 3QZBA 3BFOA 1XF5A 2QT6A 4XB8A 2HKHL 1EJ6A 5TF0A 1D7BA 1MHEA 4L4TE 2XT1B 1E4KC 4MJJA 4OF0A 1SY6H 2LABA 3GSXB 1M7XA 2ZOUA 1CC3A 1ZHLA 9PCYA 2YPKB 3IBEA 3GPEA 4KGLA 2EEBA 3CXDL 4HIHB 3G6JB 1FL5B 3OZ9L 1LWHA 1MI5B 2D2OA 3OJDB 4A6YL 2JTYA 4FNSA 3ULVC 1TF4A 4OZIA 3NAAL 1U3ZA 5AVTB 5BOPA 2CUIA 4HU2A 4FTVD 1OD7A 1JG9A 2KT6A 3JYCA 4HCRA 4FQCL 3RGBA 2WXJA 1LK2B 3CK0L 1BD2D 4EDWL 5LN8A 1RJYA 4JQIH 3UBXB 4ABUA 4N24A 2G75A 2QPDB 2XWDA 5J57B 3MLUL 1FFOB 4BFGA 1DQJA 4Y7OC 1FO0B 5LAPA 3JSSA 5CGTA 5DUJA 2WYIA 2HX8A 3LN4A 2CGZA 3F6LA 4PN6A 1IIIA 1B3JA 3MV7E 4JHAH 4BXSV 2CU9A 2WLIB 3O6MH 2X4QA 4YHPB 5FYLH 4NJ9L 5KJRL 2NY4C 3AQZA 3WMSA 1S9YA 3H9HB 3K4DA 2AQNA 1L9TA 3R7QA 4QTIL 1N7MH 1A4JB 1RZ8A 1SZNA 4PJDF 2IV8A 4X6FA 4J7RA 3RWFA 5D7JD 2YIHA 4PJIB 1JF1A 1S7WA 4ETQA 2YBRB 3AROA 5I30L 1SJEB 5IMLB 1UWFA 4LU5H 4S2SA 3DO7B 4Y16C 5DHVH 3NEEA 2XZQH 3EGDB 5BQ7B 4GG6B 4Z77B 2CH8A 5HHOE 1EGJH 5I1HL 3LRSB 2RH0A 2QSCL 2YEQA 2I69A 1D2PA 2QGCA 1PBYA 4FQIL 4HU8A 1VPOH 3BUYA 3DMMB 2D0HA 4WTXA 4GY4A 4I87A 2ISDA 3OXRA 5HVWA 1UB5A 1XO8A 3QQ9D 5H2BB 1OGTB 3N6YA 4K9JA 3HE7B 2IBGA 4M1DL 1NZRA 3KPPA 5I1CL 2UXTA 4RMQA 4MQ7B 2FQEA 4DTGH 4AEIL 4U1IA 3N85L 2QPSA 4FG6C 1VPOL 4FQIH 2YMTA 3T0BA 3QVAA 2YC1B 1XH2A 4P05A 5CCKH 3WTTA 3EJYD 1T4WA 4GRMA 1QRND 1YEKH 4UT9L 1FFPB 4X42A 3MGTA 4LU5L 5IEKA 2VAJA 5C0IB 5E51A 4OLYL 5HHXL 1DQDL 1YUHA 1TTFA 3NIFF 3T3PE 3TN0D 5IGXL 1NLBL 3BN3B 5DZPA 5DJ0A 4HJSA 3VXPB 5GS0L 3CBKB 2W91A 2OMYA 4KI1A 3LXBA 1WAAA 2IAAC 1A6ZB 4U2ZA 1CURA 5EO9B 1N7ML 5G2NA 4QTIH 1A6TB 4G71B 1XVSA 2OTUB 4JG0H 4I3SL 3BH4A 1UJ3B 3F85A 3MRCA 4PD4J 1KLUA 3UZVA 3D69B 5KJRH 4NJ9H 5FYLL 4OUUB 1JMXA 3PWPA 2XQ0A 1ETA1 2VABA 5SWQB 5GS3A 1TG8A 1G7PA 4JHAL 2IDQA 4AC4A 3CZLA 4HKBA 1T1ZB 2AK1L 4OCNC 5CEYA 4XNZB 2NUTA 3B2XA 4C57C 3KBHE 2X4OA 1UB6B 4PTTA 3OKOA 3MLUH 3QFGA 4PWGA 1SPDA 2EDLA 3HUJE 3M86A 2NY3C 2UUDK 4IOSD 5I66B 3MRPA 1TITA 4QOKA 3NK3A 3DO7A 3ARFD 2VDPB 2XTJD 3P9WB 1FNAA 1RUML 4M9OA 1T66C 3MNWA 4JFDE 4X7FC 5C0BB 2LTQC 5HGAA 3CXDH 4F7CB 4Z9KB 2A99A 4I13B 2Y5QA 4LCVA 2EE6A 2J25A 1SY6L 3H9HA 1OV8A 3FCSB 3DURB 4RRPM 2F8OA 3VFPB 2J8UB 4AGOA 3IGLA 5F7DA 4E9LA 1P6FA 2CXGA 2IDUA 2V33A 3DETD 1LD9A 2JKIS 2HVKA 4QLWA 4CU6A 5LUMA 2ICWI 3IRZA 1U4FA 2IO5A 5JUEL 2A9ML 2QQLL 5IMLA 1AS7A 3DROA 4H7VA 4PJEA 1H15B 2JH2A 2ZWZA 1JE6A 3SQOH 3RWFB 5A2JH 4UBDD 1KLGB 4JKPL 2FJUB 4WHYG 4YOKA 4JRYA 3AWGA 4NT6B 5I1EH 4WU5A 1F8TL 3EYQD 5IMOA 2CIIA 1LP9B 5IMKB 1GGIL 2H8PA 3BCDA 4M6OH 4TUKH 3ESMA 1UOKA 1J8HB 1UXSB 3VXRB 4HOZA 2OMXA 2VXUH 3BSZL 3NA9L 3SE6A 4YXLL 5B7FA 4B27A 3UC0H 1YECH 1ICTA 1TCMA 3DX8A 1MCRA 4APQD 2CUAA 4XXCC 3LKSB 4DHLA 2BNRE 2DMCA 4PRHA 4BWUA 3VFTB 3SBRA 5LGJA 4OCRH 5C6TL 3PPEA 4FQXA 1SXBA 3EW3B 4ODBD 4PJIF 3HB3B 1J9RA 4HAGA 4D9LL 2JF1A 1IO4C 5G5DB 5K1VA 3ZDWA 1XSOA 2VH5L 4TM9A 1Z7JA 3PPSA 4LVNB 3VXUD 3GMOB 2WWMC 5D8JH 1HT6A 1X9QA 2Q3XA 3QWRA 2W95A 3RJOA 2HRGA 5F7UA 1MI5A 3WIIH 1G6VK 1W72B 2YPVA 3JWNH 4YQXH 1X44A 1TJHH 5HYIA 3R06B 5D2LE 4ZUTB 3W11D 2OMWA 3WFBH 1J05B 1MKFA 1S5IL 5AZUA 5ISZE 2A2QT 4KK5D 1N64L 4WNSA 4MWFA 5EUOE 3RVUC 2WO4A 4N4YB 1PEZA 2AJSL 4X5WB 5HGAB 2OCFD 4XN1A 3FSAA 4K7PY 4F2MB 1T03L 1JXJA 5EWIH 3FH7A 5JO5A 1WWBX 3E0GA 3GBDA 4KX7A 3F7VB 4GAJH 4PWEA 3OAWA 5L2KD 4XOBA 3ZYJA 1K2DB 4JRYE 4Y4KB 4KMTL 5ETUA 2WY3B 4PW3A 5K9OA 2R2HB 3BZDA 5MP6H 4JDZA 4EXKA 4L1DA 1NCCL 2BHUA 4N28A 4WEUD 3U4AA 2OA9A 2DI7A 4E41E 1SF3A 1RUQH 3TV3L 5LGHL 5B21A 5CEYB 4PB0L 2Q2EB 2XQYK 4U49A 1JJUA 4L37A 3WAKA 3QZLA 1A47A 3GQFA 1JSYA 5K9JH 3CVHL 2EKSA 3LS5H 1R24A 2V2WA 2MPVA 1V7ML 5GZNC 5DUMH 3MBEC 3H2PA 1S9KC 1DLHA 3IPFA 5HHNA 3ARFA 3KH3A 2WXGA 2RALA 3UEZA 3JQOB 2CHWA 3KDMB 4FQ2H 2XI9A 2CDFB 4K7PH 1PD0A 3MLRL 4HHWA 3RP1A 5CEZL 1ORSB 3H42L 2PWDA 5MI0B 1PNCA 5E5RB 5EOCJ 5ENWB 1OCCB 3RU8L 3SDXF 1G6RB 3OKLB 1O6TA 4N9GB 4PJBE 3TS8A 3B2UC 3AT8A 5FO2A 4AG4L 5IZ7A 5DC4B 5IVOA 4YDIH 1N2RB 2WLKA 3QDGA 1XH3B 4GAFB 3QUKB 4E5XG 2Z7YA 3BPOB 4FQ1L 5IB3B 4YSAA 4P46C 5F1OB 1PZAA 5IJDC 1MF2H 3L5HA 2OM5A 2Y1VA 2LQRA 4QD2E 5B38A 3BWAB 3HR5B 4JFXA 4HDIB 5BJTA 1U2CA 5LB1A 3ZDXE 5CJBA 1CICC 3RDTD 3SKUD 4OD2B 1FC2D 1TENA 5ANMB 3HMWL 3QUYA 5D5MF 1AR1B 1X5JA 2CO6A 4KJYA 3IYLW 4RWYL 1T20B 4N68A 1BQ5A 2X12A 3BPNC 3WLWD 2X10A 2P7TB 4WO4A 2DQFA 4LLVA 2O6EA 5GJSH 3O3AA 4IIQA 5C0RH 3DPBB 1T89A 2BHZA 4KZDH 5J4MA 3U7WL 4XXDB 3FRPB 2UWEE 4QO1B 3CSFA 1VFAA 4E9SA 3QEGH 1PLBA 1T0PB 1CGTA 1NFAA 1OT4A 4O02L 3QIBA 4PMFA 5HI4C 3UAJC 5BVPL 1GY1A 4DVBA 3N0PB 4K94H 3Q48A 2EH7H 5B1KA 3W37A 1CK0H 3RHWK 3V0AC 3VXUA 1WC7B 1LM8V 3DX4A 2Y0SA 3GSRB 4KPHL 3Q43A 3VD4A 5F1IB 1AHWB 2VXSL 4NFCA 2PW2A 3OG4B 1XSKA 1QSFD 3OXSB 2HLEB 4OCSH 5IW1B 4A63A 4NQXA 2W9DH 1PTZA 4PM1A 4DPBX 3HC4L 4ZDHA 1T2XA 4UMSA 2WD0A 4QXTB 2G5UA 4UTAA 4MXWL 5FYKU 5FB8B 3PGDA 4RGOH 2YMXL 4J27A 1MCWM 4XGZA 5E00B 4FA7B 3CHOA 4G42B 3GHPA 4OB5H 2B1AH 5IBTH 4KJPC 5FYKH 2XHNA 2HLAB 4EDXA 2I9TA 2Y1AA 1JHLL 4PG2A 4AQEA 1FV1B 4EEEA 1X5LA 1QZ1A 3EHBD 4RMUA 5BRZB 4P4KB 2IANB 4JFFB 5ES4B 3RZCB 4OJFL 4FMVA 2NQDA 3B8YA 3I85A 2BC4B 3PHQB 5DSCB 4AYBA 1P6AB 1U3JA 5H94B 1IBHA 1VFMA 4HWBH 5HGHA 3U7YL 3KYOA 1NBYB 4WJ5B 5I5JA 4Z8FL 4DKFL 3WN5B 5CJ5A 3OLIA 3DOIA 2Y07H 2VW4A 2CK0H 2NOYA 1Z5LB 3QNYB 5HHNB 1AZUA 1B90A 4YIQA 1MW3A 1CD1A 5J6HA 5EH1A 4E41A 5ACMA 4IBTA 2LLNA 4UYPA 4X6EB 5D9SB 1ED3A 2V17L 5BRZE 4JB9H 2G60H 5JPNB 2R9HC 2BY0A 1JGIA 1KB5L 4OZ4B 5B1BB 3V0IA 1NBCA 4YSCA 5LWYL 5F9WC 4Y4KD 1G9HA 1HK6A 4Q6KA 3RRQA 5DMKB 1MG3C 3VFUB 1VKXA 4KVPA 2YAQA 4KV5E 3S37X 1MWAB 1BF5A 3B6SB 2JJSC 2IMNA 4UT7H 5I5RA 2IAMA 1QYGL 3IDJB 1UZ8B 3T3MB 4JPWH 3C5ZD 2IQ9L 3SGKC 4ZAKA 3MCLH 4O2FB 1F86A 4O4YH 2NNFA 1BIIB 5I6KA 5J56B 2RTTA 2IADB 2XYBA 3MCYA 3EO9L 3MKGA 4DFIA 1T20A 2WUBH 2OKMA 2ZCHH 3KYMB 2CO1A 3COOA 4DQAA 1IKFH 4QXUL 3MI6A 3VWJC 5KBNC 4NQTA 4G83A 1ID2A 1VACA 3D0LA 3ROLA 4EKXA 3EYFB 1D5RA 1T7ZA 2DQUH 3L3HA 3QJHA 4FQXC 4HZAA 4JO3H 4N87A 5I1IH 3I3BA 3VXSE 5AVQB 4F8OA 1WJ3A 2NNAA 2VM9A 3VM7A 3QUXD 3OAUH 4X9YA 2A74A 4XVTL 1IGTB 4TSBL 5AVWB 3KWUA 3U79A 3BW9B 3TIEB 4OSUL 1U0QA 4TVPH 3RZCA 4WNQB 3KPSA 3GMMA 4LSTL 3IDIB 2VQ1B 3VD5A 5DHMC 3OKKB 4EQ3A 2K4WA 4BZYA 2XFXA 12E8H 3N44B 1KTCA 2UWEA 1TQTA 3FFCB 4P3WA 2UZXA 1PJWA 4QRPB 3VD0A 3UC2A 1J5CA 2BS9A 3FAWA 3DX9A 4NO2B 4ZI8A 2QQKL 2HKAA 4P5TB 1CD9B 2HRPH 1ZANL 2HJKB 4HEME 3IJYB 3DJRA 5FUZH 4WI9A 1BMGA 3FU5A 3AU1A 4RRPG 3PABA 4QCIB 5FA3B 5T1LB 3IDYC 4AV4A 1N0XH 3JWNC 2J7LA 4YHML 2C9VA 3K2UL 4M7JH 4WV1C 3THMH 4EI6A 1V54B 1MJUH 4CSSA 1X9LA 3DBXA 2ZCLH 1S4IA 4LRNL 5ICXB 3RA7H 3WKMH 5BRPA 5HVFB 5CIPH 2BZ7A 4JFZL 1JV2B 1VADB 4BK4A 3BI9X 2YXWA 1L5GB 4NN7B 2OMTA 3QSKB 1BF2A 1ET7A 3RWGB 2CJUH 1QRNB 2HZHA 4P4KC 3RNQA 4AQAB 2BJML 3AY4A 1HL4A 2MWCA 3F5WB 1SLXA 2JCCB 1XGRB 2NZ9C 1Q1JL 2XVKA 3R8BB 1FSKB 2OFQA 3GBEA 4OAWB 3ARDC 5BZWB 3MUGA 4PGEA 1E2VA 3HTLX 4LSPH 3FU0A 4OCXL 1ZVSB 5IVZA 1F6AA 1JBJA 2R23A 3DJ9A 3ELQA 2P48B 4UM8A 1A7OL 4K7FB 1L9PA 4FRWA 4JHUA 1J1PL 4OZFH 1BAFL 1J5IA 2CKBB 1A9BA 3TA3D 2WLHA 5JOFB 1LL1A 2H1PH 1I1RA 5DJDA 2YUWA 3WLBB 5EBWA 4JFEB 4HIQA 1K4DA 3AG1B 1X5MA 2PPDA 2A6DB 4U1HB 5F21B 4ECNA 4K2UH 4EN3D 3QIUC 4Q2ZA 5FO9B 3QEUB 2EYTA 2OTUA 3GXUB 3S2AA 1TU2B 1SM3L 2R69H 4JPIA 2ZAGA 5KVDL 4PRBB 2IADA 3VVWA 5EV7A 2BNRD 2E27H 2X4TB 3RWHA 4BGLA 1INQA 1AZRA 1U33A 5A40E 4S1RL 3O2WL 5CMAB 3SDAC 2X2IA 3IFOA 2WYZA 3TJHD 2APBA 3TBVA 3QXTA 1QEWB 1KYDA 1YUHB 5I1LB 2NXYC 2GTQA 4WHTB 5AB9A 3GIVB 1NEZB 2VR8A 5DGQA 3T1FB 1P53A 4YFLF 1C5BH 1MUJB 1QWHA 5J6SA 1FC1A 4QRSB 3MKKA 2X2JA 3RIAF 3U1SH 1ZK9A 2CO7A 2AK4B 1RZ7L 3FF7A 1ZSHA 4M56A 1U8IA 1Z5YD 4N90D 1LHZA 4ZUVA 5TDOA 3IE9A 4LPWA 5I73B 1MCFA 3HC2A 2A73B 4BQ8A 3MUUA 5B39B 3EJCA 3C6LD 3C60B 3QIUA 3AXHA 1DSYA 1MHPH 1REIA 5DHDA 3LPWA 3LV3A 1FG9C 1RZKC 3EOBB 5C0NC 3QULA 1GYVA 4FQQA 5J13C 1FZOB 1M42A 4L3AA 1AY1H 2Y22A 3GJEB 1G0DA 4PY7B 2KPWA 4TSCL 5T1DL 5EU5A 1HHGB 3ZE0F 3KDMA 2WXLA 5KSUB 1J88A 1MJJA 4ATWA 1O7SA 4B9FA 4J4PD 5IJBC 2J5LC 4CMMB 4RMBA 1TVDA 4LSUL 4PJBF 5HY9A 4NKOB 4ZMYA 2DRUA 1A4AA 1JDCA 2C3XA 3US9A 2P8MB 3NSCA 4AIZB 4ONHA 1QFPA 4PRHE 3CMOL 3QNXB 1CS6A 4KDWA 5D7SH 3QFJA 1ZJBA 3L1EA 3GI9H 1OZUA 1YYLL 2RQ8A 3QDAA 1G9MH 4KBPA 4LHQB 4N3UA 1SVBA 5DJ8A 1Z2KA 1E3ZA 5EOTB 5FWQA 3I6GA 5K9OB 3Q8FA 3ZTDC 4PBDA 4WGVB 3CZSA 4QPEA 5E2UH 2PO6C 1BQUA 3OAZH 3MPCA 5AW6B 2H9GB 1MXGA 4NQDE 2DTML 4NWUH 3ZIYA 4MDIA 5FO9A 4LLQA 4GRWB 1AACA 2CK2A 3CTTA 5DWUH 4BGDA 1A6AB 1NKOA 2ICES 1BXUA 2JIXA 1OD9A 3CFKA 2AEQL 4U1MB 1G7JA 4R5XA 4IKJA 3GRGA 1JGUH 5I8OH 5ID1A 3CN2A 2I24N 5CEZE 1AD0B 4NWTH 4FI8A 4TPRL 3WI9A 3X2QB 4ZW5A 5BW7A 5L2KE 3JWNG 4MAUL 4R7DA 2EDKA 1ZLSL 3UPCA 3ZL4L 3HS0B 4F15C 1IEBB 2BMKA 4LASH 1F58H 4MJIB 5I6NA 1JUFA 1KB5B 3N1FC 4MCNA 4HKZB 1UM5L 4JRXD 4LVHC 5FM8A 4D9QD 1ZPLA 3C6LB 1CFVH 5D55A 1BLNB 2P5EB 1MIML 3FN0L 4JY4B 3WEAA 4H26A 2ZUSA 3QZWA 3LMJL 1P7QA 1L0QA 5CXPA 2P9RA 3V5DA 4ZX4A 2ZZUT 4M7ZB 1J8HE 3IRCA 4L9DA 4UIKL 1SDDA 2WQUA 4M7KH 2DL2A 2GAZA 4N1EA 3TBSB 2CO6B 4KJYB 1MZYA 4JRLA 1LE5A 1AHKA 1NKRA 3EOTL 3RWDB 2GG1A 1MSPA 3HE6B 3EG9A 3SBWA 1MNUL 4DK3A 5SWSB 5JHLA 1SJEA 3N9GH 4NQSB 1XGUB 4HC1H 4J28A 3WIAA 4NZ8A 5ICZA 1FVEB 1P84K 2IOOA 4PS4L 4AH2A 1CMOA 3MREB 2BK8A 1F4YH 5JR1L 4NO3A 1LE9A 3RVWD 3M07A 1SVCP 3UIZA 2A9DA 4MJ4A 1B2WL 1OF2B 5J1AB 1AQKH 3CBJB 3SGKA 1W6WA 2E7LC 1UH3A 2EEXA 4BH8B 4G8GB 3IBOA 4GQQA 3LH9A 5ENWA 2G2PA 1ANUA 1GGCL 4GSUA 2IPUG 3MN8A 4OQTA 4RZCB 3TBWB 3G6JA 1U8LA 1OEZW 2HTLD 3K71B 4EZLA 4KXZI 1HILB 1S7RB 3CZJA 1U8KA 3LD8B 3HRPA 3PP4L 3K6SA 1S3KH 1LEKB 2WW8A 2EDXA 1I3UA 1OE2A 1IC1A 4F7PA 4P3CH 4N2CA 3FPYA 1AGDA 3LTVA 2Y3AA 3ARGD 2APVA 2K6YA 3CD4A 3F05A 4GRLC 4R3SB 5C2BH 5EUOA 1FVCB 1KBBA 4ZTPH 3TU6A 1HI6A 4MB3A 2F5AL 4PV1C 4AC2A 3EH3B 2P43B 2XPGA 3FFDA 1Z1WA 2PPEA 3O6FA 4RAHA 5L9DL 4PSRA 3TYGH 3VU1A 1TVBA 3CVHA 1S9VB 1OY3B 3D48R 1BOGA 2FCBA 1XXDC 3PWUA 1MCNA 1DR9A 3NFNA 3FRPA 4YPJA 3DIFB 1OGTA 3VG9B 4DGYL 1V7NL 3Q2CA 4RRPA 4EUPH 3O3AB 3ZTJH 2I60L 2OJZH 2PYEE 3Q9QA 4PJAF 5CWSA 5D93C 5DJ8B 3UDWA 3B2MA 3OPUA 5L7XL 1EO8H 4HQQH 1JPGB 4OTXH 1F0LA 1H3XA 2W88A 4JFHE 3T6ZA 3VFGH 3B6SA 3LIUA 1U2HA 2OR8A 4XO9A 4JJOA 3I9AA 5D1XA 1IQDA 4RISL 4KHXL 1RURL 2DM7A 2W94A 2XIIA 4HFWA 3WFEH 4DN4H 1UKSA 3LZRA 3BQVA 3TZVD 1KWGA 3P0VL 2F5BL 2F8IA 1FRGL 4UQEA 1QUPA 1T0MA 2D9QB 2HRHA 2RA1A 4GG6A 4R0LC 2VISB 5E8DH 3EFFB 1CXIA 4TS6A 2X0UA 1U30A 5F7KC 4MD5A 4RAVB 3U4EB 4E9QA 1A5FL 3QQXA 3EDKA 3U4KA 3PRZA 1S7TA 4XNQB 1Z0MA 3OHXC 4O00A 4XNXH 4WZ9A 4BD4A 3OXRB 3L9RA 3KLSA 5KSVA 4JO4H 1Q9LA 4K23L 1JTTA 4PJHF 4X7CC 3QC6X 3RFZB 2NW2A 3EH1A 1E30A 2J57A 3HN5A 3CXHK 4GXVL 1YDPB 2CKBL 5CBEA 2FLMA 1J5OH 1IL1B 1BFOB 1KFAH 4ELMF 1ZHNA 5DHYB 3WEXB 1G4RA 1GL4B 3S98A 2IQAB 2EIMB 4IRJD 5ADPH 3QJRB 4ZOAA 5FF6A 2X4QB 3DMMC 2BC4A 1IGMH 4KK6D 4KUCD 4XNMB 4OF8A 2DI8A 3ECUA 4BZ2H 3UTOA 2H1LM 2CR6A 1EFXA 4UT6H 4C54A 1PU0A 3HG4A 4POZD 5EU6D 1H15A 5B1AB 3QDMD 4Q9QL 1WT5C 3PIQA 1NGWA 4MZIA 4GUOA 1X5KA 1DYZA 3G7TA 3GJFA 1S7VA 1IU1A 3U1PA 4FKEA 5IEHA 1VESA 1PZ3A 4WI0B 1GOGA 4PW9A 4ZNEE 4Y5YB 3SJVE 3BVTA 2Z64C 2YPLD 1IC0A 2XXFA 2ZSVB 4XC3H 1VERA 3VW3H 2DWTA 1EV2E 1RMFH 2A6KA 1PZDA 1PY0A 3ECQA 1A1MA 1G84A 5CP3H 4GAYA 1VGEL 1SOSA 4P07A 2IPUK 1K9TA 3OC5A 1IAKB 2NW3A 4J12A 3BP7A 1CUOA 4JN1H 5FK9A 2DQJL 4PP2B 1YEFH 1YG9A 3MROA 2P52A 2BH0A 3O3DA 4LCWD 4ZODA 2BWIA 2EDOA 4MJ5B 1M2VB 4OVVA 1KTLA 2IDSA 2J44A 1A3RH 4WDIB 1K72A 1D9KB 1JFQL 2Y24A 3LKRA 4HBQA 4NQCE 4XX1E 3SJVB 2MIZA 1RUAL 1A7BA 2FEEI 3LNFA 4XP9H 2EYSB 1V55B 2VGLM 4J1UB 1CFQB 5GGVL 2FR4B 4P2OA 1RH8A 4HKJB 4WW2A 4XCYB 1L5GA 4JHBA 4PJAB 1BSIA 3V4VL 5DD6B 4MBOA 5FHBH 1EFQA 3POCA 4AEHL 1CR9L 5KVFH 1GSKA 3BW9A 3TIEA 4BINA 1T04B 5DO2D 1BV8A 3CFIC 3LPPA 3QDMB 3WBDA 3WDIA 4QIRA 3SYOA 4U6XA 2J73A 1L3WA 5FYJH 3STZA 3ZBMA 3IJHA 4KX8A 4NO5B 3CH8A 2R29L 5EF1A 2FNWA 4GB9A 3QXVA 3BSGA 4WTZA 2XKNA 3A67L 4FABL 3WMPA 3F2LA 5E6ID 3B7RL 3FYIB 4J3UA 4NQVB 3TT1H 5AOLA 2MHAB 1FNHA 1SN5A 1NCHA 2KQNA 3ZT5A 1LILA 2Z0UA 4EI5A 1V10A 4QT5B 2KHAA 1CQKA 3ZXAC 3F3HA 3S36L 2PXYD 2YFOA 3P3SA 5E70A 4N8UA 5AW2B 1HEJC 3AMKA 2WC7A 4WFGE 4DK5A 1W15A 3EOYG 5HGGS 1DLFL 3OAYK 4KROD 4UU9A 5DQDL 4QR7A 3UFIA 1KIPA 5JQIB 5FUOL 3VGAC 1QRNA 3RNQB 4AQAA 5BZZA 1UVQA 4TVUA 3RUGE 3HAEB 2CJSA 2EXTA 4X4XB 5IR1A 1EEQA 3CWGA 5CINL 4U7MA 5E2WL 5IWLA 2LGNA 3QA3A 3QJSB 4P23A 1NGXB 1F4XH 2ZXQA 1UWEH 3D85B 2A4EA 3VH8B 3DYOA 2AXFA 4Z7WF 3QQ9C 4GI6A 2XN0A 1R3LB 4RFEA 3DLQR 4ZXBD 1N70A 4LAQL 4QGTA 3GIVA 4ODSL 3DO4A 3RVWC 4N0FA 1P5UB 3L7FB 1FDLH 5ADOH 1QI5A 1IQWL 1M7DB 1GPOL 2BVPA 5FX3A 3OSVA 4QUOA 4LVOC 3WJMA 1FO0L 3TX4A 1IGFH 4OFPA 1WFMA 5EU4A 4X9IA 1EBAA 1FP5A 1HXYB 3IF1B 3MLYH 3US0A 3GXPA 4RBPH 1FFNB 2BW5A 4L0PB 1QO3A 4NO0B 1EEZA 4BZ1A 1FZMA 1JN6A 2CGYA 3ESUF 5E5UB 3GSNA 2IF7A 4JFEA 4OW6A 5JIDA 2DYRB 2EADA 1P5UC 2QFRA 3Q3GA 2YGPA 3KGSA 4J3OG 2WNWA 3OVUB 3JWOC 3V79C 3G5XA 1ZTXH 2CKBA 1Q0EA 1JGVH 4S1SH 1AO7E 3ECBB 4Z7VE 4ZFGL 1SOXA 3VXTB 1F11B 4OJYA 4UAHA 1ZHBB 2VITB 3C87A 2I32A 2XZZA 4GKNA 4NP9A 4RX4A 4CNIA 2WZ5A 4A7VA 5H35B 3L1OH 2X1QA 1FI8C 1YN6B 4P9ML 1GZQB 2VC2B 4TQHA 5M95B 5CJQH 3JTTA 4G6FD 2V2XB 2XN9A 2ZAHA 3KE0A 4HIJA 1R3IL 4LLWB 3ULAB 5HD8D 4K7FA 3K8MA 5D4HA 3CSBA 3C9NA 1JV5A 5FM5M 4ALAH 4Q9BA 2NY3D 1D2OA 2AJZA 2JELH 4NQDB 4FP8L 5TQ2L 3T8XB 4KXCA 4RLDA 2GK2A 4WJKB 4M03A 3VGHA 3DV4A 2R69A 3E3QC 1T2QH 2VCOA 5HYEA 3NZ8A 4DGWC 4JJHA 4C4UA 1DVXA 2DKSA 4WI8A 4Z95H 4KUZH 1FNGA 4P4KD 3VWJB 5JIQA 3CHSA 3LDBB 3PV6B 4UV4L 2F18A 3SKMB 5D93B 3BT0A 3RGVA 3VI4A 4AJYV 3GHEL 2ENJA 1BXXA 3OXSA 5KYUA 2EUXA 5FGSA 4HWZB 4AVHA 4C56B 4B9YA 1BYOA 3HG0A 1SN2A 5M7QA 2GK0B 1DO6A 1HFUA 2VB5A 4XE5B 4Y4FC 4X6DA 4S1DD 1FE8L 4ZMPA 1QUNB 3PGDB 4EI5B 2KUTA 4XCCH 3UYPA 2CRYA 4CA4A 1IM9A 1CD8A 3P4NB 4IRJC 2EVIA 4WENB 4CW1B 3RPBA 1CBJA 2YGNA 3D39B 4L4TA 4OKVA 5IVXA 4TLTA 3CFJA 4U1GB 4KKQA 3PWVB 4MAYC 4NP4L 2ZX5A 4GP8B 3EGXB 4DO6A 1BXAA 4TQEH 1AXSA 3F7KA 3D25B 1GYUA 2VUKA 1M3IA 4MS8C 4Y19B 4UB0L 4UANA 1KGJA 1YNLH 1U3HA 5J6GA 5DMIH 2DIJA 4KDTC 4NI3A 4MA8H 2FB4L 1A6VH 2F74A 3HZYB 4P2AA 5ESQB 1SLUA 2OTWB 1TVHB 1EJFA 1XH1A 2PR4H 2RFXB 5BJTB 4G8IA 5T3ZH 4PUBH 1UD3A 2BFGA 4WWID 5HDQH 3TTYA 4FZEL 1XR8B 3WY4A 1RK7A 3GSNB 1TCRA 4MLIA 2WB1A 1BX2B 1MFBL 2OQJB 4K73A 2ROYA 1MRFH 3FH5A 1E6OH 1U8OA 1GSMA 5JNYB 5INCA 2A74C 4JFED 4N0UA 3IDXL 5C0GA 4E9RA 4YDKH 2CDEA 3ULUD 3DV4B 1CLZL 3ZZSA 4ZFZB 4AJ0A 1IQDB 1X5HA 3UTZB 4OLUH 1ACYL 1UZ8A 3BAEL 2EDDA 3HUJF 4IRSD 4KU1A 5GRUL 3ABKB 2YD6A 1G0XA 1TYJA 1HC1A 2ITDB 4KDTA 2VR3A 2OSLB 4U2YA 4MQXC 3R1GL 2CE6A 4D3CH 1SDAB 3KYKL 1LO2H 2F58L 3O0RL 5FHAL 2ICWJ 3T2QA 3GKWL 1QA9A 1PD6A 1I1YB 4JM2D 1YEGH 3CE1A 2ZOKB 4JG9A 3P73B 5AYUL 2XN2A 4HJJH 4KI5C 4V2BA 1GZHC 4P23D 3N0AA 3Q6GL 4IHBA 1R5IB 3B3IA 3LB6D 3RNKB 3FRUB 2V5YA 2ZF9A 5I75B 2ZWLT 4K07A 4U4BA