4X5XB

Hla-dr1 mutant bn82a with covalently linked clip106-120(m107w)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
198
Chain Sequence
MKWRMATPLLMQALPMGGGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHAYGVGESFTVQRRVEPKVTVYPSNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title MHC class II complexes sample intermediate states along the peptide exchange pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 198
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x5xB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4x5xB01
2OI9C 3N50A 3LHPH 4OJFL 2ZKHH 4KUZL 4WWKC 3U83A 3QDJB 3DSFH 2P8LA 4ZSOE 2DQGL 1FLTX 4MWFA 5FF6B 5C7XL 5GS0L 1R5WA 4HS8L 3DRTA 2HT4D 2F8OA 2MKLC 4NO0A 4PGBB 1FNEA 3NPSC 4Y7MA 4WY7H 3VFOB 1MHPL 3CDGA 4MB3A 1A14L 4RFOH 4FTVE 5FDYA 5I66A 1CFNB 1YN6B 2NY3B 3HI5L 1JPGB 1X5AA 3BKCL 2IBZX 4BQ9A 3MJ9H 5T3XH 4H1LG 2IH1B 5HGBA 4NPYB 1YZZA 3CPLB 4X6CF 2IG2H 5F6HJ 5IR1A 5FDWA 3MLYL 5IM7B 1NFDE 5TDOA 5FYJH 2DRUA 4KQ4H 3CUPB 4NQCB 4HMDA 4YR6A 4MAUH 4Y4KD 4U1JA 2CK2A 1MWAA 1HSAA 3W9EA 5HHNA 1UZ8B 2W9DH 5B39G 4JKLA 1CCZA 5ESVA 3SN6N 4YFEA 1P4LB 3GM0A 5CKGA 5D72H 3MRJB 4RMTA 3SEPA 2Y36L 4N90E 3UTPE 1DQJB 1I3GL 2MWCA 4BA8A 1KB9J 2NPLX 1PQZA 5CKAA 3K3QA 1KENH 1JGLH 3RVTC 5T3XD 5GGQL 2I27N 4GXVL 5BS0A 4DOHB 2I9LB 5LAXA 2R4RL 4XC1L 1K8DB 4MX7A 4P46C 2ORBL 2DQUH 1MVUB 4GKNA 3SGJC 2FJHB 4FQXC 1R5VA 5ALCH 4OZHE 3VJ6A 4H0HB 4XCYB 5I16B 4FQLL 4QHKI 1KIQB 1S9WB 3ROOB 2EYRA 1NBZB 4KROC 4LHQB 1NMAL 4D0BB 5H8DA 1N59A 4PIRF 4K3GA 4PV8B 1CDJA 1K6QL 4MNHA 4KZDH 4LEXH 4OLXH 5I74B 1NMCC 4NCC1 3IGAB 1JHLL 4LGRB 3RWHB 5E7BA 3VFRA 5CLWA 5E6IA 4BM7A 3NTCL 1MNUL 2PXYB 4YFLF 2BHYA 5TF0A 3FTGA 2MSPA 4WI9A 3RAJL 1F4YH 3W39B 1OAZH 4CN1A 4FXKA 2AXHA 3HNSH 4KC3B 2JB5L 5DD1H 3CCHA 2IMMA 3Q3GA 4O9HH 1J1OH 4OGAC 3OXRA 2N1KA 4QHNB 4EQ2A 1AXSB 1KTKE 5E8NB 3QQ3A 3ZSTA 1IAKA 1EEZB 4Y8DC 1N0LA 4H0GA 2NXYC 4OZFG 1P9MC 2R23B 1MCLA 3MRGB 3ARXA 1ERNA 2DJUA 2XIDA 5TJWK 5ID1A 4WCYL 3DGGB 4NQXA 1BJ8A 1QEWA 3HZMA 3UXFA 5EFIB 3QULA 5I30L 5CBAA 4JFOA 5J9PB 1I8LC 4KKCC 4F7CA 4YFLI 4IIQC 5JR1H 1U58B 4HPYH 1XCTB 5EC1B 4RWHA 3ARBB 1YNKH 4PJAB 2K7QA 4NQEA 2OX5A 4NM8H 3V8CA 4PJHE 3MFFB 1YC8A 4UIMB 4JPWH 2GTWB 3HUJF 1KV3A 5K9QI 3UMTA 1T20A 1UVQB 3MRFA 4ODVL 3DVFA 3NCJH 1BIIB 2BX5A 4N0CC 4JGMA 3RA7H 3ROLA 25C8L 2KZWA 5CGMA 4TQEH 2BSTA 5T33H 5DK3A 4MXWH 2YN5A 1D9KA 3HE7B 2F19H 3TA3B 2QHRH 4RGNB 4HFWA 2HN7A 1SJHB 1OP5K 4MDJA 3ZDZF 2HLAA 2LV4A 3GIZL 1H3PL 5CP7B 3FCTA 4NKOA 5C0BE 5I1EL 3FFCE 1IL1B 3C8KB 3GSXA 4F57L 1ZT7B 2X1OA 2Q8AL 1UWEH 1VFMA 1T5WB 1AE6H 4JM2A 5DHYA 3WIHH 2X7LA 3H9SA 4JKPH 4JFFA 1NCDH 2HJLB 3HMWL 4OQTH 1T04B 1H9VA 1FVCB 4X4YA 1J8HE 1TCRB 1KN4L 1LVEA 1NDMA 2QSQA 3GBNL 4KGLA 4BFEA 1FL3A 2CDGA 4NQSA 2EXWD 5ESAA 3SPVA 4JRXD 1I3UA 3CFKA 3VH8B 2HKFL 3RNKB 1QQDB 2R0ZH 4C57C 4OQ1A 4U6XA 1G9MH 3QEQD 2J88L 5FGBA 1KJMA 4PS4L 2EH7L 2BMKA 5SWZA 5EUOB 4UT6L 4HGMA 4N5EC 3X3FL 3L95B 3N0PB 1KT2A 3KPTA 2VITB 4HHAB 3TYFA 4DGVH 1OTTC 4O2CB 5LG1A 3K1DA 2DM2A 5FOBA 1H8NA 5F9JB 4N0UE 2DL9A 1ZA6A 5L9DH 1V5JA 1P84K 4P23D 3RBSA 2E7MA 5CIPB 3P4OB 1RUAH 5JOEA 1EO5A 1OLZA 1RUKL 4H1LH 1PLGL 4ACPA 3RU8L 3ZHDA 4KPHL 2CMRH 4RMQA 2VXVH 3O6FA 3V0VB 4ZPTB 1D6EA 3T0EA 4GAGL 2BC4A 4MMXC 5E6IC 5DRZA 5DVNA 4LK4A 4Y1AB 4Z7OE 4WNQB 1NBVL 4XCEA 1AGEA 1NSNH 1R3JA 2GT9A 5CEZL 3JV6B 3DIFA 4CNIA 4Q9BA 2D4DA 4JFXB 1QRND 5J1AA 1EZVY 4PGCA 5DJDB 2UZXB 2J4WL 2BSED 3P4MA 1DBBH 3F8UB 3VG0H 5HI4D 4DVBA 3ULVE 1Q9LA 3HLAA 5EU5B 1P7HL 5HI5D 1M4KA 3MRRB 1YJDC 2ZPKL 4X8JA 1JZ2A 1J88A 1CG9B 1YQVL 3I3BA 1AXTL 1IEHA 4XPGH 5DGRA 1G7LA 4L5FL 3KWWA 4M9PA 3C2AL 1N4XL 4OGYH 2ZCKH 4HEME 5TE6L 3BUYB 5I1GH 2UY6A 5IEKB 3VWJA 3MUY1 4PJXA 5FO7B 3RHWF 2R69L 4JFEB 2V5MA 2IAMD 3O2DA 1CICA 3GUTA 3HA0A 5CSZA 4UQ3B 1JE6A 4D9RE 4BH8A 2XZCH 4U05A 3SJVB 2RIKA 3SE8H 2ADIA 2DL2A 4NZRH 4KJWC 1WZ1H 2BY1A 4F2MA 1S78C 4U0RC 1NL0L 3IDGA 2CLRA 4HGWB 2YS4A 5F88B 1CZ8H 4Z7WA 5L88L 1JZ4A 5KSAD 5I71C 3PDOB 4S1QH 3DXAD 5D71L 3QFJD 4GKOA 4KK8C 4O5LH 1D9KC 1VEOA 2LU7A 4WJ5B 2BVPA 3QIWB 2PR4L 1WEJH 3FQUB 1LE5B 5EORH 4JGUA 3K2UL 1MI5A 4QTHA 4PJDF 4WFGD 1FL5B 1JHKL 3RWEB 1IRAY 1HI6A 1VPOL 3GJFK 4OZFH 3B2UC 4FQCH 5HYSB 5L0QB 1INDH 4TOYL 4YZFE 5E24E 1QSFE 4JM2C 4KVNL 4M7LH 2WWKT 5F96L 3BN9C 4EI6B 4MJIE 4OLYH 1PFCA 1I9IL 2Y1VA 4G7VL 4OUUA 3BSZL 5DS8A 3PGFH 3BT2L 5CP3A 2X42A 4PRNA 1IGJA 4ZUUA 1KXQE 2MHAA 2OYPA 2FHFA 5E1AB 3X13B 5DD3L 5FGBC 2QKIB 2IPKB 3S36L 1G6RL 3LEVH 5IBLD 2BDNL 1A1MA 1HYSC 5HHQB 5KOVC 1T21B 1RZKC 3NPZB 1OCWH 4HG4K 4R2GD 1IEAA 2DTSA 4G43B 4OCWL 1UEMA 2Q86B 1KF9B 1V8HA 4Y16A 4U6YA 1QFWL 3QXAB 2ATKA 1DBJH 2BVQB 1JTOA 3BPLB 2C3GA 1VERA 3T0DA 1W0YT 1U36A 1H15A 1LGVA 4HS3B 2AJXH 3BP6B 5KZCB 4O58H 3B5HA 4P49A 4HQQH 3O6FC 3BWAA 3T0EC 4V2CB 2VLJD 1AGDB 1K4DB 3BYTA 3E6HA 4ZNEA 5C0GA 2EDEA 2Q7NA 1INEL 3HPJB 2SEBA 4M93C 2HP4A 4X4XB 4MNQB 1P7KA 5T3ZD 5SX5K 1YNTB 4JJ5A 4P5TA 4LCIL 1FFOA 3VFVB 3ZKNC 5FV1L 4F58L 4HK0A 2AAVA 1ADQA 2JE8A 3MOQA 5FKAA 4XNZB 3VW3H 5E99L 1TJHH 3MGAA 1FJ1B 2A6JB 2H1PL 3V7AG 2MOVA 5C2BH 3KPQA 3B6SB 4PUBL 4UILH 2X4SB 1CU4H 1I7ZB 4GG8B 4I8DA 1BOGB 4HZAA 4Y2DD 2HTKC 3C5SA 4QLRA 3UTSE 1NGXB 5GSVA 4I0PB 3QUZB 3CFCH 5SWZE 5IV2A 2VO5A 2ZG3A 3P0VL 1GZPA 2Z91A 3UTQB 5JQHC 3JTSA 3VWJC 1KCVL 1A0QL 1LEGA 3FQTA 1FRGH 3BIAX 5LCVH 1UYWH 3BEVA 2LQRA 1KJ2B 1CICC 1JPFB 4XCNA 1QR1A 1FAKT 2JB6A 2H3NB 1ACYH 4GRMB 3MV7B 3TO4A 4XZUB 4J12A 2FIKA 2EDWA 1NCWL 2QLVB 2QADD 4F7TB 4JE4B 2COQA 1EFXD 1A4JB 3BH9A 3TH2T 5LXGH 3Q5TA 3FRPG 2R1YB 1YY8B 5F7DA 3QHZL 3T0EE 3VCLA 1J87A 2ITDA 5F6IC 1P4IL 1F6AA 1UACH 5EZLA 3WIFB 1MFNA 5I2IB 5GGTH 1PAMA 1DSFL 2J6EH 4NQDB 3MZTA 2ICES 1VFBA 1WT5A 1TQCC 4LFHG 1KCRL 1JPTL 3KPRB 2V2WB 2ED9A 2ESVD 4A2MA 1RK1B 4FFVC 5AUMB 5C07D 2P44B 1OTUC 1SJEA 1UA6H 5F7UA 3O3DB 3VRIA 1U8PA 4P2OB 1U91B 3S4SG 2H9GA 3ZYOA 4FQPA 1KEMH 4JFPA 5ICYA 2IAND 3WNKA 5IBUB 4L1HA 5HDLA 2E6QA 5MEOB 4KTEH 5AD0B 4PRHA 4U7KA 2CIKA 4YHML 2AXFB 3C6SA 1RZJH 4U1GC 1KPRA 4HLZG 4PJEF 3MMEA 3NZHH 1HINL 1I9JH 3QIUD 3LKQB 3OJMB 4F7EA 4JZJA 4TNVF 5ITFA 3RPIA 2A6IB 2YC1A 4GLRI 4HGKC 4YLQT 3FKUS 3P9MB 1RURH 5E0QA 3ULUC 3H2WA 4PJ5B 2D7MA 4GSDL 4OV6F 2GSIA 5E2WL 1QFUH 1MCPH 5J4MA 2VC2H 3ZZ1A 3ARGA 4Y16C 3WHXB 4FS0A 5IQ9A 1TFHA 3UYRL 2DQHH 2H2PC 4GRWE 4E41D 1MRFL 3C87A 1QSEB 2M2DA 4JFDA 2O5YH 4M43L 3GRWL 3U0PB 3IDJB 3NN8B 3EGSA 2V5TA 2AK4E 4G8IB 1WAAF 4I0KA 5I8EB 4Q74A 4ODHL 4W4OA 1IM3B 3G6JA 1D5XB 4L3CA 4PTUA 5DC9B 1U95B 4OZGB 3UTTA 1N0XH 1U42A 2AK1L 5DZNA 1ZA3B 4ZUVB 3HFMH 4B41A 5GZOD 3QUYD 3GNMH 3L6FA 4G6AC 4P2CG 3M8OL 3RVXC 1F11B 5CWSB 1MAJA 1E4JA 1PEZA 1Z9LA 1IGFH 1WCBA 3V0WH 4ELMF 3R8QA 1I8MB 3DURB 3HZYB 4CAGA 4UI2A 2AJSL 3LZFH 3VGEA 5D7JB 3N1FC 3IKCB 3HB3D 4ZDHB 3KPMB 3ABZA 3I6GA 3L1OH 1CFQB 5KJRH 4PR5B 4PJBB 1N26A 3DOSA 4F7PB 2GKIA 1WBYB 3SDDD 1KXTB 4U6TA 1XZ0B 4S1RL 2BVOB 5EA0H 4KQ3L 4JO3H 2Z0BA 2P5WB 4V1DB 3T8XA 3ULUE 3P4NB 3QHFH 4HXAH 5IB5B 5TDPB 3OHXB 2A73B 3BD3A 1C5DA 3LIZL 1IC1A 4YBLB 5FCUH 1AO7D 1JWUB 4YC2B 3QDGD 2MKWA 1D6VL 2EC8A 4JB9H 2HA1A 3WD5L 4M00A 5C0FA 1S3KH 1X4ZA 1BD2D 3TO4C 5DJYB 3P0YL 5DEFA 4TUKH 1ZT4A 4OGZA 4KJYB 2XA8H 1NGPH 5ETUB 4NHCL 1G84A 3B3IB 3O11A 1WITA 4OCSL 3DV6B 1RZIA 3OKNB 4ZNEE 4ALAH 3FL7A 5JO5B 4QGYA 2DM3A 5SWQB 5BO1L 3H42H 5JLZB 3O4OC 3RWJA 2BOBA 3VXMD 7FABL 1EEYA 1WT5C 4Y88A 3IRPX 3SKJL 4ONHA 3NFNB 4LSVL 4YPJA 1T0MA 3D3VE 4TTDD 5EH1A 4DW2H 2YR3A 2ICWA 5F7EL 5DFTA 1HH9A 1DUZB 2VB5A 5IW1A 1A6UL 1K5NB 2VZSA 35C8L 4XX1G 1URLA 1I1AB 2V5SA 1JMZA 1FVEB 3DX7A 4I48B 4YHOL 4H20H 2A2QT 5DVLA 1YMHA 3V52H 1NCCL 2VQ1A 1D5BB 1MIML 4FXGB 4UT7L 3ZKSD 3EOBB 5E95B 5FO9A 1E4XL 5F3BA 1NJ9A 1XF5A 2AEIT 3WEXB 5ALBH 3H9HA 2JJSA 5FYKU 3ZDYE 2EXYC 7CGTA 1FQ9C 1OY3B 2P5ED 3CLEL 4NC1E 1LO0L 1BQLH 2G60L 1MF2H 4J4PA 2X1XR 1QBLH 2JELL 4M9OA 2VAAA 1NAMA 3QQ9C 4DZBB 3RWFB 4G6ML 1FYTA 2LVCA 5GGSY 3ARDA 1I3VA 3D69B 1FIGL 3SHSA 3DMMD 4LCWE 3ARGC 1PZ5A 2X4OA 4HUNB 3D5OF 3KJ4C 5IFHL 3UDWA 4IMLB 3M1BA 4LLVA 3C60A 1HXMA 1EHLL 4NT6B 1FBIH 2R0LL 2OK0L 3WS6A 4NBYB 3MLUH 4EBQL 1R24A 3SCMA 3UP1A 4LOUD 4OT1H 1QLFB 2YOCA 4U33A 4W4OC 2BNRA 1W0VA 3IFOA 2FBJL 3IAQA 3DUHA 5FA3A 3MROA 4JN1L 4XMPL 2UVFA 1WZKA 1A6VL 3V7MA 4WW2A 12E8H 2NY6D 1BFTA 3OKKA 5GGRY 3QDMD 1CDGA 3MLZL 5CUSH 2F74A 4ZUSA 4FP8H 4PY7B 4P2RD 4OBSA 5AEAA 4PRHE 3LCYA 4LHUG 5KSBB 3N1GC 5K93A 3MRQB 4HUUB 4HZLA 3DX6A 4HLZH 4AEHL 5HGHB 4N0RA 2ZCHH 1GGBH 4IRJD 5E6ZA 1ZSDA 4MS8C 3KPNB 4RQQB 1RPQA 1D7FA 2A6DB 4JZOA 4EUPG 2PNDA 1K3IA 5DZOA 1EK3A 3THML 2CJUL 2AI0L 5C0CB 1P2CB 4JZNA 5ERWB 3CZFA 4JCMA 3VI4E 3TBVA 2XKNA 3MJ7B 1QHPA 3P3YA 1J1PL 3F7PC 4LFHD 4PJ7A 2A9MH 2YRZA 1IAOA 4R7DB 4TULH 2IH3B 4YIQB 4BFBD 5J6GB 1HHGA 1JNNL 4FNLH 2BY0A 4ZFOB 5T3ZL 1L9NA 3QNZB 3MSPA 5C0RL 1FNFA 3MLXL 4MA1C 4PJGB 5E94A 2B0SH 4HCRA 3MV9B 4G8GD 4LLYA 5AZ2L 4H88L 1T89A 3W9DA 1S7VA 1U9KA 2VJXA 4HIHA 3QA3B 2XN9D 5JTWA 1YYLL 1YMMA 3MLWL 4QRRD 3PG2A 4WGVB 3TN0B 5GS0C 3W11C 1ITCA 3ZSSA 2WAHA 2DJSA 4HULB 1S7UB 1NLBH 2XTJC 4NO5B 4LPUA 2VRAA 3LQZA 1NGZA 2DIJA 4FQIL 3Q6GL 3DECA 5J12C 2ZWLT 4PJCA 4ISVB 1ZE3C 1DL7H 4IS6A 2AXGA 2ILLA 4ODWA 1HH6A 3BPOC 3BP4B 3BAEH 3O3EA 4G5ZL 1I4FA 2GITA 1P1ZA 5DJ6A 3DYOA 4LU5H 5E8EA 1RHFA 3VA2C 5I6XB 4WUUB 2GJ6D 3HZVA 3V6OA 5D1XC 1HHKA 3F62A 3D39B 2OJZL 2GCYA 4QRQB 1EA9C 2EE3A 3QI9A 1WZMA 2HT2D 3CLFL 3KVQA 4RWYH 4H0IA 3WUWA 1FZJB 2P7TA 5I17B 2VLME 2F5AL 2JJSC 1N3NB 5C09A 4L3EA 3MA9H 1FFPB 1LD9B 4HH8A 1TDQA 5FUZH 5FYLD 4XVUD 1CD0A 3P77B 3IAPA 3U0TA 2GY5A 5ISZE 3MBEA 4KJPC 4AG4L 4J4PC 3UJJH 4ERSL 1S7RB 2D03L 1LO4L 1ORSB 1YYML 1R3LA 4CKVX 2DAVA 2IALB 3WFDL 5FF6A 5JW3L 4WDIA 3K4ZA 3ARDC 2CKBH 3FQRA 1WZLA 3ORJA 4WFFD 4U49A 1G9NC 4P2QA 1NCBH 4KKLC 4LKCB 2G9HB 1BLNA 2HJFB 2OXHA 3QEGL 3UDWC 4ZXBA 1T1YB 2HFFA 4DVRL 3V6FB 1RU9L 3C60C 4TNWF 2VN4A 1LP9E 2Q8BH 3U2SB 3C6LB 3G9AB 4H25B 1YN6A 2DM4A 4OFDA 4X6CB 1JPGA 3GSNB 3LQAL 3NFSL 4IDJL 3WS6C 2XTJE 5DD0L 2R8SL 4YDVB 4Z0XB 1GVIA 3SCMC 3QH3B 3IF1A 5CZKA 4KZEL 2Y06L 4L9LC 4QRPD 4KJQC 1OL0A 1MY5A 2J5LB 2PCPA 3L9RB 4LF3B 4G6KL 5IM7A 1Z5LB 3OKLB 4J7RA 4AIZA 1FN4A 3NA9L 4NQCA 3GJEB 4QHUB 4WW2C 3O2VH 4ZQKB 5JHDA 3LS4L 4JREC 3PP4L 2XQBL 1F3JB 3U6RB 3UBXB 1MRDL 3KPLB 1DQLL 1UB6B 1A9BB 3D2UB 4X4ME 1QLRA 3SBWA 3V4VL 1KTRL 1CLCA 2DWDB 2NY0D 4PJIF 3MRJA 4KV5F 3QYCA 4GW1B 3W0WD 1IILE 4I1NB 1RZFH 1DQJA 5MENB 2YPLD 2CK0L 2C3XA 1RK0A 2VLRD 3G9VA 5DWUL 3VD7A 4LCCA 1RUPL 1LILA 2X4TA 4TVPH 1I3RB 5JPMB 2DYPA 3T4AB 4LIQL 4OV5A 5T5FH 2I9LA 4MB4A 1FYTE 1HZHH 1RFDH 4X7DC 3BO8B 5F7FA 1K8DA 3R06A 1MVUA 1NFKA 4HXBH 4UV4H 4CVZA 3P11L 4NWTH 2UZIL 3S36X 5I16A 3EYSH 5I1IL 2RBLA 1DQMH 4Z76A 4L4TA 1CT8B 1T89C 1UCBL 1MUJB 5KVFH 4J1UB 1BZ9B 1GOFA 4ZMAT 3BDXA 3IGAA 5LJYH 4O4YH 1CGSH 4ZTPH 1KEGH 5CILH 3ARPA 1UC6A 1NPUA 3H9ZA 5DQJB 2EZ0C 5FYKD 1EEUA 4OKVA 2E7HA 4F8TA 4YEFA 4U1LB 4PRDB 1AGFA 4LKXB 3BEWB 1WF5A 1FORL 3EO9L 3MO1B 3SDYH 5KS9E 2PETA 2BNQA 3LD8C 5MI0C 4ETYA 3F7QA 4I3SL 1AR1D 1JMXA 1D5IL 1K8IA 1CS6A 5E7FA 1WBZA 2R23A 3MRGA 1YEGH 1YDPB 3VGAC 4EUPH 3QWRD 1CTOA 5E4EC 1QACA 1GHFH 4ZYKB 4D2NA 3QI9C 2VZ1A 3IDNA 1AH1A 3WNLA 1Q1JL 2J8OA 5J9PA 1YEHH 1ZVSB 5LQBH 1T83A 5HHOD 1U58A 4OM1H 2QJDA 4KY1L 1XCTA 5JW4R 5IJVB 2FGWH 4YHIB 3TLRA 1GC1H 2WLYA 4PJAA 4M6NL 4OSUH 4XMLH 3UYPA 5L2JB 2FSEB 3X17A 3MBEC 2CPCA 3MR9B 3GMPB 4PJ9D 2GI7A 2I60H 2I07A 3HUJB 5IHUL 3MA7B 4EVNA 1IE5A 2BVUA 3WMSA 1CLZH 4LVNC 1MCJA 3RKPA 4G3YL 2NY5L 3AROA 2CO7B 1FNHA 4G6JH 4UIMA 4NN6B 2GTWA 5DMGC 4MVBC 5BRZE 1UVQA 1G6RA 2XWTA 4KVCH 2NY3C 3PGDB 1A7QH 3C5ZA 1TVDA 1H5BB 2XXMB 32C2B 3STZB 1CF8H 1KYOJ 3AS3A 3CFEA 3HE7A 1A5FH 2FX7L 4N8VB 2CO6B 1I7TA 4D0CA 4HC1L 1IGMH 4UBDD 1SJHA 4K3EL 1KPVB 2AKRB 3QO0A 4HSQA 2GAZA 4Q6YA 1HWHB 4RFEA 3WXVH 2VYRE 2FIRT 5MHSD 3SDAD 1IL1A 1LDPL 1FO0B 4P0DA 4Z7VF 5CINL 5E1HB 1T5WA 1TJIH 1MFAL 1WJ3A 4B50A 1RJZA 2H45A 5HI3C 4KI5D 5EOQL 4X98B 3SBWC 5C0DA 4P4RA 2V17L 5DQDL 3AU1B 1FVCA 1KIRA 3TT1H 1U3JA 4WVRA 1TCRA 2H26B 3GI8L 2VXSL 3QRFM 2EO9A 5C0AE 2E8ZA 1FVDB 2IFFL 3RNKA 1QQDA 4LCCC 3O41A 3SO3C 2DTML 3LEXB 3BE1H 2Y7QA 1KFAL 3QDJE 1KJVB 2VLKB 3QJHA 4BK5A 1QA9B 5DTFA 2EIZB 3L95A 5DMYA 2VITA 5I75B 1JFQL 3MLVH 1SHMA 1A2YA 2EEAA 2PO6D 2XWJB 2VDKL 5D7LD 1JZ5A 3REVB 5CIPA 3P4OA 1R3IH 4LARH 4G80B 5DHXB 3FT4A 2YN3A 1M7IB 5I74C 4M48H 3UAJD 1F3DH 3CFIC 1ZLVH 1I8KA 3U1SH 4WEBH 5EOTA 4AQ1B 5FKPA 5FUCE 5AAMA 4YXLH 3OAZH 1DQQA 2PXYC 3VD4A 3SKOB 5ID0A 2HFEB 4NQCE 1X5HA 3WN5B 3JV6A 3QDHA 3NZ8A 1B2WL 4JFXA 3QZWG 3SOBH 3U9UB 1X5ZA 1HCVA 1QO3A 5DJDA 1J0HA 4X0KB 3RGVB 3DBXB 2VMFA 5EU5A 5CEZE 4NZJA 1IC7L 3FO9B 3MRRA 4CMMA 4GMTH 4P2YA 4ZFFB 4K71B 5EC2A 1UXWA 5EU6B 4C4KT 4MA8L 1RZGA 3GSWB 3INUL 5GZND 3RZCD 2LE9A 4XNYL 1Q9OA 4JRYB 1T83C 4XNQA 4Z8FL 2DMKA 4YHKL 3DVIA 5IG7A 4DOHE 2RCSH 1FH5H 5DJCA 4K94H 1XIWD 3BUYA 3OB0K 5CZXD 1OPGL 4FMFA 2OZ4L 3V95A 3TZVB 1OGAB 3VFNA 3MREB 1IM9B 5EU7C 1G0XA 4RGOH 5HDBF 3CXDH 1B6DA 1RJLB 1EGJH 2P49B 1IZJA 4YK4B 3SJVA 3JWOH 4LMQE 1IGIL 4UUJA 3LN4B 4DQOH 5I19H 3IXTA 4JHWL 3R4DA 4LGPB 1FC2D 2EKSB 4F15C 5F88A 1H3UA 4PJDB 3C5ZC 5HHMD 3QIBD 4DKEH 4UINL 5E8PB 1EJOL 2YD3A 4LLDA 4CDGC 5TE4H 3P73B 1NEZB 2PYEB 3HE7C 2HWZH 1A7OH 1HHHA 1IGYA 4WJ5A 2QSCH 1FGNL 2K1MA 1LE5A 3TA3C 1F90L 2GEEA 4RGNC 1IC5H 5D2NB 3RWEA 4AL8H 2GIYA 4XPTL 2CR6A 5FYLL 5HYFA 3IRZA 3GRWA 4E5XA 3EO0B 5A3ID 1YEDA 2FO1A 1YN7B 1BQHA 5TF1H 1CL7H 4P9HL 5GJSL 2HAZA 1M6OB 3UZQA 3KYMB 1O7VA 1JZ7A 5HYJB 1SY6H 3QEQA 4K3JL 1T1WB 2F8XC 2DQIL 4X7SH 4HBCH 3KLHD 5D1ZD 1AQKH 4PJAE 5E1AA 1UKSA 5DT1L 2YK1L 2IADB 5EU3B 3CX2A 4C83B 2D7TH 4NJ9L 5E9DD 4QNPE 1L7TL 3E2HC 4FXLA 5HY9A 1LEIA 1N2RB 1Y18B 4P23A 1A6TB 5ENWB 5EU7E 2VZOA 5HHQA 1T21A 4DTGL 4ZTOH 4HKXB 1E28A 1FYHB 5CBEB 3MRMB 1U8JA 3QNXA 2PW1A 1AQDB 5E5MB 2DQDH 3PABB 1MH5B 4C55A 3TJEL 2Z92A 4QHMB 4ONFL 3EYFA 5IQ7L 4CVXB 1JYXA 2DS4A 2VSDA 5AYUL 1OHQA 4HS3A 4FTVD 5DHVA 2YXMA 1FG2B 1V7NL 2LFGA 3BP6A 3HRZA 5DDHB 5JHLL 4G8FA 4FQHA 3OKEA 3WDHA 4LP4A 1AD0B 4P57A 1KGCD 1VADB 4RGNE 1EJ6A 2NY2D 1VDGA 1Q72L 3PV6B 5CJOL 4EI5B 3L3HB 2AJYL 3VXSB 4R97B 4AEFA 3ULSB 1HKLH 2IPUG 4PJ8B 1HDMA 1TTGA 1KJ3H 3OV6A 3ZE0E 2VAJA 2A6JA 5EN2B 4NBXB 2NY4D 1QTYT 3HG1B 4JVWA 3LKNB 4PRAB 2EIEA 1LO5A 3G6DL 3UPRB 1KIPA 1BOGA 2MFNA 5C0ND 2W60A 2J8HA 3UTPD 4N90D 3VRJA 5IHZB 3WFEH 3DWTA 4QHLB 4PLOB 5L2KB 1NGXA 4NUJB 2OLDA 4N8CH 2B4CL 5SWSB 3FOLB 5EUOE 5I8CB 3L5XH 2FLRT 1UJ3B 4WWKD 2ADJB 5F89B 4LSSH 4I3RL 5BMFL 5CD3A 3TPKA 5FYKL 5C0IA 2VKWA 3F7RA 3U30B 2ADGB 1JPFA 3QBTB 3FHAA 4NQVB 4UV7H 1NCTA 1WFNA 4PJFF 2NLJB 5KSAA 3C08H 1MCDA 4MD5B 3MV7A 2P45B 3SGEH 1X5YA 3DXAA 3QFJA 4K8RL 2YPVL 4XZUA 5INCB 3O3BB 4MYWB 3L5HA 1BJ1H 1U8LB 2VSCA 1N8ZA 4KRLB 2MCG1 3MRHB 1H3WM 3BX7C 5CSGA 4XPHH 4L8CB 4U2YA 1YEFH 1QYGL 3EJZC 4KTYA 1YY8A 4X9HA 1SEBA 1IFHH 1FZKB 4MMZC 4Y1AE 5TDNB 5E56A 4K3DL 2P8MB 3JSSA 3QIWC 1GZQA 2VXUH 2CUHA 4QKXB 1KB5H 4GMSL 1VA9A 4XB8A 3F12A 1OF2B 1F3DJ 4XCFL 5D5MA 1C08B 3KPRA 1ZTXL 2V2WA 3P9WB 3VXPB 2AEQH 1RK1A 2OQJB 4DGYL 1XCQB 2FATH 1O0VA 4ZS7L 3G08B 2AJZB 4P2OA 3MXWL 1JHTA 3U36A 5FM5M 4QRTB 5AD0A 3KAAA 4AIXA 2AXFA 2FJFB 3V6ZA 1RVFH 2VDRL 4Z0BL 2NYYD 2P24A 2R29L 1A1OB 2BXYA 3RVTD 1MHHA 5EIIA 4Q9QL 5DEGB 2GJZB 3M17B 5KVDL 1DZBA 4OFKA 2VZVA 5KW9L 1JL8A 4HT1H 3AS0A 4JFEE 4P46D 3W81A 1QFPA 1ZLUK 2VLLB 3BXNA 4M8QB 4PJ5A 1HIML 2V2TA 4I77L 5FHBH 2PTTB 1E6JH 5ILTL 4JANB 1GIGH 2ZNWA 3SJVE 1KXVC 3FT3B 4KROD 1OAXL 1CR9L 4H1LB 1E6OL 3MLRH 4JCLA 3B9AA 1D5MB 5GRVL 3ZDXF 1UM4H 1DDHB 3QQNA 1INQA 1MJUH 4J6RH 4HJJH 3MRPA 5IUSA 4ZPVB 3IDIB 4YDKH 4NRXA 2YZ8A 2FWOA 4LSUH 3T4YB 1UGNA 2UYLB 1IM3A 3MCLL 3PQYB 1D5XA 2NXZD 1WGOA 4ESKA 4K7PL 5KBNC 4DK6A 3GMRB 5HI4C 4ELMB 3S34H 4KDWA 4N5UA 3MNZA 5A2KH 4LDEB 2BY3A 3SY0B 5C0EB 1I1FA 3SKMB 4TSBL 5LWYH 4OGAD 3TV3H 3JWNC 1F11A 5C0BD 3FFCD 3RWCB 1TETL 2AJVH 3KNBA 2NXYD 5I8OH 4XNZC 3DX8B 2Y5TB 4X6EB 4LRNL 4Y2DA 1CLYH 2FDBP 2EYSB 4MXVF 4MA7H 1VB9A 1CFQA 3QXWA 1MCWM 2W65A 1WBYA 4QF1B 1HHIB 4UU9B 3FN9A 1XZ0A 5DSCA 2BVOA 4AY0A 4PRPB 1J8HD 4NHUB 2F53B 4HAFA 4Z7QF 2ZZUT 1ZANL 1JYNA 2YSSB 1W2KT 3G5ZB 3VD9A 4X6DA 1G7HB 3QUZC 5H37G 2VDML 3OHXA 3FN0L 1MWAH 4U6HA 4JY5H 5EO0A 4XPFL 3AMKA 1A8JH 3UROR 4XP4L 1P69B 3BZFA 2GJJA 2ZUQB 4YHNB 3WXWL 4NO0D 1OSZA 2VE6B 2F15A 4JM4L 3RVWC 5KSAC 5F9WB 3IT8D 1XGTA 2QHLA 5DUPL 3PWVA 5DJYA 2VDNH 3RUGF 4OAWB 3MRKA 4LPWA 4N0CD 1JWMA 5HVHB 5ETUA 1QLEL 2ZJSH 4JY4A 5I0DA 3GSUA 3B3IA 1FL6A 3ETBF 4IRSB 1W8OA 3PWNA 2ESVA 5I9QB 3JV4B 5GJTL 1VFOA 3U4AA 5C07A 4NKMB 3PP3K 3P9LA 5CEYB 4MNQE 1VENA 5AAWA 4N1HB 4OZFB 4NJAL 1LO3H 3IU4H 3I02B 3J8F7 5F9OH 5I1HL 1YPZF 4JVUA 5HHXL 2GSGB 1DUZA 4NNXA 3ILPA 1S7WB 4AMKH 5IVZA 3GZKA 4P2OC 3OKOA 3B2VH 4L4VB 1FVEA 4I48A 1B6UA 3ULVD 3O0RH 4R4NC 3GO1H 4RX4D 4L8BB 4R8WH 3N85L 3KDMA 3MRCB 4KKNA 4OFPA 2O61A 1SVCP 1HHJB 4KDTA 5ESQA 4QXTA 4TN9A 3F7VB 3X12B 5GGTA 2YMXL 3VWKB 3WEXA 1J9CT 2CDEB 5F7WC 5DRXB 1B9ZA 3CVIH 3I9GL 3O8XB 3D9AH 4R2GC 2ZCLL 1OP3H 5KG9B 2CSPA 5F1KC 5IMLB 2AGJH 1R3HB 4KAQL 4AH2A 5E08H 4XP9L 4BZ1H 3OMZA 4Y0GA 4HW6A 4OD3L 3V5DA 3GDBA 4BSWB 1CK0L 3GSOB 4E41A 3KPOA 3L3GB 4QRUA 4Q97A 3RDTD 1KB9K 1OTTD 1YJDH 4NRYB 3MV7E 3NCCB 1C5BH 3ZE2E 5IFAH 1S7QB 5KTEL 3FO1A 2F54B 3LAFA 4D9RD 2OR9H 5LGHH 4X6FB 3L7EB 4NO2A 3RY4A 4RZCB 1BAFH 3KJ6H 4RBPH 5DMKA 2FYYB 4ZUTB 2D2OA 3U7WH 5IGXL 3GIVA 5E00B 1UWEL 4ZG1A 3MNWB 1RJYA 4NQDE 1J86A 1BGXH 5E6ID 2C26A 4LAQL 1QNZH 4U4BA 1BJ1J 3DGCR 4JGJA 2X4UB 4KK6D 3B9KB 1F58L 1LK3H 2X1PA 3GBML 3KPRE 3CSGA 4X6BA 4F7MA 1A64A 3RL2B 4PRIB 3LS5H 2C7UB 3AB0B 3PWUB 1DUYB 2VDOL 1QBML 3I85A 1L7IH 3N1QC 3GB7B 1LO2L 3GMQA 3SDDA 2WIIA 1JGVH 1I1YB 5D7JC 3BGMA 5DRWB 1QSFD 2W9EH 3EO1B 4Y2DC 4YUEH 1T3FB 2HMID 3T3MF 1FNSH 2F9BT 4ZNCD 2QV2A 3U7YL 5KSBA 4ORGA 4LLUA 1KCUL 4ETQB 5EU4B 1FLRH 4MJID 3KPSB 4I5BB 3GSRA 1XF2A 3FMGL 4P3WA 1IT9L 1O5DT 1CQYA 3VXRB 1GCFA 4CU6A 2QQNL 4XNUL 4YNYB 1P2CA 4XAWH 5GRUH 1WIOA 4MHHG 2FD6H 4G9FB 3WSQL 4PJ5E 5I1CH 2NW2A 3KYNA 2D7QA 4G7YL 5CEXB 4X80H 4R7DA 1T5XB 2QADC 4YC2C 4P48A 4JDTL 5KVEH 5M95B 1MFCL 5C6TH 1MAKA 3GI9L 1UQSB 2CIIB 4PJGA 4MZ3A 1QSEE 2DWEB 4NFBA 1TENA 3IJHB 3MRDA 1S78D 3D25B 4QXUH 1GAFL 2B2XH 1T6VN 3S37L 2OCFD 2DQJH 4KK8D 1D9KD 4OZGE 5EO1B 1S7UA 5IHLB 4J23A 4BQ8A 4JEGB 5BXFB 3RKDC 15C8H 1TVBB 1RZKH 1I7RB 1MCIA 1UB5B 4ISVA 3MODL 3FRUB 1A9EB 1C1EL 3EOAA 3BP4A 4QEGA 4U1SB 5A40E 4RIRA 4X4ZA 4OCRH 4XC3H 1P6FA 1MCKA 2OXGA 1S9XB 3OQ3B 2IBZY 6FABH 3QEHB 5JOPE 5GS3A 4NSKA 1MCQA 2I9TB 4PJBE 1JNLL 2R2BB 2QQLL 4HC1A 3D39A 4XNXH 4E0RB 1L0QA 4QRQA 4KDTC 3GGWB 5IMKA 5T1LB 1B0GA 4TYUA 4E42A 1NGWA 2P5WE 4V1DE 5K9OA 1FZJA 5H37H 5I17A 2XWBA 1KPUB 1N3NA 3EYVB 1NH6A 4MJ5A 2EICA 3X11B 4MJ6B 5I8KH 2R56H 2JCCA 3UTSD 1MHEA 2R0KH 3IFNH 5CJ8A 5SWZD 5CJQH 1HYSD 2HVJA 2QBWA 1S7RA 1RIUH 3T04D 1ORSA 5C8JB 2Y72A 3O2WL 4QCIB 1NUNB 5JW5B 4P3CH 3PNWB 1EO8L 1U3HD 5B38A 1U2HA 5IW3A 4LKCA 3EJJX 2G9HA 4C56B 3MOAH 5GGSB 3SE3A 4YHYC 5JA9A 3DO7B 4XVJH 3FT2B 4OCXL 3CZJA 3LB6C 3C6LA 3NFPB 4YDIH 1LE9B 5KVGL 4H25A 2ZUYA 5ITBL 4X6CA 3O6FD 5GZOC 3T0ED 5T5NF 4JLRB 3RHWK 2JKXA 2R9HD 3C5JB 2H32A 4BSVA 3QDMA 3O2DH 1SM3L 2DLFL 5IB4B 2HJKB 2OR8A 2FR4A 4O51B 1IGCL 3KYOB 4P2RA 2WWKO 3T3PF 4DAGL 3S35L 4QHUA 1G0YR 4ZQKA 4PJIB 4KK5C 3WFBL 2AERT 1OQXA 1F3JA 4LMQI 1IAIH 4IHOA 1UB6A 3JZ7A 1G7IB 4GRWH 4K23H 3VU2A 3OJVC 4PB0L 5A2JH 2FX9H 5GGRB 3BKYL 3EDKA 5K9JH 5KANI 5IMOA 3RI5K 2RAMA 2N4IA 2Q3AA 3BZEB 5MENA 3VFSA 2FH6A 2A83A 2HTKD 3T0BA 1CDUA 5INDB 2FX8H 3CMOH 3KGRA 3L5JA 1VEMA 4FABH 1CXIA 1C5CL 5GRVK 1I3RA 1LNUA 2AJXL 5JPMA 4NZDA 1TZHB 4KKAC 1JRHH 4G8GA 3BO8A 5BV7L 1UZ6E 5FHAL 5HHVH 1U8HA 2XN9A 2P46B 1T1ZB 2ID5A 4C58B 5I73B 5JIKA 3GMLB 4CU8A 5CP3H 1FPTL 1CT8A 4Q2ZA 1MCBA 1Y6NR 3BPNB 5D2LB 5HBBA 4Y4HB 5K33A 3M07A 3G04B 5DRNA 2JJTC 1EXUA 3KLDA 2WSKA 4OLZL 5GGUA 3CSBA 4TTDC 1DEEB 2NY5C 3ULUH 3NIFF 4ZO9A 4X7CC 2AK4D 1TQBC 2CLZB 2ZOKB 1ZAGA 2BHZA 3BP5A 4EDXB 1FGVL 4LRIA 3FB7B 3K80A 5DQJA 4FQQA 4OLVH 1E27B 3EUUA 3MACL 4KTDL 5DYOB 5IVXA 5D93B 4MNGB 2J3SA 3V4PH 4FFVD 3ZE1F 4WU7A 3T65B 1UM5H 1QKZH 3MO1A 3S6CA 2ZUSA 1FZMA 4Y19B 4FQJH 4LEOA 4JO2H 4YHZL 1I9EA 4OI7A 4NN5B 5KSBE 3F65A 3D18B 4FA8A 3B9EA 1T22B 4OF3A 2NTFB 4OLUL 4UOJA 5JZ7C 1OARL 3BOVA 4ZYKA 1QFWI 4J3SA 1KLGA 4UT9L 4L8SA 4MAYB 1IAIM 3RGHA 2IC2A 1ZVSA 4FFZL 5C0CE 4XBPA 3VA6A 2QTEA 4GAFB 2ZUTA 2WUCH 2FGZA 3FQXB 3QDAA 2V2XA 5IJVA 1VFAA 4YHIA 1XGYH 5K59F 3ULUD 2C1OA 2VZUA 4HKZB 1MCWW 1MFEL 1RV6X 3GMPA 1ADQH 3E3QC 5EUKA 4S2SB 4PJGE 1BF2A 2X9YA 4Z78B 2AQ3A 3MV9E 2BNUA 3LMJH 4KKBC 4Y16D 3BVNB 5T1DH 4FZ8H 1QPXA 3W82A 1K4CB 3SE3C 4KHTL 3ULVL 5TQ2H 3C6LC 3DI3B 2WBJB 2WLZA 3DROB 32C2A 4LPVA 1A7PH 3TFKC 2RFXB 1OP5H 2GK2A 2ADFH 2IBGA 4N8VA 4Z7VB 3UCRA 2N56A 1JK8B 3C09B 2W0LA 3HC0B 3QNYB 2CKBA 3KR3H 1N64L 3D3VD 4GQ9H 3I50H 3BKJL 3QCVH 5A43C 4WUUE 1CVRA 3D39E 1EERB 3S88L 4OCNC 4DUWA 2VLRA 1X3DA 3IFLL 1WTLA 1I8IB 4Z5RB 2IWGA 1T66C 1BBDL 1CLOL 1FAIL 4YX2L 5D7SL 5F21B 2YEZB 4R90H 4RNRB 2YD7A 1FVDA 1E4WH 3IS1X 1FZOB 5TE7H 5IWLA 5DD6A 1J18A 3E3QE 4Z7UF 5DR5H 1T2QH 1N6QL 1HOCA 4YWGL 5IB3B 1G1YA 1GOHA 4M5ZL 4UTBL 1RIHH 1GPOL 3H7BA 4JM2F 1GGTA 1X5FA 3HMXL 3MRLB 1ZMYA 1DLHB 3MGTB 4DKFH 2AQ1A 3MNVA 4PLKC 4JKMA 4LCWD 2UWEF 1IQWH 3K8MA 4N0YH 5DA4A 4JFQB 3EZ8A 4X6CE 1RZ7L 1T2XA 4TNVK 3STLA 1Q0YL 4EDWL 5LBSH 3WFCH 3KYKL 2APVA 3UO1L 3L1OL 1N6VA 4DN3L 1KELH 1BVLA 4LRIC 3IETB 3SKOA 2HFEA 1VEPA 3RJDA 3PHOB 4XCCH 4NFCA 1YEJL 1NMBH 5JPNB 4D8PA 4U7SA 4ODXA 4P5KA 4BZ2H 1K9TA 3FQWB 3FAWA 3QWRA 1NGQH 4UNTA 3SKNB 4K7PX 5C9KA 3U9UA 1II4E 2Y4SA 4O2FB 2DI9A 2HT2C 1ZEAL 4DGIL 5EOCJ 2XT1B 5HHOA 3FO9A 4W6YB 1E0OB 5EU6A 4PRHD 1PD6A 5MENE 3U4BL 4L8SC 1BF8A 4D0DA 2B7DT 4KRPD 2B20A 5BOZG 2H6PA 3ZT6A 3BPCA 4XXDA 4JRYA 5F1NB 5LGKA 2EXYD 3JWDL 3DVNB 4LSQL 4P9HC 3IJYB 2NQCA 3TT3H 3A67L 3MFGB 1WWAX 4K2UL 2X9WA 2G5BA 2A38A 1FE8L 3QQ9D 2Z8SA 5EB9A 1FIEA 1PG7H 3TZVA 3LSOA 3FFDB 1OGAA 3MREA 1T0NA 1AP2A 1IM9A 4BK4A 3ARGD 5T1KD 3O3AB 1DBKL 4NN6C 1CGUA 1IC4H 3MOBL 3BDYH 1CYGA 1WBXA 4LDOB 1QSVA 3HNTL 8CGTA 1M71A 1ZHNB 1QFOA 2NZ9C 4LBEA 2R39A 3WUWG 2IGFL 2N7BA 4XP6H 3V4UH 1TZIA 2X4PB 3ZTJG 2VXTH 3H0TA 3MV01 3A6CH 2BRRL 4POYA 5FA4B 4HK3J 4PGDB 1S9KC 1F45A 2DIBA 4PJXF 3VXQA 5HJ3B 5TH2A 1WIUA 4NC0B 1ZLSH 4ODSH 4WHTB 2OBGA 5DK0B 3RIAF 2NY0C 3EO0A 1C16A 5IIEB 1EZVX 3K74B 4OJFH 1VKXB 4KUZH 1WC7B 3TNMB 5A2LH 2PYFB 2A9NL 1FNAA 2Q7YB 2DQGH 4HAGA 5GS0H 5C7XH 3OKMB 1W0WA 4HS8H 1TVHA 1NGYB 5HYJA 4NCC2 3RWIB 4I4WA 4Z7WF 1CFTA 1GGCL 2LTQC 4GO6B 2E9JA 1Z3GL 1MHPH 1A14H 5DEZA 3VFPA 3RWDB 1U8IA 2VLMD 4UOW1 3MUGA 5IWLC 2YPKA 3HI5H 2X10A 3EDJA 1ZT1B 2IADA 3W5MA 5EU3A 3HUJE 3H3PL 5D7IF 1H0DB 2PO6A 3MLUL 5ISZD 2C3HA 5D7LA 3HR5A 3HNVL 4TSCL 5JQ6L 5CJBA 2BSRB 3D85D 4EQ3A 1A6WL 4WFHE 3MLYH 4D3CL 2BK8A 3BQUB 1AQDA 2OMNA 5E5MA 4OB5L 1G7JA 4GG6A 5I1LB 2B4CC 2WNGA 2Z93A 4QHMA 2H41A 4HWNA 1JGEB 4U1IB 4PD4J 2F58L 1M05B 4I3GA 5JOFA 1KSRA 4IM8A 3FQNA 1RJCA 1TZGL 4FQ1L 4KUCF 5DJAB 3W11D 5GS0D 4WRLA 3ZDZE 2EDLA 1S7TA 5ANMB 4JDVA 1VGEL 3VDAA 4DFHA 1AD0A 2XTJD 4H5SA 4PG9B 3BW9A 4YHPA 4K8RC 2W0FA 3F58L 1I3GH 4QY8B 3PV6A 5F3HA 3WN5C 2NNAB 3CAFA 4LHUB 3VXSA 3SQBA 5GGQH 3ULSA 4GXVH 4QGTA 1J0IA 4PJ8A 5ICZA 4XPBL 5B3NA 3RZCA 3WNPA 4YQXL 3CMGA 3F7YB 2R4RH 4XC1H 3H3BC 5I18L 4EUPB 2ORBH 1BWWA 2NY1B 5D1XD 1U8KB 3OBAA 4X7TA 2JIXD 1C12B 1P5UA 5EWIL 5J11C 1XF4B 4MA3B 1NMAH 2Q6WB 3WIIL 3VE0B 1V7ML 5SV4A 1K6QH 1DE4A 1UM6L 4RA0C 5J06A 5L2KA 1JHLH 2UVEA 3G5YA 5SWSA 4KJPD 2EECA 2VLKE 4J4PD 5I8CA 1XGRB 1CIDA 3S5LB 1UJ3A 1P53A 2ADJA 4EIZC 4PJFB 3MRNB 3GMOB 3NTCH 1MNUH 2WW8A 5E2UL 1FYTD 1Q9KB 3TZVC 1CDHA 4KMTL 1C8PA 5HPMB 4OCYL 3RAJH 5KN5B 4KKLD 1A6ZB 1IKFL 1N6UA 4L29B 2R0WL 4EXPX 3QIBA 2JB5H 4MD5A 1Q0XL 3WKML 3MC0A 4YK4C 1BP3B 3SDCD 1S7SA 1ED3A 1ZVHA 1ULVA 4JKWA 2X4QB 4AEEA 1U6AL 2EDOA 2FZ3B 4UBDC 2R1WB 3SCMD 4P4KB 4WCYH 4MD0A 3QO1B 5E8DL 3DI2B 2AW2A 2APWA 4ZAKD 5I30H 3BFOA 1OTSC 1FV1B 1L9MA 3EFDL 2CR3A 1P6AB 3UTZA 3KS0H 2JJUA 1WSST 4LPCA 4HCRH 4BUGA 1OD7A 2EC9U 2QR0A 5IKCB 2OQJA 1EGJA 2WINB 3VFWA 1NAKL 1NDGB 4Q6IA 4ZUWA 1LK2A 2AJUL 3T2QA 3QUML 2HG5A 3PWLB 5EU6E 5FFLA 4OTXL 5D1ZA 3QUKA 2Z8WC 4GW5B 3NABL 4WTWA 5J13B 4KHXL 3S96A 2IPTL 4QRTA 4JRYE 4H8WL 1OB1B 3QFDB 5E9DA 2DQTL 3OXSB 3KXFB 3B8YA 3GJFB 5IMMA 1A1OA 1PSKL 5B8CA 4AENB 5DEGA 4ZSOA 4D9LL 25C8H 5F7KC 3TBYA 4UOW0 2GJZA 3M17A 3CH1A 1FFQA 3BWUC 4RFNB 1X5KA 5E4IA 2PO6C 1NANI 1OGAE 2Y9RT 3TM6A 1AGBA 1KNOA 5HHPB 3ZMRA 3U0WL 3NA4A 4XI5C 3WKNA 3PV7A 4FTVA 2C3VA 4R96B 1P7QB 1MQKL 4CW1B 2KKQA 1J5OL 3GIZH 1H3PH 1AKJB 2CDFB 1SY6A 4LNRB 2BVEA 5I1EH 3CFBB 3IU3B 3TIDB 1W72B 1WAAA 3BIKA 3ZTJH 5KSVB 2Q8AH 4HIJB 4PJDE 5BRZD 4DZ8A 4ZPVA 1F4WL 3IDIA 4ZODA 3V5HB 2PYEE 1ODAA 3PDGA 3HMWH 2VISB 1NFDA 5J1TC 2D31A 5FYJE 4L8DA 4FHBD 3DHMA 5EBWA 1MSPA 1JNHB 5CGTA 1QUNA 3HE6B 3GBNH 1KN4H 4IOIB 5D2NE 5H2BB 3NAAL 4A6YL 4MQ7B 5JXAL 4HJGB 1P4BL 2HKFH 4JJHA 3DRQA 5JORB 3VXOA 1UH3A 2EE2A 1HQRB 3GSVB 3SKMA 4M7ZC 2EH8L 3FO0L 5FB8A 2J88H 3ARSA 3OWEA 3MBXL 4PJ8C 4TNWK 4PS4H 1V3KA 2EH7H 3MQIA 1T7VA 3RY6A 4HDIB 3RTQB 1DJSA 4UT6H 2Y5TA 5T5FL 5HYJE 3S35X 3S97C 3X3FH 5DJ0B 3PWPB 4JAMB 3TBWB 2R2EA 3DNKA 5EPMB 5F7HA 2V9RA 4HWEL 3TVMB 5CZXC 4QF1A 4GBXA 1KBGL 2DI7A 1PKQB 4LVHB 1BZ7B 2R15A 3G6JF 5GS1A 1RUKH 8FABA 1PLGH 5C0AD 1OT1A 3O6LL 3RU8H 4J3TA 2CXKA 4KPHH 1UJ3C 4GAGH 3QDJD 4HS6A 1NBVH 3LKSB 1ZWIA 4NDMA 3RUGB 1OM3L 2ICWJ 4UIKL 5CEZH 4YHNA 5DJXA 5DMGD 4MVBD 3MV8B 1H3XA 3QIBC 1T4KB 3L3DA 5C9JB 2ERJB 4NFDA 2J4WH 5E8OB 2NY3D 4LVOB 2WWMD 3WNOA 3OJDB 1OWRM 1ORQB 3DV4A 1DFBL 4HUMB 4P5MA 3GBLA 4GXUN 4XNMB 3C9NA 2ZPKH 3JV4A 2AJ3B 5DD5L 1YPZB 5A3IC 2X41A 4M3KB 4XAKE 1YQVH 3GMMB 5CEYA 4DKAA 1AXTH 3VXSE 4L5FH 2WANA 4R7NA 2AV7B 4M1DL 5IVNA 3WS3B 4NQCD 4AM0B 3C2AH 4F33B 3WDJA 1N4XH 1JF1B 2G75B 4KMQA 5TE6H 1AHWB 2GSGA 4NZTL 1X5GA 1S7WA 2W07A 4RISL 4Q6IC 3IVKA 4AYFA 2BSSB 2R69H 4L4VA 4XVSL 3HG1E 4DWHA 5CEZD 3AAZB 3ZO0A 4BH7A 5I1AB 4L8BA 2QSVA 3PXHA 4HUVB 3OGCA 4HH9A 2W92A 2VDLL 4TUJB 2I26N 3EZJB 3F7VA 3PL6B 4AT6B 2IQAB 5IT2L 1QZ1A 4WV1A 4XGZA 4Y4FB 4F8QA 5CCKL 5L2KE 4PJHA 3V79C 5SWSE 1NL0H 5B8CC 2CH8A 5KG9A 3GMNB 5L88H 1R3HA 1CDYA 4OZ4B 5D71H 2Z4QA 3VXTB 5I1JL 3EDFA 3KPPB 5CJ5A 5JDSB 3GSOA 5D7KE 2PR4H 1BFVL 5TGBB 3K2UH 4NRYA 2NX5B 1XFPA 1BQHG 1JHKH 3MYJB 5FXCH 4BQBA 1NC2B 1AR2A 1VPOH 4LCYB 1DN2A 2WBKA 2P4AB 1IGML 3EHBC 2B39A 3QQ4B 3QPQD 4EXKA 3LKRA 4TOYH 1PX4A 4MQTB 2OI9B 1VGKA 4YE4L 2X89A 3N9GL 2C5DC 4KVNH 5HVWA 5F96H 4UDUB 1XGUA 4B5EA 5L6YL 2DBJA 1PYWB 1I9IH 2PXYD 4G7VH 3L3IB 3ZKQD 3BSZH 3G6AA 1K3ZA 5C0BA 3BT2H 4IBLT 3FFCA 2Z8VC 3VFTB 3A6BL 3B8SA 3MPCA 3B9KA 3BGAA 1CXKA 4I0CC 1RUQL 3NPSB 3EOYG 2YD4A 3RL2A 3V9FA 4PRIA 3QG7L 1PEWA 5DD3H 1YEIL 4C59B 1DUYA 3HHRB 1CGVA 3S36H 1G6RH 4X99B 2BDNH 1I1YA 1J8HA 3MUZ1 3I75B 3EO1A 3KS0J 4OCWH 5F7YC 2EYTB 3O45B 4N0FB 3WE6B 4I5BA 4K7FB 5BZWB 4M1GL 1QFWH 1ZGLB 5JW4M 3X3GL 4GBXC 3VXRA 4R3SB 1XH3A 4XP1L 4NM4L 1JI2A 2ZNXA 5GS1C 4M4PA 4ZD3L 1P5VA 3RVVC 1J05B 3ARBD 3BN3B 1IEBA 1T7YA 2AEPL 1W72L 4TPRL 3R1GL 4WW2F 5CEXA 4N0UA 4GAYB 4J3XA 1S9YA 1F5WA 1T5XA 2EEBA 1INEH 5ACZB 1A4KB 5GRJL 1MCFA 1DBAL 3BD4A 1WAAE 4HUXB 5FO8B 2CIIA 1OAQH 3CFJB 1JGDA 4LCIH 3NMEA 1CWVA 5EO9B 4WW1B 3IJHA 5KSUB 3K81A 2C1PB 4X5XA 4F58H 4JHAL 1ZKAA 5E99H 5HVHC 1GYAA 2H1PH 3C5ZD 3OPZL 1N5YL 5IK3A 4P46B 3PQYE 1Y0LA 2DN7A 3RPKA 3HE7D 3QZWB 1OAUL 4FQXB 4PUBH 5EO1A 1RMFL 4ELME 3TO2B 3HZKB 3WLBA 1KB5B 5BXFA 3TA3D 4HIEB 4RGND 4PJ7F 3QWOA 3LKOA 2A74B 1KC5L 4RX4A 1WQVT 3QG6B 4NNYB 1R3KB 3PHSA 4C4KO 1KYOK 2KPNA 2R1XB 1Q9WA 3P0VH 5CIPH 1FH5L 1MCOL 1S9XA 1KCVH 1A0QH 2NYYC 1G9NL 2VL4A 2I9TA 3FB5B 2R2BA 1WISA 4U1NB 4R4FL 4E0RA 4PRPE 4LL9A 1G7QB 2F53E 4O2EB 4RGOL 4WV1C 4ZOAA 1NCWH 2O93L 4M3JA 5BQ7A 3O4LB 3RDTA 4IMKA 5ICXB 3QHZH 1OGTA 3EFFA 5EZJB 4MJ6A 4PJCF 1P4IH 3FOMA 1UKTA 3UBXI 1DSFH 2EDJA 2O5XL 1UEYA 2WBWB 3VDBA 2DOCA 4NOBA 5JW5A 3EYOA 1KCRH 1JPTH 5TQ0L 4IIQB 2VR4A 3SE9L 1BVKA 2RJMA 1BWMA 3BJ91 4C56A 4HIXL 4XBGA 3DO7A 4M6MH 4LQFL 5DJZB 2NXZC 1BFOA 3IDYC 5BV7C 2CRIA 1J1XL 4H26A 1U92B 3WFZA 2VERN 3TBTA 1BEYL 1ZVYA 2YD2A 4PP2B 4ZO8A 2P8LB 1MEXL 4JFYA 3HMXA 4ODUA 4Y1AD 1BMGA 1W8NA 3EAKA 1MAML 1R5WB 1MQ8A 3DRTB 3BGFC 3C5JA 4YHMH 3HPLA 3B9KC 4WU5B 5IB4A 1FNEB 2HJKA 1B4JL 1Z0NA 1QSFA 4M8VA 4LSDA 3KYOA 3CDGB 4ONGL 5F6HI 4MJIA 2XY2A 3H8NA 5I66B 4PJIA 4L4VE 1YECL 2XPGA 4V2BA 1WWBX 2W59A 1G7IA 4GSDH 2GYSA 4N1CA 4JO4L 5E2WH 5HGBB 5GGRA 2F8VA 5EBLA 1RIVL 5GRZA 5FDWB 3LN9A 5MP6L 1BIHA 1X4YA 5GHWL 3SGDI 3UYRH 3I6KA 2ITCB 5GISL 1MRFH 3K8LA 4YR6B 4CDHA 4QOKB 4U1JB 5DUBA 1YUHA 1AI1L 5KAQF 2YKLL 4M43H 1HSAB 1KOAA 3GRWH 4FOMA 5HHNB 4APQB 4ODHH 3L3KA 4JFED 4U1KA 1F42A 2AK1H 4LVEA 2F54E 1HNGA 3AREB 1ND0A 1PQZB 3SJVD 3NVQA 3M8OH 5D2LA 4FFWC 3BDBA 1EBPA 3EJZD 2AJSH 2YHGA 3D0LB 5F72S 1KN2H 5BS0B 1JZ6A 5LAXB 5C0JA 4HWZA 2CRZA 1JPST 1DEEA 5BZDB 3OKDA 4GKNB 2XZZA 1R5VB 3QIWD 4NBZB 4ELKA 4EDXA 4U1HA 4S1RH 2HH0L 4OFYD 4KQ3H 1IMHC 4PRIE 2EYRB 2Y6SC 4NP4L 5DYOA 4M03A 3ULVC 1SBBA 1M7DB 1N59B 3LKPB 4MNHB 3ARFB 1R0AL 2XZAL 3LIZH 1XR8A 2B1HL 2NR6C 4Q9RL 2EDFA 5DHVH 1T22A 4LSTL 3VFRB 3KPSE 1M7XA 1ZK9A 3T0AA 4N9GA 3VMOA 3FTGB 2HT3C 4PV9B 3VXRE 2GTZA 3UTSA 3WD5H 4J3WA 5DK2A 3HAEB 3QHTC 5A2FA 3BH8B 4FXKB 4U2ZA 3I6LE 3IDMA 1RZ8A 5FUOL 3CCHB 1V3JA 3OGOE 4G9FE 3QP3A 5CLTA 5JDJA 3OXRB 3RDTC 4IMKC 4NHCH 3WL9B 3QQ3B 4OCSH 1IAKB 1U3HA 4K55A 1SYSA 4HKZA 4CU7A 3CX5J 3FN3A 3RIFF 1OAYL 3LV3A 2V6HA 2Z31B 5BO1H 4NQXB 4S2SA 1QEWB 4MLIA 3HZMB 1EHXA 5LKNA 4PBXA 7FABH 5GPRA 2EDRA 3SKJH 3QULB 5CBAB 4JFOB 4LSVH 5AZEL 4F7CB 5F7EH 1FNGA 3F6IA 1LEKA 1YEKL 2PTVA 1EEQA 2UY7A 1A6UH 35C8H 4EOWL 3ZKXC 1PX3A 4KK6C 5KZCD 2WBJA 4YHOH 3S7GA 4NQEB 1T0PB 2A77L 3DROA 1NCCH 3JXAA 5F44A 4UT7H 4X8XA 1JYVA 2RFXA 4LASH 5FCSH 1E4XH 3TBSA 1FDLL 3TESA 3VD5A 2CUMA 4MNQD 3HC0A 2HMIC 2XQYG 2GY7B 3QNYA 2I5YL 2OTUA 1TXKA 3SGKA 3CLEH 4P3DA 3CIQA 4U0RB 3ROLB 1LO0H 2G60H 5K9KA 5KVMC 2BSTB 2JELH 4XH2A 2HRPL 4G6MH 3G5XB 4XWGL 3M45A 4PRBA 3MGOA 1FIGH 4HFWB 2HN7B 2DD8L 6CGTA 1WTGT 2BCKA 4L1DA 4ODTL 4Z7UB 5IFHH 4RNRA 3FCTB 4NKOB 2DQEL 1EHLH 4I0PD 3GSXB 1J8KA 3QUZD 3TJHC 2R0LH 2OK0H 5DHYB 4JM2B 1A7BA 4EBQH 2OL3B 2X7LB 5C3TA 2HFGL 3H9SB 4JFFB 2QQKL 1T80A 2FBJH 2UWEB 3QPXL 2DBLL 1T1XA 4JN1H 4X4YB 4XMPH 1JGUL 2V7NA 3ZT5A 4TTGA 1HSBA 3JWDC 4JQIL 3OZ9L 1UCTA 4C56E 1A6VH 1FL3B 2CDGB 2FHCA 3RVWD 4F80A 5ESAB 3MV7D 2J1KA 1DLHA 2A0LD 3DUSA 2R2CA 3CFKB 3MGTA 1KLUA 3CFDA 4PREA 2MPAL 2PN5A 1JWSA 2AK4A 3BPNC 3OAYH 1R6VA 4Y4HC 1XGQA 3MLZH 3RI5F 2ZOLA 1TPXB 3KLAA 2ENYA 4ZFGL 1H8OA 1KJMB 1CN4A 3P30L 2BMKB 2EKJA 1N5AB 4XWOD 1F4HA 5BVJA 4NYLA 2VUYA 4AEHH 4NQDD 1KT2B 5D96B 5HDOA 5I1DA 4WENB 3ZYIA 4MCYA 5FOBB 1UXSB 3MXVL 3KPRD 5F71A 3THMH 4OF0A 4BKLA 2CJUH 2CXGA 4PJIE 2AI0H 3ZHLA 4KV5E 1EIBA 3LN5A 1J1PH 3X14A 4P2OD 2LU4A 3RL1A 4R4ND 1D6EB 1DQTA 1GL4B 1HEZB 4TUOB 5DRZB 3V5KA 3BKML 2IQ9L 1K2DA 5T3ZH 4XCEB 4Y5XB 1AGEB 5C0RH 1R3JB 3MLXH 4F9PA 1V3MA 3NACL 5AZ2H 4H88H 3OAZK 4IOFC 4YO0B 5IF0A 4J3UA 1CE1H 2XKUA 3OB0H 3MLSL 1YYLH 3MLWH 3QUMA 4PGCB 1U8OA 3P4MB 4M62L 4DVBB 3VFUB 1Q9LB 1U3HC 5MERB 4S1DD 4PJ5D 3K7UA 4LLMB 4FQIH 4X8JB 4M1CD 1HE7A 2MQ0A 3Q6GH 5GRXG 2Z35B 3EDEA 4OBRA 1G7PA 5D2LE 4NN7C 3KWWB 3E8UL 4G5ZH 1HXYB 1AFVL 4NGHL 1QSED 3NH7L 2R9HC 3QCUL 2XOTA 1QBAA 4WUKL 2WBJC 4HKJA 1ZLWK 3VWJB 4PJXB 1A02N 2OJZH 4Z77B 3D3VA 4GQPH 1CICB 3GUTB 1J12A 5D1QB 3WHE0 3CLFH 3V7AE 5FA4A 2L0DA 5CSZB 1H3TA 4MNGE 4I13B 2G5RA 5A16A 2F5AH 1DLFL 2OTWB 2XNAA 3ZYZA 3S3SA 1X4XA 3BESR 2EEDA 2ADIB 4Y19E 1MCRA 5DK0A 3SGKC 4LLQB 3H9YA 1MHCA 4F9LC 2CLRB 5IIEA 4AG4H 5D7JD 4ERSH 4Z7WB 5B38G 2D03H 3TNMA 3QJFA 1LO4H 3IS0X 1YYMH 1TIUA 3WFDH 4A6YA 5JW3H 5JOPD 5ADPL 1S7XB 2BVPB 2VXQL 1X5JA 4FG6C 1NGYA 43C9A 2CQVA 1MI5B 3WFHB 4QTHB 1UWGL 2IJ0C 5D4QA 4G6FB 1TQCB 5I76A 1JNJA 3QEGH 3ZL4L 2NW3A 5D7IB 4DVRH 1U93B 5C08B 2P5WD 1RU9H 4V1DD 4BFGA 1FNLA 1Z9OA 2X2YA 4MQSB 3KHQA 3RWDA 3UC0L 3LQAH 1ZT1A 3NFSH 4IDJH 3VXNA 5DD0H 2R8SH 4LSPL 4LCWA 5GIRA 4KZEH 2JJVA 4JR9L 1ZXQA 1NKRA 1UWXH 3RQ3A 1T2JA 1F4XL 5DS8B 1BBJA 1PZUB 4G6KH 2XA3A 1WWWX 3BQUA 4CADA 4XRCA 5HYEA 3NA9H 4PRNB 2E9WA 4ZUUB 4UTAL 2CGRL 3FB6A 3BRGC 3LS4H 4ZFZA 3PP4H 2XQBH 3F5WA 1YC7A 2AV1A 1MRDH 1DQLH 3WJLA 5DJAA 4JG1L 3DUUA 2GFBA 5ANMA 1A1MB 4ENEC 4I2XB 3V4VH 4PLJC 3TGXA 1PG7X 5BJTA 3RVUC 3RKDD 3CNKA 4Z7VE 4ZOEA 1ZHLA 3P0GB 1MIEL 2XKSA 1FLRL 5IB1A 4U6YB 5DWUH 4S1SH 4MGXA 4WI6A 1RUPH 1GSMA 5J8OA 2FO4A 4JQXA 1QVOB 3ZLQC 4QRRE 4K9EL 4LSRL 1H15B 5GGVL 4F3FA 4HIIA 4LIQH 3IFPB 1I1AD 1CFVL 1UH2A 3LPWA 3I2CL 4W6WB 3VDCA 1A6AB 3TH4T 3TYGL 3PXJA 4YDLC 4CN6A 3P11H 4CGTA 1DR9A 3E6HB 2OL3L 1RI8A 1SYVB 2UZIH 4PY8J 5C0GB 4F9PC 2SEBB 5I1IH 1JV5A 1JN6A 2D9QB 3DVGA 1YEEL 1UCBH 3VE0A 3GHBL 3AC0A 4P5TB 1KUMA 2OP4L 2P42B 2KQMA 5IESL 2DB8A 2VABB 3ECBB 1FFOB 4MSWB 3L7FB 4OM0L 5FKAB 1NC4B 2Z9TA 5T1KA 4X83A 4HMEA 3JUYA 1DN0A 3IB4A 3S5LA 2D9CA 1QG3A 4BQ6A 4H8WC 3KPQB 3FO2A 1D5ZA 3VGHA 3L5WA 2ICEB 2H8PA 1A6ZA 3U46A 4UB0L 5K9QG 4L29A 4ZS6C 4N68A 4XMKL 1FORH 3C5SB 1CI5A 3QUXB 1UG9A 5GSVB 4KRNA 3LB6D 4I3SH 1D5IH 5F1OB 2X4QA 1GZPB 2Z91B 3JTSB 43CAB 1LEGB 3FQTB 4XPAL 4WI4A 3BEVB 2ED7A 5I1KL 4XCNB 5JNYA 1QR1B 1AGCB 2JB6B 5IEHB 1FV1A 4OIIL 1MJ8L 3TO4B 2FIKB 4KY1H 3MCG1 2E9BA 2ATPA 2CUIA 4KK5D 3BH9B 3MLTB 3VFMA 4M6NH 3QXTA 4U3XA 5F7DB 3VCLB 2ITDB 3CSPA 5CMAA 1F6AB 5D6CA 3HC4L 5IHUH 5EZLB 4MDIB 1IGTA 3R0MA 3T1FA 2E5EA 4G3YH 4QWWC 2NY5H 3IYLW 4P59L 4XTRD 1OB1A 4NC1C 4GKSA 1Q38A 2V9TA 5LGJB 4UDTA 3GJFA 5ISZA 2ARWA 5C0CD 3REWA 2WK2A 5DGQA 3D85A 1SJEB 3VGGA 5HDBE 4LQ1A 1U8PB 4N8VG 1B0RB 4KKAD 4Y5YB 5D5MF 2H9GB 5ICYB 3QRGL 4HKBA 4GW4B 2BJML 2FX7H 1KCKA 2DLIA 1B88A 2FJGA 4HC1H 4M7KL 2CIKB 3C6SB 1LP9A 4K3EH 3L3JA 4M6OH 3BQUC 1P7QA 1CE6A 3MV9D 1KPRB 1AKJA 5EOCL 3MMEB 1U8NB 1W72A 4F7EB 1LDPH 4JZJB 5KSVA 5CINH 1AC6A 5ITFB 2XRAL 3RPIB 3WJLC 1MFAH 2YC1B 1SBSL 3TN0D 1MFDL 5EOQH 3WO4C 1VACA 1U8QA 2VISA 2V17H 5DQDH 4HWBL 4XX1E 2GSIB 1UJTA 4O02L 3HE6A 2YA1A 5H2BA 3G5VA 3FZUD 4EIGB 3GI8H 4LP5A 2VXSH 1S5IH 2IFFH 5D1XA 2X9XA 3KJ4B 5HYQB 5JORA 4JQXC 1S9VA 2DTMH 3AMLA 2EDNA 4X4MA 2DQFB 2JIXA 2DMBA 5D8JL 1KFAH 4JFDB 2R4SH 3RNQB 3VRLF 3B43A 3LH2L 1KJ2L 5H35A 3Q1SL 2R2HA 4HDIA 4PGEA 3T0WA 3RTQA 3LQMA 4KRPC 4WUUD 3P40A 5JZ7D 3D39D 3NIDF 3G6JB 2Q87A 5DJ0A 4L3CB 3PWPA 4PTUB 4JQVA 1FFNA 3FJTA 3UTTB 2Q76B 1JFQH 4NWUL 4Y5VA 4Z95L 5E2TL 2H32H 4TVPE 2DICA 5I15H 2V7HB 2VDKH 1BZ7A 3U79A 3KYAA 3BZDA 5FEBA 1MFBL 1WCBB 2UZYB 3BMWA 4YHLL 3PDDA 1CFBA 3IXAB 5GXBB 2I25N 4R0LB 3TIEA 2BFVL 3E6FA 3I6GB 3HRPA 5IFJB 3SDCA 3OF6A 4MD4B 3LKSA 4Q0XL 4KKBD 3O9WB 1F4AA 4NKIL 1B2WH 3HI1B 3MV8A 2FEEI 1MLCA 2Y25A 5C9JA 2EE6A 4L9LA 3T8XB 4ZAKA 3TCLA 2BP3A 3HC3L 3C6LD 4RDQG 5E8OA 5ANME 1IC7H 4JPKH 3TFKD 4P4KC 4MA8H 1RULL 4X6DF 2AJ3A 3PHQA 1YPZA 3INUH 5DI8A 3N1PC 4LGSB 4MA1B 3FONB 4U6VL 4XNYH 5KS9A 2E27L 4JG0L 4Z8FH 3QXDA 1A7NL 4CL7A 3WNMA 4GOSA 4F33A 4YHKH 1OVZA 5DFVD 1AHWA 3AY4A 1OPGH 1H8SA 3RZWA 3O11B 2OZ4H 3MJ8A 2BSSA 4QT5A 3D2UD 3TPUA 5F1IB 5J57B 2Y07L 3GKWL 5DQ9A 3AAZA 1XMWA 1VHPA 1T66D 3RWJB 2BOBB 4W6XB 5DMJB 5FECB 5J12B 1MREL 4ONHB 2IQAA 3VMPA 5MEND 5FYJU 2XG4A 4YXHL 1IGIH 2CRMA 4PTTA 2ICWB 1HH9B 5ECJE 4JHWH 3VXUB 5SV3A 2IPUK 4NZUH 4FFYL 4NUGL 5IW1B 2AABL 3H6JA 4M5YL 4PJFE 3GMNA 4NKDA 3DX7B 4UINH 3JV5A 3VXTA 1EJOH 5AWNL 3KPPA 2FHBA 2VQ1B 4RAUB 1FGNH 3U4EA 2CLVB 1JVKA 1F90H 1KG0A 5BRZA 5FO9B 5F3BB 2NX5A 3LDBC 1SJXA 2C4XA 3MYJA 1XF5B 4XPTH 4LCYA 4R4BA 4PLKD 5FYLH 3S9DB 3EOTL 3H9HB 2A1WL 3QQ4A 1FSKC 1YNLL 4HF5L 4HUWB 2BOCA 3QCVL 4LPTA 4P9HH 5GJSH 1I9RL 5EZOL 2DF3A 3LRSA 1FFRA 1E4KA 1OP3K 1CDCA 2VAAB 1NAMB 3NCEB 3PGCB 3EYUL 4K3JH 4HV8A 2OSLA 3ARDB 4OF6A 4GUPA 3HE6C 3U82B 2DQIH 4I9WE 1PZ5B 4YXKL 4M6AA 1L6XA 3OAUL 3M1BB 5DT1H 3C60B 1HXMB 2YK1H 4W70A 4NJ9H 3MTRA 1L7TH 3RTQC 1IZKA 1R24B 4JY6A 3I75A 4DTGH 4RBPK 2BNRB 5C0AA 1W0VB 3IFOB 5FIEA 4JQVC 1A7RL 3KXFE 4JFZL 5FA3B 4Y5VC 1HN1A 4WO4B 2C4FT 1ZGLA 2HYMA 3TJEH 4ONFH 3QDJA 4R3SA 4QXGL 5IQ7H 1MY7A 4WW2B 5AYUH 1EUUA 3OKKB 2YUZA 1V7NH 5JHLH 3QWQB 1CXHA 2F74B 4PGBA 3ARQA 3VFOA 1CD9B 3ZDXE 2W38A 1OD9A 1R5IB 3SDCC 1HKFA 4HZLB 1Q72H 4GRLB 1CFNA 5CJOH 4YPGB 5DURB 5DMIL 3W2DL 4UNUA 2AJYH 2LU3A 4JZOB 4QTIL 4WFHD 5HDQL 5FO8A 2IH1A 1DTUA 3NOIA 4WW1A 4NKQB 4NPYA 4ZAKC 2WQ8A 3CZFB 3CPLA 3TBVB 2XKNB 5CD5C 2NZ9D 5D70L 4PJ7B 2YRPA 1A3RL 3CUPA 3R8BB 1IAOB 4OUOA 4IRZL 3B9VA 3QZWA 1WLHA 2HVKB 3TO2A 3G6DH 1CGWA 1UZ8A 3IJSB 4OFIA 4RMWA 1TCMA 5DLML 1MVFA 4UQ2B 4LLYB 3W9DB 1S7VB 1P4LA 4HIHB 3DSNA 1AHWC 1YMMB 2B4CH 3AY4C 4ZO6A 4W68A 5C6PB 3TT3L 4POUB 4Z7QE 1MJ7L 1IBGL 4I3RH 3UJIL 5BMFH 3PWPE 5IW6B 2OR7A 5B3JF 5FYKH 4XHJC 3LQZB 1NGZB 1U3ZA 1NBQA 4Z7NF 2AQ2A 1PKQE 5MEQB 4PJCB 4IS6B 2AXGB 4O2EA 4K8RH 2YPVH 4ODWB 1HH6B 3C2SA 4MB5A 3O3EB 2FJHA 1F3RB 3BDYL 1I4FB 1P1ZB 4XCYA 4GT7A 5MI0B 1G7MB 1KIQA 1S9WA 2J8UF 3ROOA 5JUEH 1NBZA 4OD1L 1HQ4B 3VG9C 3IDXL 4D0BA 4K3DH 1JPSL 3RUGE 2VLKD 3HZVB 4M7JL 5HSFA 1HHKB 3VGAB 4PV8A 2GCYB 4XHQA 4BYHA 3UTOA 4JDZB 3QI9B 3MV8E 3RWHA 4XCFH 3WUWB 3T77B 4QHKJ 2P7TB 1HNFA 2FCBA 5J3HD 3ZHKA 5C09B 3T2NL 4L3EB 4TSAL 2W1NA 1A3LL 2PXYA 4DGYH 4ZS7H 2C4FU 3JUZA 3MXWH 3U0TB 1M1SA 3O6ML 3MBEB 1U92A 3W39A 5GS2H 3LVEA 1NLDL 1YPZE 2P43B 1E4KC 2XICA 1R3LB 1RY7B 4PP2A 1K85A 4JO1L 1CQKA 2YD1A 4QHNA 4WDIB 1AXSA 2JCCF 4LVNB 4F37F 1EDQA 3ILQD 4K8RD 3FQRB 5E8NA 3UJTL 4P2QB 1EEZA 2VDRH 4Z0BH 4WU5A 5EBMB 4M7LT 1BLNB 2R29H 2NY7L 4ZXBB 5TPWL 2HFFB 1ES0B 3DGGA 4Q9QH 4NNPL 5KVDH 5EFIA 5JXED 4U31A 5KW9H 1NCAL 3RGVD 4KI1A 4ZFOL 5CHNB 4HLJA 4RAHA 1KGCE 3HR6A 1HIMH 1CGXA 5EC1A 2O5ZL 4I77H 3IF1B 5EU6D 5ILTH 1F8TL 4G8EB 3ARBA 1X6LA 2PCPB 2Q1EA 1OAXH 1CR9H 1MJJB 4DKDC 5EZIL 1E6OH 4AIZB 4JRYD 1FN4B 4KK9D 1B0WA 1ONQB 3MFFA 4G9DB 5T1MB 2ITCA 3OJ2C 4HFUL 4QOKA 5JHDB 5GS2D 3RIAK 4YGAB 3LEYL 1J0ZA 1WFTA 2ARJB 4APQA 4K07A 1QLRB 5BVPL 3MCLH 2NX5E 3TZVD 3CD4A 1BIIA 4K7PH 1VFUA 1OGAD 3LOWA 3EBAA 1IM9D 2WWMC 1NAML 4FQ2L 2O26U 3AREA 4TSBH 1RK0B 4B7IA 4LCCB 2KDGA 4B7LA 4EN3B 3SO3B 2X4TB 3TA3A 1TETH 5FUCC 2DYPB 4M02A 3D0LA 4LRNH 4OV5B 4K3HA 3ARZA 3VFGL 3R06B 5CP7A 5BZDA 1UH4A 2PYED 3C8KA 4CVZB 1ZT7A 1AJ7L 3AM8C 5FYJD 1OTSD 1IAMA 1TJGL 1ZANH 4Z76B 3T3ME 2QSTA 4L4TB 2ZG1A 1M7DA 1Z2KA 2HJLA 1U0QA 4PB9L 3FAXA 1T04A 3LKPA 2VDMH 3ARFA 4XBEL 3FN0H 3BP7B 3R0NA 1G1CA 3EYQC 4XPFH 3VH8A 4XP4H 5HYJD 3V6BR 4CJ0A 5CZVL 5E2VL 3WXWH 2ENSA 4PV9A 4OI8A 4JM4H 4OKVB 1NUGA 5DUPH 3HAEA 3B4NA 5EUOA 2WUBL 3BH8A 1AGFB 3GSNL 3NIGF 4G42B 2L7UA 3O81A 4HHAA 1QLEH 2BNQB 2XZQL 1WVZA 4O2CA 3WL9A 3NBNA 5IVXF 5F9JA 1K8IB 1OLLA 1WBZB 5GJTH 5GRWA 1MOEA 2Z31A 1T7XA 3QPQC 4XI5D 5B21A 3GK8L 1DVFB 4D9QE 3BMVA 1EFQA 4AEIL 3IDNB 4TRPL 4NJAH 4S10A 3V0VA 4ZPTA 5I1HH 1DEDA 3Q5OA 5HHXH 3RP1A 4RA3A 4NQUA 4Y1AA 5DUML 4WNQA 3QB7C 4HCRL 3DETC 3ARVA 2VQTA 2VH5L 5E2JA 5C71A 1RUML 2DDQL 2I07B 3CVHB 1A1NB 3N85H 4EVNB 5CAYB 3TEUA 2VDQL 2DQCL 2YMXH 2VL5B 4EI5D 2V5YA 5F7LB 4PD4K 4XAKD 1GGIL 3I9GH 3VXSD 1YY9D 3DLQR 1G6RB 2ZCLH 4PJ8D 2XWTB 1CG9A 4KAQH 4XP9H 1T6WA 4Y2OA 4F15B 3C5ZB 4OD3H 3GM8A 1CK0H 1L0XA 3G5XA 3CFEB 4Y4KB 3HG1D 2HKHL 3ARBC 2X1WL 5DVMA 1I7TB 4D0CB 5KTEH 5IEKA 5DF0A 4GLRH 4X9BA 3QO0B 5FO7A 3O4LE 2GAZB 4Z7UA 4JFEA 4K7PY 4ZO7A 4RFEB 5L2KD 5IGXH 5SWSD 4UQ3A 1TLKA 2CD0A 2OL3A 1RJZB 1N7ML 4LAQH 4APQC 1KCSL 2FB4H 5C0DB 4FRWA 4P4RB 2PKDA 2UWEA 4YDJB 4WHCA 1KIRB 1F58H 5D7KD 3GBMH 5IOPB 4HGWA 4OLWL 4TVSa 5EG6C 1MPAL 3PDOA 3AREC 1EAPB 3O41B 2VDOH 1QBMH 3QIWA 3FQUA 1LO2H 4XP5H 2Y7QB 3MV11 4OFYA 4Y89A 1AY1L 1FL5A 1SEQL 1N5AA 3WCYA 3E2HB 5GRYA 3T3PE 3U7YH 3QJHB 1KCUH 5DTFB 5HYSA 1BM3L 1MLBB 2E7CA 3FMGH 1IT9H 5JIHA 4AQOA 2NZIA 1UXSA 1A2YB 1IJ9A 1HILB 2QQNH 4XNUH 4EI6A 3O3UN 1Q94B 2XXCB 3S3PA 3WSQH 3ARFC 4JPVL 3HI6L 3FT4B 4G7YH 2DI8A 1I8KB 4NC2B 2Y5EA 5EOTB 5FKPB 3UYOD 1EMTL 1HEZA 4TUOA 3X13A 4JDTH 4QYOB 1DQQB 1ZS8B 1MFCH 5CSBA 5ID0B 2QKIA 4Y5XA 3ARYA 3GI9H 2IPKA 4KH2A 4QOKE 4YO0A 3NZ8B 2ZP0T 1GAFH 1OAKL 4MXQD 1QO3B 3SQOL 4G43A 3S37H 2NMSA 2Q86A 3VFUA 4GAJL 3QXAA 3GHEL 1MRCL 5MERA 2BVQA 2P47B 4CMMB 5EC2B 1UXWB 2Z31C 4LLMA 4OF7A 1RZGB 2Z35A 3BUTA 4OZIF 3MODH 1L0YA 3EHBD 1C1EH 1WUNT 1Q9OB 3NIFE 1FO0L 4XNQB 1CBVL 3U9PL 4YJZL 1AGDA 1K4DA 4RDQF 1HXYA 3MX0A 2OMBA 5IG7B 5BS0E 2GK0B 5DJCB 4JFHE 3ZTNL 5FGCB 3HPJA 4FZEL 3TWCL 4X4XA 5DO2C 5IROA 4MNQA 1JNLH 2QQLH 4CN4A 3ZE1E 1YNTA 5C70A 2F5BL 3CK0L 3TNNB 4Z77A 2E7LA 3PQYD 3VFNB 3VFVA 5D1QA 3OR6B 1FJ1A 2HTLC 3ZKMC 2OTWA 4BFIB 4UUJB 2XFXB 3IXTB 2EDHA 3B6SA 3BHBB 4P9ML 4LLQA 1EUTA 2X4SA 1I7ZA 4GG8A 5ADOL 2YA0A 4YGVB 4HWBA 3O2WH 5ELIA 3O6KL 4LLDB 4BJLA 1HHHB 1IGYB 1S7XA 3CDFA 4I0PA 3QUZA 1HK6A 5K59E 3GEWB 1EO8H 5L7XL 3WFHA 4GBXD 2EDXA 3UTQA 3D6GA 4PRPD 4K9EC 2F53D 3VGDA 3ES6B 4R26L 5TFSL 5D7IA 3RVVD 1U93A 5F9DC 5IBTL 4M4RA 5C08A 4OCXH 4E5XB 1KJ2A 1YEDB 2B1AL 5KVGH 1BQHB 5ITBH 2H3NA 4GRMA 1IKNA 4KI5F 4JRXB 4XVTL 1CXEA 4OGXL 4F7TA 1A4JA 3QEQB 1SM3H 1DQDL 4S0SD 2DLFH 2R1YA 3CVHL 3MZGB 1XT5A 1IGCH 1DBML 3WIFA 4DAGH 3S35H 2B5IB 5I2IA 1F6FB 4NQDA 3WFBH 4NQEE 1VESA 1MELA 1TPXC 4IRSD 4PB0H 4OD2B 5HY9B 3VGBA 1LEIB 2ZG2A 3WO3B 4P23B 4I2XA 2GQHA 3BKYH 5AUMA 1E28B 5L0QC 1OSPL 1U8JB 5D96C 3O3DA 3QNXB 2PW1B 1U91A 3LHPL 5GQBA 2ZKHL