5CJOH

Crystal structure analysis of elbow-engineered-fab-bound human insulin degrading enzyme (ide) in complex with insulin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVSSYSIHWVRQAPGKGLEWVASISSYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARDRVMYYWSFSKYGYPYGMDYWGQGTLVTVFNQIKGPSVFPLAPSGTAALGCLVKDYFEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTCNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Insulin-degrading enzyme
publication title Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2015-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoH01
1BP3B 1YMHB 4HH9A 32C2A 2Z93B 3AFLA 3MRDA 1QFOA 1J7VR 4UT7H 2MOVA 2VLRA 4OLVL 2X9YA 1CFBA 4WW2B 1NFKA 2GK0A 4X7DC 4YBQD 2BK8A 4R2GB 2NY7L 4A6YH 1LO0H 4ESKA 4OUOA 4U0RC 2E27H 4QOKA 4KVCH 5DEGB 2FSEA 1EAPB 2X70B 5JNYA 2D7TL 2W9LA 5I8OL 1TJGL 1DSFH 4XCEB 3VXRA 4HZLA 1KB9K 3RNQB 2GAZA 1OGTB 4LKXA 5CHNA 3VD3A 1M71B 1BFVL 3EO9H 3BN9D 3OB0K 1ADQH 1RVFH 4PGEB 2H2SC 3RKDC 3VFGL 1Q1JH 4XNYH 4XWGL 2NY0C 2OI9B 1A6UL 1CFNB 2BRRH 3PIQB 2OL3A 1JUFB 3EFFA 5F7DA 4WWKB 4Z7VA 3EOTH 3MRBB 1E4WH 2A6IA 2AJZB 3FFCB 3FO9B 3QWOB 5CJQL 2FCBA 4H1LG 4QXTA 2V7HB 5KVEL 2DL9A 4LKCB 4RFNC 5HHOD 1MCOH 3TVMA 1N5YL 3MRQB 4XXDB 2VJXA 5A2LH 2YPKB 2EDRA 4LCYA 2CRIA 2VLJB 4G8FA 4HK0A 3GSNL 4X83A 3SKMB 3HPJB 5E8NA 5F96H 5TDOB 4XCFH 3NPSC 3NAAH 4R90L 1NGWB 3UTZA 1H8NA 5B8CC 3P9LA 5GRVL 1ZT1B 1NBQA 1K6QH 3BPLC 1JK8B 2B1AH 4LNRB 4C83A 5L2KE 1F42A 2X41A 4ZG1A 5E5RB 3STZB 4S11A 1GGCL 4QRRE 5EUOA 4I9WD 4LNVA 4UU9B 3KHQA 1Q0YL 4Y5XC 1L6XA 3ULVC 4PJDE 5K9JL 1ZANH 2AXFB 4PB0H 4HIXH 3NCJH 4P4KD 4P3DB 4MCYB 3MV8E 4P49A 3ZYZA 4CGTA 4OD1H 2QTEA 2IJ0C 1Z0NA 3C6LD 3KLAA 1DZBA 4OCMC 5I16A 2I9TB 5D7IB 1E6JH 4X5WA 5F21B 4F7TA 3T0VA 5IJKC 1I75A 1AY1H 3LRGA 2JJTA 5C7XH 5CFHA 4G80A 1G1CA 4HS8H 4LP4A 1J0JA 3DRQB 2YPLE 1K8DB 1CFSA 2C3XA 3L3JA 2VXVH 1CTNA 4PRHD 2IG2H 2XZAH 1WGOA 2R1XB 3WIHH 1XF5B 1T66D 4NKDA 5I1KL 1KTLB 2IH1A 3B3IA 3O4LD 4NOFA 4Z5RA 3WFBL 5FDWB 4R4FL 2J8OA 4MA7L 2PO6A 1G0XA 2NXZB 4G42B 4XVSH 2ADFH 2R4RL 4R7DA 4JFHE 5EU3A 3QO1B 5F1KC 4MXQC 3WFEL 3HZVA 1FORL 3LZFL 3ZHDA 4IRSD 1CLOL 5DURD 3QUMH 5I19H 5EC1B 1IAMA 1RV6X 4PRDA 3ZDYF 4WDIB 1UM6L 1ETZA 2NY6D 3IFPA 3HZYB 1HINL 1SBSL 3TBWB 4NQEA 5FHAH 4F33B 1YYLH 2OTUA 3TYFA 2YWZA 2X42A 1NC4B 2R1YA 5MI0B 3HS0B 5CZVH 1AKJD 4KMLB 5JLZA 5FF6B 4WFGE 1J86A 3KPQA 4LPYA 4IIQC 1C08B 1F4AA 4M4PA 5FO8B 4XRCB 4MDJB 3A6OA 5C07E 3L3KA 1KN2H 4MNQB 5DJXB 1KTRL 3QDGA 4ODXB 1BIHA 3FT3A 2DIJA 4J1UA 4WTWA 3BI9X 3HZMB 4I5BA 4QHLA 4IS6A 1FVCB 4BK4A 3UDWA 3O8XD 3EDFA 5KVGH 5KG9B 3BXNA 2NX5D 2WP3O 5D1ZC 4F57H 3W2DH 3MRNB 3VMOA 5I2IA 2VDQL 5D2LA 2DM2A 1JPGB 5T3ZD 1VFOA 2VDMH 2YS4A 3RWIA 3D6GA 1YJDC 3L3DB 3CPLB 5F7LB 1HQ4A 3IYLW 1IAIM 4L3CB 3IDUA 3MRKB 3OAZH 4IRJD 4JQVA 1Y6KR 2VRAA 4WUUD 1NCDH 3VXNB 3MV9A 3QIWA 5BW7A 3QP3A 2ZPKH 5GRYA 5C08A 4OZFB 1FP5A 2WUCL 2CD0A 4K3EL 4L1DA 4EJ1C 3CU1A 3UAJD 3VFTB 2YRPA 5E2WH 5MENA 3O9WB 4QYOA 4IDLA 3S7GA 1JHKL 3SGDH 2AXJA 4Z76B 2E6PA 1XMWA 3FFDA 5DEFA 3LKOA 1V7NH 4FFVC 1OCWL 1E6OL 1RY7B 3VA2C 4YC2C 2AQ2A 5FO9A 4NRXA 1X5AA 2DQIH 3I2CH 5AG9A 3O6ML 3CFJB 3DX8B 2I07A 1CE1L 1ACYL 3EZ8A 4JLRA 2OSLB 1O7SA 1X5GA 4HUWA 1V3JA 1HH6A 1I8KB 1PG7X 4PJHB 4KK6C 4JRYB 3D87B 3C5JA 4NQUA 4G6AD 1D5IL 5AYUL 1IGMH 1P2CA 5EO9A 4UZGA 2FEEL 4MD4B 2NW3B 1NC2B 3HPLA 5DHYB 2AEQH 1RULL 1J8HB 1U8HB 3SDXB 3FRPG 3FQXA 4XHQA 1HHIB 3D85A 2JIXD 1RZKH 1AHWA 4OZHE 4KJWC 1DN0A 1NAKH 2B4CH 3FT2A 1GIGL 1KIPB 3ZE1E 3MRLB 3HI5L 3GMQB 2LVEA 1AI1H 5TE7H 4OFVA 2XICA 1CXIA 5C09A 5M95B 4K3HA 1JGVL 4FQ1H 3SQOH 1G9MC 1YPZF 2BSTA 1FZMA 1K4CA 1T7VA 3DUUA 4PBXA 1OM3H 3TBYB 3ZKSD 2R8SL 1I4FB 3P4NB 3VRJA 3VWKB 5ITBL 5F1NA 1JBJA 2X4UB 5GRZA 4H20L 3CLEL 4QRTB 4U05A 1EPFA 4RRPA 3VRLE 4HWUA 4ORGA 4JN1H 1NPUA 4K71B 1JL8A 2JJSA 4WCYH 1DDHA 1UXSB 4MA8H 2NZ9C 2IAMA 1SHMA 3RWEA 1HKLL 3QT2A 3WIFA 1DEEB 4U6TA 3RJDA 2HMID 5E6YA 3QCTH 4XVJL 5EU5B 4GQ9H 2EIBA 4OLYL 4DGVH 4YK4C 2X10A 1ONQA 3BPOC 4QHNB 3IDIB 4LPXA 2YD8A 4P9MH 1EEYB 4J3SA 2YC1A 2F53B 2AXGA 3ECBB 3KPPB 4FQPA 1IT9H 1P4IL 2JB6B 2J5LB 2AKRA 2R4SL 1EUUA 4L9LC 4QHUB 4EI5C 2IH3A 4LBEA 1KJ2H 1OQOA 5DHVA 4ZTOH 5DDHB 2EDXA 5ALCH 2FZ3B 35C8L 2VDKH 4PGCA 4CU6A 3KLSA 3LQAH 1AFVH 1OAZH 5EB9A 1K3ZA 4HPYH 1KGCE 4JPKH 4DTGL 1JTTA 2H1PL 2XTJE 2CDEB 2YK1H 3ZKMC 5BRZD 5GS2D 3RGHA 2YRLA 3GSQB 1R5WB 4M1CD 1IEBA 3EYSL 2HFEB 4O4YH 5IB5B 3VJ6B 5HJ3A 1ZT4A 1QHOA 3DV4A 2V2XA 2Q6WB 4YUEH 3TFKD 2H3NA 1A7PL 3VFPA 1MJ8H 3WXVH 4PJAA 1OY3B 2IQ9L 3RZCC 1NGZA 4DVBB 2C7UB 1BJ1H 3VXTA 3VE0A 1GHFH 1E28B 3BIAX 3GSNA 5IBTL 4LGRB 4S1QL 1IGCL 5JHDD 3FAWA 3OAYH 3BGAA 4I3SL 2J8UE 2XRAL 1KJVA 2CDFA 4K94C 3V79C 5J06A 4JGMA 4WHYG 4QRPA 4Y4FA 1EJ6A 4ODHH 1NGYB 4Y4HA 4YDIH 3L5IA 5I75B 4YFLI 5C0BA 1INEH 4Z7WA 1EEZA 1CCZA 4ZOAA 4ODUA 5EOCJ 1MOEA 1T6WA 3TBSB 3H6JA 3X11A 4MMZC 1YEHL 5IIEA 4B7LA 4DOHE 2EKJA 3MJ8A 2FYYB 1JHLH 3ARGC 3K1KC 1QLFB 5CSZB 3QDJD 3OKKB 4GT7A 4F2MA 4HWEL 2ITCB 1DANU 4GRMA 2F54B 1CD1B 1DE4A 2LABA 1MJUL 3CC5A 2QLVB 3QXDA 1AO7D 2Z35A 3CUPA 3DURB 4P5TB 4QT5B 4U31A 2VR5A 4CJ1A 4LLMA 1YZZA 3DXAB 5J11B 5F7UA 3NTCL 1H3WM 2AVGA 2O5YL 4F9PC 3DRTB 2E7BA 1RZ7L 2VLRE 1UWGL 3BKYH 5DJYB 4M1GL 1S5IL 3PWNB 4M4RA 5FYLE 3IJHB 1NLDL 4OF5A 1FZJB 4OKVB 4BA8A 1TZHB 3HE7A 4QOKE 3Q2CA 3MREB 25C8H 5DD6A 4HG4K 4N8PA 4ZTPH 4BUHA 5I66B 1ZEAH 1VGKA 3ORJA 4PUBH 2L4OA 1EMTH 4HEPG 2Y06L 1YDPA 2W1NA 5CIPA 3B9KA 1UWEH 3RAJL 3VXRE 3RIFF 1INDH 4ZUTB 4M7LL 4PJDF 2EDYA 4HQQL 3SJVD 3ILPA 2VXTH 4K3JL 5CJOH 4RFEA 1TITA 4XCCL 3CK0L 1IJ9A 4Q6YA 1MCLA 4AMKL 5JORA 5BCAA 1UENA 2X1OA 3X3FL 1TPXC 3DPBA 2EYTA 3KJ6H 1DBAL 4Z7VE 2LU3A 3BP7B 5IB2A 4URTB 2PW2A 2XY1A 2DMKA 1CR9L 1UCTA 1FNEB 5DT1H 3QI9C 4G6FD 1RFDL 1BVLB 2VZ3A 4EXPX 4ONGL 1U91A 4MDIB 2YD1A 5DZOA 5EPMA 1KCRH 3ROLB 5DO2C 3PHOA 4KHXH 1AQDA 4EVNB 4ZSOA 2VLME 3F7YB 4MGXA 4WU7A 2HFGL 4L5FL 5CBEB 2B20A 1PQZB 2YN5A 5HYSB 2IC2A 4UIMA 3MCG1 1X4YA 3HMXH 5EUOE 4LMQE 2HRPH 1FSKB 4POZC 4ORZC 1WC7B 5BVJA 5F3BB 4PJ8B 1HYRC 4UNUA 4XNZB 3WKML 1D9KB 1KEGH 3DX6B 1KELH 2D7OA 1TTFA 4UUJB 3EAKA 5DD5H 4PREB 4NKQB 3HLAB 5JPNB 4S0SD 5EIVA 2NY0B 5F71A 4QF1B 1CFTB 4FZEH 1LMKA 1P53A 5EC2B 15C8L 3F5WB 3V8OA 4OGYH 3BUYB 5FK9A 2FGWL 5ESQB 4KJYA 1CT8B 3RWCB 4QHKI 3FFCD 1JN6B 1OQXA 4X5XA 4YX2L 1P4BL 4B50A 1FQ9C 1IILE 1XGPA 4HIJA 3O3AA 3STLB 2HFFB 3ZHLA 3HMWH 5D7LA 1RI8A 3NPSB 1KBGL 4BELD 2GTZA 4XBEH 4HCRL 3BPLB 4X4XA 3H3BC 4OF3A 1CICB 1IFHH 5ETUA 4G7VL 3FQTB 4MS8D 5HDLA 2F74A 1NUGA 1HHKA 1MIMH 1IAKB 4JZNB 3S6CA 4NC1C 3A6CH 2R0KL 2E7CA 4H88H 1H15B 1QFWM 5D7JB 4KI5E 4N8VG 4NQVB 4NQEE 2DI7A 3H7BB 3TO4A 5FAAA 3HE6C 1AXTH 3E6FB 2FGZA 2GSIA 3KPLA 5TE6H 1BEYL 3OZ9L 4ZUSB 4OCSL 2APVA 5AD0B 2FO4B 1Z9LA 1BX2B 3T2OA 4LLYA 5IGXL 3CX2A 3G04A 3HAEB 3QDGE 4LCCB 1T03H 1QD0A 3CVHL 3OGCA 1KN4H 1V3LA 3MRRB 3TCLA 4X5LA 1PW3A 4Q7DA 5BMFL 3PABB 3OR6B 5IJVA 3TIDB 2APTA 3WUZA 3T3PE 3CGTA 3N1FC 3S3PA 1AGEA 2ADJA 4HWBH 4NCC2 3X12A 5F97E 4BH7A 3WN5B 3QO0B 2DQTH 2W60B 4KJPD 1E4XL 5DFTA 3PWVA 1PD6A 3FO2A 5HHOA 5D2LE 5F7EH 4NGHL 5TQ0H 4XBPA 4UB0L 1CD9B 5L6YL 4XPAL 1N8ZB 2GK2A 2NXZD 4YEFA 1PYWB 4EIGB 1MHHB 1UB5B 2BXYA 3SGKA 3MV9E 4FQIL 3LPGA 4XMPL 2W92A 5E4EC 5C08E 4C54A 3IDMA 5DA0B 1MIEH 3U9UB 4X80L 3R8BB 5MENE 1U95A 4KZDH 2FIRT 4ZXBC 3VFRB 4OZHF 1FGNL 2Y36L 4JPWL 5FXCH 3ULVH 1I8LC 3ZE1F 5MEQB 1NC4D 3IJSB 4IIQB 2DLFL 4P4KA 1G6RL 2YHGA 5ADPH 4NFDA 5D6CA 5HYQA 2VSCA 3RL1B 4HV8A 3MGOA 1FNGA 1SJHA 2LV4A 3C6LA 4OLXL 1N6VA 1J0KA 3HFMH 1FYTD 1CDYA 4MNQD 1DFBL 4OSUL 5EOTB 3DSFH 1AGFB 3RZWA 4KKBD 1X4XA 3MA9L 2BY0A 5EOQH 3VRLF 3TNMA 5D1ZB 2X4NA 4LCUA 1UVQB 2LFGA 1KTDB 5IG7A 1FJ1A 3QDHA 1EHXA 2DTMH 4PRHA 1ORSA 1OTSD 5E8EA 3M17B 3O4LA 5IBLD 1JGUL 5J7CC 4NNXB 5GGUB 3K74B 1NFDB 2EYRB 1GL4B 1MRFL 3X13A 3LS5L 3NCEB 1YMMB 1G7HA 5I76B 1DQDH 5EU7C 2BVOB 4FQJH 1BOGB 2DQEL 3BKCL 4IRSA 3KPOB 4ZO7A 5C0AA 3OKMB 1WF5A 5TPWL 1MI5D 2XZCH 1FPTH 3O9WD 4WI2A 3G9VA 5DA4A 5C09E 4R9HA 4U6VL 3WXWH 2FNBA 3RQ3A 4PV9B 4YC2B 4OFKA 4W6YB 1AKJA 2JK5A 3RX5A 2KZ1B 3K1DA 2NY2C 3NZHH 3MNZB 4YHNA 3X3GL 2V5SA 4NQCB 3R1GH 5KSAB 2XA3A 4HPOH 5KSBA 4KPHL 2I26N 1K2DA 3RVTD 3L5HA 2NXYC 4NRZA 1AQKH 4TRPL 1LO3L 3JUYA 5MEPA 3WNNA 4N0FB 4HUXA 2XWJB 3GMLB 3LHPL 4J7RA 3DVNA 2GITA 2PXYA 2NX5A 3MZGB 5SX4H 4JRYD 4TNWF 1F6AA 3AS3A 1VADA 3C8HA 5LJYH 1NCNA 4FQQB 5CKAA 5IMKB 1FCGA 5DJCB 2J8UF 3IXAA 3BSZL 5J0BA 3SKUD 4U1JB 1HSBB 1MRCH 1NC2D 1YJDH 4LCIL 4RIRB 5HHXL 1E0OB 1T0NA 1XF3B 5ESVB 4IRJA 4NFCA 4KUCD 4ZOBA 3D69B 1J8HD 4WUUA 4RQQB 3H3PH 4D0CA 2VYRE 3IFNH 2GKIA 1F6LL 1A7RL 2V9QA 1JWSB 2H32H 2QR0A 3K7UA 3WE6B 3HC3L 1M1SA 1KIRB 1OT2A 3PGFL 1KPVA 1WCBB 4GLRH 3NABH 3Q5TA 3QPQD 3S8WA 4KRPB 2ZCKH 2R0ZL 3T04D 3V0AC 12E8H 1B6UA 1REIA 3V2AR 4P2RD 4LGPB 3BZ4A 5C0EB 2AERT 2VXQH 1UYWH 1F90H 4H1LB 4PJAE 4X6DA 2OXHA 4JFPB 4AT6B 5CP7A 1OAKH 4YK4B 2V6HA 3BDYH 3E8UH 5FV2A 1RIVL 1JWMA 3BT2L 2ZCLH 1YECH 4PS4H 4QRPE 3LQZA 4LQFL 2F53D 5C0BE 5FGRA 1ZGLP 4Z7WE 1MVUA 1FBIH 2QQLL 5A2IH 2EDKA 5L8LB 4N0RA 1Q0XH 5IW3A 1R24B 2JIXA 1KSRA 3GSXB 5C6PB 5DK0A 3FOMA 1IKFL 3QCVH 2NTSP 1I7RA 4Z7VF 1CGVA 3HG1B 1NCCH 4HSQA 5L7XL 4Q2ZA 3I02B 2V7NA 5GS3A 1TCRA 2DQHL 4JFFB 1ZHNB 4I0PC 1I9IH 2UZIL 1ZS8A 3IVKA 3V6ZB 5FM8A 2BVUA 2PR4H 5IEKB 4YHMH 5D70L 1VGEH 4I48A 1U8OB 2HJFA 3Q5OA 2EH8L 5L9DL 1G7PB 3OMZA 2OXGA 3NCCB 3RZCB 5ITFA 3QIUB 2QHRH 4HKXA 5DJ0A 1HOCB 1FFNA 3JUZA 1P1ZA 4NQTA 3TIEA 1V8HA 3D18B 5D93B 3ZE0E 3TH4T 1XIWB 4Z0XB 4U6YA 4HCRA 1J0YA 5EUOF 1HKFA 2OZ4L 4P9HH 5I9QC 5GGRA 3LKSB 1BPVA 3CFIC 4DZ8B 4ZQKB 4HS3B 1IGIH 4QXGL 1OAUL 3SCMC 2DI9A 4M6OH 4HBCH 1W0VB 3PWPD 3PWJA 4ETQA 4PRBA 1NEUA 5LGJB 2Q1EA 4HLZH 1LO5B 4E9LA 4RGNB 4PJIA 1PG7H 5HBBA 3BZEB 4MJ6A 1F3JA 4X4YA 3ARGB 2I5YH 1CI5A 1Y18B 2XWTA 2ZSWB 4Z18A 1IKNA 1Q9LA 5C6TL 2X4QA 2BJML 2PUQT 3HB3D 4PD4J 5E56A 4U1IA 1KFAH 5CILL 4F7EB 1G9NH 4I77L 3S37L 2F54D 1KENL 3LKNA 1WT5C 3H2WA 1R0AL 3P0YL 3D3VA 4P5TD 1L7IL 3CVHA 4OLVH 3ABZA 3DXAD 1M6OB 4ZSOE 1LVEA 5BRZA 2NY7H 2DBLH 1J8KA 3LKQB 3WUWA 1I9JH 3I6KB 3T2QA 2A2QT 4KKLC 4JANA 5H35B 3GHBH 1TZGL 3T1WA 3ARED 2B2XH 2E6QA 3QQ3B 2B0SL 5I8OH 4MAYA 3CFKA 4KI5F 5FYJH 2WBJC 3RY5A 5JHDA 2VXSH 4N0CD 1BFVH 1K4DB 4KTEL 5HI4D 2AGJL 3E2HB 4YO0B 3MRCB 2UVEA 4XWGH 1A6UH 1GAFL 4YNYA 1TPXB 1QFHA 4A6YB 4DGYH 3UTSB 2F8XC 3VG0L 3RU8L 2L7UA 2DLGA 4XXCC 1I8MB 1RIHH 5HVHC 5J1SC 4G9DA 1N5YH 5B38A 2X1PA 4XAWH 5F9JA 3QDJA 4JQXC 3V9FA 2DTSA 4PY8J 5CLWA 3ZYOA 2VL4A 5DRXB 3T3PF 5JQ6H 5D7LE 4PTTA 4HF5H 4EQ2A 5IMOB 4Y2OA 1AO7A 2WMPA 1VFAA 4FQXB 1TQCC 5BV7C 3DUHA 4F7CB 4M1DH 5D2LF 4YFDB 2XTJC 5HD8C 2NYYD 5HVGB 3BO8A 1FFRA 5I15L 5T33H 3SE3C 1QBLL 1NBVL 1H5BC 3GIVB 1BVKA 1YEFH 4PRPB 3WV0A 2A9ML 3FN0L 4KKNA 3V5HA 4CKVX 3PV6B 4TOYH 4PGBB 1JNLH 2W07A 3AY4A 2YD7A 4PJ8D 4XP5L 2A9NL 1JYVA 1D9KD 4LRNL 3A67H 1G7IA 1VACB 1ZWIB 4G3YH 3WYRA 2PYFB 4AENA 4LOUC 3CFEB 4JM2B 2FO1A 4LLAA 2OX5A 5D1QD 2AK4B 4GAGH 2A73A 1UXWB 5GS0H 4KAQH 3MTRA 2FJFA 2ZG1A 4AL8H 1IBGH 2Q3AA 2DDQH 5I1KH 2D31A 5DRNA 4JFXB 1UQSB 3EFDH 4XGZA 1WZ1L 4OF6A 4R4FH 8FABB 4XB8A 4MA7H 4H5SA 5HHOE 5KSVB 4GUPA 5H94B 1JZ6A 4R3SB 1HH9B 3WD5L 2R4RH 3OPZL 3WLBB 5C2BH 2XNAA 3WFEH 2G9HA 1FORH 3BW9A 1OAYH 2Z8VC 1PX3A 1YQ2A 3CMOL 1CICD 1MFAH 4NUGL 4HKBB 4N9GA 5JQHC 1A21A 4MQ7B 3VA6A 1O7VA 2P45B 1G9EA 3O2WH 3VH8A 4M7KL 2BVQB 4OCXL 2D3VA 4RISL 5D7JD 4JO3H 4I9WE 3OJDB 5DQ9B 4JKWA 5DWUH 1W8NA 3VMNA 3U0TB 4JO2H 1RHHB 5DEGA 2A6JB 2NY5L 4L4TB 5DGRA 2X70A 4GKOA 3LH2H 4M02A 5CS7A 1U8LB 4HS6B 2CO7B 2A6KB 1R3HB 4XCEA 4M3JA 3B8SA 4V2CB 1IE5A 3RNQA 1OGTA 2AJYL 4TSBL 2MJWA 4U6XB 4LF3A 3IU4L 2YN3A 4O9HL 1JZ5A 3AM8A 1H3PL 4OAWB 2XTLA 4PGEA 5GRXG 1MCHA 2EEDA 3MLZL 3LKRA 2QKIA 5CGMA 3LB6C 1AXIB 1CFNA 1MAMH 5J3HD 3VU2A 3KYMB 1YA5A 2CJUL 3QRGL 4J8RB 1NLBH 3T4AA 1JNNH 1JZ3A 1BWWA 3FFCA 3FO9A 3QWOA 3UJJL 1JRHI 4PRHE 1A3QA 4LKCA 5EZLA 3TVMC 2UUDK 1IM3A 5FGCB 4TQEL 3O4LE 3HR6A 3MRQA 3EJYD 2GCYB 3GFUA 2AJVL 1TMCB 2CK0L 2NY3D 1NDGB 1P7QD 4OCYH 2FLRT 4M03A 1DQTA 3HPJA 1EEQA 4PP1C 5IBUG 4NJAL 3P9MB 1FIGL 1T0PB 1ZT1A 5L8KB 1FN4B 3INUH 3VG9B 4MWFA 3CH1A 5E24E 2VR9A 4LNRA 3PWUB 1UH4A 5C0AE 3ESVF 3ARDA 4XTRC 4Y16B 4ZXBB 1JHKH 1UT9A 3E6HA 1S7WB 2JCCA 4RGMB 3STZA 1VKXB 2DKMA 2E7MA 1ZT7B 4OCRH 2O5ZL 4P23A 2V17L 1TNMA 3NVQA 1OCWH 1IARB 5TDNB 4MCYA 2BC4B 4K8RC 1RUAL 4X6CA 3O6MH 1YEGL 4JQIH 3BGMB 1ACYH 4EUPG 1N6UA 4K07A 1RZFH 1QRKA 1C12B 1U2HA 4TULL 1VFUA 3VXUA 3WL9A 5KSBE 2JJTC 3TYGL 3ARSA 1WBZA 1CFQA 1FC2D 1Z6JT 4PJ5B 4H8WL 1SVCP 2CR6A 3DRQA 5C70A 1L9NA 3MLUH 1SY6L 5KVDH 4XCNA 4X6FB 4M62H 4PJAF 2NX5E 4U6HB 4Z0BL 1C7TA 4FQCL 3FN9A 3C2SA 3DO7B 3O3DA 1WBXA 2RFXB 1F3DJ 2P5ED 3I3BA 5C0ND 5SWSD 1HYSC 3CZFB 5T3ZE 5FDWA 5E2VH 3IJYB 3K4AA 3SPVA 2PO6C 4NZJA 4G42A 2X1XR 4NM4L 1YMMD 2V5TA 1WAAA 3KYOB 5L2KB 3ZYJA 3RPIB 4FXKB 3SO3C 3LPFA 5D2NB 5DC0A 2Z91B 2V5YA 3GSRB 4WUUE 1ZSDB 1QOKA 2OZ4A 4Z7WF 2VIRB 3VFMB 1ZLWK 1AP2B 1A3LH 1WBYB 4KI5C 4WDIA 4PJDB 5CZKA 1CL7L 5GRUH 3TBWA 3EYOB 1U8QA 1DQJB 3DX9B 4RBPK 1I1RA 1EO8H 1SYVA 4ZDHB 1NC4A 1NBZB 5D96B 5E08L 4XVUD 4KTDL 2HN7B 5IFJA 4GAJL 4HC1H 3W9EA 5HGGS 2QSVA 4HFUH 4U33A 5AZEL 5FF6A 3OKOA 2BNUB 5D72H 4XRCA 1FYTA 2E8YA 1T1ZB 2YPLB 5HPOA 4NQCD 4ODXA 5KSAD 4WI5A 3BWAB 4F15B 4TTGA 4L8BA 1N64H 3FMGL 3HZMA 4X6DE 4XVJH 3HUJA 3UDWC 1FVCA 3P30L 3G08B 5GRJH 4DN4L 2JB5H 1J0HA 2BRQA 4Y19B 3ZE0F 1OVZA 4EBQL 3MBEB 1EHLH 3HI6L 3D25B 5T3XL 3QBTB 5F9AC 1MCPL 1BGXH 5J9PA 3D0LB 5ICYB 4JQVC 4NFBA 2KDGA 4CMMB 5DTFB 1YUHB 2RJMA 3MSPA 5EO1A 3QIWC 3NH7H 1OHQA 2Q7YB 4ZD3H 5MP6L 2BVEA 3IRZA 1MI5A 3VFTA 5DF0A 2IFFL 2GSGA 1OP5K 2WM0A 7FABL 4YWGH 4L8CA 2J2ZA 4M43L 4PY7B 2DJSA 4JKPL 4Z76A 2Y1VA 5C07B 2Q8BL 1Q9KB 4DAGL 4KRPD 4KK5D 2P7TB 4PG2A 1FDLL 4H0GA 5ADOH 1KJ2B 3O45B 1RU9L 1RZJH 3TA3B 2R29L 4GW5B 3GJEB 4UDUB 1HE7A 3TBVB 4E42B 4P5KA 3CFJA 4JPVH 1IAOB 4I3SH 2OSLA 1U3HD 3AMKA 4M6NL 2XRAH 1KCUL 2CLRB 4LLDB 4P48A 2QADC 2WV3A 2YKLL 5I1LA 2CSPA 4PJHA 4MHHG 4JRYA 3VFVA 5KJRL 1QSZA 3TJHC 3DMMA 3GRWH 1P9MA 4AIOA 3BPCB 3GGWB 2NW3A 1U3ZA 5CINL 1NC2A 2XKNB 2ZUYA 4PJIE 3TPKA 1JGEB 1XF4A 3OJ2C 5K9QG 3DI2B 4JJ5A 1AGDA 1NCBH 4RA0C 4MB3A 1BFTA 3EO0B 1AHWC 1EERB 5A40E 4UQ2B 3VMPA 1PGRB 1KIPA 3HG1D 4PLNC 3MRLA 1XF2B 4GRLC 3MYJB 4RGOH 5EZOL 3HNTH 5FOBA 4DKFL 3DECA 5ID1B 5DFVC 3ZKMD 3D3VE 2OP4H 1RZ7H 1MUJB 2EIZB 3EYFB 3O3EA 4PJ7B 5BRZE 4NQSB 1NLDH 1I4FA 3P4NA 5HXMA 2XFXA 2X4UA 1MY5A 5HI3D 4P2RA 4E41B 5CEZH 4RFOL 4YHPB 3AXLB 4G9FB 3QIUD 1JPST 3ARBB 2IAMC 4M8QA 1NBYB 3RAJH 3QG7L 3NFPB 4M7LH 1XIWD 4F3FA 4HQQH 2BVPA 3U0WH 5JHDE 2APWA 1MJ7L 5JW4M 2VE6A 4JY6B 4UTAL 4PR5B 1FGVH 2Q7NA 4NKMA 4MAUH 5FA3A 4GW1B 3WHXA 3KWWB 4QHNA 3OGOE 1BOYA 3S35L 2VDOH 4Y2DA 1LE9B 5I18H 2F53A 5I1IH 2Y5EA 4C56D 3OKDA 2G2RA 4RGND 3U6RA 2OR9L 3O6FC 2AJUL 5B39G 1CR9H 2JB6A 2R2EB 2E7HA 2NY1B 1GZPB 4ISVB 4IRZH 1RFDH 4NBYB 4IOFD 1MF2L 3C5SA 3JTSA 3QDJE 1BAFL 1RAMA 1X5JA 1KLGA 1PY9A 5ID0B 5DDHA 4UQ3B 4DW2L 4JVPA 1LP9A 3RIFK 3VD9A 1HIMH 4P4RB 4BSWB 4PG9B 4Z95H 1AO7E 4XBGB 4GBXB 4LFHD 1CG9A 3CSPA 5KW9L 3F6LA 2CDEA 4QXWA 1U36A 4GMTL 2DWEB 3GSQA 3GSOB 2HFEA 4GFTB 3VJ6A 5F89A 3FONB 2DIBA 3S4SA 3VXSA 2Q6WA 3DV6B 5EBWB 1JF1A 2J6EL 3THML 1R5VA 2GHWB 3MV01 2WBJB 1ES0A 1JF5A 1EK3A 1MJJB 3Q1SL 4KUZH 3QXVA 2EDBA 2P8PA 3VXOA 4DVBA 4NO0B 3E3QE 2FR4B 1E28A 5F3HA 2K3TA 1DCLA 5GGQH 4XC3H 1QRND 5IESL 1LILA 4IMLB 5FUZH 5GHWL 4I4WB 43C9B 5KSUB 3VGBA 5C0DB 5LGHH 4Y4FC 3PWPA 1KJ3H 5I30L 3LS4H 4Y4HC 3MLSL 2C26A 2VAAB 4PV8B 5I1DA 3UTSD 3UMTA 5IB3B 4LEXH 4N1CA 3TBSA 1D6EA 4YHKL 3O2VH 4I3GA 1X6NA 1A0QL 2FYYA 5JW4N 5CSZA 1A1OA 3G6AA 3OXRA 2ITCA 4NWTL 2XTJB 4K7PX 1BQUA 1NUFA 3S34L 2ED8A 2XOTA 2R2CA 1KOAA 4QT5A 3DURA 4P5TA 4DCQB 4FQXD 1J0IA 3G5XA 2YR3A 4LHUD 1H5BB 4HKZA 5HGHB 2OM5A 1JI1A 5BXFA 3GMMA 4KK8C 3MLRL 4JFEA 5IVZB 2VDLL 4PRPD 1M7IB 5TDPA 2A83B 2A1WH 4O2CB 3C5ZB 5IOPA 3HE7C 1ZTXL 1MHEA 1FZJA 3AREA 4OKVA 1WWAX 4NUJA 2B1HL 3QULB 2J8UB 1A7OL 3MR9A 5IMMB 4ELMB 3B9KC 2BNQA 1WISA 1UWXH 4KH2A 1I7TA 3QFDB 1R3LB 1Z5LB 1CGTA 3KPSA 4JM2D 3VD4A 1QNZL 2Y6SC 3KYNA 4ALAL 3KNBB 4YDJA 2VH5L 4U1GC 1RK0B 3C2AH 3KXFD 2F19H 1QG3A 1L4IA 4FQHB 3KYKH 5KSBF 4J3TA 1ERNA 4ODTL 5ACZB 3FFCE 3U30C 1KC5L 1R3JB 1DLFL 3BX7C 2UYLB 4NWUH 2IPKB 1FNEA 3V5KA 2DKUA 4HH9B 4K3DH 2YUVA 4ZUWA 4YFEA 1TIUA 32C2B 4DZBA 3MRDB 5C0IB 1TLKA 4ZMAT 5LQBH 4NN5C 3LV3B 5B4MD 2VLRB 1GGBL 3ROLA 5BV7H 2CKBL 2GK0B 3O2DL 4HDIB 3MFFA 1NANI 4EVNA 5F9WB 2YRZA 4BZ2H 1PQZA 4QOKB 3UC0L 5HYSA 4YDLC 1FE8H 1WITA 4APQC 1WWCA 3C08L 4C57C 2JCCE 3WLWC 2FSEB 5BO1L 5D8JL 3JXAA 1G6RH 2XA8H 1Z9OA 4P3WA 5GSVA 3VXRB 2D03L 2IGFL 4HZLB 5DD0L 2RHEA 1EH9A 2VTFA 1D9KA 1U8MB 4OQTH 2OQJA 4X6CE 2OTWB 1NH6A 1X9QA 1JP5A 5C86A 3MRFA 2OL3B 3NGBC 4M6ML 4LEOB 4FXGB 2R23A 4QF1A 5F7DB 1CFTA 1EJOL 1IZKA 4Z7VB 4FTVA 3VXUE 2YUXA 1GH7A 4X9HA 3BDXA 5D1QA 2A6IB 2IF7A 5EC2A 1DQML 3BUYA 4MSWA 4LK4A 5ELIA 5ESQA 4ZNEA 1L0XA 4U3HA 1CT8A 4X6DF 4LCYB 3P77A 1D5ZA 1BQSA 3TWCL 4HK0B 5E8NB 3RVWC 3SGJA 2H6PA 2OCFD 3BMVA 3UTZB 2ENYA 5FUOH 4UIKL 4C83B 1WAAE 2YPVL 1DQLL 1RJYB 3U46A 3NN8A 4OLWL 4RMVA 3V52L 3FQTA 5TPWH 2H41A 4MNHA 4FNLL 1IAKA 4YBQC 4M7ZC 4JZNA 3BGFC 5DJZA 4Y16D 2EYSA 1A7QH 1GC1L 3BJLA 2RGSA 5D7JA 2C1OA 4KZEL 3DVFA 1DBKH 5CJ5A 3H7BA 4LAQL 2VZVA 3KLAB 2ZZUT 1LO2H 1UWXK 3RTQA 4X5WB 4F7TB 4ZUSA 3PNWB 3V4UH 1PZUB 3T0ED 4HMEA 4WO4A 2R1WB 1FYTE 3S35X 3CIQA 3BN9C 4OM0H 3KJ4C 1CFSB 3L3JB 4S2SA 3QA3A 3IAQA 4LSVH 4PJ5D 5JW5A 3HUJE 1MWAH 3MRRA 4D9QD 1I9RH 3AAZB 5FGBA 1ZHBB 2IH1B 4M9PA 1MSPA 1JZ4A 1C16A 2IPTH 2QQKH 3WN5A 3SO5A 3QEGL 3T2NL 2PO6B 1G0YR 5HHXH 2BCKB 1JFQH 1J5OL 1J1OL 4OM1L 3SO3B 5ICZB 4JDZA 3HZVB 1P7QA 1DR9A 5IFAL 5KN5A 2W59A 4QKXB 3K2UL 5L2KD 2V9TA 3TT1H 4PRDB 3ZTNH 3SGKC 4POYA 3MRIB 3V0WH 1ETZB 3BN3B 4UT7L 4PJIF 1QPXA 2APXA 2CPCA 2KZWA 5F44A 4X9GA 2KL6A 2OTUB 3TYFB 5E5UB 1LO0L 1ZV5A 1MI5E 2J88H 5JMOC 3PGFH 2E27L 1OD7A 3ILQD 3UZVB 4KVCL 2FH8A 4TNWK 1HEZA 5JLZB 4LAJH 4EDWH 2DLEA 1T80A 4P4KC 2MPAH 3AGVA 3L3KB 4L3AA 3IU3B 1DSFL 3QDGB 3RL1A 3FT3B 3C6LC 2W9EL 3WUWG 2LTQC 4ZOEA 1PAMA 5HPMA 4I5BB 4QHLB 5IHLB 4IS6B 3EO9L 3V6OA 1ADQL 1RVFL 1AGFA 1Q1JL 4R97C 1C7SA 5DUBA 5E6ZA 3BXNB 4YGAB 5HYIA 4IOSD 1A2YA 2BRRL 5DGQA 2Z4QB 3AS0A 5I2IB 3GMPA 4LLVA 2R2HB 3C87A 3EOTL 1OP3K 1E4WL 4PJHE 1A9BA 3K4DA 4LLWB 2Y4SA 4Y19D 4JRYE 4NO2A 3RWIB 1T66C 5FB8A 1LEIA 4QRSB 1MCOL 3U83A 3MBED 1F02I 2P5EA 1FH5H 1T2XA 5SWSA 3QDMD 3GI8H 5F7HA 1IAII 3DGCR 5EN2A 1YNLL 3GHEH 3MV9B 3QIWB 4HLJA 2L7JA 1YMMA 3NAAL 3OBAA 4LCWD 3P4LA 1F8TH 4IRSC 2B1AL 1CFVH 3KPOA 3ZKND 4QEGA 4X8JA 5B38G 3OKMA 5KVFH 2YUWA 2NY6C 4NO5B 3MJ6A 1PEZA 3JV4B 3ARQA 1JPTL 1ZA6A 4QCIB 4L3EB 1BF8A 2EH8H 4UDTA 1ZANL 5EU6A 3HCVA 5L9DH 4HIXL 4TYUA 4XWOD 3NCJL 5KVMC 1K85A 5FO9B 3CXHJ 4PV9A 2P48B 4NRXB 3E0GA 1S7RA 4OD1L 4JB9L 2I07B 4DGIH 2V2WB 4YBLC 4HUWB 4P2RE 3TA3D 4NQCA 4QY8A 2OMBA 4GS7C 1AY1L 5DXWA 4EN3D 3MLVL 3BVNB 4HS8L 3R0NA 4CMHC 1TVHA 4XPGL 3DARA 4QXGH 2XWJA 3C5JB 5FEBA 3X17A 2VXVL 2PXYC 5EO9B 2IG2L 2HKFH 3WIHL 5ALBH 4TVPH 1T1XB 3QHFH 1EA9C 4OFIA 1OP9A 5IMKA 4RMRA 4GAFB 5EH1A 2OBGA 1SJEA 3FQXB 1JZ8A 5L0QC 3D85B 2F53E 4OZIA 1HSBA 4IRJC 4XVSL 3MLYL 5ESVA 4MJID 2ADFL 1EFXA 5FYKH 3S5LG 3D69A 4RSVA 3FT2B 1P5UA 4RQQA 5CILH 3QUML 5I19L 4YXLL 3T65B 1U93B 1EZVX 4L8DA 3P0YH 1RUML 1IC7H 3UAJC 5CBAA 3UBXA 1QEWA 2BSTB 1LP9E 3VD7A 1FZMB 1K4CB 5FHAL 1RUKH 4B0MM 1YYLL 1MEXL 5FO7A 3VRJB 1PEWA 5HHMB 1PY4A 1HNGA 4X98A 1QA9B 4KVNH 5CZVL 4ORGB 3O11A 1DDHB 5IP4A 5IHBA 4CW1B 5E1AA 2IAMB 3D5OF 1KN2L 3VXSE 2F5AH 3G5VA 3MLXH 1HHHA 4E41D 3VH8G 2NTFA 3WIFB 4G9FD 3SE9H 2MQ0A 3ARBD 1F2QA 1U3HA 4WI3A 3LN9A 5KVGL 3IETA 2BHUA 3O2DA 1MLCB 4F57L 3B9VA 3W2DL 1PKOA 1JE6A 5HTSA 1FNSH 3HNSL 2AXGB 3I6GA 4G6AC 5IBUB 3MPCA 3PWPE 4M7JH 2VDML 1QHPA 5L88H 2X9XA 2IH3B 4LBEB 1PFCA 5DHVB 4P2QA 4DN3H 2NY1D 5LKNA 5I17A 2ZPKL 4Z7UA 2WLZA 3DHJA 4R96A 5E2WL 3CLFL 4PBWD 1FL6B 1I3GH 1IEBB 2DD8H 4WNQB 3RHWF 2AP2A 2EKSA 4GBXD 5IEKA 5HJ3B 1YEDA 3HHRB 1ZT4B 2EZ0D 3DV4B 2V2XB 1V7NL 3MOAH 1U8OA 2H3NB 4LVOB 5ISZA 3B9EA 4FQLL 4MQSB 1U3YA 4PJAB 1J1PH 1ZLSH 4YDKH 4Z7OE 2DQIL 4YHYC 2DBJA 1NGZB 3I2CL 3VXTB 3VE0B 5T1DL 3C6SA 3GSNB 3U7AA 4XP5H 4OFYD 5E6IB 4PLOB 1J87A 2JCCF 3M1BB 1XIWA 2DN7A 1CDBA 2HMIC 1KJVB 2CDFB 2BNQE 4H25B 4QRPB 4Y4FB 4G7YH 4HS3A 4Y4HB 1AJ7H 5C0BB 4ENED 4ONFH 1U8PA 1IGML 1GGIH 4X6CF 3X11B 5IIEB 4C56A 3MJ8B 4ACPA 1LO5A 2NCMA 3BZEA 2AEQL 1U41A 2YUZA 4F2MB 1Y18A 1IKNC 1IC4H 1RZKL 1TQBC 1DE4B 2Z35B 3CUPB 3CDCA 2NQCA 2B4CL 2Y25A 1KGCD 5D1XB 4LLMB 2D0GA 3PDOB 3QEUB 3REVB 1BD2A 1AI1L 5TE7L 3SDDB 4PYHA 4PD4K 3OXSB 3SQOL 3LN5B 5C0RL 1M6OA 1OM3L 4M1CC 4OCXH 1PDKA 3S3SA 4EUPH 3HE7B 5DD6B 1WAAF 4KMTH 3TFKC 1SEQH 1UB6A 4BZYA 4JN1L 3C5ZD 5IVXA 4WCYL 5CIPB 3ULSA 4KKCD 3B9KB 4OLZH 5T3XE 3GEWB 2CLVA 2OS7A 1U8IA 3N9GH 5KBNC 4RMUA 1XGTA 3ILPB 1DQQB 2KPNA 3P73A 1QRNA 4RFEB 4GQ9L 2YBRA 4FQ2L 4TUKH 5CEXA 3MRHA 3QUXA 3MRCA 4DGVL 4XNQB 3GJFH 5IHUH 3PGCB 2EYTB 4P9ML 4A6YA 4TNVF 4FTVE 4I3RH 3QRGH 5IM7A 4HUKB 3NA9L 1C5BL 5TF1H 4D94A 3UJJH 1IT9L 2RQ8A 4ZNEE 4K9EC 4NIKB 3U1SH 1KJ2L 2DYPD 3HUJF 3WCYA 4ZTOL 5I1HH 3BQUA 5EPMB 3OJMB 5ALCL 3MCLH 5DRXA 2VDKL 3RRQA 1AQDB 4ZSOB 4O5LH 2RAMA 3PQYB 1AFVL 1OAZL 4HPYL 1ADQA 4RAUA 1I85A 4JPKL 2UV3A 1VFMA 3H7LA 3X14A 4LHUA 3VRIA 4CVWA 3LOWA 2YK1L 4QWWD 2EH7H 4QOKD 1F11B 3HC4H 3DIFB 4YUEL 1T89A 3RL2B 2NPLX 5ABDE 3WXVL 1MJ8L 1UC6A 4UOW0 3PV6A 1UH3A 3AY4C 1RUAH 4HFWB 4PGBA 3VXRD 3RY6C 3E3QC 4Y1AB 1GHFL 3B2VH 3I3DA 5DJ6A 5IR1B 3SKOB 5C9JA 4JCLA 3P40A 3NGBB 2PYFA 2DQUH 2EDNA 4L8SA 1WWBX 2BOBB 4JM2A 1KF9B 4IDJH 3I9GL 3C09C 3DGGA 5FK9B 4ODHL 4LMQI 4N8CH 4YDIL 4KJYB 5JO5A 1SY6H 1CYGA 1INEL 4X5XB 1UXWA 5J6GA 3KXFA 4F37K 4K2UH 4UT6H 3VFOA 1XGPB 4GO6B 4HIJB 4CBPA 4NKOA 2M26A 2GFBA 3MUY1 3SQBA 1G1YA 1UQSA 4JFXA 1JHLL 5D7LB 1JJUA 5GIRB 2GTZB 3PL6A 3QIBD 5KSVA 4Q6IC 4R3SA 4X4XB 4PJHF 5J57B 2VLMD 2VZSA 5ETUB 2O93L 5K93A 2DQFA 2FECI 3TNNB 2W9DH 4ZAKB 1UCBH 1QFWI 2IBGA 3BKYL 1EBPA 3TO4B 4M5ZH 4KUCF 4K7PH 1MCCA 3WIHA 1XGRA 5J13B 1DUZB 3KPLB 1YEKH 3P3YA 25C8L 3OJDA 5DQ9A 3ZDZE 4ZTPL 1ZEAL 4PUBL 1EMTL 5FCUH 1KXQE 2A6JA 4XH2A 2KKQA 5MHSD 1HHGA 4J3XA 1OPGH 4XHJC 2W0FA 1UWEL 3G04B 2A6KA 1INDL 3BH9A 3WEXB 1W8OA 2VXTL 5CJOL 2ZOLA 4U6XA 3TCLB 4P3CH 3AM8C 1NAMH 5H37G 3V6OE 1PX4A 4JE4B 5C0CA 1CLZH 2OI9C 4I0CC 4H0IA 1AGEB 2ADJB 2B7DT 3P0GB 3KJ6L 1IRAY 3PWVB 3FO2B 4GSDH 4EBQH 5EWIH 2C9AA 1W0YT 5E00A 4GJTB 1HYSD 4XNXH 4XBPB 4RMWA 3KPRD 1MCPH 5DT1L 1KPRA 3STBA 3GZKA 5GISH 2P5EE 1CZ8H 5SWSE 2GCYA 4GRWE 2BY2A 5SX5K 1KCRL 1FFQA 5KAQG 1YMME 4KHXL 3WFHB 5IT2H 2VB5A 4MS8C 3V4VH 5MP6H 2LE9A 2IANB 5KAQF 4CJ0A 2DQJH 3R0MA 1LEGB 5FV1L 1U95B 3PWUA 2P44B 4PIRF 4Y16A 4XP4H 3C8KA 4M43H 1QTYT 3HMXL 2HRPL 2W0KA 4P4KB 1ZT7A 1TENA 3BD5A 3WS6A 3V4PL 5HYQB 3ZKQD 4O02L 4HV8B 3C9NA 5EU6E 2GUOA 1KEGL 1KYOJ 1LP9F 4PJXA 1NKOA 1KELL 2F58H 1FO0H 3FO0H 3T0EA 1KJMA 4YBHA 3WNOA 4Y8AA 2X4NB 3S4SG 4NQCE 5D4QA 4FZEL 3IGAA 3M8OH 1A64A 5GJSH 2YKLH 2ZUTA 5IG7B 1FJ1B 1NL0H 4KRMB 4PJ5A 4PRHB 4OGYL 1ORSB 5E8EB 1URLA 5KJRH 3GNML 4X6FA 5JA8B 5ACMA 4JEGB 4U6HA 1EVTC 2RCSH 4G6KH 4KJPC 1S9WB 4NN7C 4DVRL 3DO7A 1G7HB 3HMWL 2AJSL 3BZDA 1FLRL 3EJZD 4XBEL 2NXZC 4EI6A 4OZIE 2ZSVA 3SKNA 2ICWB 3MV9D 3UYPA 4IRSB 1YEEH 5C0AB 2PN5A 1IFHL 5D2NA 3L3OB 5IHZA 3RPKA 3CFBA 1MIML 1A02N 5EZOH 1KCSL 2AJXH 2WWMD 5C0JA 3VFMA 2HVJA 3A6CL 3ULUH 4H88L 4BQ8A 1AP2A 4X7SH 1WBYA 3NIFE 3EYOA 4DFHA 3BUTA 1S9YA 1T6VN 4L3ED 6CGTA 1AXTL 2JK5B 4ZDHA 4DJMA 3DYMA 3NFSH 5F93C 3VFUA 3GBNH 5TE6L 4YHNB 2H8PA 3B6SA 5CD5D 1W72H 2ARJB 1K2DB 4GS7B 3IS1X 2QV2A 4NRZB 3RI5F 5MEPB 1T03L 4AZ8A 3V8CA 4HUXB 5JW3H 4KKBC 4PRID 3BWAA 5EA0L 3DVNB 2PXYB 4PY8I 4Z7OF 3DLQR 1F6AB 4PGDB 3G08A 4Y4KB 4ZFOB 2VSDA 4JZOA 2AV1A 4HWBL 4YPGA 1OTSC 4Y19A 2DQTL 3WNLA 5L0QB 5F7EL 3MBEA 5IBLC 4IRJB 1KACB 2NMSA 2OR9H 3IT8D 4U4BA 5TQ0L 3QDMA 1WSST 2VUOA 4WUUB 1FLTX 3D85D 2QSQA 4D0CB 4U3CA 1N0XH 2WIIB 4LCWA 4P2QE 2ZUXA 1KNOA 5JOEA 1U92B 3VI3E 4HZAA 4Z7UE 4LSQL 5IWLA 5EBLA 3OKNA 2N1KA 5ENWA 2B5IB 1KPVB 5I0ZA 4KZDL 3A6BH 3P4MA 4GMTH 3ULVL 5HHMD 4OF0A 5FM5M 1S7SA 5ADPL 1QSFB 3D9AH 1XGUA 1D7FA 3BZ4B 4PPTA 5ISZE 4PG2C 1Q9KA 2J6EH 5T5FH 3QUYA 3FB7B 3HFML 1KJ2A 4X6DB 5HYSG 1T5WA 3SDYH 4K23H 3DSFL 3Q1SH 4GW5A 5CP7B 3H9YA 3TBVA 4ZS6D 3QNZB 3RVTC 4EN3A 3LCYA 5IESH 1JWMB 5EOQL 8CGTA 1QYGH 1ZE3C 3UTQA 5E2UH 2CLRA 3B8YA 1FIEA 3LQZB 3EUUA 4ZFGH 4Z9KB 4HMCA 4YHOH 1FZKB 3MUZ1 3E1F1 5C92A 4X99B 3BEWB 4J23A 1P9MC 1PVHA 3ZSSA 1G7MA 5T3ZH 3ZDYE 1CXFA 3GGWA 4C56E 4RGNE 1Z3GL 1JGEA 5AAWA 4MJIA 1DEDA 1DQDL 5HGDA 1I7RB 2D0FA 4FQJL 3IAGC 5TFSH 3EO0A 1TCRB 1LD9A 1EGJH 2M1KA 4YEEA 1ZS8B 3IVKB 5JW4R 2CMRH 2XZCL 1XF2A 1BD2E 5ID1A 3NBNA 4I48B 1HCVA 1LWRA 4LPCA 3WXWL 4LRIC 3EYFA 1MUJA 3QPQC 1KCVH 4PJ7A 4YHYB 5I8KH 2KBGA 5IQ7H 2P8LB 5DJ0B 1KLFA 4YHLH 1P1ZB 3NZHL 1DJSA 1XCTB 4L4VB 4E41A 3MODH 1CDCA 1I3RA 3R1GL 4K71C 4U6YB 4HPOL 5IVXE 4G9FA 3D39A 1PJ9A 5DJ8A 3ARBA 5GGRB 4U49A 1AQKL 1NBYA 5E6ID 5T1KB 3NFPA 1QVOA 5DMIH 3B2UD 3UP1A 4BFGA 2IBBA 3BKJH 3P4OA 3PWJB 1QRNE 4QRPD 4Y4FD 4JY6A 2VH5H 4ETQB 3L95A 4PR5A 4KROC 3TH3T 5E03A 3KWWA 1CXEA 4MJ6B 1F3JB 1YY8B 4CDHA 2E7LA 1LE9A 2XWTB 1MRCL 1FNAA 5LG1A 1YJDL 2X44D 2X4QB 1DLFH 2NY5C 3SY0A 4XNUH 4HJ0D 3H3PL 5DD3H 1IMHC 3LKNB 3KS0J 3RWHA 3D3VB 3IFNL 1KCLA 1ZXQA 5D1XD 1B0GB 3CVHB 4HMDA 4JAMA 1GGBH 3TF7C 1LHZA 2CKBH 4P4RA 1HI6A 1I7UB 3SDDD 2VDNL 4PG9A 4XBGA 1GOFA 3VI4E 4JKKA 5FOJA 1ZA3A 4MD0A 3WUWB 1ND0B 4UNTA 4JANB 5GS0D 3NABL 1U8JA 1L0YA 2CGRL 3U36A 2BSED 4O51A 2DWEA 1NJ9A 4M48H 4U7KA 4Z7NE 1UA6H 4MCZA 4MAYB 3RVXD 1UYWL 1F90L 1I1AA 4JM4H 3U48A 1CS6A 1X5LA 1MJJA 5I71C 1DP0A 4J4PD 5BZWA 1OAKL 3H9SB 3QPXH 4N0YH 3BDYL 1CBVH 4OZGB 4YNYB 3ZDZF 4IMLA 2AABH 4M6MH 5EZIH 3DX7B 3MBXH 1YECL 4I18B 3KGRA 3OB0H 5KSUA 4DKEH 3IKCA 2ORBH 1DQMH 2J3SA 2VAAA 5I75C 5T1LD 4FZ8H 3HMXA 5B38B 3MOBH 1G6RB 3KXFE 5BQ7A 1FBIL 4X6EA 5F9JB 5JXAL 1ZLUK 4MNGB 4CDGC 1Q0XL 3RUGA 1B0RA 2N7BA 2WUBH 4X7EC 4N9OB 1HNFA 3MQIA 3QCVL 1AO7B 5J89A 1OSPH 3HB3C 3S96B 1NCCL 3MMEB 1H0DB 3OKEB 5TQ2H 1DQLH 2WQRA 3BO8B 4JDTL 3PQYD 4P5TC 5CUSH 5K9QI 2C3VA 2Y7QA 2XPGB 1RK1B 2PR4L 4YHML 4PJEA 5EO0B 5J11C 3O3BB 1BVKB 4W4OA 4MXWH 1VGEL 3ZDXE 5GS2H 4GRWF 1GC1H 4KY1H 1F00I 2QJDA 3V5HB 4XVTH 1T21A 3B5TA 5DI8A 4LAQH 4U2YA 2A83A 1BZ7A 3AREC 3WO4C 3C5ZA 3TPUA 2QHRL 4G8GD 1EIBA 1G7IB 1QR1A 4NDMA 1QZ1A 5BVPH 4Y1AD 4AENB 4P9HL 4ELMA 4N0CC 4E5XB 5HI4C 1NMAH 1R3LA 3RDTB 1Z5LA 3ZKXB 5IV2A 4Y5YA 2C4XA 3NPZB 1KUMA 1WIUA 3B9AA 2FIKA 3EYQD 5C0CE 2D31B 5DRNB 2W0LA 2FEEI 1P7KB 4XGZB 3UO1H 1PG7L 3RNKA 4UT9H 4BZ1H 2I5YL 4H5SB 6FABH 4GUPB 2YA1A 1EV2E 5E2TH 2CUIA 5FDYA 4XPFL 5D7LD 4G6JH 2DYPA 4OM1H 4XP6H 2XQBH 1KB5L 1RZ8B 2XNAB 1OB1B 1A22B 2G9HB 3GKWH 3BW9B 5FGCE 5IFAH 1NCTA 1KFAL 1X3DA 1G9NL 2VC2L 2BZDA 5C0IA 4N9GB 3RP1A 3ARZA 2A6DA 3LV3A 2A74B 5DJ2A 2NYYC 4HDIA 3VH8B 3CSGA 1MWAB 1B0WA 4Q9RL 2DBLL 3NACL 4ZAKD 1MFCH 4WY7H 4OZIF 1I9JL 1MPAH 3EOYG 4GOSA 3TO4D 4HWBA 3GHBL 2B2XL 1FSKC 2PTVA 4U2ZA 2BSRA 3NIGE 5JIKA 2D7PA 4UV4H 3UBXG 2EDQA 4PJ8C 3SDAB 4XNZC 1D9KC 2W9EH 5FYJL 1U8MA 2HTLD 5HHVH 1MRDH 2VXSL 3NIFF 4LF3B 4PJXE 3U4AA 3JTTA 2OTWA 3L5WB 5GGSA 3T0EE 3LKPB 2DIAA 2QKIB 3LKRB 4NCDA 4XP9H 3VW3H 4K94L 3QUKA 4LEOA 4FXGA 4DGYL 1DL7H 4U1NA 1MFBL 5D1QC 5DQDH 3T4AB 4YJZL 4PJ5E 5F9DC 4NOBA 3CCHA 4D9QE 1TZIB 1RIHL 1UKQA 5EZLB 1HWHB 4D2NA 3CFCH 4LASH 1IM3B 1HSAA 2YA2A 5I73B 1FRGH 1S7QB 4XAWL 2XXCB 1TXKA 3QIBA 1YNLH 3ARFB 1S5HB 3N1QC 5JQ6L 2HWZL 2DOCA 4HF5L 1MREH 1KT2B 1Q9OA 4M3KB 4TTDD 4MWFB 1WWWX 3CH1B 1MAJA 4M1DL 4GXVH 1CICC 1RJYA 3ARDB 5D2NE 1BIIA 3E6HB 2JCCB 3VGHA 1M05B 1FZOB 2IAND 5T33L 3FQRB 1QSVA 3UXFA 5LCVH 1Y6MR 1JPTH 2QHLA 4C4KT 1YEFL 4P23B 3FHQA 5DVOA 5D7JC 3O4OB 3VI3F 4OLUL 4Z7UF 4TOYL 4X6CB 1JNLL 1P4LB 4JB9H 3M45A 4RWHA 3ES6A 5BOZG 1NGXA 1Z9SA 2GJZB 3A67L 3BJ91 4G3YL 3SKJH 2ZJSL 3VWJD 3U4BL 3VXUB 4P59H 3WL9B 3PNWA 1WBZB 1CFQB 3MLVH 2ZUWA 2R1WA 5IB1B 4LCCC 1CXKA 4XPGH 5HHQA 5LGKA 4XCNB 1SM3H 5SV4A 4GAGL 3F58H 5J3HC 5GS0L 1ZAGA 4PLKD 4KAQL 2DJUA 3AAZA 4AL8L 1IBGL 4NN7B 2DDQL 2YXMA 3O3DB 1WBXB 3T2PA 5DVKA 1ZHBA 3EFDL 5E9DB 1QBMH 1V7MH 3WN5C 3SPVB 4Y19E 4CVXB 3KPRA 1YNTB 1I3VA 2WWKT 2BCKA 3EJYC 3MLYH 3TESA 3QDME 5E94A 5DRWA 5ICZA 4H26A 5C2BL 2NY3C 5DMYA 3SDCB 2EIEA 4KQ3L 1OAYL 1UZ8A 3JWOC 3MRMA 5C0AD 4YXLH 4LCWE 2DJ4A 1MFAL 3MRIA 1RUMH 3K0WA 1PG7W 4NYLA 3O2WL 1U8QB 1MEXH 4ZPTB 2K9UA 1SYVB 1F4XH 4JO3L 3ZT6A 4ZUUB 5IKCB 5IFJB 1B2WH 5DWUL 3W9EB 2WAHA 5DMKA 4JO2L 3MA7B 3OKOB 4LFHG 1RJCA 1FYTB 5HGAA 3LH2L 2F5BL 3IU3A 2WNGA 1N2RB 3EGSA 2VKWA 3SEPA 3PP3K 4L8BB 2I25N 3J8F7 5IMLB 2E3VA 3HUJB 3V6OC 1GPOH 3GB7A 4X8XA 4PLJD 2PXYD 2X1WL 1MAML 2H32A 2VISB 2Z4QA 3GI9H 4Y4KD 3HNSH 2R2HA 1NLBL 5IVXF 1JNNL 1MCNA 2SEBB 4LLWA 2FEDD 5J9PB 1OT1A 2VQTA 4QRSA 5HDBE 5C0NC 1NUNB 1XR8A 1YN7B 3VGDA 4LLQA 5EO1B 4JFYB 4OCYL 4FA8A 1U42A 2VNCA 3S88H 4MJIE 1SJXA 2HT3D 4KGJA 5JIHA 3MV11 4I8DA 1WICA 1MI5B 3INUL 1WFOA 2GSGB 3CLFH 3FRUA 1FNFA 5C0FA 4L8CB 2YOCA 4IHOA 5JOFB 1WV7T 4NO5A 3JV4A 5IUSA 1TETH 4OCRL 2AW2A 2P8MA 4M5YH 4QCIA 4L3EA 3B5HA 3H42L 4FQLH 4XVUC 1UM5H 2EC9T 1GZQB 2ZCHH 4LHUG 1QSFD 4PJ7E 5I74C 4P5KB 3CSYB 4S1RL 5T1DH 3VI4F 4JQIL 1DBJH 3CXHK 2NLJB 2D4DA 4LPWA 2V2WA 1RZFL 4E41E 5KSAC 3HC0B 3ARXA 4G9FE 3D39E 1BQHB 4PRIA 5I1LB 4Z7NF 1J05A 4OFDA 4W81A 4CUCA 3BVNA 5EFIA 3VFVB 1KEMH 3MLUL 1A1NA 5KVDL 2IWGA 3DMMB 3RWFA 1D5XA 5J1AB 4M62L 4MQXD 4CU7A 5JHLL 3GUTA 1MELA 4LLUA 4R7NB 4MLSA 4XC1L 4G6MH 1T1XA 1XF4B 4LSSH 5AYQA 4JJ5B 1AGDB 2VL5A 5E2VL 2OJZH 1MCRA 3BPNB 1C1EH 4OF7A 4XZUB 4JM2F 3NFNB 1KLUB 4L29A 1CGUA 2X6MA 2COQA 5EBMA 2AEPL 2DS4A 5T5NF 4HUMB 3UTPE 5FOBB 5CP3H 4ZFZA 1K9TA 1U93A 3T65A 4OZFH 3ARUA 1A3LL 3JV6A 4ZFFA 1JZ2A 2ZUVA 4Y5VB 5GRUL 3OKLA 5C0RH 3O3EB 3CNKA 3MGTA 3MNVA 4HWZB 1EO8L 2XFXB 4JFDA 5HVWA 1IGYB 1QA9A 4HC1L 3FO1A 2P47B 4P2RB 4KRPC 3VXQB 1N0LA 4HFUL 4KK5C 5KANG 3TC9A 5D72L 2ZNWA 4M8QB 4L9LA 4CW1A 2F15A 4L4VD 3ZDXF 2VLKA 5F6IB 4F3FB 4AEFA 2BVPB 1N64L 1U3HC 2DWDA 3KLHD 2VE6B 3MUGB 3W5NA 4FQ2H 5T1KD 4BFIA 3WFCH 4KI1A 4NKMB 5FA3B 5GRJL 3WHXB 1W0WB 3EHBD 4KROB 2JB5L 3QJHA 1R3IH 1MLCA 2MCPH 2XN9A 3OF6D 4FG6D 4Y2DB 2AV7A 3OKDB 4OBSA 2G2RB 1EHLL 3NA9H 1C5BH 3U6RB 1MNUH 1E4XI 1P84J 1INQA 4KDVA 1BGXL 2ZUQB 3C5SB 2OJEB 3JTSB 3WHE1 1KLGB 2IMMA 1XH3A 3RUGE 3NH7L 2E5EA 1I1YA 1LP9B 4G5ZH 4KC3B 4C58B 4ZD3L 3D3VD 5DVLA 1CG9B 1GVIA 1OW0A 1YQVL 4LVEA 2LQRA 4YWGL 3MCKB 1FL6A 2GJ6A 5M7QA 2Y5TA 4WNQA 5FKAA 5CZXC 1S78D 5L8JB 5F89B 5DYOB 4QNPE 4PJEE 3S4SB 4DUXA 3VXSB 2K1MA 1JF1B 3V6FB 3QXWA 1R5VB 1SMAA 5ADOL 1ES0B 5HI3C 1RZJL 4MAYD 3VFSB 4KJQD 3VXOB 2P8PB 3SE8H 3UPCA 5I71B 3QIUC 5F3HB 3FCTA 4JPVL 2EDHA 3WJLC 5D93C 5E6IA 1XIWC 3M1BA 3P2TA 1EAJA 3H9SD 4ELME 3NIGF 4AEIH 3PWPB 4O00A 3I9GH 4H25A 1QACA 5I1DB 5JIPA 2VXUH 3GRWL 5E5MA 3L5JA 4PJXF 2CRYA 2X5PA 1JWUB 1S9XA 1PZ5A 1Z0MA 2AJ3B 1D6EB 4TUJA 4W4NA 4RGNC 5F70A 5F72S 5EORH 4U1HA 1YYMH 1A1OB 2PYED 1NCBL 3G6AB 4C59B 3QDAA 3OXRB 4IOFC 4V1DA 2R39A 3QUZB 1JGDA 5D1XA 4R4BB 1MCJA 3G5XB 4Q74A 1UFUA 2XZZA 4RGOL 3PDOA 3QEUA 3HNTL 5E7BA 3REVA 4HKZB 4MZ3A 2WANA 5BXFB 3SDDA 3GMMB 2ADIA 5F9OL 2OP4L 4K7PY 3OXSA 4ZFOL 2LU7A 3L3GA 4JFEB 3LN5A 1BHGA 4JDVA 3CZJA 5TDPB 2D4FA 1IM9D 5IOPB 1RD6A 3T0BA 3AREB 1MHEB 3WO4B 4JVWA 4NUJB 3WS3B 3GMOB 1NGQH 3MGAA 3LEYH 5CEZL 3PF2A 3V95A 3MR9B 1Q94B 2BNQB 4PGJA 3HTLX 4BQBA 1I7TB 4J4PA 1VESA 3KPSB 3U0WL 2DKSA 1DQQA 5FYKU 2HH0H 3KYNB 4YDJB 3E2HC 3RDTD 1FGVL 1AE6H 4MAUL 3GK8L 4XNQA 3T0AA 4E0RA 3PGCA 4RNRA 2VDOL 2VDPH 1UKTA 5DD1H 2CUMA 5T1LA 3HI1B 5I18L 5I1IL 2CXKA 4W6WB 1B4JH 3WDIA 4S1SH 1HXYA 1A9EB 3CJJA 4AG4H 3ULVE 4IRZL 4EOWH 3V5KB 4ZUWB 5DFWH 4DZBB 3BAEH 1X5HA 3DETD 3SN6N 1NDMA 1A5FH 3MFFB 1HIML 4NKIH 2XKUA 3FQWB 4YXHL 4Z95L 3PQYA 4RWYL 4FQXC 1I85C 1B90A 4WEUD 3WFDL 4AEEA 3IFLH 4I2XB 4OI7A 3AROA 4OGAD 1F11A 1IGJA 3M07A 5GSVB 3V4PH 3DIFA 3KHOA 4Z6AT 1T89C 4O02H 4XPTL 3RL2A 1SYSA 3QB7C 4G8GA 5E8DH 4XHJD 2OQJB 1DBMH 4P46B 4HFWA 4KUZL 3SDAD 3ZO0A 2DICA 4Y1AA 5DLMH 5B22A 5MHSE 3CU7A 5IR1A 5GGQL 3SKOA 4XC3L 2E9BA 3MRFB 5FUZL 3LEXA 2R23B 4FTVB 4ZPVA 3RKPA 4OB5L 1ZHKB 4JM2C 5D1QB 5E4IA 5E95B 2BOBA 5K33A 5LGHL 1KJ3L 4PTUA 3LS4L 4MSWB 4NNPH 5EU4B 2OLDA 2XIDA 3GNMH 2I60H 1Q38A 2J12B 3FB6B 4LEXL 4AEHH 3P77B 3WBDA 1D5ZB 5FECB 4DVRH 4OTXL 4R26H 3AUVA 1YY9D 3O2VL 2FHBA 2H6PB 2AJSH 5EBGA 1FLRH 5GIRA 3KPRE 3ARFD 2O61A 5SWQA 1FG9C 3U46B 3NN8B 4UV7H 1CIDA 5B4MC 4TVSa 2ZKHH 4MNHB 5HDBF 1KCSH 3G5YB 1V5JA 2HYMA 3ARDD 5DJZB 2EYSB 3ZL4H 3TNNA 4HWNA 5D7KE 4ZAKA 2PTTA 2C1OB 3BH8A 3HZKB 4JKLA 2C4FU 3HKFA 2KH2B 3O0RH 4P23D 2A1WL 2AI0H 4CVUA 3QEHA 1DUZA 3FL7A 1I9EA 3RTQB 4OV5A 1NSNL 1HDMB 5J12B 4WO4B 1ZHLA 1CU4H 4NQDD 3WEXA 3VXUD 5GGVH 2HTKD 5IFHH 3NA4A 4S2SB 3QA3B 5EA0H 5JW5B 2P42B 4PJ7F 4K7FB 1I1FB 1JTOA 1T3FB 3C2AL 1NQBA 1GGTA 1C16B 2F19L 3BP4B 1TNNA 1WK0A 3KYKL 4PFEA 4UILH 3LEVH 5HYFA 2NR6D 5E9DD 3OL2A 4HC1A 4JDZB 4NWUL 2NY3B 4HK3N 1P7QB 1W72B 5KN5B 4CNIB 1N59A 1XGQA 2UVFA 2VUYA 4K3DL 4D3CL 3KDMA 5K9OA 5LQBL 3SDCD 3VXPB 5BV7L 3RI5K 2X05A 3WFHA 4LSQH 4EDXA 5DSCB 3QQ9D 3VG9C 2IANA 4BZ2L 1LK3H 1LEGA 1KG0A 5IVOA 4J3UA 1HEZB 2D9QB 1FE8L 3LRSA 4Y16C 2AK1L 3AVEA 4RGMC 2X9WA 5C1MB 3H0TB 1UACH 4TVPD 5C71A 5E2JA 1MH5B 2I9LB 4NPYB 1WUNT 3WS6C 2XA8L 1TCMA 4L3EE 5DUMH 4LIQH 2XT1B 4PJCA 4YQXH 4JO4H 1QP1A 4OD3H 4F7MA 5HPMB 4MJ4A 3BESR 4OQTL 3QYCA 4BKLB 1TFHA 5FYKD 2EEBA 3VWJA 4JHWH 4ERSH 3QZWB 3FJTA 3T0EC 4LDEB 4HGKC 1KYOK 5DUBB 3BE1H 1J10A 1A2YB 4MX7A 3HAEH 3GMPB 4KXZI 4LLVB 1S8DA 4PRIE 2NY4B 2D2OA 2E9WA 4CVZB 1A9BB 1ODAA 5FB8B 4NO2B 2DF3A 1LEIB 4XAKE 1DANT 4YDVA 2P5EB 5SWSB 5EUKA 4M61A 2VLLA 2CLZA 4FP8L 5DQJA 4GRWB 5EN2B 2V5RA 4G43A 5IEHB 3HR5A 1S9WA 1Z3GH 4NP4H 5FUOL 4UTBH 4JKMA 4OKDA 3IXTB 1D5BA 2ICWA 5A1AA 5B3JE 4QXUH 4NO3B 4X8JB 5D2NC 3JWOH 3QXUA 5F8QC 3L3OA 3KPTA 2HJKA 3N1PC 2EEAA 1YN6A 1ZA6B 2Z31D 1A7QL 4JRXB 4UDTB 4AJ0A 5EU6B 3HCVB 3RUGF 3ILQC 4FS0A 3GRWA 1DBKL 2EE2A 3FTGA 1S7RB 4ODVH 4BSVA 2IMNA 5I74B 5A3ID 1OARH 1JRHH 5D96C 4NRYB 5HHME 4JFDE 4NN6C 1LO2L 4FFZH 4ZS7H 2WBKA 4QY8B 3C60B 5GS1A 3W9DA 3V4UL 2ARJA 5DJAB 2Y9RT 3L3IB 5TF0A 4QNPF 3WJJA 4PJEF 1QQDB 1I8IA 4LSTH 4WV1A 1TVHB 1EVUA 2B4CC 4RMSA 2VLKE 4TPRL 4OM0L 4F15C 1JPFA 2OR8A 4U1LA 4LSVL 1MCWM 1MWAL 4S1DD 2Q87A 1I9RL 4PGDA 4Y4KA 3DMMD 4ZFOA 4JJHA 4KV5E 1AIFA 2JKXA 2XN9E 2IPTL 2QQKL 1GXEA 4F58H 2JELH 3D0VB 4WEMB 1SJEB 5HYJB 5KOVC 4OZIB 3MBEC 4ELMF 1JFQL 1EFXB 4NZTH 4HK3J 4JGJA 3TT1L 2WIIA 4QO1A 1JV5A 5DK2B 5J56B 3ZTNL 1FG2A 4L8DB 4HAFA 3V0WL 5CBAB 4HUVA 1CK0H 3UBXB 1QEWB 3ZKNC 1U92A 5BJTA 4YAQA 4XMLH 5IWLC 3V7AE 2VDNH 3U7WL 5FO7B 2J88L 3FT4B 3BIBX 1EZVY 3OR7A 1HZHH 4X98B 2CGRH 2VDRH 4YHZH 4Y89A 2GJ6E 4EDWL 3O11B 4ODWA 2VQUA 1M7DB 4XWOC 4NHUB 2MPAL 2Z8RA 5E1AB 3JWDC 1F4WH 3G5VB 1HHHB 1QSFA 3G6DH 2R56H 2NTFB 1HHJA 1UGNA 1ZK9A 3FB7A 3ZZ1A 1XZ0A 3KR3L 1V3MA 1U3HB 3TA3C 1T22B 4N8VA 4EN3C 3QNZA 2CKBB 3IETB 3DVGA 3LQAC 3I6GB 4HIIA 4LVNB 5EZJB 4KROD 4R0LB 2PF6A 3ARTA 4Y2DD 2DQCH 1FZKA 1P5VA 5JOPE 4HX1B 2FL5A 3MV7A 3BEWA 4X99A 1FH5L 3ETBF 3LDBC 4P2QB 3GI8L 4YE4H 5JXAH 2MKLC 4JG1H 3MACL 4WEBL 2EC8A 3GHEL 3TV3H 5I17B 3KG5A 4Z7UB 3JWNC 3TZVD 3PV7A 3EDDA 5H2BB 4R96B 4BM7A 1F8TL 5J8OA 4V1DE 1L0QA 1CFVL 5KVFL 4JDTH 5GSRB 2EKSB 3T08A 3ULVF 5LXGH 1VEPA 1YEDB 1G9MH 2Z92B 1G7LB 5ISZB 4NZRH 1K8IB 3MRPA 5BOPA 5DS8A 1WZKA 1OTTD 4LSRH 2UZYB 3VXSD 3WSQH 2CRZA 3GBMH 1P69B 3C6SB 5CD3A 3T8XB 2P8LA 2FD6H 4DGIL 4H0HB 3MXVH 1XCTA 4L4VA 4HXAL 3ARBC 4OIIL 3OQ3B 1ITCA 1NMBH 1WJ3A 2FHCA 4HULB 4H1LH 1JIBA 1JPSH 3VFWB 5T1KA 1WFNA 4WI9A 3QXTA 3SGEI 3ZTJG 2BSSA 1U8PB 5INDA 2HKFL 3OF6A 1A14H 1CDUA 5ALBL 3BKMH 4TVPL 4C56B 3CXDH 3QHFL 1WVZA 2PKDA 2N4IA 3QG6B 2E7LC 1YY8A 2GQHA 3OWEA 1A6AA 1N3NA 3DROA 4XPFH 3LQMA 5FYKL 1KB5H 4ZNCD 2NY1C 5E0QA 3CDGA 2CK2A 2YD4A 3JV0A 2JJUA 5FM4A 4Z8FH 1TJIH 3DBXB 3BD3A 1BD2B 1AR2A 3P0VH 2VC2H 4IOIA 3QUZD 1DBBH 1IC7L 1B0GA 2DLIA 1AGCB 3U7YH 3NCYP 3VGGA 1CL7I 1U8KA 4CN4A 3EIFA 1RUKL 3GSWB 1I7UA 3PQYE 3UPRA 4Q9RH 4GBXC 1HQRA 3L6FB 3NACH 3AU1A 4X7TB 2EZ0C 4JFED 1ND0A 2VN4A 4KVNL 1T04A 1UB6B 4XXCA 3UROR 1KV3A 2QL1A 4J3VA 5IVXB 2P46B 3ULSB 2ZG3A 3MROA 5J6HA 2BP3A 2CLVB 2F5AL 3MLXL 1U8IB 5E8PB 5GGTH 4JQXA 2VERN 3SE9L 1XGTB 3QXAA 2R2BA 2R0LH 2BNQD 4G8GE 3U0PA 3P73B 1QRNB 2YBRB 4MJ5A 5CEXB 4XX1E 3MRHB 3DOSA 4Y1AE 3QUXB 3G5ZB 3I6LD 3KPSD 3H9SA 2ADGA 4K94H 4OZGA 2YSSA 4NSKB 3DX7A 1MFBH 1FNSL 4I18A 5IM7B 4ENEC 2ZUSA 1ITBB 3JBG7 4M7JL 2D7QA 1GRWA 5L88L 2O26U 3LPWA 1F4YH 3LMJH 1G6RA 3DJ9A 1F4HA 2PYEA 4DN3L 3BQUB 4MNGA 3H9HA 1MQKL 4RX4D 3LD8B 1P7HL 2UUDH 3ALPA 4JN2A 2HWZH 4OQTA 3GBLA 4OQ1A 1QKZH 4RAUB 2MFNA 4N5ED 4TN9A 3S96A 3QAZC 3X14B 3MMEA 4LHUB 1H0DA 3OKEA 1H3GA 3VRIB 1C8PA 4AM0B 2FH6A 2EDFA 1TVDA 1I3GL 1T1YB 2DD8L 4UI2A 3TP4A 4AK1A 1WFTA 2XPGA 1RK1A 4W4OC 5EO0A 3O3BA 3MOAL 2UY7A 4G8EB 5ANMA 3T4YA 5GZOD 1IM9A 1X5XA 1J1PL 4OLUH 4YDKL 5T3XD 1ZLSL 2HG5A 2Q76A 3BEVA 3C5ZC 5DJ6B 1S7UB 4HAGA 4KKCC 5C9JB 1B3JA 1O0VA 1LDPH 4P46D 2ZJSH 3U4BH 4L8SB 3BIKA 2NZIA 3DGGB 4E5XA 4RCAA 5CKGA 4G7YL 4DQOH 4Y7MA 4Y5YC 3RDTA 4FTVD 5JO5B 5C9KA 1AJ7L 4ONFL 5ERWA 5J6GB 3KXFB 3AB0B 3VFOB 1FFPA 1NCAH 4RAVA 1GGIL 2YD5A 4NKOB 2GFBB 1L9MA 1P7KA 2X4RB 3PL6B 3MRJA 5DMGC 2FB4H 1IC4L 2BOCA 4RMTA 4DWHA 1RZ8A 1OB1A 1JMXA 2DQFB 4KQ3H 3MFGB 4HUUA 1A1MB 4KQ4L 1GOHA 3MXWH 2QSCH 2G75B 1MCSA 4HJGA 1BQLL 2A74A 3HNVH 1MHCA 4QWWC 5F9WC 1MWAA 1NEZA 3FZUD 1XGRB 2IANE 1ZLWH 3U82B 5B3JF 3CVIH 4WFED 2H45A 3I50H 4KMTL 4WRLA 1SEQL 4K55A 4XH2B 3QR2A 3Q0HA 1HHGB 4RBPH 1PKQA 2W0FB 4OLZL 1H9VA 3RTQD 4CAGA 2F5BH 4KK9D 3BH9B 3SDAA 3N9GL 4GG8B 4LSPH 4PJCE 4LSUH 4WO4D 5AEAA 1X4ZA 1CN4A 4BFBD 4HLZG 3QUMB 2ZOLB 3MJ7A 4RRPG 4TUKL 5EU7E 3L5WA 5C0CB 1NMCB 3LKPA 5IHUL 2ESVD 2C1PA 3ULUD 1AR1D 4OIAA 5BZDA 4I3RL 2K7QA 5TF1L 2YZ8A 5E00B 3D1MC 4D9LH 3BFOA 2XQYG 1TZIA 3GSVB 4FFYH 4BQ9A 3IDNB 1KPRB 3IDGA 3U1SL 1S7QA 5I1HL 2BVYA 3QIBC 1JTPA 2WSKA 1SMOA 3MCLL 3ARFA 1S5HA 4KV5F 1AGBA 1N6QH 4O5LL 1UJ3B 1KT2A 1E4KA 4MA3A 4S0TD 1YNKH 2J4WH 3C8KB 4M9OA 1M05A 3MJGX 2EH7L 5ACLA 1FZOA 3FQRA 1NFIB 3HC4L 3GM0A 1B4RA 1OP5H 3V7AG 3C9NB 3H42H 2GUOB 1A6WH 4UBDD 4PJXB 4OF8A 4XPHH 4EQ3A 1E27B 1P4LA 4S1RH 1IZJA 1ZGLA 3B2VL 3T0EB 1KJMB 3W82A 2GJZA 4QTIH 2A77H 4NQDA 5E70A 3IGAB 2ITDA 1FL5B 2OTPA 2DQUL 4KTYA 2ZOKA 4OFPA 4IDJL 3UJTH 3QSKB 5IB1A 3TO2A 3OKYA 4N8CL 1NANH 2NY4D 2P5WB 4K2UL 4UT6L 4P57B 4NZUL 5JHLH 3JZ7A 4UOW1 4XC1H 2AQ1A 5E9DA 3SBWA 4CVXA 3O3UN 4EI6B 1YNTA 2ZSVB 4JFZH 3SKNB 3MYZA 4R8WH 3TN0D 2KQMA 1A6ZA 1U6AH 4MYWB 5IHZB 5CEZE 3ZYIA 5T1MB 3SDCA 4BK5A 2AEPH 3CFBB 5CWSB 2BX5A 1NCWH 5C0JB 1F45A 2HVJB 4P2OD 2W9DL 5ECJE 1EHAA 4OGZA 3EO1A 5FA4A 1UCBL 4FFWD 4M5ZL 3QFJA 1K5NB 1S9YB 4HT1L 2EO9A 4K7PL 3KPMB 4ZPTA 4JRXD 4HHAA 4LDOB 5EU6D 5CSBA 3VFUB 3QRFM 1YEKL 4ZUUA 5IKCA 1NKRA 4NN6B 4OT1H 2BNRD 2H8PB 3RVVD 3MA7A 3B6SB 2FJGB 4PJ9B 4PJGA 5FCUL 4WHYH 3L1OH 1OPGL 3O81A 2B39A 4AH2A 5IF0A 2H2PD 1QSFE 4HIEB 1N2RA 3C60D 4WJ5A 3RGVB 4MMXC 5DZLA 3U9PH 4F9LA 3WHE0 5IMLA 4P3CL 1NAML 1AD0A 3UBXI 2GTWA 5I8CA 1CLZL 4JZOB 2AV1B 2HLFD 4YPGB 2FBJH 2VISA 4GSDL 3UJIH 5EWIL 3RX7A 4KU1A 2ICCA 1CDGA 3QDMB 2SEBA 2XI9A 4XNXL 4GG6A 4MB5A 2ENSA 4LVHC 4N1EA 5HYJD 1Q72H 5GISL 1CZ8L 3MV7E 1YN7A 1EFXD 4LCWB 1E4JA 3RVUD 3EJZC 1KNOB 2DMCA 4JFYA 4J6RH 4JFQA 5BW7C 4M93B 5JDSA 2YA0A 5IT2L 4YIQB 5EBLB 3OKNB 4W6XB 4X0KA 2P4AB 3V4VL 5ENWB 2DQJL 1BLNA 1YQVH 2WWMC 1F13A 4NT6A 2CIKA 1CGSH 2Z31A 3P4MB 1TJHL 1DLHB 3P9WB 4XP4L 1TTUA 5JOFA 3S36X 2HT4D 1W2KT 1S7SB 5A2JH 1XGUB 4UAOC 4D8PA 2AQ3A 4ZOCA 3QUYB 1GJIA 1S9KC 1T5WB 2F58L 1GZQA 2HJLA 1FO0L 4ONOA 4EKXA 3FO0L 5CD5C 3CSYA 3TH2T 4EN3B 2NLJA 2FX9H 3UTQB 4L4VE 1UZ6E 3HC0A 3M8OL 4IJ3C 4MLIA 5GJSL 1BQHA 1NL0L 3DYOA 3ROOA 4GRLA 1FVDA 4GAYA 3IFOA 2EDLA 4XX1G 3V7MA 4D0BA 1OAXH 4WU5B 5J1AA 2R69H 1G7MB 2BMKA 3LDBB 2RCSL 4JFOA 4G6KL 2OK0H 4GKNB 4R7NA 4YGVA 2PW1A 2MNUA 1PLGH 4MJIB 1N5AB 4P2QD 1A6VH 5HGDB 3UEZA 3DYPA 4XZUA 1YEEL 1LD9B 3NMEA 3NFNA 1KLUA 5EOCH 4U1KA 4TSAH 2IQAA 4P9HC 2R9HD 1FFOA 2ZG2A 2AJXL 3IDXH 4DEPB 2F8VA 3ET9F 3ULUL 2UWEB 5F9OH 4X7SL 4Y5VA 5CZXD 2XZQH 4LDLB 4OJFH 5ISZD 4JY4B 2WINA 2PNDA 4HWZA 4F80A 4OGXH 3OAZK 3NFSL 1DVFB 3GBNL 1IGYA 4KWUA 1VPOL 2Y07L 4JREB 4KFZC 3VXQA 2VKXA 3JWDH 3VDCA 3O6FA 1KIUA 1I3RB 2JJSC 1W72L 3D39B 3QJFA 5DJ8B 1IAIH 1JI2A 4FHBD 2IBZX 1LK2B 1QVOB 5HSFA 2LAAA 4ZS6C 5JW3L 4NBZB 3IDJA 1BBJB 2ATKA 1BJ8A 4AYFA 4N5UA 1G9NC 3P4OB 3Q6FB 5DVNA 4RDQG 3MUGA 2ATPB 4B41A 3L95B 4UNVA 2MSPA 1FL3A 3GK8H 3W81A 3H9SE 1W0WA 4RDQF 4OZGE 2Q8AH 4LQ1A 5F6HJ 2ICWJ 4EUPA 4XT1C 2VN7A 3VXMB 5JXED 1IGTA 3U2SA 2ZUUA 3SY0B 3Q6GH 3FQNA 1P84K 3H9ZA 3WIIH 1N0XL 3RWHB 2OJEA 3TZVA 1JGLL 2PYEE 1L6ZA 1I7ZB 4MNGE 1A6TB 3BZFB 2J7LA 4JAMB 4KRLB 1PSKH 1QSED 4WHTA 1BD2D 1HI6B 4YXHH 3LVEA 4RWYH 1ZA3B 1OW0C 4MD0B 4ONHB 3GJFA 4LGSB 4Z78B 4Q9QL 2A0LD 3V0VA 1U8JB 3A6BL 2H26A 2VZUA 4P99A 3U36B 1QR4A 1OTUD 3WFDH 3MCKA 4O51B 1NJ9B 5FIEA 1MCFA 1VFBB 5LBSH 1J12A 1YEIL 5LAXA 5DYOA 3K8MA 3QCUL 4MCZB 2CDGB 5E99H 3ZT7A 3D9AL 1IL1A 4XPTH 4LVOC 5ANME 3V6FA 5BS0B 1I1AB 5T5FL 5ICXA 1SEBB 3MOQA 3SDYL 4K23L 3VFSA 5BZWB 1CQKA 1U8NB 2GT9A 3KPNA 3MLTA 5E6IC 1QYGL 1L7TH 3LN4B 5E2UL 3B2UC 5F7YC 3QUXD 4Q0XL 2Z8WC 4OB5H 5E8OA 3IKCB 2FJHA 1B9ZA