5CJOH

Crystal structure analysis of elbow-engineered-fab-bound human insulin degrading enzyme (ide) in complex with insulin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVSSYSIHWVRQAPGKGLEWVASISSYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARDRVMYYWSFSKYGYPYGMDYWGQGTLVTVFNQIKGPSVFPLAPSGTAALGCLVKDYFEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTCNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin-degrading enzyme
publication title Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 33
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2015-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoH01
3NAAH 3ZE1F 5IB4A 4DGVL 3CLFH 3TH2T 1NCBL 1JHTB 4YGVA 3D3VA 5M7QA 3GMLB 4OCXL 1S5IH 4N68A 3ZHDA 2XZZA 5EUOB 1JGUL 5TE7L 2JCCE 5E5MB 1PY9A 4MCZA 4JFED 3BPNC 5CINH 3CXDH 3BPCA 2JB5L 4M8QB 4E41D 3KLHD 5IESL 4EOWL 1XR8B 3HPLA 4G42B 1OM3H 5J12C 3QQ4B 2Y36H 2C26A 1NBVL 2M1KA 4FQPA 1BX2A 1JUFB 1FFQA 1WZ1H 3UZVB 3VD4A 2Y06H 3U48A 2BVTA 3CFEB 4NQVA 3BN9D 1R3HB 4NWUH 1VEOA 2CSPA 2ZCLL 4GUPB 2G2RB 1JVKA 2ZJSL 4G80A 4F7TB 5F1NB 2I60L 4NHUB 5IFHL 1ROWA 2NY5L 4TYUA 5IKCB 3F7RA 4L4TE 4P2OC 3OKOB 5DK3A 4XPHL 3V0WH 5DFTA 3BPOC 3BKCH 4KQ3H 4JO2L 1PZ5A 2B4CH 2X7LA 2NY5C 1CXKA 2VDMH 3BVNA 3V7AE 4R4FH 5J0BA 3DTXB 1GGIH 4MLIA 4MVBC 1B0GB 4XXDA 1T6WA 3PGCA 2DQCL 5ILTL 4DZ8A 2VABA 5MEPA 4J1UA 3ZTNH 3MLSH 3BIKA 3VCLA 4OM1H 3F65A 5DK2A 2ADIA 4R96B 2ORBH 3KVQA 1MQKH 2OI9B 4NQDA 4HBCL 2Q7YA 1ZHBB 4J3UA 3RWIB 1HHJA 3VXRD 4RFOH 4E9LA 2WIIA 1S7SA 1MF2L 2ADGA 4TSAH 5DGRA 1ZS8B 4WI6A 1CXLA 5D4QA 5SWSB 1CL7H 4XMLL 3VFUB 4OD3H 3PP4H 3CVHL 4PD4K 4YIQB 2QQLL 4JZJB 3BDYL 3MXWL 5DD5L 2GW5A 2VLKD 2X4PA 3T65B 1OTUC 3SKNA 4OGXL 4HIEA 2DJSA 2ITCA 5DUML 3UYOD 3QDHA 2AEPL 3PWJB 4ZS6C 3EFFA 2AJZA 4PJGB 1MFDH 4WENB 1DVFD 4AM0B 2VQUA 3V8CA 1DQJB 2EC9T 1IFHH 5ESVB 5IM7B 4KPHL 1RIVL 4K3GA 5K33A 2YN3A 4PB0L 3LRSB 4HMDA 4NO5B 4KJWD 3KAAA 4NYLA 1C1EL 2NX5B 5EA0H 5F1KC 4P59H 1FNEB 5C2UB 2BX5A 3ES6A 3AS3A 2NW3B 3LN9A 3T4AA 2C3VA 3MA9H 3QG7H 1FFNA 3T2NH 2YWYA 4I48A 4FFVC 5IJKA 1A5FH 1NUNB 1REIA 1SVCP 2R0ZH 3RJDA 3KPTA 1RZ7L 4DGIH 3B2UD 1S7RB 3SY0A 1MVUA 3KPRE 4L8DA 3BGMA 1X3DA 3X17A 4EI5B 4Q0XL 4JJ5B 1S7UB 4M62H 1FZOA 1BQLH 5T1LB 2Z8WC 5C0DA 3ORJA 3SE8L 2CKNA 4HCRH 4WWID 4V1DE 5E2WL 3SDXE 1JN6A 2BVOA 1X5GA 5DD3H 4G6AD 2CDFB 3B8SA 3CH1B 5FYLH 3RHWK 4GBXA 4NC1C 4NQCB 2Z4QB 1IGCH 4LIQL 3VFTA 4ZPVA 5J3HC 1J87A 1NGPH 5EC1A 3DGGB 1RJCA 1R5WB 4M6OH 2IH1B 4GG8A 1NUFA 5DSCA 4P2RD 3A6CH 1H3GA 3MLWL 1CD9B 4UV7L 4LBEB 4QOKB 3KXFB 3QFJD 4M4PA 4MXVF 4PV9B 3PUCA 5GGTL 5DO2C 2MCPL 2UY6A 5ICYA 1GGYA 5I66A 2E27L 3MV8D 4M7JH 1XF3A 3S96A 3OQ3B 4U1KA 5LGHH 3L3JA 5JNYB 2EKSB 5DYOA 1SYVA 2X42A 2XWTA 3GSUB 3QUZA 4X6DB 2R69H 3SBWA 1KIRB 3PWPD 4DVBA 3EOYG 1FRGH 1LK2B 1ZWIA 4PJHE 3GSNL 4H0IA 3LD8C 4YHOL 4B0MM 5GSVA 1FGVL 3E6HB 4FQXC 5A2JH 1A6TB 3T0EE 4DVRL 4WO4D 3GKZA 3PWLB 4X7TB 1RZJL 3TP4A 3IXAA 4Z7UB 3KPLB 5TQ0L 3AY4C 4POZD 3PGDB 5C86A 3IU4H 3UTPD 4IIQA 3OXRA 1NDMB 3HN3A 2ZCKH 1I9JL 4R3SB 2EDHA 2HT4D 5H35B 2VXTH 43C9B 3VFPB 3QA3B 2EIZA 5E8PA 4LVNC 3QSKB 5TH2A 2AKRB 3PWNB 3NA4A 3WEXB 4E42B 3HE6D 1V3KA 1PVHA 4MQSB 4WJ5B 2E6PA 4BH8A 3EAKA 1IQWL 1T5XB 4LF3B 3VGBA 4X6CA 4Q7DA 4OLYH 2IAMC 2W9LA 4L1DA 3MJ7A 5CUSL 4P5KA 3U1SH 4LGSB 3MV7B 3DECA 2MWCA 1EJOH 2WAHA 3BMWA 2EDOA 1OAKL 2MJWA 1LEGA 3O4OC 2CR6A 4RA3A 4EKXA 3C2AH 4CDGC 1CXIA 4YNYB 3OKNB 3SE9H 3VXSD 1FNSL 3QNXA 1GGCH 3PABA 3TIEB 4BYHA 3RJQB 2ZUVA 5C0CE 1WFNA 4DOHE 1K4CB 1I1AC 3EO0B 2VL4A 5T1DH 3HG1A 1N7ML 1JMZA 1X7QA 4OZGB 3T1FA 4DKFH 1FFOA 1YEEL 1YNTA 1RULL 1B90A 4OQTH 3QJFA 1RUAH 4PRAB 4K9EH 1NC4D 5JIHA 4RAVB 1OSZB 4IDLA 4NRZA 5L8JB 4HUWA 4WCYL 4X5XB 3CPLA 3RBSA 1UM5L 3D18B 3WNPA 1WBZA 2J6EA 3BGAA 2V9TA 2I26N 1NL0L 4NFBA 4PJCA 4Z7VF 1AC6A 4OZFB 5IW1A 1INEH 4PJ5D 1YY9C 2Q8BL 3HZVA 3TT1L 1MCLA 3L7FA 1MFEH 3GDBA 3HS0A 1TQCB 1FSKB 1D6VL 4QXGH 1Q72L 3ARBD 3LN5B 5FOJA 2WUCH 3MX0A 1U8MA 5TDNB 4GKOA 1W72B 2FGWH 1EERB 4XVTH 4HIIB 3MBEC 1R24B 3KYKH 1LP9E 3N50A 4L5FL 4N0CD 4GRLA 3I50L 4NZJA 4OFIA 2WZPD 2V7NB 3MCLL 4L4VD 1C5BL 4MAYB 4JFEE 4PJFA 1W8NA 3ZO0A 4E41E 4XC1H 1AJ7L 5IW6A 3ULUC 4X4YA 4LCUA 2AK4A 1EVUA 1H3PL 4GS7C 2E3VA 1IRAY 3K7UA 5D8JL 1VGEL 3OAZH 4Q97A 3X12A 2CMRL 3MRCA 5DT1L 12E8L 4L9DA 2OSLB 5FYJD 2R1YB 2WSKA 2Q8AH 3E2HC 4B7LA 3L3OA 3QQ9C 3QB7C 2E6JA 2UZYB 4IJ3B 1D6EB 3H9YA 2VDNH 2DIJA 4P46B 2WUBH 1UXSA 4NO3A 4ONGH 3AB0C 5ITBL 1QFWM 3C60A 2WWKO 4HLZH 4Y4KA 2QV2A 3SQBA 3HZKB 4K3DH 5F9JA 4R0LB 1J88A 4Z7WF 1BF8A 1TXKA 2GY5A 3OZ9L 4H1LA 1OY3B 1SEQH 3LKOB 2HKFH 2UZIH 1NAKH 4Q9QL 3DSFL 3EO1B 5D71L 1IC4H 3LQAH 2COQA 1FH5L 4HUXA 4L4TB 1CL7I 3MNVA 3VFMA 3WKML 4G6FD 1RAMA 3N1PC 2HRPH 4OZFG 3UTZA 4F7EA 2G60H 4JB9H 3GJFB 2NY2C 3JWOC 1NFIB 3RHWF 1IKNC 5DQ9B 4ZDHB 4GRMB 4PJDE 5BRZA 1SHMA 4TUOB 3MRDB 1TZGL 4Y5YB 2R0KH 3BXNB 1FIEA 3DXAD 2YEZA 4H25A 2FATH 4Z95H 4HX1B 1EK3A 1DQQB 5E2TH 3MRKB 3QEHB 2VLKE 3MV11 4YPJA 3HKFA 2UWEA 2OR7A 2VLJA 1IGYA 5ICXB 4X4XB 2GQHA 3G6JE 4ODVL 4PB9H 5IEKB 3NFSH 4GMTL 4HW6A 4BQBA 3B6SB 4I5BA 1FJ1B 3FQXA 1U8QB 1VKXA 1F4WH 2HJLA 1G84A 3QUYC 3KYOA 4P23C 5LWYH 2Q7NA 3ARUA 5FA4B 1KXQE 4NOFA 3P11L 3E3QC 3ELAT 5GGSY 1FE8L 2QSVA 3OGCB 2YK1L 3REWB 3Q6GL 3QPXH 4JPIB 4EEEA 4X6FB 1WWBX 3VFRA 5CMAB 3VGEA 3HAEH 1GL4B 1HCVA 1OW0C 1I8LA 4OLWL 4WW2B 2IAND 3EYSL 5CGYC 4HWEL 4KI5C 4LCCB 4K3JL 4Y16D 4D8PA 1JWSA 2X4QA 5I18H 3JZ7A 1ONQA 3QDMD 3O8XC 3ZYIA 3ARGA 4P3CH 2W9EH 5DJ0B 5FO9A 2ATKB 2XPGA 2KZWA 1R3LB 1HZHH 4GQ9L 5C0RH 5F7MC 4UV4L 4HKZB 2NY6B 1W8OA 1DSFH 1JZ2A 1QACA 3U0TA 1XCQA 1HILA 2OR8A 4WGWB 5EZIL 1KCKA 2GK2A 5C0AD 1FV1B 1AE6H 5L8KB 4P5MB 3IDJB 1U8KB 4JFOB 5F6HI 2B39A 1HXMA 3V7AG 4PBWD 3QCUH 1WZLA 2A9NH 4MNGE 4RFNC 5EULV 3LKNA 1LD9A 3QUMA 4P2RE 1HYSD 4HULB 1PSKL 2IFFH 3P0GB 4JM4L 4LLDA 5HPMA 3QAZC 2YS4A 3QFJE 3SDXB 4K94C 1T1YB 3OKLA 3S37X 2A74A 1X5AA 4XHJC 3NFPA 4JLRA 2A6IA 4ZTOL 4HS3A 3FFCE 2AV7B 2Y5EA 3DUUA 1KYOJ 3QIWA 2NY1C 1F42A 1KG0B 2VITB 1VPOL 2VWEE 1LO0H 3FQNB 3MNWA 5IMLA 1KJVA 2DLGA 1MCPL 1QG3A 1GOFA 1XF5B 1X5ZA 4XMKL 3QHFL 2BY3A 2AEWA 1TJGL 3CNKA 1CF8L 4BK5A 1BGXH 2HTKD 1U92B 3K80A 2OR9L 1IAOB 4LPWA 4AIZA 4YDKH 4QTHB 5BVPH 5H37H 1F6FB 2NZ9D 3QCVL 5J4MA 1K85A 5GRJL 3O6ML 5DJ6B 1ZLUK 1Q9WB 4ELME 3D5OF 1MCFA 3BKJL 3D9AL 4XPBH 1NUGA 3H42L 2DLFL 5I17A 4HF5L 4N0YL 5IB5A 2BRRH 3C2SA 1JP5A 1KJ2L 2DIAA 3TZVB 4XNZC 4TSBL 5EBWA 2I07B 1AKJB 4Z7NE 3SCMD 3UTPE 3S35X 2XWJB 4U6XB 2UUDH 1A6VH 1KIPA 2F8VA 2P46B 3WIIH 4I2XE 4QY8B 1I3UA 3LIZL 5I73C 3LEVL 1LE5B 1T04A 3JUYA 1KIQB 2R23B 4OI7A 1KB5H 3UC0H 2EE2A 2CDGB 3FAWA 3GNML 4BKLA 3RWCA 5D96C 3CFBB 2OMBA 1YN7A 2R2HA 2WW8A 5DEZA 1IQDB 4WFGE 2J88H 3MTRA 4WEUD 4BFGA 5ICZA 2D03H 3WUWB 3P0YL 3ZKXB 5TGBA 4UINH 2DQTL 5L2JA 3V5KB 4OLVH 1Z0MA 4X7DC 5C0BA 4HEPG 2F19H 1MI5E 4FXKB 1MRFL 2BSED 5JW4R 3VWKA 4TTDD 1P1ZA 3VXSE 1EZVY 3GMOB 5GSRA 4ZD3L 2XKSA 5HJ3B 4N5UA 4C56A 4X6BA 2R29L 1RFDL 1TQBB 4OIIH 4TSCL 1ED3A 4PGBB 1T80A 3IJSA 4IMKA 2G5BB 5HI3D 1OAYH 1NFDB 4EQ2A 1IMHC 3SOBL 4PFEA 4CADB 1GCFA 2N7BA 4P4KA 4W4OA 3ZE1E 2WWMD 5I9QB 3BQUA 3R06A 4TNWF 3IXTB 5J6HB 4L8BB 3NIFE 4HS6A 1Q1JH 2DD8H 4PTUB 1I1YB 1N5AB 3UP1A 2RIKA 1OTTD 4OB5H 5BCAA 4HPYL 4X7SH 1BM3H 3DUSA 4APQD 3L5XH 2HFTA 3LEYL 1IC7H 4UAOC 4I9WD 2QKIA 3FQUB 5HHVL 2FRGP 2YUZA 3BH8A 1WVZA 2FH8A 2CKBB 5BMFL 2WMPA 4XNQA 1UM6L 3KLAA 3E6FA 3HC4H 4PJ5E 3CGTA 5GGSB 5C0CB 1I3VA 5D1XA 2YWZA 1ADQH 3SKJL 3TJHC 5ADPL 3QQ3B 4ZXBD 2FO4B 3P9MA 4HK0B 1FC1A 3MXVH 3VDBA 1K2DA 4OM0L 5JO5A 1AFVL 2FX7H 2FGZA 3U9UA 3UPRB 5JW3H 3BEVB 1RPQA 2GT9A 1E6OH 2XZCL 5LAXB 3W39B 3EGSA 1OB1A 4XVJL 3SDAA 3W2DH 3D69A 3H0TB 1YECL 4RAHA 3QXTA 2YHGA 5DDHB 3MLYL 3UAJD 4L4VE 3ARFD 5F8RC 4C4KO 1YZZA 4HGWA 3D85D 1EO8L 1PKQA 3LV3B 1UJ3B 3U46A 4KVNH 1S9YB 5EOQL 5KG9B 1T03H 32C2A 4AL8H 4BH7B 4OBRA 3GK8H 3LCYA 4EBQL 1EEZB 1NCWH 4X8JB 5FYJE 4YO0A 5F1OB 4LCIL 4H8WC 1LP9B 1XGUA 4FQQB 4UB0L 2IPTH 2JLLA 2EYSB 4KXZH 2GK0A 4MQ7A 1SEBA 3MFFA 2DB8A 3STZA 4JHWH 4JFEB 4AQOA 5IR1A 3F5WB 1GPOH 3T0EC 2X4RA 3QDGD 3PHQA 3EYFB 1L9MA 2C1OA 2HVJB 3KLSA 4XWGL 5J13C 2BSRB 4AG4L 4XCYB 5E00B 3LZFH 3UTSA 5A3IC 3UEZA 1L6ZA 2FEDD 2LQRA 1BQSA 2PCPB 4PP1D 3BOVA 3MPCA 3PXHA 1HINL 3OAYH 3I3BA 3HC3L 4G9FD 3VW3L 1BLNB 3CVIH 4HPOH 3S88L 4EDWL 3WXWH 1MIMH 1A3LH 3CJJA 4U7KA 5IJKC 4OF8A 5DJXA 2N7AA 4WWKD 1CQYA 1TVBA 3FT3B 4UTBH 1JHLL 2WLYA 4YXHH 4FZ8L 4M02A 1HKLH 3DXAE 3OWEA 3OJVC 4YR6B 4NNPH 5I1GL 2P45B 1NCBH 2ZOLB 3KDMB 2WP3T 4GLRH 2IADB 1Z3GL 3SDCD 2V2WA 2O5ZL 3VJ6B 3L95A 5CJBA 3FB6B 1EHNA 1HI6A 2FBJL 4E5XA 4OCXH 3FTGA 1KCVL 3VXRB 3RWJB 1RIUL 1JGUH 2IALA 3TA3D 4OLXL 4IDJL 3UX9B 4J3WA 1PYWB 4G43A 4HV8A 3RA7L 4L8CB 2JB5H 2D4FA 3DWTA 5FUOH 4DGYL 5EZLA 5IESH 3VWJC 5B39A 4RFEB 1N2RB 2AJYL 1CFNA 2VLKB 1GSMA 2XKNA 4GAJL 3NIGF 3IGAB 1JZ6A 3O3EB 3AREA 3EYUH 3QUKA 4LSVH 2IANE 4L9LA 5D2NA 2ZCLH 2X4NA 4Y19D 5EU4A 3CXHK 2YC1A 4HWUA 4PY7B 4M1GH 1M05B 4X9FA 2I60H 5BOPA 2LE9A 2NY5H 2H45A 4JG1L 3RVUD 4B53A 4U1LA 2V6HA 4O58L 3QDME 4XPHH 2YKLH 3SBWC 4NNYA 1AD9B 1J11A 1VFOA 3QWRD 1LDSA 4IRJA 4PJFF 1NGWA 3RVTD 5DZLA 4ODHH 4LOUC 3K4ZA 3BP5A 2JKXA 4MDJA 2V5RA 1VGKB 3FO2A 3IVKB 1X44A 3O6FB 1MWAA 4R4ND 5ILTH 3ARDB 4ZTPL 4ERSL 3WFDH 3GRWA 5C0AE 1ACZA 1HEZB 4XCNA 4GAGL 4MA3B 4XXCC 4OCNC 4X98A 3QNZA 2DDQH 3GSOA 4IIQC 3DROA 3O9WC 1MF2H 4XRCB 4JY6B 1AO7D 4NDMA 4LHUD 1J5OL 3TCXA 4N90D 2PNDA 3BN9C 4NRYA 4WV1B 5GJSH 3JBG7 4Y5XB 4OZHF 3CUPB 4F9LC 4NCC1 4ZSOA 4B41A 5CZXC 1KCSL 3MRQA 3MXWH 1PY4A 5DD5H 1KCUH 3EYOA 4LKCA 2I5YL 2EDWA 4JKPH 5DUMH 4CN6A 2H1PL 1QFWL 5I8KL 4DUVA 2AEPH 5JIKA 1U2CA 4MNQA 1F13A 2X40A 2E7LC 5GRUL 2GEEA 1CE6B 1X5LA 1ZE3C 5D70H 5F7YC 3TGXA 1RIVH 4M48H 5F72S 4ODXB 1QSEB 5F1IB 4JO1H 3BGFB 4PB0H 3QFJB 1C1EH 1KENL 4JAMA 5IK3A 3TJEH 5HHNB 2H26B 4NUJB 3X14B 1HIML 3FKUS 3MV8B 1IGMH 3RVVD 4X0KB 4XZUA 4U1NA 2J6EL 2DWEB 3PWPB 1A6ZB 4XI5C 1S9VB 3MRHA 5HGBB 3T77A 5MEOA 4P2OB 2BCKA 1AGBA 1ZT7A 1KN2L 2HJFA 4ORGA 1I7UB 1AGCB 4S1DD 4IBLT 3HE7A 3CC5B 4ZPTA 1PJ9A 5T1KA 4JE4B 5IOPB 3WJLA 4WO4B 3S4SB 1FYTD 3LRGA 3RY5A 3SE8H 2ARJQ 1MLBB 4CU8A 3UTTD 1DVFC 3V6ZA 1WV7T 3ARRA 4PJBE 2PW2B 3DMMA 1JGDA 1KLFA 4D0DA 3T3MF 5IQ7L 3EDFA 2HJKA 2H3NB 4I2XB 1J1PL 4D3CL 1ERNA 4FFWC 1NCAL 5LGJA 3TYGL 3QEUA 3HE6B 4U6HA 3VXPB 2XQBL 1ZGLA 1KTDA 1QLEL 3AS0A 1EEUA 4UV7H 1A02N 3L5IA 3GMNB 1JFQL 3BAEL 4QHKJ 1U95B 3NPSB 5HPOA 3IU3A 1MFBH 2AJVH 4YAQB 2ADFL 5FV1L 1B4RA 2MCPH 5FA3A 1WITA 4L3CB 2PYFA 5T3XH 1K6QL 3CVHB 3DVNA 1BECA 4DN4L 4GFTB 1BJ1H 5LVEA 1NBZB 3HC0B 4U1HB 3CFKB 4I9WE 3VXSB 1MCWW 1NAMH 3RGVD 2A1WL 3PHOA 2P7TB 1D5MB 5IJVA 1CGVA 1LK3L 2J2ZA 1Q94A 3QULB 4Y4KC 5GS1A 3QUZD 4Y5VA 2J1KA 1G9NL 2NCMA 4DVRH 3OKKA 5C6TH 1OAXL 2CRIA 1NC4B 4O9HL 2EYTA 5F7DB 5D7LB 3GSRB 4M9OA 1EHAA 1G9NC 4JZNB 1NCTA 3D2UD 1U2HA 1DL7L 5KS9A 1I9JH 1ZT4B 1MRDL 5BZWA 3QPQC 4PJ5B 1XGRB 3S37L 4MD5B 5CZKA 3RU8L 3S4SG 1I9RL 3P9WB 1MCHA 3ARBB 3GBNL 4KXZI 3DOSA 2R39A 1GOGA 4JDTL 4NM4H 3GIVA 1UH2A 1W0YT 5D5MA 4WEMB 4DJMA 2DL9A 3GKWL 4OZ4B 1IJ9A 3FO1B 4XGZA 4Q6IA 4Z7WE 4RDQG 4R6UA 4NZRL 5CUSH 4PJAF 4OCSH 3T2QA 2Y7QA 4Q2ZB 4OI8A 3AM8C 4LVEA 4QRRE 2NY3C 2OJEA 3IDMB 1AIFB 3DX8B 2PYEE 3FB8B 5JZ7C 3MRRA 3MGAA 4ZMAT 4R8WL 2AVGA 3EHBD 2B7DT 1II4E 3IFLL 2CLRA 4TN9A 3MRBA 2NY4C 3S35L 1ZGLM 5KTEL 5EU6D 4P3WA 2HWZL 4KROC 4IOIA 4LAQL 2DQFB 5DJZA 1YEEH 1RULH 1I8LC 2Q76A 4G9FE 1NLDL 3FO0L 3HZMB 4PV8A 1JYVA 4XPFL 5K9KA 3HG1D 5EU7E 1UM5H 1RVFH 2JIXD 1H3UA 4GLRI 3V8OA 3FOMB 4X5LA 4PLKD 3IKCA 4KJPD 4LCYA 2Q8BH 4NT6A 3ARGC 3WIFB 5HD8C 3KPQB 3S5LA 2NLJB 3QH3A 1D6VH 4N9GB 5EZJA 5CEXB 1G6RA 4UIMB 5IB2B 2AEQL 3B9EA 3GSNB 4EZMA 5BJTA 2J3SA 2HLAB 4LNRA 5FUCE 1XAUA 5INCA 3HLAB 4IOFC 4JY5L 4G6FB 1U8JB 4L5FH 4QHUA 3AU1A 5M94B 3I50H 3U0WL 5C08D 3DETD 3KG5A 3ULUH 4NO0A 3RKDD 4Q74A 3QUML 3MCLH 4NSKA 4Z18A 5I1AA 1OL0A 4PP2A 4P49A 2Q87A 2W60B 4I0PA 4JDZB 4GRLD 1TIUA 2D7TL 1S7XB 3DXAB 1G0XA 4OKVA 5D8JH 1VGEH 2VZTA 2DBJA 2CMRH 4YHIB 5DEFA 3ZE2F 5ACZB 3MR9A 3DVGB 2EXWD 1UWEL 4NKDA 5B3JE 2AK4D 2XNAB 4PYHA 2YA1A 1KLUB 3QIWC 4Y19E 4HFWB 1D5ZB 5IHZA 3OB0K 2HN7B 5I71C 2DTML 1G6VK 3PDGA 3QEGH 1CICA 3O4LD 1UYWH 4QCIB 1RJZA 3VRIA 2FECL 5FM4A 2AV1A 1MHPH 3HRZA 2A73B 3CX5K 5GZNC 4OCYL 1R3JA 1S78C 5MENB 3PF2A 4JRXA 1VFBA 3GEWB 3VRJB 3KPSA 4KKCD 3VXNB 3QXAB 1IEAA 1KPRA 2IANB 4HH8A 1A1MA 3MV9D 2D7QA 4EUPB 2YXMA 4MD0B 2N1KA 4HIJB 4Q9QH 3O11A 3VFVB 3DSFH 4Y16B 1AP2A 5D71H 2CPCA 2Z93B 2H2SD 1CD8A 3JWOH 3K1KC 4W81A 3QDMB 1YDPB 5I1CL 1AO7E 1OGAB 2ZSWA 3MROB 4N90E 4IHOB 2R1WA 1JPFA 4OGYH 4KRMB 1TZGH 1J1OL 4F7PA 4NUGL 5E2UL 1OT1A 4UI2A 4NKOB 2BMKA 2V2XA 5MERA 1LO4L 4XVSL 3SDYH 1S9WB 5C0AB 5BRZD 2W0LA 3QCTL 4ODVH 1EPFA 4GMTH 5D2LA 5JDSB 1UH3A 1HSAA 6CGTA 3H9HB 5HDOA 3C6SA 5B8CA 3Q3GA 4U1SA 4LVHB 5EOTB 3TO2B 1OWWA 4Y0GA 3I6GA 3P11H 4NN6C 4JFDA 1DN2A 3DIFA 1RUKH 1NGYB 5SWZE 4JGUA 4Y4HC 1FE8H 5F44A 1F11B 3QXUA 3Q6GH 1XIWD 3LSOA 3SKOA 5CJQL 5ENWB 4IMKC 2DL2A 5CEZE 4GRWF 4PJIF 1A14H 4ZQKB 3EDEA 4W4OC 4OLWH 2DIBA 1TCRA 3RL1B 4YX2H 5DHVH 3TO4D 2XY1A 3R0MA 3Q5OA 4L4JA 5DRXB 3VFWA 4LU5L 4HWEH 5FGSA 4G6KH 4IRSA 4NQUA 4R4BB 1U8LB 4HUVB 4K3JH 1N8ZA 5I74C 4U33A 3K0WA 4K7PY 3K8LA 3FN3A 2GIYA 3GJEA 3CXHJ 4KRPC 4WI8A 3VXMA 1RZGB 1A9EA 1S8DA 3O45B 5F89A 1FYTE 3ARSA 3WFBL 4GQ9H 1QLFA 4YHPA 3TVMD 3LKSB 4M8VA 1YEGL 2NY0C 2P47B 4NN5C 1QO3B 3RX7A 3ULSB 3UTTE 1T1XB 5FF6A 3TIDB 4Y1AB 1MEXL 3SCMB 5C0JB 4M7ZB 4BUHA 5EZIH 1WAAE 2AQ3A 2LAGB 2WNGA 1KGCD 4JCMA 5C0EB 3MMEB 2GSIB 4CGTA 5AEAA 1HH6A 2Q3AA 5KAQF 4QEGA 4OGAC 3H2WA 1MJJB 4K94H 1Q38A 4HXBL 3V6OA 1PSKH 4FFZL 4JM4H 2X89D 1I1FB 4XX1E 1U8IB 5HHOA 3R8BB 2CD0A 4GKSA 3MGTB 2OZ4A 1A9BB 1EBPA 3ZL4L 5TE6L 4WFHD 4ZTOH 4KAQL 2VQ1A 1X5XA 3JV4A 5LKNA 1VPOH 4YPGB 3I3DA 3VG9C 5IEHA 5CILL 1T7XA 1KTLA 3EDKA 1WSST 1OP3K 2YRPA 3LKPB 4OD1L 4OKDA 4XMKH 3L9RA 4LMQI 2CUIA 5EBGA 3BP6A 4PJ7A 2BFVL 1FNFA 5FO7B 1TJGH 3VE0A 5I75B 1A7QL 1HHHB 1CF8H 2ZG3A 4OFYA 2VMFA 3FOLB 1T1WA 2GJZA 5CP7A 2VZSA 4DCQB 5ESQA 4Z7VB 3LEXB 5F93C 3NA9L 1OGTA 3QCVH 3WNKA 5GRJH 3LAFA 4HJGA 3O6MH 4KKBC 1DDHB 4Z76A 4FXGB 4TVPD 3DBXA 5F9DC 3P4OA 5IB3A 3P0VL 3H42H 5I1DA 5GIRB 4HF5H 4ZUUB 5C7XH 1EAPA 5IVXE 4N0YH 4JM2D 1KJ2H 2F5BL 3V0AC 3WN5C 5E1HB 1YMHA 3TWCL 2XKUA 4F8QA 3EJYC 1F2XK 4QXWA 4UIKH 4WU7A 2I9TA 2R0LL 1BQHG 2X4SB 5FYKD 4DKAA 2DM2A 3KPMB 2DLTA 3LIZH 4CKVX 1CQKA 4L1HA 3JV0A 3DO7B 5D7JD 5KVEH 4QRQB 4ZXBB 1SQ2N 5K9QI 5GXBB 2MKLC 5JXEC 3U6RB 4UILL 1NC2B 1GGTA 3SDDC 1FN4A 2IWGA 2G75A 4BQ6A 4KKNA 1T21B 3THML 1AXTL 4RX4D 1TDQA 4N8VG 3DV4B 5IBLC 3P0YH 5GQBA 5JR1L 4R2GD 2DQTH 2OTUA 3ARFB 4KJQC 3SGKA 3D85B 5F7NC 2LVCA 3HR5A 2XA8L 1BVKB 5HI4C 3F7YB 4KK8C 4I8DA 1A7NL 4K3EL 1JYNA 2ID5A 1BMGA 1E6JL 1EFXB 5IMOB 2R29H 2V2TB 3ZT5A 4K8RD 1CLOH 4TSCH 1QUNA 1M6OA 3VWKD 3SOBH 4Z7WB 4C59B 2F74A 4F37K 5EU6E 1YY8B 4JN2A 4OAWA 3P2TA 4BFEA 3ZYJA 1G9ML 5EPMA 4ZFGL 3D39D 5IVNA 5EWIL 1EFQA 3AREC 4R90L 3H9ZA 4AT6B 1NDGA 3BUYB 3V0VA 2W38A 4L9LC 4P4KD 4NRXB 1G9MC 5D2NC 4FNLH 1E4XL 4NGHH 3QDGB 4CVXB 3RDTD 4Z7OE 3C6LA 4MS8D 4G7VL 1SM3L 4YHYB 3QZWA 4MZ2A 4MZ3A 7FABL 1YEHH 3PP3H 3SKJH 5ADPH 1I4FB 4IRJC 3UJJL 4U3CA 1MWAL 1T2JA 1XMWA 4G3YL 2VLMD 1AFVH 3HNTL 5L2KB 3GRWL 3VI3E 4F7MB 1F45A 4NPYB 4XPTH 3WD5L 2XZCH 1INQB 2XY2A 4LEOB 1MFCL 3WHE1 5J6GA 1OARH 4XVJH 5J8OA 2GAZB 2DICA 5F3HA 5HGDB 5C08E 1D7FA 1YECH 2WANA 4L8SB 5ANMA 2EH7L 1UWGL 5HI3C 3UZEA 1C7TA 4N0UA 4MNHB 3EOTL 5IT2L 1EO8H 5GGRA 3X13B 4C83B 1IAIM 2AXFA 1P69B 1UVQA 2XFXA 1EVTC 2PO6D 1UADC 5EOQH 4H8WH 1R3KA 3G5VB 1OTTC 3MNZB 3TCLA 1GZQA 5EUKA 4APQC 1I7TA 2JJUA 4NC2B 2AQ1A 4EBQH 1M71A 2BK8A 4I3SL 4LCIH 3GMRA 2BERA 1MPAL 4UB0H 1T83A 4POYA 4HIHA 4OQTA 5IVZB 2EDBA 2EE6A 3TA3B 1G0DA 1MCKA 4FOMA 1S9XA 3D0VA 4YC2C 4YGVB 5DZNA 3O4LE 4ZUTB 3RZCD 2QADC 4UUJA 2ZUQC 1P4LB 1YEIH 3IAPA 4LFHD 5KS9F 4UDTB 2A0LC 3O2DH 3L3GA 4AG4H 4WHTA 2B0SL 3SPVA 3MRIA 3DI2B 4PIRF 5C09D 3HPLB 1XGQA 4OZHE 5I76A 3VI4F 1UKQA 3MV9E 4M1DL 4Y19B 1BX2B 1HINH 3DJ9A 5D5MF 3UTSD 3K2UL 5EIIA 4G8EA 4JO3L 2EO1A 3VW3H 2IJ0C 3LB6C 5HYSB 4KDWA 4NQVB 3S88H 1NMAH 4EDWH 1J0IA 1SBBA 3PIQA 3AUVA 5I6XC 4J8RA 5K9JH 4RGMC 1RU9L 4XAKE 1JZ8A 4G80B 5E4EC 4GW1A 4F58L 2F53A 5FCSH 4FZ8H 3RI5K 4OLUL 1PZ5B 3EJJX 2X7LB 4U1JA 1Z3GH 4RWYL 3HMXH 3QXVA 3O2VH 3L3HB 5B38A 4MQXD 3RPKA 3MOBL 5SX5K 2VZUA 4RMWA 3RTQD 3PGCB 5GS2D 2EIDA 2FBJH 1NMBL 2VABB 5KVGL 1KCVH 4J1UB 2OQJA 1RIUH 3VCLB 1AO7B 5ETUA 2E7MA 8FABA 4OLXH 4LHUB 1PLGL 3RA7H 1X5HA 4NQDB 4PP1C 1AGEB 1ZLVH 4BK4A 2Q7YB 4WI2A 3VH8A 4DGYH 4QGYA 3NN8B 3Q5TA 3FQTA 4WI3A 2WIIB 4D0CA 3T2OA 2AJYH 2ADGB 2W0PA 2KL6A 1QKZL 4LPCA 2CUHA 4GAJH 1ZVSB 1DR9A 1MJ8H 3B9KC 3M17B 3IFOA 4XP6L 1SMOA 1KCRL 2BVPA 2X4UB 1M7XA 3DYPA 4JFZH 1L7TH 4WWKC 1A7RL 4RCAA 4TRPL 2YSSB 4HIEB 4OCLC 2OK0L 2WINB 4YGAB 4JDVB 3RWDA 3L5HA 1CDYA 1OHQA 4GG6F 4O58H 2AJZB 4NBXB 3VA2C 3IS1X 1HHIA 3SDCC 3VD3A 5KVDL 4PGDB 4M6NL 4YBLB 5FUCC 1ZA6B 5ESAB 3NGBC 2FL5B 2R15A 1ZXQA 3GMQA 3IDIB 3PQYD 5MI0C 1NSNL 4PREB 1JPGA 3LH2L 3VXTA 1H3WM 4AY0A 3RIAK 1KIUA 4NYLB 2AI0L 5D72H 4WY7L 5HYSG 5DUBB 1KJ3H 4CVZA 3CFIC 4NJ9L 4GAGH 4Z8FL 3ES6B 1KGCE 3T4AB 2ZOKA 1FL3B 4FQLL 4RIRA 1S9KC 1A1NA 4PBVC 1FFNB 4GAFB 1P4IL 4WUUA 4I48B 4YUEH 5CD3A 3BI9X 3OPZL 4RGNE 3RIFK 1FYTB 1P2CB 1T3FB 5HHMD 3EOAA 5DMKB 4J6RL 3UTTB 1Z5LA 5F9WB 2NXYB 1KCSH 2P42B 1N5YL 2JB6A 3D1MC 4WFHE 1EH9A 5IBUB 2P8MB 5C0DB 5ID0B 3OAUL 4GKZA 3UCRA 3IDXH 4BSWA 1QFWH 3DV6A 4HK3J 2F9BT 4Q6IC 5I8KH 4LHUG 1FHGA 1JN6B 3RVTC 1UENA 3NZ8A 4KJYB 4GBXB 4MYWB 1N3NB 4F37F 2VDLL 4U1IA 3C09C 4OLEA 3A67L 3GBML 4NZTH 3VFTB 4R4NC 5ID1A 5EC1B 3QDJD 1VFMA 1H9VA 2LFGA 3BH9B 2HKHH 3C08L 4BFIB 1A3QA 2YPLA 3L5WA 3RWGA 4TVPE 4GG8B 3ROOB 1KENH 1VHPA 5DSCB 3ZZ1A 2FBOJ 2DI7A 1U3HC 4PJ8D 5CBAB 3RP1A 4EXPX 1XH3A 4L3EA 5GS0L 4LLVA 1HIMH 2FB4H 5E6IA 1KPUA 1CD1A 1I8IA 1KT2A 1V3LA 4MSWA 5CJOH 3G5ZA 1WF5A 5GS0C 5DJ2A 1SY6L 3A6BL 4PJAE 3E8UL 3RGVB 5FYKE 2UYLA 5I66B 3BPLB 4NO2A 3S96B 4PLJD 1RJLA 4X9BA 1KN2H 2YUVA 5D2LF 5DYOB 1QSZA 1SYVB 2XWTB 5H2BA 3QUZB 5IIEA 1G6RL 3N9GH 3KWWA 5EBLA 2V7HA 1WBYB 2XTLA 1ZWIB 3VXUA 4YFEA 2DKMA 1FO0H 3E1F1 2NPLX 1X6LA 4DN3L 4A6YA 5GSVB 5IVXB 1EJ6A 1XGTA 3G9VA 4U6VH 2Z31D 1HQ4B 4UU9A 4KK9C 1I75A 1K4DB 4N8CL 3KHOA 5AZ2H 3T1WA 3D2UB 3KR3L 3PWVA 4FTVD 3GBLA 4IS6B 3IXAB 5IGXL 1FFPA 2GJ6E 1J1PH 4K7FA 3WJJA 1KBGL 1UEMA 2A6DB 1NCAH 4WFFD 1SBSL 4KRNA 1A0QH 3CSYA 3T08A 3WIHH 3CDFA 3DMMD 4GO6B 4OJFL 2YD2A 4G8GA 4XVUC 4A2MA 4XNYH 1UZ6F 2P44B 3SHSA 4B7IA 1WC7A 4M7LL 1QLEH 2EIZB 2KQNA 5TH2B 3G6DL 1JFQH 3BAEH 2FJHA 1ORQB 3ABZA 2EZ0C 4NZDA 4HSQA 4MJID 2Z35A 2ADFH 4S11A 2AJSH 3D39E 4BH8B 4OSUL 2HTLD 3VFSB 1FPTL 1TTGA 4NBYB 4JY4B 1K6QH 4JRYA 2NXZC 1E4JA 3CSPA 5FHAL 1H5BA 4PJXA 2M26A 3OAZK 1CICC 1KB5A 4XX1G 1T66D 1LEGB 4I3RL 2A1WH 4G8IA 4YQXL 3CLFL 1O5DT 3UROR 4H1LH 5EU6B 3OKMB 3QXWA 4ETQA 3QNXB 1G9NH 2R9HD 2VLME 2ZUYA 3ARYA 1S5IL 3SEPA 2NW2B 2P48B 4LRIA 4O9HH 1GYAA 3HG1B 4P5TC 5T1MA 5BO1H 4YHZL 2NZIA 2NNAA 3T1FB 1S7WB 2JK5A 2JIXB 1DL7H 1YNTB 3L3DA 3MO1A 3FT2A 2BNRD 1MRDH 3QJFB 5KSBA 1JWMA 1OM3L 2R4SH 1IZKA 4NRZB 1A6WL 5D93B 3K8KA 2KZ1B 4HUWB 3CPLB 1X4ZA 4JG0L 1JPTH 2K7PA 5E9DA 3GM0A 1WBZB 1WZ1L 2FLRT 3GBNH 4JKMA 1PFCA 2Y06L 2HH0L 4JDTH 3L5JA 4EN3C 5JOFA 3HZVB 4YHLH 4NWUL 3HS0B 2WQRA 3VFGL 4JZOA 5C08B 3EOBA 1WWAX 1U58A 3RWHA 4U6TA 5JORB 1YN6B 1MIEH 3DRTA 2B4CL 4GRLB 2VDML 4KUCF 3C5ZC 4R4FL 5JTWA 1GGIL 1PAMA 3ZHLA 4H88L 5DS8B 3EFDL 3TLRA 5B8CC 3N06B 4ODUB 4ODWA 1ADQA 5FB8B 4PJFB 3NCJL 1LO5A 3IFLH 3C5JA 2P8LA 2VDPH 1S7TB 4Y4FC 4MHHI 5C09E 3MLSL 3S35H 5IW6B 4GSDL 4X4YB 5KTEH 4OM1L 4LCUB 2AK4B 1UB6A 2CDEB 4TOYL 5IMKA 3Q2CA 2HWZH 4LAQH 3IRZA 1MQKL 3X12B 5IF0A 4KTEL 3MRCB 5HI5D 1NLDH 3O4LB 4RFOL 5C3LD 1KTKE 1AGFB 1MCCA 1JIBA 3QWOA 4IRSC 1CL7L 3RIAF 1NEUA 4OD3L 3PP4L 4M61A 1J7VR 3CFDA 1BFOA 2YOCA 4LVOB 2LTQB 4YDJB 3BD4A 3C60B 4OZHB 5HY9B 4PJ9A 4YDIH 4Y4KB 3BKML 3MUHL 4XCEA 2AEQH 1NLBL 2DQIL 4J4PA 5TE4H 5F9JB 3RIFF 1MFDL 5JHDA 4M93C 4PJIE 3PL6A 2DS4A 3BZFA 4JY5H 3VG0L 4JVUA 3U0WH 3EHBC 2NR6D 2VIRA 1T2QH 3ULVL 4JHZA 5BZDB 5B21A 5D1ZA 4S0TD 4HUXB 4O02H 2CO7B 3MNVB 3VFMB 4WHYG 3ULVC 1A6PA 2D7TH 4WTXA 3A6OA 3UTZB 4F7EB 5DVMA 6FABL 3AMLA 4ZS7H 2OZ4L 2WWKT 4XBPA 5DFVC 3BD5A 1TLKA 5BRZB 3D25A 4I0PD 2LV4A 2YD1A 1UWEH 3QG7L 4G8FA 3T2NL 1HN1A 5CP3H 1AQKH 2DQUH 5KW9L 2MSPA 5JIPA 5HGAA 1EX0A 1CDGA 4DGIL 3B43A 4W6XB 1IGYB 1UACL 2A9MH 5ISZD 4HS8H 1DLFH 3HR6A 3BZEB 2OX5A 4I5BB 5FV2A 1VKXB 1J0HA 2GFBB 2HJLB 4OCYH 5F8QC 1QQDA 3KYOB 1QRNA 1RSFA 1BZ9B 2JTDA 3PQYE 5C6PB 4I0KA 3UO1L 5FYLL 1DUZB 4PRPA 2CIIA 3STLA 1NGQH 3ALWA 1NGPL 4UOW1 3VFRB 3L3IB 1IAIL 1GAFL 5I8CA 1ZGLP 1U3ZA 3IF1B 3WHE0 4M5ZL 1CXFA 1QRKA 3U30C 4QRTA 4ZUVA 5GRVL 2D2OA 3HUJA 4LL9A 1CU4L 3MRNA 4N5ED 3FONA 1TTFA 5CKGA 5ABDE 2P5EE 4S1QL 2OL3H 4R7NA 3EYQC 3IDYC 3LDBB 4F8TA 1JPST 2FJFB 4D8PB 2X4QB 4MDIA 4S0SD 1ONQB 4RMQA 3TVMB 5HHME 1QFWI 1ZVHA 1J1OH 1VB9A 3TBTA 5E2UH 5J1AA 3GHEL 1LO4H 4XVSH 5A2IH 5FO9B 2R1XA 4FQIL 4PUBH 2VLLA 5LGHL 2X9YA 4KKLD 2EEAA 1RHHA 3ZKQD 4AENA 2D31A 1NCCL 2VB5A 3QCTH 3AAZA 2OTPA 3IS0X 1T0MB 2DAVA 5I1KL 1FRGL 3U0TB 2QQKH 3IDGA 1XCQB 1HILB 4QHKI 5D1QA 5T3ZL 2BNUA 5ERWA 1F97A 3RUGA 2B1HH 4NQSA 5DD1H 4N1EA 4YDLB 3QDJE 1HXMB 2KQMA 4ISVA 1CDBA 4YHNB 5CIPH 4F15C 4ENEC 3LKNB 1HXYA 4M1CD 3U4BL 1LD9B 3QUMB 1NCUA 5DUPH 2H2SC 1LHZA 3BJLA 5CJQH 1UKSA 4LLDB 1U9KA 5HPMB 1EUUA 2AQ2A 2B5IC 3IRPX 4FP8H 3ARXA 3NH7L 1FVEA 1YPZA 1T1ZA 2A74B 4KVCL 3NFPB 4JLRB 2VXTL 4LU5H 1DBML 1H15A 5FECA 3MNWB 1AC0A 5IMLB 3UTQB 4DWHA 5INDA 3F12A 1O7VA 1FVCA 4YZFF 4HWZA 5FOBA 2Q86A 4OLYL 3CCHA 3WFBH 1U8PB 1M7DA 4JM2B 1YEGH 4JGMA 1UQSA 4Q9RL 5IFJA 4QTIL 4FTVE 4PJAB 2OYPA 3X3FH 3C2AL 1FL5A 5IB5B 2NYYD 3SE9L 5EBWB 2ESVA 4WFFE 4W6WB 4ZNEA 5D7JB 1JHTA 4FA8A 4TQEH 5A16A 1KIPB 4HXBH 2EDLA 3TO4C 2XTJC 5EUOA 4WI4A 4NQEA 5EU3A 1PX4A 1Z9OA 4PS4L 4BKLB 3RWCB 4M8QA 4MJIE 3P77A 2XN9E 3ZL4H 3H3KA 5TE6H 1F4HA 1MH5B 4KAQH 1XR8A 3DRQA 4G42A 3WXVH 4R2GB 1YN7B 2R2HB 1T83C 5F70A 5HHOD 3TN0C 1JUFA 1D9KD 5ICZB 4FQ2H 3LHPH 3WLBA 2AXGB 1AR1D 2CXGA 3CFEA 4QT5B 3L7EA 5L2JB 2MOVA 4UT9L 1BPVA 4GUPA 2G2RA 2WUCL 3VWKB 4OCRH 4NHUA 2WBJD 3KPPB 4M43L 5IKCA 1P1ZB 1J05A 3OKOA 1UXWA 4QWWD 1U8HB 5DRNA 3UPAA 4C56B 3P0VH 3D39B 3KYKL 2A6JA 1ED3B 5CJ5A 2VQTA 4OD2B 4P4KB 4NN7C 3NCYS 3BQUB 4RGNC 3TWCH 3R06B 1KUMA 4XCFH 3I3EA 2R0LH 4NKIL 3RDTB 1P7KA 2BNRE 2I25N 4J12A 1JL8A 3L3KA 3RVWD 3DUSB 2QSQA 2AK1L 3HTLX 1IBGH 2YD7A 1NGZB 2QKIB 4NOBA 4KUCD 1U6AH 3BH8B 5DXWA 3ILQD 1FAIL 1ZHBA 3KS0H 4UBDC 4UILH 3QNYB 1ETZB 1S3KH 4IOSD 4WDIB 3RWIA 3OAYK 3WO4B 5CHNA 3E6FB 5D1XB 5EBMB 2YZ8A 4Z0XA 3EKCA 2PXYC 3O3DB 1KELL 3EO9L 2VDNL 3P9MB 5SWSA 2HFFB 3THMH 1AXTH 5JMOC 1K2DB 3VI4E 5BXFB 2WUBL 1F8TH 1RUML 2ZCHL 4YIQA 1PKOA 4QHNB 3DHJA 3RRQA 3U9UB 4P48A 4YBQD 4JZJA 3FHAA 3T65A 1NAMA 4FQXA 4XP4L 3SDAB 4MA1C 2VXQL 2XA8H 2PO6B 3TNMB 3REVA 4MJ5A 1A7NH 5DZOA 4K3EH 1E6JH 4PJGA 3V7MA 4HGWB 1SEQL 3F7VA 5E8DL 1DQJA 2F54A 3QIUD 4CMHC 2HKFL 2ZUUA 3U46B 5ESVA 5IM7A 3Q6FB 1G9MH 1G7PA 3SQOL 4NO5A 1FBIL 5EWIH 4YO0B 3RZCB 4H20L 4XP5L 3VG9B 2NX5A 2RFXA 2G60L 3QRFM 2ZUWA 2GK0B 4MQ7B 5HDQL 3CH8A 4JREB 1SYSA 1RV6X 3STZB 2EDYA 4QNPE 4PLNC 5KOVC 2R0KL 35C8L 1SM3H 5IR1B 1KPVA 3UJTL 2FO1A 4C4KT 5C09B 3DLQR 5F6IB 2X4RB 2ZUSA 1BD2A 1J1XL 1L6XA 1CFTA 2C1OB 1A3RL 2R8SL 3UTSB 4HJJL 3ET9F 1BQUA 3EDDA 3FQWB 3NFSL 2VXUH 3EIFA 4JJ5A 1S7UA 1MFCH 5FK9B 3UBXB 5T1LA 1P6AB 1F4WL 1KB9J 4TVSa 2V5YA 1KLGB 2YPKB 3VRLF 1QFOA 2BP3A 2H32B 3QG6B 2EXYD 1A6AA 3MRMB 1E4KA 2CDFA 5AG9A 3H7LA 5IT2H 1HQRA 3CH1A 1I1AA 1G7MA 4GG6E 3QPXL 4PJXF 1UH4A 4U2YA 3ZYZA 1QSFA 3DGGA 1T0PB 2CIKB 2DI9A 3WLWC 1TVBB 4KKAD 4GRWB 4PJIB 5JQHC 1AQDA 1KTRL 4OZIA 5EO1A 2FECI 1XFPA 3WSQL 4MS8C 1A7PL 3KXFA 3B8YA 2J5LB 1PG7W 2V2WB 4CMMA 3L95B 4PV9A 3R0NA 1BREA 5ISZE 1JF1A 4M3JA 4P3CL 1HI6B 2W9EL 2P8PB 4QXTA 3FTGB 5JPNA 2R0WL 2EYRA 1HZHL 3TBYA 5C0RL 5CAYB 5KSBF 2DQDH 5F88B 4G43B 2EKSA 4FMKA 1DSFL 3MBEA 3F62A 4X6DA 4YXKL 1IGFL 5HVHB 2FIKA 5EZLB 3S36H 4HIXL 4KHTL 3CFCL 3V6FB 2XKNB 3RL2A 1F00I 4QRPA 1R5VA 1TZHA 3K2UH 5E6IC 4JO3H 4LFHG 3QCUL 3QUKB 4P2CG 2Y23A 1C8PA 2IGFL 1T20B 1EHLL 5D7IA 5EU4B 4Z7UA 3KPLA 1CBVH 1RU9H 5AAWA 3A0OA 2YC1B 4HZLA 1TFHA 3PXJA 4XBEL 1CDCA 4F58H 4XTRD 2P43B 1M7IA 3G5XA 4D0BA 4U1LB 3U4EA 4A6YL 1NDMA 4R3SA 4OLUH 5JW4N 3QA3A 5DD0L 1LO0L 3MLTA 4GJTB 3UBXG 5BV7L 3PWNA 3P9LA 4RWYH 5TDPA 5GGUA 5HTSA 2DM4A 3BP5B 4LPYA 4WJ5A 4LNVA 3FO2B 3JTTB 1MWAB 1NMBH 5KVGH 4LF3A 5BV7C 2X2YA 2J8UA 3ARZA 4KH2A 3WYRA 4Z6AT 1BVLA 3MRGB 4YDKL 5KANG 1X5FA 3BMVA 4WTZG 3VXQA 4XCNB 2BSSA 4K23L 1J9CT 1PLGH 4K55A 1X5YA 4X98B 5HHMB 3QNZB 2DM7A 3MV7A 4JFXB 1LNUA 2HT2D 4U4BA 1EUTA 2MPAH 4K7PH 5BS0A 4O5LH 3HA0A 4NDMB 2BRRL 4ONFH 2IPKA 4NRYB 1J8KA 5KVFH 1DEEB 1UB5A 4XP6H 1DFBL 3HHRB 1FL6A 4NQCE 5E95B 1XR9A 3MRQB 2X9XA 1LEKA 4XWOD 3EYOB 1FIGL 3BYTA 3EO0A 4TRPH 5SWQA 4LKCB 1KB5L 2H6PA 5FDYA 1NCDH 3MJ8B 4PRHD 3QDJB 2QJDA 3UYRL 3RPIB 4PRAA 5KVDH 4M6NH 2FLBT 1TENA 4RAVA 3RTQC 3MRLB 4PJ8B 1IGTA 4X5XA 3O3BA 3D18A 4DEPC 1MCJA 4D2NA 1NSNH 3LH2H 4GQPH 4X4ME 2ZUTA 4OZFA 4UINL 4ZFFB 5IK3B 2F19L 1V3MA 2IG2L 1OVZA 4MQTB 4LRIC 1ZHKA 4Z8FH 4C58B 1Y0LA 1HSBA 4XZUB 5L0QC 4P2QA 4FQLH 2W9DH 4U1NB 4HIIA 1P4IH 1R24A 2IEPA 3IETB 4M7LT 5KSAD 3T77B 2RQ8A 1F58H 5MEOB 3N0PB 3RVXC 4J6RH 1U8OA 2NY7L 4HWNA 2V7NA 2Z31B 1Q1JL 3HE7B 2J7LA 3N85L 2Q6WA 2ERJB 4FTVB 4X7SL 5DHVA 1HWHB 3QI9C 1BIIA 1F2QA 1FORL 3LRHA 5HGHA 3TFKD 3JSSA 3DMMB 1JGDB 5HYJD 2F5AL 2EIEA 1ADQL 5IQ9A 3GBMH 1NUDA 5LGJB 4JPVL 2JCCA 4ZAKD 3MXVL 4U6YA 5FFLA 4RBPH 4U6HB 3RY6A 4G6JH 3O6KL 4MJIB 5DD6A 2R2BB 4WGVB 3I6KA 1KTDB 1T0NB 2DWDB 4LLUB 4DAGH 3NACL 3W2DL 3JWNC 1TJHH 2YPLD 2GITB 3IU3B 3FZUC 4MXQD 4R0LA 1DE4B 4UOW0 4CNIA 4MJ6A 4HK3N 1BWMA 5FA3B 1SY6H 1I85A 3I75B 3E8UH 2QL1A 3NZHH 4L3ED 1AXIB 1EBAA 4R9HA 4KVNL 3LKOA 3DVNB 43CAA 2ZP0T 4EDXA 1MAMH 5IUSA 1T03L 4AL8L 3EO1A 3MYJA 4L4TA 1I8MA 3LS4H 1G6RH 1J0KA 2VXVL 3MZGB 5CS7A 4YEFA 4DN3H 4OZGE 1IM3A 3DX9B 4PJ9C 2EDJA 1NFIA 5GS1B 4JHWL 5DQ9A 3RZWA 4Y5VB 4N8CH 1KV3A 4I4WB 4ZDHA 1MCSA 2BVUA 2NTFA 3KR3H 3MRDA 4CRPA 3OKKB 5IG7A 3EJZC 4Y5YA 4Z7QF 3BXNA 1A1OB 1GPOL 2DMKA 5CEZH 1JRHL 3PL6C 4HX1A 5IGXH 3ZKSD 1DQQA 1KBGH 1YPZF 3QEHA 2V9QA 2VDRL 3LZFL 5D1ZC 5JUEH 4OJFH 5C07D 5C92A 2VO5A 5BZWB 2GTWB 2K3TA 4M7LH 3B6SA 1MAKA 2IMNA 5MEQB 1U8QA 2VLRD 3G6DH 1OT2A 3QXDA 1D5XA 1CFQA 2F58H 5DC4B 3CVIL 5AZEL 3U79A 3OR7B 4OSUH 4FS0A 5D5MB 1FPTH 3OGCA 3REWA 1FZKB 4JPIA 2EIBA 1NMCC 4QHMB 4HWBH 2VYRE 1W0WA 2ZZUT 4Y7MA 2VDKL 4E0RA 4YXHL 4I3RH 2VNCA 5DA4A 3JUZA 4LSUL 1HKLL 4YQXH 2VSDA 2K9UA 4NNPL 1GH7A 3MLRL 4I18B 3QIBC 4X83A 3MRRB 3MUY1 2E8YA 2CLRB 3KNBA 3MRBB 3CD4A 5JHLL 4U1GC 1IEHA 4NQXB 2Z9TA 1R3LA 4U31A 4YHZH 4IOIB 2RBLA 5TFSL 3SO3B 5DJZB 1DLHA 4YE4L 3GGWA 2Q76B 5FUOL 1AD0B 3BP4A 3F58H 4PV8B 1YMMD 3K4DA 1A6WH 5I1LA 5HYQA 4JG0H 1VERA 3O41B 4P5MA 3IDJA 4N9OB 1U8KA 1I3GL 1LE9A 4RQQB 3EYUL 4LSVL 3WHXA 2HH0H 3KPRA 3B9DA 4OF3A 3S5LB 3DGCR 3DYOA 3VFGH 4O2FA 2MMXA 4UT7L 4S1RH 4M1GL 3PDOA 3TBSB 1T66C 3GHBL 3BRDA 2FHCA 4V1DA 1MY7A 3ROLA 3SDXA 1T1YA 5BJTB 2YKLL 4LNRB 2I9LB 5INCB 4B5EA 1J18A 4QHUB 3AU1B 4GG6B 2VITA 5D1QC 1N64H 2R9HC 5DRZA 4ODHL 4H88H 4PRDB 3EFDH 4GW4B 4WU5B 4NSKB 4X9GA 4LLWB 3CDGB 3NCJH 1JGVH 1MNUH 4B50A 4CW1B 4U2ZA 4I0PB 5DWUL 5FAAA 4ZFOB 3S3JA 1CLCA 4BZYA 1U92A 3I02B 4GSDH 4EI6A 1IAOA 4PGEB 3WFDL 4LSQH 1L0XA 3VD7A 1A4JB 4OKVB 4TOYH 4QTHA 5D7KD 3EDJA 4ZOBA 4MMZC 4KTEH 5DEFB 5DJ6A 2DDQL 4PG9B 5ISZB 4LP5A 1ZANL 4KUZL 4NKDB 4Y2OA 1B6UA 2NXZB 5EC2A 1YC8A 5GJSL 3TZVA 3BISA 5IHZB 3J8F7 4R97C 1AKJA 4JKWA 1CICB 1KYOK 2ZKHL 2XWJA 4PGCB 2VL5B 1R5IB 1KCUL 5LQBL 4PJHA 4MA7H 3ZDYF 1LE5A 3HRZB 4JKPL 3BKMH 2R23A 2IF7A 1NLBH 2DQIH 4OI9A 2CDGA 1VENA 2Z92A 1VFBB 1AY1H 1OQXA 3KPSB 4JJHA 1WTLA 4D94A 3T0EA 5D70L 3VG0H 1IEAB 3ME0A 5CBEA 3ULVH 1IQDA 4M48L 4J4PD 2V17H 2YZ1A 2VR5A 4JO1L 3SO5A 1AP2B 1KN4L 5JHDD 4RAUA 3O2DA 4H5SA 3TJEL 4MAUL 6FABH 4KK5C 1UZ8A 2OZ4H 4OLZL 4FABL 4OBSA 4J23A 5KOMC 5DLMH 1IGML 1FQ9C 1YNKL 1T4KA 3L1OH 3VFNB 1JPFB 3O6FD 3QUXA 5K59F 2GUOB 3T0XA 3TBWA 3ARDD 5HJ3A 4F7PB 1VSCA 3VGAB 1Q0YH 2BMKB 4PGBA 2XQYK 5KW9H 2G5BA 4WHYH 4NHCL 2HT3D 1CGSL 3ARVA 1UACH 2ZSVB 5J6HA 4PRHE 4AEIL 4PTUA 4Y2DA 5KSVB 1ES0B 5DA0B 5D2LB 3CDYA 1NBYA 2RB8A 4XHQA 1PEZA 5IROC 1NANH 1HNFA 3AVEA 5C8JA 3Q3GB 4U1SB 1H3TA 1IM9A 4ZUWB 3I6GB 1QHOA 1BBDL 3UO1H 2VDOH 3DIFB 2CKBA 3HMXA 2DYPA 1QBML 5GGSA 5C0CA 3LSOB 3SKOB 2A6KA 3QQ3A 1IAIH 1GAFH 4K71B 1JK8B 2AGJH 1ZKAA 4M5ZH 4YEEA 4HK0A 4S2SA 4DKEH 1KC5L 1TCRB 3VWJA 1CU4H 4OV5B 4OZIF 5F9OL 2DQGH 4S1QH 3UPRA 1P9MC 3VFWB 1DZBA 5HYEA 2YRLA 3BFOA 4CJ1A 1QSED 1QNZH 1BHGA 1ND0B 5GGVL 2FIRT 1G1YA 1JNNH 3H0TA 4LKXB 4F9PA 1MFBL 5DMIH 5DDHA 2AJVL 2DLEA 4I1NB 5T5FH 3V4VL 1G7JB 5GGRY 3GHEH 5T3XL 1UJ3A 1WEJH 5F89B 4X6DF 1S9YA 2HLFC 3QFDB 5KG9A 4FQIH 1CVRA 2L0DA 1NCCH 3H6JA 1NAML 4CL7A 5I1KH 2PTTA 1CFSA 5T3ZH 1LP9A 4FQQA 5HYJE 4P2OD 4JZJC 3GSWA 4CDHA 1AHWB 3ULUF 1T7YA 2HVKA 5E03A 3MUGA 5D7IF 5I1IL 1HH6B 2APWA 4JFEA 5C6TL 4E41A 3U4BH 4MVBD 3LY6A 1JE6A 4XXCA 3GO1H 3EYFA 2HVJA 4M03A 5HHOB 2FR4B 4GKSB 3O9WA 1D9KB 3NH7H 4KVCH 5JIIA 1DBMH 3JV4B 1XGPB 2ARWA 2PCPA 2WP3O 2BNQD 4L3AA 4XMPH 2P24B 5IEHB 5DEGB 4F9LA 2J8UF 4ETYA 2J4WH 2WBJB 4NM4L 1BLNA 1JNLH 1X4XA 2VZOA 4DK6A 4NFDA 5IVOA 4KKLC 4U05A 1T1WB 2H2PC 3KJ4B 1DBBH 1NFDE 5ESQB 5ALBL 5FDWB 1CN4A 1IKFL 1EGJH 4RA0C 5FXCH 2YA0A 2E7LA 3OB8A 1D5BA 3WDHA 3ZLQC 1TNNA 4OCSL 4Z76B 4HKBA 1KF9B 3DBXB 5CD5C 3FT3A 4Q9RH 1OTUD 4ZUSA 4QTIH 2KBGA 1GXEA 1CZ8L 3OHXA 4EI5C 1BJ1J 1EAPB 4ZS6D 2Z8RA 2D4DA 1VFAA 5E7BA 3KDMA 4HJ0D 3RQ3A 1PX3A 2IADA 3V5HB 3PP3K 1YMHB 3FB6A 1OD7A 4KHXH 1WBXA 1MREL 5C07E 1E4KC 2P5WD 5C0IB 4LSPH 3RWJA 3TBVB 4L29B 4YHKH 2ESVD 2YRZA 2VLRE 1A4KA 2ICWA 4PS4H 3NCBB 4LSDA 3BW9B 1T5WB 5C0NC 1UKTA 4PJDA 1A7BA 3FQRA 4JO4L 5D7LD 3QWQB 1N2RA 2G75B 2BHYA 4K2UL 1MCEA 4NQED 5IMMA 4YDVB 4QF1A 1RVFL 2VLKA 3IGAA 1HH9B 3O3EA 4FFVD 1H8SA 3G6JA 1KEGH 2BZDA 2OTUB 1DQLH 1FAKT 4UT9H 4JFFD 1DVFA 5C9JB 3QIUB 3HR5B 4PY7A 4FN0A 4X5WB 3OL2A 4M43H 1FO0A 3MQIA 1MFNA 2C3GA 4BSVA 5SX4H 3JWDL 5IP4A 1EO7A 3UJIL 4G9DA 2H8PB 2VJXA 1M6OB 5HSFA 5E99H 3ULUL 2F74B 4JN2B 1SJXA 4KI5F 4OAWB 3JWDC 4PGZA 1HNGA 3IVKA 4JPWH 4NKIH 1JGEB 3PV6A 5J3HD 4QXUL 2XZAH 3WIHA 3V0VB 1NGXB 3BP7A 1YMME 4N0FB 2AK1H 2PW1A 1OLLA 1HEZA 5DVLA 1ZA3B 3LQZB 4MA3A 5E8NB 3WUZA 5IFAH 2CLVB 3HCVB 1JZ4A 1FAIH 1RQ5A 4QYOB 4X99A 3C6LB 5CGTA 4FHBD 5B4MC 3SKMA 3BZ4A 1BAFL 2JCCF 2YBRA 3QZWB 4XRCA 4JY6A 5J11B 1OWRM 1KELH 3EO9H 4Z77B 1C7SA 2IBGA 2XYCA 3CFJA 4TVPH 4WV1A 5DO2D 3QEGL 4HUMB 1UYWL 2B8OT 2ZCHH 1RUMH 4QRUB 5C9KA 3RFZC 1EO5A 4TNWK 1N6VA 1PQZB 5B3NA 5J6GB 1MHPL 3BDXA 4XP4H 5F3HB 4M6MH 2VXQH 4I3GA 1YEFL 3NCMA 1TCMA 3I84A 1MJ7H 4CJ0A 3ARQA 3ILPA 1G1CA 4LSSL 1C16A 3KGRA 4N0UB 5FYKH 4R7DA 5K9OB 3MLZL 4WW1B 5CJXC 1CE6A 3MSPA 4MNGA 5GGRB 4FQXD 5E8DH 4P2RA 2XFXB 3O0RL 4ODXA 4FZEL 4LCWD 2BVEA 5D7KE 2ATPA 2JJSC 1RZ8B 4A2LA 3JWOL 3QFJA 3SQOH 1FBIH 1M71B 3GSQA 2BOBA 3VXRE 3GMRB 4H20H 4XP5H 1ZLVK 3FFCA 1XF2B 3ILQC 3T3PE 2H26A 3X14A 5HDQH 1E28B 2DQJL 5T5NG 2AP2A 3GSXB 4OGYL 4X0KA 3TPUA 2O5XH 3H9SD 1U0QA 3UPCA 1S9XB 3D0VB 1DQTA 35C8H 3ZDXE 4UUJB 3UJTH 1S9VA 1SJEA 5CFHA 5EZOL 3SDYL 3VDCA 4ONHB 4LPVA 1J1XH 1MRCL 1A3RH 4QHLA 3GB7B 1MSPA 3B3IB 4WHTB 5FKAA 2R8SH 3SPVB 1B0RA 1Q9OB 4HJJH 1I7UA 4ELMA 1FGNL 2IAMD 3AM8A 3CC5A 1Z9SA 4OCWL 2O26U 5I76B 4WO4A 3S4SA 3BWAA 1BD2D 3SJVD 3O6LH 2DTSA 1MLBA 1TQCC 1FSKC 4G8EB 1EIBA 1RUKL 4WTWA 2PW2A 4DTGL 5I8EB 3TT3L 3CMOL 3PIQB 4OTXH 4PJEA 4J8RB 2H3NA 4I2XA 5MEND 1A14L 5JXAL 4P99A 4GW1B 4YX2L 3WNNA 4GAYA 3VXPA 1I1AD 4OFPA 3GMPA 4MAYC 2ED7A 1J8HD 5FM5O 4G6KL 5I0DA 4KQ4L 3WSQH 1QSFD 4U1JB 5EN2B 5C71A 1A7PH 2X10A 3GSVA 4KU1A 1NANI 2B20A 2JF1A 1U95A 1YUHB 5FIEA 2X1PA 4YH6A 1OGAD 4L3CA 2R0WH 2OQJB 3ZE0E 3SGDH 2YD4A 2RAMA 5ETUB 3BO8A 8FABB 4LAJH 1MI5A 1YY9D 1NBZA 4IJ3C 4U1HA 1AI1L 1IAII 3VXSA 2BOCA 4YXKH 1IGFH 1ZSDA 3VH8B 4JFQA 4HIXH 4KHTH 3RY6C 4P46C 3CFCH 5GPRA 3VGDA 2P7TA 4YXLL 2UVFA 1IEBB 5FHBL 3MBED 3QULA 1RUPH 1XCTB 4Z78B 4PRBB 3MREB 4PRHB 4RMUA 2IGFH 4R0LC 4K94L 3C9NA 3CDCA 1EHLH 1I85C 4HC1A 4KKAC 1FVDB 1QSEE 2GTZA 3Q1SH 5GZOC 4JZNA 2O5YH 4JN1L 4XBEH 5D6DC 3RWDB 4TUJB 3ULUD 2H41A 4A6YH 2GJJA 5E4IA 4HKXA 4PG2C 1HHIB 1P4BH 1U8NB 2CQVA 4PJ5A 1XGRA 5DD0H 3MV8E 3OR6A 5BV7H 1CIUA 1I7RB 5CP3A 3ARBA 3GMQB 4FMFA 3FMGH 4MX7B 1JPGB 4FG6C 3PWPE 4OFKA 3IDNA 4F7CB 3FCTA 2ARJA 4Y5YC 3PJSB 5AAMA 2FSEA 5D9SA 5KSAB 1C5CL 4K23H 1ZHNB 1WWWX 1I8KB 5JW5B 3HB3C 4Q2ZA 2FJGA 4L4VA 4CAGA 1A1NB 5F1SA 3OMZA 1G7IA 5E24E 5C7XL 5CD3B 5C6WH 1HOCA 5M95B 1WISA 1AIFA 1HYRC 3DX8A 1H0DB 3FB8A 3TH3T 4Y1AD 4PJHF 1Y6NR 4FFYL 4W70A 4UIKL 1DFBH 1Z5LB 5BS0D 3HAEB 3M07A 1FIGH 1Z9LA 5I1JL 2OBGA 5HYJB 4OIAA 2BNQE 3IJYA 4Z7QE 2EEDA 2BVQB 5KVEL 3DV6B 3BZDA 2OL3A 4AIOA 3AC0A 5ALCL 4ZAKB 3OX8B 3NZ8B 4WW2C 3UYRH 1ZOXA 4HLZG 2ED9A 2FYYA 3NCYP 4LCCC 5ID1B 4JQIL 2YR3A 1WFOA 2I27N 2YPLB 3RWGB 2BVYA 1G7QA 3T0VA 3WIFA 5C0FA 3ISWA 2NLJA 2MTPA 2IG2H 4WI9A 1T89A 4L3EB 4LLVB 1KPUB 1CD1B 2CLZB 4WNQB 1GC1C 1KT2B 4MSWB 3WS6C 4Y4HA 3IJHA 2VE6A 1QSVA 3G5ZB 3JVGC 2NY6C 5JOEA 5DJ2B 1CLOL 3QUYD 4P9HL 1U8JA 4P23D 5CIPA 2J12B 2P5WE 4W68A 5T33H 2X1QA 5DJCB 1RJLB 4H0HB 3HZYB 2NY7H 4JFPA 2GSGA 3WFZA 4J7RA 4P9HC 1FNAA 5IIEB 2C1PA 3N85H 3KWWB 3CLEH 4W6YB 5EBLB 2V7HB 4M7KL 4JDZA 4JGJA 4OF7A 1B0WA 5D7LE 2CGRL 3DXAA 4FNLL 3TNNA 1XGTB 4NGHL 4J2XA 4UU9B 1EEYA 5CGYD 1JI1A 1FORH 4KI5D 2DMBA 3DVGA 4HUNB 3PWVB 5BV7B 3O81A 4PRID 5C07B 1BF2A 2BY0A 2F5AH 2XNAA 1YEHL 4MB4A 1YJDC 3WS3A 3O8XD 4JFFE 2LABA 1UA6H 4JPVH 1D5ZA 2VLRB 1NC2D 3T4YA 3FAXA 2LAAA 5J06A 3O6KH 4XNMA 2GCYB 4XPTL 5F96L 1I7ZA 1OARL 3G6AB 3NACH 3HAEG 4JFHD 2FJHB 3MJ6A 1Q8MA 25C8H 2Z35B 2MKWA 3UZQA 3VRJA 5I15L 2UVEA 3B2VH 2MHAB 2IANA 4H8WL 4JRYB 5K93A 3VFVA 4Y16A 4NKMA 3S3PA 1EFXD 1LP9F 4LIQE 3TZVC 1H5BB 4PJXB 4POUB 2X4OB 2Z93A 4JR9L 3QDMA 1KB5B 1CTOA 1YDPA 2R2CA 4LQ1A 3WUWG 3ZKNC 1YQVL 3OJDB 2VXVH 4HH9B 1XF4B 3CZFA 3MROA 4XHJD 1NJ9A 4U3XA 1MCWM 4ETQB 4MD4B 2NY1D 4FQCL 5L6YL 2IPUK 1YEIL 1JRHH 5DI8B 4C55A 1YMMB 5IW3A 3KYAA 3D87B 5T1MB 1UJTA 3O2DL 5C0AA 2X5PA 2VDRH 3MACL 2NNAB 2JK5B 3WBDA 3JV5A 3L3DB 1J0ZA 2R2EB 3FT2B 5KSBB 3ZTJG 3ZKXC 5JDSA 3VMOA 1CR9H 3H9HA 4MXQC 2AJXL 5F7EL 3WN5A 2QR0A 4NP4H 5L2KD 3ZDYE 4X6CF 4LCWE 2A2QT 1UCTA 4LMQE 5I1HH 1LEIB 3QUXC 3U7AA 1NGYA 5AZEH 1NMAL 5JOFB 5J1SC 1DBJH 3F6IA 1IE5A 1F11A 1TQBC 5ITFB 5K9JL 4RSVA 3C5SB 4JZOB 2VTFA 4ZQKA 3EOBB 4WRLA 5JXEA 1M1SA 2F8XC 3RWEB 2PN5A 4Q9CA 2VDKH 3SDDA 5I9QC 3HFML 3H9SE 3RWHB 1UG9A 2AJ3A 3IYLW 4LSRH 4X7FC 3ALPA 5CSGA 4YFDB 4LSUH 5DRXA 4Y2DC 5H37G 5EOCL 1OTSC 3IFNL 4HUVA 1F4YH 4X6EB 3MLRH 3EZJB 5DQJA 2CKBL 4ODTL 3HMXL 3O2VL 1F6AA 5H94A 1BQHA 1VACB 1LO5B 2AXHA 4LLYA 1ZHLA 1RZGA 4J3XA 2P8LB 1QR4A 5JHLH 1KCLA 2O93L 4OT1L 3O45A 1UB6B 1I3RA 4PJDF 3SJVE 3LKSA 3D3VD 5TFSH 5IF0B 3ULSA 4YE4H 2QEJA 3DUHA 4KFZC 4JPKH 1TPXB 2QQNH 3SCMA 1OSPL 4ZNCD 3FN9A 1I1CA 4PJCF 3JXAA 1GIGH 3QWOB 4OUUA 5MENE 4N8VA 4XCCL 3G6JF 1I3GH 1MJ8L 2D3VA 2F15A 5C0EA 3MMEA 2GSIA 1QFUH 1A2YB 4M61B 4F9PC 1TTUA 3CFDB 1BFOB 4JFZL 5DJ8B 1L7TL 3MRFB 2ZUXA 1J8HE 5AG8A 4F3FB 2HMIC 4UT7H 1FNLA 5CLTA 1UJ3C 1GZPB 3PNWB 4XCEB 3GHBH 3SGDI 4OF6A 3KPRD 5E94B 3MGOB 3MGTA 1A9BA 4PJBA 5JHDB 1H8OA 1ZTXL 3BZFB 1X4YA 1CD0A 1OGAE 3DVIA 4YPGA 4V1DD 3BRGC 1A8JH 4PBXA 3V4PH 4XAWL 3TJHD 5FM5M 5EOCJ 4MXVE 5DWUH 4NCDA 5D72L 3ZT7A 4DCQA 3KLHC 1KJ3L 3LEXA 4XBPB 3RBGA 5LCVH 1EMTH 5BQ7A 4U0RB 4FXGA 2XG5A 5GGQH 1ZANH 3KPOB 4G8FB 4KUZH 1HHKB 3INUL 1JZ7A 5E6YA 4YUEL 5GIRA 4ZUUA 2APFA 1JV5A 5HGAB 2OJZL 3NABL 4NQDD 4APQA 2SEBA 3FJTA 1KNOB 3UDWA 5GHWL 1TZIA 2ZKHH 1Z2KA 2WIMA 4YBHA 15C8H 1FNGB 2WK2A 2X4SA 3ARTA 5LQBH 3KPMA 4WEBH 2CK2A 1CG9B 3IDXL 2PR4L 4ESKA 1QQDB 4QRQA 2YD8A 3MLXH 2OS7A 1YEJH 2QQQA 3U6RA 2KUTA 4MGXA 3PG2A 1JGLH 1F02I 5JPMA 3STLB 1P5VA 2YD5A 4NZTL 1T21A 4NJAH 3BPNB 3WFHA 5I8CB 1KN4H 4HXAL 1U42A 2HKHL 4QRTB 4ZUVB 3BT2H 5DJAB 3DV4A 3NCFB 3T0ED 4DW2H 1UWXH 5J12B 4XB7A 4HAGA 2J8UE 1WCBB 2VISB 4MAUH 4R7NB 4FQHA 5DJDA 4OLZH 4FABH 4LARL 2FB4L 5A3ID 4UDUA 4YHMH 4MDIB 1YNKH 2VXSH 2C7UB 5CJOL 1RZKL 4Y1AE 1H8NA 2UWEF 5IMOA 4HLJA 5EFIA 5F7LB 5DJYB 4XP9H 3TBTB 5BS0E 4ZFZA 3SN6N 1MJUL 2R1XB 3GMMA 4NHCH 4ELMF 4Z7WA 1RZKC 1CGSH 2D9CA 1MHCB 3HI5H 5E70A 1RHHB 3BPOB 5HHXL 1ULVA 4QRSB 3N9GL 4AEIH 4MB5A 4WHDA 1Y6MR 2APVA 1FO0L 5D1QB 1W0VB 1QOKA 4QRRA 2DBLH 2VAAB 4NRXA 3HNVH 4Z7NF 3P4MA 2XOTA 5ERWB 4U6VL 3NFNA 5I19L 2JELH 3K2MC 4PJEF 2NXYD 2DQEH 2PYEA 5AZ2L 1BBDH 4CVXA 5A43C 1KJMA 1BEYH 4P57A 1QBMH 1HXYB 2YD3A 1T2XA 3KPNA 1I4FA 4KJWC 2IH3A 1CLYH 2BNQB 5E56A 1A0QL 1IM9D 3WIHL 1KC5H 2X4TA 4F2MA 4GBXD 5BVJB 1YPZB 4XNYL 5F9OH 1VADB 4G9FA 5GJTL 3UMTA 4Z7VE 1H15B 4XH2A 5I1EH 4LEOA 5GGVH 2GAZA 3ARDC 3B9KA 3HNSH 5HGDA 5DHXB 5INDB 1WFUA 2DJ4A 1WT5C 3E3QE 3F12B 3VWJD 5JLZA 3DHMA 4L8SA 5DURD 1FVCB 3V4VH 1QD0A 2AJSL 2ICWJ 2HT3C 1AGDA 4HWZB 1LGVA 4MNHA 4WWKA 2Q86B 3B2UC 3ALXA 5TF1L 5EDXA 2D0FA 1BZ7A 3CCHB 4KMQA 3V5DB 1IGJA 1M7DB 3G5VA 3HI6H 2Q20A 4WV1C 2FX8L 3SDCA 3UYPA 3DX6B 1UQSB 3MUJA 4PRIE 4J3TA 4MMXC 4G6AC 1FL5B 2P5WB 3NIFF 5IVZA 3WNMA 1IC5H 3TA3A 1QBBA 2ESVB 4HHAB 5I1IH 4NIKB 4TULH 5EO9A 3VD5A 4UZGA 1PDKA 4ZUTA 5A16B 2PUQT 4LOUD 1P4LA 4X80H 1FZJB 1QFPA 3W82A 1X5KA 4DFIA 4UDTA 4M5YH 4NQEB 5EU3B 4JFHE 5BO1L 1Z9MA 3S36X 1KULA 3BGFC 3P77B 4LLQB 1JMXA 3MOAL 2R4SL 3DRQB 1TETL 1K9TA 1F3JB 1JPTL 4JFFB 4Y19A 3O9WD 2VWEC 2XWBA 1BJ8A 3WLBB 2X44D 4U1MA 5HYSA 3EZ8A 3L7EB 4YHLL 4X7CC 2ITDB 4PTTA 3T04D 5FKPA 3U2SA 2GKIA 5ALBH 3BKYH 1B6DA 1IKFH 1JRHI 5F21B 2HAZA 3QWRA 4GW5B 5EO0B 5CZXD 3W9DB 5JMRA 5AYUH 3LN4B 4KV5F 1J05B 1R3IH 1MIEL 4WI7A 1UXWB 2M2DA 5DRNB 3V4UH 1CZ8H 4LK4A 2A6JB 1J0JA 4WO4C 3QDGE 3SE3C 4ZYKA 1RURL 4KI1A 2W0FA 4D9RD 3L3HA 1MUJA 1Q9KB 3X11A 1GVIA 1U3HA 1MREH 3FB7B 4POZC 2G9HB 1P7KB 2VDPL 4HKJB 5E1AB 3L6FB 3L3KB 5EU5B 1AO7A 4HFUL 2HT4C 4LHUA 2IQAB 4Y88A 5CSZA 3EUUA 3NVQA 5L2KE 5F7KC 1AGEA 4K7PX 1JTPA 4H26B 3HE6C 3NN8A 4JO4H 5CHNB 3CAFA 2I24N 1N0XH 4K2UH 2W92A 4P3DA 4Z0XB 4MWFB 1SY6A 3U7WL 1ZVSA 1ZLSL 4XI5D 3M17A 1S5HA 2V5TA 2YMXH 4PYGA 1HWGB 2AABL 3OKEB 1DEDA 2DI8A 2ZPKH 3NPSC 4JVWA 4EJ1C 2X4UA 4F80A 3LD8B 2H9GA 1NAMB 4FQXB 4YDIL 5AUMA 2YSSA 4M3KB 1A7OL 5DVOA 2WINA 3REVB 4JDVA 5TE4L 4MJ5B 4LCWB 8CGTA 5E5UB 1R6VA 4NM8L 5AYQA 4HJ0C 1S7VB 3JWDH 4EIZC 5SWZA 1L0QA 3UJIH 3BWUC 4EQ3A 1S7QA 3F7VB 4GMSH 2F54B 4PGDA 3EYVB 1T2QL 1ZA6A 5ESAA 5D6CA 2FL5A 2YD9A 5F7UA 3IDIA 4ELKA 4O02L 3D3VE 4PREA 1G7PB 4HC1L 1L7IL 3H9SB 5JDJA 4FFWD 3T09A 4QXUH 1OP5H 1A64A 5L7XH 4LVNB 4AMKL 2RFXB 2FD6L 4ZS7L 4PPTA 1VA9A 2E9IA 5DUBA 3C8KB 4NZUL 1SYSB 3RWFB 1V8HA 4UQ2A 1FL3A 1KPVB 1BAFH 1AQKL 2DQUL 1BBJB 2IAMB 3LPFA 5E6ZA 4JCLA 3F8UB 1SJHA 1FYTA 5SX5H 1VEPA 1BD2B 1P2CA 3SJVB 1T3FA 1CFTB 2CJUH 4O2CA 2A9ML 5DMKA 4HS8L 3UTTA 1N6QL 3AXLA 1DLFL 3ARBC 3O4OB 3QJHB 4NNXA 3DARA 1HDMA 3FFDA 3FRPG 4HWBA 4S1SL 5IWLA 3RX5A 5MHSD 2DOCA 1WAAA 2P8MA 3TV3L 5ID0A 1DN0A 5IHUL 1YEFH 3Q0HA 5HHPB 4N0CC 3KJ6H 4LSSH 1A6AB 2R4RH 1MLCA 4UOJA 3C60D 1K3IA 3MLZH 1HQRB 4KJYA 2APBA 4MJ4A 3B9VA 1I1AB 1N3NA 3DURA 1NGQL 1G7MB 4P5TA 4Y4KD 1L9NA 1J8HB 1RZIA 4PR5B 3WL9B 1YEKL 1P84J 3O0RH 2LU4A 4FZEH 1QSFB 1DQDL 5FYJL 1KFAH 3BH9A 2J8HA 4BFIA 1CDUA 4NFCA 5EG6C 3ROOA 3JTSA 2OL3L 1AQDB 1E27B 5ECJE 5E08L 5CBAA 1RJYB 4OZIB 5EO1B 1U41A 5A1AA 3BD3A 2DQJH 3WFEL 4NQDE 1A6UL 4CMMB 4UNVA 3QPQD 4EN3A 3X3GL 1G7LB 4FQ1H 1OCWH 1JF1B 1C08B 3FFCD 3U9PL 4QXTB 5JPNB 3RGVA 2DLHA 5EZOH 4JVPA 4OZFH 2EYRB 4LHQB 3WNLA 1CCZA 3TBYB 1MRCH 4PUBL 2FZ3A 2ENYA 3WFCL 2X05A 4HAFA 2P49B 3MC0A 4UQ3A 4DKDC 3W9EA 3MBEB 3RNQA 1FGNH 3BESR 2FIKB 4OCWH 2QQKL 1UT9A 1WBYA 1QBAA 1W72H 3C5ZA 2ED8A 5E8OA 1FLRL 2VLJD 5IVXA 4KRLB 2B1HL 1T89C 5DD1L 3RL2B 2D9QB 4QRPB 1R5VB 1TZHB 2X41A 1HQ4A 2R56L 4DZBB 1K4DA 2NY3D 2L4OA 3D2UA 4Y4FA 5A40E 4DTGH 3TT3H 3CMOH 4HG4J 2OP4L 4GS7B 4IS6A 5D7IB 5DUPL 5JZ7D 4Q58C 2A6DA 1QEWA 5JXAH 4HZLB 5F71A 3CU1A 4FP8L 3G5XB 1M7IB 5DTFB 4D0BB 2NY4D 5CWSA 3U4EB 1IAKA 3E2HB 1RZJC 2XI9A 3B5HA 3MJ9A 5K9QG 4KROD 4LSTH 5AD0B 2A83B 4KQ4H 5ACLA 3MLTB 3TEUA 2WM0A 1NKRA 3P9LB 2EDRA 5TDPB 5GGUB 1ORQA 3T8XA 3AB0B 3W5NA 3STBA 4TTGA 3VFSA 3W81A 4XNXL 2J8UB 4JY4A 3N1GC 1BVLB 3QR2A 4WFGD 2RJMA 1QPPA 3VXQB 4EUPG 1F4XL 3N1QC 3S97C 5HD8D 2BSSB 3ARGD 5MP6H 3OV6A 1AI1H 3FT4B 3W0WA 1LNUB 4O2EA 1CLZH 5EH1A 1CE1L 2GYSA 5BS0B 3X3FL 1O0VA 1MI5D 4YXLH 2VSCA 5FHBH 2IPKB 3D6GA 5FM8A 5EU6A 3OKMA 4IOFD 3JV6B 1UB5B 4TQEL 1HK6A 3IFPB 1IILE 1FL6B 4X8XA 3LKQB 2B1AL 1XR9B 4RBPK 1LEKB 2NW2A 2NY2B 2EDQA 4ACPA 5SWQB 1JNHB 3LS5L 2ICCA 4PJBF 2H6PB 1NEZB 4JN1H 1VFUA 3FB5B 2XICA 1S7WA 2JIXA 4Y16C 2QTEA 3QHZL 3GJFH 4MCYB 1A47A 3KHQA 2XXCB 5F7FA 3WXVL 1QVOA 3FRUA 2ICEB 3U36B 1IGTB 3MODL 1RZFH 3O3BB 2QHRL 4FQ2L 3LHPL 3MRPA 4WHCA 2IBZX 1T22A 3QIWD 2Y07H 3PGFL 4HUUB 3QISA 5FCUL 4YWGH 4KZEL 3MCKB 3QUYB 3IDUA 4P23B 1ZHKB 4O51A 1QR1B 1C5CH 4OCRL 1Y0LB 1HSBB 2HFGH 2OTWA 5C08A 5CEYA 4P2QB 5JORA 1YN6A 5GZND 3T0AA 1MCOL 1YEDB 1S78D 2EH8L 3O2WL 3ZSTA 2IMMA 3SGJC 3G5YB 3F7PC 3MCG1 1ZT1A 1HYSC 5DS8A 1U8OB 4ODUA 4FFYH 4XCFL 5FB8A 4LVHC 5TQ2L 3ECBB 3OSKA 2Q6WB 4PGJA 1S7TA 5CCKH 3PHSA 4PRIB 5I1JH 5DHVB 1YC7A 2CDEA 3QP3A 1IBGL 2IBBA 4UMGA 1IGIL 2P1YA 1BIIB