5IV2B

Cetuximab fab in complex with arg9cir meditope variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
216
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cetuximab Fab, light chain
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 44
structure length 216
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iv2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iv2B01
4P3DB 2XZQL 1E4WH 5TDPB 4JJ5A 4KJWC 4WW2A 4KZEH 5EO0B 1JNLH 4XCYA 2UWEF 3TPUA 3QEUA 3RL1A 4R96B 1VSCA 5HPMB 4HIHA 3TPKA 3MRMB 1KGCD 4X4YA 5EZJB 4EOWL 3IKKA 4HJGB 3UTZB 4P2OB 4HKZA 4E41E 5IB2B 1U8HB 3T09A 5ETUB 4K3DH 4U33A 3DMMA 4NZJA 4ELMB 1CFVH 1DVFD 2VDMH 3K4DA 4BA8A 4ZFGL 2QHRH 4NHUB 1EAPB 4I48A 3RWHB 2XACC 1FFPB 2BNUA 4YXLL 2YXMA 1A7RL 4ZUTB 5TDNB 2FJHA 3MRRB 2AXFA 3V6ZA 3MNWA 3BQUB 5BVPL 3HI1A 1ZTXL 2EDXA 4PREB 4ZQKA 5IB3B 3TJEL 1GGCH 4MD4A 4ZFOA 2I5YL 4HJJL 4KJWD 4LNVA 5DJ0B 5IWLA 3ZDYE 5EA0H 5CBEA 3G5YB 3MRCA 2DS4A 1P4LB 4RGNE 4N0UE 4ONHB 1IBGL 4BZ2H 4ZUSA 5FV2A 4L3CA 2CKBB 3LHPL 2NXYD 4N0CD 5FUOL 1EJOH 2DI7A 3N85L 4XPAH 3QHZL 3O8XB 3L5WA 2E9WA 3E6HB 3SOBL 4HH9B 1F58L 2C26A 3C2AH 4LCUB 4PJ9D 3BVNB 1YNKL 2ITDB 4PJFE 2CK0L 2YK1L 3RZCC 4MQXD 2E27L 1EZVY 1WC7B 1EO7A 1AGDB 3VE0B 3HC0B 4CW1B 3UTTD 3WKNA 3GBMH 5B38A 1YMHA 1T1YB 1AR1C 2GTWB 5DD3L 1DQLL 5D2NA 3DROA 1ONQB 1CXEA 2NY6B 3PP4H 4AY0A 3HAEH 4XX1E 4P46C 4P48A 3EYSL 3F65A 4XMKH 5I75B 4M4RA 1X3DA 2JB5L 5BS0D 1DUYA 4L3EA 2XN9A 4HGMA 3CUPB 1FVEA 3JWOL 5GGRY 2G5BA 2WIMA 1OD7A 3KPRD 4OD2B 3FZUD 4N8VB 5EBWB 1FP5A 4HWZA 5JQ6H 3DURA 3AXLB 4M62L 4YHOL 5E2JA 4ELMF 5CKAA 1FVCA 4CADB 3T65A 1Q0YH 3MBEB 2MJWA 3IKCB 1D5MB 1H3GA 2F74B 5HJ3B 1FAKT 2W9EL 3SE9H 5CCKL 2FD6L 4RAUA 3MOBL 4UB0L 3U4EA 4CAGA 2F5AL 3MR9A 1S9WB 5ITFA 4MNHA 3AU1A 1OGAB 3ARDD 4FQLL 5DHVA 1E4KA 2W38A 3EDDA 4R7DB 1GPOL 3D0VA 1H3VA 1HE7A 1HH9A 4OF6A 1LO2L 1CFTB 2NY3C 4NQSA 3OKMA 1S7QB 3ARSA 2IALA 3TVMA 4I3RH 3UC0L 2BFVH 3WJJA 4NCC1 4O9HH 1QZ1A 4RBPH 1KIPB 1IKFL 4WUKH 4P9MH 4H26A 5FO8A 4WFFE 4JM4L 2OTUB 2HKHL 4AENB 3E2HC 4OZ4A 3VRJB 5C0BA 1A22B 3UMTA 5E00A 1HI6B 4I5BA 4K71C 3U2SA 5I16B 2WM0A 4HH8A 2FIKA 4L4TD 5I1GH 3UEZA 1OGTA 1MFDL 2ENSA 5D96B 1A7NH 4M03A 3EBAA 1PYWB 2FBJH 3WIHL 4W4OA 4GRWF 2OP4H 2MKLC 4XNYH 1AFVL 1D9KA 3QAZC 2EYSB 5TF0A 2MQ0A 2XA8L 4KUCD 5GSVB 2FX9L 4GW4A 4HIEA 4FQ1L 5A3IC 4O58L 2DBLH 2PO6A 1A0QL 3VGGA 1DN2A 1LMKA 3HC4L 4CMHC 3EHBD 2X4NB 3B3IA 3OAUL 4HIIB 4I77L 2HH0L 5B39G 1JWSA 3VFVB 3O11A 2ADFH 4LLDA 2EDJA 1BHGA 1KLFA 3I84A 2VKWA 2HTKC 4U7MA 1B4JL 2QSCL 2VL4A 3PABB 2CDFA 2AGJL 3QWRD 1I7UA 1UB5B 1T4KA 2EDWA 2PXYA 2Y5EA 4GRWE 4OZHA 1SEBB 2Z8SA 1MELA 3U9UA 1RZJL 2VQ1A 1NMCC 4PFEA 4HFUH 3KPLB 1NLBL 3GMQB 4GO6B 3ARFA 2HRPL 4F9LA 2AJSH 1H3XA 3UYPA 1N26A 2OSLA 3SKMB 4NUJB 1TCRB 4ZOAA 4M7KL 3QCTH 2EZ0D 5FA4B 4YHML 3FO9B 1ZT7A 4HEPG 1WITA 2J6EL 3S5LG 3QIBB 4F9PA 2Z31C 4ELKB 3DX6B 4AEFA 1H3UA 4F7MA 1F2XK 1MJ7H 2BVEA 4Z7WA 3HE7C 3TLRA 2VR4A 2ZJSH 3OR7A 2A9NH 1AGFB 3Q1SH 3ARWA 3KPSD 5IEKA 1MAML 2AAVA 4ZFGH 3GJFK 3OGCA 4Z5RB 1RUQL 2C1PB 4Y5VC 2VR9A 3EFFB 3IJSA 3T77A 2P8PB 3QH3A 3ULVE 2X70A 3THML 4RZCB 4KRPD 1QBAA 2M26A 4XP4L 4JFZL 4QNPE 4QHLB 5CJXC 1SVCP 3C5SB 2SEBB 1UWEL 1FNGA 4HJJH 3ZE1E 2XT1B 3ZDXE 1K8DA 2VOTA 4Y2DC 1HYSD 5CZVH 1DSFH 4PP2A 4DAGL 4PV8B 2DQFB 1FNSL 2A6IA 4K07A 3Q5YA 4JO4L 4LEOA 5JMOC 4EI5B 2HWZL 3IDIB 3MRKB 5IMLA 4YK4B 2IADB 3NIFF 5DFVC 2AKRB 4PB0H 4RFEB 1W0VA 1RUKL 4CVXB 1FFNB 3VFUB 5DJCB 5HHOE 4PGBA 3IJHA 4FQQB 2W9DH 5KJRH 3MRDB 1V7ML 2ILLA 2JLLA 2Y7QA 2YK1H 5JOFB 5HHQB 4MA1B 2F54D 1XGQB 3DXAE 2IQ9L 4PG2C 3IXAB 1K3IA 3DYMA 1Z5LB 2OCFD 3KPQA 3SKJL 2ERJC 4DGIL 5D2NE 2Z8VC 3MOQA 4YGVA 1ORQB 2BY2A 1CLYL 1KJMA 1G6RA 1LEKA 2D7MA 5J3HD 1CFSB 2E8YA 1NGWA 3P73A 3O2DH 4QRSB 4NZTL 2K3TA 1V7NL 2DM7A 2XFXA 3GM8A 5K9OA 4G6AD 3WLBA 2P5EA 2YUWA 2JB5H 4BKLA 1FH5H 3UBXA 3MV8E 3GSWA 4PJ8D 3B9KD 4GW5B 4GBXD 4OTXH 4JVPA 5DFVD 1FYTE 1IAKB 2DRUA 4OCLC 4NRZB 3GKZA 4HWNA 1YQVH 1OHQA 5GRVL 3ZKMD 1F6FB 4LLAA 4YDJA 1BJMA 1KG0A 2O5XL 3SY0B 4YHYB 1MJ8L 4M62H 3PDDA 5D2LA 1BLNB 1DVFA 4LCCC 4P23D 4XC3L 1U8KB 3JVGC 2J4WH 4OCRH 4BQBA 4YPJA 1QSVA 1A1MB 3L5XL 4XNUL 3TBTB 1ZE3C 1U8NA 4HKBB 2CIKB 5FM4A 2FD6H 4MLSA 3VD9A 2F5AH 1GHFL 5IVOA 1I4FB 5C6TL 4LKXB 4F58H 3TYFB 4MQ7B 1PGRB 1CFQA 5F9WC 3TYGL 2DQDL 4BJLA 1BVKA 1GPOH 2XI9A 1P1ZB 1G84A 5IHZA 3B9DA 2GCYB 5IQ9A 3V6FA 4FXKA 3VWJC 3A67H 4KXZH 1QLEL 2DM3A 4Q9QL 2ATPA 1MIEH 2NY4D 4JG0L 1WZMA 1KUMA 2GK2A 4NJ9L 1GGTA 1F11A 1A6UL 4S2SB 3VMPA 3QDMA 1KCLA 1A3LL 3QIWC 3DARA 4XVSL 2WBJD 4LKCB 1Z9OA 4U1IA 1Q94A 4JM4H 4KGJA 4PJ9A 1ZHNB 3W2DL 1QLRB 3KXFD 4MSWB 1FL5B 5DWUL 1KJ2B 1OCWH 3UTTA 3ZLQC 5K33A 5BCAA 3K4ZA 3O81A 1DUZA 4F57L 5KANG 4PBXA 5ESVB 3LKOB 3SJVD 1CS6A 4H25A 3F6LA 3GMPB 3RWJA 3MBXL 3ETBF 2ZSWA 5L2JB 1JK8B 4G8GB 1VESA 2R2EA 2WNGA 3PQYD 5BS0A 5JIPA 3WEXA 4I0CC 2XXMB 4JFDE 1LO5A 5B22A 5CSBA 4GG6F 2OXHA 5IEHB 4O51A 3ZDZF 3QIWD 3NCFB 2XTJE 3FQXB 4I77H 3RTQB 2HH0H 3BZFB 3PDOB 4BSVA 4XP1H 3LD8C 3KPRA 5L8KB 1JHLH 1I8MB 1S7UA 1OAUH 5FB8B 1FC2D 4F8TA 5D6DC 4WGVB 1M05A 2QSCH 5JOPE 2VWEC 5MP6H 4MHHG 5F7UA 3P4MB 4M5YL 1WFTA 1BVLB 1RZJH 4WFEE 4LAQH 4FZ8L 5GRXG 1JN6B 3MFFA 4XBGA 2HRPH 3FHAA 2VRAA 4XCNB 5FYLL 1UWGL 4NUGH 4GG6E 1QTYT 1IQWH 3ZDZE 3VFRA 4PY7B 5AWNL 5DK3A 1ZGLB 1IEBA 4HD9A 2OM5A 5D7LB 1KJ3H 5TH2A 3PWLA 3C60C 1IQDB 4ODWB 3SDCD 4J3VA 3WMSA 5E5UB 5ICYB 1KCSH 3NTCH 3ARTA 3RHWK 1T22B 3I75A 5KS9A 3K74B 1L7IL 3LN5A 5EO9B 3ARUA 2Q76B 3T2OA 1Q38A 4LVOB 2O93L 4BH7B 4HQQL 4LP5A 4WO4B 4UINL 3FFCD 5L2KD 4MAUL 4OGAD 1LVEA 5FYLD 2WWMD 2V9RA 4KK8C 4L4TA 1WZKA 4LIQH 4LSTH 2R1WB 4ZO9A 2E6PA 5EBMA 3WJLA 4GJTB 1FNSH 1IVLA 4I0PC 4KPHL 3FOMB 2WUCL 4EN3C 3BH9A 4LBEA 2FEEI 4Z77B 4PRBB 3WNLA 4PJAA 2JIXD 3WL9A 3P77B 5SWQA 1RUKH 5JIIA 3ZE0E 1YC7A 5DEGA 4MB3A 2JELL 3E0GA 1WWAX 3K81A 4DGYH 5DDHA 1F90H 4U49A 1V7MH 5B38G 1VADA 5HHXL 3QUML 3U82B 4O00A 1WJ3A 4HK0B 3HZMB 3WFDL 2AS5M 5I0ZA 1EVUA 3DSFH 4NN6C 4Y4FD 1JWUB 3RZCB 2WSKA 1FPTL 3K46A 2XKNB 3Q3GB 5CILL 5H37H 5GGSY 4Y8AA 5B3NA 3H3PL 1JGVL 4PRPA 5GZNC 1FAIH 3WIHA 2CRIA 2AV1B 2A6JA 4PJGB 1HWHB 4UUJB 2ZCLL 5D4QA 3FT4A 1HINH 3QP3A 4ZO6A 3CMGA 5HI5D 3JTTA 3BXNA 4P46B 1HHHB 3VG0L 4OIAA 1NCDL 1K5NB 2UZYB 4FHBD 2DMKA 1BBDL 2YBRB 1BQHA 3I02B 2O5XH 4P2OD 4QRRD 3IJYB 4I9WE 5T1MA 5LGHL 3SGKC 3KPSA 5E94B 5ENWB 2F19L 5FYJL 4HX1B 5IESL 4J6RH 5DJXA 5J6GA 3AS3A 5DO2C 3QPQD 5D7JC 5CGTA 2DIBA 4YBHA 4X9BA 3PWNA 5I8KH 2AQ3A 3LVEA 3QI9B 2CD0A 4TSAH 4PJIA 3TP4A 5IVNA 1DQJB 3DNKA 3H7BB 2J8UB 3E1F1 5HGHA 4Q9RL 1OTSC 5TQ0L 4C83A 2J6EA 4JY5H 4HT1L 1KIRA 5DMGC 4GSDH 2X10A 1QR1A 4XWGL 2VDNH 4HXBL 1QLEH 4PGDB 1I3VA 2CK2A 4LHUB 4Q9QH 4OGXH 1AY1L 3QPXH 4JG0H 1N6QH 1G7IA 3PWVA 4BM7A 1OSPH 4Q58C 3L3KB 1X5HA 4FNLH 4YDLC 3BKCL 5F1NA 1V3JA 2R0LL 4QHMA 5DUBB 5FYJD 3RX7A 2HLAA 3BGAA 4R3SA 1P7HL 3O8XD 1ZLWH 3VWKD 5CD5C 2DTML 4JLRB 2LU4A 3ARXA 1ZAGA 2F54A 5E2TL 2ZOLA 1MFAL 4Z7VA 4FN0A 1LGVA 15C8L 3DBXB 3QDGA 1NEUA 5I1KL 3FQRB 1HKLL 5DZNA 3C8KA 5F89A 1WK0A 4BELD 4CN4A 2H26B 4I3GA 3RIAF 4V1DE 3Q2CA 4F57H 4K71B 1DLHB 2IPKB 4BZYA 4QWWD 4NKDB 4RQQB 4K7PY 1CD1B 4WDIB 4GMTL 4PJGF 4WY7L 3MLUL 4FZEH 2BDNL 2VSCA 4IRSD 1RU9L 1A7PL 4PJ8A 3QAZB 2B7DT 4GBXA 2YPVH 3JSSA 4IMKC 1YMMD 4X6DA 1WQVT 2ZUYA 3ARRA 4RMWA 4KDWA 5T3ZH 2M1KA 2AEIT 7CGTA 4PJEB 1RZFL 3GMMB 5D1XB 4S1DC 1G7MA 1PKQA 4CMHB 4N8PA 4R97B 3TA3C 5IHBA 3G9VA 4OAWA 4N0YH 4Y4KC 1HQ4B 1U3YA 4P23A 2FGWH 5F7DA 3LDBC 4X8JB 1PDKA 4S10A 2DL9A 5I74C 3P9LB 1R5IB 4YUEL 1W2KT 4DVRL 2BSTA 5I1IL 4DOHE 4J1UB 5LWYL 1U8LB 5MERA 1B0GB 4I18A 4O2CB 4HUMB 4YPGA 3RKPA 1NFKA 1OGAD 3U1SL 1XGUA 3VXMA 2J8UF 3ROOB 1DFBL 5IB4B 4JKKA 3H42L 1Z0MA 4LLQA 3MUHL 5B8CA 2QKIA 4E0RB 1E4XI 4U2ZA 4R6UA 3VH8A 1UQSA 2DQHH 1M6OB 2B1AH 5C6PB 2Z31B 4S1DD 5E03A 1V5JA 4L8SA 1G9EA 3BGFC 5E8EB 4OGYL 5FKPB 2AXGA 3FB5A 3U0TA 4JFEE 3W9DB 5EU6A 1DL7H 1NGZA 2BVQB 4Y5VB 2UZXB 3HLAA 4NWUH 5CLWA 1TXKA 2V5RA 1B88A 2VC2H 3VXRB 2NY0B 2E7LC 1I85C 2HT4D 4ZUVA 5IJVB 4F3FA 5IVXA 3SJVA 1YNLH 25C8H 1PG7W 3KJ4C 1MPAH 3F7RA 4Y2DB 2Z9TA 4JZJA 2AJZA 5I66B 1ZT4A 1RAMA 2DQEH 1T7YA 1E4JA 5DVOA 4XPGL 5JDSA 5KVGL 2GITA 3S88H 4K94C 1JYNA 3WO4B 1WZLA 2WINA 5GPRA 3WO3B 5HHXH 4U6VL 3WN5A 4MJ5B 4OUOA 4U7KA 4ZDHB 3FTGA 4QCIB 2DIAA 4PJEF 3WFDH 5F3BA 1N6UA 2N7AA 1IAOA 2YPLE 3DHJA 1P2CA 3TWCL 4NO3B 3CIQA 3V52H 3MV9B 2GW5A 1FPTH 4MJIB 4XAKD 2VABB 3FO0L 1TJHH 5J0BA 3UBXG 1OWRM 4Y16D 2ERJB 1T5XB 3CLEL 1UFUA 4HBQA 5C3LD 3OKEA 5EBLB 3LSOB 2ZCLH 2FDBP 4KI5D 1QBML 4AG4L 3OB0H 1FIEA 3VXSD 2BERA 2UWEA 1U8JA 4RA3A 3MNZB 2H32B 5TPWL 4D3CH 3T0XA 3QUXD 1IMHC 4PP1C 1NCDH 4UV7L 1U8MB 4MMXC 1BBDH 1G0DA 1YJDC 3QIBD 3SDCA 3MLYH 5F97E 2FL5A 4KTEL 3H7LA 2VDPL 1TVHA 4CL7A 3C9NB 4XBPA 3R4DA 3BWUC 2NZIA 4YDIH 1WIPA 3O4LD 3Q6GH 1X7QB 5JR1L 5HGDA 3ZL4H 3PIQA 1FNHA 1QYGL 5TE7H 2E9JA 5L8LB 5DRXA 4OKVA 2FRGP 2R0ZH 2CQVA 3SO3C 2UVFA 4FP8H 3FFCA 5L2KA 1T1ZA 2GK0A 2ZSVA 4PJIE 5L8JB 3GNMH 3OWEA 1ZANL 4NKOA 4HPYL 5L0QB 5TQ0H 1UYWH 3QCVH 3A6BH 5GRYA 2XG5A 4MD0A 3FN0L 4NNYB 3N50A 1BAFL 4XWGH 4HXBH 1MFCL 4YBQC 3X12A 2RHEA 1II4E 3OAYK 4OF0A 1EZVX 4EI5D 3SDAB 5ADPL 4HXAH 1G7QB 1CDBA 4WUUD 4P3CL 2JIXA 2GYSA 1CLZH 5I17A 2R0LH 3LPWA 5HI4C 4QRPB 4Y19B 1CIUA 3NN8A 4WWID 1NBZB 3O3AA 2DTMH 4TSCH 3P4NB 3FN9A 5HVWA 3K80A 2GJ6E 5CHNA 3VXQB 5KZCD 1BFSA 3K8LA 3WCYA 1IGIH 1EBAA 15C8H 3HS0A 4Y4FA 4BK5A 12E8H 5LKNA 4LIQE 5L7XH 3GKWL 5C2UB 3VCLA 1UEMA 3MOAH 4ENEC 1OW0A 3TBSB 1NANH 4P3DA 4M7LL 5TDPA 1C5BL 5E56A 3UO1L 2E6QA 2BDNH 3OTTA 1UH4A 1O5DT 4IOIB 4KU1A 5TDOB 4R96A 4Q6IB 3ZSTA 3L5IA 4TULL 1Z3GL 5HPMA 1CIDA 3MRMA 4XPTH 3QUMA 2IFFL 3I6LE 4PJ7F 4JGUA 3S9DB 1IARB 5EZJA 1QACA 4G9DB 3UTZA 4P2OA 3FQWA 1RK1B 4FTVD 1AXSB 4PJDE 4MJIE 4ELMA 1L9NA 5IR1A 4XCCL 3UTSD 4NHUA 1JBJA 4OD1H 3WIFB 4WWKD 1FFPA 4YUEH 4DVRH 4WTWA 1AQKH 5LWYH 5TDNA 3MRRA 1CTOA 1QFOA 4R26H 2DF3A 4PREA 4XPFL 5IB3A 1KJ2L 5F9OL 3MUGB 5DJ0A 1DFBH 1S78C 4PJ7E 1ZXQA 2WUBH 1J05A 1BIIB 3H42H 3GI9H 3CVHB 3G5YA 2P45B 3SQOL 3GMRA 1M71B 1P4LA 5BW7C 4ONHA 3RQ3A 2C3WA 4M5ZH 1OP9A 2MPAL 5T3XH 1R3KB 2QEJA 2EIZB 4JDTL 4AT6B 3H3KA 3PGFH 1MCBA 4OGYH 3O8XA 4XAWH 3E6HA 3VWKA 4LCUA 3BVNA 3VW3L 2ITDA 2QBWA 3JWNC 3ZYIA 5C0CD 1CL7L 3BD3A 3KXFE 3KAAA 1WC7A 4YO0B 1NCUA 4ODBD 3VE0A 2R0WH 3HC0A 1E27B 1YNTA 1T1YA 2GTWA 3I3EA 1IAII 1H15B 4IOFD 2EE2A 3ME0A 2WZPD 2EE6A 3C5JB 4RMVA 5IVXE 1F00I 3SJVE 5AEAA 4X9HA 3RGVC 1ORSB 5KVMC 1KTDB 4I0PB 5BOPA 3TCXA 5KTEH 3PQYE 1NDGB 4G8GD 4XPGH 4ZO8A 2FHCA 3TJHC 4EN3B 5KVGH 2VXQL 4JO1L 5TQ2H 1QRNB 4IRSA 3JV4B 1A4JB 3BP4B 4OKDA 3CUPA 4XZUA 1YMMA 3C5ZB 1GGYA 4K94H 1LO0L 3F58L 3H6JA 2VH5L 1WIUA 4OD2A 2PF6A 5EBWA 4H88H 4POZD 1F42A 1ZA3B 2J7LA 3AXLA 4X98B 1VDGA 4NQTA 2EDBA 3W82A 5A2FA 4CADA 2JJSC 4NN6B 2X4PB 5D6CA 2F8VA 3MBEA 3CLEH 3IKCA 1D5MA 1ZOXA 2YC1B 3D1MC 2WQRA 2DM2A 3EO1B 1CDJA 1QBMH 5DVLA 2FO4B 2BXYA 3BDYL 2HTLC 4OZGE 1S9WA 3EYQC 1BQHG 5TPWH 1T1WB 5CD3B 1OGAA 3I9GL 3NABL 3NIDE 4HDIB 5D7LD 1CXKA 4KTDH 3BPOC 1YEKL 1T66D 5FA3B 5T3ZE 1CICB 2Z92A 4KTEH 2VDPH 5L9DH 3MZGB 5GRUL 1S7QA 4TN9A 1OAKL 4WVRA 4XVTL 5FYJU 1MCCA 3HE6C 2APVA 4I13B 1X4ZA 1KIPA 3G6JB 5FHBH 1HHKB 3LMJL 4G9FE 4WO4D 2OTUA 5DC4B 1D5BB 4MS8C 4AENA 1C16B 1HSBA 4F15C 4F37F 3MLSL 3VRJA 2D9CA 3D2UD 5FIEA 3W0WB 4G8IA 4IMLB 2R4RH 4FQCH 3WXWH 4LCWD 4CVZA 3V4UL 2E9BA 3WBDA 5AZ2L 4D0CA 4Z7UB 2DQCL 1PYWA 5I2IB 1NLDL 5AD0B 4P3CH 1BPVA 4MWFB 2EYSA 1ITCA 1K4DB 3VFNB 2ICWJ 1I9EA 2IANB 4PRNB 5IBLD 3BT2L 1NC2B 1DQML 5IK3B 4YDLB 2DLHA 2MCPL 4X6BB 2H45A 3FB7A 1TZGH 2X4NA 3AREC 5E2UL 3TZVB 3R1GL 2J8OA 5DJZB 4HF5L 2PCPB 4X7TB 3FRPA 1S5HB 1XF4B 3LV3B 3MSPA 4LARL 2IAMB 2W60A 3PABA 2YRZA 1BEYL 4LSUH 1UB5A 3EYUL 4BQ9A 1SEBA 2C7UB 2W0PA 4Y16A 3KYKL 1J87A 2Q1EA 3KPLA 5DRWB 3GMQA 5AAWA 3PP3H 1BBJA 1TQCC 4NUJA 2G5RA 1TCRA 4JPKH 1JTPA 3LY6A 3QUXA 5FA4A 3FO9A 3LZFL 5JO5B 1F4AA 3GK8H 4KKBC 1XF2A 2IFFH 3QIBA 3NFPB 4QRRE 4N5ED 5H37G 3UX9B 1TJIH 2GHWB 3PNWB 5HHVL 3NA9H 1JP5A 1AGFA 5FGBA 3MLVL 1RIHL 3S7GA 1NCCH 4Z5RA 3HB3D 3N1FC 3BZEB 3ZHLA 4YFEA 3NZ8B 4QT5A 3G6JF 2VNCA 3L1OL 4OQTH 5EIIB 3C6SB 4Y4KB 4KK6C 4OM1L 1PY4A 2ADIB 5HHPB 3MUZ1 5ERWB 1M7IB 3OJ2C 4RZCA 2Q8AH 1K2DB 1YEJH 3LKSB 4QHLA 5I74B 4FFZH 5F9OH 3TNMB 1IM9D 1I9JH 1I1AC 5GGUA 1T20B 2DLEA 3VH8G 3BO8B 3CDGB 2O61A 4MMZC 4ZG1A 2DQFA 5IG7A 2NX5B 1A6VL 4Z7UF 1O7VA 4LHUD 1NCNA 4EI5A 4G7YH 3MRKA 2MPAH 2Y06H 3IAGC 2JTDA 4RMUA 1XT5A 2IADA 3TNNB 2AKRA 5C0EB 4CVXA 35C8H 1FFNA 3VFUA 1ERNA 1AIFA 1OAXH 4UDTA 5C08E 4FQQA 4D9RD 4WENB 3MRDA 1ZHLA 5JOFA 5HHQA 4DKDC 1XGQA 2VTFA 1VFOA 3LQAL 4XH2B 1IGCL 1FZJB 4DKEL 1Q9KB 4HHAB 2YKLL 1IC4L 5DD6B 1Z5LA 2FJFA 1RSFA 1U91B 4TTGA 1BECA 2O5ZL 4Z7UE 1ORQA 5A2JH 3WFZA 1KXQE 1JNNL 1CFSA 4QRSA 4ACPA 3W9EA 4J4PD 1EIBA 1NMBH 1VACB 4Z0BL 4P57B 1BFVL 1H8OA 4WHTB 1HIML 3DRTB 2X4TB 4O5LH 2C4FT 3KJ4B 5GZOD 5TE6H 4UAOC 4GW5A 2NY2D 5E1AB 3A6CH 4R90L 1I8IB 1IAKA 1KCVH 4Q6YA 1XGPA 4M61B 5C0ND 1LO0H 4NRZA 2PTTB 3ARBB 3BKYH 3RY4A 5ILTH 2VH5H 5LQBL 1G9ML 4JRYB 5MEPA 2VE6A 4WI7A 5FGSA 3SY0A 1XGYL 5F44A 1BLNA 2IG2L 4LLWB 3UJTL 1KSRA 1U8KA 3UTSA 1NGXB 3U0PB 1UACL 4WWKA 1A1MA 3JXAA 3TBTA 4HKBA 2CIKA 2F5BH 2IBGA 2VDOL 3NACL 1RIUH 2OL3B 5SX5H 3QWOB 4LVHB 2YRPA 3GRWL 1OAQL 4LKXA 3NABH 1KCUH 3TYFA 4EDXA 4MQ7A 4DUXA 2BK8A 1KB5L 3SDDB 4DK3A 3D18B 4MDJB 4L8BB 4KROC 4U3XA 2HN7B 4KQ4H 4JGJA 5KVFL 1SJVA 2KDGA 3OKKA 2CR6A 2OQJB 1CGVA 3RI5K 4I4WA 4XVTH 1AGEB 3EFDH 1B9ZA 5LGKA 1YEFL 4K23H 3X3GH 3ABZA 4RGMB 2KH2B 1I8KB 4LKCA 8CGTA 2VB5A 4JRXB 1S9KC 4XC1L 1DBML 4KZDL 2I24N 4KUZL 4HUVB 3MLSH 2BC4A 1ZHNA 5C0CA 4M02A 2VITA 1QLRA 2WP3T 2OJEA 1NBVL 2H8PB 1FL5A 4XVJH 5D7IE 3VXRD 5D8JL 1BFTA 1KJ2A 3T08A 4ZUUB 2VJXA 2NY0D 3SDXA 1RIVL 1X6LA 1XCQB 3BIKB 1W0WA 2VDQH 4BH8B 4S0SD 4OFYD 5DR5H 5ESVA 2A83B 2FATH 1ND0A 5D5ME 4X5XB 3LKNB 3EO0A 3GMPA 2DLIA 5LBSL 5T3XE 3EYFB 1RHFA 5L2JA 4K3EL 2G9HA 1EVTC 1JK8A 4G8GA 4X99B 3GIZH 2X4OB 3RVTD 3ROLB 4JY4B 3GSNB 1CG9A 1DQMH 2X41A 3UAJC 1KEGH 5DEFB 5IEHA 4KI1A 4ZSOB 1ACYH 3FQXA 3RTQA 3BZFA 3V79C 2WMPA 4LRNH 4WGWB 4GXUN 5LAXB 4JFQB 4G5ZH 2CJUH 3RL2B 3CZFB 5FB8A 2VAAB 5E6IB 1BX2B 3F5WA 4LARH 4EQ2A 2VSDA 2P43B 1VFUA 4XAKE 1KTLB 5DYOB 5FOBB 1T0NB 1MRDH 3AMLA 5E8DL 4X83A 3P4MA 1BVLA 3WYRA 3B5GA 1LK2B 4N0RA 4WU7B 4HS6B 1T7ZA 3PWPB 2VZSA 5EU3B 4A6YB 3TN0D 4J8RB 4ETYA 4G6MH 1EERB 4JHZA 3VXSE 1I7RB 3P4OB 3I3DA 3FN3A 3B2UD 1EGJH 1T5WA 4UV4H 3IU4H 1I9RH 1MREL 2HP4A 3LZFH 5CSGA 3VXTB 1E6JL 5D7LA 4MQTB 3PE9A 4PD4J 2IMNA 4FFWC 4ODWA 4MCZB 1IQDA 1RJYA 2CMRH 5ICYA 5ISZE 5F9JB 1WZ1L 4RNRB 1JPGB 5HHVH 4BZ1L 1WUNT 3O4LE 4GFTB 1UXSB 4WI8A 1T22A 1RIHH 5KG9A 4FA8A 5FFLA 5EO9A 3H9YA 4M9PA 1URLA 3S34H 3U4BH 4ODUB 4Z6AT 5JPMA 5KW9H 1LDPL 3L1OH 4KQ3L 4LMQE 4BH7A 5I8CA 4K7PH 3GMLB 4WO4A 4PJBB 1IT9L 2OK0L 3QCUL 5EU7E 1UJ3A 1WTGT 3DV4B 3UYRH 1J10A 2QR0B 4M1DL 1S7TB 1GC1C 3ZT6A 2R1WA 3H9SB 3QRGH 2HAZA 3ZTNL 1AGCB 4NQXB 4X4MA 4OCXH 5ELIA 3AUVA 3ZKQD 4PRHB 4YH6A 3SDAD 1OTTD 5JDJA 3B6SB 4WUUE 3MA7B 5IFHL 3P77A 5K93A 3CNKA 5D1QC 3ZKSD 3MYJB 5SWZD 2CXKA 1P7KB 2Y07H 3IDXL 1QSED 4LLMB 4K7PX 3GSRB 4LFHD 3UROR 3D5OF 1ETZB 3NBNA 4WEBL 4TPRL 3BN9D 1FJ1B 3NFSH 4DKEH 4HK0A 5CEXB 2YKLH 1IC4H 1PBYA 3OF6D 3HZMA 3S35H 5JHLL 1KELH 2M8XA 1A02N 2GUOB 1JWUA 1MHHB 5FDWB 3L3OB 5F7WC 2ZG2A 2XKNA 3Q3GA 1FORL 8FABB 3X3FL 4DN4H 4JQXC 1UADC 4PJHB 5M7QA 1S5IH 3SGEH 4DK6A 3BMWA 1QLFB 1DEDA 4G8FB 2B39A 3HR5A 2AV1A 3GUTB 1IGTB 4PJGA 1BFVH 1MVUB 3F7PC 3J7HA 1HIMH 4I2XB 2EDDA 4NOFA 2GQHA 1HHHA 1DN0B 1J0YA 4YDVB 2D9QB 4LRIA 5JW4Q 1MFBH 2D03L 3CVHL 2XIDA 2YBRA 1EXUA 4AMKL 4YHLL 4ALAH 2YD2A 3I02A 1NSNH 3S35X 4FTVE 2FGZA 1QFWM 3X13A 1BF8A 4EVNA 3CH1B 5EU4B 3UJTH 3IETB 2H2PC 5HD8D 5E94A 1N4XL 5ENWA 4HX1A 4HAGA 2MOVA 3RVXC 3KWWB 3HUJB 1A8JH 1UM6H 1HXYB 3HG1E 3JBG7 3QUYC 1R3IL 3SN6N 5JXAH 4XB7A 4PJBF 3IFNL 2VDOH 4G42B 3TH3T 3NACH 3QDJB 2VDKH 5HDBE 3QI9A 5HVHB 3HR6A 3AM8A 3WHXB 3OHXA 3N0PB 5IMMB 5I1HL 4G3YH 1A2YA 3H7BA 3OAZK 2J8UA 4TTDC 1Q9WB 1MFNA 1IM9A 4NQVB 1TPXC 2YWYA 1KYOJ 2QSTA 1KN2L 5CKGA 2E6JA 4HV8B 4PGDA 4LHUA 4BSJA 5L6YH 2EO9A 2N1KA 2XG4A 1JRHI 3GI8L 3SKOB 4RGOL 1C12B 1NJ9B 3BUTA 3U9PH 3L3KA 2E5EA 4CMMA 2B0SL 4F7PB 3S8WA 1JGEA 5CLTA 5BMFL 5DUBA 1RD6A 4LSVH 4KZDH 5D71H 3V4VL 3G5VB 3HE6B 4LPWA 5C0CE 2PYEB 4L8CA 1I8LC 1RJLB 4UQ2B 3U48A 4M48L 3QUYD 3HMXL 5ACMA 5INDB 2BNRB 2FEDC 3FQRA 2H26A 3QXAB 2ZG1A 1D6EB 3ZMRA 5CJOL 4PRHE 2XRAL 2IPKA 5I30H 4NKDA 4PJHF 4RQQA 3OPZL 1KPVB 2DTSA 1CT8B 2GFBA 5KSVB 4WDIA 4K3EH 1JUFB 5CZXC 4FXGB 3KLDA 3KHOA 4L4VD 4MZ3A 3NCMA 3FRPG 5DFWH 1XGTA 3QBTB 5CEZH 4M93B 4G6FB 3C5ZD 1RJZB 2VLJE 3GMMA 5D1ZC 5D1XA 1D6VH 1EEYA 5EDXA 1N8ZB 3KLSA 5E2WH 3VI4E 3JWDC 4YR6B 5IW1B 1G1CA 4QLRA 1H8SA 1HQ4A 5E8DH 1BF2A 4DN3L 1Q0XL 1MAJA 1C1EL 3BRDA 4X8JA 2I9LB 3F12B 5BV7B 3DX9A 1HHJA 3HUJF 3D48R 3P9LA 1SBSH 2ZCHL 4J1UA 2GSGB 1U8LA 1B0GA 4O2CA 4OV6F 2NYYD 3CFKB 2E9IA 4F33B 1VPOH 3ALPA 1HXMA 3ROOA 1RUPL 5EN2B 5GS2H 1CICD 1AD9B 1AE6L 4DZ8B 2JJTC 2AW2A 3ULUL 4E0RA 3U46B 3U0WL 1UEYA 1A9EB 3BE1H 3FQNB 3OKDB 1DQQB 3WFEL 5HYQA 2UUDK 2YUZA 3HUJE 3RGHA 4KQ3H 5EIQA 4ZOCA 5E8EA 5FKPA 2OK0H 3QCUH 2BNQB 3W9DA 2BVQA 3LKRA 2V2XB 5KAQG 2EH7L 2LFGA 1RUAL 1UKQA 3WFCH 3GRWA 4P4KC 4OF7A 1J5OL 4M1DH 3G5XB 3U30C 1NPUA 3VXRA 4QGYA 4LCWE 5I1EL 1KB5A 1T83A 1A7QL 4DW2L 4FMKA 3ZTNH 2EDEA 2D2OA 4OFYA 1NAMB 3ULUD 2PW2B 1DANT 1KLGB 1I1AB 4KKAD 4FQ2L 5I66A 4P2RB 4YLQT 1TNMA 3L5HA 1QBBA 3C09C 1JGUL 5DQJA 3I2CL 2NY1B 3OXSA 1NC2D 4X5LA 1UM5H 3BW9B 1O0VA 3TZVD 3MREB 4MJ5A 4NT6B 3SDYH 3EGSB 3BGMB 4ZDHA 4QCIA 1UGNA 3PV7A 4MNGE 4WV1B 4DUVA 4WI6A 5I18L 1PQZB 4ZD3H 2WP3O 3MV9A 2IAMD 1WFUA 1FNLA 1FORH 4JDZB 2VABA 1EEQA 2WLZA 5I76B 1IKNA 3WFHB 4FQIL 1T5XA 5SWSB 5L88L 3MJ8B 4F7CB 3VFMB 3ZE2F 3EDEA 3M8OL 3TN0A 2ICEB 4NBYB 2DQUL 4NP4L 4XVUC 5AYQA 5HTSA 5BRZE 5C70A 5T5NF 1NQBA 3V6OC 1TVBA 3MNZA 4H1LH 2H32A 1G7PA 1G0XA 3UJIH 1I3UA 1U8MA 4MD5A 3NA4A 1DLFH 4UAOB 4ZYKB 4OUUB 1CE6A 2F53E 3C9NA 1QHOA 1SM3H 1MQKH 1T7XA 3QWQB 1JZ8A 1XR9A 3O6LH 1IGFL 5E99H 4C4KT 2RCSH 2BRRH 3HA0A 1N4XH 2XY1A 4I3SL 2YN3A 3N9GL 4KHTH 4JG1H 1UWXH 2VISB 3RWIB 1CR9L 4XNMA 1NEZB 2Y5TA 3S3SA 4QY8B 1X5IA 3LPFA 1CLCA 1WBXB 3JVGA 4MA3B 3JV0A 4JHWH 5FYKH 3RKDC 3VXUE 4O4YL 3ZKND 1KN2H 5DK0A 4OLXH 3RIAK 4B53A 2DKUA 1YY9C 2NX5D 1XR8A 4KDVA 4S1QL 3SDAA 3X11B 1OTUD 1LP9A 1G7QA 2PR4H 2JF1A 4JKMA 1FVDA 4KROB 5I1LB 4K3JH 5BMFH 4OCSL 1MJJB 4OLYL 4QRPA 1X5FA 4Y19A 5SWZA 5FK9A 1NBZA 2NW2A 4D9RE 5E9DB 3N1QC 3P4NA 4Z76B 1U41A 2A6DB 2XTLA 3OKNA 3VXQA 2IPUK 3BAEL 1BZ7B 4OCYL 1IZKA 4NQED 1KYOK 5J12C 3OKLB 1NMAL 3HMXH 4G7VL 1I7ZB 3OX8B 2C4FU 3V0WL 3D9AL 3UPAA 3MV7E 4PJCE 1IFHL 4KDTC 4POYA 4YFDB 1Q1JL 3D3VB 4XCEB 2XRAH 4PJ5B 4FQXB 4OJFL 5C09D 3OPZH 5B4MD 5IFAL 1GVIA 4LGSB 4EZMA 3TBSA 1FG9C 3MLRL 4S1SL 5DURD 2OL3L 5EB9A 4UI2A 5CJQL 1A14H 2LU3A 2VN7A 4IOIA 5TDOA 1KNOB 2BOBB 4Q6IA 1IJ9A 2BHZA 4JKPH 3KPNA 3K1DA 2YD4A 2NXZB 3ARBD 1RVFH 1RFDL 3B8YA 4WI4A 2COQA 2IPTH 4JRYD 4UBDC 1C08B 3BHBB 3HNSH 1RK1A 4NQDB 2CO7B 1U93A 1EFXD 4LLVA 1AXSA 5K9KB 3L3GA 5I6XB 5DJ8A 4YXHH 1H0DB 3FKUS 3R8QA 4DN3H 1Q0XH 5HYSA 1C1EH 1KV3A 1P53A 1IGYB 5JMRA 3RA7L 5IQ7H 1TMCB 5FUZL 3G6DH 4N90E 2X4RA 4S1RH 4ZNCD 3PF2A 3MYZA 2ITCB 3P30L 1JFQL 1LEIB 2NR6D 1KULA 2BVPB 4IDJL 1CQYA 3MUGA 3QIUB 3SDDD 4RIRB 4TOYH 1RUPH 4RA0C 3GDBA 1BIIA 3CVHA 2X2YA 1KPUB 3ULUH 1M71A 1IAMA 4R4BA 3CFCL 4XWOD 2HA1A 3T0EB 1T03L 4Y4HD 5TE4L 2HYMA 1FNEB 1R3KA 2C3HA 2V9QA 1BREA 1F3RB 4HS8L 3GSNL 2EIZA 1KLUB 1LNUB 3GSXB 4AT6A 3MLZH 4JRXD 3ZKXC 5F8QC 4GH7B 1VEPA 3BPNC 3CK0H 3CSPA 4AL8H 4OCWH 1RUAH 1QSFB 1Q9LB 4YO0A 3D39D 5I1EH 1A7QH 1EMTH 2LV4A 4NJAL 4ZTOL 4XP5L 1CXHA 3MXVL 3QXWA 1N59B 4IIQC 1SBBA 4NKMB 2KPNA 3VRIA 3KPPB 4H5SB 5F1SA 1KTDA 2V5TA 4OZFH 1GIGH 4EBQH 4YZFF 2P44B 1JGUH 3I2CH 4YEFA 4L4VA 1QHPA 1QRNA 4HUNB 4J7RA 3JV4A 1BOYA 1A4JA 2DL2A 4L9LB 1RY7B 5D1QB 1EHLL 5AZEH 3HZKB 1P5VA 3C5ZA 1NCBL 5E0QA 4AEHH 2IGFL 2ESVB 3U79A 5CUSL 5I18H 3HMXA 5E6ID 3O6FC 1OAYL 1ZA3A 1I9IL 4D0BB 4FG6D 3WSQH 4X98A 1A4KB 5EUOB 3TBYB 5J11C 2X4PA 4PRAA 4OIIH 2JB6B 5L88H 1KT2B 1P5UA 4MVBD 5GSRB 4F7EB 2IPUG 2YC1A 3M8OH 4LQFL 2KL6A 3EO1A 3MA9L 3TV3L 2DQUH 5IGXL 3EJJX 5GRWA 1T1WA 3OJVC 5CD3A 3ARVA 5CEZE 4HDIA 3KS0H 4JM2B 3LQMA 2Q7YB 2EH8H 1UC6A 1H8NA 1IEAA 3QNXA 5FA3A 5F72S 1CICA 1XF3B 4C55A 2J88L 4FFYL 3O2VL 1CN4A 2FIRT 5INCB 4P5TB 2DIJA 3QO1B 5J1AB 4U31A 4WW1A 3V4PL 4KH2A 3X17A 2Z8RA 4C59B 4CN6A 1W0YT 5DUPL 4HG4K 4EEEA 4D94A 2EDOA 3G6JA 4ZAKD 3WV0A 4OFPA 1HHKA 5CP3H 5F6HJ 4J3WA 5F6IB 1T1XB 3BP6B 1D5BA 4HGKC 2VXSH 1FV1B 3I50H 3ZTJG 2DMCA 2AVGA 1MFEL 5DVNA 1U58B 3DV6B 4XB8A 2XYCA 5FYKU 5C0AB 4RGNC 4LHUG 2HVKB 4FABL 4IMLA 2JE8A 3WS6A 5FO7B 1XCTA 4W6WB 4LSRL 4QKXB 1LE9A 3EJYD 3L3JB 5I2IA 4K9EL 4L29B 1LP9E 1TPXB 2UY7A 4UIKH 3RP1A 5AD0A 4KK5C 4MWFA 3OZ9H 1JE6A 3N1PC 2HT3D 5SWZE 2QADD 4OCSH 3VFNA 2C9AA 4NNPH 4JPWL 1QSEE 2IANA 2CGRL 5EO1B 5JW3L 1NC2A 4NQCD 5K59F 4P2QB 5F7NC 5IK3A 4X6BA 2A0LC 2DBJA 3BH8B 3TZVA 5DJZA 3BWAB 3WD5L 3QEQB 2H2SC 1S5HA 3LEVL 4OZIA 4ZFFB 1XF4A 3D9AH 3LV3A 1YPZA 4HUXB 2DWEB 3ULSB 2XV6B 2IAMA 2P5WB 2ICES 1HHIA 3BKJH 5JZ7C 5EUOF 3U4AA 2C7UA 4Y5XA 3NZHH 4S1SH 1MF2L 5DRWA 4PTTB 4HK3J 3PG2A 4ZOEA 5HHMD 2B1HL 4OZFA 2KUTA 4JPVL 4UQ3B 2R9HD 2FNBA 2BSRA 3VJ6A 4JM2F 5JO5A 5F9AC 5IVZB 4WU5B 3RWDB 3QNZA 3B9VA 1RUMH 1INDL 4PTUA 4Q9CA 3R06B 2A0LD 3PNWA 5MEND 1P7QD 1L7TL 1YDPB 4ODSL 4QEGA 4LU5L 1G7HB 2VLME 3NIGF 5D1ZB 3BJ91 2VDLH 3BZEA 4LNRB 2G60L 4LSQL 4YFLI 1LDSA 3C6SA 1B4RA 2ADIA 3SCMD 5ERWA 3QJHB 1M7IA 2R4SL 3P30H 1JF1B 1K2DA 3LKSA 4KGLA 1JHTB 3TNMA 4WEUD 1A7OL 1T20A 1F3DH 3BO8A 3CDGA 3GHBH 5C86A 2X9YA 5D7SL 4XP6L 3MRBB 3O9WC 2NX5A 43CAB 4LSSH 1T03H 3TO4C 1R3JB 1HEZB 3L3DA 2AK1L 3TNNA 1H3WM 4DEPB 4NO0B 5C0EA 4HS8H 3ELAT 4C4KO 3CSYB 4B0MM 3EYOA 3KJ6H 3DETD 4HIXL 1MJUH 1OP3K 4MZ2A 4PRIE 1MWAB 3MODH 4IS6B 5ALBH 4QHNA 4NQEA 4XH2A 4K8RL 5C0AE 1FZJA 3MRFB 3QFJE 1QKZH 2APXA 5BVJB 1Q9KA 1F13A 1I1RA 1YY8B 5FYKE 2E8ZA 4Y5YB 5DD6A 1MCPH 1INEL 4GS7B 1SEQL 1TJGH 1U91A 5GIRB 1OT1A 4ZTOH 1NKOA 2ZCKH 4XP5H 2I07B 3DTXB 5CP7A 3MXVH 4X6CA 4GRLD 1OAZL 5C09A 1NCAH 2ATKB 2BY3A 5DA0B 3QEGL 5BV7L 1VACA 4P9HL 1CI5A 2D7QA 3O9WD 4P57A 3RVVD 2R2HB 3NPSC 6CGTA 3VDBA 4GKSB 4O02L 4WHTA 3D25B 4U3CA 2QLVB 3DRTA 2X4TA 2V17L 5LG1A 2ZPKH 3GJEB 4EUPB 1KACB 4JFFB 4NDMA 3L6FA 1NCBH 4U0QB 3G08B 3FQTB 2PTTA 3ARBA 3C09B 2IGFH 5IOPB 4K8RD 4JRYA 4FQHA 3LRHA 5DD0L 1EFXA 2P5WE 1NCWH 3L9RB 5GJTH 3I85A 4GQ9L 4LLWA 4GXVH 5CMAA 4JE4B 4WW2C 5IF0A 2BVUA 1NGXA 1OQOA 3U0PA 1GXEA 4QXGL 1EO5A 2BHYA 5FECB 3NH7L 1R6VA 2AJVH 5JTWA 2A77L 3MA9H 3TV3H 5IGXH 1BWWA 3JV6A 5FHAL 2OL3A 1FZKB 1U8OA 5HDQH 3QWOA 4F37K 1AI1H 1JNHB 3O6MH 4WCYL 3SDDA 1UENA 5ID1B 4MCYA 3DMMC 4MDJA 4P5KA 2Q3ZA 1NC4B 3IS0X 3L3IB 2J88H 2HN7A 1NAML 3EDJA 5CAYB 1GZPB 5E08L 3VFSA 4LDEB 4NKIH 3KR3H 4HK3N 4ORZC 3VRLF 2OQJA 4OCNC 4Y4HA 4AZ8A 3IDGB 4G6JL 2B4CL 4KRMB 4NN7C 4PPTA 1AGEA 2DAVA 5BO1L 3H8NA 2CLRB 3SEPA 1U3HB 3O41B 1AGBB 1I8KA 3MLXH 5E5MB 3KG5A 4JRXA 3RVWD 2HT2C 2DDQH 1MI5E 3VXPA 4HUVA 3V9FA 5IWLC 1N5AB 4JDVB 5CINH 4ZXBD 1QFWH 1QFUL 1WWBX 2I60L 2A73B 1MFEH 3VI3E 4YWGH 2JCCA 3P40A 1DBJL 4D8PB 4FABH 4G80B 5IBUG 1FO0B 4YEEA 4ZUUA 1UCBL 5BJTB 1SVZA 3BIKA 1Q72H 1XCQA 4BH8A 4G6KL 2IH3B 3D0LA 1WLHA 3ILQD 3ULUE 3IVKB 2VLKB 2AK4B 2A83A 4K9EH 4OFKA 2Z93B 3LKNA 4HKXB 4LFHG 4IRZL 3CXDL 2VR5A 2XQBH 4X99A 4JPWH 3BEVA 5DJAB 4AEIL 2X4OA 3ROLA 1S9YB 4FRWA 4N9GA 4JY4A 3GSNA 2YPKA 2NY1D 3K4AA 5DEFA 2DQJL 4DQOH 4KKNA 4MA7L 1G7LA 2FH6A 4ZSOA 7FABL 4HMEA 3CX5J 4LVNB 5A1AA 3WD5H 5D2NC 3FL7A 5C0RL 1WWCA 3RL2A 3CZFA 4Y1AE 1YPZE 3MNVB 3GIVA 2VAAA 5E6IA 1VGEH 1PZUB 1BX2A 4XNXH 5J1SC 2M2DA 3TT3H 1KTLA 4ZPVB 5J12B 1Y0LB 5DYOA 5FOBA 1T0NA 3DGGA 5I1AA 3AY4A 5FM5M 1YUHA 2J5LC 4WU7A 5SWSD 2UVEA 1NL0L 1L6ZA 3PWPA 5EU3A 4XHJD 5DZOA 4J8RA 1K9TA 3DVGB 1MHEB 2B1HH 1I7RA 5C6WH 1EA9C 3U7YH 2IJ0C 3IDYC 3L95B 4APQB 3G5ZB 2V2TB 6FABH 3RUGE 2Y36H 1EAJA 5TJWK 3VXTA 1BQUA 5DFTA 3REWB 4MCZA 1UM4H 4YDKH 5HYSG 3H2WA 3QISA 1ZGLP 4GAJL 5JA9A 4RNRA 1JPGA 4ODSH 1S7VB 4YHIA 5FM8A 1CXIA 1SY6A 4FFVD 5F6HI 2VXVL 5EORL 2G60H 4P59L 4ZAKA 1CDUA 5H35B 1IAIM 1JIBA 1F4XL 3PL6B 1BZQK 3R0NA 5FGCE 4XTRC 4PJBA 1T21B 1E4KC 2IC2A 1JHKL 3BUYA 4NSKB 4HUWB 4M43L 3GO1L 3STZB 2R0KL 2WLYA 2NY5C 1YEIL 4OLWL 5FCUL 3DX8B 5GS3A 3STLB 3VFWA 2QR0A 1S7TA 1W72B 4KC3B 3TVMC 1CQKA 3V6OE 2HMIC 1A6TA 3G9AB 3WJJC 3H9SA 1DBKH 4XP6H 5DTFB 1AGCA 4UT9L 2LVCA 1AC6A 1K6QL 1HILA 1BZ9B 4GAYB 3B6SA 5EZIL 3MA7A 3ZYOA 5IB5A 1JGLH 2D0HA 3QXTA 5DMIL 1OD9A 2ARWA 4XXCA 3MYJA 1Y6MR 1P7KA 1WIOA 3QG7L 4UT7H 3RBGA 1R0AH 4LLMA 3GSRA 1ETZA 2EYRA 2IH1A 2W65A 4Q0XL 2DJUA 5GISH 1N5YH 4NQEE 3RWEB 5D9SA 4K8RH 1FJ1A 1GZQB 1N0LA 5CEXA 3MO1A 4N9OB 1INEH 4WNQA 2K7PA 3TEUA 5J6HB 1F02I 1A5FH 4W4OC 5I1JL 5ANME 1MNUH 1MHHA 1D9KC 5F96H 5FDWA 3CFDA 2HJLB 5C0JB 4JRWA 1OQXA 1OAZH 3CPLB 4ODHH 4FQXD 4RSVA 3GJFH 4NM8L 2CUHA 5M95B 2PO6C 1QLFA 5M94B 4JQIH 4QXTB 3QEGH 5IV2B 2XOTA 2PETA 1I1YB 1IGTA 1MVUA 4GRMA 2VDRL 1BD2B 2WV3A 1L0QA 2V17H 4X6FB 4EXKA 5LJYH 3PGDB 3BSZL 4YDVA 4Q9BA 3RVUC 4XHQA 5IT2L 1HN1A 3QXUA 5J8OA 5I19H 2PXYC 1WFOA 1NFDA 3T3ME 1P7QA 3CH1A 5EU4A 2X4UB 4OM0L 5B39B 3MZTA 3ARFC 4F9LC 5TF1L 3RWFB 1N0XH 2R8SH 3IF1B 3ARYA 3MCKB 3NH7H 1CFBA 3KWWA 1MHPL 3FT3B 4TNWF 1HXYA 3VD4A 3W11D 2OR9L 3QUKB 2ZUXA 4ZODA 4G42A 5FHAH 4ZUWB 2V5YA 3QDJA 1I3GL 5J11B 3SCMA 3TM6A 1QBLL 3V5DB 3RNKB 4F9PC 1S9VB 4HPOL 4MXVE 1CGSH 3WNNA 5IMMA 1P84K 4CNIB 4MNQE 1M7DB 1Q9WA 3QIUD 1T0PB 3NCJH 4NCC2 3BYTA 3NCYS 3DVNA 1RK0A 4PJXE 3FO2A 4ONFH 4E41B 2C3VB 3T0ED 2XZCH 1ZEAH 4GMSH 3SKOA 1B2WL 1NJ9A 2CDEB 3ARPA 3UDWA 2DLFL 2B20A 2ZUVA 4QHUB 4F7PA 1KENL 1RZKC 3SE8H 2VERN 4R7NB 5IMKB 3IRPX 1FBIH 1YEDB 1FLRH 4KVNH 1X5GA 1DE4B 3HE6A 4U6YB 2PYEA 5KSAB 1RJLA 2UZIL 3D39E 2HJKB 4OI8A 3C8DA 2AJXH 4KV5F 5INDA 2BNRA 3VD3A 4HJ0D 3HCVB 1D6EA 4NZRL 4GRLA 2R39A 2YA0A 4RGNB 4N0UB 1PKOA 1CT8A 3SGDI 2X4QA 4IRZH 5KSVA 5J7CC 5A43C 1FYHB 1PY9A 4AEIH 4FXGA 4MJ6A 4NM4H 4LPVA 3FJTA 1FIGL 4GKNA 9CGTA 3HMWL 3ALWA 1ZHBA 3IFOB 3MCG1 4KKCC 4PJFB 5HVFB 4H20L 4LLYB 4Z78A 2HFGH 3LPGA 4BQCA 1H5BB 1RULL 3R0MA 4YR6A 3WXVH 4TRPH 5IW1A 2B2XH 4JB9L 4U3HA 5JXED 5DD5L 4URTB 2X40A 4OZFG 4QXUL 2I9LA 3F12A 5E2VL 1PX3A 3LEXA 4OLVH 5DMYA 4OI7A 5JW4M 1OF2B 5GGQL 1CF8L 2GTZB 2GSGA 5T1LB 1RV6X 1YYLL 4R2GB 3V5KB 3CFKA 3GEWB 4JO2H 4F33A 2FJGB 4NRYB 4HWEL 4ODVL 1GAFH 1DVFC 3BPLC 5EN2A 3W81A 4Q97A 2NZ9D 4GAGL 3CVIL 4YBLB 1AD9A 4DZ8A 4UTAL 4QHKJ 1GRWA 4AM0B 4GAJH 2OJZL 3K8KA 4DGVL 4JCMA 1E4XL 3U46A 4ZMAT 2ADJA 4P5TD 4WI5A 1KCRL 5IP4A 3O0RL 3FQNA 3OKDA 3VXOB 3IFPB 2VXUH 1MLCB 5IKCA 1DQQA 2P48B 3IYLW 3BKMH 2X5PA 3UJJL 4LMQI 1J1OL 3WLWD 4HBCL 2O5YH 3WHE1 1FRGL 2BNQA 4UTBL 2P5ED 1JHKH 1WFNA 2W0LA 4OD3L 3VGHA 3GO1H 5IMOB 2V2XA 4PLOB 4ONGH 5BZDB 2BSED 2NY7L 4ZXBA 1YEIH 3M17B 2BX5A 4OLWH 5DHVH 5FCUH 5I8EB 3O4OC 2AI0L 1R5VB 2ZWLT 3G5XA 1XZ0B 5ICZB 2NY5H 2K9UA 2VLRB 3ZDYF 1E28B 3MRPB 2NXYC 3MJ7B 4N0CC 4BUGA 1NAMA 3VFGH 4DTGL 2PW2A 1JTTA 1MY7A 2OBGA 3QUZB 1I1AA 5EZIH 2DM4A 4TVSa 5DMIH 4PJ9C 4P2RA 2KQNA 3LS5L 2R56L 2FLRT 5LVEA 4BFIB 4KY1L 4MQXC 1U6AH 2X9WA 4NQCE 3TO4B 4EDWH 2A2QT 4LPTA 1QA9B 3PP3K 4P2QD 5EOCH 2P8MB 2L7UA 3ESVF 1J8HE 1X5ZA 3MREA 4NT6A 4PJFF 3EGSA 3BGMA 3QEQD 2Z91B 4WV1A 1F4WL 5IJKA 4WJ5B 4RFNC 1SHMA 1PQZA 5I1JH 2HKFL 5C07D 2MQCA 4JR9L 1EK3A 4OLUH 3AAZA 3V0VB 1CBVH 4JDZA 1S7SB 4YHZL 2F8XC 3WFHA 1TETH 3PHQB 5SWSA 3EAKA 3QNYB 5LGJB 1L4IA 4F7CA 3VFMA 4ZFZA 3QDMD 1A1NA 4OFIA 5DA4A 2VDRH 1KCKA 3RPIB 1S3KH 5HHME 2FX8L 5CBAB 2AEPL 3GGWB 4LL9A 3QDHA 4B7IA 1YYML 4OV5B 3FZUC 4PGJA 3V8OA 3NPSB 4U1LB 5IT2H 2CLZB 2OZ4L 1YEGL 4LAJH 1HQRA 5IM7A 1MUJA 4ZYKA 1QQDB 4OUUA 4ERSL 5CIPB 5MENE 5E70A 3WUZA 2NTSP 4GKZB 4M8QA 3ES6B 1NGYA 4XBEH 3RDTB 4PLKD 1ZHKA 4GRWB 5JHDE 3KLAB 3MJ9L 3RWIA 1NEZA 3PXHA 4XT1C 1VGKB 2HG5A 1AO7D 3ARDC 4J3UA 2OR9H 4QY8A 4JJ5B 4FQJL 3P11H 3JWOC 1WBXA 4WW2B 1P9MA 1I3GH 4O2EA 4XCYB 1QBLH 1D7FA 1FE8H 3TPUB 2BRQA 2VN4A 4W6YB 1T0MA 1S7WA 4PBWD 1FFQA 1YECL 3L3HB 2Y25A 4HKZB 1ZLVK 1F2QA 5DF0A 3X11A 2LU7A 1R5WB 1KENH 5I1LA 4NO0D 2A9ML 1MJJA 1AXTL 1KEML 2QQKL 5E9DA 2YD6A 3MCLL 3GSQA 4NN7B 1RZKH 3DX7B 43C9B 2FJHB 2AXFB 2GY7B 3MNWB 3LS4L 4RMTA 2JJWA 3WJLC 2UZIH 4ZQKB 2X44D 2LAGB 4MD4B 1I7ZA 4ZFOB 4LCYB 1ACZA 3FRUB 1ES0B 4KK9D 3CC5A 1F3JA 2VLRE 3HTLX 4HCRL 4NZRH 4Q2ZB 4XCEA 4W6XB 2DLGA 3EOYG 1CU4H 4FQXA 5C8JB 1PAMA 4XCFH 4YX2L 2ICWB 4L3CB 2D31B 4W81A 2G2RA 2KKQA 3CDCA 3EHBC 5IW3A 2XICA 5K9QI 4KHXH 3ARGB 3GMNA 3L5WB 1EHXA 4R0LB 5HHOB 5F71A 5J06A 2CR3A 2Y1VA 3LB6D 1JZ7A 1KNOA 2BOBA 4JFFD 1EV2E 3FHQA 4LGPB 1UZ8A 3DXAB 5I15L 1H3PH 1RHHB 2YEZB 3NCBB 4OLZH 1PSKH 5B38B 3QEHB 1UA6L 2DQIL 5K9KA 5I8OH 3QZWA 3IU3A 4JB9H 5D2NB 1G6RH 3S3PA 3B43A 1IGYA 2FWOA 3PUCA 2EZ0C 1QNZH 2Q8BH 5GGQH 1CF8H 1N64L 4WW2F 2XN9B 5T1KB 2B5IC 3MV8B 1A1OB 2YD5A 4LEXH 1FO0L 1FYTB 3QIUA 4RIRA 1AHWB 5EC1B 4YJZL 4QTIH 1KPUA 3WHE0 4DGVH 2OJZH 1WV7T 1E4XH 3DURB 3T0EA 1KCRH 1RZJC 1FNEA 1CGUA 3U6RA 3T65B 1U3HD 3HNTH 4PRPD 4Z8FH 4KRPC 1HNFA 1KLUA 3GSXA 4JO3L 4QOKD 2XZQH 5MI0C 4K3HA 1XIWD 1TDQA 1RZGA 2NY7H 3MR9B 5ITFB 3VGDA 4PGCB 3ULVF 1HYSC 2LVEA 3AU1B 5CJ5A 3MRJB 3HC3L 4PRDB 4QNPF 1QSFA 1T89A 3W5MA 3CU7A 4V2BA 4D9QD 2VQUA 3D0VB 3ZE1F 1HH9B 3ZDXF 4EOWH 1IAIL 5DEZA 5IW6B 2AERT 5DLML 1T2XA 3DUUA 2AK4D 4DTGH 5JW5A 1X5YA 1J0ZA 2IALB 4C56D 1BQLL 2AJ3B 2J3SA 5HYJD 3KPPA 4IRJB 4H5SA 5EPMB 5JPNA 2R56H 1NBYA 4KY1H 3RIFK 2F8OA 4NIKB 3MRQB 1MCQA 4YXLH 4L9LA 1A7RH 3QR2A 3HZKA 3TBWB 5C0BB 5BVPH 1ZTXH 4YAQA 3TJEH 2ESVA 2AJYL 2I5YH 2OI9C 5H2BB 5J3HC 3OG4B 1PEWA 1YEEL 4UU9B 4MAYD 4G6AC 2BHUA 3U36B 5JXEA 5EUOA 1IBGH 2EKSB 5GGVL 1FDLL 1JPSL 1KT2A 4PJ8C 3B9KC 5GSRA 4F7EA 4GBXC 3LHPH 4N5UA 4GG8B 1GGBL 5GXBB 5FUOH 2FX8H 3N85H 4YIQB 2NQCA 3QHZH 3QG6A 3SOBH 4JFDB 3ZKMC 2DKSA 1F58H 1EO8L 4APQD 1YNKH 4J3SA 4QHKI 1BVZA 3C6LD 1IGML 2CK0H 4JM2A 2XTJB 3ZT5A 1YEGH 2E27H 3O11B 5EZLB 4P23C 3QDGD 3SQBA 3Q0HA 2L7JA 1SYSA 1KN4L 4P5TA 5DD3H 3QO1A 1DQLH 5J1AA 3L7EA 4C57C 1NCTA 3NGBB 1T4KB 4I18C 4K7FB 1VFBB 4JZNA 4X6EB 1CE1L 3HAEB 3PL6D 3EYSH 4H0HB 3BP7B 4XNQA 1T1XA 4FQJH 3RU8L 1U0QA 3T0DA 4L3EE 3CFIC 2XN9E 3D85D 1TLKA 1FV1A 1UT9A 4X4ZA 4GG6B 4UOW1 2CXGA 4HKJB 1XF1A 3V7MA 1U58A 3DV6A 5B8CC 1F6AB 3JWOH 5GJSL 2HVKA 3T4AB 2NY4C 4LP4A 1DBAL 2XA3A 1VENA 4OI9A 3RRQA 2RQ8A 2XWBB 2A1WL 4NZDA 2WBJC 3OR7B 2QQNL 4L29A 1WEJL 4YHOH 5KSBA 2X4SB 5DS8B 1EEZB 5IEKB 5DMKB 3P0YL 2C3XA 3RX8A 4JVWA 5HGBA 2A9MH 1V8HA 1HZHL 4YHKL 2K7QA 2PYFA 5EO1A 3T77B 1U3ZA 2W9EH 5CCKH 4P2QA 3MOBH 3QH3B 4UB0H 2D7NA 2FB4L 1BOGB 3BH8A 5D7KD 2X1PA 3BWAA 5TFSL 3QEQA 4FQLH 1LO3L 2GY5A 3VXMD 1FCGA 3MROB 4NGHL 5GHWL 1CDHA 4HUXA 2DWEA 5C07A 4LASL 4JZJC 1LO2H 4HC1L 2A6IB 1UXWB 1IC7L 1ZKAA 5E8PB 3OQ3B 5A2LH 3UC0H 4FXLA 3GHEL 4J12A 4PTTA 4AK1A 3WN5C 3SKNA 1IKFH 2LABA 2WW8A 3IJHB 1IZJA 2HKHH 2RB8A 1YN7A 5EU6D 2JJVA 4QF1B 1TENA 5C0BE 1XFPA 2A38A 1U95B 5I15H 4GW1B 5IVZA 4WU5A 5DJ2B 4N68A 3RWDA 3WFBL 2B8OT 3R06A 3FCTA 1DR9A 3OAYH 2DQIH 4JREC 5DZLA 3PXJA 3CDFA 3AB0C 1G7HA 4DZBB 1MFDH 4YGVB 1X5JA 2E3VA 1WISA 1CFNB 5T5NG 3P73B 5F93C 3WIHH 4OZHF 3RAJL 1QD0A 2J1KA 1AFVH 1TIUA 3LH2L 2XFXB 2XA8H 1AO7A 2FX9H 3IDJB 4RISL 4FQ1H 4QRQB 4O58H 3NAAL 2MNUA 1JPTL 3QJHA 1A0QH 5HGAB 5F7EL 3SDCC 2O26U 5JORB 1JF1A 3HC4H 1CD0A 2CH8A 3CFJB 5DQ9B 3OAUH 1JHTA 1W8NA 3TGXA 1JMZA 1D5IL 2OZ4A 4OB5L 3VDCA 4PY8J 3MQIA 4YDJB 3MRBA 2XPGB 3WNKA 5E7BA 4E41D 43CAA 5MEOB 1B0WA 1X44A 1B4JH 4Z7WF 3GSVB 3KYMB 4HWBL 5HI3D 3WKML 2AGJH 1R3JA 4X5WA 1HEZA 4OZHE 4OGAC 4NO0A 4KJPD 2WWMC 5I9QC 3MJ9A 1NLBH 4JKWA 3DRQA 1A47A 1MWAA 5KSAD 2R15A 4CKVX 1OP5K 1A64A 4M7KH 5BVJA 4YHMH 1CFQB 1YY8A 5C2BL 1AR2A 2J6EH 4KJYB 2VYRE 4H8WL 4Y5YA 5F7MC 3PV6B 5GIRA 4A2MA 3V6FB 1IAIH 2I07A 3AS2A 3DTXA 4Z7WE 1MCDA 2ATKA 5J56B 1MAMH 4NN5C 5EC2A 1RUQH 1HSAA 2R2HA 4GKSA 4M1GL 3ZE0F 1F8TL 3HNVL 3GJEA 2WBKA 4RFOL 1FNAA 5GS0L 4EUPA 1PLGL 4JFFA 4Y4FC 3THMH 4JHAL 3G08A 4XP4H 3BI9X 2ZNXA 4JFZH 4JEGB 2DQTL 5IOPA 1UWEH 2XWJB 2DWDB 2HFEB 3BISA 1K3ZA 1OW0C 2VIRB 3L9RA 1CDYA 5FO9A 1ZGLM 4V1DB 4DAGH 1DUZB 3DWTA 1MH5B 4JO4H 4HCRA 1IM3B 4Z9KB 1LILA 4RFNB 3MXWL 2HWZH 1JWMA 5HI5C 3P4LA 5FECA 1E6OL 4KKLD 2ADGB 3BZ4B 3RBSA 4NHCL 5T1LD 1FZKA 4R2GD 2HLFD 1FL3B 1JV5A 4O51B 4P2OC 3V7AG 3OSKA 5GS0D 2IQ9H 4BSVB 5ID1A 1RZ8B 3EJZD 5FEBA 3KPRB 1NC4A 3NVQA 3L3IA 4YXKL 3GFUA 1GZPA 3SKJH 4XXDA 5E4EC 1KN4H 4M4PA 4DGIH 3QSKB 1NEZG 2BSSA 1PX4A 3QPQC 4WEMB 4UOW0 3LQZB 1U8PA 3B4NA 1CLYH 3IDGA 4KVCL 5ICXB 3LRSB 5HDLA 1ZLSL 4JQVA 3WE6A 2CLRA 3TBVA 1U3HA 3O41A 4NZTH 1V7NH 3EO9L 4PS4L 5C0DB 5C0FB 1A6WL 1CE1H 2D4DA 5E5MA 4PGEB 4QOKA 2P5EE 2APFA 1XIWA 2ZOKA 5ESQB 2IEPA 2R1YB 3RY5A 1ADQL 4DOHB 1N5AA 4JDVA 4NC1C 5F1OB 2A73A 1WAAA 1Y6NR 3ARDB 3T0AA 4NC2B 3B2VL 5GS1C 4D8PA 4G80A 1FO0A 1R24B 1G7JA 5IHUL 3O45B 5BJTA 2EXYD 3RZWA 1DBAH 1KGCE 3PWLB 2W9LA 3DO7B 4IJ3C 3KHQA 3IVKA 4MA8L 1MJ8H 2AK4A 2QQNH 5KSBE 5D2LE 4C56A 3QUZD 4YE4L 3O8XC 2D7TL 2Z93A 5KS9B 1RURL 1CDIA 2CKBL 4HKXA 3VWKC 5HYJA 3P0YH 2FR4B 4XC3H 1ZWIB 1Z9SA 4CDGC 5JQHC 2PTUA 5KVDL 1HZHH 3SGJC 5DJAA 2DI9A 4XNUH 3L5XH 3SPVA 2FB4H 2H41A 4JFEB 1GHFH 3ECBB 5GRZA 3BQUD 4M7ZC 5C6TH 4YHNB 3TYGH 1K8IB 5GGTL 1K85A 4QWWC 2DQDH 4MAYA 4X4XB 5FF6B 4ODTL 1YN6A 2IQAB 3TIDB 4OGZA 1G9NL 4JGMA 5DT1L 1X9QA 2I9TB 4IRSC 3E8UL 4NJ9H 1A6UH 3QDME 1A3LH 5F1IA 1NGQL 4XVSH 2NY3B 2RFXA 5DJYB 3G6AB 3MLWL 2Q7NA 4QXWA 3L95A 1FSKC 4APQA 3G5ZA 3C6LA 1TQBC 5KSUB 1ULVA 3QZWG 3W2DH 2EECA 3REWA 3SE4A 3UTTE 5DWUH 5A16B 2MMXA 4M1CD 3E2HB 2YPLB 3GM0A 1F6LL 1FFOB 1UCTA 1S7VA 3HFML 3OV6A 5EZOL 2G75B 4JN2B 2CRYA 3RDTD 2NY6D 5K9JL 3RAJH 3GSUB 3BYYA 3IAQA 3MBXH 3PL6A 4AQOA 1AO7E 4TSBL 1DQTA 1KBGL 5KVEL 1SMOA 1T21A 5HYEA 5BS0E 4NSKA 3D85A 4U1SB 3NAAH 4KAQL 3ULVL 3N06B 2GSIB 4PYGA 3STZA 3JTTB 4K55A 3STLA 3DX8A 5JOEA 1W72A 2R69L 3KPRE 4EQ3A 5DJ6B 5DTFA 1NKRA 1PD6A 3S4SB 5T1MB 1BZ9A 3F7VB 4GAYA 5J4MA 1ROWA 3WKMH 5KS9F 1NUFA 2BCKB 4NNXA 4M5YH 5JNYB 4UMGA 3MBED 5DJXB 4KMTL 4FZ8H 1TTUA 4PLJD 2ID5A 2QQLL 4NZUL 3PWNB 3KPMB 5FYLH 4RDQG 1UWGH 1M7XA 4IHOB 1L0XA 4LDOB 4KRPB 3RWEA 1S8DA 1NAKL 1NMCB 4PJIB 2HT4C 2CKNA 5AWNH 5C2BH 1OSZA 5HGHB 1A3RL 2YD1A 3MTRA 4W68A 2EEBA 2HJLA 3M07A 3CPLA 4OSUL 5KS9E 1F3DJ 4QXTA 1CK0L 4WIQA 2E7HA 3MFGB 1L7IH 4XGZB 2R29L 1I1YA 4JANB 3UZVB 2OMNA 1R3LA 4N1EA 5F1NB 4KUCF 1BD2A 2WK2A 3HE7B 2FHFA 3ARGD 4HQQH 4X6FA 5HHNA 5HHOD 4UINH 3LIZL 4B5EA 5GS0H 1PLGH 4MAUH 3TFKD 2GJ6B 4MJ2A 5GQBA 4HSQA 3HRZB 2ZOLB 3DXAD 4Z7VB 3MRGB 1F45A 4U6XB 4L4TE 1Y6KR 4Y16C 2X6MA 3E6FB 3ZYZA 3ZZ1A 1WBYB 4KPHH 1FLTX 2D3VA 1EHNA 4KI5C 4HC1A 4DKAA 3C8HA 1C7TA 2OI9B 2WUCH 4J3XA 3IF1A 4ODXB 2DQGL 1OB1A 2YZ1A 3RPKA 4AH2A 3MCKA 4PJAE 5DGQA 2R23A 4Y88A 3FT3A 1P4BL 3QUXC 4LSDA 3FOLB 1E4WL 3QUKA 4M3KB 4ZUWA 3RNQB 4KZEL 1JNLL 3S36L 3V5DA 3QIBC 2IMMA 2JELH 1MLBA 1S9VA 3B9KB 4PJ8B 5CGYD 4GBXB 1VKXB 3IGAB 4PY8I 1I75A 1M7DA 5E8OB 3QUMH 5FGBC 4YXKH 1UJTA 4E41A 2C3VA 3MRLA 4U1JA 1JRHL 4PJDB 5CZKA 2CDEA 1CFVL 2OTWA 2QQQA 5CILH 2VDML 4P23B 3Q5OA 3H3PH 3PWJA 4QHUA 4PRPE 1JGVH 2QHRL 4PS4H 4ZS6D 5EU7C 5E4IA 1A6WH 1YA5A 5IUSA 4QOKE 1YEDA 2ZUTA 1DE4A 2BSTB 1RQ5A 1FQ9C 4I18B 4U6YA 1CVSC 5KSAA 4JFOB 4YPGB 1OOAA 1JZ5A 5E8NA 4HW6A 3S97C 4PJIF 2HJKA 3VG0H 4D9QE 1GGCL 2EO1A 4EI5C 4PJ7B 4YK4C 2BJML 3HCVA 4M7LT 3CGTA 4C56E 5LGHH 2NY4B 2D7TH 4BZ2L 5HYJE 3VH8B 2CKBH 3IT8D 3KPSE 4HWBA 4IRJD 3JTSA 2F19H 5FYJH 5IESH 2GJZA 1EJOL 3GSOB 2WBJB 4LLUB 5CWSB 4RAHA 3FB5B 4KMLB 3LKQB 4LCCB 3C2AL 3B5TA 3HLAB 3VFPB 4AQ1B 4PJFA 5EOTA 4LLYA 3KXFB 4Z7VF 4Q9RH 1H5BA 3GBML 4HT1H 5T33L 3T0WA 1CGYA 5IROA 4J2XA 4MB5A 4LOUD 5F9WB 1A21A 3O6KL 5IVXB 1AY1H 4YNYB 2V9TA 3SJVB 3TH2T 5DT1H 3CZJA 4G8EA 3FB8B 4M8VA 3VWJB 1ZT4B 1KOAA 3BKCH 1NGQH 4XMKL 5HBBA 2HVJA 3VGFA 4P5MB 3PQYB 3QULA 3MLWH 5T1LA 3V5KA 1QVOA 4F80A 3J8F7 3QIWB 4KJQD 4JN1L 2F54E 2FJGA 2ZUUA 4NRYA 2XTJD 5E2TH 4BK4A 1J0HA 1MFAH 2FZ3A 4Z7VE 3FTGB 2C1OB 4UOJA 5F3BB 3QDGE 1UKTA 5I1KH 3VXNB 4AM0A 1J8KA 1G1YA 1HKLH 1EFQA 2YA2A 4WWKC 5JQ6L 3VG9C 2N4IA 3EZ8A 3VXOA 3IFPA 4PJDF 2W0FB 1MLCA 3GBLA 4U1HB 1Q0YL 2V2WA 4TSBH 3VFOA 2CLVB 4WFED 3OKEB 4GMTH 1ZV5A 5E24E 4YFLF 4KAQH 4WY7H 5EO0A 3MLUH 5IMOA 1BGXL 5BZDA 1RU9H 1A7PH 3M17A 4OZGB 1GSMA 5I8EA 3P9MB 4X6DE 3KDMB 1XZ0A 2R69H 5ICZA 1SMAA 4EXPX 1RZFH 1E28A 1PKQE 3MRPA 4HJGA 3MJ7A 5IB2A 5DXWA 1U8HA 4XBPB 3QUZA 5ETUA 3LD8B 2BFVL 3T1WA 4O9HL 3OJDB 2P1YA 1EAPA 4BFIA 4KMTH 3RWHA 5DRXB 3BMVA 3TO4A 4G9FB 5ITBL 3FFCB 5I1IH 4ZUTA 2P8MA 4R4ND 4M9OA 1T1ZB 1ADQA 1NAKH 1UH2A 2P8LB 3BQUA 4N0FB 4IOFC 2V7HB 3U1SH 5I0DA 4NKOB 1J86A 3VXME 1KF9B 4WHCA 4WJ5A 3DUSB 1BWMA 5I1GL 4HLJA 3DHMA 4JY6B 3X12B 1A7NL 5D70L 1S7SA 5IVXF 3CLFL 1Z2KA 1NGPL 2YRLA 3PHQA 3QNYA 3C60B 4I8DA 4XNYL 5LGJA 2CKBA 2R29H 4EUPG 2EE9A 4TNWK 3EYVB 5CBAA 3RX5A 2DBLL 2HRLA 3GGWA 1J0JA 4NN5B 4HH9A 5EU6E 3TESA 4OV5A 2ZUQC 4U1LA 4POZC 2YSSB 1QQDA 2ADFL 1AGDA 4CW1A 5CIPA 5GGTA 3HS0B 5HYFA 1FNFA 5DMJB 2R2CA 4GKZA 3ES6A 1REIA 3RDTA 1ONQA 5DD1L 2FECI 2DQGH 3AS0A 3KLAA 5F3HB 1JZ3A 1P4BH 4HFUL 1VGKA 2EXWD 2AJSL 2YUVA 3L5JA 3S36H 1ZLUK 4U0RC 1T66C 3BEWB 4OZGF 4RAVB 3QCTL 1B3JA 4TVPL 4LCIL 4U6VH 3RTQD 3NIDF 2VUOA 3IRZA 4IEFB 3QUMB 4ZTPL 3WNMA 3L3HA 3TWCH 4N8VA 3FQWB 4QRRB 3ZHDA 1MJ7L 4LVOC 1JRHH 4I9WD 2ZJSL 2A9NL 3Q1SL 4WO4C 5IR1B 1NUGA 4OLEA 3BDXA 3FO0H 1X5KA 1R5WA 3FMGL 5T5FL 2WAHA 1UJ3C 3CFEB 5E4EB 3H9HB 4XMPL 4OFVA 3AMKA 2F74A 3PGCB 1VFMA 4ETQB 5HJ3A 4AG4H 43C9A 3DX7A 2YD3A 2UWEE 3UCRA 3KLHD 3S36X 5D72L 1A6AB 4XP9L 4TUKL 32C2B 3X14B 4LCYA 4UV7H 4TVPD 1GGUA 1ZVYA 4R7DA 3FRUA 1ES0A 3IS1X 1UVQB 1J05B 4P2CG 2BJMH 4Z18A 5CZVL 1DSFL 3CDYA 3GMRB 2YN5A 4Q2ZA 5GS1B 1CFTA 3MUJA 5C8JA 5FDYA 1OLZA 2ICWA 4M6OL 5JR1H 5IBLC 2D31A 4IJ3B 4Q7DA 1KC5L 1QYGH 3ET9F 4PB0L 3ARGA 4BSWB 4R0LA 5HHOA 3VWKB 3FFCE 1E0OB 1U42A 5L2KE 1XGRB 5C08B 2W9DL 5C0GB 5DK2B 5KJRL 5FYLE 3OAZH 3CSGA 1ZANH 3DXAA 4HPYH 1NUNB 1HI6A 5D7JB 1RHHA 5I16A 3IFLL 2YEZA 3B83A 5HVGB 1W8OA 3QEHA 1YNTB 3FN0H 5T33H 3LEYL 1BAFH 4M7ZB 4V1DD 5GGRB 1MFCH 3O6KH 3Q6FB 5ADPH 4E42B 3O2DL 3K2MC 5FOJA 5GSVA 4LRIC 1FH5L 5T1KA 4AIZB 3N1GC 4IRSB 3MV8A 1JL8A 1A1OA 4N5EC 4OTXL 4XZUB 4JN1H 3EDKA 1YMMB 1FYTA 3JZ7A 4HIIA 2J12B 1AHWA 5EC1A 1YQVL 3VFVA 3QRFM 1CDGA 1FSKB 3HB3C 3QHFL 3RZCD 1TQBB 3GKWH 5FXCH 2H9GB 2JKXA 4D2NA 5D6CB 2J4WL 4OCRL 3QI9C 4U1GC 1AR1D 3AM8C 4M7LH 1UB6B 1C5BH 3UO1H 1BGXH 3MLTB 3EIFA 4Y2OA 3SKMA 3O3DB 4PGCA 2ZUWA 3MRJA 4P46D 4PRDA 3JV5A 4F58L 2FO1A 4TULH 1Z3GH 5EULV 3TO2B 4Y8DC 4HGWB 2Z92B 5IW6A 3A67L 4ELKA 3DX6A 3PJSB 3CFBB 4UNUA 4ELME 1MIEL 2AJ3A 1DJSA 4XCCH 3TCLB 3KPTA 4IRJA 5EPMA 4HLZG 4X9GA 2C1PA 5EOQL 1DBBL 4YC2C 3TA3B 2LQRA 3EFFA 2P47B 2NMSA 1WCQA 2P8PA 3MRQA 5ITBH 1KFAL 2A6KB 1HSBB 4JFED 4M00A 3TBWA 1QEWB 1EX0A 3LDBB 1QFWI 3QI9D 2IBZX 3PHOB 4XPFH 3C5SA 2SEBA 1KJ2H 4LVEA 4G8IB 5H2BA 1OVZA 1OCWL 5D7IB 4NC1E 4J4PC 4UU9A 4CVZB 3SQOH 4D0CB 4PV8A 5D70H 3U36A 3RI5F 4HMCA 3CLFH 2EKSA 5GZOC 2UUDH 1NGPH 3IDIA 5D5MB 1VEOA 1TCMA 2NY2C 3HN3A 4GG8A 1V3MA 5HY9B 5FYJE 2NY3D 4RFEA 5C0NC 4JDTH 4L5FL 4YIQA 5DJCA 1ITBB 3AGVA 3LQAC 4JFDA 4MDIB 3UYOD 5D1XC 1OM3L 4L1DA 3VW3H 1I3RB 3MJGX 3TC9A 3FB7B 1D3CA 4R97C 1JYXA 5SX4H 1CL7H 1CXFA 4Z7NF 1BJ1H 3BGFB 4XP1L 5C0IB 3D6GA 1J7VR 3DECA 3MGTB 3FQUB 1JHLL 3IXAA 3OJMB 5EZLA 5EOCJ 1JYWA 1OAUL 4BFBD 2YPLD 1QG3A 4NRXB 1NDMB 3MACL 2W60B 3DJ9A 5DD1H 1DDHB 1WT5A 5MP6L 5DHXB 4K7FA 4Y16B 5DRNB 1VFBA 3QHTC 4HUUB 4X6EA 3HAEA 4LAQL 3FT2B 3BP7A 2GEEA 3QYCA 3VXSB 1BBJB 2VXQH 4JO1H 4NUGL 4GG6A 1IQWL 4HKJA 1G9MC 1F6AA 1WF5A 3QUXB 2JJUA 1YMME 4YHPB 2YD8A 4LCIH 4TVPH 5KN5B 4Z7NE 5CEYB 3T4AA 1XF2B 5A3ID 1KJ3L 3F58H 3DO3A 4ZTPH 2EIBA 1KPRB 3REVB 5D1XD 2XWBA 3DVFA 5ISZB 2YUXA 1GJIA 1KCSL 3NTCL 1N3NB 3O4LB 2X4SA 4B50A 1S9XB 2W91A 1EEZA 5DS8A 4B7LA 5DMKA 4CBPA 3P0VL 5T5FH 3FMGH 4QT5B 4XMPH 2ED9A 2HTKD 1AJ7L 5F7FA 4D9LL 1T83C 3BDYH 1BOGA 2NY0C 5D72H 1FC1A 1I4FA 1OGAE 4XP9H 3RY6A 4TUKH 2GT9B 2CUMA 3I9GH 4QRUB 3RWGB 4NBZB 3GMOB 3MROA 1CYGA 3OXRB 3OBAA 5GGUB 5D7IF 1P1ZA 1YEKH 4LIQL 4LSTL 2GCYA 2O61B 5IG7B 1UXWA 1I7TB 3RVTC 5GRUH 2Z35B 4GLRH 5E8PA 1JJUA 4M6OH 3SBWA 1OAKH 4WUUB 5D5MF 5HYIA 3WO4C 3GBNL 4S2SA 1KC5H 2Z31D 3MRIB 3T0VA 3HE7D 2IF7A 4PR5B 3LMJH 1F4HA 4WHYG 1AIFB 1JCKA 4UDTB 3QQ3B 4DGYL 1F90L 1ZHLB 4QF1A 5KOVC 1BM3L 2GJ6D 5KZCB 2HJFB 1U95A 3VMNA 4GW1A 3H0TB 5DJ2A 3SO3B 3IFLH 4MSWA 3DSFL 1IKNC 2FJFB 1WICA 4MB4A 2GAZB 4U05A 3LEYH 3V4UH 4XX1G 5AZ2H 2ZNWA 1N2RB 4DZBA 2DQCH 3FO1B 3TN0C 1CFNA 2EEDA 3LKOA 1NLDH 3W9EB 3B2UC 1FAIL 3NIFE 4Y2DD 4U2YA 2AV7B 4M6NL 5KANI 3T2NL 3IDJA 4KI5F 4QRQA 2EDNA 1HINL 3FONB 5HGAA 3S6CA 3BT2H 5JORA 2MCPH 4BYHA 2CO6B 3CFJA 5DQ9A 1XGPB 5E2UH 3R1GH 3PDOA 5BQ7B 4LPUA 4HF5H 3F7QA 2WBWB 5GRJL 1I8MA 3I6LD 5MEPB 2VE6B 2XPGA 1UG9A 4GOSA 1FGVL 4LDLB 3QHFH 5MEOA 4FTVB 3MV9D 4HIJB 3GSVA 3KYMA 3WUWB 4MJID 4CJ0A 1BEYH 3EYUH 3UTSB 4J6RL 4JFYB 3KYKH 4WWKB 3VG9B 5F88B 4FQPA 4KI5E 3V5HB 3HG1B 1JN6A 2YOCA 3NCYP 5L0QC 4MHHI 4XCNA 4XMLL 5I8KL 4TSAL 4PY7A 4EDXB 1ZGLA 4KJYA 5J9PB 3WDIA