5IV2B

Cetuximab fab in complex with arg9cir meditope variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
216
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cetuximab Fab, light chain
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 216
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iv2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iv2B01
4YPGA 4E5XA 4Y7MA 5IVZB 4PY8J 2GCYB 2NW2B 2ZUTA 3OL2A 2E7LA 3DMMD 4RCAA 1JHTA 5SWSA 1PD6A 3I3BA 1TQBB 2DS4A 5DS8A 3HR6A 3UYRL 4KKCC 1BFOB 3I3EA 4NSKB 1IQWL 1FN4B 5I1JH 1NFDF 3QQ3B 1A14H 1KCVL 1YEDB 3C60C 2NY2C 4MJ5B 1MHHB 3RKPA 3V8CA 5IVOA 4OCRH 4XNZC 3FQNB 3EDEA 3GNMH 2EYTA 1KLUB 5DJ6B 3FQWB 4OZHF 1YMMB 1X4YA 2EKSA 5D1ZB 5DRNB 5ID1A 4XMPH 5IMMB 4EOWH 1MWAL 1NBVL 3HNSL 4JPVL 1YNLL 5MEND 1EEYA 3KS0J 1JPGA 5DMGC 5L2JA 1HYRC 3W5MA 4FQHB 5DVLA 4QO1A 4PJ7F 4FQPA 4HV8B 2ZCLL 1QVOA 3JTSB 4AEHH 5HYJE 4MLSA 1IE5A 1MELA 2Q76A 4JG1H 3H3KA 4NKDA 3VXTB 2YUXA 1N0LA 4CMHB 4QT5A 1YN7B 3PGCA 4MA3B 4GG8B 1P5VA 3WFZA 1BVLB 3X3FL 4L4TA 2NX5E 5MEOB 3OZ9H 1QBBA 2AV1B 4IDLA 2DBLH 4J3XA 4NM8L 3UJTH 1J1XL 4YHPB 3CFBB 4CN1A 5AG8A 4P59L 1XF5A 2ATPA 4UDTA 2R8SH 1CGUA 4DGYL 5DWUH 1WISA 3NCBB 3RWHA 4HIEB 4P2CG 4GG6A 5HD8C 2XTLA 4RAUB 2VN4A 4YUEL 3S3JA 2YN3A 2CKBA 2BY2A 4JHZA 5EU5B 15C8L 2IAMC 1E6OH 5JHDA 2QSCL 1FAIL 5TGBB 5DDHB 3BRDA 2JK5A 3VMPA 1IZJA 2BRRL 4NGHL 4AT6B 5FUZH 5EFIA 5L7XL 1SM3L 4LCCB 2AK1L 4PTUA 3LN5A 3EFFA 4KDTC 4JJ5A 1ADQL 4Q9RL 1I1YB 4KRPB 2BOCA 3OPZL 5I30H 2XTJC 1MAML 1QFWM 2HFFA 2H32B 5KSVB 4ZUWB 4J7RA 4JO2H 3QI9B 4P2OC 5FO8B 3HRZA 4M8QA 2NY4D 2ADJB 4M03A 2RBLA 1W0VB 3MGOA 3BRFA 4RFNB 4TOYL 4JDZB 4MNGB 2WNGA 3FKUS 4XNYL 1KTLA 2NW3A 1G7LB 3SY0A 5B3JF 1DE4B 4GKNA 1U8PA 2NY7L 2Z91B 2X4OA 5K9JH 1N4XL 5C86A 3S98A 1XGTA 3ULUH 2DQIH 3FCTB 2EKJA 2DTML 2HLFD 4R4FL 5CSBA 5E1HB 1QEWA 3WIHH 4UDUB 5AD0A 3GSVA 5KSAB 2XA8L 5GS1B 1FLTX 4Y1AD 1WWBX 3EYFB 3TVMC 1I3GH 3P9MA 5MI0C 2ESVE 5JLZA 5JQ6H 5C0DB 4MA8L 3QQNA 3V5HB 2DQTH 4K94L 1NGPL 1JNNL 4FZ8L 4PJ9B 5I8OH 4KMTL 4NC1C 4X98B 3Q3GB 2OP4L 4QCIB 4M7LL 1VFUA 4JRXA 4N5EC 3TBSA 2F54E 1VENA 1A9EA 4E42A 4L4VA 2CD0A 4PYGA 2IANB 4P2RE 3WLBA 5IESL 3O3BA 1ZHBA 1AY1L 4QRUA 3QFJA 4NBXB 5TF1L 2H9GA 2IWGA 1S9VB 4TUKH 1CFSA 5E4EB 4RGNE 2X4QA 4ZTOL 4GS7B 3HE7C 3RVTD 4JFZH 4L3EE 1G0DA 1Y18A 3Q6GL 2R0WH 4I48B 1SJHA 3FB8B 1T6WA 1MREH 1I1AB 4PJBE 1J8HA 2G2RB 3QDMB 3KPOB 3VXSD 3ILQD 2J88L 5BVPL 4G6KH 2DQFB 5KBNC 5EU6B 4QXGH 3RZCB 3HB3C 4Z7OE 3O0RH 3WCYA 4GOSA 1KJ2H 1W72H 2FRGP 2VJXA 2F58L 3DXAB 3FONA 4WWKB 4OZIF 3KYMB 1A3RH 3VGDA 1LP9A 4J3UA 3ZKND 1NPUA 2JB6A 3RVWD 1EHLH 3FN9A 3TBVB 3VH8B 1DQDL 4FG6D 4KQ4L 4MB3A 3GMQB 1UWXK 3AREA 4RGNC 2F53E 1Z0MA 5FXCH 1FORL 5J7CC 5T3XD 3TP4A 1UB5A 5D7IE 1MJJB 5DRWA 5FYKL 3IFLL 3C6LD 5E9DE 2GJ6E 4TVPL 4NNXA 4YHMH 3F58H 3ULUF 5KVMC 3HCVA 1JV5B 4YAQB 1QBLH 2GT9B 2I5YH 2J6EA 1VFAA 1BEYH 5D2LF 3TFKD 5EORH 5HY9B 1DQJA 3IS1X 4LVHB 2V5TA 4NT6B 5FYJH 3BESR 5CS7A 2VSCA 3PWLA 5SWSE 4I5BA 4MA1B 3DX6B 5C0AA 4P9HL 4PGEB 5C09D 4J6RH 3DETD 2NY1C 4YDJA 3IDYB 1R3JB 4R0LA 2CIIA 3WXWL 4NWTH 4CNIA 4Z8FH 1I1FA 4YIQA 1JHKL 4X6FB 5FOJA 4OSUL 3O2DL 1CIDA 1UACH 4HZLA 3G08A 4LKXB 3VXNA 1Z0NA 2NPLX 2JELH 2NZ9D 3D3VB 3V6ZB 4NKMA 2RR3A 1U93B 3I75A 4ZODA 3A6OA 1BM3L 3C5ZA 1NGXA 4HUXB 5DF0A 2OTWA 2V2WB 4L8CB 3OKKB 4UQ2B 1FVDB 1G1YA 5DUBB 2VQ1B 4F58L 3G5YB 4X80L 4AZ8A 3FO9A 1T6VN 1FFPA 3CH1A 4XP6H 3MYJB 4GXUN 2AJUH 4LF3B 5C2UB 1BQSA 4OZFH 3LD8C 2E7LC 1KEMH 3LKQA 1BJ1J 3CFIC 2R23B 2D0HA 4Q9CA 3IAGC 3TH3T 4PG9B 2WBJA 4L4TE 2R15A 4D3CH 5DJXB 3RVVD 2Y07L 4WU5A 2OBGA 4NQDB 4UT9L 4X4YB 3G6AB 5IG7A 4HGKC 1AQKH 5I9QB 1BLNA 2WBKA 4GG6E 5BOPA 3MNVB 4FTVD 4RA0C 3I9GL 1DUZB 2XKNA 4K7PL 1JGDB 3NA9L 1VPOH 2I24N 5JIPA 3RWEA 1T5XA 3UTZA 3VCLA 4CU6A 4XB7A 1A7PL 1G6RA 5GJTH 4DOHE 4C56D 4DEPB 1YJDC 1MLBA 4G8GD 4H88H 4Q9BA 2I9TB 3KLAA 2EYRB 5E03A 2J4WH 1ORSA 4PLNC 2R1XA 5DMIH 1NEZB 5CGMA 1C7TA 1P2CB 2XZCL 4YZFF 4CVZB 2DWDB 4MJIB 4LFHD 4ALAH 1IARB 2NYYD 3NPZB 5F1IA 1ZVSA 2NXYB 1MLCB 1CN4A 5ESVA 3P77B 5A1AA 1E28A 3FFCB 4PRNB 2H32H 2KDGA 5H35B 2IQAB 1XCTB 1ACYL 4LQFL 4HBCL 3W0WA 2XFXB 2Z35B 3TJHD 4ZTPH 1QPXA 4EI5D 3TIEB 2HJLB 4FN0A 4FQLH 5HHVL 1IZKA 3I6GA 2VISA 2FIKB 3J8F7 4PTTB 4OCXH 2VDKL 4FQ2H 3EKCA 4GW1B 1F2QA 5EULV 3REVA 5DJDA 3ULVL 1A3LH 1F2XK 3BZFB 3OJMB 4P5TB 1T1ZB 2VDLH 5C0CD 1K8IA 1MH5B 1CLOH 4GRLD 3WEXA 2EC8A 3PQYE 3DUSB 5CEXA 3ORJA 3TH2T 5ADOL 3BZEA 2GITB 3SDAD 3LH2L 2X4NB 5IB3A 3O3EA 2NMSA 4NHCH 2HKHL 4ZPVA 2AV7A 1JE6A 4JRXE 4TSAL 4AIOA 2BFVH 5IWLA 2DOCA 5EO1B 4UTBL 3V4VH 2B8OT 4NJ9L 5TE7L 2BVPA 5B39A 4B0MM 2R2HB 3SJVA 3K1DA 3UMTA 4TSCL 4S1QH 4G9FA 1TZIB 4P5MA 5EBWA 1QBMH 1ORQB 1MWAA 4XPBL 3IDJB 3S97C 3SKMB 2A9NH 1OGAA 4RMRA 1P1ZA 4FQXA 4XX1E 4GQ9H 3E2HB 5I73B 4MNHA 4XMKH 3M8OL 4WUKL 1AP2A 5F7EL 3O6FB 4U1HB 4NQVA 3VFWA 5E2WH 3FT4A 1AGBB 4HIXL 1GOHA 4XVJH 1J8HE 1I85A 1CF8L 2WLZA 3B8YA 5D71L 3QNZA 5HYJB 4GAYA 2HG5A 3MRLA 3VH8G 5CD3A 4JEGB 2QKIA 4XWOC 4KY1H 5T5FH 2Y25A 5E56A 3ARBD 2VB5A 4ZNEA 3MSPA 2DMCA 1BQHB 5IB1A 4RQQB 4U1MB 1HSAB 3DSFH 4H1LA 5TE4H 2HTLC 1HHKB 3GMRB 3LKSA 1YEGL 2R2CA 3QXUA 4JDVB 4NKOB 4YBQC 3VFPA 1IGCH 1JZ6A 4X6EA 1MRFH 1Q9LB 1MF2L 4MQ7B 3MREA 3CSGA 5CJOL 3MV7A 1RJLB 2NY5L 3H42L 5F6IC 3ARXA 1OOAA 4UOJA 4IBLT 3BEWA 3WFEL 3QH3B 3ZTNH 2VO5A 5CD5D 4XHQA 4RNRB 1OAKH 3P4NB 1T7WA 5JIKA 1IM9B 2VZVA 1JPSH 1JTTA 4ZO8A 2P46B 3MGAA 3C5SA 3U79A 4F9LA 1J87A 3B4NA 2PO6B 4FFYL 5E1AA 1CK0H 2HYMA 4JCLA 5F71A 3REWB 4HQQL 1OGTB 3VGAB 2RFXB 3HG1A 5DK0A 2GTZB 1LO0L 5SV3A 5MENE 5D2NA 1ZLVK 3ECBB 1NKRA 3TN0C 5J13C 3RAJH 2PXYB 3PP3K 1U8JB 3VI3E 1QR1B 5F3HA 3IU3A 2W91A 5BXFA 3TCXA 3CVIH 3L9RA 4QY8B 2IQ9L 4A6YB 3AREC 1F8TL 1M6OA 3CFKA 2BVQA 2DIBA 5GSVB 1MPAL 4U7MA 2DLFH 4LMQI 4RFEA 4CADB 1RZJL 3CMOH 3VWJD 4HUKB 1RK0A 4BFGA 4HJGB 3NABH 5EN2A 4FFZH 2NY6B 4X7DC 3AMKA 5C6PB 2HT4C 2V9TA 3DPBA 4DJMA 4QRRD 3ZLQC 2X5PA 1IKNA 3SGJA 4FMFA 3ELAT 1CXEA 4OQTA 1TJIH 1CICA 4HMDA 1GL4B 3JXAA 3WHXB 1IAII 3DO7B 5D8JL 1TVHB 5DYOA 1WC7B 2KZWA 4HDIA 4D0BA 3MLTB 4R0LC 2AI0H 2QSVA 2Q6WA 4AMKL 1A5FH 3T77B 4OD1H 1GXEA 2NY2D 1HNGA 4JFXB 4DUWA 1OAQH 1UEMA 4O2EA 2IPUK 2F54B 2AJVL 3ZE0E 4QOKD 1JBJA 3D69A 3I50H 3VXRA 5T1LD 2VABB 1FAKT 3C5ZC 4P2RB 1Q9KA 3EGSA 3QJHB 2UUDH 3VFVA 1KN2L 2R69H 1NEZG 3DX8B 1P7QD 2V17L 3TEUA 2ERJB 5IFHL 1YQVL 2HH0L 1C5DB 4MA7L 1X5GA 3CXDH 4HAFA 5FA3B 3MOBL 1OAXH 4GKZB 2DM4A 4X7CC 5FOBB 1G9MC 4DW2L 2B1AL 4QRPB 1RUAH 5IF0A 1BFVL 4NM4L 3PL6A 2WBJC 1HILA 2DTSA 2ZUQB 5CUSL 2XZAL 2VLJD 5KS9B 1E4WL 4N8VB 2D4FA 3O4LE 1JPTH 4MGXA 3SE9H 3MRNA 3STZA 4QTHB 2NNAB 4EN3D 1LNUA 5JMOC 5AWNL 3W0WE 5E70A 5JTWA 2V2TB 4F8TA 4JFHD 4S2SA 2EZ0D 5SX4H 2F53B 3C5JB 3VW3L 4X6BA 1NC4B 5D7IB 4PRBB 2WLYA 3M1BB 4P2QB 4XI5D 4MDIA 1LE5B 2A9MH 4AQOA 1EUTA 2GSGA 2GJ6B 3N06B 5C0BD 2FZ3A 4R6UA 4PR5B 4Y2DA 2R4SH 1WICA 3NFNA 1JF5A 4Z6AT 4QHUB 5IM7A 3T2PA 2C3VB 3BZDA 5D5MF 3L3KA 1KCRL 4G6MH 4ZFGL 3WUWA 4L29A 4ZS6C 4F80A 4HIHA 1K4CB 2EXYC 3T0ED 4R4BA 1ACZA 4X0KA 5IT2L 3RL1A 5FB8A 2BDNL 4LVOC 1BOYA 2BRQA 3O2DA 2AERT 4K8RD 2OR9H 2VDMH 2Z31B 1RFDL 3WHE0 4G9FE 1MCWM 2V9RA 5D7JA 1OGAE 2EO1A 2H26B 3RFZC 4ETQA 1G7HB 2YZ8A 1YN6A 3LSOB 4JFEA 3W11C 3MRHB 1HXYA 5AZEH 1PZ5A 1RUPH 3B2UC 4JKMA 1UCBH 2BY3A 4HXAL 4EUPB 1MHEA 1XF4A 2YRLA 5AEAA 1T83A 4FXKB 5I66A 2J2ZA 3O11A 1D5IH 2MPAL 4JREB 4NJAL 2F19L 5IWLC 3VRIA 4ZNEE 1KCSH 2A83A 1KYOK 4WHTB 1F90L 2QR0B 5E6IA 4XP4L 3N1PC 4LLWA 5MEPA 4F9PA 2H8PB 5D6CB 4X6CB 3VFUB 5E8OA 1YY8B 1FLRL 3D0LB 5T1KB 1YYMH 1ED3B 2FX8L 4M7KL 3S5LG 4LSDA 4FQXC 5DJYA 1ZK9A 1TZGH 2P8MB 4HGWB 2X9YA 3PDDA 3MRBA 4NRXA 1GYAA 3O45B 3SPVB 3JVGA 4FXGB 3ILPB 3HZMB 4ODXA 5C09E 1EA9C 4E41B 2EO9A 2E9BA 3FO2B 4L3CB 1I85C 3EBAA 4ODVH 4XCEB 5GQBA 1WCBB 1RQ5A 3BOVA 5HGBB 4MNQB 2NY3C 4OGZA 3ALXA 2VLKB 4J12A 1KIQB 1DBAL 2VDNL 2ZUXA 3U7YL 3HG1E 3OMZA 4N0RA 2W0PA 4IOIB 5D2NE 2ICWJ 4Y5VA 1MEXH 3PHQA 5E8NA 1QFUL 2FATH 1YEKH 5AUMA 2BNQA 3AS3A 3ZKSD 2BSED 1JN6A 3IAQA 1R5WB 2FJGB 4BSVB 1AO7A 3FHAA 3HI1A 5E0QA 1AR1C 2HFTA 4R90L 3W2DL 5ESAB 3WKMH 1H3PL 2YPKA 2D7TL 3G6JA 3F7PC 4EDWH 3B3IB 5C0FB 4P48A 2YOCA 1P84K 5L8LB 2X4SA 5CZKA 4UQ3B 1WV7T 1LO2L 4A6YH 3WIFA 4JG0H 4F9LC 3IKCB 3L5HA 1Z3GH 2Q8AL 1X4ZA 5GGTH 3PWPA 3QCTH 1T7YA 1NAMB 1D5MA 2YD6A 5D2NC 5HYSG 3PQYB 6FABL 1JFQH 2BXYA 3WS6A 3BUYA 1AD9B 2R29H 4LPYA 3DUUA 3T0AA 1ZA3A 3MNWB 2O61A 2QSQA 5EIIB 4AH2B 3ZSSA 1A6ZB 1KXVC 3GSUB 3WS3A 5TDOA 3L5IA 4S1SH 4MX7B 3LKNA 3VXRE 4YDVB 1GGCL 4OF7A 3V2AR 3L3HA 2DDQH 3TO4A 4AEEA 5I18H 5HYQA 4M6OH 4WI6A 5T3ZH 5CJBA 1TZHB 2B2XL 4B50A 3VD9A 1NGYA 1FNAA 2QHRH 1OSZB 2H45A 5FUOL 4BK5A 3KHOA 5IEHB 3DGGB 5HYEA 1IKNC 4LOUD 3SGJC 4K94C 4K7FA 1EK3A 4PRAB 4HMEA 1CICC 5C8JB 5GRVK 1GGTA 4Z77A 3V5KA 3HS0A 5C70A 1K2DA 2EIZA 3LS5H 2LAAA 3GMLB 3L7FA 1HHIB 3QULB 1EBAA 3RA7H 3SE8H 2E27L 2EDWA 1PBYA 4GBXA 5ALBL 1V05A 4U1SB 4Y89A 1U8IA 2RQ8A 4PGDB 1I8IB 3TESA 3VWKB 4XMLL 5TH2A 5IVXA 2VC2L 5B4MD 1AXSB 2EDXA 4ZFZA 1K8DA 4I0PD 5I8CA 4ZD3L 1D5XA 5K9KB 1T0NB 3SDCA 2YD8A 1OB1B 5D1XA 3DMMB 4JO1H 3TT1L 1RZGB 3WNMA 1U8MA 3ARYA 3MRMA 3KNBA 3EYOA 1OWRM 1D6EB 3PL6C 4Y5YB 1MOEA 2EYSA 3HMXH 4DCQB 2CIKA 4JFOB 3PWJA 3PV6A 5FCSH 5J1TC 4PJ8D 3HZYA 4XCYB 5CZVH 4PBVC 1HEZA 5E2TH 1RURH 5FK9A 1JZ5A 1MIEL 1T1WA 4HXBL 1FNHA 5CHNA 1P4BH 2ICWA 2ZCKL 3D2UA 4PLJC 3QUML 5F1OB 3BP7B 4KJQD 5MENB 1HINL 3BPOC 1RJYA 2XRAL 4TRPL 3BPNC 3CDGB 4AEFA 3SDDD 3EJJX 3NIGE 4FRWA 4HIJB 1QO3B 3UXFA 4EUPG 1JTPA 2I9LB 2YPLD 5JW4M 3BP6A 4NC0B 4MS8D 5F7MC 4OAWB 1OARH 3O2VH 1RZ8B 2HWZH 1OF2B 3CNKA 3FQRA 3O6KH 3SGEI 2D4DA 4IIQB 1RY7B 3WNLA 5HGAA 1FNFA 2DD8H 2GY7B 4JFEE 3GI9H 2X4UA 5F9DC 3RDTA 1AGCA 2UZXB 3QPQD 3O9WA 2O5ZH 2XZZA 4Q0XH 5INDA 4LRNL 2XQYG 4Y2DC 1WF5A 3T8XA 4KK8D 5FAAA 1JNJA 3MODH 3FRPA 1CDYA 3QHFL 3DRTA 3KPSA 4P9HC 4E0RB 1FNEB 4PRPA 1T1XA 5LCVL 4NRZB 3MJ7A 1GC1L 4OCYH 4CVWA 5CILH 4OLXL 1NLDH 4KI5C 1BGXL 1I1CA 3QO1A 2CO7B 5IMLB 4IRJA 4YXKH 3P4OA 1KPRA 1MRDL 3HAEB 5KVDL 4K71B 1FG9C 5JXEA 2VLRD 1FNGA 5D7JC 1ETZA 1F3JB 1CFVL 2LTQC 2OL3A 3BP5A 3P11L 3MGTA 1NGQL 3PABB 4O51B 4PJBF 3CIQA 5FYLE 1HQRB 1URLA 1YEJL 4PBWD 4WIQA 4YDLC 4OIIH 2NY4B 4XCCH 4XC3H 3QBTB 1S7SB 3BGFC 3X13B 1T83C 4Z7OF 2ITDB 4DKEH 4GRMB 1KB5L 1WZMA 5D7SL 5J3HD 2K7QA 4LSPH 4XNXH 1JWSA 4GSDH 4Y2OA 4M62H 2CKBH 4F7MB 4PRDA 5E6IC 4C4KO 4HF5L 4NNYB 4F57H 4F9PC 3V95A 2VOTA 4JRYD 1EO8H 5GRJH 2YWZA 2AJXL 3WE6B 5E2VL 1LE9B 1AXTL 4YBQD 3ARWA 4ZXBD 4LLYB 2BNQE 2IPKB 5D7IF 4CRPA 3O4LB 3WO4B 4WFHE 4KJYB 1DVFD 1BBDH 3OR6A 4RDQF 2VLLA 4WFED 1AO7E 5H8DA 5DD6B 4KTDH 2DQCH 4XPHL 4Y1AB 3V4UL 1PVHA 1BIIB 3UPRA 2YRZA 3GSNL 5DEZA 3G6JE 1N6UA 5C92A 3JVGC 1IEBB 1JNHA 1T4KA 4S1RH 3J7HA 2FGZA 2IADA 4XCNB 5JOPD 4UOW1 3MROA 1LO3L 3QT2A 1MUJA 3F7QA 3ZO0A 3MLZL 1F97A 4KHXL 3UZVB 5C08A 2H3NA 3U2SB 2BVTA 4LCYB 4U6HA 4X7FC 3LKPA 4KVCH 1XR8A 3BIBX 3OR7B 4UILL 1OCWH 2VR9A 4JFDA 1T7VA 4JY4A 2YS4A 4K3EH 4Y5VC 1G7MA 3WFHA 5D4QA 2EDJA 3MA7B 2CLVB 3C8DA 3TN0D 2P8LA 5JR1L 2Y1VA 4HJJL 2WK2A 4ZQKA 1DR9A 2NXZC 5ABDE 1NAMH 1CGWA 3VFOB 1HNFA 4Z7UA 3EJYC 4QHNB 4FQJH 1C5BH 3MR9B 4ZUUB 1QUNA 4UAOC 4YNYB 1NAKL 1WBZA 3VXSB 3ROOB 2GSIA 4CJ0A 3LQZA 3H8NA 1A4KA 3W9DA 1CGSL 2ZG3A 3BAEH 1J1OL 4UV4H 1CFBA 2O5YH 1DANT 5ILTH 4F7CA 4ELME 4O5LH 1I9RL 3WS6C 1FO0B 1FE8L 4HFUL 3D25A 2VXQH 4JFHE 1KTKE 4GG6F 2HT3C 2OSLA 1MY5A 2FL5A 1NANI 2FD6L 4PG2A 1A8JH 2CXGA 1X5XA 2BJML 2UZYB 3H9HB 3DX7A 3K46A 3C6LB 1KFAH 3TO4C 2E8YA 3NH7H 5DQJB 3TCLB 5F7LB 2MKWA 3P40A 5ITBH 3C5ZD 5IVXE 4YWGL 3RJDA 1WTLA 1K5NB 1UYWL 2VZ3A 5INCA 2BSSA 2R39A 1FZMB 2HRPL 4WNQB 3V0WH 4K3JH 5MEQA 2F74A 2YC1A 4U3CA 4GMSL 2IBBA 1DSFL 4UI2A 5IKCA 1B0WA 3FB5B 1T5WB 5C09B 4MWFB 3SKJL 5L8JB 1PGRB 3T0EE 4LSUH 3BN9D 1KJ3H 5CCKH 2DB8A 5KVFH 5IGXH 1HOCB 2XXCB 4G8IB 2EICA 3P0GB 2DLGA 4PB9H 4TQEL 2WINB 1KG0B 2ITCA 3B6SB 1GOFA 4L9LB 1OAYL 4W4NA 1RUKH 4MHHI 3P0VL 3DO3A 1RIUH 4GBXC 3RBSA 5DA4A 3BPLB 4YR6B 3S96B 5ADPH 3CDCA 1PW3A 4XZUB 3O41B 3ZT7A 3VFSA 3SCMD 4EJ1C 3OJ2C 2Y72A 3DV4B 3BKYH 4FQ1H 5D1XC 3D85D 3EOBA 2MCPL 3GUTB 3CVHB 4PRIA 5GGRB 1T21A 2O93L 1GGBL 4OTXH 1NJ9A 4V1DD 4EI6A 2PTTA 1XH3A 3ZDZE 2MMXA 3DVGA 3DRQB 1G9NL 4BELD 3HAEG 4U6XB 3G5XA 3QCVH 2PYFA 1DTUA 5DHVB 3KPSE 3QHZH 4LNRB 5BMFL 1MRCH 4LPXA 3GJEA 2CDGB 4ZOCA 4UV7L 5DZNA 1DUYB 4N0YL 4FTVB 1UM5L 3KWWB 2XNAB 2WIIB 4IHOA 5E8DH 3HMWL 4HIIA 3RIFF 7CGTA 5FHAH 4ODHL 3DBXB 1RK1A 2OZ4L 4QHMB 2VAAA 2A2QT 4C56B 3N1GC 1MFCL 1OSPL 1JZ3A 4G8GB 3JV5A 2DMBA 2BHYA 5B22A 3RDTC 4AEIH 3O9WC 5C0IA 2ZOLB 5LBSL 3LZFL 2DKSA 3LHPH 2WANA 1WZLA 3PGDB 2HFGH 1NCDH 3V6FB 5GS0L 1ZHNA 4DKFH 3OKOA 3MRQA 1Q1JL 2A6DA 1QLEH 1T2QH 1KTRL 3BSZH 2DQEL 2BVOB 1UG9A 5DD1H 3WIIH 2ZWLT 1NMBH 1NCTA 2CLRB 1MCLA 1GIGL 1T20B 4JFPA 1A6AB 3KPNA 2HFEA 4EI5B 3O8XD 4OBRA 3KPPA 2WWKO 3E3QC 1X5IA 4OUUB 5JXEC 3GHEH 3SJVD 3H2WA 5H2BB 4OM1H 2Y7QA 1QP1A 3MJ9L 2GTWA 5HHOD 3S36H 5F96L 5C0CB 5TE6L 4XVSL 3FO1A 3TPUA 3QUKB 4GRLB 4UT7L 3RNQB 2Y6SC 5HI5C 4P3CL 3SDAB 4QTIH 2OTUB 4KRNA 3IJHA 1EO5A 1KLFA 1B0GB 2FHBA 1CE6B 2V5RA 1MVUA 1F3RB 4R8WH 4D9LL 3GSOB 3K8MA 4TPRL 1ITCA 4P3DB 5BZDB 3IFPB 3GJFA 3VI3F 1LDSA 2AAVA 2IMMA 4JFDE 5DMKA 4RMVA 4WW1A 5C3TA 1IKFH 1H3XA 2Z93B 1PAMA 3P73B 1MCRA 1XIWD 5DLML 1F11B 4X7SL 3MV7D 4Q6YA 2OXHA 1O7VA 4XPTH 3ZDYE 2WUBL 3BDYL 1O0VA 5L2KA 1AR1D 5BZWB 2PN5A 4MVBD 2W60A 1U9KA 4LIQE 5EA0H 1S9KC 3MUZ1 1DLHA 1RUQL 4BKLA 2CMRH 5AG9A 1U92A 4MAUH 3V6OE 1SJXA 3ARBB 5IQ9B 2X05A 1CU4H 4M48H 1MHCA 2J1KA 2X4PB 3KPTA 4LKCA 4XP9H 5FEBA 1CLZL 4OM0L 4OGAC 3X3GH 2BOBB 2APWA 5IIEB 2GY5A 5MHSE 3ZE0F 1G7IB 1CLCA 3HC4H 2FEEL 3ROLB 1QLFB 1NLBL 4HKXB 1CD8A 5FKPA 4RRPA 4KGJA 5EUOE 3TJEL 3HZKB 4KZDH 3F5WB 3FB7A 4L4JA 1FO0H 2WP3T 4RGMC 1QRND 3LN4A 5I76B 4JPWL 1CD1B 2KUTA 4J3SA 3CFCL 1RV6X 5JDSA 1AKJA 4Z7VA 4LMQE 3QEQD 3DYPA 3IRZA 4K3DH 4I8DA 4PJXA 4S10A 4YDIL 4H1LH 3U30C 2YA1A 4RISL 5DMJB 3NTCL 4W6XB 1JWMA 1IRAY 1FL5B 1RD6A 3U0TA 3GRWH 5CJQL 4G6JL 4Y88A 4JN1H 2FB4H 3NN8A 5E00B 4QHLB 4YBLC 1AGEB 2Z8SA 1AFVH 4IM8A 3W9EB 2OM5A 2VDOH 4JQIH 4PG2C 1BJMA 2UUDK 2R0LH 3VWJB 3TYFB 1DP0A 2YD7A 1VGEH 2A73A 5I1JL 1I9EA 1QFPA 4M61B 1IGJB 3CH8A 4DAGL 1JCKA 4OCRL 5CZXD 1IMHC 4HG4K 2BC4B 1Q94B 4FMKA 3BP4B 3GSNA 4XMPL 4QRRB 4G6AD 3WBDA 5JW4N 4KK9D 2X6MA 4PRIE 2IH3B 3GHBH 5CGYD 1D3CA 1NBYA 1F4HA 3N50A 5B38B 1YDPA 4TNWF 3IF1B 4EBQH 4JG1L 1FZOB 4XBPA 3PL6D 2D0GA 3BT2H 2PW2B 1CQKA 2NY2B 3CVHH 3UTPE 1X5AA 1RHHA 3EYVB 4QOKB 1AD0B 1IGMH 5T1LB 3HR5A 2NR6D 1ZSDA 1F02I 4YX2L 4YE4H 4O2FB 3OZ9L 1IM3B 1YYLH 1BD2A 2DBLL 1MSPA 3MRKA 1P7QB 3UJTL 1HH9B 3MACH 2V7NB 2W65B 3TA3D 5J8OA 3RNKA 4HMCA 3IJYB 1KCUH 3G5ZB 2R8SL 1TCRA 1MQKH 5DWUL 4JKPH 2YRPA 1BHGA 1M71B 5LGHH 3Q0HA 2M8XA 5FYKD 3QUZA 3MLYH 4G80B 4WCYH 4OCWH 4TVPD 2HJFA 4H5SB 1ZGLM 2D03H 4WHYH 5SWZD 4XPFL 5FUZL 2HAZA 1CBVH 2NCMA 1INQA 4I9WE 2VLJB 5BRZD 5JXAL 5C07E 1S7QB 1EPFA 3W5NA 3QDGA 4QRSB 1Y6NR 5I30L 5IB4A 4WFEE 3DTXA 5SWQB 1KJVB 4F7TA 4WEMB 4TTDD 1JPST 4EN3B 5KSBA 5IW6A 5CP7A 4JO2L 5DJ0B 2YMXH 4ELMB 1G9EA 3AXLB 3RRQA 4X7TA 1XF3A 4KI5D 5EOCJ 3DHJA 1V7NH 4ZOBA 5T1MA 1HWHB 3BW9A 4U1LB 5C0EB 1OTUC 4J3OC 2YD3A 4MB4A 1LEIB 5K9JL 4NRYB 2FLBT 1KYOJ 2M1KA 2JIXD 1C16B 4M02A 3ULUL 1YNTB 5C0BB 4F7PA 1SBBA 1VB9A 4RGOH 4JM4H 1GGIH 3WIHL 1RJCA 1I3GL 2HN7B 2UWEA 4Z0XB 4JLRB 2PTUA 1HK6A 4R4ND 4BH8A 5JQ6L 3L5JA 4YFLF 4NKIH 5JHLH 3SE3A 4JN2A 3AAZB 3T0EB 3BZ4B 4UIKH 1KUMA 3ZHLA 2FECI 3CCHB 2ADGA 1Z5LA 4IS6A 2OS7A 5I1DA 3IKKA 5IMOA 4XRCA 1N5AB 4R7DB 2F8VA 3PWVA 2C1OB 5FGBC 3WNOA 4NQEA 4PJDB 4LHUA 3QG6A 3PHOB 2FSEB 3MV9D 5L2KE 3BWUC 4M7ZB 2DQGL 2X4TB 3MRPB 3TLRA 2ICEB 5E7FA 1GHFH 4LASH 4HLZG 3OG4B 3AB0B 4JFZL 5A16B 4UZGA 1VADB 4S1DD 2R0WL 1ZGLA 3D0VB 1MREL 4Z7NE 3Q48A 1J1PL 5JO5A 3ZKMD 5JPMB 4KK5D 3B9KD 1P84J 4G6KL 4PIRF 5E8PB 1DN0A 5M95B 2QADD 4N5UA 1W72L 2CPCA 1W0WB 1A3RL 3MNZA 4UNUA 1FSKB 3T1FA 4LLVA 3OKNB 3VXMA 5JOFB 5SX5H 2NXZD 4KHTH 1T1YA 5BVJA 1HKLL 1FZJB 1EHLL 3VXPA 1AQDA 2OZ4A 4Z18A 1I7RB 4PJXE 1D6VH 3KJ6H 3ULVD 3GIVA 1EVUA 3NACH 1NFIA 4PP2B 4NIKB 4YHML 5DEFA 3G9VA 2MTPA 1HE7A 1QBLL 2I5YL 3KLDA 3S37H 1BEYL 3N1QC 1KPUB 2UZIH 1MIMH 1R3IH 5IBUB 3U9PL 1CFNB 1QQDB 3BH8B 5EORL 1GC1C 4BZ2H 4ODUB 4KK6C 4CW1A 2LE9A 5FYJL 3QIBC 3S7GA 3ABZA 5FHBH 2R2EA 2Q20A 4J6RL 4YXLH 3OGCA 1U91B 1UH3A 4NWTL 4Z8FL 2VZTA 4X4MA 1M7DA 4LK4A 5ICXB 4IRSD 4PV9A 5EUKB 1J18A 1RUMH 2V5MA 4POYA 3MJ9A 3PDGA 4YXHH 5KG9A 1CVSC 1UACL 3RX8A 1LMKA 2F5BH 3VD5A 3RU8L 2JELL 5E08H 3L3IA 1WIUA 3MUJA 5AAWA 3CLFH 4MJ4A 4JVWA 2BNRA 4M6MH 3O4OB 5EU4A 5I8EB 3HHRB 5MERB 5HI4C 4URTB 4XP6L 1HQ4A 2AJUL 4JDTH 4QXTA 3IXAB 4ZYKA 5J9PB 4BJLA 1E4JA 1KEML 3UO1H 4G5ZH 1ZHLA 3EDJA 2V5SA 4NUGH 3NIGF 3BN3B 3LPFA 5ANMA 5JQHC 3ZDXE 1QSFA 4D3CL 3U4BH 5CBAB 5F88B 1BD2E 3H9SE 2N56A 4L1HA 1P6FA 5LGJA 5IB5B 3JWDH 1YEHL 1EAPA 3T4AA 1BOGA 5DR5H 4LVNC 1FVEB 1U8LA 2VXVH 1AQKL 43CAA 1A9BB 2F9BT 6CGTA 3OKLA 2ZOKA 4QKXB 5C0GB 1Q9OA 4KUCF 1I9IH 2YXFA 1UZ6E 5CMAA 4O02H 4MJ6B 2KL6A 1VPOL 1IAMA 4GW4A 2V7HA 4XTRC 1MY7A 2DBJA 3FT3B 2AK4A 3F12B 4KUZL 4XNUH 5GJTL 1DANU 3V8OA 1S7VA 3S3SA 4JFFD 3QDGE 4H88L 1T2XA 1KNOA 2R2BB 1NMCC 2J4WL 3BQUA 4H20H 4Y4HA 5KSBE 5DMIL 4UBDC 4PY7B 4NPYA 2YPVH 5DQDH 4PS4L 4HWUA 4D9QE 4HUWB 5CSZA 5AZ2L 3E6HA 4M1CD 4R2GD 2JKXA 1DBKH 4ALAL 4I0PB 4M7JH 3TBYB 1RZIA 1ERNA 2FBJH 2RAMA 3QFDA 4KU1A 5EUOB 2HT2D 3QUZC 1V3LA 2BVYA 5F9AC 4ZTPL 4FQLL 3UTQB 1XR9A 4OCXL 4FQ2L 5EBGA 3RDTD 5DJZA 4PJ8B 4YHYB 1XGQB 1PZUB 2VL4A 4JGUA 1IBGL 43C9B 2VDLL 3MRFB 2Z8WC 1CLOL 2AJZA 5A3IC 5A2LH 3SDDB 4GAGH 3DV6A 2A1WH 3BEVB 3MCLH 2YPLB 4HK0B 4D0CB 1KACB 1VFOA 1OLLA 4NHCL 4J4PA 2BFVL 3G6JF 3V4VL 4GLRI 4HWZA 3T09A 2XQYK 4X9FA 5IEKA 3A67H 2NTFB 3LRSA 3VRLE 1CR9H 3F7VB 4Y19A 5TDPB 4RAVB 4K8RH 1DLFH 5BV7B 4S1QL 1F45A 2FHFA 1QBML 4GW5B 4K3HA 2P42B 3V6BR 5JW5B 1NGWA 1OPGH 4E9LA 4JVUA 5JUEH 4XMKL 1KTDB 2CLZB 4DQOH 2QQLH 4OLVH 5A40E 2GYSA 5E2WL 1JGVH 3SE3C 1R3KA 4M5ZH 4XVJL 3OKEA 1X5KA 1W8OA 2X1XR 3GM0A 1SY6H 1QRNE 4OBSA 3RPKA 1NFKA 1YPZB 1F4XH 5T5FL 1D5BA 4PJAB 1XGTB 3CFDB 4OZ4A 4CU7A 4Z5RB 1T03H 3X12A 1LGVA 4O58H 2VLRB 3U46A 4ZFOL 4H8WC 3DSFL 3QIUA 2AVGA 2H2SC 4HX1A 2OQJA 5I0DA 1WFOA 4LLAA 3VXME 1IGCL 2KQMA 2YBRB 5E95B 1MRFL 2Q3ZA 1FYHB 5BW7A 4OF8A 2X89A 5IBUG 1I7TA 2CK0H 5DJ8A 1U3HA 3MRRA 5EOTB 2Q8BL 3BJ91 3GO1H 1HDMA 2LVCA 4FZEH 3ZTNL 2OX5A 4MD0A 5EZLA 5GS2H 5C08D 4ELMF 1OAKL 2CRYA 3DIFB 4JRYB 1PJ9A 4U3XA 3KHQA 4DK3A 4CU8A 4ZXBB 3MUGB 3QUYD 5C07B 1X5ZA 3KXFA 1DVFB 3HNTL 1CK0L 3V4PL 3JV4A 3WN5B 4WJ5A 3WL9B 4PJCE 5CIPB 3HN3A 5HHMD 5I71C 5GZND 2NLJA 3KLSA 5L0QC 2X4QB 5IVXF 1M05B 5F1NB 1A6UH 1SBSH 3EO1A 3I6KA 2J5LB 4X4ME 2F5AH 1EFXA 3CVIL 4EDXB 3MRIB 3UC0H 3EZJB 1A7QH 2KKQA 1JZ8A 4OLYH 3GMOB 1HH6B 3L5XH 2DLFL 4HWNA 5I15H 3OF6D 4YHNB 3KPQA 4M9PA 2W0FA 1EEZA 1LWRA 1SYVB 1GZQB 4XNQB 3GMPB 1X5JA 1K6QL 4GKOA 4OZGA 1AE6H 3WIHA 3MBEA 5GS0C 4RDQG 1MFNA 3NABL 4I18A 1U8NB 4FFZL 5CEYA 1JUFA 2VH5L 3V0VA 2Q86B 3BHBA 3TN0B 2BSTB 5CBEA 3RWFB 4RMWA 2D3VA 2HMIC 1QSED 4LBEA 3BYTA 3T08A 1KCKA 4P23C 4OFYD 3U36B 1E27B 5JORB 4OI9A 1CDJA 4J3TA 2X7LA 1CL7I 2AI0L 1JGEB 1A5FL 1FL3A 1HI6A 1ZT7B 4PV8A 2PNDA 4M4RA 4NUJA 4AJ0A 1OAQL 1ZVYA 2ZJSH 4PJIE 1I4FA 5DRZB 4Y16A 3ARDD 4U33A 4MXQC 2E7BA 3FRUB 3I50L 3QA3B 3IJSB 2HLAA 4AL8L 5GSRB 3ZDZF 2QQQA 3SDXA 4MAYA 5HGHB 3IDMA 3BDBA 2ATKB 2R69L 1JL8A 4U1IB 4JKLA 3DGCR 2DIAA 2XPGB 1FVCB 3T0VA 4NO5A 1M7IB 1BECA 4NQXA 1UXSA 2XQBL 3CXDL 3FQTB 4WI8A 3MCG1 1OAXL 3IDNA 2E9IA 4JZOB 4NDMB 1I1FB 3SGDI 3EUUA 3QAZB 2W9DH 1RUAL 1KIRA 4MCZA 2YEZA 4KV5E 5BJTB 5E5UB 3PGFH 4KJPC 3C5ZB 4KKBD 1BP3B 1KJ2A 1W72A 4C83A 2FO1A 1U8KB 4Y4FA 1JPTL 2MWCA 3C09B 5GRUH 1JF1B 3SE9L 5ID0A 4KVNL 2YZ1A 2Q87A 1WBYA 1P4IH 2FJHB 2BVUA 1YEEH 3EO9L 1OP5H 5A43C 4GUPB 4X4XB 2XI9A 4UMGA 4Q6IA 1SEBB 1OLZA 1CXLA 4YHIB 1TQCB 4G3YH 1MI5D 5GGVH 5JA8B 4OLUH 3ZYOA 1J0ZA 3QDJE 4HJ0D 3RGVD 1HHGB 3W39A 3L5WB 1UM6H 2H6PA 3QSKB 3BQUC 4Y4HC 3CDFA 5JNYB 2A0LD 1DEEA 2A6JA 3N85H 1F5WA 5ENWA 3MV9E 2MOVA 5GGSB 1BBJB 4HHAA 5I16A 1QNZH 3SCMB 4JY6A 4RWYH 1TJHH 5J12B 3QEHB 4G6ML 3D85B 3HTLX 2EDBA 5IVZA 2GCYA 2NW2A 2AJSH 4LLDB 4ZFFB 1CI5A 4V1DB 2DRUA 4Y19E 3DWTA 3QZWB 2OR9L 1TETL 5KAQG 3G5VB 3MV8D 1BFOA 4NSKA 4UU9B 2ICES 3X11B 1FN4A 1IAIH 1JJUA 3QQ3A 4X8JB 3X14B 1YEDA 3FZUD 5ETUB 5JDJA 3QIWD 4MJ5A 1MHHA 3IXTB 3V7AG 5AZEL 1BIHA 3FQNA 4XC1H 1RUPL 1KLUA 1UCBL 5DJ6A 4P3WA 4QWWC 3FQWA 1YMMA 5D1ZA 5BV7H 5DRNA 5IMMA 5HHXH 2ZUVA 3U0PB 2N1KA 3U9UB 1FP5A 1D5IL 4PJEE 3DVIA 4FQHA 3ZDYF 4J4PC 1KCSL 4HV8A 5SV4A 3ARGD 3JTSA 4YEFA 3DURA 3VXTA 3VG0H 1UWXH 4NC2B 3VE0B 3H9SB 1YN7A 3L7EB 4WDIB 3EYUL 4MA3A 1VFBB 4GG8A 1BVLA 2X1QA 4KI1A 5MEOA 5I8KH 2AV1A 1L7IL 3LRGA 1TZGL 4YHPA 5F7UA 3CFBA 3CMGA 1WAAE 4NQTA 1VEMA 3NOIA 4TULH 1MCPH 1AGDB 3NGBB 4HIEA 4K23H 4U05A 2ARWA 1HWGB 1HSBB 3BWAB 4ODVL 4RAUA 3O8XB 2CDFB 5GHWH 4YGAB 4MSWB 2VDRL 3OQ3B 5TGBA 5DDHA 1A6VH 5T5NG 1KJMB 3AS1A 5EUOF 1Q9WB 3L3GB 3QIUC 4AT6A 3MLWH 3MQIA 3KG5A 3CDYA 5HHOB 4LCCA 3RWCB 2IFFH 3CSYB 4GFTB 3D18B 2Y06H 1MCDA 1MEXL 1WEJH 1GJIA 4TNWK 1I1YA 3D6GA 2FATL 5BW7C 3LEXB 2B0SH 2H32A 1FG2B 5KSVA 4ZUWA 5FO8A 3QI9A 1MCHA 1U3HC 1XFPA 2EH7H 5CIPH 2ADJA 3WKML 1IGFH 2HG5B 1W0VA 1JNLH 4JDZA 4MNGA 4DVBB 2AKRB 4EDWL 1P7KB 1G7LA 4ODSH 2J7LA 5F7DB 1DE4A 4OZGE 2XXMB 4EZMA 2FO4B 4A6YL 2Z91A 2CH8A 1UWGH 3PNWB 5I75B 5IFAH 3FCTA 1Z3GL 2LVEA 1JPFB 1XIWB 3MREB 5GGTL 4XT1C 3MRDB 4K7PX 2O5XL 3QCTL 1S5HB 3B83A 4OD2B 5GJSH 3EHBC 5FF6B 4UDUA 5KSAA 3QIBD 3VGGA 1KLGB 5GS1A 4CKVX 1JFQL 3EYFA 3PHSA 4Z78B 3W81A 3T2NL 3U4AA 1J0IA 3RL2B 3WKNA 4HFWB 5C0DA 1ZWIB 1SVZA 3VJ6B 3HA0A 3V5HA 3GKZA 1MFBH 5CWSB 4PJ9A 1QKZH 4X98A 4L8BB 3GJFH 3Q3GA 1JVKA 2R9HC 1PG7H 2DDQL 4FFWC 5I18L 5D9SB 3SDXE 4M6OL 1VGKB 3MBEC 4FFVD 5T3ZL 4I18C 1J0HA 1V8HA 5GGQL 2R1WB 3OKMB 3WDHA 2QHRL 2IANA 4RX4A 2VUYA 3STLB 4XP5H 4HAGA 2EIBA 3UROR 1EEUA 5J11B 4J2XA 3P0YH 1S9VA 1DDHB 5ERWB 4LNVA 1U42A 4CVXB 1PQZB 2DQJH 5F6HJ 1UJ3B 1PYWB 2LQRA 5C0NC 3QNYB 4MLIA 4WI3A 4PD4K 1QRNB 4M8VA 4I48A 4M5YH 5F8QC 3FB8A 4LRIA 3QEQB 3C08H 1I1AA 2G2RA 3NA4A 3QDMA 5HJ3B 3KPOA 3RA7L 3SE8L 3L1OH 4Y16C 2ZZUT 4NO0D 2DQFA 5EU6A 1FYTA 1Y0LB 3RZCA 3KGRA 2XKSA 5K93A 3RVUC 4MAYC 1DBMH 1NBZB 3HRPA 1KXQE 2IALB 3DXAA 3RI5F 4WWKA 1FFOB 4XPGL 5L88L 3KYMA 4WFGD 2BCKB 4G8FB 1NCBH 3IFOB 4IJ3C 4GKSB 3HFMH 32C2B 3OHXB 5E5MB 4X5XB 4F2MB 3TBVA 3VH8A 4JO1L 3GMQA 3S4SB 1RZFL 3RUGE 4JB9H 1FZKB 3VGBA 1MJJA 5EB9A 3PDOB 3QZWG 2B1HH 4IEFB 1KXTB 3KJ4B 4UBDD 4Y4FC 1MVFA 1T04B 1OTSD 5CZVL 4FP8H 4PJCB 1JV5A 4YAQA 2GT9A 2R56H 1QR4A 1P4BL 4UTAL 3QUXD 1XGRB 5HY9A 1OWWA 5I1CH 3WXVH 4NT6A 1C5CH 2Z4QB 5E2UH 5J6HB 3CGTA 1E0OB 3DX6A 4Q6IC 3SE4A 4PGEA 1OARL 3O2VL 3V5DB 2HWZL 3PL6B 1R3JA 3GGWB 1VFMA 3O6KL 1QFHA 4LEOB 2DD8L 4X6FA 1CGYA 3GI9L 5HVWA 2KQNA 2JCCB 4OCSH 5GZOC 3HUJB 4LKXA 2O5ZL 4Q0XL 1YMME 3AU1B 3D3VA 1U93A 3SDYH 4HUXA 3TA3B 3MODL 3RHWF 5A3ID 2V2WA 4R97C 4L8CA 2E8ZA 3OKKA 4UQ2A 5CEZD 1FVDA 3SKOB 4NOBA 5DUBA 2VQ1A 4OCYL 3G5YA 5CILL 2HP4A 3MPCA 3MYJA 1NLDL 4LF3A 4N8CH 4DTGH 2R1YB 4HS3B 1YY9D 2UY7A 2CR6A 5FV1L 1KN4H 4YXKL 1TQBC 5SWZB 4WI7A 5B39G 2R23A 5F89B 5D7KD 3MMEB 5BRZB 4PG9A 3P30H 4PJIB 3O6LH 4P46D 5DJXA 4Z7NF 5IBTH 5KTEH 3F65A 4NQDA 5HHME 2VZOA 4C57C 4X4YA 2E5EA 3G6AA 1QFOA 4OIIL 4XC3L 4WUUD 5DFVD 2VWEC 5IQ7H 3UAJD 3MNVA 1DUZA 1F6LL 4KROD 1JGDA 4LSPL 4RMUA 4XNXL 4GSDL 3E8UH 4M62L 3JV6B 2CKBL 4H25B 5FCUH 4U1GB 2CJUH 3PP3H 4F57L 1XGPB 2JIXB 3CK0H 5GRJL 3IU4L 3WUZA 4NQED 4CMHC 2WZPD 2CK2A 4H1LG 2I9TA 4PJXF 3CLEL 3CPLB 2EYRA 4BUHA 1ZHKB 3DOSA 2ZSVB 1BBDL 3L3DB 3LY6A 3D39D 1NEZA 4KTDL 1P2CA 2DQCL 4B41A 3SKNB 2DQDH 5DC4B 3K1KC 2DWDA 4MJIA 5DVKA 4CVZA 4MNGE 4S1RL 3MO1B 1UQSB 1MLCA 3P77A 1IGIH 5H37H 4JANB 1T2JA 3FFCA 5C0RH 1FC2D 4PRNA 2Y5TB 4ISVB 1L6ZA 5TDNB 5H35A 2BSRB 2IQAA 1XCTA 3BKCH 3MRCB 5C1MB 3U7WL 3WFDH 3FQXB 2XFXA 2Z35A 3GM8A 3BVNB 4XHJC 3TIEA 3QDJB 5IB2B 2HJLA 4KVCL 5SX5K 2FIKA 3HE6C 1OCWL 3B2VH 4PTTA 4IOFC 4LCCC 4GW1A 1C12B 4K3EL 1T0PB 3IYLW 2J8HA 3K4ZA 3MV9B 3QJFB 5DJYB 3SGEH 4KRPC 5DK2B 3MLUL 2BHUA 1J1XH 3BZFA 4P5TA 1T1ZA 1MH5A 1RVFH 2R4RH 3I3DA 2D7QA 4KTYA 1X5LA 3DUSA 4L3AA 4NHUB 3BX7C 1XCQB 2A74B 2GITA 2X4NA 5F97E 4RFNC 3ZTJG 4FQJL 4U0QB 1C5BL 5EO9B 1XAUA 1S7TB 3G9AB 1WK0A 4PLKD 5EO1A 2EEAA 1KELH 1GRWA 2VDPH 3B9KB 1EZVY 3OG6B 3OSKA 3LEVH 3LS4H 2GIYA 1CGTA 5E8NB 4ENED 3O3AB 3NFSH 4S0TD 4Z7QE 2R2HA 1FIGH 3OPZH 2QADB 1U6AH 3TNNB 3ZDXF 1TZIA 2ZUYA 1ORQA 4UV4L 2O5YL 3IDJA 2COQA 3SKMA 2ZCHH 3GKWH 5GS1C 2NXZB 2P5ED 4O5LL 1KIPB 4P23D 2DI7A 4PJEB 3O6FA 4U1HA 3RKDD 2VXQL 3CC5B 3SO3B 1AGBA 1VDGA 5GISH 1QYGH 3RTQD 3ZT6A 4LHQB 3QDME 5HYJA 4PJ9C 1UZ6F 2P8PB 1INDH 4WHYG 2ORBH 5EU6E 1A02N 1KFAL 2NY0D 3S4SG 4KDVA 5F7KC 3I6LD 4PGBB 4MDJB 3NH7L 1BQHA 4RQQA 4U1MA 1HSAA 3T2OA 2L0DA 5ITBL 3DXAE 1C08B 1CXFA 1HHKA 3GMRA 4NKOA 4JDVA 1CCZA 1OHQA 1S9YB 1C1EH 3OAZH 1N6QH 1Q9LA 1R24B 4K3JL 4MQ7A 5KSBF 1RJLA 3JTTB 5E4EC 1IEAB 2Z92B 4GS7C 4OB5L 4LSUL 4YK4B 5CCKL 1BX2B 1OQOA 3QH3A 1L0QA 4KMTH 5KVFL 1XF2B 5IGXL 5EZIH 3EDDA 4IRSB 3L3HB 4RNRA 1CD9B 4LRIC 1IC5H 3P4NA 3GSQB 4PB9L 1IM9A 2HA1A 2WV3A 1CFQB 3LV3B 5A2FA 4M4PA 5TQ2H 4ZUTB 3KYNB 1YEIH 1RUKL 3BDXA 1RIUL 2DLEA 3RVXC 1HN1A 3RZCC 2J6EL 2PO6A 3HC3H 5C3LD 3REWA 4NN7B 1OGTA 5KANG 2D31B 5ADPL 2RFXA 4WWKC 2JJWA 2XV6B 2GTZA 3UBXB 5IOPB 1OVZA 3PWUB 1G7PA 3TO2B 4OCLC 3ECBA 5IJVB 2VSDA 3BKYL 2PXYA 1U8JA 2QSTA 5ACMA 1QR1A 1HYSC 4QY8A 4A6YA 4OTXL 5GSVA 3JWNC 4X5WB 4CADA 5H94A 3VFTB 3LQMA 3D3VE 5HVHB 3CFEB 4HJGA 2FGWH 2HKFH 4R26H 5J6GB 3QHZL 1MRCL 5JZ7D 3ISWA 3VRLF 3C2SA 2EDDA 4LVHC 3P4MB 3FO0H 3DJ9A 5E8DL 2JJVA 3WYRA 4LSQH 2YD2A 3ZYIA 4F3FB 3SE4C 3WHXA 2RJMA 3DO7A 3N1MC 3IDYC 4MQXD 1TVHA 1WC7A 2MQ3A 4OLEA 3BGAA 3MLTA 1A7NH 4QHKI 4JFFB 2YKLH 3T77A 4DUVA 4TVPH 4JFXA 3X17A 4NQDE 3JWOC 5HHQB 4NQCD 4AEIL 2F54A 1NANH 2C5DC 3LHPL 2VABA 1NCDL 4P2RA 4PP1D 4R2GB 2EH8L 3H6JA 3QJHA 5IBLD 3EW3B 3EO0A 4DKFL 4WVRA 3DX8A 4GMTH 1QLEL 1T2QL 1P53A 5DD1L 1C5DA 5F7FA 1NMBL 4PRHD 2CGRH 3EJZC 5FA3A 4GKZA 1VHPA 2DMKA 4BSJA 5FOBA 2XWTB 4QRPA 4LCWD 4PJBA 3RDTB 4HS6B 1V3KA 1GAFH 4OM1L 4S11A 1CXKA 2J12B 5LKNA 2AXFB 2VQTA 1F13A 3S36L 5KS9A 4N8VA 4AG4H 4MJIE 5I1HH 3B5GA 4UB0H 1RIHL 2EDFA 3Q1SH 3OJDB 4F58H 3FFCE 3MJ7B 4QTHA 2NNAA 4YC2B 1EGJH 2P24B 5I9QC 4CN6A 4QTIL 1NC2D 4D9RD 1JHLL 4PJCF 4UNVA 5KSUB 1T22B 3RY6A 2J8UE 4WFFE 1AXIB 3QO0B 2V2TA 1IL1B 1KPRB 4R8WL 4PJGB 3HMXA 1A1MB 2F53A 3C5JA 3RUGB 7FABH 1NC4A 4HD9A 5D7IA 1JZ4A 4PRBA 3M1BA 3QIUD 1EJOH 4P2QA 4A2LA 1NH6A 3H7LA 4R96B 1LE5A 4ONOA 5J1AB 5J57B 2GJ6A 1WCQA 2EDOA 3U1SH 4PR5A 4BZYA 4K9EH 5D1QD 1YUHB 1FIEA 2FEDD 4TSBH 1ZMYA 1NDMB 4QHUA 3RZWA 2C3VA 5AAMA 1HIMH 2APBA 2GAZB 5J89A 4KKAC 5EA0L 5DO2D 2AQ2A 5BO1L 4WO4D 1K4CA 2AS5M 2CMRL 2ZP0T 3HPJB 4JFYB 1ZVHA 3ARFD 1CU4L 1BZ9B 4M48L 4XP9L 1GVIA 2Z31A 5DUPH 5I6XB 3I84A 3X3GL 1JRHI 5LWYL 5AYQA 5JW3H 1HXMB 4OFKA 3MCKB 2H26A 3PP4H 1G7HA 1J88A 2UYLB 3LSOA 4OI8A 4OV6F 3ES6B 4P5TC 4PJIF 3MRHA 2GI7A 5F3BB 4I1NB 5B8CB 4ELKB 5EC1B 2EDRA 4EUPA 2AXGB 4AQ1B 2JTDA 3RQ3A 2BZDA 3NIFE 4FXKA 4OT1H 1IC1A 4KZDL 4BA8A 2IFGA 1C8PA 1FO0L 4WHCA 3ULUD 2QQNL 2I07B 3PE9A 4I2XB 4WHTA 2QR0A 4KQ3L 1F4YH 4FFWD 2FJFB 2H8PA 2DKMA 4ODWB 5D6CA 3QUYB 4X6CA 3VFUA 4G7VH 3R06B 1YY8A 3ULVH 1KB9K 3D0LA 4KRLB 1D9KD 4L8SB 4RZCB 5T1KA 4KV5F 2VR4A 2FBOJ 1Z9OA 1ED3A 5HHMB 3RX7A 3GRWL 2IEPA 3E2HC 5I73C 1UEYA 2P8MA 4HGWA 1VESA 2FB4L 3UBXG 4Z7UB 3O45A 3SPVA 3O6FC 4FXGA 3ILPA 3HZMA 3GSXB 4E41A 4TSAH 5FUCE 1AFVL 3EZ8A 1T66D 3VI4E 3FO2A 4L3CA 2VDOL 4UTBH 4JQIL 4JM2B 4XCEA 2R0LL 1WCBA 5HGBA 4MNQA 4Z7WB 1U3JA 2VLKA 4XWGH 1NCNA 2JB5H 1KIQA 1JGLH 4MD5B 4UINH 1ZEAH 4IOIA 2YSSB 3KPRD 4TNVF 3WJLA 3CX2A 3Q6FB 5CEZE 1TMCB 1R5WA 2FJGA 1QSEB 3FQUB 4BSVA 2R0KL 4HIXH 4KJWD 5D71H 3UYPA 5ESAA 3L95B 1XF1A 4EBQL 3D1MC 5HPMA 3IDGB 3QNXB 4M9OA 4KWUA 3B3IA 5C0FA 3BT2L 5FUCC 4PB0H 3ARDB 4L9DA 4UQ3A 1OT2A 1IGML 5F1KC 1OP5K 3IKCA 4YE4L 2PO6C 5BS0D 1YYLL 4D8PB 3FJTA 2CO6B 4HUVB 2AEWA 4WUUE 1KCUL 1NAMA 1MQKL 3TBTB 3PQYA 4OQTL 4JKPL 1GOGA 1S7RB 2PXYC 4LL9A 1AD9A 3RIAK 4RAHA 4BFEA 3HPLB 3MLYL 4IRZH 5J06A 3MNWA 1PSKH 2SEBB 5EIIA 5T3ZE 4AH2A 4WCYL 4OCWL 2MFNA 4P4KD 5E4IA 1A6ZA 3GSUA 2D03L 4PJEF 1CBVL 4MX7A 4YDVA 5GZOD 3MRGB 1CD0A 4JZJB 4QYOB 5K9QG 2Z8VC 1B4RA 3RWJB 1FH5H 2XN9D 5FYJD 1TZHA 1LO0H 4LCUB 4APQD 2NY6C 5DJCB 1OSZA 5DD0H 1NCWH 3K81A 3LPWA 3S35H 2JJUA 2YMXL 5IEHA 3DGGA 4JY5H 3C8KB 1EAJA 1PG7W 1V7NL 1IC4L 4PRAA 4QRPE 5GRWA 3V7MA 5C8JA 3L6FB 1F8TH 4IOSD 3FB6B 2DAVA 2P5WD 1MI5B 1FPTL 1WAAF 3K8KA 3RGVB 4LSTH 3AM8A 1GGYA 3GMLA 5KS9E 1HHIA 1I7UB 3QULA 2X44D 5FO9B 2VE6B 5DC9B 4RGOL 1LQSR 4JM4L 1GGIL 3NVQA 4U1SA 3R8BB 3ZE2E 1J05B 1N3NB 2V5YA 2X9XA 4PGDA 1I8IA 3VWKA 1AXSA 2ERJC 4NKIL 2G5BB 4AK1A 5JHLL 5K9KA 1T0NA 2VIRB 2Y23A 3THMH 1OB1A 4UIKL 3DMMA 4P2QE 4MCYB 1RZGA 5A2IH 3MV8B 3QQ9C 1D6EA 1L4IA 2A77H 4Y5YA 1OAUH 2AJVH 2ZUQC 4DCQA 4JFOA 3BH9B 3QIWB 4OZGF 4XCYA 2OMNA 4ZS7H 1I8MB 1ZA6B 3BP7A 3VG9B 5MENA 4LASL 3CDGA 4MA7H 4XVTL 1VCAA 3MOBH 3RY6C 4HIJA 1QO3A 1H0DB 2I9LA 2WMPA 3ARGB 1S7WB 1UKSA 2PKDA 3BRGC 1N64L 3QXAB 1RZ8A 1OF2A 3RI5K 4WI5A 3MLSH 3HE6D 4IIQA 3MV11 1PLGH 4P49A 3WMSA 5FGCB 4BSWB 2C7UB 5CGTA 2C1PB 2HTKD 4AENB 3K2MC 1FJ1B 2BY1A 2DLTA 3SDXF 1S9WB 1Z9MA 4HEPG 4FQCH 2UV3A 4KHTL 3JUYA 3C6SB 4E0RA 1FNEA 4NRZA 3OBAA 1T7ZA 4PJHB 3L3JB 1G0XA 4LGPB 4NFCA 4X6CE 5IMLA 1MHPH 1RJZB 2XT1B 1D6VL 3KJ6L 4HPYL 2ZSWB 4OZHE 3NACL 4BK4A 2Z31C 3HAEA 4UIMB 3CJJA 3MOAL 1PX3A 4ACPA 3QUMB 1JYWA 1F3JA 3K7UA 3S37L 2DIJA 3PABA 4O51A 2UZIL 1MIML 1R3IL 2QV2A 4Z76B 1QRKA 1HQRA 4PUBH 4U0RB 4DGIH 2YA2A 4R7NB 2GK2A 5FYLL 3GJFK 4E41E 4ZFGH 2V6HA 5FHBL 1S7SA 3X13A 2ITDA 4GRMA 2ZUSA 4YXLL 4MNQE 4PLOB 2DYPD 3ARZA 2BDNH 3TZVD 4JREC 1MJ8H 2VLKE 3RHWK 4F7MA 4NNYA 1RUML 4PD4J 5IMKB 4KXZI 4YXHL 2F5BL 2OI9B 4I3RH 3WE6A 3UP1A 4AIXA 5E08L 1LE9A 2DJ4A 1FFNB 3RUGF 3CLFL 4LLYA 1KPVB 1VEPA 2IPKA 3O4LA 3VFNB 4KJYA 4OKVB 4M6ML 5T33H 2GK0B 3QIBB 5DD6A 3H7BB 3VD3A 4Y1AA 1JTOA 2EXWD 4K2UL 2WWMD 5GRZA 3U7AA 4M1GH 1GZPB 1BIIA 2ZKHL 1DBJL 4L8DB 3GMNB 4JDTL 1W8NA 1IEBA 4EVNB 2J8UB 2AEQH 4NJAH 3QYCA 4XCNA 4G5ZL 3UO1L 1OTTC 4JHBA 4NUGL 1ND0B 4XP4H 3DX9B 1FFRA 2JJTA 1F3DH 2BMKB 4ZAKD 2VAJA 3U2SA 4LCYA 4ORZC 3U4BL 4QGTA 1S7XB 1FYTD 4U6TA 3OR7A 4M7KH 4N1HB 1VEOA 1KB5B 5DR5L 3WJLC 3MA7A 5GGUB 2CLVA 1YEFH 4IMLB 1KSRA 1OAZH 1A6WL 1I9IL 4QNPE 4O02L 5ISZD 3F62A 4G43B 4GAJH 3VFOA 4QHNA 5ACZB 3MR9A 4ZUUA 1U8HB 3LDBB 4YNYA 2L7JA 2G60H 3LVEA 3VXSA 2X4RB 3KLHD 2VDNH 3ROOA 4JGJA 4NO0B 5TFSH 4H20L 4QXUH 3EFDH 2YHGA 1LEKB 5DQDL 1LD9B 4Q97A 3NZ8A 1DBKL 4M7JL 3UTSD 3LRHA 3FAXA 4W68A 2CXKA 5DXWA 4D9RE 2FBJL 4R90H 1FO0A 3SBWA 5C0JB 3VFRB 1B4JH 2VLMD 1EVTC 3ARUA 1L7TH 2P7TB 3H9HA 2YD9A 2ZNXA 4KDWA 3C6LA 4N90D 4JM2F 5DQJA 3TCLA 3H3PH 4DZBB 4WW2B 2E6PA 3GRWA 4HEME 4GXVH 3WLWD 4LSRH 2FR4B 4FOMA 3ZYZA 1YECH 2DJUA 3QUXB 1K5NA 1U58B 1FZMA 4KKLC 4WNQA 1LDPL 2A1WL 5F9JB 2RIKA 1S8DB 3FB5A 4NN5B 1T5WA 5C09A 4PJFE 4MWFA 3HNVH 4I77L 4PREB 4OLZL 2ENYA 1HOCA 4G8IA 4RA3A 4X9IA 3AM8C 3A67L 2DI8A 3S5LB 5FECB 1CR9L 1T7XA 5LQBH 2H41A 4K8RL 5IB4B 1DLFL 2WINA 1KG0A 3B6SA 3B9EA 1ZAGA 1YMHB 4XVUD 4WV1B 4ZUSB 5FUOH 2APVA 1OPGL 2PYED 5JUEL 2VNCA 1U2HA 4HWEL 2E7MA 12E8H 4PJ5D 4YR6A 4MZ2A 3S96A 3VWKC 4KRMB 4DQOL 2QQLL 4OLVL 4XZUA 3O41A 5DHYB 1JGVL 35C8H 4M5ZL 3DV4A 3VA2C 5T1DH 3DMMC 3GUTA 1SY6L 3QWOB 1NSNH 1N5YH 3CVHA 3Q2CA 4HH9B 1BZ7B 5GGRA 1ODAA 4WY7H 4NZUL 4UT6H 5KVEH 4O58L 4YHKH 4Y5YC 3QEGH 3QWRD 4P46B 3DRQA 1U95B 4DZ8B 4OV5B 3JWOH 4U6XA 3EAKA 5DJ2B 4OI7A 2EDYA 4XMLH 4LNRA 5DHVA 3VXOB 3H9ZA 3IT8D 4YFDB 4O00A 4WUUB 1DQML 2CDGA 1WIPA 4Z7QF 2CK0L 1DUYA 5DRXB 4FTVA 3GMMB 3KWWA 3WV0A 4L1DA 2XNAA 4KROB 1WWWX 2WIIA 3GO1L 3UTTD 4KKCD 3LAFA 2MCG1 3QXDB 1A2YB 3C60D 3DBXA 4DVRH 4OLWH 1JWUB 5L6YH 4QHMA 3KYKH 4MQSB 4IIQC 4C56A 4G8GA 2P45B 5EG6C 1RHFA 4LAQH 1ZS8B 3GSWB 5HYSB 2OL3L 5C7XL 5KVGH 5EZJB 3D39B 4QRTB 4DFIA 4HXBH 2ZOLA 3RWGB 5DMGD 3K4AA 3PGDA 3V6FA 1UGNA 2H2PC 4P2YA 1A6UL 4KPHH 1SBSL 2OXGA 5FM5O 3AVEA 2GUOB 4M93B 3UTOA 4RRPG 1F4WH 4NZRH 3UC0L 2BVOA 2BK8A 1A7QL 5DSCB 5B3NA 4WHDA 3SN6N 2CLRA 5IHZB 3L5XL 1N7ML 1T20A 1SQ2N 1A6AA 5I15L 1AHWB 3QQ4B 3T3PE 4EI5A 3CXHJ 3GZKA 3R0NA 2BXZA 4K71C 3QHTC 3OKYA 4OUUA 1AE6L 4EIZC 5H2BA 4DUXA 4Y1AE 1EXUB 4FS0A 4GLRH 3IB4A 4IDJH 2HVKB 4LLVB 4PY8I 1UJTA 5C0CA 3QHFH 1A6TB 5EU3B 5IP4A 3OGOE 1EO7A 5BVJB 4WRLA 3QUKA 5HD8D 4GRLA 3RNQA 5GIRB 2IAMD 1UKTA 3SDAA 4BYHA 4C55A 3GK8H 2OTUA 5HPOA 1SYSB 5HYJD 3GFUA 4LEXH 1B0GA 1CE6A 5D96B 4AM0B 1A0QH 1MRDH 3GSOA 5KVDH 5EIVA 5GPRA 3OAZK 4P3DA 4GO6B 3IFPA 5BZDA 2LU4A 2XTJD 2ZJSL 1P4LB 2YD4A 1GSMA 1N8ZB 3P11H 1SEQH 3KVQA 3RWDB 1NGQH 2HLFC 2LU3A 2NX5D 1A22B 2Z93A 4P2OD 2MSPA 4BQBA 1CXIA 3P73A 2RB8A 3WO4C 2E9JA 1U8OB 4XB8A 4ZDHB 1F11A 1S9XB 3NIDE 4JAMB 2EE9A 2P5EB 5JW4R 3CZFB 4P23B 3H9YA 2ILLA 2P47B 4F7EB 5BZWA 4CMMB 3VFMB 5D7SH 3RTQB 3VXSE 1QFWI 2W9DL 4Q2ZB 2P5WE 1E4XI 4LIQL 1TCMA 2NY0B 2JJTC 4H26B 3ARBA 5IQ9A 1QHOA 3PGFL 2X4PA 4X99B 5I19L 3BO8B 2BOBA 5GRUL 3TVMD 2EDHA 4DN3H 1OW0A 4G42B 1CE1H 1P4IL 5IIEA 4C4KT 4D0DB 5D7LD 3MLVL 2YD1A 5HSFA 1G7IA 4ZYKB 3ROLA 1YEEL 2RHEA 1QLFA 3DVFA 1T89A 3PWNB 4HUUB 4HKXA 5ESQB 1NFDB 4KMLB 3RVTC 5T3XE 3U4EB 2AP2A 1JI2A 4N5ED 3HZKA 3PJSB 3F5WA 4JFQB 5GGVL 5I76A 4OLUL 4OZHB 1CD1A 1CLYH 3ILQC 1UM6L 4YGVB 1DQQB 1JZ7A 3AS2A 5IVNA 3OXRB 3N85L 4ZSOB 2M2DA 4PJ7B 4NWUH 1IQDB 4LU5H 3HE7D 1QNZL 1XEDA 1FL5A 2ESVD 1LILA 1TJHL 2KZ1B 3ZKNC 2W07A 3RVWC 1UVQB 1G7JB 3SBWC 4DWHA 2QEJA 3FMGH 4FG6C 5E00A 4HCRA 4QHLA 2AXJA 1AGEA 3C2AH 1NAKH 2PR4H 3V52H 4U1JB 4BH7B 2J8UF 4FXLA 1MNUH 3VWJA 1PX4A 3HB3D 3TYFA 3WSQH 3C6LC 1IAIL 3K0WA 4W6YB 4H0GA 2DL2A 1R3HB 1CGSH 4M61A 1IGJA 1CL7H 4P2RD 2XA3A 1OM3L 2AEPL 2G75B 3HLAB 4XC1L 2IPUG 2BC4A 1Q94A 3TFKC 1L0YA 1J5OH 1NUDA 5I74B 3BP4A 5BV7L 4JJHA 5HHXL 4QRRA 1UM4H 5CJ5A 5LJYH 4RGND 2IH3A 5K9OA 4L3ED 5CEZH 3DETC 4Y4KB 2RCSL 1B0RB 2FD6H 2VITB 5B38A 4G6FD 2Z9TA 1NDGB 3IF1A 1FZOA 3EDKA 2PW2A 4W70A 1ZLSH 4NQCB 3EYVA 3SGDH 4QOKA 4LHUG 1AD0A 1N59B 2NZ9C 5MP6H 5T1LA 1A1NB 5J56B 4O2FA 4HLJA 4FTVE 5I8KL 1IM3A 3BPLC 1P7QA 1HH9A 5IW3A 3BD4A 2V7NA 2W65A 4RIRB 2NY1D 3IJYA 4R3SB 1X9QA 3G5ZA 4ZUVB 3WFBH 3SKJH 4PRHB 1S3KH 4XGZB 4TULL 1MCPL 4K23L 4YHOH 2X1OA 3VXUD 1M71A 4HKZB 4C56E 4G8GE 5GHWL 5F7HA 4TNVK 2FWOB 4LCWB 4G80A 3NIFF 3RWIB 4YHZH 4H5SA 5E9DD 3S9DB 3MLWL 3D5OF 3TGXA 5BQ7B 4U6VL 3RVVC 2IFFL 4LVEA 1S7QA 1T0MB 2Y06L 1WEJL 1NGZB 4HKBB 4QRSA 5SWQA 1KJVA 4GAFB 1ONQB 2DWEB 4KAQH 2B0SL 4EN3A 5LXGH 1CWVA 4PPTA 1JK8B 1NC2B 2EH7L 4ELMA 5SWSD 3AXLA 2MCPH 1TJGH 1IGFL 1JNLL 2PETA 1GGBH 1A7OH 3WD5H 4OJFH 3I2CH 2G9HB 4ODSL 4U1LA 5C0EA 5K33A 2Z31D 1LEIA 1OL0A 2EIEA 1UWGL 4NRYA 3VI4F 1C16A 5IFAL 5C0CE 4Y8DC 3DSNA 4YEEA 1YNTA 5C0BA 4X6DE 2XG5A 4M1DH 4XH2B 2ED8A 4G9DB 3NCYS 5D1QB 3U48A 5C2BH 5GJSL 1KULA 1QA9B 4N0YH 2FX9H 1UM5H 2NYYC 2HN7A 5DJAB 4Z0XA 4RMSA 4JLRA 5ICZB 3PG2A 4OQ1A 4X5LA 4PJFB 4WO4B 3AAZA 3TIDB 3T0EA 5FO7B 3BZ4A 4BFIB 1MFBL 1SHMA 4HBQA 1D5ZB 3TJHC 3ARFB 1QKZL 4EI5C 4OZIB 1AC0A 3CCHA 2DQHH 4L4TD 2VXUH 1PG7L 3MRJA 1N5AA 1HHHB 1T80A 5LVEA 3ARQA 4R7DA 5T1KD 2C1OA 4FQQB 5DD3H 4WTXA 5I1IH 1S7UB 3ETBF 3O3DB 3PHOA 1FGVH 4TUOB 2VDQH 4N0UE 3UTSE 2FSEA 3MFFB 3MOQA 5E94B 3GIZL 3MRPA 2X4TA 4GRLC 4XP5L 4F15B 3MX0A 3P0YL 2DQEH 2ICEA 1SY6A 3SDAC 5JHDD 5ICYB 2DQJL 4F33B 3FOMB 5A16A 2VLME 4TUJB 1VADA 2PUQT 2CQVA 1LK2B 2EDLA 4TYUA 4M5YL 3D0VA 2XICA 5D2LB 3C08L 3GBMH 5LAXB 3KDMB 3PUCA 4N90E 5JPMA 1MFEH 3ZYJA 1D9KB 1BWWA 5E8PA 4KTEH 4N9GB 1AIFB 3MUHL 4BFBD 2PW1B 1DBML 3DECA 3LEYH 3CUPB 4J1UB 4UT7H 5I0ZA 2D7PA 4CAGA 3IDUA 1W0WA 2WWKT 4CL7A 2ZNWA 4ZMAT 3OKNA 1UZ8B 4O9HL 5JOFA 1NCBL 4XPAH 4EUPH 5F9WB 1CZ8H 1JZ2A 2FDBP 1FZJA 1R5VB 2GEEA 5F7YC 2IBGA 1IGYB 1JGUH 3IFNH 5FM8A 4U6YB 1I7RA 2WQ8A 5C9JB 3ARBC 2AJ3B 1JYVA 2B1HL 2FYYB 5DHXB 1PY9A 4LLQB 3BGMB 4PP2A 4FP8L 1OW0C 1SMAA 3TM6A 3KPRB 4X7SH 5FM4A 2R56L 3BXNB 5KS9F 5D70H 4JKWA 1KPUA 2WUBH 1CFNA 1QQDA 3BH8A 3BDYH 2APTA 5TPWH 3WXVL 4ODUA 3QXVA 4P4RB 2E3VA 1T89C 5C6WH 2ZPKH 2CR3A 4XWOD 5DEGB 3ZE2F 3R8QA 5E2UL 4ORGB 4QRQB 4JRXD 1W0YT 1KT2B 4ZPTB 1P69B 2VXTH 4M6AA 1MCOH 1U91A 3ME0A 2HTLD 5EO0B 4L4VD 5ICXA 5EUKA 1CLZH 4QEGA 1CFTB 4OCSL 3ALPA 5BS0B 3FN0H 3QFJD 4QRRE 3SDYL 1DBBH 3KR3H 4KKLD 25C8H 3WDIA 5I8EA 5MERA 4HPOH 2QTEA 3UTTE 4N8CL 4DTGL 1J8HD 1A1OB 4Y5XB 3GB7B 3IXAA 5J9PA 1W2KT 4P4KB 5KN5B 4JPWH 1KN4L 1CDBA 4QOKE 3VWJC 1IAIM 3P30L 4RISH 3DARA 3O6LL 5CBAA 5F88A 2XN9B 2EE2A 4WGVB 5IBTL 5C71A 5KTEL 3L3OB 5IB5A 4APQB 2QHLA 4NBYB 3QG7H 3UJIH 3P9WB 1FVEA 4G6JH 1AGFB 5I17B 3GI8H 4N8PA 1A9BA 2DF3A 3ARED 5IQ7L 5C0GA 3K3QA 4NP4H 8FABB 3JZ7A 4MJ6A 3T1WA 3E8UL 2KH2B 5FDWB 5FCUL 2P5WB 2CJUL 5DFWH 4NFDA 2OK0H 2VLJE 2VXSH 3FT3A 1DJSA 3CK0L 5KANI 5LGKA 3V6OA 3F12A 2ADFH 2XYCA 4YH6A 3JWDC 3SOBH 2YUVA 4DAGH 2HT4D 4X6CF 3OV6A 2R2BA 4HC1H 1UWEH 3H0TB 3MA9H 1FQ9C 1YC7A 4ONGL 3MFGB 3Q5OA 4HWBA 4PY7A 4OZFB 3KYOB 1Z9LA 5C0AD 2DQDL 4QF1B 4HUWA 3LKOB 4I0PA 4HKJB 5IK3B 3TBYA 1IGIL 5C0RL 5K59E 4YO0B 3DURB 2I27N 2IPTH 5EUOA 3BKCL 3WFDL 3A0OA 2MJWA 2ED7A 5C0BE 4UNTA 5DD5H 2XTJE 4MMXC 1YA5A 2CDEB 3B2VL 3UTQA 1L9MA 3ZKXB 4YX2H 4PJ8A 1U8QB 1XGQA 4HS8L 1X7QB 2B5IB 3RJQB 2PCPB 1LHZA 2H2PD 43C9A 3MRFA 1RVFL 2R4RL 4EN3C 1H5BB 4JR9H 3MXWH 3SDDA 3FOLB 3LIZL 1EMTH 2HJKB 3BEVA 4HK0A 2YPLA 1J8KA 4D0CA 1Z2KA 1XGYH 2WBJD 2EZ0C 3TWCH 2YN5A 3Q5YA 4CVUA 1KELL 4XPFH 3HE6B 2VDPL 4XI5C 1RZ7H 2FHCA 1RULH 4PJDE 5JXAH 5EZOH 3ZE1E 3LEVL 4YHLL 3LS4L 2NTFA 4H8WL 4OF3A 1U2CA 1IILE 3F7VA 3NFSL 5TDPA 4RAVA 1FIGL 1U6AL 2C3HA 1TNMA 3QRGL 4GW5A 2JF1A 2Q1EA 5D7LE 5JW5A 2ZCHL 3GKWL 1PKQB 3SDCC 3E0GA 5HHPB 1KTDA 1UA6H 4JPIB 1H3WM 2CLZA 4NC1E 1TVBB 4NO3B 3VDCA 3G04B 5GISL 1F00I 3T0EC 1QYGL 1QSZA 1TTGA 1YPZA 4QNPF 1INDL 4K8RC 2ORBL 4PJAA 5JA9A 3CFDA 4Z5RA 3LQAH 2X1WL 3M07A 2VLRA 4N68A 5HGDB 1WGOA 1FNLA 3O4LD 4O4YH 2OJEB 4NZJA 1I7ZB 1FBIH 2YBRA 1C1EL 1N6QL 2P49B 4ZS6D 2FH6A 4M7ZC 4MYWB 2EXYD 5FFLA 2A6KB 2KPNA 4JPKL 1WBXB 3RGHA 3W0WD 5IHUL 3T4YB 5EOTA 2DYPB 3AB0C 1V7MH 3TZVB 1S78C 4XXDB 2JLLA 2X9WA 4LLUB 4EXPX 5EZIL 4C54A 1HHJB 1IC5L 1CQYA 3DIFA 4JRYA 1ZXQA 3HAEH 5TQ2L 2GFBB 3W11D 1NMAH 1YEIL 1S5IL 4ZXBA 3MUGA 3B2UD 3QEUB 5C07A 1VKXB 5JPNB 3HC3L 4K55A 1DVFA 3P3YA 5I1KH 3WN5A 1NCAH 3FTGB 2DQGH 3WL9A 5CIPA 3INUH 1R5IB 2G5RA 1FSKC 5IV2A 2Y36L 1M05A 5F1NA 5ECJE 3ARPA 3LKRB 4IRJC 1N6VA 4ZFOB 5EOCL 4EDXA 4ERSH 3MRIA 3P9LB 1Q38A 3GMOA 3I02B 5E8EB 1LEGB 1HH6A 1J1PH 5D93B 3QRFM 3T65B 4ZAKB 4G9FD 1IAKB 4M00A 4PJFF 2XOTA 2AGJH 4YHNA 4BQ8A 1FYTB 1GZQA 1SYVA 4XNQA 1OGAD 5FA4B 4FQXD 3GMPA 2FGWL 4N1EA 4X6DB 2Y5EA 2WQRA 1ES0B 2HKFL 4R26L 3MXVH 5CKAA 3PIQB 4MQTB 3TBWB 1U8NA 1LO5B 3A6BH 2P1YA 4M6NH 2Q86A 3TN0A 1I8KB 1TTFA 2BSTA 2LFGA 1IAOB 4FNLH 5I1EH 3E1F1 3FO0L 2MHAA 1J10A 1HKLH 4XAWH 5ISZB 3T0BA 3RWFA 4LSQL 3VXUE 2NY3D 5DUML 3OJVC 3QPXH 2A6IB 3U36A 4NQSB 2ED9A 1E27A 1KENH 5AYUH 5JORA 1A7NL 4MD4B 2YKLL 1JGEA 2EE3A 1NCCH 1JYXA 1UB6B 1ZT7A 2VTFA 4BZ1H 3ALWA 5J4MA 5F93C 3EYSH 5DRZA 3UBXI 3VD4A 1I3RB 3FRUA 2XZQH 3QA3A 3IJSA 4FABH 3SEPA 3U9PH 1QBAA 1VACB 3NCCB 5GSRA 3S88H 4N0UB 1KBGH 3UTSB 4N0FB 2GQHA 5HGHA 3O4OC 2ATKA 4MXVE 4U1IA 4OZFG 3ARVA 4GMTL 2XPGA 2E6QA 2Z0BA 1FVCA 3ARSA 1X6LA 1M7IA 3D48R 4D2NA 2ADIB 2CGRL 3FQTA 4POZC 3VXQB 4JZOA 4NDMA 5F9OH 2WSKA 3TNMB 1TNNA 3RP1A 1BQLH 2Q3AA 1I75A 1GAFL 2BVEA 4JGMA 3RU8H 1YNKH 5BJTA 3HG1D 2NZIA 5D5MB 4LLMB 5ITFA 1U8KA 4AG4L 4XBGB 5DK3A 5I1HL 1JF1A 4JZNB 1ZTXH 4NYLB 1A64A 4X4ZA 4UB0L 1BVKB 3EOAB 3Q1SL 4CJ1A 3BIKB 2FJHA 3B5HA 1EGJL 4LOUC 3WFCH 2VL5B 1C7SA 2B4CH 4Q9QH 3B43A 4LPUA 4GUPA 4X4XA 3B8SA 2DQUH 4FQIL 1SEBA 3WO3B 3U0WL 7FABL 5T3XH 2GJJA 4YHIA 2ICWI 3V6OC 1EJOL 1HHGA 3L5WA 3GSRB 4NNPL 1NBQA 3IETB 3T3PF 1YEHH 3U1SL 3OX8B 5JNYA 4F37F 4K9EL 4LSSH 2PYEB 3JV0A 2P43B 4PJ5B 1CICD 4TSBL 2W92A 5B4MC 2YPLE 5GGSA 2GJZB 2NTSP 1BBJA 4I0PC 1X5HA 3SCMA 5JHDE 1HIML 3QEHA 5K9QI 3D85A 4Z95H 3T04D 4KUZH 1A14L 4LLDA 4ZFFA 4V1DA 5GRVL 3VXRD 2A38A 3QZWA 2VUOA 3VRJB 5GRYA 3G5VA 5DUPL 4UU9A 3X11A 4YPJA 1BVZA 3GNML 2Q7YB 5JW3L 2Y4SA 4PJ8C 4X8JA 3X14A 1P9MA 4YHYC 3PP4L 5ETUA 2LABA 4EOWL 4PS4H 3IXTA 3R1GH 3FT2B 5AZ2H 1EHNA 2VYRE 4NN6C 5EC2B 4Q7DA 5FV2A 4KJQC 1EEQA 2XWBB 3GBLA 3ULSB 3SDDC 1IC7H 1TIUA 5CINH 4MXWH 3U0PA 4AEHL 4OT1L 3UTTB 3U9UA 2CKNA 1YPZE 4MS8C 3NIDF 2L7UA 4PJAE 3C60B 2XKUA 2VLRE 3V7AE 1F4YL 4XNZB 5I1GH 5HI3C 3T0DA 1FNSH 4G7VL 3HC0B 3RPIB 4PLJD 3VE0A 3H9SA 3L7EA 3QPQC 4WDIA 1UXWB 3QWQB 1IBGH 1VFBA 5BV7C 4J8RB 5GGRY 5DHVH 4KK8C 2X70B 1HCFX 1UFUA 1CG9B 1BREA 1GH7A 1FL6B 1PDKA 4QLRA 2AW2A 4ZOAA 4B53A 3MJ8B 1E6OL 5I2IB 1AGDA 4JRYE 5EPMB 2V2XB 1HSBA 3BWAA 4I4WB 4PGCB 2EDKA 3O8XA 2CDFA 2K3TA 4L4VE 4MSWA 4JHWH 3PXJA 5GS3A 4AIZB 1YC8A 3U6RB 1CGVA 4Y2DD 3CU7A 1KJMA 1ZT1B 4XWGL 5JIIA 2JB5L 1Q9WA 3L3GA 1B2WH 1JGLL 2FX7H 3QFJE 5HHOA 5I1LB 3RWCA 4UINL 1ZEAL 3CSYA 3D18A 1SJEB 3LEXA 5JOPE 2IAMB 3STBA 1FG2A 3ZHDA 3HZVB 3IDIB 1DZBA 5J3HC 3NFPB 1KEGH 4DVBA 2AKRA 5D7JD 3OKDB 1P7KA 4ZNCD 2DQIL 4PB0L