4AM0B

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
DIVMTQSQKFMSTSVGDRVSITCKASQNVRTSVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
total genus 50
structure length 212
sequence length 212
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4am0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4am0B01
5DUPH 3T0AA 1RJLA 1FZOA 1MIEL 2PO6D 4TVPE 4WDIB 1G9NH 4ELME 1LO3H 1G6RH 3GSVA 4RAVB 4OCWH 1G7HA 2VL5B 1DBKL 2BVTA 1T0MB 2IBBA 3HCVA 4U1GC 4WTXA 1AGEA 1BZ9A 3DXAE 1MCCA 5KG9A 1MLBB 5CLTA 1A6WH 43CAB 5F9OH 5E8DL 4NN5B 3HPLB 1CE6B 4YAQA 4M7KH 1FL6A 1RVFH 4UV4L 4MQSB 3WFEL 3QUYB 5EU4A 1Q9LB 3SDXB 4AENB 4HIIA 3DX7B 4HWZB 3GNMH 2AXFA 3U7WL 2AV7A 3GEWB 1CR9H 3C08L 4PJIE 4PP1C 3RA7L 3G5VA 4RNRB 4U1HB 4ZFZB 1EMTH 2VLRA 1F3JA 1IAMA 4MNHB 1RZIB 4AQ1B 3RWDA 1MCOL 3G9VA 5B39G 5CKAA 2NXYD 4EI5C 2Y4SA 4O4YL 2X41A 2XT1B 4NQDA 3Q5YA 5DMYA 1KG0A 4I0PC 3SQOH 1OLZA 1SEQH 2CLVB 5FGCB 4EJ1C 5ITBH 1A02N 1GZPB 2W07A 4G6FB 2KBGA 4U0RB 3QEQD 4MLIA 5IVNA 3UZQA 3QIBC 4E9LA 2HP4A 2BY2A 3MC0A 3NIFE 4W70A 4PBWD 5EG6C 1WC7A 1FIEA 4HKZB 4WY7L 4HC1L 3U79A 1RZJH 4NNXB 3IKKA 5MENA 3EOBA 3JWOC 1MCSA 5HGBA 5BV7C 3TWCL 5E1AB 4GSDL 4BQBA 2QR0B 3L5XL 1GOHA 5TF0A 5DVLA 5GSRB 1U36A 5CCKH 3FT4A 4ZS7H 4XP5H 2Y25A 3GMRA 2DQDH 4G6AD 1YYML 4JM2F 4YQXH 3BKYL 5EWIL 3JV0A 4U1MA 4E0RA 3FO2B 4KDWA 4BZ2H 5CGYC 4ODXA 5GIRA 1R5WA 1KFAH 1T20A 1E6OH 1X5IA 4MS8C 2H6PA 4F7TB 4OGAC 1D5ZB 4PJGF 2VYRE 3GRWA 1AQKH 2IANE 3HFMH 2A6DB 1PDKA 3TVMA 5EC2B 3R06B 3RVWC 1PG7H 3RGVD 4PD4J 5GZOC 3FT2A 4OI8A 2NY0B 3IFOB 3LPFA 3PWNB 4PJBE 5CJXA 4O2CA 4N1EA 4OIIL 3B83A 4GRWH 3CMOL 4HIJB 1ZT4A 5KVEL 1Q1JL 1CZ8L 4NKMB 4PJHE 4UU9B 2P5ED 5CBAA 3P11H 2BNRD 2X9WA 1R3LB 2X4SA 1FNSL 5DR5L 4C56E 4XPBL 1T5WA 2XTJB 2AS5M 3N9GL 1J88A 4LSQL 3WS6C 3PWUB 1TENA 5FO7B 5D9SA 5C07A 4LARL 3KLAA 5I1IH 5DMJB 4X98B 1TJHL 2QHRL 4IOSD 2H41A 3VG0H 1JMXA 2AJZB 2HVKA 5ID0B 2E7BA 1KSRA 1DQJA 4J3UA 4HFWB 1S9YA 3WD5H 4MQTB 3LV3B 3FFDA 3S7GA 5DZNA 2Y7QA 3VXQB 2YPKA 4ZYKB 1OGTB 2M26A 5T1DL 4G8EB 1JPFA 2XFXA 1BAFH 3LAFA 1N3NB 4GO6B 4QEGA 1PKQA 2VXVL 2N1KA 2GFBB 1MFDL 4QXUL 3CVIL 5IBUG 2JB5H 1ZVSB 4JRXE 4PD4K 4HXAL 4Z7VE 5F8RC 1IZJA 2E9WA 3L7EB 4UNVA 1E4KC 5GPRA 4OCRL 3ZO0A 1P84J 5CZXD 3WNPA 2PW1B 3CFDB 1TQCC 2QKIA 5E8OA 1QR1A 1XGTA 3IFPB 2YR3A 3QZWG 3MV8D 4PGCA 4N8CL 5EU3A 1C1EH 5DD6B 4I77L 3LMJH 4P46D 1X9QA 1U3JA 4LSDA 3WHE0 5A2JH 5EO9A 3P3YA 1UXSB 3LPGA 1NDMB 1C5DB 1DQDH 1BGXL 1R3IL 4HUUA 5HGHB 3V6FB 4DUWA 4LDOB 1AO7E 5F1OB 3KPQB 1LK2A 3SDXF 2UZIH 5CZVH 1FH5L 1DN0B 2DQUH 5IG7A 4U1GB 2DTML 5IF0B 5F7EL 1NCNA 1A4KA 4OD1L 2EIDA 3Q6GL 1U6AL 3RZCA 3ROLB 1OF2B 1YYLL 4GXUN 3VFPB 1T0NB 1MRCL 5DD5H 1F58H 2OSLB 4WCYL 3O3DB 4G80A 1IGJB 3BEWB 3R1GL 4S2SB 2R0LL 4PJ8C 3WN5C 2EH7L 1CF8H 4UDTB 4UI2A 3CH8A 4JKPH 1P84K 2CK2A 1EEQA 3ZSSA 3FB7B 2KL6A 4Q2ZA 3VFWB 2VDPL 2EYRA 2CRYA 4JAMB 4UT6L 4V1DD 4OF5A 4FFZL 1MJUL 3I50L 4GMTH 4HPYL 4EI5B 5E00B 4Z76B 5EBWA 5CMAB 1YEHL 4KVCL 2MCPH 5SX5H 3HKFA 4GAYA 4JDZA 4I0PB 3EO0B 3UJIH 5E24E 4YHML 1K4CB 2EDQA 3HMXH 3C5SA 3QIBB 3TPUB 1PZUB 3S9DB 3KPSD 5DEZA 2AABL 1MWAB 1NGXA 1BOGA 3X12A 2DQIH 1FYTE 3CPLB 1LO0L 3FB5B 2EH8L 1J86A 5BV7B 1ETZB 1LO5A 2BNUA 4HT1H 3TYGH 3WLBB 1OAZH 1S7SB 4JRYD 4H26B 4P2OA 4P9HL 1VFOA 4EN3C 4PLOB 3QDMB 3ARFC 3PG2A 4BQ8A 4HWEH 4LHQB 3F5WB 3L95A 3QQNA 5ILTL 1XZ0B 1ODAA 1Y6KR 3DSFH 5D1XA 1OB1B 1U8JB 3NABH 5T33H 4QRUA 4F7CB 2ZP0T 2YRLA 1CG9A 1GPOL 4LVNC 4XBEH 1FFNB 5C0BD 3F7QA 4RBPK 1BVZA 5HI4D 4XNMA 1NMAL 3GJFH 3MBXL 4PJEE 3AAZB 3SKUD 4QRRA 3UTQB 1I3GL 4OAWA 1FJ1B 3OAUL 4XNQB 3LHPL 4HH9B 1I4FA 1JPTL 1SJXA 4YDJB 3DVNB 2BJMH 1Q0YL 2IALA 2R2HA 1KEML 1AD9A 5CIPA 3B6SB 4LSSH 4M8QB 5J6GA 1CDIA 4JPIB 4KRLB 3S5LB 5GJTL 4DKFH 2H2SD 4JFEE 4HFUL 2BVQA 3SJVE 5F88A 5JOPE 3OAYH 4ERSH 5JA9A 4R26L 2IPTH 1L7IH 4UAOC 5T3ZH 3CIQA 4BFIB 3MLTB 2VXQL 1CD1B 3MJ7B 4I0CC 2W60A 3V8CA 5C6PB 2R4SL 1PZ5B 4XAKE 4L3EB 3T65B 3KPNA 4Q6IA 5DRNA 5AUMA 3VI4E 4RMUA 4JPKH 3S3SA 2YZ8A 5GS2H 4QT5A 2XI9A 4PGBA 1U9KA 1CIUA 5IEHB 4OZFH 5JHDE 4P2RB 2XACC 1DBAL 4H25B 4OZIA 2RQ8A 2VAAB 4R4FL 3F7RA 4KKBC 4JB9H 1AI1L 3TBTA 1YNKL 1F13A 4WWID 4YZFE 2JJTC 2D7NA 3D3VE 1XF3A 1NCCH 1ZSDA 1TXKA 3U0PB 4URTB 4X99B 4XHQA 2EDFA 2NW2B 1TQCB 5MEND 2UWEE 4M4PA 3FO0H 4G9DA 5C09A 1NSNH 5TDNB 5B4MD 3MLSL 3QO1B 4NWTH 3H9SA 1AXSB 1Y0LA 2CGRL 3AVEA 1WEJH 3MGOB 1UJ3A 4ODTL 4EEEA 4TNVK 3KVQA 4JQXA 2Q86A 3OHXA 3QXTA 4KDVA 1DFBL 4JFDE 1RHHB 2C1OA 3E0GA 3O3UN 4NKIL 1Z9SA 2IGFH 3BN9D 2LFGA 3U6RA 4RX4A 3B9KC 3TBWA 1KB5B 1ROWA 2YKLH 4G6JL 5T5NG 1RK0A 1CQKA 1HQRB 4FTVE 1KLUA 1CFVH 1EX0A 2X4QB 1YN7A 2KQMA 4P5TA 3TVMD 3CSYA 1KTDB 4R3SA 5C3TA 1IC4H 4LHJB 3GMOB 5IVZB 3WIIL 1FC1A 2VKXA 4P48A 1N59B 3G04A 5HI3D 3ZDYF 3ME0A 2PTUA 1U8PA 3DWTA 3WNLA 2DMCA 4NO5A 4X8XA 2G60H 2X44D 3TFKD 1KTLA 3R0NA 5FKPB 4ZD3L 1EH9A 4PJ8B 3WN5B 5IB5B 1IGYB 3CFJB 3ZE0F 3M17A 1NGYA 2A83A 1ZEAH 3MCKA 2GY7B 5EBLB 4FQ1L 3HRZB 1JNNL 2RR3A 4HPOH 2HT2C 3RWCA 2JK5B 1TPXC 3I3BA 1VERA 5C07D 3ZE1F 2UY6A 3QEQB 3LSOB 2R4RH 4K3JH 4IRJC 5MP6H 4FQXC 2PR4H 3NCYP 5IBLC 1I9EA 3VMPA 5B22A 4LCUB 1YEJH 4PRPE 5D70L 5I75C 2GSIA 4OIAA 4I18C 3TO2B 5J3HD 5EOQH 1RU9L 4XVTH 2Q6WB 4DTGL 2G75B 2HT3D 3UYRL 2X1QA 5MHSE 2GAZB 1OTSC 1NFDE 3RX5A 2QSCL 3U9UB 1NFKA 3HNTH 5I8KL 1SJHB 3KYNB 4KJQD 2MCG1 3MRPA 3WJLC 4LDLB 4DZBB 1JWMB 1REIA 3RU8H 1CGWA 4LEXL 4ELKB 4PB0H 3NACL 4LRIA 5DDHB 3PHSA 2H8PB 3MNZA 4XRCA 4NQSA 4LMQE 3HNSH 2EDXA 3HZKB 1A6UL 4HBCL 2DM3A 3ARFB 3MROA 5FV1L 1T03L 1A6TB 4KHTH 3LEXA 5JW4M 1FN4B 4PLJD 4JO1L 3P9LA 1X4ZA 5F71A 3RGVB 4LVNB 3EDJA 4Z7NF 1HXMB 2FATL 1BFOA 5FYKE 2BY1A 4ZO8A 5FKAA 5GGUA 2WZPD 5T3XH 3RUGA 1MEXL 4N9GA 4K3HA 1PX3A 4X8JA 1A7QL 5TPWH 4NRXA 3M45A 1LO4L 4GRLA 4PP2A 4B53A 5AD0A 4QXGL 5LJYH 3ULVH 1E4XI 2ZSVA 2BVUA 4MA3B 4UOW1 5JXAL 3PIQB 3RZCD 3ZYOA 1JWSB 3VA2C 3CSPA 4FFVD 5L2KE 4GT7A 5D93C 5DO2C 5MEQB 4UAOB 4IIQC 4C58B 4FRWA 1VEOA 1BFVL 1UZ8B 3IDJB 3C09C 3MLYH 2Z8VC 3HN3A 3VWKC 1IC5H 1OW0A 3T0EC 1KGCD 2H32B 3DJ9A 5F3BB 1XR9A 1JGDB 4JFPA 5JQ6L 2HJLA 3FAWA 5DLML 4MXVE 1HHIB 1EK3A 3IDGB 4F7MA 5B8CC 3AXLB 1RZKC 5F44A 2EKSB 3WNOA 1S8DA 4D3CL 1HE7A 2PCPA 2VLLA 1XGQA 3HS0B 4Z78A 5D7JC 3UTTE 1G7JB 2RFXB 3RVXC 1GZQA 1XIWC 2W0FB 3ES6B 3W5NA 3BWAA 4KWUA 2VDML 3MACH 4ZPTB 3L3IA 1I1FB 4NSKB 2BRRH 3S34L 1JL8A 4EOWL 4G8FA 3BD4A 1WCBB 3F62A 4P46B 2YK1L 1HSBA 4WV1A 4QHLB 1MHCA 5E8NB 1AGDB 3DMMC 1T7XA 5K9JL 2A9ML 5CSZA 1I9RH 3DI2B 1MCEA 3ISWA 4YXLL 4NUGL 5TFSH 3QNZA 4TSCL 4P2OD 1FVCA 2RHEA 4NHUB 5FXCH 3WCYA 2VISB 3GSNH 3GGWB 4NQVB 1JHLL 2OCFD 5F8QC 3RHWF 3MV9E 3IDUA 5F1KC 5D1XD 4IOIB 2MHAA 5D5MB 4K7FB 1ZMYA 2R56H 1UA6H 4ZAKA 4OTXL 4Y4KA 4CW1A 4G9FE 5GHWL 3B2UD 1UG9A 3HUJA 3BKJH 2NY3D 1GGYA 1T1XA 2EKJA 4QRRD 4EIGB 3ARYA 4ZSOA 2DWDA 1UCBH 1Z9MA 3ESUF 3L7FA 3MREB 1KN4L 4M6ML 1RJYB 5EOCH 5I8EA 1TDQA 1X4XA 2PW2A 3ZZ1A 1INDH 4MD5A 3OQ3B 3IKCA 5E0QA 3NCJH 5LVEA 5C6TL 5I74C 4IJ3C 4O5LL 1JHTB 1T6WA 3L5WB 3RNQA 1T0PB 5I17B 1H3VA 1BZ7B 5IM7B 5ICXA 3BX7C 4MA8L 5DHYA 2NR6C 1FL3A 3P77B 4UINL 4DGIL 3A67H 1TPXB 4H8WC 4JFFB 3BMWA 2GT9A 3MLVL 1G1YA 5HGDB 3D39D 4JANB 4IRJB 4FQXB 3G9AB 1N4XL 4XC3L 3X3FH 4QHKJ 4Y88A 5I75B 4ONGL 3VGEA 3LN4B 4MCYA 4I18B 2H9GB 3JUYA 4Z0BL 1Y18A 2FJGB 2KDGA 4QOKA 3QZWA 4GKZB 5C92A 4MD4A 5FOBA 1NGWB 1A1OA 4Z7QE 1CGSH 1YUHA 1D6EA 2FX9L 3FQRB 3P9WB 3HZMA 4OCSL 3HC0B 1SEBA 2ITDA 1DANT 1NH6A 3FMGH 1PG7X 3VH8G 2R69L 4K23H 1KCSL 2IAMD 4KQ3H 3LKRA 1H3PH 5H35B 1EO8H 1J8KA 4PR5B 1QBBA 4PYGA 5FYLH 5F6HJ 5C0AB 2XZZA 3VGAC 5SWQA 3SQBA 1YEFH 5C09D 5CSGA 3BOVA 4MJ6A 4NKOB 4DVBB 3T77B 4HUWB 3H9SD 5BZWA 3O6KH 2YD8A 4QTHA 4MX7A 2DQGH 4TSBH 4RDQG 2CKBL 3KJ6H 3LS4H 1PVHA 1G6VK 1AGBA 2APBA 3PGFH 4NKDB 1F6FB 5CUSL 2P5WB 2Y9RT 3GK8L 1R0AL 2CIIB 5GGVL 5CILH 4RX4D 4S1QH 2X2YA 1QYGL 1OTUC 1TCMA 5FGSA 5EBGA 4M1CD 5EUKA 1J18A 1IKFL 3MPCA 1ND0B 5ITFB 1W72B 1KPRB 5I1EH 4KJYB 4P5TD 3PP3H 1I9IH 3BH8B 2WWMD 1UXWA 5TH2A 4HJ0C 1T89C 5GGRY 2ESVA 2Z4QA 4P4KA 1CLZH 1OD7A 1U92A 3ORJA 4WWKA 5D7SH 2G9HB 4OUUB 4HIEA 5D7LA 3MOQA 1D5BB 5FFLA 1BEYL 1H3WM 1X4YA 3DVGA 5I19H 5GGRB 1OSZA 1S7RA 4P5MB 1X5YA 5DJ0B 3GSRB 1BQHB 3BZ4A 3C09B 1MCWW 3GB7A 2OR9H 3VWKB 3T0EB 3O8XC 1HHKB 2SEBB 3RAJL 2FIRT 4HWBH 1FV1B 3BZFB 1TJIL 1IEBA 1MF2L 1L6XA 1QSEE 3NCCB 5FGBC 3W81A 2YUZA 5JO5B 4NZRH 1CLCA 5EU5B 2IG2H 4PREB 4WEUD 5T1LB 5B8CB 5D6DA 4Z7UE 1P1ZB 4HULB 5BVJA 5D7JB 3BDYH 3IETA 2ICWI 4YPJA 4OZHA 3UO1L 2VDLH 1XIWB 2ADIB 1E28A 2E9IA 3KYOA 4N0FA 1ONQA 4OBRA 1D9KC 5D1ZA 4YNYA 1U95B 1B3JA 4GLRI 1IAII 2F74A 2P5EE 4X4MA 1QA9A 2BNRE 1IGFH 1K8DB 2X4TA 4U6HA 5D5MF 5FYKL 5SV3A 2CIKB 3VXPA 4HS6A 4MVBD 3A6BH 2ZCLH 2KPNA 1SYVB 3MGAA 3CVHA 1EIBA 5C08A 1NDGB 3U36A 4HCRA 1FZKB 2R9HC 3R8QA 4M7LT 5B38G 2BVYA 2BXYA 3RVTC 3BP6B 5I76B 2EDOA 3T8XB 5D7KD 2OJZL 5I1AB 1T2QL 3C8KB 3FL7A 3B9VA 4TULL 5I1LA 1G0YR 2ZOKB 1KCVH 3DI3B 3MNWA 3P4NB 2R1WA 2DYPB 1A7PH 4KY1H 4KRPD 3AY4C 2XA8H 3S37H 1T7YA 1RZGB 4OCXL 3EGSB 4U6XB 1MWAL 4GRLD 3MTRA 2W65A 5JNYA 3RIFF 1IL1A 2EDJA 4M48H 3TGXA 1AP2A 4H88H 1U8QA 1WUNT 4FQLL 4GW1B 4F58H 3KXFD 1KPVA 1JHKL 3SKJL 1QR4A 4PGJA 2YPLE 4UV7H 1F2QA 5I74B 4IJ3B 5ESQA 5DK2B 4KZEH 2P42B 1JUFA 1K9TA 1N7ML 2OZ4L 2X4UB 1N0LA 4OSUH 3BWUC 2OP4L 4MAUH 3FQTA 4NP4L 2OTPA 3MV8E 3PQYA 4PRNB 3UEZA 1TTUA 3WFCL 4LF3B 1HKLH 4OGZA 4POYA 3LDBC 4OFDA 1IM3A 2YEZB 1F4YL 5GRUH 3MMEB 5EB9A 2NQCA 1TETH 4FG6C 1GGIL 2DJSA 4WFGD 4H1LA 1F4WL 3PGDA 5KN5A 3ARGA 4MNQA 4JE4B 3TT3H 2COQA 3LKPA 4ZOAA 3EJZD 1UYWL 3MRKB 5JW4Q 2GJ6A 4YPGB 3C9NA 5LBSH 3PV6A 4TPRL 2CK0L 1E0OB 4LCWB 1XCTA 1YNLL 5IJKA 3ULUE 4ZQKA 4P57B 2O5ZH 2P8PA 2X9YA 1FO0A 4CUCA 4I4WB 2NX5A 3OGOE 2QQLL 5KSBE 1S7TB 5F1NB 5TF1H 4Z77A 2X4NB 3V4UH 3VXSB 3ZE2E 5E2UL 4PLNC 3VGAB 4L1DA 4GS7C 4D94A 3T0DA 2DBLH 2HG5A 3FO1B 4P49A 4OV5B 3HAEG 5FYJL 1F4XH 1QVOA 3UPRB 3ARQA 1ACYH 1VGKA 1KELL 1F6AA 1IARB 1UWXH 3AS2A 3BN3B 4GW4A 4V1DE 3GI9H 2LVEA 2Y36L 4XMLH 1YECL 4F3FB 1NAML 4F9LA 2UYLA 1WBYB 5IBTL 4HV8A 1NCDL 2JIXB 2AEPH 3TM6A 4HMCA 4MNGB 1IGTA 3MRGA 4OCMC 4NCDA 4RZCA 5GZND 2D7PA 4ZAKD 3QI9A 2GTWA 4KVNL 3MXWL 1MH5A 4Y4KD 1CICA 4GKOA 1MAML 2Z93A 1SY6H 1ZXQA 4KZDH 4C4KT 3KPRE 2A6JB 3IU3A 1MIML 3GIVA 4Q9QH 5DMGC 5E94A 1KF9B 5IIEB 1DUYA 3ZDXF 4EVNB 1YMHB 1Z2KA 4HKXB 4G5ZH 4JRYE 4PJ7B 1CDGA 1RK1A 1N0XL 1JV5B 1CDUA 4A2MA 5HHQA 2VSDA 2NTFB 5IB3B 2ZCHH 5DT1H 3O8XB 4ZUTB 1GHFL 3HZYA 1UH4A 4EDWH 1CTNA 3FTGB 4R8WH 5KANG 2P24A 3NAAH 2HH0L 4QHUA 5C0BE 3V5HA 1TZGH 5INCB 5JPNB 1B6DA 1H8SA 2VAJA 4XVSH 1Q9KA 1RI8A 4D9RE 4OFPA 4K07A 4FP8L 4M6OL 4Y2DA 3D69B 4RISH 1N5AA 4W6YB 4XGZA 5D96C 4QOKD 3TCLB 1D9KB 1A2YB 4K3DL 1FFQA 3J8F7 3REWA 1R5VA 5IEKA 2LTQC 2WK2A 5E2VL 1EHLH 2EDKA 4KFZC 1GGBL 2VDRL 5DS8B 3VFRA 3E8UH 4ODVH 3QWQB 4GAJL 4FQPA 2W9EH 3D5OF 4IS6B 4WTZG 4NDMA 1CT8A 5IROA 2MPAL 5GGSY 3GJFK 1FZMB 1OP5H 4HAGA 2BFVH 3TBVA 5DI8B 4QF1B 2HFFB 5GGSB 5IMOA 1ES0A 4LCYA 4ZPVA 3RWEB 2J8UB 2E8YA 3ZTNL 4WTWA 4N68A 1NBZA 4BKLA 2ERJC 1HH9A 2ZPKH 4JY5H 3O81A 2VLRE 4JFEB 3VI3E 2B1AH 2GITA 3SJVB 4MSWB 4FZEH 1FNHA 5JUEL 4S10A 3OAYK 1SM3H 3LQAH 2VITB 1QQDA 3TJHD 3TESA 5D1QC 2VLJB 2AI0L 5CP3H 4YDLC 2YSSA 1EBPA 5C0FB 4NQDE 3MRIA 3MBEA 3O11B 4X6DB 1N6QH 3EDKA 3WIHA 5KTEL 5HHVL 2MKWA 5E08L 2CJUL 3O9WD 1T83C 4AH2A 2WSKA 1U58B 4UTAH 4FXKA 4UBDD 3N85L 5TGBB 5FO8B 1IAOB 5BRZA 4YH6A 2B39A 1AGFB 3I6LE 5C6WH 4Y4HA 2ESVD 3D39B 5GRVK 1RUKH 5AWNL 3RDTA 4P4KD 4UNTA 2CLZA 2DRUA 5BW7C 4WWKD 2CDEB 5D7LD 4XH2A 5JHDB 3BIKB 3IJHB 3QO0B 1GH7A 3U48A 2IC2A 4C4KO 3CLFH 3T0XA 3LDBB 2VKWA 2M1KA 4WUKH 2FEDD 4JGUA 4JFXA 4TNWF 3Q0HA 3AREC 3D3VB 4XHJD 5CBEA 2UUDH 4NJ9H 3NPZB 1FAKT 2J88H 4X80L 1KBGL 4MJ4A 3L1OL 4R7NB 2APVA 2IAMB 5SWSA 3W39B 3SGJA 4K9EL 1ORSA 3FQUA 1WZMA 5J1TC 3IXTA 5T5FH 3QDGB 3MRCB 3QEGL 4WI3A 1HWHB 4UILL 4WFED 2IMMA 4PJ9A 4HEME 1MUJB 4Q9CA 2BVOA 2NY1D 4G6ML 4XB7A 3G5ZA 5D1ZD 3BZDA 3SDYL 1N8ZA 3L6FA 4PRAA 1YEIL 4PV8A 3VDBA 4GS7B 5CINH 4ONOA 3MRBB 2X09A 2FX7L 3NCYS 2AK1L 3U82B 4PRDB 3MRDA 4YWGH 2D0GA 1DQQA 4DN4L 2QHLA 5C07E 1MY7A 4U1LA 4F37K 2V7HA 3JBG7 4XBPB 3C2SA 5CEYB 5IR1A 1V7ML 3M1BB 5TE6H 3OF6A 1YY9C 5DJ2B 4PJ7F 1CE1H 3IDYB 3V8OA 4LU5L 2IBGA 1OVZA 2Z92A 4UT7L 4F33A 1LVEA 1YJDH 1NAKL 1SVZA 3Q5TA 2F58L 1QSFA 1PKQE 2BSRA 5E6ZA 1MCIA 4F9PC 2DLFH 4XNUH 1NC2B 1ZLSL 4PRPB 5DTFA 3QUML 3WL9A 3BFOA 1N5YL 5CD3A 1QEWB 1T22A 4C54A 5DURB 4FQIH 4RIRA 4O51B 1AJ7L 3BSZH 5JOFA 4Y19A 1HZHL 3PQYD 2Y07L 3GIZH 1RZFL 2WIIA 4K55A 4WO4A 4U7KA 1IAKB 1JNLL 3TV3H 1A1MB 3IFLL 4LCCA 5KVFL 2BVEA 1S7QB 2R2EB 1UACL 5FM8A 3P30H 4KMQA 1R3HA 3EYUL 4FXLA 3ARGD 4MNQD 4N9OB 4WU7B 4Z95H 1GGCH 4NIKB 1AR1D 1JNJA 5DQDL 4HF5H 3HC4H 1DDHA 2GJ6D 3DPBA 1G9MC 2Q8BL 3TH2T 5D96B 2OL3L 5EZJB 1NGPH 4HMEA 1SHMA 1J1OH 4KI1A 1U8LB 3IDXL 3HMWH 4M5ZL 1TZHB 4JCMA 1PLGL 2J8UF 1G7MB 5ALBH 1TZIA 1AD0B 2LTQB 3EFDH 3MFFB 2NX5D 5M94B 4NQCA 4DGVH 4QWWD 3OZ9L 1DL7L 1LGVA 1G84A 2IADA 3IT8D 4U1SB 3DHMA 3TBYB 4X6DF 4X7TA 1LO2L 4XCNB 3SDCA 4JG0H 3OKOA 3C6SB 4ORZC 3L9RA 4S11A 5D6CB 5C0GA 3O6FA 5DJXB 2Q8AH 5DYOA 4P3CL 1QLRA 1RZ7L 4OQTH 1D5XB 3CX2A 32C2A 4ODWA 4UIMB 5L2KB 5D2NA 5D1QB 1DQLL 1K4DA 3KXFB 1XF5B 1IM9A 4L5FL 1JWUA 1A6ZB 2YC1B 4H0IA 2FZ3B 3ZHDA 4KTYA 3ARTA 3S36L 1NBVL 1ZHKB 3THMH 1HH6B 1KJ2L 1QO3A 4H20H 2NYYC 5LKNA 2FGWL 3QI9D 1YQ2A 4YDVA 3BT2L 1CICD 5DFWH 1O0VA 3N1GC 1WICA 5CEXA 2QSVA 3U7YH 5LWYL 2FO4B 2JB6A 4GG6B 1QUNA 4OZIF 4L4TA 4RWHA 3VFOA 1G9NC 5I71C 3NN8B 2V5SA 5J4MA 4XWGL 4NC2B 5EOCJ 1J1XL 4ZTOH 1UWGH 3WKML 4M7LL 1D5IL 1OARL 5FV2A 3ARVA 1I8KA 3AREB 1XCQA 2F54B 2IPKB 5EPMB 5T3XE 3TIEA 2AJ3A 3HLAA 2EYTB 4WU5A 1DQTA 4KUCD 1WWBX 4D2NA 1P2CB 4HGWB 4B7LA 3VFUB 3OXSA 1CDBA 5DJ6B 1D6VH 4MYWB 5JOEA 3H42L 1F3DH 5DQ9A 3H3PL 4YK4C 5K9OA 2X7LB 3TC9A 3K2UL 4Y2DD 4QRRE 5DJZA 5MEPB 3AS1A 1R3KA 2Z35A 4KXZI 1JI2A 1P5VA 3CMGA 3U0WH 2DQHH 4IRSC 3B5TA 4RCAA 5DEGA 3KLHC 1U8MB 2V2TB 2FJHA 1NLDH 2ATPA 5CGMA 4PRIB 3LB6D 5DD3L 3INUH 3KYMB 3RWGB 2Y6SD 5HDLA 4Y5YC 4CBPA 1I8IB 4YHZL 1WFUA 2Z0BA 1U91A 2F5BH 5E5MB 2C3GA 1BVKB 4LSUL 4NO3A 5LXGL 5I66B 4Q74A 3IU4H 4MJ5A 4OT1L 5B3JF 3L3GA 3JXAA 1D5MB 4CVZB 4CN1A 3NOIA 5GS3A 3FOMB 4CVXB 4QRSB 1QBLH 2WBWB 2GCYB 4N8VA 4YXKH 4E42A 1MQ8A 5DK0A 3BZEB 1K8IA 5ANMA 5BVPL 1MQKL 3LRGA 3BUTA 1A6VH 3O4LB 4TNVF 1XEDA 5E4EC 1RJZB 3MBED 1W0WA 4NQTA 5C0NC 3CDGB 5BO1L 1MOEA 2VR5A 4L8DA 1JGLH 4PBXA 4W4NA 1CFTB 3LKSA 4NM8L 1N2RB 3PABA 5JXEC 5J06A 2HAZA 4PJ5B 1YY8A 2QQNH 3U4BL 2O5YH 2O93L 5BRZD 3RL1B 3VFVA 2ADGA 3W9EB 2X4RB 2JJVA 1XGPB 4X5XB 1F11B 3QXAB 4XZUB 5I73C 1GSMA 3TN0C 2HKHL 4N0YH 3CXDH 2HWZL 3DX8A 1P7QA 3RDTD 1WT5C 1KPUA 5C09E 4YBHA 4JFOA 5FDYA 3GRWL 3VFMB 2NW3A 4IOFD 3H9SE 4S1SH 3ULUC 4KROD 3D25A 3QCVL 4NQEA 1B0RA 2F9BT 4BM7A 4APQA 2UY7A 4KTEH 5CJQH 2HN7A 2APXA 3MLWH 1QKZH 3HE6D 3MV7A 2DDQL 1FL5B 4KK9C 4B50A 4U3XA 2ITCB 4KKLC 1BQLH 1VSCA 2IH1A 5SWSD 3HR6A 2XZAH 1MRFH 2DD8L 1RIUL 3FQWA 3S37X 3RUGF 5KVGH 4XVUD 4IMLB 1F45A 1IBGH 4NBZB 3VWJA 4MXWH 2VC2L 4NO0A 3DARA 4PJ9D 4N0UB 1IQWL 3O0RL 4MXQC 2HKFH 4NM4H 2X4PB 3PWPB 1MIEH 4N90E 3OR6B 4M6NL 2OTUB 3RBSA 3RI5K 1DBKH 5GS2D 3NA9L 1ZHBB 3I2CL 1QRNA 1ZAGA 1WBXB 5L8LB 2BSTB 1EFQA 4PY7B 5E8DH 3SGKA 5TE4L 3LZFL 2AERT 5EFIA 4UV4H 5F3HB 3O9WB 1LEGA 2XG5A 3CU1A 1UB6B 4M43L 3WFEH 2EIZB 1LP9A 4GG6F 1JF1B 4BH7A 4P3WA 4OKVA 2N7BA 3CD4A 3UDWC 3U7WH 3PWLA 4P5KA 1BX2A 3OF6D 4AL8L 5EUOB 3PL6C 4D0DB 1M7IA 3C08H 5DWUH 4Y8AA 3RA7H 1NCAL 5ADPL 4ZUVB 1FYHB 2YOCA 3L3KB 3WUWA 2C1PA 1MCOH 2E3VA 4PV9A 3DROB 4CVWA 4WFHD 1QSEB 2B8OT 4MA1C 3ZT7A 4O4YH 1MHEA 4X6EA 4JM4L 5I71B 1CDYA 1G6RB 3IF1B 1TTFA 4RMSA 4RGNC 3D2UB 4YR6A 2FD6L 1AY1L 3VXUA 3LKQA 3Q3GB 3EYOB 5EH1A 4L9DA 5IQ9A 4R90L 4LP4A 3G5YB 4Y19D 4HIHA 3EO1B 2BP3A 4WY7H 4HC1H 4MJ2A 4WO4D 2CLRB 3TWCH 1P4LB 2FH8A 4GSDH 4RAUB 4U1JB 3C5ZD 1Z3GL 3WSQH 4HJGA 5FECB 4M62L 5C8JA 3TNMB 5BOZG 3QJFA 2B4CL 4LHUB 4DZ8A 4YK4B 1CFSB 4HUNB 5DXWA 3PWJA 5LGJB 1P4BH 3UTOA 4PJCB 4PG2C 1YYMH 4BK5A 4KK5C 3BKYH 5DJDA 3IDMA 3EDDA 1T1ZB 5ESVB 5EWIH 5GS1A 4IRSB 4XCFL 5I8CB 4L4VA 4EZMA 1I8MA 4F2MB 2EC9U 1NKRA 2DJUA 4XNYL 4Y5VA 1WTLA 1IVLA 1OAYH 5DEFB 3L3OA 3H8NA 2HJKA 1WGOA 4Y5YB 5HHOB 4X0KA 4NQCD 2ZUQC 3CH1A 3KPPB 3QULA 3K8KA 2J6EL 3FHQA 5CFHA 5IUSA 4YEEA 1SJEA 4OIIH 3WS3B 2D7OA 2H26A 1MLCA 3F12A 3CMOH 5E03A 5KVEH 1CZ8H 3DV6B 1FFOB 3SDCD 1L0YA 1ZT7A 1U8NB 3MX0A 4MCZB 4U7SA 1FNSH 4OFVA 5DR5H 3U0TB 4XPBH 5EIIA 2YPLB 3O6FD 1X5AA 3HZVA 3TYFA 3N9GH 3VU2A 4LSQH 4P4RA 3MO1B 1C5BL 2I27N 4JY6B 1GGTA 2CUHA 5HYEA 4J6RH 4LARH 4RFEB 1IM9D 5E4EB 3G6AA 3B9AA 5HPMA 2DQCL 2QHRH 4ODUA 2DKSA 1NBYA 2VUYA 1R3JA 5TJWK 1A6PA 5DRXB 4LEOB 4PJFB 2HMIC 5D72L 2OK0L 2ZKHL 3VD5A 4RMTA 5FA3A 1IRAY 1T21B 3IFNL 4R2GD 4RAHA 3MRQB 5I73B 2APTA 3TN0B 2VABB 3KR3L 5T1DH 2VLKA 3QJHB 4WHDA 2VL4A 1S9VA 4QO1A 4ETQA 4TQEH 3OKDA 4LQFL 4CJ0A 1RUAL 2VXVH 4GRWB 3STBA 1MFDH 1JK8A 2MSPA 3T4YB 1M71A 4HXAH 3D85A 2V5TA 2D9QB 2FHBA 3EZJB 2Z91B 3PP4L 1O7VA 2NY4D 5KSBB 1A64A 4TUJA 3BI9X 4Z5RA 2FR4B 1H5BC 1U41A 1KJMB 4M9OA 2DBJA 1KIUA 4HK0A 3UBXB 3HG1A 3DTXA 5FUZH 3ULSA 2R15A 4I77H 1JN6A 2KZWA 4DJMA 3GHEL 2CR3A 2YMXL 3HUJE 3QIUA 4I5BB 2AP2A 3G08A 4ZSOE 3STZA 3REVA 3SE3A 5LQBL 3GMMB 2MQ3A 4UUJA 3N50A 1BGXH 5EC1B 1R3IH 1UWXK 2R0WL 1JFQL 3HAEH 1I3VA 2XN9A 2CDGB 2G2RA 2VH5L 2B20A 5GRJL 4D8PA 3PNWB 3S96B 2HA1A 4HWNA 5IV2A 3P0YL 1EEYA 4LFHD 2DTMH 5F7EH 3UZEA 5EUOF 2C4XA 4OD1H 3FFCB 4O02L 1U6AH 1RQ5A 3V52L 3UJTL 1YYLH 3KPRB 4BH8B 1MRCH 3Q6FB 4FFWD 4WCYH 2AJXL 2A77L 2C3HA 3OXRA 5JZ7C 2W91A 5D71L 4XCEB 2EH7H 2FRGP 2FX8L 2VMFA 3PL6B 1F42A 5JR1L 4DKEL 4QOKE 2ED8A 4AJ0A 5ICYB 4UT6H 1OQXA 4QNPF 1TMCB 4I2XA 4QHNB 3PF2A 4FFZH 3TNNA 4JM2A 1MJUH 2DWEB 3I50H 4HPYH 2HVJB 3UTPD 1YEHH 4KVCH 1E27A 4R97C 4KDTA 1GIGL 2D9CA 3VXMB 4RGNB 2YD3A 2P7TA 4UT9H 4YHMH 5KSVB 1KYOJ 5T1KA 4PJGA 3PDOA 2O61B 5E56A 1P7QD 4EQ3A 2WINA 4PJCF 1OLLA 4KXZH 2GQHA 1LO0H 2EH8H 1AC0A 3WEXA 4Q97A 4KV5E 4NQED 2FJFB 1S7XB 4APQD 4DOHB 4PS4L 2B4CC 5DZLA 3MV7D 3EOYG 4LKXA 2GSGB 4TVPH 2XZCL 1OP3H 3UJJL 3BMVA 3QT2A 5ILTH 1C7TA 1A7RL 4MZ3A 1EGJL 5ETUB 1T04B 5DHVH 3F7YB 4ZO6A 1GPOH 2L0DA 2O5XL 4F7PB 2XQYK 3DRQB 2FYYA 3DUUA 4JZJC 3OKMB 4S1RH 1NMAH 3MBXH 4WENB 5TQ0L 3VWJD 2P8MB 2ESVE 2DL9A 4NO0D 2DQJL 1HIML 2ZUQB 1I3GH 5D7LE 3OAUH 2CUIA 5FCUL 3LHPH 1JPTH 3UROR 4E5XB 2R39A 1Q0YH 4RSVA 1A9EB 1ZA6A 5C0CA 3O6LL 1FSKC 2XQBL 1TCRA 2MOVA 4QXTA 1MREL 1KYOK 2X10A 1QRND 5ENWA 2ICCA 3LEVL 4HFUH 4PJFF 5IT2L 3MA7B 5IFJB 3MUZ1 2LU3A 5DJ8A 4JPVH 4R26H 3B4NA 5HXMA 4N0CC 4NWUL 2VDKL 2VQ1A 3LQZB 2E7HA 1W2KT 2VXQH 2XXMB 2VZ3A 3S35L 4IMKA 1DEEB 1MI5D 2DM7A 1NC4A 2G5BA 2A73A 1NPUA 1OM3L 4KQ4L 4WDIA 1I7RB 4GRWF 4RAVA 4OZHE 1RUML 2MWCA 1HXYB 2HLFC 4WFEE 2VL5A 4HLZH 2WUCL 5I0DA 1T0MA 3VFTB 2AXHA 3GJFB 3DVIA 4KKAC 1MLBA 1XR8B 2UUDK 3BIAX 3MUJA 43CAA 1YDPB 2FECL 3HPLA 1XF4B 1CE6A 1DBAH 3QPQD 4I3GA 3F7VB 3RKDC 1VFAB 4R4FH 1TVHB 2ZZUT 3HE6B 3U4EB 2ZCKL 3QUYA 3VXUD 5C08E 3ULVC 2CSPA 1Q9LA 5IW6B 3SDXA 3EBAA 2D31B 3TT1L 4AENA 1HCVA 2ZNXA 3DX7A 3MLXL 4HWZA 5HDQL 3MOAL 5IGXL 5IHLB 4HK3N 3D48R 1YEGL 4YLQT 3SDDC 4RNRA 4U1HA 4ZFZA 1H5BB 1RURL 4MNHA 1RZIA 4Q6YA 3U2SB 1YQVH 1CFQB 2YD4A 2V9QA 4LMQI 1DLHB 2X4OB 3K0WA 4HG4J 3DV4B 3WLWC 4WW2C 3AS3A 4ODTH 2CLVA 4RRPG 1FNFA 1GZPA 1UCTA 4HHAB 4JHWL 1DFBH 3MLRL 4NKIH 2UZXB 2EDLA 2JTDA 3O45B 5FUCC 4OZFB 4KC3B 4RMRA 4M4RA 4HKZA 4G6JH 1CDCA 4NNXA 5DD0L 5C0IB 4PY8I 1C8PA 4QCIB 5E1AA 1UH2A 2QR0A 5E6IC 1PYWB 2QSQA 3PQYE 3WIIH 5GSRA 3SCMC 2XNAB 4U49A 2G5RA 1BM3L 4MDIB 1EPFA 4M1DL 3S3PA 4B41A 3JV6B 4YXHL 4MNQE 3FO2A 4ZD3H 4UIKL 1HHHB 1UKTA 5C9JB 2GJ6E 3RQ3A 4WI8A 2ZUWA 4FQ1H 1JNNH 4XI5C 4F7TA 4JRWA 1D5ZA 4H8WH 3MYJB 3BJLA 2A6DA 3O2DA 3OR7B 5EC2A 3R06A 1DP0A 3PWNA 3IFOA 4HG4K 4P0DA 5D70H 3BH9B 5J57B 4EXKA 2NX5E 4JQXC 1QHOA 4R97B 3PGCB 5CJ5A 3C5JB 3QDJB 4HIJA 1QP1A 4NKMA 4UU9A 3UYRH 4DTGH 3K4AA 2IPUK 4ONHB 2BC4B 5DFVC 1R3LA 1QG3A 3VRLF 4YBQD 3C5ZB 2VLKD 4NCC1 5IQ7L 2KUTA 2Z31C 3BD5A 1ZGLP 3PWUA 5FO7A 3ARDC 3NVQA 4LEXH 4XWOC 4Z0XB 4M7JL 1ITBB 1Q72H 3NACH 4X98A 1MELA 4XAWL 3D85D 4I0KA 2FL5B 4FQ2L 2AJZA 5ID0A 1IT9L 1A6UH 4A6YB 2XRAL 1JJUA 3G6JB 4H5SB 4HFWA 1T03H 2FEEL 3HG1D 3ZHKA 2QSTA 3DUHA 3LV3A 1CTOA 4EUPH 1AE6L 3VXQA 4U05A 4ZYKA 1OGTA 4JO1H 4S0TD 3NZ8B 4X7SL 2FSEB 2FATH 4G8EA 3RY4A 3QIUD 3P4MB 4JZJB 1N3NA 4XTRD 4GW5B 1UEYA 1MEXH 2GFBA 3N1QC 4IHOB 4TTDD 2DLIA 1F3DJ 4U1IB 1A7QH 1ZVSA 2XN9D 3L7EA 1LO4H 4J2XA 3IS0X 2PW1A 2YHGA 3CFDA 1CQYA 1A8JH 3QQ9D 5JTWA 1C12B 4QXGH 3IFPA 2HTLD 1S5HB 4LPYA 3O2VH 2ID5A 1T1YB 3NIGF 5IB2B 3T04D 5JXAH 3OJVC 1RHFA 5DD6A 2BDNL 5F9JB 2D7TL 3OSKA 1BF8A 4XVJL 5ELIA 1UXSA 2AVGA 1NDMA 3QAZC 1C5DA 3BPCB 1FBIL 3BESR 3UTZB 4MVBC 5HGHA 3V6FA 2FBJL 5DVOA 4JFYB 1XH3B 3FRPA 1E4XL 2VTFA 1YPZB 4K8RD 2EDWA 2I07B 3CK0L 1DN0A 1LNUB 5JQ6H 5IF0A 3TA3D 5DLMH 1BECA 1QBAA 4JM2D 3ROLA 2JJUA 1OF2A 1MJ8H 2OMNA 3BDBA 2YRPA 3WE6B 3VFPA 1T0NA 4D3CH 1U8HB 5F7YC 1OSPH 4JEGB 2OSLA 4RA0C 3QQ4B 3O3DA 5HYQB 4U2YA 2NY2C 4WVRA 1IGJA 5IFHL 3BEWA 2VDMH 1XGUB 5T1KD 2XIDA 4DFIA 1OOAA 3S34H 4S2SA 4GRLC 2I9LB 4JKWA 2Y1VA 4UDTA 2FWOB 5DJCB 4ZFGL 1NEUA 5HD8C 4QRPB 2YK1H 1UQSB 7FABL 3VMNA 3RTQC 3SDDB 2EEDA 4LP5A 8FABB 3FB7A 3WDHA 3VFWA 4JAMA 1NLBL 2E27L 2A9MH 5K9JH 3GM8A 4JGJA 2NXZC 4YXLH 4HKBB 1KJ3L 4NUGH 4EI5A 4FQJL 1C16B 4TSCH 4XC1H 5E00A 4Z76A 5CMAA 3OAZH 4WW2B 3L5HA 1BQHG 4I0PA 3UAJD 3EO0A 1JHLH 3JUZA 5HTSA 1JYXA 3BO8B 5E6YA 1K4CA 1LD9B 3QIBA 4OD3L 3TPUA 5A2KH 2DLTA 4NFBA 2DS4A 5HHMB 5F1IB 1MWAA 1OTTC 3CPLA 4YBLC 4OTXH 3QYCA 1R24B 3FB5A 5GHWH 1WBZB 1ETZA 1H8NA 3V6BR 3WLBA 3OPZL 1S7SA 5F9OL 5E6IB 3BW9B 1KN4H 4M6MH 2GJZB 4H26A 1MJJB 1RVFL 3SCMB 3QDMA 5C0CD 1OP9A 1V7NL 3NBNA 3F5WA 4LIQE 5KZCB 1K2DB 4QLRA 1XZ0A 4M1GL 5C6TH 4O5LH 1OB1A 1U8JA 4F7CA 1FFNA 5FB8B 2OR8A 3P4OB 4GJTB 1VHPA 2XKUA 1QLFB 1MPAL 3MUY1 4UINH 4DGIH 4NN6C 3VJ6B 3CX5J 2F5AH 3GSNB 3LIZL 3AAZA 5SWSE 3MLVH 1NC4D 5M7QA 3UTQA 1FJ1A 2GK0B 4XNQA 3TZVC 3CVHL 3DVFA 4HH9A 4YDJA 3QUKB 1MAKA 5GSVB 1N4XH 4XC3H 3RZWA 3DVNA 4HCRL 3GMQB 2PYFB 3F7PC 5HSFA 2EICA 2KH2B 4ONGH 1ZLVK 3T2NL 3B6SA 5ITBL 4P99A 4M8QA 1NMBL 5IHUL 3D9AL 4JPIA 4Z0BH 1LDPL 3S5LA 3VXOB 1J10A 3QHZH 1MVUB 5GRZA 1M6OB 5TDOB 2FX9H 3G6JF 5GZNC 4OFIA 1DR9A 4YFLF 3SPVB 2Z31B 4BFIA 4JQIL 3MLTA 1CXFA 4NO2B 3WS6A 1CD1A 1IFHL 3MJ7A 5GGTA 1KCSH 3QUYD 3P9MB 3ARDB 5JDJA 1RJCA 2EEAA 4JFHD 1AQDB 3DX9B 1PZ5A 5BZDB 1ZHNB 3SGDI 4L3EA 3T65A 3GO1L 2YXFA 4HK3J 4AEFA 2JJWA 5J9PB 3VMOA 5JIHA 5D7IE 5IEHA 4BZ2L 1TQBC 4P2RA 4H25A 4KK8D 4LBEB 2VAAA 4LLDB 3CX5K 1QLEL 2CKBH 2LV4A 3HC3L 4KMLB 4HUVB 1EO7A 2YD1A 4G6FD 4X6CE 2ICES 1G0DA 4WFHE 2CXGA 5CUSH 1QSFE 3ARUA 1R0AH 2V7NB 4GOSA 5GGVH 1PG7L 5SX4I 4WW1B 3P40A 1QYGH 1KV3A 4JVWA 1E4KA 2CH8A 3QP3A 3U0PA 2BOCB 4X99A 2NW2A 4OLUL 1IKFH 5JQHC 1FLRL 1OD9A 4I9WD 5GJSL 1GYAA 1E4WL 5TDNA 4YJZL 4Y19E 1MI5B 4ODSH 43C9B 1WAAF 3QO1A 1HN1A 2R23B 3U9PH 1YPZF 5EULV 1AXSA 4Y16C 3MGOA 3X11B 1BEYH 2ZNWA 2NY7L 3QAZB 1XFPA 1FO0L 1RHHA 1KJVB 2CPCA 4U7MA 1S78C 5E70A 3BGMB 4ZFFB 3L3HB 5IFAL 2HFEB 3RAJH 1KB5A 4OCYL 3DRTB 4PUBL 4XCCL 1GJIA 3ULVF 4BSVB 1CK0L 3HB3C 1HQRA 1MF2H 2X4QA 3GKZA 1NANI 3WD5L 2QQQA 1KTDA 2JJSC 3HI1B 3GMOA 5IVZA 1A21A 5EU6B 2NY0D 4BSJA 1FVDB 1N59A 2JCCE 2N7AA 3GMLB 3W9DB 3GSUB 1T7WA 4ENED 2OS7A 4NQCE 4LVHC 5DC4B 5IJVB 5H37G 2APWA 3UO1H 2NY2B 1KCLA 1RY7B 4JO4L 3AROA 3F65A 2JB5L 5FKPA 4WW2F 4PJ8A 4QGTA 4L8SC 3WN5A 5IB5A 4NKQB 1IGYA 3CFJA 1NMCC 4WI6A 2XTJD 3K4DA 3OB0H 5EBLA 1AR2A 3HRZA 3K2MC 4U3HA 2JK5A 3RTQB 3KHQA 4NGHH 4OF7A 3FOLB 5FYKH 1SMOA 3EDFA 3QEQA 5BCAA 1LE9B 3LSOA 1TVDA 4WUUB 1J1PL 1T1WB 3DGGB 2NXZB 5B39B 3HR5B 5D2NE 4LCUA 3ILPB 3FCTB 1TLKA 1MCKA 3TO2A 1DQDL 1MHHB 2FIKB 2Q6WA 2G75A 5DK3A 4CU6A 5EOTB 1R6VA 4KI5C 2GAZA 2OJZH 5A3ID 1T2QH 1IAIL 3P73B 3U9UA 1HQ4B 1WWWX 4NT6B 1I7TB 1SJHA 4DK6A 3KYNA 3MCLL 4TUOB 5AYUL 4YBLB 1L7TL 1P4IH 2DLEA 1UM4L 1B2WL 2L4OA 4DZBA 1JWMA 5FGRA 4L4TE 4R7DB 4DW2L 4ELKA 4RWYL 3DOSA 4LGRB 4OCXH 5DDHA 3RGHA 3PWVB 4OZ4B 3OX8B 3UC0L 2H8PA 4UB0H 3TBSB 3HZKA 4LPTA 2P45B 3P2TA 3ARFA 3OKKB 1DE4B 1A9BB 3HI5L 3SKJH 3NGBC 1A0QH 1A6TA 2QADC 5DMIL 1FN4A 1N7MH 3U1SL 3RGVA 5JA8B 4PJAB 4NP4H 1J7VR 1HXMA 2BMKB 4F8TA 4NZTL 4F7EB 3WFCH 4NN6B 3QXDB 2KQNA 5D2LB 5EZLB 3QUZC 2F8VA 1F4YH 3AB0B 3IAPA 3TZVB 1GGIH 2VXUL 1VFBB 3RY6A 1F4WH 1HHJB 3BD3A 4JN2B 2MCPL 5B3NA 2Q76B 2RJMA 5HYJE 5HDBF 3LQAC 5FO9B 4J3TA 4MA3A 3PIQA 3KPLB 1JWSA 4TPRH 3O3AB 3IRPX 1WIOA 2CK0H 1DJSA 2DQIL 5MEQA 1FGVL 1YNLH 5ESAB 4QRQB 1JBJA 4P3DB 4CNIB 4GMSH 1UZ8A 5A16B 4RRPA 3IDJA 1YMME 1CGYA 3TYGL 1T2XA 3QRGL 2B0SL 2H32A 3EAKA 1IGIL 4PP1D 5F3BA 1JGDA 1GL4B 2A6IB 1NL0L 4HWEL 5IESH 4LNVA 1BLNB 1HHIA 5ANME 3DSFL 3ECBB 3IDGA 1RFDL 2DF3A 1LK3L 4AYFA 4EI5D 3H9HB 1TQBB 3AXLA 1KELH 4HH8A 2EKSA 4XBEL 3D6GA 3LH2L 1H0DB 1F00I 2Y36H 3HS0A 4I0PD 1YECH 1NAMH 3D0LB 1G7JA 1BREA 2RFXA 4KKNA 3ES6A 2W0FA 2VQUA 3UTPE 4ZPTA 3QIBD 1I1FA 4NSKA 4KUZL 2GYSA 2VE6B 3H6JA 4LIQL 5IBUB 4V2BA 1WCBA 4NZUL 5JMOC 4P46A 4PFEA 1CFNB 1BBJB 4QHLA 4KVNH 3MXWH 4OGXL 2PTTB 2LAAA 4LSSL 5E8NA 1AGDA 4J12A 1MAMH 4C57C 4POZC 4AIXA 3F8UB 3PHQB 1MIMH 2Y72A 1Q0XL 3CC5B 1MRDL 5E99H 1L7IL 5IW1B 4Y16B 4NHUA 3QDMD 1LQSR 2VISA 3GGWA 5EO0B 4NQVA 3MNVB 4NQEE 2BCKB 1N0XH 1YEDB 3TA3B 3RI5F 2R0KL 3H7LA 4IOIA 4Y4FC 4AM0B 2EDNA 3MV7E 5D5MA 4K7FA 5CGYD 4UMGA 4BQCA 1GHFH 1HDMB 4MS8D 2LVCA 4OGAD 4IBLT 1Z5LB 2HH0H 1AHWC 3L3JB 1CN4A 1ZTXH 2CDFB 2MNUA 3RVWD 3SN6N 1MJ7L 1EERB 3MREA 5GZOD 1RJYA 1T5XB 5FHAL 3ZTJG 4M6OH 1VFUA 1IKNC 1KC5L 2BRQA 2XPGB 4LVHB 4NRZB 1EEZB 4HX1B 1DTUA 1J11A 5GS0C 1DVFC 1JHTA 3L5WA 1VCAA 2ZJSL 2OTWB 4L8SB 5I17A 1BZ7A 5IM7A 4YX2L 4FABL 5E2VH 1GGBH 1QRNE 1CICC 3P77A 2VDRH 1HYSC 4GAJH 4JFFA 1HHGB 3AGVA 3FO0L 3NFNB 5JPMB 4G8GE 5HGDA 1A3LL 4L9LC 4J7RA 4JANA 4NWTL 4IRJA 1II4E 4FQXA 2IJ0C 4L3ED 1LP9E 4R4NC 1FDLL 2DM4A 3NCEB 3LN4A 1WFOA 4HQQL 4I18A 2H9GA 1A4JB 3ZTNH 4CADB 2FJGA 2IGFL 3QPXL 4GKZA 1NQBA 4Y1AB 4PJDB 1NGWA 4P2RD 3FQRA 3BQUB 4MJIE 3HC0A 5JUEH 4ZTPL 1QFPA 1M05B 2VZTA 3WJLA 2AI0H 3QEUB 1IZKA 2NZ9C 4PJAF 3WXWL 5H35A 1BBDL 4PR5A 4TRPL 2E7CA 5HHVH 5E08H 1B6UA 4K7PL 2CJUH 4YHPB 5D2LF 1MFNA 2YD5A 3U4AA 4F80A 5C0AA 5I2IB 1KEGH 3N85H 4PTTB 3BP4B 3UTSB 5E4IA 3NGBB 3SKOB 2QADB 3FQXB 2VOTA 4NKOA 3V0VB 3T77A 4DVBA 4HUWA 5AWNH 5IB4B 5K59E 1V8HA 3WDIA 2F53B 3EJJX 1W0YT 4KMTL 3IJYB 3CU7A 4NKDA 4BSWB 2IQAB 4J3WA 3ZT6A 2P5WA 3QUZB 2CIIA 4OF3A 1FPTL 4LPUA 3WFZA 2JELH 3C6LC 2ZUSA 3I9GL 1QPXA 5KSAC 3RVVC 5ITFA 6CGTA 4PGDB 1ND0A 4L4VE 1W72A 5EOQL 4X80H 1KBGH 1KPRA 3L1OH 3PJSB 4KJYA 3BH8A 4NBYB 1PQZB 1A1NB 1A47A 3EYQC 3HRPA 5SV4A 5CZKA 3CJJA 3MRJB 4K9EH 3DIFB 2G9HA 4KAQL 4OUUA 1D5BA 3CAFA 4PRBB 1L6ZA 1MFBL 2A0LC 5GGRA 1X5JA 3QEGH 4P5MA 5DJ0A 2D7MA 1TIUA 1BQHA 3GSRA 3OKLB 4UILH 3RU8L 4AG4H 4G6MH 4L29B 5E8PB 4ZS6C 5CEZD 1PW3A 4PJ8D 3SDYH 3VWKA 3T0EA 1OWWA 2X5PA 1HHKA 2SEBA 3Q5OA 4ZMAT 5KJRL 4HZLB 1FV1A 4K2UL 3BZFA 5ID1B 1YEIH 3EOAB 4X4YB 2FX7H 2AK1H 5JO5A 1ZK9A 4Y4HC 5E1HB 5EA0L 5EU5A 4PRHB 4LLMB 4PREA 5T1LA 4DN4H 5B8CA 1P1ZA 2C4FT 3RVUC 1JZ6A 5HGGS 5D7JA 4Y5XC 1XIWA 2ADIA 4GBXC 1X44A 4XP6L 4MWFB 3H0TB 2NCMA 3IVKB 1U95A 4QTIL 5BMFL 4QRTB 3W2DH 2ZWLT 3ARBC 5LGHL 1K8DA 4NHCL 3EZ8A 5TDPB 4W4OC 4UT7H 2CIKA 3IGAB 2X9XA 1NAKH 3DBXB 1MCHA 1SYVA 4EKXA 2F58H 4YGVB 1OAUL 1DZBA 1NDGA 4TOYL 3N06B 1JRHL 1MCBA 5FDWB 3W11C 1BJ8A 3DSNA 1FZKA 2A38A 2DLHA 3GSWB 4EN3D 3QWRA 3AU1B 15C8H 3ARFD 1NANH 3U30C 3T1WA 3VGFA 4BZYA 1ZLSH 3BP6A 3QHFH 3QUMH 5I76A 3MLYL 4XBGB 1N5YH 3T8XA 5I1AA 4Y4FB 1MCLA 3C8KA 4IDLA 2EZ0C 1AJ7H 2ZOKA 3BKCL 4U1NB 4LLVB 2NLJB 3WYRA 1HZHH 4RGMC 3P4NA 2Y07H 3IDNB 3QSKB 2DYPA 3VXRE 5BOPA 1MCNA 1VFMA 5KVFH 3IDIB 4TNWK 3ULUH 1RZGA 1AHWB 3EGSA 4U6XA 1UACH 3EKCA 1M7DB 1EHNA 2DQTL 3SE8L 1NUFA 2ZUYA 2NY6C 3M07A 3VXTB 4GW1A 2XN9E 4YDKL 2Q8BH 2OL3H 1WITA 4W81A 1CGTA 1DVFB 5DK2A 3QXUA 4WJ5B 3IDXH 1J8HB 4M5ZH 2X4UA 4Q9BA 1PLGH 5HGAB 4PRNA 4KI5F 4G7VL 3LY6A 4LF3A 4PJDF 3GSXB 4P2QB 4OF8A 2YEZA 4L9LB 1WV7T 3MMEA 4OZGB 4XCYB 4DN3H 3GMNB 3OZ9H 1DL7H 1JTTA 2B2XL 2YRZA 3E2HC 2EE3A 1MCRA 2ICWB 3ZDZF 4LAQL 1LO2H 3MRKA 4ZDHB 4J4PC 4YPGA 3X13B 3QG7H 1ZA3B 3GMPB 1KACB 4NNPL 4OUOA 1DUZB 4LCWA 1UA6L 3QQ3B 4I2XE 4P3CH 1RZ7H 4NUJB 4KKBD 4P57A 2C7UB 1FNGB 2WV3A 4LCCC 1MNUL 4I4WA 4U6VL 4L5FH 1S7TA 5F1NA 2V5MA 3DURB 4NFDA 3S36H 2X4NA 1NBVH 4JLRB 1KJ2H 3FB8B 3VXSA 2FGWH 3VE0B 3UYPA 3BT2H 4PJGE 3A0OA 3I02B 4OLVL 5ISZE 3O4OC 3GSOB 2BXZA 1JE6A 4AEIH 3FO1A 5EIQA 4OV5A 1KLGB 4YUEL 5DRWB 5LWYH 2F19L 5I18L 3UPRA 1K5NB 5E9DD 4F15C 2RGSA 2AK4D 2EIBA 3BUYB 4F3FA 4XWGH 1J1XH 1WBYA 3WKMH 3TJEL 5J89A 4M7LH 1OARH 2JIXA 4MNGA 3B9KD 1G1CA 4LKCB 1JPGB 1WWCA 1EAJA 3C6LB 1JGVL 2YPVL 2EC8A 4D0CB 5CHNB 5KSAB 2BNQB 1FC2D 3QBTB 1CDHA 4JVUA 2A6JA 1TJGH 3ZL4L 3ARPA 3P0VL 3H42H 3H3PH 5IIEA 4X7CC 3C2AL 5J56B 4NPYB 3K2UH 5IMMB 4EVNA 1YMHA 4HKXA 5DSCB 4PJ7A 1KNOB 1JV5A 3MGTB 1EBAA 5C0CE 1WIPA 2NTFA 3GSQB 5IB3A 3X3GL 3KHOA 3O8XA 3IS1X 1VB9A 2J6EA 4ZUTA 2FGZA 2WAHA 4WGVB 1JF5A 3NIDF 3FTGA 3CDCA 2HT2D 4KPHL 2HT4C 1YEFL 4JFFD 4JO3L 4YHZH 3ZKNC 5C9KA 5F9AC 3QCUL 2I60L 5FGBA 1EUTA 1FNLA 4KH2A 5INCA 5JPNA 1T66C 4IRJD 4FQXD 3O6KL 4LSUH 1U3HC 5LXGH 5IBLD 1I7UB 1UT9A 3LS4L 3D69A 3PGFL 1GAFL 1BD2B 2ADFH 5J8OA 4Y5XB 4GBXB 3MR9B 4KHXL 4U6TA 3TCLA 1D9KA 1EV2E 1A2YA 1OTSD 2V17L 4FQHB 3H3BC 4ZFOB 3K8LA 2CD0A 5EU7E 1B90A 1MQKH 1UM5L 3MODL 5CKGA 3W0WB 1I3RB 5DS8A 4CMMB 2WLZA 3ARBB 5I1EL 1KT2B 3V6OC 1URLA 4IS6A 1I9IL 4LCIH 2VDOL 1FZMA 4LHUG 5BO1H 4XPTL 5T5NF 5DI8A 2K7PA 4O9HL 5D7SL 4QF1A 4N5EC 5FOJA 4YHIB 1RD6A 2HFFA 5GGSA 3SDXE 5C0AD 4TVPD 3U4BH 3U30B 1S7WB 4FQCL 3RWEA 2J8UA 1P9MC 1NKOA 2HKHH 5DJAB 2HWZH 4OGYH 3T1FB 4U1KB 1FFRA 3DXAD 1NCUA 5H2BB 4JFEA 1NGZB 2Q7NA 3SJVA 4MSWA 3DNKA 4RGMB 4Z7WB 5HYFA 3MRMB 3SBWA 3CZFB 3GRWH 2VITA 4OB5L 3N1MC 1KIQB 3AY4A 4L8CB 2VLJA 4S1DC 2P5WD 5C0FA 4NZRL 2MKLC 3O11A 4X6DA 2YA0A 3CUPB 5FGCE 1KULA 2EXWC 1AKJB 4IDJH 1S7VB 4AEHH 2FECI 2DDQH 1J0ZA 1U58A 1BF2A 2NY6B 3BDYL 5IVOA 5TGBA 5FO8A 1IAOA 1ZV5A 4OZGF 1XGYL 4XPAL 2VIRB 1WFTA 1AGFA 1CU4L 4XXCC 3T2PA 1F90L 3D39A 4P59L 3BP7B 4MAYC 4I9WE 2DD8H 2CDEA 3SDAC 1RIUH 5D7IB 5DO2D 3BRDA 5JHDA 3BIKA 1C08B 1Q9OB 3IJHA 4KK6C 3QO0A 2VC2H 4XP9H 4LLQB 5DJYB 4CU8A 1FZJB 3O0RH 4M7ZC 2ZCLL 4X6CB 3VWKD 2WIMA 3T0ED 4M6NH 3GBNL 3E2HB 2X70B 3D3VA 4YDIL 1PY4A 1MFAL 4LOUC 4KTDH 4O2FB 3J7HA 2AV1B 3NA9H 5GRXG 3I2CH 1A3QA 4R7NA 3CFEB 2IAMA 5DA0B 1EHAA 3E1F1 5EIVA 5TE4H 1LHZA 4H1LG 3LZFH 3W39A 5T1LD 3I75B 3QA3B 3SY0B 4BZ1L 4PG9B 3QDGA 3MRCA 3MZGB 5D7JD 4M43H 2XA8L 3RVXD 3S37L 1XIWD 3VH8B 1JPST 1MUJA 3RNKB 4K7PY 1B0WA 3LN9A 4WI5A 5I30L 2HFGL 5C0JB 3D0VB 3EHBC 2IFGA 4AL8H 3T4AB 1B0GB 1NCAH 3DHJA 4H88L 5ADPH 4DCQB 2K7QA 1J5OH 3BPOC 2ZG1A 3DUSB 3O4OB 4WIQA 5IMKB 3DMMD 3G6DH 3MRBA 4K3GA 3WKNA 2XTJE 4PRDA 4UOJA 2PUQT 1BVLB 1I9JL 4KZEL 3VCLB 1CDJA 1X5XA 2XWBB 1VGEL 4DQOL 4JM4H 3OKYA 3QWRD 3S88L 4LK4A 1ADQA 2A9NL 2XXCB 2JCCB 4XBPA 1SYSB 2FD6H 5CEYA 1AY1H 3SE9L 2WUBH 3CFIC 3FB6B 2I25N 1DBML 3M1BA 1XF2B 4PLKC 1TETL 5IP4A 1N64H 1P7KB 4LNRB 2DIBA 4R90H 2B5IC 5DJ2A 1QOKA 1VACB 2OI9C 4YHLL 4OLYL 2DYPD 3R4DA 4C56D 3OB0K 3E3QE 1AGCB 1Z3GH 1EGJA 4M62H 1T3FB 2B4CH 4ORGB 5F7MC 3TEUA 1WLHA 3Q2CA 3NMEA 2BK8A 4A6YH 1RZ8B 3BKML 1NC2A 3VGHA 2J1KA 4PRPA 5L9DL 4HKJB 5A2FA 1A6AB 4XCFH 4ZNCD 1BPVA 1QEWA 4XP4L 5E2JA 3L5IA 3MJ9H 4YIQB 4O51A 1Q8MA 4XNYH 5IVXB 3X14B 1A7BA 1NBQA 2A6KB 2X40A 3OMZA 4K8RL 2NR6D 2ARWA 1IAKA 2AQ2A 1A1MA 3B9DA 5KW9H 1IGMH 2PF6A 5L7XL 1S7QA 2R2EA 2FEEI 1EJ6A 3GJEB 1ACYL 5TQ2L 4E41B 1U3HB 4NQUA 3DETC 4WU7A 5HHPB 1DCLA 2BVPB 2H3NB 5BS0B 5KS9B 1KIRB 4PJXB 1F2XK 3H9YA 5SWZB 3TO4C 2PYEB 5EZJA 1K6QL 5JW4N 1C5CL 3BEVB 3I6KB 2AKRB 1U8LA 4BQ6A 1LE5B 1TZHA 4LCWD 1G7MA 4P9HC 1AD0A 4L8BB 4EN3B 3MFFA 3LVEA 2QEJA 1C5BH 2ENYA 4KZDL 2AGJL 1ZKAA 2DQCH 4XNXL 5KVDH 1D7FA 2VZSA 2YBRB 4Z7WF 2ADJB 1JP5A 1U8IB 2ICEB 3VXSD 4I48B 5D72H 2ZKHH 2OK0H 2VZOA 4U1SA 1AO7D 3TBYA 4XCNA 5B38B 2RCSL 4MQ7B 3IFNH 3RIAK 4EXPX 5I9QC 3JV5A 3C6SA 2V2XB 3WIFB 5HYJB 1A7NH 1CFBA 1UWEL 5D6CA 5DJXA 4HAFA 3ZDYE 4LQFH 1D5XA 5L2KA 1RUAH 1R5IB 4UIMA 1FIGL 4YHKH 5D1QA 4JKKA 3KXFA 1XF5A 1A6ZA 1OGAB 2YC1A 2FZ3A 1TZGL 3RL2B 2JIXD 4AIOA 4ZUWB 1ZHKA 1YMMB 4XVSL 3PP4H 3ZE0E 1HH6A 5CIPH 1OTUD 3WFDL 1T83A 4RISL 3ZE1E 3VFNB 5L2JB 3RWIB 5BQ7B 2FO4A 4HJ0D 3AFLA 4GG6A 3C60C 4MAYB 3GHEH 2YMXH 3KYKH 3SDAB 3NN8A 1DQML 5HI5C 2ARJB 3HNVH 5LQBH 5IHZB 2W9EL 2R0WH 1JFQH 4M7ZB 3B5GA 3B2VL 3QDME 4LQ1A 2VH5H 2BFVL 3O8XD 5GRJH 1CGXA 3AREA 3V9FA 2IPKA 2F54A 4ZNEA 3MXVH 2DI9A 5EPMA 5A2LH 3P0YH 5DUBB 4RMQA 2EYTA 3WHXB 2E7LC 1P2CA 3EYVB 4HGWA 3VFUA 4O02H 1TFHA 5H8DA 3KNBB 3V52H 1MFCL 2J2ZA 4JY5L 3MOBH 5DJ6A 3UJTH 1MCPH 4QHMB 1RIHL 4LDEB 2X7LA 4HW6A 1CLYH 4MLSA 5DMKB 2DQFB 1RULL 2OXHA 2AJXH 4UQ2B 2A77H 5MEPA 4J3XA 5L6YL 4OLXL 3PDGA 1D9KD 5D71H 4WI2A 1U8MA 2V2TA 4X6BB 2FX8H 2H2PC 4Z7NE 4EQ2A 3LEYL 4PRIA 2D0HA 5E9DB 1QPPA 3KYMA 5JR1H 4DKEH 3RWGA 3UYOD 3BPOB 2B1HL 1OAKL 1V5JA 2AK4B 2WANA 3QR2A 1I8IA 4R0LC 4X6FB 3HAEB 5E5MA 5F9WC 1BVKA 4QHKI 3B9KB 5I66A 2R9HD 5F9DC 1GIGH 2AAVA 1JZ5A 3QXWA 3QRFM 4TSAL 1EO5A 4QY8B 1D5MA 5FYJE 3RVTD 4CVZA 4L3EE 5HHNB 5E8EB 3FOMA 4CVXA 4AT6B 4QRSA 2GCYA 2WP3T 4ONFL 3SE4C 3BXNB 4DUXA 3HI6L 3JVGA 1XF1A 1I1YB 4JFED 5AAMA 3BZEA 3M8OL 2R1XB 5F7WC 3SJVD 3ZTJH 3RFZC 5JOPD 2OI9B 2MQ0A 2D03H 1C7SA 2IMNA 1YEKH 4KKCC 5DQJB 1BOYA 4P2RE 4R6UA 2VLJD 4LLYB 3O4LA 3QFJB 1RJZA 5IVXF 1RUPL 4G7YL 3CDGA 5IOPB 5F6HI 1UB5B 4YE4H 1HILB 1Y6NR 4G8GB 4BUHA 4G42B 4PS4H 1CFTA 1INEL 1N2RA 4LSPL 4PJ5A 4XAKD 1QFWM 4PGEB 2XZCH 4F9PA 1T7VA 3SOBL 2NTSP 3UJJH 3RWFB 3RL1A 3W9EA 3MLPA 2X4RA 1XGPA 4X5XA 1F11A 1A7RH 3QXAA 4XZUA 4Z7OF 1LEKB 2WW8A 5KS9F 4ODHL 2GTZB 2O5XH 4PJXF 1IGCL 4MB5A 3ZHLA 2VXTH 4HUXB 5JHDD 1GC1L 2JE8A 5TQ0H 4D0BB 3V4PL 4HGMA 3VFMA 3O2DL 3FN0L 3F58L 4MJIB 5CINL 5DRZB 1HIMH 3RWJB 3EIFA 5FCUH 2BY3A 2HFTA 5HPOA 4FG6D 1OCWL 1GCFA 2MFNA 1M1SA 1OAXL 3D3VD 3RKPA 4XXDB 3O6LH 1FCCA 2XQBH 1FL5A 1YN6B 1MREH 4M8VA 5AG8A 3B3IA 2ITCA 2VR9A 3RWHB 4LPXA 3TO4B 3OJMB 5AZEL 2V5RA 4X7DC 4NWUH 1CWVA 2VDKH 4JZOB 4IMLA 3V79C 3QDGD 2BHUA 1HYRC 5L88L 4L4JA 3S35H 4KJPC 4ELMB 4N0UA 3ETBF 4JDVB 4XP1L 5EO1B 2IEPA 1OM3H 4KQ4H 3U7AA 3MA9L 2X4PA 3PWPA 1KCRL 5DHVB 3QEHB 2W9DL 5F7UA 1RUMH 3DXAB 3OR6A 2OTUA 1KB9J 1AH1A 5JW5B 3ZKMC 2VDQH 2WUCH 3IAGC 5MERB 1HI6B 4GH7B 5CEZE 4PTUB 1ZLWH 1ZHBA 4J3SA 5I9QB 1WBXA 2P46B 4ZXBC 2AJSL 4K94L 1RPQA 2BSTA 3CLEL 4PY7A 2IFFL 3T3PF 4GXVL 4UOW0 2EC9T 1V3KA 3KPOB 3QEQE 5F3HA 3O9WA 1UZ6F 1UB6A 2MMXA 2EIZA 4CKVX 1JF1A 3MJ6A 2XV6B 4FXGB 4PJIB 5HDQH 1IC7L 3MOAH 5IGXH 4OM1H 2BHYA 2ED9A 4LASL 5EUOA 4XT1C 4D0DA 4NFCA 4GQ9H 4Z95L 4PPTA 3P4LA 3WBDA 5D93B 2Z8WC 4ZUVA 3SGEI 4WNQB 3L3KA 1RURH 1NJ9B 4IIQB 2F15A 2FCBA 3DROA 1WFNA 4EI6B 1QSEA 3CZJA 3T2OA 2WP3O 2HRLA 3C60B 5DMGD 3KLDA 1G6RA 1ZOXA 3FN9A 3IF1A 3D2UA 1NC2D 3MLRH 4IMKC 4PRPD 3S36X 3MRRB 5EN2B 2C3XA 3Q3GA 3EYOA 5DURD 5MHSD 3ILQC 3G5YA 4WEBL 3EO1A 2I24N 1S7UB 1FGNL 3T0BA 3BAEL 5DD0H 3O41B 1CXEA 3QH3B 3DLQR 5EU7C 2CLRA 1NCTA 2Y23A 1P4LA 4JG0L 3EYSL 4RAUA 4U1JA 1GXEA 5FECA 1I1AC 3TNMA 4LHUA 1CFSA 1BM3H 4PGZA 5LGJA 3O3EB 1IEAB 4PJCA 4M1DH 4JCLA 5C0EB 4P2CG 3SO3C 5ESVA 1T1ZA 5JDSB 3DMMB 4IRSA 4M3KB 4YXHH 3L5JA 4BFGA 5I8CA 4UIKH 4YHNB 3ALPA 5IKCB 4F2MA 3ZSTA 1IQDB 2IANB 4GQPH 2WBKA 2XWJB 5DEFA 3NFPB 3HPJB 4Y5YA 4PJBB 5HHOA 5I1GL 5H94B 3VXRB 4R0LB 3KPPA 3STLB 1WF5A 2HTKC 5F9WB 4PJHB 3WS3A 4LFHG 3DV6A 4C56B 1FFOA 4ZTOL 1UWGL 5GXBB 1HEZB 1U8NA 2FHCA 4MCZA 4NC1E 1FE8L 3U0TA 1NEZB 4UDUB 2YPLA 4FNLL 5FA4B 5IQ7H 5I0ZA 1A3RH 4I3SL 5L2KD 1GVIA 3JWOL 4X9GA 3MO1A 1PY9A 3QUXC 1I8LC 5BV7L 4JY6A 3KDMB 5D1QD 3EJYC 4RFEA 4M7JH 4N8VG 4G6KL 4FQ2H 1A7OL 1JPSL 5DRXA 4LEOA 4ZUSB 4PJFA 1IT9H 5JXEA 3V7AG 4MQXC 2XRAH 1S9WB 2PTVA 4YHYC 4HXBL 4GKNB 1T21A 4FMFA 1EFXB 4LSRL 2DQHL 5ICZB 3MRQA 1AE6H 3TN0A 5JLZB 2VABA 4X7SH 1WT5A 5AZ2H 5CS7A 3QJHA 1K3IA 2NNAB 1CGUA 3QG6B 4JRXB 1GC1C 4L3CB 4Z7VB 4ZO9A 3ZYIA 3VRJB 1HNFA 3T4YA 1VDGA 3UTTD 3JZ7A 4MDJB 4QKXB 1PSKH 2Z91A 3MRNB 3ARED 5KSBA 2F54D 4P23C 4ENEC 4ELMF 4HMDA 2FR4A 5LG1A 2WBJC 1KJMA 3H3KA 3S98A 5D5ME 1PJ9A 3UBXA 2J8HA 5ISZB 4RFOL 3V5KB 1ZT1B 2BDNH 3DECA 1JVKA 2H1PH 2D7TH 4GRMB 1QTYT 4XVJH 2WM0A 2ZOLB 4I5BA 3UP1A 2J7LA 5GGTL 4YFEA 1BJ1H 3GMMA 4X5WB 1AO7B 1RAMA 1FBIH 5EC1A 1EXUB 1OPGL 2FBJH 2CDGA 4EUPB 5CP7B 4PRID 3PNWA 3S96A 1ZS8B 4PJIF 1E4XH 1FLTX 2PXYC 3CK0H 3EO9L 1ZGLB 4MA7H 5CWSB 2AQ3A 3ROOB 1P7HL 3FFCA 1X6LA 4GAFB 4K94C 4ZXBB 3O2WL 3VW3L 3TH3T 1JNHB 3KPRA 4YEFA 4BH8A 3Q6FA 4C55A 1GRWA 1QNZL 5IFHH 3CFKB 3KPSE 3EFFB 4XCEA 4J1UB 4PB9L 4XPFL 3UDWA 5J7CC 2P43B 3NIFF 4ZFGH 1YY9D 3PL6A 1WJ3A 1J0HA 2FHFA 2R8SH 3E6HB 5ICYA 1CLOL 1NLBH 5F6IC 2E27H 5HHXL 3O4LD 4QHNA 4BK4A 2JLLA 5ACMA 5SX5K 2DWEA 1OY3B 2HVJA 3S4SB 4FQJH 5GISL 4X4XB 1KTRL 1B4JL 2J3SA 4PJ5D 5KVGL 3I3DA 5C7XL 3VXMA 3WUWG 2W9LA 4MXWL 4M93C 2V2WB 2UZYB 5KSVA 3BHBB 4OD3H 1FYTB 1KXVC 2O61A 3WHE1 3N1PC 5C0AE 12E8L 1KB5L 5C2UB 4C83B 4JPWL 2BSED 1CI5A 3NA4A 2FBOJ 3QIWC 3MV11 4X9IA 3OPZH 4JVPA 1TITA 5C0DB 2FJFA 1I1AB 1S7XA 3QNXB 4PJBF 2P8LB 1JZ2A 2P5WE 2GSGA 3V4VH 5EORL 1V7NH 4PG2A 3SO3B 4PJHF 4M1GH 4DVRL 5ETUA 5CEZL 1T04A 5AYQA 1TVBB 3PUCA 1FRGL 4PJEB 5J13C 4CDGC 3F7YA 4XMKL 3N1FC 4F7PA 5DWUL 3UPAA 2C3WA 1FFPB 3DRQA 1MPAH 3OKMA 3OG6B 2P8MA 5IK3B 3LIZH 2NMSA 5KVMC 4WHCA 4AMKL 4CVUA 5DGQA 1GOFA 4PBVC 5E7BA 3CVHH 3HMXA 3PWPD 4HWUA 4E5XA 2HLAB 4HCRH 1A9EA 4IRZL 1UM6L 3T2NH 4TTGA 1EJOL 1NMBH 5IHUH 3D9AH 3T0EE 3GUTB 1LDPH 2EDHA 1UENA 4YFLI 3MLUL 2QV2A 4J8RB 5JHLH 3FZUC 2VUOA 3MA7A 5IFJA 3GBMH 1G7PB 4OLZL 3EYFB 3KPMB 3LQZA 4JQIH 3ZDXE 1IFHH 3QFDB 3QUXB 1DEEA 4JQVC 4K3EL 2LU7A 2DQEL 2OLDA 2ZSWB 4JFZL 3WSQL 4Z7VF 1I7RA 5MENE 3GO1H 1PAMA 1HXYA 4QYOB 2NYYD 3FRUB 3QXVA 1P4BL 3VFTA 2J4WL 4YHYB 3GJFA 1DSFL 3MRFB 2F8XC 3VGBA 3HE7C 1XR8A 1PEZA 1YDPA 1QSED 1F4AA 1XF4A 1CXLA 3F7VA 4FHBD 2EXYC 1VFAA 1TVHA 1OAYL 1QLEH 3HC3H 1AFVL 3HE6A 3D2UD 3U4EA 3TIDB 3WDJA 3JWDL 4HS8L 5IW6A 2D31A 1BWMA 1ZWIB 5FIEA 4H1LH 2UWEB 2QQKL 5CD5C 4P23B 3BIBX 4OLUH 2IF7A 1H5BA 1FLRH 2WBJB 1S5IH 2GUOB 5GJSH 4OCNC 1E4WH 3U2SA 4X83A 1CFQA 1DLHA 5HY9B 2X4OA 5IB1B 4JFQB 4JFDB 4LHUD 4GG8B 4M00A 4WHTB 3DV4A 2M8XA 1CBVL 3LPWA 3AM8C 3VGGA 1BFTA 5I8OL 4D9LL 2NY7H 4HHAA 4U6YB 1FO0H 4J6RL 4CAGA 3O3BB 4IRSD 4FZ8L 3NTCL 3KLHD 3O45A 4FTVB 5IFAH 4OZFA 1WWAX 3O6ML 4OCYH 3CSGA 4PUBH 4XCCH 4F57L 3OJDB 5C0IA 5F89B 1CK0H 1JRHI 2PXYB 2CKBB 4LLUB 5GGVY 1I3UA 5HHOD 1LEIB 2A74B 4QCIA 1J0JA 4OI9A 2OJEB 1WTGT 4OD2B 1N26A 1PYWA 5CJOL 3MZTA 4AIZB 3SGEH 2XNAA 4TQEL 4MDIA 4JN1L 3VFSB 1BIIB 1FVEB 4JO4H 2EYSB 3JV6A 3MV01 5GS0H 5EBMB 4JR9L 3BVNB 1HHHA 2YPLD 5C9JA 3BYTA 2Y06L 3MYJA 1ITCA 3OR7A 5I1CH 5F6IB 5HYSB 5FUZL 2VN4A 4LCWE 1J1PH 1QRKA 4K71C 5C0ND 3T08A 2PO6C 25C8L 5JXED 3BH9A 3PGCA 1FAIL 1NFDB 3CFBB 3PXHA 3C5JA 3QDJA 1G7IB 4M93B 1Q9WB 3LKOB 3UXFA 2XZQH 4ONHA 1MAJA 4GLRH 2BC4A 3VXSE 2VDNL 3TN0D 1IAIH 1U3ZA 2FB4L 3CCHB 3C5ZA 1RUQL 3MCLH 5AYUH 1L7TH 1UM4H 1B2WH 3QIWB 4DW2H 4PJEF 3L3DB 4RWYH 3OKEB 4Z0XA 3ULUD 35C8L 3UC0H 2FL5A 1DLFL 1KOAA 3A6OA 4A6YA 3G6JA 4H5SA 3HI5H 4KK9D 4MNGE 1YEEH 2BSSB 2I5YL 1J9CT 3IJSB 4KKLD 3GKWL 2DICA 2NXYC 5DMIH 1L0XA 1WIUA 3U1SH 3MJ9A 5J13B 3NZ8A 5DUMH 2FSEA 4NZTH 5INDB 3P4MA 3GM0A 4GXUM 5IWLC 1IJ9A 4JZJA 3OJ2C 4GW5A 1FG2B 1VKXB 4IHOA 4Y2OA 4U1IA 1O7SA 4MXQD 1KGCE 4FOMA 3JTTB 2ERJB 2VXUH 3DX6B 4P2YA 4O00A 4PJ7E 4WI9A 4R4BB 2IH3B 1C12A 3VI4F 5J1AB 4UT9L 1S5HA 1T1YA 5I1HL 5IB2A 3FFCD 3LKNB 4YDLB 2W59A 1SVCP 4MZ2A 5F9JA 2CUMA 4HDIB 2QBWA 1BWWA 3KPRD 3SEPA 1ZHLB 1FGVH 1HCFX 1CCZA 3BPCA 2I9TB 4TYUA 4G6AC 5JIKA 3IAQA 2X1PA 3RPIB 1NCWL 3UTZA 3B43A 4YZFF 3FQNB 3WIHH 4JFYA 3QRGH 5DVMA 2B0SH 2CMRL 1XH3A 3PL6D 3NFSL 3IYLW 1IGIH 4UZGA 1WAAA 4ETYA 4TVPL 1NL0H 1WZ1L 1YPZA 2I07A 1LNUA 5ACZB 3MLZL 5F70A 4M6AA 4HIXL 2UWEF 1OWRM 1VPOL 5EZIL 3HE7B 1RFDH 3WNKA 1LK3H 3UTTB 3RGVC 4NQXB 4MMZC 4M61B 3WE6A 1EAPB 3WFBH 3LH2H 3VFGL 3S35X 3KWWB 1U8HA 4GKSB 4S1RL 3VXMD 3B9EA 3SKMB 4RGND 4OLWL 3QQ4A 5KAQF 4D9RD 3JWDC 5HYQA 1SBBA 5ALCL 1A14L 1XGUA 2XQYG 5F7DB 3LD8C 4KUZH 4LPVA 4LIQH 2I9LA 4NZUH 3RY6C 4LRNH 2FWOA 5DJCA 4GAGL 2J8UE 4QRPA 1UQSA 2EDYA 3WXVL 4K9EC 2WQ8A 4OGXH 2HYMA 3SDDA 1W72L 8FABA 4YHOL 1FORL 2OYPA 4JO2L 3MRHB 4UQ3B 2NY5L 4HKBA 2CO7B 4JPVL 4JHAL 1C16A 1Q0XH 1MRDH 3MV9B 1BJMA 3V2AR 2VLJE 4WW2A 2YZ1A 2DAVA 4X6DE 2CKNA 2J5LC 4KK5D 3BO8A 1LD9A 2Y5TB 3QNYB 2R0KH 4G9FB 2E8ZA 5F1IA 3BP5B 1HINH 4B0MM 4NC1C 1R24A 2VLRD 4MGXA 4HJJL 3D39E 5CJ8A 1AIFB 1A22B 1NAMB 1WBZA 4W68A 4OM0L 3NH7L 1XGRB 3EOTL 1MJ7H 5E6IA 3BW9A 1H8OA 1RZKL 2GJZA 4EDXB 1MJJA 1ZLUH 4LAJH 4NQDD 3SCMA 5FHAH 5BXFB 3V0WL 3I6GB 5CZXC 1KC5H 2AJVL 5BJTB 2UVEA 1K2DA 2C26A 2XKSA 1OT2A 2ZJSH 5J6HB 4OZIE 1NFDF 2XG4A 4P46C 4YX2H 5FB8A 3P4OA 2R2CA 4FABH 3I6LD 3BDXA 1QLFA 3MRLB 3VJ6A 2YWZA 1QZ1A 3FONB 4RMWA 3GSNA 1W0VB 5F96L 3FAXA 2ATKB 1YQVL 1D3CA 1I85C 5C70A 1A3LH 3RPKA 2GK0A 4JZNB 4K71B 3QDGE 4WI4A 1QFWL 3QUKA 4O2EB 5GSVA 3TLRA