5E03A

Crystal structure of mouse ctla-4 nanobody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
VQLVESGGGLAQPGGSLRLSCAASGSTISSVAVGWYRQTPGNQREWVATSSTSSTTATYADSVKGRFTISRDNAKNTIYLQMNSLKPEDTAVYYCKTGLTNWGRGTQVTVSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CTLA-4 nanobody
publication title Crystal structure of mouse CTLA-4 nanobody
rcsb
source organism Camelidae
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e03A00
1WT5A 3MROB 2NY6D 1Y18B 5EO9A 4YWGL 1FBIL 2R1YB 5EC1B 1YEGL 4NC1C 4L9DA 3BT2L 1FNFA 4YDVA 2ATPB 3B2UC 2GI7A 1CR9H 5AZ2L 1LEGB 3MA7B 5F3BB 1MEXL 2H2PC 2P8MA 3BPOC 4J8RA 3GRWH 2YA2A 4U1SA 4TNVK 5EORL 2AI0L 5ADPH 1GIGH 3K1DA 4UNTA 3H42L 4R4BA 4XCEA 2RIKA 3U30C 1YY9D 1AY1H 1LEIB 3BGFB 5A2KH 1P5UA 1X5YA 4QHLB 4EQ3A 3B2UD 2C3VB 1RUQL 2B0SH 5MEOA 4J1UA 4Z95L 2JCCA 3UAJC 1KIQB 1MHCB 4Q9CA 1BX2B 4FZEL 5ISZB 1WFTA 5CLTA 5GGTA 3W11C 3G5ZA 2FATH 2X42A 4LCWD 2IAMB 3ZT6A 2A73A 1IZKA 4WWKA 4P9HC 3S36H 5K9KB 4RISH 1LILA 2FJFA 1HZHL 3MRRA 3RGHA 2UYLA 1JWUA 1YEDA 2IF7A 3MRIA 2Q8AL 3OG4B 3QG7H 4U6HB 1F42A 1NMCB 4X9IA 4J2XA 1UZ8B 2EIZB 5KOMC 4RGNE 4PJEF 3HC4H 3HZMA 4PJEE 3VFPB 5F71A 4X5WB 3W11D 3OHXB 1A0QH 5IUSA 5GGTL 4AG4H 4KTDL 3QXDB 1PY4A 3SGDH 3D0VB 4C56A 3WFBH 4ZO8A 4R8WH 3F5WA 4XNXL 5H94A 4J3OC 1Z0MA 5ILTL 4RFOH 4NHCH 3WN5A 1G7JB 1MIEL 3VXSB 4ODTL 4NN5B 1YQ2A 4U7SA 4JFEE 5DLML 1IKNA 1CFNB 5MENA 1MCCA 3EJYD 4HUUB 3V0VB 1BFOA 3QEUB 1IBGH 5SWSE 2D7TL 2ZCHL 2E7MA 1YDPA 4PP2B 4WFHD 5EZJA 5T1LA 5E9DE 1LO3L 1E6OL 1K8IB 5FCUH 3VXRB 5KG9A 1I1AD 3GB7B 4L8CA 4PTUB 1RMFH 3QCTH 4P5TA 4XX1E 1DCLA 4FXLA 4TN9A 2ITCB 4CJ0A 4IOFC 1IARB 4LIQE 4TVPE 3UEZA 1T2JA 3M8OL 4ALAH 4WFED 1CU4H 2P5EE 2YEZA 4JZJC 3OR6B 2GW5A 4U1IB 4N8VB 2VXSH 1PZUB 3VCLA 3IJHA 3K74B 4EVNA 2XRAL 2PYFA 1NFKA 4U6YA 3RPKA 4X7EC 2FL5B 3JV4A 3U4BL 3S5LA 4P4KA 3UXFA 1QFWM 1I3RB 1A6WH 4J12A 4MA3B 3VWKC 1BEYH 4IOFD 4JPVL 4X83A 2ZUXA 1JVKA 2A77L 2R2BA 5EUOB 4JY6A 3QUKB 1I7RB 2MHAA 4P57A 4RAUA 2YK1L 2F8VA 1FNGA 1VEPA 3GMNB 1U3ZA 2GITB 5GJSL 5C0AB 3TGXA 3FB8A 3QDJA 3VXUA 5FYJU 4NUJA 5MP6L 5DFVC 1I85C 5BCAA 1WVZA 1UVQA 1RULH 2ZOLB 1CZ8L 5D2NB 2NY1B 4JY5H 3TJHC 3PHQA 1BHGA 1E4XI 4UU9B 1YNLL 5I74B 5E99L 3VGAC 3PJSA 1GAFH 1I8IB 3QISA 4IOIA 4JO4H 5EOTB 3DSNA 1INQB 4OKDA 2PXYD 2F5AL 4L4JA 1UWGL 5CILH 1QKZL 1ZVHA 2AEQH 3STZA 3CZFB 1KCUH 4PJAF 5IGXH 4PJAE 3OV6A 2B1HH 4LVNB 5KN5A 1BP3B 1ZS8B 3VG0H 3MRQA 3VFOB 1I7ZA 4I5BB 5K59F 5K59E 4YGVB 3N9GL 5ID1B 3HNVL 2DDQH 2NYYD 5EIIB 5JXAH 3GMQB 4OFIA 1X5KA 4QXUL 2FECI 4YDKH 3QPQD 2A6DB 4HS8L 3QUXD 4QYOB 5CD5D 5EB9A 3M17A 4NC0B 4OD1L 1FL3A 1SJHA 2VXQL 2B1AH 5D2LB 2D9CA 4KVNL 2HT4D 1WICA 3IJSB 1S5IL 3BEVB 4EDWH 1F3DJ 1OW0C 2WP3O 1YPZB 4OFVA 5C0RH 1S8DB 2AV1A 3DX9B 3UBXI 4NZJA 3MV11 3IYLW 2ZKHH 1OAYH 1J5OH 1F2QA 3VXNB 1SBBA 5HHOA 4RFEB 1YC7A 3OB8A 5DS8B 4X99A 1WITA 5EU6E 4BUGA 3QCVH 4XPBH 1P9MA 4TTDC 3UBXA 3X3FH 2L4OA 4JHWL 2FX8L 2JB5H 2R2EA 1M7DB 2Q1EA 3O9WC 1EH9A 4NO0A 4YAQB 3KDMA 1N4XH 4KI5D 4ONHA 2OZ4H 4JO3L 4ONGH 3UO1H 4ZOBA 2FECL 5EO1A 2L7JA 4JEGB 2ZG2A 3QHFL 3TZVA 2R15A 5FECB 1Z5LA 3KWWB 3C60D 3FO0L 3RWEA 3UJTL 1DBML 1F8TH 3QUZB 4IMKC 2FBOJ 1TXKA 4OFPA 5IESL 1VEMA 1BFTA 4G6JL 4P2CG 4RZCA 4F37K 4L8SC 4FZ8L 1CWVA 1D5XB 3PWVA 3O9WD 3X14B 5B8CB 3JTTA 1FZKB 1ZLSL 3L6FB 3PXJA 2CO6B 3O4LD 1N7ML 1V7ML 3TH4T 4HKXB 3VXPB 1KG0B 1F4WL 5DK0A 3IDMA 3MACL 1EHNA 4ELMB 1K2DA 3TT1L 4I3GA 4GQ9H 2IANA 2O5ZH 3PQYA 5JNYA 2VERN 5FF6A 3KPRB 1MHHA 4JGMA 4Z78A 5IM7B 4JFDA 5IFJA 2NY5C 4MNQE 3X17A 5DUMH 3VXOA 3DETC 1OGTB 3MV9B 1KLFA 3LKPA 2G60L 2BVEA 1H8NA 4ZTPH 4K8RC 4NQUA 5F88A 4CDHA 3DX7B 3BMWA 1IFHL 1ES0B 4UQ3B 3V4PL 2PW2B 2JELL 1OSZA 1RZ8A 1T04A 4XCCH 1QSFD 2H9GA 4TSCH 3SKMA 2QTEA 4JM2F 4PTTB 1A6VL 4JY4B 3MLRH 3QNXB 2HH0L 3S88H 1XGUB 3QHTC 3OXRA 2EYRA 1ZHKA 3BEWB 3SCMC 3GIZL 4PIRF 2VXVH 2X89A 3KYNB 1KELH 3FFDA 4K3DL 4P48A 4K7FB 2KZ1B 3WE6B 2Z92B 4U2YA 5C0GA 8FABB 4OZHA 1L6ZA 4YBQC 4Q74A 3EIFA 3OKEA 5T5FH 3UZQA 1MIMH 3R8BB 4PYGA 3BQUD 1VSCA 2WIMA 1UADC 4WUUA 4ZO6A 1FGNH 3QIWB 1XF1A 1CGSL 3GBML 3DX6B 4MVBD 1I7TA 3FQXB 4HS6A 1GGCL 4OZGB 3I02A 4OQ1A 2VDLH 2V7HA 4M6NL 1FFRA 2HFFB 3BUYA 2N7AA 3PP4L 4PJGB 3ZE1F 3ZE1E 4HJGA 4V1DB 2IC2A 3ELAT 4OV5B 5JHDA 1Y6KR 2EC8A 4ZUUA 4XB8A 2ED8A 5C2UB 2PO6A 4QWWC 5CLWA 2GJZA 1N59A 4PRHB 2FZ3B 4TQEH 1OGAE 4R0LB 2ZCKL 3WJJA 2YPLA 3HAEG 2GT9B 3H8NA 2FIKB 1RK0A 4W68A 1TJGH 2AJXL 3GRWA 1HIML 4FQJH 3N1QC 3EO0B 4ODSH 3U9PL 4D3CL 4NN7B 3BRFA 5DJCA 3H9SA 1TPXB 1PZ5A 3G6AB 4HMDA 3FQUB 2G9HB 3DIFA 3CLEH 3QDGD 4M93B 3GMPA 2BNQB 1B9ZA 4QWWD 3RPIB 3DV6A 4GW4A 4WU7B 3S4SA 4YDLB 5T3XH 5L2JB 1DN0A 3UC0L 2OMBA 3ZTNH 4OZ4A 4JLRB 3V6OE 5IW6A 1S9VB 3VD5A 3GRWL 3I6GA 3MRNB 3B6SA 5ADPL 1GIGL 1WT5C 1ZHLA 3CFDA 5HHPB 3RUGA 1WZLA 5HYJA 2KBGA 4LL9A 4XHQA 3VXQA 5FIEA 4HMCA 4D9RD 5ICZB 4UIKH 3SGDI 4XHJD 1KIRA 2CQVA 1A6ZB 3QH3B 4LHUB 2H8PA 2B0SL 4K3EH 1AI1L 1UEYA 2OR8A 2W65B 4NQEA 1D5MB 1WBYB 4CGTA 4HWZB 3WNNA 1JZ5A 3D87B 1CI5A 1Z9SA 2WBJA 1HSAB 1BZ7A 1KPVB 3ZE2F 4GS7B 3ZE2E 3SDCB 4C57C 1OTTD 3TVMA 3D3VA 5IV2A 4CJ1A 3ZDZF 5IHZA 3ZDZE 2AJSL 4UNUA 1PW3A 1I1FB 2X1WL 2P8LB 4JG1L 4X4XB 4ETQB 4I9WE 1C5DA 1MCEA 3NACL 2X44D 4CMMA 4WWKC 3OGCB 1N6QL 4AG4L 2X4UB 2VZVA 1CS6A 4A2MA 2GSIA 2VDPH 3BE1H 4QTIH 1CF8H 2HVKA 2FJGB 3I9GH 3P9MB 4Z6AT 3QI9D 3ZYJA 2OTWB 4R8WL 5IBUG 5IG7A 2DI7A 2XN9A 4JFOA 4L1HA 4WW2A 4RFOL 1AGFA 5GGSY 1QFWH 1W2KT 2IPUG 2VZOA 2E8ZA 2XWJB 4ZSOE 4Q97A 3FO1A 4G8GA 3HC0A 3HG1B 3ARGB 4NJ9H 5E5RB 1BVKA 4GRLB 3VWJC 4P2YA 4X6FA 3QFDA 1ND0B 5F7EH 4OLUH 4CVXB 1RZGA 1JPGB 5CJXA 1K3IA 2NTFA 3KPQA 4POUB 4LLYB 5FOBB 3WN5C 1MJJB 1H3TA 1QQDB 1IGJA 3C09C 3IVKB 3NPSC 3MUY1 1HEZA 4BH7A 2ZOKA 3OZ9H 3VRIA 4RGOL 4NDMA 1P1ZA 4AH2A 3VWJD 3MC0A 4JPIA 1LDPL 2P48B 3CD4A 1HHHA 5H37H 5GHWL 4MA8L 5JPNB 3P4MB 4OCWH 4IS6A 5C2BH 1AXSA 5D93C 2A9NL 4P5TC 1MVFA 5J13B 4PFEA 5AYUL 5E8DH 3BPCA 3P0YL 5J11B 4JRYB 3O41A 5F9WC 3W9DB 1QYGL 2DL9A 1TETH 5ICXA 1HXYB 3NA9L 4KGLA 2AJZB 1T2QH 1W0VA 5DDHB 2J8UB 4X6EA 3QXTA 5JDSA 4LCWE 4P4KC 1NBQA 4KHTH 4UT6L 3SGJA 1SYVB 4HCRH 1RY7B 5TDPA 1S7TA 4PRAB 2A1WH 4LASL 3VA2C 3I2CH 4E0RA 1X9QA 4Z7OF 3RWCA 3FQRB 4Z7OE 4XPFH 4LPUA 3RL1A 1MRCH 5GS0D 1BOGA 2QQLL 4GXVH 3MLUH 2EYTA 2B20A 4PJ7A 3T4YA 2VZUA 4ZS7L 3FB5A 4ZAKC 1T1WA 1TVHB 3TBWA 1GAFL 3FT3A 4IDJL 4BFBD 1J0ZA 4FTVB 4FQXA 4K9EC 2AEQL 1IGIH 1XMWA 4EI5A 5IMLB 3RVXC 4OLYH 4HC1H 2FEEL 3LKRA 3H6JA 4U0RC 4CNIB 4X5XA 3VE0A 1B0GA 1NSNL 5CEYA 3TM6A 3VG0L 3KXFA 2C26A 2ARJQ 4YHKH 1CL7I 5E8EB 4JGJA 1RV6X 5JMRA 2DDQL 4FFWC 1NGPH 4UT9H 4ZAKD 1CDBA 3SDAA 4OLVH 4PJDB 3B9AA 1NAMH 1DUZA 2AJ3A 4WFHE 4WHYG 3QT2A 2PTUA 3PV7A 4X0KB 1E0OB 4LEXH 5HDQL 1IQWL 2X5PA 1P84K 1I8KA 3GGWB 3TA3D 5C0RL 4MAUH 4AM0B 5J12C 5CZVL 1GYAA 3X13A 3GK8L 5HHVL 4ZFGH 4G9FD 4ISVA 4WFEE 4G9DB 3BWAA 4PBWD 3NZ8B 4NSKA 1T5WA 3ARTA 3O6FD 2ICWB 4A6YH 1RZJC 4F7PB 1ED3B 3QEHB 3IKCA 5DRWB 1CL7L 4WY7H 4UTBH 4L3EB 4XCYB 1I7UA 1UH4A 5L2KB 3BHBA 1VFUA 3UO1L 3KPOA 3A6OA 5IJKA 3IAQA 4LARL 4HH9B 1F90H 1AGEA 2DQGH 3LEYL 1KGCD 4KKLD 1C8PA 4JRXB 1E6JH 2BC4A 1HKFA 5I15L 3OQ3B 5F96L 4WNQB 4PLOB 1F8TL 4KUZL 5E4IA 3MRMB 1P9MC 3I84A 5BXFA 1MLBB 2VB5A 3GO1L 1I1AB 3EDFA 3KYOA 1WFNA 4X4YA 1EVTC 2DN7A 4HS3B 4YPGB 2ADGB 4GMTL 5CZXC 4AQ1B 4Z7WF 4Z7WE 3WIIL 2V2XA 3QYCA 5JDJA 1KF9B 1I3UA 4DWHA 5JHLH 3WDIA 2YD2A 1J12A 1AO7B 2CUHA 4GUPA 4Y16D 2CLVB 2BDNH 3W0WA 3NCJL 5IVXF 5IVXE 3E6HB 3DYOA 4EDXA 2Q76B 4NQCD 5DI8A 4MZ3A 2O5ZL 2BSTA 1IQDB 4JJ5B 4LSQH 4KK6C 4Z5RB 4PGCB 2ZUQC 5D8JL 4P5KA 4F2MB 2WSKA 3CX5K 3ULVL 1OP3K 3HS0B 4MJIB 5BVJA 5C0CB 4QRRA 1DBAL 1ZTXH 3D39D 4F15C 4ZTPL 4Z8FL 4MD5B 1FJ1A 2R4RL 3IRPX 2L7UA 4BKLB 1S78C 4LLQB 3QULA 4TUJB 4NQTA 5DRNB 1K9TA 3SKOA 3FFCD 1KXTB 1WSST 2B2XH 1T89A 4RMRA 2VR5A 3WNOA 5MEPA 1XR8B 4KK6D 1SBSL 4ZPVA 3MXVL 4J7RA 2DD8L 3U6RA 1FNSL 3MV7D 3C8KB 3BP7B 3GKWL 1U8OA 3MLRL 1HQRB 5CJBA 3WO4B 3F7YB 1OD7A 3CCHB 2VXVL 3GKZA 3L5HA 1GZPA 2NW2B 3ZKXB 3HZVA 5IJVB 5F9JA 2G2RB 3T2NH 5FA4A 5T5FL 1R24A 5B39B 4UBDC 2BMKA 1BD2E 1YY8B 4OGAD 4CVWA 1J0YA 2QR0B 3JWOC 4EI6B 5HI4C 1FZOA 3NVQA 1HSBA 1EXUB 4KI5F 5DT1L 4KI5E 3W9EB 1LK2A 2BZDA 5CSBA 3O45A 4LF3A 1DDHB 5GGVH 1JRHI 4HBCL 4XMLL 3QUXB 3VRJB 4UIMA 5HPMB 3LSOA 2I25N 3CJJA 4XP5H 2ADIA 5KVDL 5GGRA 3VD4A 3KYAA 3ILQD 1V5JA 2D7NA 1KTDA 4WI9A 4AEEA 5F7MC 1GZQA 1KB5B 2F5BH 4XP9L 4ZXBB 3KLAA 4S1DC 1MCPL 5HI4D 5ESAB 3SE8H 4O51A 4OF7A 1UH2A 4NJAH 4LGSB 3BAEH 2VR4A 1G1YA 1N0XH 5IHLB 5J1AA 5AEAA 1NGWA 3IXAA 4HF5H 4IRSB 3NFSL 2HAZA 2GUOA 1YEHL 4FXKB 2NX5D 3EFFA 4JPKH 2HWZL 4L4TB 3WKMH 5GS2D 4OLXH 4RMQA 3CVIL 3HLAB 2HFEA 3NPZB 3VG9B 3KPLA 2PTTB 4LSTL 3TESA 3CLEL 1K6QH 1PGRB 2PO6C 1PQZA 3CAFA 4YBLB 4KROC 4GRWH 3C6LB 2NY4D 3DVGB 1JRHL 2FGZA 1TZIB 2MMXA 5H8DA 1YJDH 1BZ9B 1DANT 3ZTNL 2DWEA 5IR1A 2VLRD 1XR9B 3MCLH 4IRJD 1CT8A 1T7ZA 2CDGB 2E7LA 4HUVB 1BVLB 1DBKL 4PRPB 3BKYH 1B0RA 2YPKA 4YHYB 3PNWA 2P24A 3UYRH 3QDMB 4M7LL 1JF1B 4RAHA 4M61A 4UIKL 4KROD 2HT2D 5D96C 4N0UA 3HE6A 3VGHA 5GZNC 4KK5D 1L7TL 1RJLA 2IALA 1T83A 32C2A 5DR5H 2OQJA 4AY0A 1IM3B 1QFWI 2XZAH 3ARFD 3LRGA 4MCYA 3UDWA 1RU9H 5KANG 1Q38A 1MFDH 2VITA 1S9XB 5D7KD 2FWOB 2EDLA 5DF0A 3TO4B 1EMTL 2P43B 3GIVB 4P5MB 1U6AH 1UT9A 5D1ZD 1PKQB 1G7PA 1R3IL 2AW2A 4OGXH 1HXMB 2IG2H 4PY8I 1T5XA 2YRPA 1ZEAH 4HSQA 3P4NB 3KLSA 1TJHH 1MCFA 1NAKH 3CFEA 4JHAH 4YHZL 2UZIH 3ALPA 4YXLH 3LRSA 5EG6C 2CLRA 3EBAA 3C08H 2VDPL 1IL1B 3K2MC 4QTIL 1CF8L 3TVMC 3H0TB 3MGOB 5EU3A 2AKRA 4HT1H 3V0WH 1T7WA 4XH2B 1JYVA 4UINH 4Q58C 4Y2OA 5L8JB 1G7HB 4M5YH 1WUNT 1XEDA 1UYWL 5DXWA 2YD7A 4NRXB 2W91A 2XG5A 1JK8B 4NJ9L 3K81A 2GJ6B 4BH8B 5GS1B 2W60B 3RY4A 4XVJH 2O61A 2OI9C 1N5AB 1D6EB 1KFAH 2R1XA 1LO2H 2CSPA 3BQUB 4WW2C 12E8L 2QQKH 5CJ5A 3ARDA 1HWGB 4QOKA 5FUCC 3IDYC 3REVB 5FYJH 3QDGE 3FAWA 4IEFB 3IFLH 2HP4A 4M7ZC 2HJFB 3CDGB 2P5WA 2D7OA 5A2FA 3UROR 3T8XB 4MAYA 2JB6A 4PP1C 1QRNB 3G6DH 1A1OB 1H3UA 3X11B 1CLOH 2C3XA 3MV8E 5JOFB 3MNWA 5IT2H 3HAEH 4KY1H 4LSRL 5CJXC 1DLHA 4Q9QL 5IQ7L 2CXKA 3P9LA 5C09D 1X5LA 5C2BL 2GCYA 1NCCL 3B9KA 3MLVL 2PUQT 1FYTD 2X4PB 4N90D 3OB0K 2PYEA 1AFVH 3WNMA 3EYFA 3BGMA 1SQ2N 3MRCB 3HMWH 5BZDB 3QNZB 1BBJB 1TETL 1QTYT 2VXUH 1GGBH 5BW7A 3UTTB 3CFCL 5F7DA 2E6QA 2LV4A 4P46B 4FQ2H 2VDMH 4MCZA 4F8QA 4BJLA 1H0DB 4HC1A 2VE6B 5B3NA 2Y9RT 3I2CL 2OTUA 2IPKB 4XPFL 5DWUL 1YECH 1F58H 5M94B 3V52L 5J56B 2EDRA 5F7HA 3MLUL 3G6JA 1QSED 5KOVC 4ZFFA 1NGYB 2XNAB 4QO1A 4CU8A 5D72H 4KTEL 1NAMA 1WBZA 3DI3B 3QIUB 5TF1L 1VHPA 1TTFA 1G84A 1MAJA 2A9ML 5EH1A 4HC1L 2LU7A 5LXGL 5GSRA 3ARBB 1N2RB 4LEOA 1EO8L 1MAMH 3B43A 3ARUA 4JDTL 4F80A 5I1GH 1G9MH 1NGPL 4UT9L 1YA5A 3U7YL 2R0WL 4OAWB 5CJOL 2AXHA 4QRUB 1CDIA 3IAPA 4FQXC 5IK3B 4A6YA 3ROLA 1DE4A 4TSAL 3IS1X 4EI5C 5HDLA 2F54E 3QWOB 1OF2B 4GG6B 5I1CH 1MNUL 4ZS6D 4KPHH 4LEXL 1U95A 2B5IC 2ZPKH 3WIFB 4Y4KA 3O2VL 4JFFB 2AQ2A 3IDNA 2AQ3A 3KS0H 1ZKAA 3FTGA 5L7XL 1F97A 3P73B 3SDAC 4PJ8A 1NFDA 1IMHC 3QO1B 4P59H 1A5FL 5J57B 4HIXH 3PDOB 1OAXL 5SWZB 1MJUH 4MDIB 3ARSA 3HPLB 1OCWH 1Q0YH 5BO1H 4P3DA 5JXEA 3O6KH 4M02A 4FFYL 1DUYA 4WY7L 1NUDA 2W9EH 3ZKMC 4ZO7A 5BQ7A 1QLRA 3U0PA 4HPYH 1A7QL 3KG5A 5IHUH 4V2BA 3WFCL 3GUTB 5BRZA 1MLCB 2DQGL 2CGRL 4LLWA 3LAFA 4WJ5B 5MENE 3VDBA 1FN4B 3HKFA 4C4KT 3WDJA 1BQHG 1WTLA 3P40A 5DFTA 4NKIL 3TO2B 3A67H 4JHZA 1J88A 3DRTA 4EEEA 3O8XB 4XNMA 1NGQL 4WCYL 2CK0L 5DD1L 2NLJA 4IRZH 3VXTA 43CAB 3TWCL 5IJKC 5IQ9A 1RIVL 1B4RA 1TQBC 4NQXA 2W0KA 4PR5A 3V6FB 3BDXA 2PKDA 4JFXA 3VRLF 3VRLE 1RIUL 3NGBC 5JHLL 4ETYA 2X1PA 3U83A 2VOTA 4LLDA 3U9UA 1LGVA 3SBWA 1FFQA 1FORL 4HJ0D 3LZFH 4XT1C 3LEVH 3ULUD 1XGTB 1U8JA 1U8IB 5E6IA 4ESKA 3MRHA 4LSQL 1EIBA 5INDB 1MH5A 5LGKA 1HKLL 2V5MA 3TBVA 2NY0D 2DICA 3QZWG 2MFNA 2YZ1A 1A14H 5LAXB 4XAWH 5J0BA 3V6ZA 4O02H 2V9TA 4MJ6A 1MRFH 1M7XA 3MJ8B 5DURD 4WIQA 4GW5B 4Y5XC 5JLZA 5TDNA 1G9NL 5I1EL 2OK0H 4E5XA 3I3BA 2VZ3A 1XGPA 1S7WA 2B2XL 3U7WH 4PV8B 1D9KA 1MUJA 3D48R 3ECBA 2WUBH 3ES6A 3F6LA 3VFSA 4PLJC 2OX5A 3R4DA 1J8HD 1UJ3A 3O3DB 1I1YA 4GKOA 2OYPA 5KSVA 2AK4B 4Z7UF 2WMPA 4Z7UE 5JW3L 5FA3B 4DN3H 3WLBA 1RAMA 2RGSA 2EIEA 2F53B 1D6VH 5DD0L 3NCYP 2VWEE 5SWSB 4LCYA 35C8H 5F3HA 4LCUB 5DJ8A 2AEWA 4XCNB 5E9DB 1A02N 4LLUA 3UJIH 5I8EA 3FQTA 1J05A 1F11A 4RMUA 3T65A 4DZ8B 4PLJD 2Y5TB 4KHXH 3K46A 3RIAK 4YHNB 4WHYH 1NBVL 4LCCA 4KXZH 3QRGH 4KK8D 5HYQA 3EOTL 2P5EB 3S36X 2APXA 1G9EA 5F6HJ 1VFAA 2QEJA 3C2AH 4LSVL 4PY7A 5DEFA 2FGWH 3DMMB 1QLEH 4JGUA 1ZLVH 3SDXA 1ZV5A 5L9DH 3RRQA 3S34L 1RIHL 5I8CB 2DQTH 2F5BL 5GGSB 1XIWC 5ACMA 1M71A 1A4KB 4HUWB 2D03L 1S7SB 4U1MB 4HUXB 1OQOA 4L9LB 3A0OA 3FRUB 3SE8L 3LQMA 1U8MA 3U7AA 4JKPL 2EE2A 1JHTA 3FB6A 2Y1VA 4M43H 4PBVC 3BZDA 1UGNA 3LDBC 1U3HC 5C92A 2I9TA 4HF5L 4M8QA 3U36B 5HHOE 4YIQB 4JE4B 4HX1B 4NO2A 3PHOA 2DI8A 2EDYA 1XIWD 4NQCE 1A9EA 5C08A 4YFLI 3LN4B 1RJZB 3SY0A 4DAGL 2ORBL 2X4TA 1QUNA 4OKVA 4GAYB 4X6DA 4TUKL 4UOW1 3ALXA 4GMSH 4NNYB 4LAQL 1QA9A 4AT6A 5EUKB 5D6DA 2MCPH 1U3HD 4MDJA 4LHQB 1QSVA 1HYSD 3D39E 4YHMH 3WXVL 3BPLB 3CFBB 3F6IA 4Y7MA 3KR3H 4NQDA 2FO4A 3NFNA 3QXUA 3P30L 4QRPD 5FB8B 3TV3L 3QO0A 3UYRL 1CFVH 1OARH 3O0RL 2BNRA 5T3XD 2E9IA 2VYRE 3D85A 4LVOB 2X6MA 3EHBC 5TE4L 2A6KA 4O00A 5DR5L 4PJBF 1JPSH 2E7LC 4PJBE 3TPKA 3IGAB 2V5RA 4XWOD 2IANE 4NZUH 2JJVA 1G7MA 2CDEB 4PS4H 5D7LB 3T4AB 2IH3B 3HE6C 4HWBH 4X6CA 2VISB 1ZVSB 2GK2A 4OZFG 1U8PB 1T83C 2NY3C 3BIKA 5HGAB 4WU5A 5FKPA 3UDWC 3UYOD 4CN4A 1ADQH 1TJHL 5D70L 4GW1A 1GGYA 2IQ9H 1C5CH 2UWEF 3EO9L 3TYFB 4NWUL 2UWEE 1A21A 4FHBD 1KEGH 3C08L 4F7TB 5HVHB 3SJVA 1CE1L 4M7KH 5AG8A 4RX4D 5EU6B 2V5SA 4X9BA 3LN5B 5E8NB 4YNYB 5IF0A 3BH8A 4RNRB 1VGKB 4PJXB 2XPGB 3GHEH 2DM4A 3IAGC 1ZVYA 3AMKA 2R1WB 3OKNA 4XVJL 5HHQB 3ZT5A 2DRUA 4C83B 3IDIA 4YBHA 3MX0A 5HHMD 5GGUA 3MOQA 1G7QA 5HGHB 5KSAA 4WW1A 3L3GA 2NX5E 1DQLL 3MCG1 3BOVA 3EFDH 2C4FU 1G6VK 1LE9B 2XZCL 3MBEA 4P3CL 2CIIB 1J11A 3IFLL 4Y1AA 3ZYOA 3QIBD 1U8HA 3UTQA 5C0FB 2R4SL 5FO8A 4L8DA 1MRDL 5J4MA 1P4IH 3ARPA 4KU1A 3IU3A 1JPTH 2VLRE 1KXVC 2EDNA 5J9PB 4JPWH 4KKBD 5JHDE 4R4FH 1Q9KA 1BJ1H 4HQQL 5EU5A 1BFVH 1AFVL 4XVSH 1KTLA 4MAYC 3HMWL 4U3CA 4PD4K 3F62A 1IKFH 4S2SB 3T0VA 3NCFB 2AGJL 1XAUA 1OLLA 4G8IB 3F58H 3PXHA 3BKCL 4XNZB 3STLA 4K71B 1GGBL 3S9DB 5F7WC 2DBLL 1BM3H 3RL2B 4OD2B 4RGMB 3B9KC 4FQ2L 4EN3C 1CDCA 1WEJL 1UCBH 3AU1A 4DTGL 2N1KA 4G42B 1CD1A 1Z0NA 1RZ7H 3T0EA 1F58L 1NBYA 2JIXB 1IM9B 1U8LA 4QRTB 5DEZA 2VRAA 3L7EB 2B8OT 5I18H 2BSSA 5B22A 1FH5L 1DVFD 2HKHL 5BW7C 1MY7A 3LN9A 2P42B 4X6BB 4Y5VB 2P8PB 4RMVA 1T21A 1QD0A 2ICWJ 4EN3D 4M3KB 5AWNH 5HYJE 4Y2DA 1NLDH 1X6LA 4YR6A 4HGKC 4FMKA 3RTQB 1TDQA 4XBPB 1RHFA 3FN9A 2VAAA 4MQTB 5C0BA 1YC8A 1G9ML 2QKIB 2BVQA 4LLMA 3AFLA 4G6KH 3ARFB 2BOCA 2EDEA 4NQEE 1KULA 1EJ6A 3DURB 4N8CL 5BJTA 3BZEA 1KENH 1TVBA 2AEIT 3BWUC 2V6HA 3MYJA 2VSDA 1KLGA 4YHIB 1IAOA 1T22A 5TGBA 4Z18A 2A74A 5I1CL 5L8LB 5C07B 3ZL4L 4OJFL 3MSPA 5A40E 2Z8WC 2NCMA 3BGAA 1P84J 3EOBA 3F7RA 3LEXA 1OGAB 5J3HC 3VMPA 4I0CC 5BZWA 3WUWB 1JZ3A 3RI5F 4P59L 3DGGA 3U0TB 4HIXL 1DQQB 1CVSC 2APWA 2HTLD 2GTZA 1XF4B 5SWQA 4I48B 1CICA 3CLFH 2DTMH 3BN3B 2H45A 2W9EL 2D9QB 5C09E 4Y4KC 4WW2F 5KSBF 5KSBE 4F57L 5JR1H 5FUCE 1MFAH 5JQHC 1T20B 3BSZH 4N90E 4HIHA 4PJ8C 4U33A 4R6UA 3PIQA 3EDJA 3HC3H 1AGBB 1S7VB 2C1PA 3RWIA 1RUPL 2COQA 3TIDB 1OAUH 3GMRB 3HFML 1SHMA 4K2UH 5JXEC 1TIUA 4LFHD 3TPUB 4NHUA 2Z91B 3IJYB 5JO5A 3RP1A 5DJXA 3FO2B 3FMGL 2D0GA 4XC3L 5D5MA 4HKJA 2ZWLT 3C2SA 1XGQB 3JBG7 4ZUVB 3M07A 2ZSVB 3MJ7A 1CFSA 4PJCF 3CFKB 4PJCE 4ERSL 3AROA 2FH6A 5ITFA 1QBLH 4JVUA 3MCKA 2A6JA 3DROB 3VFMA 1AHWA 2WM0A 4PJ9D 1FDLL 3QFJD 3D0LA 2HRPH 3IXTA 4XNQA 3LZFL 4GBXD 5AD0A 3LEVL 1WV7T 4KZEH 2DKMA 1H5BB 4WFFD 4NYLA 4R97C 1OP5H 3RGVB 1JGEA 5DJDA 4WHTB 1MAKA 3RIFK 2HLAA 3Q5YA 5DD5H 1HH6A 3CX5J 1ZLWH 1YNKH 4MJ2A 2HJKB 1JWSA 1MRFL 1A6UH 1OM3L 1TNNA 3UPRB 2D31A 4GKZB 4HDIA 3C5ZC 1T4KB 4KKAC 4M6OH 3UTZB 2GHWB 5E6IC 4NO5A 1AIFA 3PWJA 3U2SA 4KKNA 5DQ9B 1CXFA 1XF2B 3E8UL 2F8OA 5J7CC 2WUBL 2AV7B 5C9JB 3HPJA 1KN4H 2X7LA 4PJHF 3GNML 4PJHE 1R5VB 4ORGA 1QSEB 2VABB 3E1F1 4ZSOB 1NFIA 1JNHB 2J5LB 2PN5A 4PJ7F 4PJ7E 4QY8A 4G80B 5BV7B 3IDXH 3KJ4B 5F3BA 1I1CA 5CP3H 1OTUD 1LNUA 3RVUD 4G5ZH 3C5ZD 4KKAD 1A6TA 3AMLA 3GI8H 4YDIL 1D9KC 4HFUH 4FQIH 3MJ6A 3RAJL 4P23B 4WEBL 1KJ2B 2DWDA 2Q6WA 4DW2H 4LDEB 1BF2A 3DRQA 4R7NA 2BY1A 1UJ3C 1CLYH 4KMTL 5IEHA 3KXFE 1CGVA 2I07B 5EZIH 4I3SH 3EYQD 3QRGL 3ARED 3VFTA 4KFZC 2I60L 5K9OB 3C2AL 4KZDL 2XWTA 2YS4A 1H3VA 2PCPA 2APTA 3SOBH 2CRYA 5L9DL 1EHLL 4PRBB 1YEJL 1U8QA 3H9HB 4H0GA 5ANME 5LGHL 3FCTA 1JV5B 1WBXB 3LH2H 1VADA 1H9VA 1OHQA 5EZOH 1YNTB 4MHHG 2ZUVA 4LCCC 4HFWB 5A2IH 3V5DB 1T1YB 5AZEH 5LJYH 4Z77B 3W5NA 4P2RB 1UWXH 2YC1A 3NFPB 1TMCB 1DBJL 2I26N 3J8F7 2VQ1A 5D6CB 5EBLB 2XKUA 1N5YH 5HHNA 1U8KA 4PJ5D 1Q9OA 4Q6IA 3V95A 3W39B 3IDUA 2K7QA 1RUAH 1NC2B 3VXSA 1YJDC 3NCYS 3U30B 1HH9A 2P46B 2DQIL 3D2UA 2DAVA 5HGBB 1INEL 2HJLB 1NGXB 5KS9A 2R69H 1CE6A 4YHLH 3QEUA 5SX5K 4WI8A 4UDTA 5J6HB 3L5WA 2B7DT 2RB8A 2CLZB 3KR3L 2X4QA 5DMIH 1VKXB 3PWPD 4U3HA 8CGTA 4U6VH 4OLWH 5D1QD 4HZAA 3MRGA 4O2EB 3AS2A 4YE4L 1MFEL 3F12B 3RWJB 4PJEA 5KVEL 1U58B 2OR7A 2CR6A 1RHHB 3ROOB 4D94A 5DMKA 1UQSB 1P6AB 5D6DC 4TRPL 2ZUTA 4MYWB 1ADQA 1P7QD 1R3JB 3S35H 4ZUSA 4YX2L 3LKNB 5DRZB 1JPSL 5DYOA 1FFPA 1IC1A 3EYOA 4L4VE 4KKCC 4J4PC 4NT6B 1W72B 3N1MC 2ATKA 4KDTA 1WISA 4JFEA 2YRZA 2W0FA 5D7JC 2D7PA 15C8L 1MCHA 5IMMB 3QUYB 4M4RA 2Y5EA 2I5YH 1SVCP 3L1OH 1HINH 2C3WA 5ADOL 4PRID 2R2HB 3LKSA 4MA1C 5DD3H 2EZ0C 2EKSB 1LE5A 2GSGA 3VXMD 1VFBA 4V2CB 1II4E 4JHBA 1XCQB 2J8HA 4YQXH 3DO3A 2M1KA 3GMNA 1HILA 1WIOA 5FK9A 2Z8VC 4J4PD 4KKCD 3X12A 2FX7L 3F7PC 4JN1L 3RWHA 2BRRL 1AKJA 4MNHB 4QHNB 3U4EB 2VLMD 1G1CA 3NH7H 5I19H 1XH3A 1QFHA 2M26A 1HHKA 1KNOB 5D7JD 5HY9A 4HEME 3OKKA 2XTJC 5ALCL 4OFYA 3MGTA 3B8YA 4AEIL 5CP7A 1Q94B 2EKJA 4TUOB 2XWBB 3OJDB 1JGDB 3HZYA 2EIBA 4U31A 2ZJSH 6CGTA 5GZOC 2M2DA 4DZBB 1FNLA 2C4XA 4JZJB 1AR2A 2B4CH 5I1LB 1OLZA 2YR3A 4BSVB 1KCRH 3RA7H 3H7BB 3FO9A 1HQ4B 4UUJB 43C9B 3EYVB 4MD4B 5IOPB 3EAKA 4Z76A 5MERA 4LIQL 4TVPL 1EAPA 1NEUA 3VFOA 5JPMA 1NDMA 2WUCH 1U93B 3VWKB 1I3GL 3Q0HA 2BRQA 4KK9D 1DTUA 1IC5L 3JV0A 3TN0D 1XF5B 1YQVH 5DJAB 4QF1A 1P4IL 3MRDA 4HGWB 1T7YA 5KSAC 1AGCB 1YMMB 3WFHB 4OT1H 4RAVB 5T1KA 3MNVB 4P2QD 3G5XB 3HE7C 1C1EH 4MWFB 4MS8D 4ZYKB 3MZGB 1UC6A 3EJZC 1YN7A 2HRLA 4WO4A 3BKMH 4XVSL 2BX5A 1R0AL 2H26B 5T3XE 5KANI 1P2CA 3WBDA 4Q2ZB 1FIGH 1M6OA 4MD0B 1MCOH 3F58L 3UCRA 4M6MH 2A0LC 1BJMA 3VGAB 2Q3AA 4LOUC 4RFEA 4E41D 2ADJB 4PJAA 4OQTA 5IROA 5LGJA 4ORZC 1NEZB 3QJHA 1TJIH 5DC9B 3HE7D 2J6EA 4H25B 1GRWA 4LSSL 3EJZD 3RWGA 1MI5A 3N1GC 1MVUB 3HMXH 3GMMA 4QXGH 3BO8A 5CGTA 5B4MC 3L3IB 4I2XA 5JZ7C 1P4LA 4GXUN 1TZGH 5FDWB 2MQ0A 2A0LD 3MRJA 4KUCD 3SDDD 5IB3A 4QRPB 5CD3B 5IHBA 4OQTL 1D5ZB 1FGVH 2OJZH 1BD2B 1T0NA 4K55A 4TOYL 3RBGA 4P0DA 2J6EL 1GC1C 1NLDL 3T0EC 3OKLA 5K9QG 3BX7C 3LQAL 3PWUA 4YHOH 1AP2A 4D8PB 5I1DB 1B88A 1LO0H 2VLLB 3QEGH 3UPAA 5MI0C 4MSWB 3E0GA 1JN6A 4NGHL 3GZKA 5FEBA 1KENL 2OM5A 4X9FA 1J9CT 2XKNB 4E42B 1KC5H 1BMGA 3GI9L 4Y2DC 4F9PC 2QQNH 1H3PL 3DTXA 4ZUTA 2DYPB 4OCSH 1F6AB 1WCQA 1A9BA 1RJCA 1M7IB 1K8DB 4FQLH 5TFSH 5IIEB 4HZLB 4KTYA 1IT9L 3C6SA 2XQYK 5DJZA 3LV3A 4QTHA 7CGTA 3DWTA 5GGQL 1SVZA 4NBXB 3VI4F 3VI4E 5E2VH 4FQQA 4XRCB 1ZSDA 1AE6H 3L3JA 2UUDK 4QRQB 3F7VA 5SV4A 3UTSB 3TEUA 5KAQF 3RZCD 4APQB 1KSRA 2DLIA 3GJEA 2V7NA 1KCVH 1MFAL 1LP9B 4JFYB 3FOLB 2E7HA 2DM3A 3QEQD 3D69A 4LSUH 5EOCH 1D7FA 1DSFH 4NNPL 4LAJH 1RK1B 5C8JB 4Z7VB 2Z31A 2VLKD 5ETUB 5EU7C 1CICC 1B4JH 1GOHA 4B5EA 4MNQA 2X4RB 5BS0A 4IMLB 1ZT4B 1KEMH 4KMQA 5EA0H 4CADA 2L0DA 4X80H 4XCFH 3E6FB 1A47A 2VDOL 1YUHB 3MOAH 1FG2A 2HFTA 4X4ME 3RNQB 3DX6A 1AJ7L 1U92A 2VLJD 4L5FH 4UT7L 2HN7B 4KAQL 1ZAGA 5IVZB 2Q7YB 5E8OA 4KRPC 4DVBA 4FQCL 1KUMA 3AB0C 4JM2A 1ZA3A 2XOTA 3BD5A 2XTLA 1KT2B 5I66A 1X44A 3DVNB 5B38G 5CFHA 2EECA 2CIKA 4G6ML 1G7LA 3DXAB 1KN2H 1T1XB 2PYEE 2E9WA 3DYMA 1WCBA 1YNKL 3O3EB 2XFXA 3CK0L 1EEZA 1GSMA 1AHWC 3SCMB 5CP3A 4F3FB 1KJVA 3T08A 3CDFA 5IWLA 1BF8A 3T3MF 3ETBF 3T3ME 4I0KA 3WNLA 5IBLD 4CBPA 3DO7B 2W9LA 3MMEB 3QPXH 4Y4HB 5HJ3B 1KB5H 1AXTL 4MQ7A 2DTSA 1BAFL 1C12B 5EN2B 3CUPB 2QADC 1KN4L 2XZQL 4ZQKB 3ZKND 4EIGB 1C08A 2Z8SA 4RIRA 3HZKB 1S7UA 2FBJH 3G6JF 3G6JE 3ZHKA 4LQ1A 4PV9B 2C7UA 3IETA 1WGOA 4H20H 3DI2B 2VDRL 4Q9BA 3HN3A 1HHJB 5TQ0H 4HFUL 3MLSL 4ZUWA 1FPTH 5EU4A 1FG9C 4NKOB 2X70B 2ESVD 4OIBA 5FM8A 1JCKA 5HYEA 2N7BA 1UM6L 5FAAA 5C0JB 3MO1A 3RDTA 3SEPA 3CZJA 1S7RA 4YEEA 3SGKA 5KZCD 3MXWH 4X98B 2A6IB 4ODUA 1XGRB 1A7RL 1HDMB 4J6RH 4K7PX 5IW3A 3BP6A 5CEZD 2GTWB 2DQUL 1SY6L 3MV8B 3SOBL 4Q6YA 4FP8L 1BQHA 1D5IH 1F4HA 5TQ2H 3VFRA 2LFGA 2W07A 5EZOL 3ZYZA 5ALBL 2QSCL 2JJSA 1FNEB 5GIRB 4ETQA 1EFXB 1J18A 4S1RL 5IKCA 5ESQB 3P0GB 2GKIA 5C6TL 3WIHH 3WSQH 3DV4A 2K3TA 3CSGA 5FYLD 1A7OL 1T7XA 4UB0L 1MHPL 1VERA 4NM4L 5DEGA 3K80A 2Y36L 1LEKA 1I9RL 5EO9B 5E00A 1O7VA 4XPAL 1NMCC 5IFAH 4EUPG 1DFBH 4U6XA 3JV6B 4YDVB 4XMPH 5E1AA 5ISZD 4QKXB 1RVFH 3ARWA 1YEKL 1ZWIA 2IAMD 5BRZE 1FZJA 3DBXA 4HLZG 5EBMA 3QZWA 2P8MB 4BFGA 4J8RB 1NCWH 4U1SB 4HIIA 1JZ8A 1BIHA 2NY2C 2RQ8A 1JYNA 3OF6A 4QXWA 4XCEB 5GJTL 3LKQB 3CXDL 1W0WB 1CLZH 5F7FA 2EDQA 4C4KO 3P0VH 4I0PA 4LBEA 1IEHA 3FT2A 5MEOB 4QHKJ 4J1UB 2JCCB 1ETZA 3SN6N 2A73B 4LNRA 1NC4A 4WWKB 5BOPA 3KPSA 4MXWL 3B9DA 1FO0H 1MCRA 2FJFB 3MRRB 3L9RA 2UYLB 1JWUB 1YEDB 3WHXA 3MRIB 4HJJL 1ZANL 1KB9K 2I5YL 4M4PA 5F97E 1KOAA 3IFPA 4OIIL 3HZMB 5DJ2A 3MLXH 5DD3L 5JUEL 2HKFH 1ZT1A 1PX3A 3O6LH 4XWGH 2Q8BL 2YA1A 3VXRD 4M5ZH 4RFNB 4HG4K 5FKAA 4C56B 2H6PA 5GGRY 4PRAA 1AC0A 3F5WB 1Y6NR 3NH7L 5I19L 5H94B 4LQFH 5BV7L 2D0FA 2LAGB 3WN5B 1DQDL 4RA0C 1RZIA 3C09B 4KI1A 2FD6L 3NPSB 4OZIF 5MENB 3C87A 4OZIE 2DQEL 1BFOB 5FGSA 1KJ2L 1YDPB 3QUMA 1K5NA 5D71L 5EZJB 3WO3B 1KCRL 3RA7L 5T1LB 2BVOA 5DUPL 2VH5H 5C0IA 4OCLC 3T1WA 4G43A 5KG9B 4L8CB 4ZFZB 3T77A 1G7IA 4P5TB 4U4BA 3ZLQC 3RJDA 5I71C 5I74C 4ACPA 5D7IF 5D7IE 5IB4A 4K23L 2YEZB 4LCWA 5F9WB 4XTRC 5TE7H 5FFLA 3VJ6A 3X3GH 3VCLB 1XFPA 3IJHB 4OFDA 5C0AD 4EVNB 3QUML 4L3CA 4H8WL 2PYFB 3TT3L 4OT1L 4U6YB 3KJ6L 3JV4B 4LVNC 3S5LB 4P4KB 3WXWH 1J1PH 2NY1D 1JZ4A 3PWPE 1FFOA 3HMXA 1WFOA 2BHUA 3AGVA 4XMKH 3ALWA 1KTKE 4Y0GA 3BVNA 2R2BB 1XT5A 5A16A 1OAKL 4JY6B 4XTRD 1MCOL 1MJ8H 2MHAB 4P57B 1B90A 4PD4J 4I3RH 5DFWH 4RAUB 4IJ3C 1NKOA 4HPOH 1FNGB 3QRFM 1NUNB 2WLZA 3L3KA 2Y25A 1TJIL 2VMFA 4OI7A 3FB8B 5DQJA 3QDJB 5CJQL 1KPUA 3PGDA 2FB4L 3SQOH 3VXUB 1PG7H 3WJLC 4B7LA 1SJEA 4NUJB 2IFFH 3M1BB 4ZO9A 2NXZC 1R3HA 5HVWA 1UVQB 7FABL 3I6KA 3CC5A 4H1LG 4QXGL 4U0RB 2VDQH 3PHQB 3GMLA 5ERWA 4OZFA 2FJHA 2FLBT 4DGYH 2AQ1A 2AK1L 3WDHA 3PJSB 1OAZL 4PRIE 3FZUD 4IOIB 3VXME 4G7YH 1MREH 4YFLF 1FGVL 3EDEA 4IIQA 1I1AA 3LRHA 4G6AC 2ADFL 3STZB 1PD6A 5GRUH 3LHPL 1J1OL 2FH8A 1ROWA 2BNRE 5KN5B 3EDKA 3W2DL 2VLME 3MRQB 2IADA 3O4OC 1I7ZB 1BOYA 1KBGH 1LO0L 1Q1JL 3QUZC 5J12B 4X8JA 4XP1L 4XI5D 1YYLH 1SEQH 4FFZH 4FNLH 2OR9L 3M17B 4G6AD 5CCKH 5B8CC 1FL3B 3QCUH 5DVNA 1IC7L 5DSCA 1MFCL 3MPCA 5GRJH 1AR1C 4NCDA 2XTJE 2AV1B 1O7SA 1QSZA 3NCCB 1A22B 2X9WA 3QUZD 2P47B 4MXQC 4MMXC 2R0ZH 3SHSA 5HHOB 1AE6L 3FQNA 1IE5A 5DO2C 4X99B 4M8VA 3MRLA 4OLEA 4Z7WA 4JDZB 1DEEA 3UBXB 1JUFA 2R2EB 4NO0B 3KDMB 4ONHB 2GFBA 1AR1D 5FYJE 3FONA 1QLFA 1DL7H 4HV8A 3CVHA 4LSUL 4BZ2H 5IVXA 4HIJA 5EO1B 3JTSA 5JW4N 3OPZL 3TZVB 1S9YB 2NW2A 2OS7A 3LVEA 1Z5LB 2DOCA 3RWEB 5F6IC 2PXYA 3KPRD 4I77L 3IDJA 1KEML 4RZCB 4E41E 4LCIH 4NFCA 3PABA 5DRXA 4OD3H 4XXDA 1UKSA 3PWVB 5B3JF 5GS0H 1RFDH 5B3JE 5HGDA 4K07A 3MV9D 3JTTB 1JZ6A 3AY4A 3HCVA 4JG0L 4OF5A 2ZUQB 2VL4A 1MF2H 4NFBA 3CVHL 4UZGA 3HI5H 4Y1AE 4GLRH 4RA3A 2Z31C 1RZKH 3TH2T 3VFNA 5LCVH 3V7MA 2D3VA 3QUXA 4F15B 5DK0B 3SE9L 3IDMB 2HG5A 2X4NA 4WTZG 1K2DB 1P4BL 2IANB 1H8OA 3PQYB 5JNYB 5FF6B 1KB5A 1MHHB 1V3MA 2AXJA 3O3AA 3PF2A 4Z78B 3EGSA 4JFDB 2CKBA 4PLKC 5C71A 5IFJB 2HTKD 1IEBA 5GXBB 3VXOB 1V7NH 2VUYA 2HYMA 3LKPB 5FYKD 4L29A 1W8OA 4HWEH 4MJ5A 3PWLA 3UTOA 2Y23A 4XPGL 3VW3H 5F88B 1LVEA 5HI3C 2NTSP 4XP4L 1WWWX 4GAJH 1OSZB 1RZ8B 2P4AB 2H9GB 3T2QA 1F13A 4PLKD 3SKMB 3QIWD 2CKBL 2QQQA 2X4OA 4HEPG 4YO0A 3D9AL 2DLEA 4BQ6A 4LMQI 3DVGA 2VZ1A 4XVTH 3OXRB 1BZ9A 2EYRB 1ZHKB 3C60A 3KPPA 4LPWA 3HUJA 5I6XC 5IWLC 3FFDB 4H20L 3ME0A 1PX4A 1AGDA 1ORSA 1PAMA 3DX8A 5C0DA 5L6YH 4JB9H 4OZHB 4V1DD 3T04D 5HI3D 1QVOA 3ORJA 3OKEB 1NCDL 1J7VR 4QHMA 3O9WA 3NTCH 3QAZC 3P11L 5JORA 1CXKA 5E8PA 2R29H 3TBTA 4YDLC 4PRHD 3O4LA 4WUUB 3AUVA 5D7SH 4NKMA 5C0BE 3LMJL 2AEPL 3WIHA 5LWYH 3QEQE 1IM3A 3CXHK 1I7TB 3LKOA 4HS6B 3KPTA 3I02B 3NABH 2V7HB 3GBNH 1F4XH 4L8SA 2J7LA 1T2XA 3BUYB 2VLKE 1D5IL 4HJGB 3IU4H 5TQ2L 2BNQD 3RDTC 4A2LA 4EIZC 1IGMH 5CKAA 3RVTC 5JHDB 4HHAA 4HUNB 3SGKC 2R0LL 4D9LL 4LPTA 3MLWH 4ZUUB 3BP4A 1HXMA 3NIFF 4BSWA 3NIFE 4HBQA 2PO6B 2Z93A 2GJZB 3MBXH 2DQDH 1GHFL 1N59B 1UB5A 1A1NA 2R9HC 1JNJA 1L6XA 3VFVA 2YPLB 1AXIB 1RK0B 2KUTA 3GSXA 3CFJA 2UVFA 5TDOA 4RCAA 5TE6L 1MHEA 5T1MA 5IEKA 5BVPL 3GSOA 2VLJE 1EGJA 4O2CA 3SDCC 5DJCB 5CEXA 5EU7E 1QSFA 4ZDHA 3H9SB 1HK6A 4DGVH 2MWCA 2JJSC 1PZ5B 3V4UH 3IS0X 3DIFB 4LHUD 5IVNA 3MLZH 4QRSA 3GMPB 3RX8A 3VD3A 1DFBL 2EDFA 3DV6B 4NM8L 3WYRA 1S9WA 4GW4B 3S4SB 2V2TA 5CWSA 5D96B 1DN0B 3H3PL 2VIRA 4OZ4B 3RI5K 1U41A 4YEFA 2W60A 3RFZC 1CBVH 3I6GB 4TPRL 3B6SB 3SDCD 1FO0A 1EGJL 1ZHLB 3CFDB 2HLFD 3RUGB 4PGDB 3BQUA 4LRNH 5JOPD 2NY5L 3VXQB 3GHBL 4M03A 1P5VA 3L5XH 3AM8A 1KIRB 5D5MF 1ZGLA 5D5ME 1QEWA 1XF3A 4QXTA 4XPHH 3P0VL 1L7IH 5EFIA 4TNWF 2H8PB 4U1HA 1KV3A 4K8RL 1AD9A 3MLYH 3Q3GA 4NQEB 4NRYA 3S37L 5GGVY 5DK3A 1LK3H 1NBZA 3MA9H 1FO0L 3T0XA 2WBJB 1BZ7B 2QSQA 3GSQA 4N9GA 1E4KC 2HFGL 3OKOA 1HOCB 1YEEL 5FO9A 3TVMB 3D3VB 5IV2B 5IHZB 2ESVE 3MUJA 4NP4H 4I0PC 2AXGA 5HBBA 4DGIH 1DANU 4DFIA 3HG1D 3ARGD 1QFPA 4GRLD 3WHE0 3QNZA 3BDYL 4N0YH 4G3YH 3MODH 4KVCH 4CMMB 2HKFL 5JA8B 5I8OH 4XWGL 1NJ9A 1A1MA 5CEZE 1FLRL 4G8FA 2GSIB 4MHHI 1HHGA 2E27H 2OI9B 3E3QC 4M5ZL 5J13C 1TCRA 3EJJX 2HVKB 1UACL 1I9JH 3QDGA 3Q6GH 2EE3A 5IG7B 4LQFL 2XN9B 2H32H 4JFOB 1WIUA 3A6BH 2JJTA 4WW2B 3CIQA 1AGFB 5JMOC 1JFQH 3IDYB 4R2GD 3FO1B 5HDOA 5F44A 4G8GB 3HC0B 5T3ZL 4Y5YA 5F9OL 1BVKB 2B4CC 4M7ZB 2X1QA 3GSUA 4X6FB 2XXCB 2NY6C 3RNKA 2AVGA 4TVSa 5MHSD 5GS2H 3QFDB 5FYLE 4Y8DC 1RZGB 5CS7A 2NTFB 3KPQB 2Y7QA 5MEQB 4JRYD 5KZCB 3O11A 1IGJB 3HNTL 1JPFA 1UCTA 1MQ8A 1HEZB 2VC2H 4BH7B 2ZOKB 1VEOA 3NCMA 1BGXL 3VRIB 4LU5L 4NDMB 4AH2B 5ISZE 4JPIB 2AXFA 1XGYH 4DJMA 4XVUC 1HHHB 4OM1H 1VACA 1KCSH 5AUMA 1A6AA 5ITBH 5INCB 1YY9C 5KVGH 4IS6B 1FZMA 4PPTA 2FCBA 2N4IA 5FGCB 2Y07L 2DLGA 3QQ3A 4JDVA 1NPUA 3BPCB 3O41B 4MJ4A 1E4WL 1Z3GH 5ICXB 4EUPH 4FTVD 3VA6A 1W0VB 4FS0A 4XVUD 4TNVF 4X6EB 3QI9A 5JDSB 4YXHL 1A3RH 4HLZH 3I50H 1YYMH 4M6AA 5E2TL 3FRPG 4UNVA 5H2BA 1S7TB 1GOGA 4G7VH 4WUKL 1NL0H 4GSDH 2DLFH 4E0RB 3BISA 3RWCB 2IFFL 4FQPA 3RL1B 3VXSE 3HI6H 4FABH 4ZFOA 1BOGB 3RWFA 1MCWW 4M1DH 2EYTB 3GEWB 4MB3A 4PJ7B 5KS9F 3T4YB 5KS9E 4Y89A 3FB5B 2F54A 1T1WB 4DGYL 3TBWB 3FT3B 4NWTH 4RSVA 1UJTA 1TQCC 1LO4L 4X7SH 1NCTA 3SPVA 3GSRA 4OCXH 1T66D 4FQXB 4HK0A 5H35A 4WTWA 3VXRE 5HHXH 4ZPTA 4EI5B 3LKRB 3KNBA 4JN2A 4DN4H 4NIKB 3GJFH 4X5XB 1B0GB 2VQTA 5DQDL 3EJYC 5CEYB 2ZCLH 3KXFB 4ZFOL 4D0BA 1IAIH 5IB1A 3VWJA 1F3JA 2ARWA 3LPGA 3O2WH 4M7JH 3SDAB 3LS5H 5EWIH 1YYLL 4IIQC 1DUZB 1I1AC 1SEQL 4AENA 4L3ED 4FFZL 2AJ3B 4FNLL 1XGTA 2I27N 3CDYA 5L2KD 3RWDA 4D0DA 4AEHH 3V7AG 2Y06L 2EYSA 5GRJL 1I8KB 3CFIC 1PLGH 3WD5L 4JRXD 1I9EA 4KQ3H 4LFHG 1S3KL 1LO5A 1MPAL 2NZIA 3X13B 3KYKL 5KJRL 2O5XH 5IBTH 2Q20A 1OPGH 4ISVB 5TPWH 1C16A 3MRBA 1QO3A 3BWAB 5KW9H 4M3JA 2R0ZL 1T5WB 3G04A 4DCQA 2W9DH 3I3EA 4LGPB 4OSUH 4OF0A 3H2WA 3D1MC 4I8DA 5C0AE 3IKCB 2VN4A 4P9ML 1GGIH 5EDXA 4J3XA 1MCBA 1I7UB 3QHZH 4YFEA 2DQCH 1Q0XL 3BHBB 3LPFA 2FHFA 3KPOB 1DL7L 5I1KL 4GAGL 4S0SD 1AO7D 4JVPA 1AGEB 2CMRH 4GKNA 2Z8RA 3QXAA 4LKCA 2BC4B 1T03L 4K3JH 2OTPA 1OWWA 2ILLA 5FHAH 1JNNH 5KVMC 2FNBA 1JYWA 5BXFB 5FCSH 2ZZUT 4JFZH 5DJ0A 5FGBA 3KYOB 4FQ1L 5GS0L 1RFDL 2JJUA 4MJID 4X4YB 5C0CD 3WO4C 5E24E 2IQAA 1URLA 2V2XB 4ZAKA 3HI5L 3JWDH 1RJYA 5LCVL 2PXYC 3TF7C 4GUPB 5CMAA 3W0WB 2OSLA 5F1KC 5E2WH 4N0CC 5K9QI 4Z0BH 3O2DH 2BSTB 3QWQB 4YPJA 5D2LF 3TBSA 1RUML 5D2LE 4BM7A 1X4ZA 2LE9A 1A4KA 4Z7UA 3HB3C 1CQKA 3AY4C 3TA3A 2EH8L 2WQRA 2NYYC 3MR9A 4P5KB 4W6YB 3MJGX 1YPZF 3BXNA 5BVJB 4WEMB 3MJ9A 1V7NL 4G9FA 4QRRB 1X7QA 2GK0A 3BN9D 3QPQC 3QUXC 3LQZB 1DQTA 2FYYA 4H1LH 3PL6D 5CD5C 1MCJA 3O6FA 3C5SA 1FJ1B 3TLRA 3VW3L 3ZZ1A 1OOAA 1FVEA 4RWYH 3THML 2HT4C 3QULB 4K9EL 4HXBH 4N0CD 4ZXBC 4N0FA 3SKOB 5MEPB 3TNMA 2DQHH 3B83A 3HB3D 4ZPVB 4X9HA 5T5NG 5EC2A 5DUBB 3V5KB 1MI5E 3U6RB 4JR9H 1MWAH 4LSDA 1P7HL 1U8OB 4GAYA 4XVTL 4DKEH 4RBPK 5CUSH 3MJ9L 4KQ4L 3BH9A 4NNYA 4I2XE 2EH7H 1GZPB 2JF1A 2APVA 3EYUH 3HZVB 4HXAH 1E4XL 1UA6L 4JB9L 3C8HA 4JRWA 5DHVH 5F9JB 1VB9A 5FA4B 3VG9C 1R24B 2BVTA 4KI5C 4ZXBD 2DL2A 3GMOA 3T0BA 5I1AA 3L3DA 2BMKB 2VNCA 4UQ2A 2GAZA 5ID0A 3WHE1 4KC3B 3BKJH 5A3IC 3VFGH 2P44B 3S35X 1QBBA 3RX5A 1FZOB 1HSBB 3TJEL 5D7SL 1OTSD 3C60C 4IRSD 1YEFL 1PVHA 4Y16A 5LWYL 3DUHA 3O45B 4LF3B 1K85A 1UXSA 4L4TD 2VDNH 1RZJL 3LDBB 4NQCA 4ELMF 1NMBL 3LSOB 4M48H 4ELME 2ADIB 2FHCA 5GGRB 1ONQA 4ODVL 2BK8A 3SKNA 3IU4L 3KPRE 1KTDB 1BBDL 1GZQB 1NQBA 3C6LD 5A3ID 1M05A 3PP3H 4R90H 3KLAB 1FE8L 2F8XC 1NGZA 2R0KL 3MV9E 3D39A 1P7KA 3FQWA 4OCYH 2WBWB 3C5JA 5CZKA 5J1AB 2J4WH 4GT7A 2FR4A 1NGWB 3BZ4A 3IXAB 4PRPD 2GUOB 5TJWK 1EO5A 1QBMH 3FFCA 3ULUH 3EFFB 4Y19D 2NZ9D 1W72H 3QDMD 1UZ6F 5EULV 4JQIH 1UZ6E 3W5MA 4F37F 5FHBH 4MZ2A 1QBAA 2HFEB 1MELA 3KPLB 3SDYH 3MV7A 3H3KA 1PQZB 1UM4L 4YUEL 2BNUA 4K94H 4PJBA 1G6RH 4F7CA 5I0DA 1T1ZA 5B38A 4GQPH 2NY7H 1JHKH 2OP4H 4N0RA 2V2WA 1IGCH 5FYKE 2DWEB 1X3DA 5IR1B 4XP6H 2YN5A 1IC4H 3TO4D 1CT8B 4S10A 2E6PA 5BS0E 2V9QA 1B0RB 2RCSL 6FABL 3PNWB 1C5BH 2P24B 3V4VH 2XIDA 5I1JH 5LQBL 5J6GA 4HKBA 4M61B 3TYGH 4N0UB 2ZSWA 1JI1A 1L7IL 3HE6B 2UWEA 2AJVH 1RJLB 2IALB 2NY3B 32C2B 2X1OA 1KJMA 3S3JA 2OQJB 3MV01 4MCYB 4OZGF 3K0WA 5T1DL 4OZGE 1EEQA 3FHQA 4AZ8A 1ZLUH 1INDL 5GPRA 3BQUC 2YMXH 3E2HB 2VITB 5F89A 5F1NA 4ODXA 1A64A 3CPLA 4V1DE 5E2JA 1FVCA 2H32A 3AM8C 3VDCA 4NZDA 2F15A 4NP4L 3K2UL 3OTTA 4DGIL 4H88H 4MVBC 1T5XB 2GJ6D 4MX7A 4CVZA 2BFVH 4HK3N 4XAKE 1JI2A 4F7EA 1OSPL 1KB9J 3U48A 4G3YL 2R8SL 1KIPB 1QACA 2EEBA 3MODL 5F7NC 1U8NA 2AS5M 3CFEB 5FO7A 1U2CA 2NX5A 3LRSB 4TULH 3MRPA 1E27A 4J3WA 2CLRB 5SV3A 2E27L 5EU3B 3KLHD 2H1PH 3BW9A 1QHOA 3Q6GL 3JWOL 4HG4J 3LIZH 1VESA 2EC9T 4YC2B 3MOBH 1QRND 5KTEL 3B2VL 1CDHA 2WWKT 1RD6A 2VLRA 3J7HA 4IRJA 2O61B 4PGEA 4P46C 3ZKQD 1DQMH 2HMIC 1R5IA 2R1XB 4FRWA 5IFHL 4LHJB 2JJTC 2IJ0C 3ARDB 4QOKB 2XA3A 4NZTH 4U1NA 3M45A 4NBZB 5CGYD 3VGFA 4Y5YC 1Q9WA 1GH7A 1A3LL 2OBGA 4Z9KB 2EEDA 3R1GH 1VPOL 3ARFA 2P5WB 4EUPA 4MAYB 3CX2A 1MJ7L 2JB6B 3UTTD 5IB2A 3TFKC 5DMGD 1FL6A 4ZD3H 1KCSL 4P46D 3MNWB 5ITBL 4CRPA 1E28B 1TFHA 5I2IA 2HMID 1DLHB 3P9LB 3PGCA 5D1ZA 4HAFA 4XHJC 1EDQA 5AYQA 3ARBC 3BJLA 4L8BB 2GCYB 4OTXH 1JJUA 3B9KB 1CR9L 1KCLA 2CRIA 5ESVA 3CMOH 2PYEB 3EYFB 3BGMB 1IZJA 1Z3GL 3QIUD 4QLRA 5I75C 4LVHC 4GKSA 3TFKD 1DQQA 1J0JA 1OTTC 1IAII 3S7GA 1AY1L 5F7DB 1NUGA 1OB1A 5LVEA 5A1AA 4PUBH 1MOEA 1CG9A 3ARBD 4MCZB 2E9BA 4FQHA 2DLFL 2OTUB 3GJFA 4R26H 4JZNA 4FABL 4NUGH 5HYSG 2CDFA 4WFGD 2FATL 4JO1H 3N85H 4DQOH 3G6JB 1AGBA 3AAZA 3HG1E 4KDWA 3S36L 3V8OA 4ZFFB 5CIPH 4RISL 1FFNA 4XNYH 3QI9C 4W4OA 2XICA 1ACYH 2VN7A 1TTUA 1U9KA 3QG7L 1VDGA 3WFEH 4XC1H 1NDGB 4OCXL 4OCNC 4JFFD 2YD5A 3HC4L 5GSRB 4LEOB 2ZCLL 1ZT7A 1A0QL 1XGQA 2CK2A 5AAWA 1IAIL 4BFIA 3MRKA 2PF6A 1SJVA 5SWZD 2EDHA 4OUOA 4CL7A 3WFBL 1JE6A 3HI1A 4OLZH 4UAOB 2LABA 5C09A 4M62H 5T33H 4A6YB 3KPSE 3ROLB 1DE4B 4ZODA 5KSBA 4NHCL 5I1HH 1AQDA 1FYTA 1IGFH 4NZRH 1H5BA 5MHSE 2AP2A 3E3QE 3CSYA 3S96A 4AEHL 4W6WB 3T1FA 2CH8A 1U95B 3PGFH 2W59A 5JW5A 2XACC 4UV7H 4Y4KB 2MOVA 1S7XA 1TITA 1IBGL 2WINA 3IDNB 1PLGL 3C9NA 3BUTA 2VUOA 1NMAH 3FTGB 3G5VA 2YBRA 2YWZA 4PB0H 3KPMA 4UI2A 3H7LA 4PJ8B 2O5XL 5IBTL 1HNFA 1NFDB 1T0MA 5FM5O 5CHNA 4MQSB 1NCBH 3O8XD 4GKZA 2J8UF 3PWNA 5FCUL 2J8UE 2W9DL 3OR7A 1RMFL 1MCWM 3QCTL 4P3DB 1XF2A 2XKSA 3BP5A 1DUYB 1MCQA 4ALAL 5BQ7B 1CU4L 1N3NA 3T3PF 1QLRB 2CKNA 4PJCA 3T3PE 3R8QA 3U0PB 4EZMA 4R2GB 1QSEA 1WC7A 2VXSL 3WUZA 5DK2A 5BRZB 5LKNA 4LLWB 2CMRL 4K3JL 1UWEH 2GIYA 1G0DA 1JNNL 2CJUH 4UV4H 1A6WL 3DRTB 4FTVE 1L9MA 2YD4A 4XNMB 2XY1A 1BEYL 5GS0C 2Z35A 1ZHNA 4AMKH 1H3WM 2OXGA 2NLJB 1OT1A 5C7XH 3A6CH 3VXTB 4KJYA 1WAAA 2DI9A 2YSSA 5IQ9B 2I07A 2IPTH 3QQNA 2X4SA 1BWMA 4YDJA 4NQXB 1RZKC 5DHXB 4PR5B 4FXGB 1R3KA 4JFXB 4FMFA 3ARZA 4H1LA 4ODHH 2P7TA 4PJDF 2DJUA 4PJDE 2OL3H 2D0HA 2I24N 4LLDB 3U9UB 4AYFA 3FT4A 5FGBC 4PRNB 3OJMB 2NR6C 5E2WL 4N8PA 1RULL 4PJHA 1U8JB 5E6IB 3MRHB 4JY5L 1MH5B 2NW3A 1PJ9A 2AK4D 5ICYA 3TBVB 4OCRH 1MWAA 2BCKA 4HKZA 3NBNA 4F9LA 2F53D 2E9JA 4JO4L 3K8KA 2DQFA 4J3VA 5SWSD 3OXSA 4XPTH 3V6ZB 4MJ6B 5CILL 5E9DD 2WLYA 1CFTA 1ZHBA 2AJUH 2BOBA 5DHVA 2NQCA 5JLZB 5TDNB 1KCUL 3UTPD 5I8KH 4E5XB 4BZ1H 4CAGA 5IGXL 2NR6D 2B1HL 4NO3A 4UOJA 1XGPB 1S7WB 1FL5A 3TA3C 1D9KB 1CLCA 1MUJB 3ECBB 4L3EE 2Y6SC 5F21B 4YWGH 3ES6B 4TVPD 4GH7B 2VWEC 3VFSB 5JXAL 5L2KE 2QV2A 3BMVA 5GRZA 4JR9L 1MWAL 2P5ED 4N5EC 1UJ3B 3BT2H 3EZJB 1I1YB 5KSVB 2VO5A 1B3JA 3DMMD 3HR5A 1JNLH 5AZ2H 2X2YA 4YDKL 3O6FC 4LLVA 1MEXH 5ANMA 5EORH 2EDBA 4LCYB 4HXAL 2B1AL 3VMOA 2AI0H 5DJ8B 1S7QA 1F3DH 2OZ4A 1RPQA 3QP3A 4LLUB 4EDWL 1FAKT 5I8EB 3FQTB 3H42H 1J05B 2P1YA 2Y6SD 4GRMA 3ULSA 3ZTJG 1F11B 3T65B 1ZA6A 1U58A 4OUUA 3ABZA 4N5ED 2ZKHL 4PBXA 4KKLC 1OAYL 1J5OL 4LCCB 3DUSB 5D9SA 1JMZA 1RUQH 5F72S 5HYQB 3FHAA 4Z95H 1IGYA 1VFAB 4PY7B 5HGGS 4FZEH 5DEFB 1EUUA 1AO7E 3QCVL 4LKXA 4XPBL 1BZQK 3X3FL 2JB5L 3CXHJ 3SDXB 1W72A 1N4XL 3MREA 1HZHH 2OZ4L 1HWHB 4ONGL 3RKDC 4R90L 5GRYA 4JKWA 3PDDA 4POZC 4GRWB 3MFFA 2R23A 1G6RA 1U8MB 1IJ9A 4MJIE 4Y16C 5C0CE 1JHTB 5I9QB 3FB6B 5IMOA 2EKSA 1WTGT 5KBNC 2J4WL 4X4ZA 2I9TB 5CBEA 4M8QB 1U2HA 4KTDH 4NO2B 3PHOB 3OKMA 3RKDD 2VKWA 4J3SA 4EXPX 2EXYD 4XNXH 4NNXA 4WTZA 4POZD 1A9EB 1J8HA 3KPNA 5C08B 2WW8A 1FIEA 4ODTH 3SY0B 2X4TB 1G6RL 1Q94A 4OKVB 4JZOB 4X6DB 1GPOH 2AJYH 5C3TA 4RWHA 4L4VA 1JHKL 3OAZK 3NN8A 4Y5XA 3L7FA 3CU7A 4JKMA 4AT6B 4NOFA 4MDJB 4GQ9L 2D7TH 2ZCHH 2IBGA 1G0XA 1IC4L 4BSVA 3EO1A 1LO3H 4NQDB 2FO4B 3NFNB 5D7LD 4C55A 1E6OH 4R3SA 5DUML 4YHPA 3FOMA 3QO0B 3V4VL 1NCAH 2BNRB 3QWRD 4U1KA 3WS3A 1F5WA 3TYGL 3D85B 2FRGP 3PUCA 4H0HB 1M4KA 2K9UA 4W6XB 2C5DC 4KJQD 2A6KB 2CRMA 3T09A 1R6VA 4MA1B 4XCCL 1WJ3A 5EU6D 4OGAC 4TSCL 2XRAH 2YMXL 3LCYA 3WMSA 4N8VG 3Q6FA 3U4BH 4JREC 3S88L 1G7MB 1QR1A 3G9VA 4HMEA 4U1LA 5FYKU 4X6CB 1KELL 4JPVH 4XBGB 1B0WA 1TTGA 2A77H 2XTJB 3BIKB 4PRDA 5A2LH 5TF0A 5FKPB 2DJSA 3PL6B 4GW1B 1NUFA 4ODBD 1MIML 1AD0A 3ILQC 5FOJA 5DD6A 1CD9B 1SM3H 3RHWK 1D5BA 1PG7X 1B6DA 2KPNA 5GJSH 3SJVB 4B50A 1XIWA 4BUHA 1FGNL 1XZ0A 5EBWA 5MP6H 5KVFH 5IF0B 3BH8B 5SX4H 4OFKA 1YEIH 1IAMA 1PDKA 3KVQA 3IB4A 3EW3B 3N0PB 4IHOA 4JFQA 2VDLL 5DC0A 2OJEA 1U3HA 4XNZC 1LE9A 4JQVA 5DVOA 4F7MA 3V79C 3HUJF 5E99H 3HUJE 3BJ91 5I76A 3OKNB 4ZNCD 5DMJB 3DARA 3FB7A 4D0CA 4RGMC 3D18A 3L3OB 2JK5A 4QRPA 3DLQR 3IDIB 2F5AH 4LMQE 4PRPE 1UWGH 5GGUB 1QKZH 1G7QB 2MQ3A 2UY7A 5KSAB 4WW1B 2NY4C 3L3GB 4HIEB 1ZE3C 3QDME 4TQEL 3RY6C 3VH8A 4HW6A 1TJGL 3IFOA 3O4LE 4FQJL 1V3JA 3MBEB 3N9GH 4ODSL 5E94A 4Y1AB 3R1GL 3HNVH 4IRJC 1U8HB 3UTQB 4Y5VC 5FO8B 4L8DB 1IAKA 1T3FA 1Y0LA 4QXUH 3MNZA 4HS8H 3IU3B 1RUKH 2ZUWA 3U4AA 2EEAA 4OD1H 2QHRH 3VFWA 2HT2C 1F3RB 3NMEA 4KVNH 3P4OA 2JIXD 1IM9D 4KK5C 5T3XL 3B5HA 1PKQE 1Q9KB 1S5IH 3REWA 5EU5B 3ARFC 2VZSA 1TZHA 3F7QA 3RX7A 1KTLB 5CIPA 3STLB 3V5HA 5ENWB 4Y19B 4YZFF 4YZFE 5D1ZC 4RX4A 2IFGA 4DOHE 3RTQD 1QSFE 4PUBL 2FHBA 4LK4A 1IRAY 3AU1B 4FFVC 4ZNEA 1CD1B 4K3EL 1EK3A 1UG9A 3T0EB 1NBYB 1U8LB 1JIBA 1HE7A 5IVOA 1KPRA 3QHFH 4K7PH 5HI5D 2BSSB 5JA9A 3FO0H 3UJTH 4UMGA 1DBMH 3RZWA 5IESH 4G6JH 5C07D 1F02I 1T21B 2EIDA 4FZ8H 4HAGA 4Y2DB 3L95A 4FFVD 5C0NC 4YR6B 5EO0A 1U3YA 1OGAD 3SE4C 1MFBH 4EXKA 1ZLSH 2AAVA 1QRKA 2VAAB 5IBUB 3QIBA 4O2FA 5C0BB 5J06A 3EYSH 5CINH 2BVQB 3QJFB 4LLMB 1P53A 3UP1A 1E4JA 4Y4FD 4W4OC 1FSKB 3BE1L 1N7MH 3KYMB 1K4CA 2BOCB 1V7MH 3I9GL 4NQVA 1JTTA 1F4WH 5BJTB 3MACH 3ARXA 1NANH 1TVBB 2UZYB 4M62L 3BZEB 4OV6F 3MYJB 3TT1H 1KLGB 1IAOB 1T22B 1QFWL 5TGBB 1TCMA 3QDHA 2A74B 2NXYB 5C0ND 4P2OD 5IP4A 3EDDA 3PGFL 3VGEA 1Y6MR 2RFXA 2WNGA 4BK4A 1N8ZA 1GJIA 1VGEH 1H3GA 3EOBB 5TH2A 3LEXB 2G60H 2XQBH 4PB0L 5BZWB 4U0QB 3F65A 5F7EL 4OLUL 3GSNH 3DGGB 3V8CA 2GTZB 1IFHH 3G08A 5SWQB 1H5BC 3V4PH 1GGUA 2JELH 1CICB 3TBYA 4ELKA 3V2AR 2XI9A 1CDJA 3OZ9L 5IMKA 4X4MA 5CSZA 1A6VH 1H15A 2HH0H 3S8WA 4HIHB 4F33A 3PIQB 1DVFA 2C1PB 3RWIB 5DJ6A 3OX8A 1DQJA 4K3DH 3RJQB 4OCWL 1BIIA 1SEBA 1JF6A 1SJXA 2OL3A 4HCRA 1PBYA 1UB6A 4EN3A 4NHUB 1YN6A 4KRPB 3RGVD 5E8DL 4D9RE 5JO5B 4LPYA 5GSVB 5DJXB 4WDIA 2BERA 4DKDC 3FRPA 1KLUA 1T2QL 2BVPB 2IPTL 2R39A 4HKJB 5D5MB 3JWDC 3KJ4C 4LPVA 3MLTA 1CGSH 1T0PB 3MJ7B 3GBMH 4DEPB 3U1SH 5ITFB 1GGCH 4KHTL 1ZLVK 2OL3L 3MCKB 2A6JB 1OY3B 4HCRL 3VFMB 1AHWB 4GFTB 1IEAA 2A1WL 4M6NH 3D0LB 4M00A 4CU6A 3IXTB 4R96A 4XNQB 4ZTOH 5AD0B 1MRCL 2ED7A 4GG6F 1CIUA 4XZUA 4GG6E 1LD9A 2P49B 4GXVL 5JW4R 4NYLB 4TSBH 2E7CA 3UMTA 1JGEB 5DJDB 4PJFB 2HLAB 1BQLH 1A7PH 3P77A 2QADB 1HH6B 2ZCKH 2CO7B 3I75A 5D1XD 3UJJH 3ESVF 1JWSB 5C3LD 2AJXH 1HIMH 3U9PH 2D31B 4H5SB 1IGIL 4P23D 4D3CH 5SWZE 2FX9H 4OLYL 3Q48A 4ZS6C 4BZ1L 5HVFB 4NO5B 1AIFB 3PWJB 3U2SB 1GC1H 1FV1A 5ABDE 3D6GA 4YHKL 25C8H 1UXWA 4F9LC 3HPJB 2X7LB 4KDVA 3JV6A 4ORGB 4OLVL 1T80A 1NFIB 1JNLL 1NAML 3OGOE 5JOEA 4UDUA 3UC0H 3JV5A 1X5AA 4QY8B 1J1XH 1FAIH 4R7DA 1LNUB 1T7VA 3AVEA 1A6TB 1W8NA 3MUZ1 4CN1A 4OF3A 2DWDB 2Q6WB 3QSKB 3EOAA 4MAUL 3LKQA 3GSVA 3DRQB 4R7NB 1W0WA 4P2RD 3DGCR 4WI5A 4ZFGL 5IEHB 4I18A 2ZUYA 4LSPH 3L3HA 5F9AC 3VFTB 1AI1H 4A6YL 2H2PD 4PJ9A 1XCTA 2XWTB 3QFJA 4Z0XA 5BMFH 4LHUG 4UTBL 2PCPB 4GBXA 3DVIA 1S5HA 1FRGH 1U8QB 2ICES 1NC2D 3FCTB 2H3NA 2SEBA 1VADB 4ENEC 3P2TA 2IEPA 1F2XK 1F90L 2A83A 1CXIA 2AJSH 4JG1H 1E6JL 1MFNA 1BQSA 3UAJD 2YC1B 3NACH 4HJ0C 2VQ1B 3ULUC 3ZT7A 1N6QH 3PE9A 1L0YA 4H26A 2FSEA 5HHNB 1U8KB 3T0DA 1VCAA 1Q9OB 4Q6IB 2WAHA 1FVDA 2NY0C 2NY2B 2ZG3A 4U1GB 2B39A 4ENED 3QUYC 4K94C 2EDDA 3QA3A 1HH9B 3D2UB 2AK4E 2H41A 1GPOL 2BDNL 2AJYL 5KS9B 2F53E 1CE6B 2DKUA 3C5ZA 1HHIA 2FIRT 1ZXQA 4UDTB 3PHSA 4NKDA 5CBAA 3L5WB 2X4QB 3UTPE 3K8LA 4RDQG 4PY8J 3MRGB 3QUYD 4ZFZA 4RGNB 1NCAL 3WEXA 4PJEB 5ACZA 2ERJC 1ZTXL 2JE8A 5C0EA 3AREA 1QPPA 5DMKB 5JIIA 4OB5H 4MNGA 4RGOH 4D2NA 3BIAX 3HRZB 1EEYA 3MGAA 4ZUSB 2W0LA 5SX4I 1LDPH 4HUMB 5GHWH 1FLTX 5DYOB 3QBTB 2RJMA 1FFPB 3EYOB 4MA8H 1BLNA 4P4RA 5ACLA 2ATKB 2HVJA 2A9NH 4JFEB 3VI3F 2W0FB 4KK8C 3VI3E 5EBGA 5AYUH 5L0QC 4OZIA 1CXEA 2C3GA 3P0YH 1QYGH 3B3IA 2LQRA 2AABH 4G9FE 4D9QD 4PGBA 3T2NL 1HI6B 3LKSB 3NA9H 2J12B 5CEZH 4PJIA 1LE5B 2GSGB 4BQ8A 1VFBB 2ICEA 5IW1A 1SM3L 4PJ5A 5KSUA 1HILB 5FK9B 3X12B 1U91A 3PV6A 4AIOA 3RWHB 4UT6H 1AKJB 4LASH 1XH3B 5D7IA 3M1BA 1HHKB 3VWKD 5HY9B 5KVFL 2IH1A 5I73B 3OKKB 3WL9A 3RIAF 1YEIL 5FDYA 2YUZA 3MGTB 5GGVL 2QQLH 3ZTJH 5CP7B 1DR9A 1KGCE 5J1TC 1T6WA 5I71B 4XP5L 3HZYB 4DUXA 5FYLH 4ZS7H 4PG9A 1O5DT 3BRDA 1QFUH 1YMMD 3ARRA 4IDJH 4JAMA 2BSRA 3CH8A 3PWPA 4WI6A 3QNYA 1F6LL 4QCIB 5D1QA 1X5FA 3FO9B 1HYRC 5AG9A 4HGMA 5MERB 4Z76B 2W0PA 4NJAL 3BAEL 5DFVD 5F9DC 1N0XL 1EAPB 1ORQA 1NSNH 1LDSA 5JPMB 3TJHD 1NDMB 4JANA 3H9ZA 1P7QA 2WIIA 4JQVC 4OGYH 1HYSC 1HNGA 1NLBH 4QHUA 2DJ4A 4JPKL 3DUUA 3WKML 2K7PA 2EE9A 4OLXL 1A2YA 2F74A 4QF1B 4U49A 3MRDB 1K6QL 1RUKL 4IJ3B 4G8EA 5T1KB 1EAJA 2QHRL 4AIZA 5HDQH 5D7LE 1IQWH 1YJDL 5BOZG 1YN7B 2NMSA 4WO4B 2NXZB 4PRIA 5CZVH 4ZOCA 1P2CB 4JQXC 3MCLL 3VXMA 3GK8H 5HHVH 3W81A 1OT2A 1M6OB 3TIEA 3BKYL 4XWOC 4J4PA 1R3LA 3VFUA 1BD2D 1OD9A 3FFCE 4PJAB 5LGJB 3LPWA 1IGTA 3QJHB 4JDZA 5D7JA 1CL7H 4NFDA 5DGRA 1NANI 3MV7E 3RWGB 3UX9B 1MI5B 4NOBA 4PJXF 4PJXE 2XZAL 3GMMB 5DVLA 1RU9L 3BO8B 4LARH 1CXHA 1MFDL 4I2XB 3O4OB 1N64H 2YD6A 3LEYH 4K7PL 1S9YA 1P4LB 5I15H 1CFQA 3HTLX 3GSWA 3MRJB 5F96H 4KUZH 2DQJH 1U6AL 2DYPD 5IB3B 3UYPA 3U46A 5C6WH 4APQC 3GO1H 3QG6A 4OGXL 1T0NB 2IG2L 4TTDD 3OKDA 1ZEAL 1B6UA 1CD0A 3OKLB 3G5YA 4GMTH 1MFBL 1NAKL 1NCNA 4JHAL 2UZIL 3PWUB 4YXLL 3WIIH 3TN0A 3EYSL 5CINL 1AP2B 3T0AA 2VR9A 3GSNA 4KGJA 5E4EB 1JN6B 4HT1L 3V0WL 2G5BA 3NCJH 3UTSD 4UINL 4M5YL 4P2QA 2X9YA 4APQD 3DTXB 4QT5B 4ZUTB 1OP5K 4LPCA 4CDGC 1A9BB 4I4WA 2PW1A 5D8JH 3QIBC 3ULVH 1VGEL 1ZLWK 3KLDA 1DBAH 2XQBL 3C6SB 3HAEA 4QGTA 5DJZB 1PYWA 3IF1A 3LV3B 4QTHB 1KFAL 4Z8FH 4E41A 3GSNL 1LO2L 2R4RH 3KAAA 1ITBB 2NNAA 4U1JA 2QQKL 4KKBC 2LU4A 4FQQB 2EO9A 1ZSDB 2WWMC 3HE7A 5F6IB 3L3JB 2ARJA 3GM0A 3OAYK 2PNDA 3F7VB 5FYJL 2PETA 1SBSH 3MXVH 4M1CC 5CSGA 5GS3A 1Q8MA 2DD8H 1ACZA 3GJEB 2V7NB 2CXGA 5I17A 1FNSH 5I16A 3QDAA 4PREA 3DETD 3GKWH 3G6DL 1CLOL 1VFMA 3D69B 3CU1A 5IT2L 2BHYA 4KY1L 4K8RD 5IB5B 2G75A 3SDDA 3DSFH 2Z31B 4NKQB 2WWMD 2X05A 4Y4HC 3SKUD 2KZWA 4MNQB 5BS0B 3Q5OA 4AEFA 4RQQB 4M1CD 4CADB 3DXAD 2WWKO 5B39G 2VXUL 1DVFC 3R0MA 5DT1H 3SCMD 2VJXA 3CH1A 4NPYA 5ECJE 1FG2B 3DOSA 3U1SL 1UM5H 5HYSA 3B4NA 1U92B 1NH6A 2VL5B 2C9AA 2VDML 4HBCH 4X7TA 4XMLH 4YBQD 2ENYA 1A4JB 5E8OB 4DVBB 4Y4HD 5D7KE 5KVDH 4JM2B 1ZA3B 4ZTOL 5F1IA 1YECL 5CKGA 5GRVK 2Z4QA 5C07E 4PYHA 1Q9LA 4XP9H 4TSBL 3RVWC 5I66B 1EBAA 5EZLA 1MCPH 1WWCA 2V5TA 5DZOA 2KL6A 2CIKB 5D72L 3I3DA 3D25B