5E03A

Crystal structure of mouse ctla-4 nanobody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
VQLVESGGGLAQPGGSLRLSCAASGSTISSVAVGWYRQTPGNQREWVATSSTSSTTATYADSVKGRFTISRDNAKNTIYLQMNSLKPEDTAVYYCKTGLTNWGRGTQVTVSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTLA-4 nanobody
publication title Crystal structure of mouse CTLA-4 nanobody
rcsb
source organism Camelidae
molecule tags Signaling protein
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e03A00
5CKGA 1MIEL 4Z76A 3HG1D 3PP4H 3TCXA 3L3OA 4PGDA 3RTQB 4RA3A 3DMMA 3BN3B 4APQD 4HS8L 3MLSH 1U8MA 5FYJE 3MGTA 3FB6B 4FFZL 5LAXA 4DOHE 2Z35B 1YEIL 1MCKA 5LVEA 4NRXA 4HMDA 3VFTA 3RY5A 4QF1B 5HJ3A 1RUPL 4PJFF 2VYRE 4OGAC 3HI1B 3MFFA 2UWEF 2MHAB 1JJUA 1HWGB 1TPXB 4NO0B 2DOCA 2V5TA 4Z7VB 3R1GH 5LBSL 4M00A 5T3ZH 2V2TB 4ODTH 4MMZC 3RBSA 1RURH 1CXHA 5SWSD 4LSRL 4QO1A 4P4RB 4EBQL 4OGXL 1BX2A 3GBML 3ARXA 3QUXC 5C0AE 1G9EA 2IMMA 1GGCL 4R4ND 2X6MA 4AZ8A 2VRAA 2VZUA 3WN5A 5I1IH 4ZXBC 4LOUD 2YS4A 4I48A 5L9DL 2AQ3A 3SCMD 4EN3A 4OCSL 2BXZA 2DJ4A 3MLYH 4R7NA 4OFDA 2YRPA 4P2QA 5F1OB 3ULVE 3NTCL 2X4TB 1X3DA 4QRPA 5LJYH 2OMBA 2LE9A 4YDJA 3EKCA 2XTJE 4C58B 1JFQH 3CNKA 2RR3A 2AXFA 1JN6A 1I7ZA 4JRXD 2C1OB 1BLNA 2YPVH 1JZ3A 1I4FB 4LVEA 5HHXH 4LLDA 4JFDE 3MBED 1FH5L 5CJXC 4J3UA 1UYWH 5IB3B 2HLAB 1TNNA 4P2OD 5I2IB 4AT6B 3O41B 2BNQE 5D7IA 3UC0H 1UA6H 5FYKH 2DQHH 1ZTXH 3THMH 4YLQT 3EZ8A 2I07B 4M1CC 1EXUA 1BVZA 1VEPA 2ESVD 4XWGH 5A2IH 1U92A 5HDBE 3GM8A 1FZMB 5DURD 1HINL 1UT9A 4DK6A 3VXUE 5BVJA 1WVZA 1KCUH 2WSKA 3O6MH 4PRPA 4ZOCA 1E4XL 1AO7A 4QT5A 1CXLA 1FLRH 2CK2A 4MNQE 2AQ1A 2EICA 3BRGC 3ARFD 2WBJD 3LS5L 3KPPA 3RWJA 3MOBH 4DW2L 1KEGH 4X4YB 2DQIL 4MA1B 5J8OA 4MLSA 3ZE1F 4YDKH 4LNRB 4F7PB 2G9HA 3RZCB 4JFXA 2AJZB 3KS0J 4KJPC 3S34L 3T0XA 5I0ZA 1RPQA 2P46B 5IBLD 4LDLB 1H3UA 3P73A 2ARJA 4PRDB 3MRHB 3DJ9A 1X5IA 3CXHK 3DWTA 1KJ2H 5DA4A 3OB0K 1YEKH 5J3HC 4E5XA 3NPSB 5I16B 5CWSA 3QULB 3SHSA 5B4MD 5IQ9B 1JRHL 5KW9H 2Q86A 1ZS8A 1H3PL 1X6NA 4MQ7B 3L5XH 5IVXE 2QADC 2X44D 3EYVB 1Q9KA 4AEHL 3ABZA 4KAQH 3QH3B 4FQLL 3GI9L 1N59B 4FZEL 1M6OB 1JNLH 5EBMB 2A77L 1MH5B 3SDDD 4U1SA 5FCUL 3T0EE 4XVUD 3MV8A 3FOLB 3QWQB 4QHUA 1U8KA 4DKEL 1MI5B 1LNUA 1I85A 4XAKE 5I18H 3B5TA 1FG2A 2CPCA 4C4KO 3QCTL 4DKAA 1MEXL 1ZEAH 3QO1A 1KIQA 3GK8H 3BP4A 2XI9A 3TYGL 3I75A 2NW2B 2Z8RA 4NZDA 4LSQL 4HPYH 2BJMH 4Y0GA 4RAUB 3G6JB 2VXUL 5E95B 5HYQA 4PJBB 5GSVA 3CGTA 4P0DA 2IBZY 1GCFA 4MGXA 4Y2DD 3RPIB 1OF2B 3MUZ1 3RA7L 1T1XB 3I85A 3RVXD 4IBLT 4PJIA 1IC4L 3L5HA 4TYUA 2CLVB 4K3DL 5DK0A 3FQRA 1YYLH 2DL2A 4KUCD 3V4PL 4G42B 2XA8L 5IMOA 2OJEB 3S3JA 2BVEA 2APFA 2XRAL 5IQ7L 4EVNB 3QJHB 4G43B 3QDGB 4S1SL 4ZYKB 1O7VA 4L4TD 2NZ9D 3KYAA 1G7MB 1MHPH 5E00B 4U1JA 2CUHA 4KWUA 3VXMD 2EDHA 1OB1B 2Z31B 4C59B 4NO2A 5HGBA 2X4OA 5FIEA 5K93A 2MCPL 4JRYA 3DGGA 4OCWH 4OQTH 1JVKA 3O8XC 3LPGA 4GW4B 2YRLA 4F7CA 2A6DA 5J0BA 4FFYL 4PRHA 4JY4B 4D3CL 4LMQE 3U0TA 2ICEA 1I8MB 1J0YA 5DGQA 1NL0L 2W60B 4HKBB 1NCBH 2W91A 4Z0XA 2EDQA 2R0LL 4HV8B 4NOBA 1G7QB 2JF1A 4XMKL 5CEZH 3A6OA 3RY6A 5AD0B 4PJEB 2VLRD 5D2LE 2FHCA 1A0QL 1ZGLP 1FO0B 3ZKND 3PL6C 3KPSD 1GRWA 2WBKA 4ZTPH 5MEOA 1ORSA 4Z8FL 3BYTA 5CBAA 4NO5B 5GXBB 4OBRA 3U46B 1QFWI 5DMKA 3UTPE 5HYJB 2X4NB 4PJ5A 4RFNC 1ZXQA 1KIRB 5HVFB 1KT2B 2VUOA 1F4YL 2FX7L 1CFSA 2LTQC 4S1RH 5MEQA 5KOMC 1N6UA 2CDFA 2WINA 2FYYA 3BH9B 2NMSA 4XTRC 1KNOA 4YAQB 3VG0L 5J6GA 4IRJC 3OKLA 4WI3A 2RGSA 1R24A 4KDTA 1HHJB 3G5ZB 4E41E 3EYOB 3M8OH 4PGBA 4GKZB 1WQVT 4NQCB 1NUNB 4JB9H 5SX5K 1KXQE 3FO2A 1PX3A 4L9LC 5DS8A 1X5HA 4R0LC 4IHOA 4J23A 1I8KA 1IGIH 4PJGA 1E27B 2IANE 3QUKB 3RJQB 5HI4D 1QRNA 3PHSA 1T1ZA 3S36X 2VSDA 5EPMA 4O4YL 2DQFB 3BMWA 3PP3H 1F11B 3ULSA 2Q3AA 1IGMH 3GSVB 2I25N 4JFQA 5ACZA 4DUVA 5KJRL 4WGWB 4W68A 1KXVC 5IHLB 1OLLA 3CMOH 4D8PA 4O51B 3T3PE 5EZJB 5D1QB 2XWBA 2V7HB 2VTFA 5F88B 1PQZB 1F3DH 1N64H 4M6AA 3RWHB 2E7HA 4R9HA 1M05A 5CD3A 1JUFB 1HKLL 1S78C 1T0NB 3IB4A 2DLEA 3HRPA 4EDWH 4OGYH 2VZ1A 2A0LC 4N0CC 4XRCB 1U8OB 3PIQB 5DJ2B 2R39A 4MD5A 1BZQK 3O4LB 4XX1G 3GO1H 1VFAA 3L7FA 4XP9L 4M6NL 3PGFH 3ROOA 3VWJA 4PTTB 3H9SE 5HSFA 2GHWB 3GNMH 5GHWH 4YHLL 5F9OH 4NC2B 4OLXH 2CKBB 2W9DL 3QNZA 4OLUL 2R1WA 4DTGH 3IGAA 1A1NA 3D25B 4GFTB 3TYFB 4XH2A 3L5WA 1B9ZA 4MJ6B 4DOHB 1QP1A 2HLFC 2VAJA 2GUOA 1HHGA 1RZ7H 3KYKH 5BMFL 2VXQH 1OCWH 2EIDA 5F3BB 4JM4H 3ZE2F 1D9KC 1CDIA 3FFCE 4LDEB 4YDLC 1KJ2A 2QQKL 5ICXA 4LCYA 1JTTA 4LFHG 5HY9A 5HHNB 4OGAD 4MA8L 3QIWA 2IH1A 2OR9L 5KSBE 4IEFB 3GSWB 5TDPB 1U3JA 4LK4A 4LVHB 3OG4B 43CAA 3T1FB 5LWYL 1D6VL 4YO0A 5FKAA 5B39B 5B3JE 5C0AB 1MFCH 1AD0B 2B2XH 3GKZA 4HKZB 2WQ8A 2IAMA 4ZS7H 3QUXD 2N4IA 1JNHA 3D3VD 1AD9A 3BJLA 1GOGA 2EE9A 4R96B 4FQCH 4NWUH 2HT4C 4LPYA 5JOFB 5HDQL 1OY3B 4KPHL 2E5EA 4ZXBD 5L8KB 3VDAA 4Y4HC 4NN6B 3CLEH 1J18A 1EK3A 2FECL 4I77H 4AY0A 1W72L 4S0TD 4YPGB 5ABDE 5T33L 3LCYA 3C60D 4LBEB 4MJID 4OT1L 3T2PA 2N7AA 2QSQA 2XTJB 5EOTB 4GAGL 4TTDC 5ADPH 5LKNA 3IJSA 5BS0E 1NC2B 3RDTC 1DFBL 4L8BA 2X9WA 1G6RH 1RZJL 1YYMH 4N1CA 4Y16C 5DEFA 3S35X 3CXDL 1V7ML 1FJ1A 4JFDB 4ZO7A 3VGHA 5BJTA 1A7NL 1SM3H 2JIXB 3F7YA 5DHVB 3QJFB 4ELMA 2DTSA 2EDEA 9CGTA 4L8DB 3DRTB 1MIMH 1ZLVH 2BNQB 1T5XA 1QSED 3DV6B 3G5XB 3B9KB 4YEFA 4RISL 1A7OL 1EEYA 2PW1A 5TH2B 4YBLB 2D4FA 3RWCA 3BXNA 4HZLA 4PY7A 1BBJB 2Y06H 5B39G 3MC0A 1FYTD 4M1CD 5I75C 1Q0YL 1FPTH 2HG5A 3ZDZE 1AI1L 4GMSH 3LQZA 4KKNA 1S7VB 3B2VH 4UINH 3TPUB 3NH7L 3VXUB 5ANMA 1WEJH 3D6GA 2AJUL 5IM7B 4UTAH 2NXYC 5HI5D 3L3IA 1HN1A 4MNQB 3LEYL 3ARBC 5C0FA 1L7IL 3AMKA 4EZMA 1I9IH 4IIQB 3MRRA 1UWXK 2J8UF 3SKMB 2VLKE 4OQTA 4XVTH 4EUPB 2EYRA 4FQXC 4CU6A 2SEBA 4H20H 1EH9A 5IWLC 1ES0A 4X6CA 5JLZB 1CGVA 4XCCH 1AHWA 4HWBH 3ARDD 1LO2H 1J1OH 4HGMA 4KJPD 1JZ2A 5IHUL 1MVUA 2ATKB 5AUMA 5JO5B 1TZIA 3RL1B 2DN7A 1Q72L 2HRPL 2VLLA 4NHUB 4G8FA 4JY6A 1HZHH 5E6ID 5J3HD 3EGSA 1FC1A 1S9WB 2EEBA 5EIVA 5IGXH 3QIUA 5J56B 1TJGH 5MP6L 3CSYA 1QUNA 3VXTA 2EXWC 1MFEH 2DKMA 2Q7YB 5IVXB 3CDYA 3W39B 1MHEA 3SKOB 3DUSA 4G7YL 1MJUL 2QADD 4WHTA 4OF6A 1JE6A 1GPOL 1JWUA 5C07D 1KV3A 1W0VA 1Z9SA 4X4XB 4PY8I 4JKKA 3T0EB 3NFSH 2JE8A 5E99H 3UPCA 5AZ2H 1RULL 5KSVB 3TVMA 4PJ8B 1P7QD 1EEQA 2VXTH 2J88H 3RNQA 4F9PA 3ARUA 1HHHB 2A6IA 5C8JA 5I1DB 1Q94A 5IHBA 5E08H 5LGJB 2IALA 2A9ML 4MCYB 3FO1B 1JHLL 2YWYA 3NIDE 4CVZB 2YN3A 1I3VA 5CEYB 3VXSD 3D85D 1VPOH 2V17L 3LAFA 3HPLA 1VGKB 2VDOH 2VL5B 2OCFD 4F8QA 2ZG2A 5D96B 2P8PB 2F54D 2HN7A 3U7WL 4PRNA 3MOAL 4NYLB 2FSEA 1JIBA 4WW2B 4KTDL 5C0BA 2Q8BH 4N8VA 3S96B 3NACL 4WWID 3EYQC 4YHNA 5F3HB 4BFGA 1F4WL 5F1SA 3ECBA 1HSAB 3HUJE 5FGBA 5I9QB 5IB5A 3RVUC 3WIHH 3S37X 1TJHH 1XR8A 2E27H 3E6HA 3NFNB 3KLAA 1IT9H 3HE7B 4PJBF 3O11A 3UP1A 5JORB 2CO7B 4TSCH 2CRIA 1HCFX 5FGRA 1J05A 2VR4A 3P9LB 3LPFA 4WWKC 5A16A 4CMHB 3FO9A 3KPRD 5DYOA 3EW3B 1XGUA 3AROA 4GXVL 4U0RB 2IPTL 2X4UB 4Y5XA 3MUY1 3RHWK 3Q1SH 5FM5M 1RJCA 4JO2L 3MLZL 3O8XD 3VRLE 4M93B 5CEXB 1KC5L 5DO2C 3CVHL 4O02L 3ZTNH 5F8RC 1LO0L 3J7HA 3E8UH 4PLJC 3DLQR 1RZJC 4FQHB 4HMCA 1WAAE 3QI9C 3I50L 1BFTA 5D2LB 3EDEA 4HWZB 1CIUA 1ZVHA 1WBZB 4GG8A 3RWEA 3ULUF 3QFDA 3RGVC 4TVPH 4C56A 1XF5B 1S7XB 3PL6D 1N7ML 4KI1A 1EO8L 4ZPVA 3LIZL 2VDKL 1EFQA 3BVNA 5ICYB 3UROR 3GMMB 1KF9B 3OB0H 3QCVH 3ARRA 3HC0A 1EJOH 3G5VB 3V0WH 1DDHA 1DN0B 3F7QA 3TJHC 4IS6A 1MF2L 3UTTE 3TN0C 2DQEL 3HNSH 4YBHA 3M07A 1MY7A 3OKKB 1JGUL 4Y5VB 1RUQH 2Y36L 4GW5A 3ALWA 4XTRD 1F58L 3UYPA 4X99A 2EEAA 3U1SL 3A6BH 4E41B 3QEQE 1XGPA 4RGNC 4IRJD 4JZJB 4I18B 4PJEF 2QLVB 2NR6C 5CAYB 3D39D 4X6DA 2ADFH 3T2OA 4HPOL 1E4WL 2HFGH 4ONGH 4MA7H 5F89A 4YHZL 2ZUVA 1A22B 2IANB 4NO3A 2PO6B 5KN5A 3KJ4C 4EI5A 5KVMC 5FOBB 4ZFZA 1U93A 3U7YH 4CDGC 1KENL 2QV2A 3BAEL 4P2RA 2O93L 3IFPA 4HS6A 1SYVA 2HH0L 1F42A 4GRLA 4Q9QL 1JPTL 5JZ7C 4XHQA 2V5SA 3ARYA 5E5RB 3L3DB 4O5LH 4ZNCD 4XP1H 3UEZA 5FYLH 3WFBH 3VH8B 4M7ZC 1T1YB 5J1AA 4L8SC 2X9XA 1V5JA 4Z9KB 3DROB 3AREA 5HYSB 5C08B 1KPVB 4JFEE 3C09C 4Z5RA 3U4EA 4G6KL 2FJFB 1BZ7B 4U6XA 2H32B 5FUCC 1FE8L 5F7EH 1S78D 1DBBL 5D2NA 2OTWA 1J8HE 1MLBA 2A0LD 2C1PB 3MRJA 3C2SA 3PWJA 4M8QA 3V6ZB 5IEKB 1T5WA 3RGHA 1BMGA 4HH8A 1BIIB 4I1NB 3SE3A 3H9SB 3MLRL 4HG4K 2P5ED 3DPBA 4OF7A 2P8LB 3TBSB 5H37H 4D9QE 3KAAA 3LH2L 1JGLL 1UM6H 1S9VA 1UKTA 1PDKA 2QSCL 2X4SA 5E4EB 5L6YL 4N9OB 32C2B 4XBEH 3BKYH 4XCFL 2AI0L 4UU9B 1KG0B 2PCPA 1LMKA 3OX8A 2DQJL 4GXUM 4XVSL 3IFLL 3QIBA 4LAQH 3IS1X 3D0LA 4JZOB 3GBNH 4XB7A 4BM7A 3MV9D 4JKPH 2R8SL 2HLFD 3FFCB 3GSUA 4NQUA 2A6KA 2BVPB 1N8ZA 3DVFA 3VH8G 1D9KD 1KJ3L 2BRRH 4PBWD 4JFZH 5TGBB 5HGDB 5HYSG 1VCAA 1PZ5A 1NFIA 3NA4A 3PWPD 1WZ1L 5A43C 5KSBB 2W9LA 3SGJC 1URLA 2VITA 4TUJA 2BOBA 2QEJA 1A6AA 4GO6B 1XZ0B 3PABA 4KMTH 5IB4B 4WUUD 2FL5A 3P9WB 1BFVH 4WO4C 5IIEB 3MUHL 2PXYB 1CL7H 1NJ9A 3D0VB 5HHQA 3CFIC 3EYSH 2MSPA 4D9RE 2Z8WC 3GDBA 4CBPA 4BSVA 5J13B 1WBYB 2HT4D 2HTLC 4ODVL 1AKJA 4Y4HD 1LEKA 3O2WL 5BV7H 4NJ9H 2XNAA 1FSKC 3WNMA 4OM1H 2B0SH 1HH6A 2EH7H 4IRSC 1Y6NR 3EDDA 3K7UA 5BS0B 4PJ9D 1EDQA 2XPGA 4X7TA 4JO3H 3L7EB 5SX5H 1AGFB 3RAJL 3MV01 8FABA 3RDTD 1HHKB 4ZUUA 4Y16D 4GH7B 3MNVA 1YNKL 4MXWL 1CGXA 2G2RA 2G75B 1P5UA 5DWUH 2CH8A 1T1WA 4MB5A 4XC3L 2GJZB 3C6LB 4MSWB 5B8CB 4F3FB 3VA2C 4F7MB 5I8EA 4UILL 3VWKC 2XYCA 1IL1B 3IVKA 1NGZA 3FB5A 1INDH 1PEZA 1OTUC 3SQOH 1MPAH 3P0VH 1LDPL 4DWHA 2HKHH 3CFEB 2CIIA 3CFJB 2CLRA 1EO5A 5D9SA 1EGJL 4WJ5B 1FNEB 3RU8L 3RTQA 3BW9B 5EU6D 3WIHA 3QPXH 1ORQB 3T2NL 4YWGH 3HG1E 1DBAL 5H8DA 2Z35A 5BXFB 3TH4T 4YXLL 1ZA6B 5FM8A 5ITBL 4EIZC 2YD5A 4AIZB 4QF1A 1G0YR 1L6ZA 1ZLSH 2NXYD 4M03A 5BRZD 1YC8A 4IMLB 5JHDA 3VFUB 3V6OE 1P53A 5HHPB 4X6FA 3D9AL 4NQDD 3GJFH 2VLKB 5ISZD 3BH8A 3NCJH 4NO0A 1YEGH 4Z7VA 3INUL 1YY8B 4CRPA 4DEPB 2MMXA 3FCTA 3KYMB 3X14A 3RKPA 4KQ3L 2HP4A 3BZFB 5DVLA 3JWOL 5DFVC 4P4RA 5F7DB 5CFHA 2ED9A 1EZVY 3TO2B 4A2LA 2AEPL 4QRQB 3GSNL 4HCRL 1HQ4B 5SWSE 3BI9X 3O6FC 3WHXA 4XI5C 15C8H 1RZKH 4MHHI 2ILLA 1KACB 1BHGA 1KELH 5ID1A 3QQ9C 1BQLH 2ENYA 1L7TL 1ZANH 1MCPH 1C5CL 3IDYC 3TWCL 5KVGL 3RQ3A 4WI5A 3EZJB 3MJ7B 2VJXA 4LGPB 1X5YA 2O5ZL 2C1OA 3VDBA 3U0PB 1Z0NA 3EDFA 2ARJQ 1CLYH 1GHFH 4ODWB 1TVBB 2HLAA 3PHQB 5EZIL 4AT6A 4HBQA 4M1DH 4I2XE 3WDIA 1JYXA 4HIIB 2PW2A 1IEHA 5IVXF 5D72L 3M17A 4JHBA 4OZFH 5I1AB 5I30L 2VL4A 5IR1B 4E9LA 2I07A 3BGMB 5DC4B 1MFDL 3MV11 3TH3T 1Q1JL 4FNLH 1YZZA 2ITCB 5I66A 3JTTA 4P3DA 2GTZB 5DZOA 1FZMA 2X4QB 3W5NA 2ESVE 2GITA 2HFTA 4L4VD 3ZKXC 3MYJB 1XGQA 5CJOH 3QXAB 3WXWL 3SDCD 4JPVL 1E4XI 4WFGE 2O5XL 1DLFL 3EYQD 2BDNH 4P3CH 4ZO9A 3DGCR 1WFTA 6FABL 3HUJB 4LCWE 3ES6B 2RBLA 5ENWB 3OQ3B 2AXJA 4U0QB 4F7PA 1IGCL 3RVUD 5A1AA 2AJZA 5TQ2H 1F97A 2DD8H 2FX8H 4PRDA 1ZLWK 5AZEL 2IJ0C 1G0XA 3EYFB 3GHBL 4QRTB 4AL8H 3IKKA 5CJQL 5I8KL 4K55A 4M5YH 3T77A 3VGAB 4WW2F 4N0YL 2MWCA 4Z95L 1G9MC 4PR5A 3ULUL 5D7LD 4ENEC 1JRHI 5JW3H 4GLRH 1EAJA 1MHHB 2HMIC 4PRAB 4MA3B 1J10A 3QH3A 3K1DA 1IKNA 1DUYB 1OTSC 1UWXH 2E9JA 3K3QA 5EBMA 4J3WA 2DQCH 4K7FB 1MY5A 5KANI 5KAQG 3QI9D 3T04D 3B83A 5CIPH 4I0PB 3TZVA 5B3NA 3M45A 5HYIA 4KKAD 1MI5A 5DSCB 1UXWB 1ZHLB 3TT3H 3WFCH 2AEWA 1PY4A 4JN1L 3UTTB 5D8JH 2NW2A 2NY7L 5EC2A 2DIBA 4U2ZA 4ZQKB 3TJHD 3RPKA 3TN0D 1NCCL 4RAUA 2IPKB 3G6JA 5HPMA 2YPKB 1ITBB 5IVZA 1AFVL 1TNMA 1MJ8H 4HXAL 1H3XA 1NMCC 1RHHB 2RAMA 3QEQB 4MNHB 1OF2A 3FB8A 1T1XA 3ZTJG 4RGND 3D69A 3HE6B 3BJ91 4NQSB 2VQTA 2WQRA 2NY5H 2FJGB 3FT2B 4DN4L 1TTUA 2CLVA 2BNUB 1NAMH 2C4FU 2R56H 3P0YH 4HFUH 4RDQG 1H9VA 1DVFB 2OJEA 1NFKA 1OPGH 1AP2B 2WUBH 2MOVA 2Z93B 3VFNB 4RCAA 4ONHA 5FF6B 3JWOC 1T2QH 1CF8L 3REVB 3QJHA 4G43A 3QDGA 2FH8A 1CFNB 1SJXA 5JZ7D 3VXQA 4UT7L 1AH1A 4XC1L 1OAYH 5INCB 1KBGL 1X6LA 1D6EA 2CXKA 1QFPA 5GSRA 3O45A 4JFEB 2B39A 4WVRA 1CICC 2Z31A 1MFBL 1YMME 1UCBH 4L3EA 3SKJL 1QSFD 1P4IL 1O0VA 4NN5C 1QR1A 2FIRT 3IDMB 5MEPB 3RWIB 4F33B 3S5LB 2DM2A 3TT1L 1J8HB 4MAUH 1N5AB 4U7SA 2I24N 3ZYZA 1I8MA 5J1SC 3EFDH 3K4ZA 4JGUA 3QG7L 4HKBA 3P77B 4B0MM 4OBSA 1G7QA 4LSPL 4JJHA 1WTGT 4KTEH 5AD0A 4WGVB 4AG4L 1MAJA 4GQ9H 1FO0A 3T3PF 4Y8AA 1AGEB 2Z91A 4OCRH 2VLRE 1IJ9A 2W0LA 3U46A 3KPSE 4MDIB 1TZHB 3V0VB 3PV6B 1OGTB 5L2KD 3HI5H 5HYJA 5DUBB 4R2GC 1WBXB 3B3IA 5JOEA 4HHAA 5FB8A 1UACH 1Y18B 4JCMA 4O58L 2P7TA 4L3CB 1UADC 4NM4H 5GJTH 6CGTA 1FAKT 4G8IB 3OZ9L 4R97B 4JPIB 4K7PH 2VC2L 1AQKL 2VERN 1MAML 1DQMH 2H3NA 2F19H 1CD1A 3NZHL 4PUBH 1JWSB 3G5ZA 4Q9BA 2LAAA 2NY1C 5CILH 3OKOB 4GKZA 4NQCA 2W59A 1YECL 1IQWL 2GSIB 3D2UD 3S5LG 2X1PA 1BQHB 1E27A 3QUKA 1LILA 4I4WA 1PBYA 2EDDA 4N8CL 3AU1B 5I71B 4EN3C 2BY3A 1IBGH 2C7UB 2X2YA 2LU3A 4NNPL 3EYUH 4U1HB 3UJTH 3ETBF 3JWDC 3PP4L 2I9LA 2C9AA 2EDBA 4FQ2H 2HTLD 3DX7B 4YK4B 4FMKA 5GGVY 5F88A 3BPLC 1NKRA 1PQZA 5KSBF 1FGNH 1C7TA 3AXLB 3CDGB 3IS0X 4RMUA 4NZRL 5AYUH 2OTPA 1JUFA 4TUOA 2EDRA 5K9QG 3TV3H 1YC7A 1U8OA 3OWEA 3PIQA 2DQDH 5LCVH 4CJ0A 2ZUQB 5C3TA 3H3PH 5SX4I 1F13A 3AMLA 1J0HA 1LK3H 2ZSVB 3R1GL 1S5HA 4UV4L 1OARL 5T3ZL 2DWDA 3CCHA 3F62A 2YD6A 4ODTL 3MTRA 4HFWB 2P8MA 1CGSH 5IKCA 3KYNB 2OLDA 3VWKD 4K3EH 5GRYA 5EO0A 1DQDL 2C26A 5ETUA 1OTUD 2CKBA 3MR9A 1NKOA 5IESL 1F2QA 2JCCF 4HH9B 5I1IL 3HR6A 4NFDA 4OQ1A 1BQHG 4CMMA 1BWMA 5K9KB 4HJJH 3D25A 1BGXH 3MLYL 3HG1B 4R7DB 3STLB 2CLZB 4NQVA 1RIVH 2A73B 2HFEA 3F6LA 1PSKH 4P3WA 1DQTA 1I3GH 5F3BA 4OCXH 1AIFB 4IDJH 1VSCA 5D6DA 4RAHA 1JFQL 5F70A 5HHNA 2HT3C 1CE6B 1G7IB 2YPVL 1R6VA 1VEMA 4YZFE 3BN9D 2VNCA 2GSGB 4QXTB 5T5FH 1UYWL 4W6YB 5GRVL 1I7UB 5B39A 2HFFA 3ESVF 5DFVD 1AD0A 5CLTA 4RMVA 3QO0B 3VFGH 3ZDZF 1F90H 4ERSL 5SWSB 3MRPB 4XPFH 5TF1L 5FYKL 3QDMA 1ZTXL 5FECB 3THML 4PJXE 3O6FD 4WEMB 4XI5D 2YBRB 5L8JB 4XWGL 5GZOC 4YHKH 3PQYE 2D7TH 1RK0A 1E28B 1OGAA 4LKXB 1BD2D 3VA6A 4JR9H 4M43H 3P2TA 3A6CH 3GJFB 3VXNA 2OS7A 4LBEA 3QUMH 2RHEA 3O6ML 4MZ2A 4HJGB 1GH7A 1QBLL 1NC2A 1FLRL 1I85C 4JDTL 1BZ9A 3WDHA 4BQBA 4HUVA 3MV7E 3BEVA 5K9JH 3MOBL 4JFDA 4FQJH 2JIXA 4HEME 1T7VA 4YDKL 3P4OB 4LLQB 5DRZB 5DJAB 3MREB 5JHLH 4L8DA 5JPMA 1C1EH 4HKJB 5JQ6H 3DV6A 3G5XA 1IAOB 1JF1A 4LSTH 1OAQH 5TH2A 2O5YH 2F8VA 4I3RH 2J6EA 3GRWH 4FFVC 5HHMD 2VR5A 5KW9L 3KYOB 4NUJB 1ZT1B 1AXSB 2ESVB 4LIQE 3TPUA 3L5XL 5F9WC 5FV2A 5T3XD 4DQOH 2UUDK 4KAQL 1QACA 1DQQB 3BPNC 4LHJB 5DURB 5JNYA 2ITDB 4EOWH 3V4UH 3K2MC 4MNQA 1IM3A 3JWNC 3LQAH 3PWUB 3WKNA 3LKSA 3SKMA 3CLFH 4EUPA 4Q0XL 3ARFB 1P7HL 3NIDF 2XT1B 5JLZA 4HIHB 3MO1B 1IRAY 4ONFH 5I18L 2WUCH 3LKOB 5I1LB 1ZK9A 5EA0H 5CZKA 1IAIH 5JA9A 4WRLA 2FBOJ 3W2DH 4FXKA 5JO5A 4LHUD 1HQRB 1CDJA 1FFOB 1AJ7H 4NHUA 1W8NA 3FMGH 4U6HB 4HPYL 2BJML 5KAQF 1T80A 3H6JA 1WIPA 4LCCA 1NGPL 1S9WA 3VFVA 1HILB 4OZIF 3BFOA 3H3KA 4ENED 5DTFA 3T3ME 5C9JB 4N90D 2Q7YA 5IVXA 3W39A 2HMID 4NUGH 1A7RH 5KTEH 3HUJF 3HZYA 3MROB 3U82B 5ESAB 5ERWB 3PDDA 4ZS6C 1OTSD 4M7LH 4X4XA 2MTPA 3T0EA 1KIPB 1YYLL 5AWNL 3GSQB 3IDUA 2M26A 3DSFH 5KSVA 1JV5A 4PJ8A 1X5AA 3I6LD 3SDDB 3TJEH 3C5ZC 3WJLA 2ERJC 4G8GD 3BHBB 4ZOAA 3ZE0F 1K2DB 3OXRB 2Q7NA 1CFBA 2O61B 2V9QA 1A8JH 5LGJA 3WLBB 1A4JB 1MHPL 4YHOH 4E0RA 3VRLF 2HTKC 3FO1A 4RDQF 4QHLB 1U8JB 1H5BA 4CVZA 5CEYA 1RHFA 1VGKA 1CXKA 1N3NB 1G7LA 1WAAF 5DJDB 3BRDA 4G6AC 3ZDYE 4N68A 2FZ3B 3GUTB 3FFDB 4Y2DB 4P5TD 1GGUA 3BWAB 5K59E 5JDJA 3EJZC 4M5ZH 5J11C 1KYOJ 2F54E 2DBLH 3S96A 1NCBL 1B90A 5F3HA 4HWNA 4PV8B 3BX7C 5DF0A 4GG6A 4JCLA 4KKCC 1HSAA 3MLPA 1QZ1A 5GIRB 4KY1L 4ZO8A 4PPTA 3KXFE 1FNHA 1SY6H 3GIZH 3HNVL 4L5FH 3HE7A 5FO8B 5JORA 4UTBH 2ZUWA 5M95B 3OKNB 1V7NH 4S1RL 2FGZA 5E8EB 3V5DB 4DUXA 1YMMB 3DYOA 5SWQA 1CICD 4NHCH 2D31B 1A9EA 2X4UA 1GJIA 3KPRE 1WWBX 5EU3B 4WDIA 4FTVE 2X09A 1R3IL 2OJZL 5C0RH 4OSUH 5DD5H 3MRIA 4JB9L 1WC7A 3OXSB 3D5OF 1UJ3A 2BZDA 4FQHA 2K7QA 1CGTA 1XF3B 1IGIL 5D2LA 1YUHB 1J1PH 3B9AA 2DDQL 4RIRA 4GS7C 1S7XA 2A1WL 1Y0LA 2VLRB 2IF7A 4P23A 5ADOL 2ZCKH 3KPSB 4YIQB 1ZLWH 3V2AR 3B5GA 1ZHNB 1OAZH 3C8KA 4NC1C 2J8OA 1NSNH 3CMOL 4R2GD 4FABH 4CDHA 3OKKA 3ESUF 4Y5VA 1N64L 3VD3A 2XZAH 5T1KB 3F65A 3X3FH 3GBLA 4EDWL 4OGYL 3WHE0 1YQVH 1R3HB 4LVOC 3S8WA 3C9NB 1OAXH 3LDBC 4LVNB 2H2SC 1WFNA 1EO7A 4PP2A 3FAWA 3TNNB 2IAMC 4BZYA 2FO1A 3PGFL 3D39E 2IANA 4OIAA 3GNML 5GHWL 4AIOA 2XWJB 4ZD3H 5FOBA 5F9OL 2ICWB 3MUJA 1IFHH 4WUKL 5CUSL 5FHBH 2E9WA 4OLXL 4EN3D 1YPZF 4I0KA 4P2QD 5DJ8A 4JQXC 4AMKL 4TVSa 1CCZA 1D5XB 4XPAH 4DTGL 1TVHA 2QQNH 3O2VH 2XN9A 4QRPD 3WS3A 1UQSB 1LE9A 1INEL 3DROA 2QQQA 4U3CA 3NN8A 1P1ZA 3KYKL 3BD3A 2NYYC 3H42L 2R2EB 4JM4L 3KS0H 3QNYB 2H32A 4MB3A 3IAPA 4XBPB 4POZC 1P4BH 2ZCLH 4JREB 4U3HA 5C0JA 2WMPA 4QKXB 5IEKA 5E1AB 3V6ZA 1AY1H 4HC1H 4HIXH 3ARGC 4LU5H 1BIIA 3G6AA 4WI8A 1AE6H 3H9SA 2Y6SC 3CFDB 2P8LA 3TBSA 1X7QB 1ADQA 3WFEH 1KCKA 1MFCL 5C70A 2DWEB 4LP5A 5CMAB 3U30C 4ZS7L 1QD0A 3IFOA 5DVOA 2BHZA 1I7TA 2R23A 1KG0A 4HLJA 4ISVA 4FQCL 4NWUL 5E8NB 3HMWL 2BVQB 1PD6A 3VJ6B 3TA3A 4JZOA 4PRPD 3CLEL 3O3DB 4JKMA 2FR4B 1AO7D 3TESA 2F74B 1SBSH 1BOGB 4X6EA 4YUEH 5ADPL 1JGEA 1EX0A 1UB5B 3U0WH 1G6RL 1AHWC 4X8XA 5HGDA 2OZ4H 3MXVH 3K1KC 3TLRA 2HT3D 2RIKA 3TO4C 3FQWA 5KSBA 1E4KA 1MCWM 4DJMA 5J9PA 1EVTC 3GI8H 2CK0H 3OAUH 2AXHA 4R6UA 3PWPE 5D7JA 5IB4A 4O9HH 1G6VK 1MIML 2F5AH 4NOFA 5IIEA 3FN9A 4C83A 1ODAA 1CGYA 4XB8A 4PLOB 3D0VA 4Z77B 1CT8B 4PJXB 5DJCB 1KLUA 3KPMB 4U6YA 2AK1L 2Y06L 4KVNH 3QUXB 4R90H 3ZL4H 4F37F 3D3VB 3BKCH 4G6JL 4OIIH 1KB5H 3PQYB 1FNSH 1FPTL 1F45A 1LE5B 3QCUL 5GZOD 4GMSL 3UPAA 3B2VL 3EHBC 3GSXA 4ZXBB 3QWRA 2B1HL 3SY0A 1WEJL 4PLKD 1VA9A 3G04B 5GGTH 3WBDA 4UTAL 4Y4FC 2V6HA 5GGQH 3MV8D 3TVMC 2DLFL 5BZWB 5BS0A 1CLCA 3CFKB 3OGCB 5HXMA 5FYJU 1AGFA 4F9PC 2DI8A 1I9IL 1YMHA 1HHKA 2H9GB 3FB7B 3QHZH 2F5BH 4X9IA 4XVTL 2G75A 2FB4H 2D7QA 5HDLA 5HHOE 2GJZA 2PR4H 5B8CA 4F2MB 5KSAA 2I26N 4XCCL 5ESVB 3U2SB 2DKUA 4F7MA 4HWBL 4UBDC 2KBGA 1LO2L 3IU3B 1IL1A 1J1OL 3ARZA 4JHWH 4CVUA 4X7DC 1MWAB 4WFHD 4OCYH 4YDVB 4Q9RH 5JQHC 1QSEB 4ODUA 1T20B 1K8DB 1RMFH 3S3SA 1HZHL 1FNEA 4JGJA 4FFVD 5IGXL 3BW9A 1XR9B 2BHYA 1LGVA 1TJGL 2NY0C 1SY6A 3LKRA 1YNLH 1FYTB 3OAZK 3MLUH 4OF0A 2CR3A 3QB7C 3EO9L 3CC5B 3H7BB 1ZA6A 4YFLF 5D7KD 2BNRE 3G6DL 4GRWH 2VLJE 5TE4H 4WW1B 3MLVH 4L4JA 1M7DA 3WNOA 3NFSL 5A2LH 1GOHA 4NBYB 1YY8A 2NTFA 2OSLB 5MERA 2VXTL 2UZIH 1YJDH 2J88L 2YEZB 2DYPA 2AKRB 5D1XC 2B5IC 1JMZA 4FHBD 1NCNA 3TO2A 2GT9B 4QRQA 3SPVB 5BW7C 1HQ4A 3E2HC 5D6CA 4JRYD 3RIAK 4J8RA 4NJAL 3FOMB 1NGXB 1Y6KR 4AENB 1VPOL 4PRHD 3V5KA 1I1FA 5C86A 1F8TH 2DRUA 1UWGL 4W6XB 2DS4A 5J57B 1HDMB 3B9DA 3ZZ1A 1HXYB 1NPUA 5FK9A 2R15A 1RV6X 3G5YB 1Z5LB 3MACL 5JPNB 2QADB 1EAPA 1T04B 3MJ7A 4D0CA 4ZS6D 1C5DA 1IC7H 1MLCA 1TETL 1U3YA 3BE1L 1EHLL 3U0PA 4HK3J 4J6RH 5DD0H 3LN5A 3NCYP 3RBGA 3O9WA 3GSOB 4PJ5D 3LRSB 1TJHL 3PHQA 2E27L 2UZYB 1P7QB 4DZBB 1IT9L 1RU9L 3PNWB 2GW5A 2OXGA 3IDIB 5EU5B 4F9LC 3W9DA 4A2MA 3VXOB 3FQXA 3MCG1 1T0MA 3VFRB 2HTKD 5FYKU 5IR1A 5I1AA 1DEEB 2EKSA 3HZVB 4XMLH 3SDAA 4OD1L 1RJLB 2ITCA 4BFIA 5HGHB 3D85B 4WV1C 4U1LA 5E8OA 2X4QA 2F58H 4G6AD 5F7HA 3S7GA 4P9MH 5CP3H 5E7FA 5FUOH 1A6VH 4Z7NF 3DRQA 1NDGB 3ZTNL 4MD4B 3FO0L 2F54B 1QO3B 4EI5C 4PB0H 1FV1B 3EJZD 7FABH 1QRND 5DD3H 3E8UL 3L3JA 2KQNA 3H8NA 4UMGA 2QTEA 4GRLC 3VD4A 4CADB 1QBMH 5TDOB 5E5MA 2WM0A 1RUML 3UTZB 2AS5M 2COQA 1WWAX 3ES6A 5ENWA 3DTXB 1ACZA 3KXFB 3QZWB 4U6TA 1QFWH 3AREC 2KPNA 4HC1A 1FNGA 1UVQB 2VIRB 4QRRA 3QCVL 2D7OA 1EJOL 3FHQA 3DVGB 3I6GB 3EYFA 1I8LA 4QRTA 5D2NC 4HX1A 5EUOE 1A3QA 5DZNA 4HDIB 2DL9A 2UUDH 3KPRB 4FTVB 2W65B 1MHHA 3SE3C 2VDQH 1FVCB 3A6BL 4MA3A 4NCDA 3BKJH 5D7LE 5HGAB 3R8QA 1DUYA 3MLWH 2HFGL 4ONGL 4MA7L 4KUCF 4JLRA 3EIFA 4K7FA 2QBWA 1RZGB 2YPLE 1A6ZA 1F3JA 1NGWB 4I0PA 1SYSB 4OIBA 4MNGE 3ARVA 5F1NA 5DSCA 2OZ4A 1UXWA 1QLEH 1ZHLA 4JAMB 2R1XA 1KB9J 4N0UA 3PL6B 3RWGB 1AGDA 4O5LL 4XP1L 1G7PA 3WFBL 4X5WA 3UTTA 1AXTH 3QZWG 2M2DA 1LQSR 4LARH 4ZQKA 1U95B 2HJLB 3N06B 2IPKA 4RFNB 1S7TB 1VESA 1YEJH 2LTQB 2YD8A 5FO7B 3QEQA 1NFDE 2K3TA 1SMAA 1KB5A 1A1OB 1FVDA 3HE6A 5EN2A 4M3JA 4POUB 3DSNA 5B22A 4IRJB 2FJGA 2B8OT 2H2SD 3D39B 2EE2A 2IAMD 4RGNE 2BNUA 4XNYH 1JF5A 5C0CE 1UM6L 1ACYH 1DVFA 2JK5B 1OWRM 4L9LB 4XBEL 4R0LB 3BKYL 3REVA 1D5ZB 3OJ2C 1Q9LA 1JPGB 1CFNA 2E6JA 3IDNB 2BHUA 1U2HA 3C5SA 4XNUH 1MJJA 4LAQL 5INCA 4H1LB 3GBNL 1U8IB 4AEEA 5CSZB 2Y1VA 4AEIL 3DYPA 2NYYD 1Z9OA 1GAFH 1XMWA 3IDMA 5MEPA 3VGGA 4JFZL 3S5LA 1QSFE 3AY4A 5CINH 1DBKH 1J8HA 4POZD 1N5AA 4XCNB 3N1PC 1F00I 1A2YB 1G7JB 3N1QC 5FUCE 4PJHE 2M1KA 4KMTL 4K3JH 1VFUA 2KKQA 1BFVL 2Y6SD 1QBBA 5KSUB 1WFOA 1TLKA 1CL7L 1FCCA 1CVRA 3EYSL 2CDEB 3SDXF 5IROA 1OHQA 1F6LL 2VDPH 4MDIA 2FATH 1TZHA 5IJVA 3V0VA 1KEML 1MUJB 5DUBA 1WBXA 1Y18A 5HBBA 5HDOA 3KDMA 1MJ7H 1E0OB 3T09A 4L3CA 1OL0A 3IDJB 2DQUH 4JN2B 2H2PD 2XWTB 3H9HB 4ZUWB 3O3BB 4QCIB 4G8IA 3ZKQD 4OM1L 2EH7L 4JPIA 4BSWA 2GI7A 2BCKB 2GK2A 2GYSA 4H1LG 4HUWB 4JO3L 3MGOA 2HWZH 5CGYC 3O6KH 2EC9T 4RA0C 5EUKB 2DQTL 1D9KB 3MZTA 4KDVA 3OKOA 4YDLB 4OV6F 2VXVH 5DWUL 4HIEB 1EEUA 1E6OH 3PWPB 4EDXA 1GC1L 1W8OA 4DGVH 5CEZD 1MREH 3BO8B 1HH9B 4WU5B 1QKZL 4WUUB 1INDL 3IXAB 2BSTA 3AU1A 1MOEA 1MPAL 2C7UA 2HKHL 4BYHA 4XNQB 2WNGA 4XP4L 2NY6C 2XZQH 1NMAH 1IGFH 1YEDA 4C4KT 2FJHA 4QTHB 5BOZG 3QPXL 5HHVH 5DJ0B 4YWGL 3UBXB 4NRYB 1CLOH 2D9CA 4MWFB 4Y4HB 3CDGA 3N1FC 3KLDA 3PWVA 4QGTA 1ZLSL 1MCQA 3IDXL 4QWWD 3TVMD 4U3XA 4KRPC 1F6AB 4NQXB 3VFPB 4Z7QE 2EXYC 4G9DB 5CBEA 1KTLB 5FA4B 2ZSVA 2AQ2A 5DVKA 4OLZH 1CXFA 4PJXF 1NAKL 3RDTB 2Y7QA 4NQEE 2VQUA 4Y16B 4X7FC 4HFWA 1I8IB 3KYNA 3QBTB 4NWTH 3LY6A 3QUYA 2OTUB 3TGXA 4HK3N 3KGRA 3OHXB 3LEXA 1MCWW 2E7BA 1RZKL 4KUZH 1S9YA 5K9KA 1KELL 3OR6A 4M61A 3LEVL 3KR3H 1BQLL 1ZANL 4R7DA 3STLA 2CLZA 5C0BD 1MCPL 2EO9A 1DLHA 2NY0D 4UNTA 4ZUVB 3T0VA 5EU6B 2NY2C 3VI3F 5I75B 1XGYL 2XFXA 1RVFH 2BNRB 4HQQH 1AIFA 2NW3A 3QXWA 4RGMC 3RX5A 3MNZA 1IM9A 3JVGC 4CGTA 2FWOA 1K85A 2ZJSH 3UBXG 1NBVH 1CE6A 1G7IA 5E2TH 2NXYB 4FQIH 3NZ8A 3ARBB 3O3EA 1GHFL 2P43B 2R9HC 2VDRL 1B6UA 1X5KA 4QYOB 3DX8B 1I7UA 5J7CC 1OWWA 4FQXB 4M1DL 1S7QB 3QO0A 5SWSA 3MRPA 1PG7W 1EMTH 5C0GB 2IFFH 4ZDHB 1FN4A 3MRBB 2WLZA 1FNLA 2YBRA 4GRMB 1KN2H 3LS4H 1R5IA 1IKNC 1T21A 4FNLL 4YHIB 2DJUA 4LKXA 1J0KA 5I6XC 4NNYA 4OZHF 1JCKA 1B0RA 5IV2B 4KHTH 4W6WB 1I1AC 5C09A 1RI8A 1NBZB 3TZVC 5EFIB 5CJOL 1JNNH 1VERA 4PREB 1S7UB 4G6MH 1IKFH 5J89A 1FIGH 4P3CL 4MXQC 2OL3H 3PE9A 1A7QL 1DQLL 4DVBB 5T3XH 3JTSB 4M1GL 1BBDL 3MLXL 1XF2B 3P4OA 4LLQA 5DJAA 2IADB 3MREA 4L8CB 5EB9A 4I2XA 4JZNB 5TQ2L 4HKJA 1H3GA 1IGJB 1ND0A 1YDPB 2FX8L 1TCRA 4UQ3B 4XXCA 3HN3A 4HT1H 4AL8L 2AV1B 1BVKA 1F5WA 4M5YL 5INDB 3QEUB 4X4ME 5JW3L 2J2ZA 4TULH 1PKQE 3KYOA 4NUJA 5BV7C 3FQUB 1AXSA 5F9AC 4GAFB 4D0BB 1CR9H 2DLTA 5HHME 1KUMA 4FXGB 3EFFA 4IOIB 2X89A 3KNBB 2X70A 4PTUB 4XAWH 1C08B 1XF1A 2ITDA 2BOCB 4EI5D 4L4VB 2Q76B 4K8RC 2DQCL 3EDJA 2EDWA 3PWUA 2E8YA 4O2EB 1G9MH 3FZUC 4GRLD 4LCWA 4KRMB 1WICA 4DGYH 3EOBB 2VZ3A 5CD5C 4Q6IA 5JUEH 3QPQC 3TT3L 1DL7H 2Z31C 3LKOA 5I1LA 2IMNA 4K71C 5I8OH 3ARED 3O0RL 3CAFA 3IRPX 1UWEL 3S37H 4EXPX 5D8JL 1HQRA 4IOFC 4NPYB 5EUOB 4U6HA 3OAZH 1ZVSB 2P49B 3RNKA 1HILA 5SWZA 4WWKB 2ZSWB 3HAEA 4DK3A 5IFHH 5GISL 4C55A 5C9JA 4X9FA 3OGOE 5D7LB 5GGRB 4Y19A 5IB1A 1K9TA 2IEPA 4NKIH 3MROA 2LVCA 2J3SA 3IJYA 3V8CA 4XHJD 2NY5L 4LOUC 5ESAA 1W72B 5ERWA 4BUGA 5D4QA 3SCMC 4LMQI 1NAML 2B4CC 2R56L 3P0YL 1KIPA 1MRCL 2YPLB 1I3UA 1EBAA 1OP9A 5IMKB 4MNGB 2AJSL 5DRWB 1OPGL 5FOJA 2WUBL 1YN7B 3QI9B 1AGCB 4UV7L 5MI0B 1JWMB 2DIAA 1K2DA 4JFPB 2QQLL 5TE6H 3X11B 3I6LE 1R3LB 3RGVB 3LZFH 1FZJB 2O61A 2E6QA 1OAYL 4G8GE 3WLBA 4YE4H 2CJUH 4Y1AE 1R5WB 4FXLA 5L2JB 2R2BB 3QISA 4ZFFB 1JZ4A 3MBEC 2CGRL 1U8JA 2R29H 5F9DC 1UCBL 4P2OC 2X4RA 3CSPA 1ITCA 3HNTH 5KVDL 2F53A 3TN0B 5IOPB 1NFDB 5DJDA 4OJFH 1A14L 4MAUL 3QUZA 2J8UE 3SKNA 2GK0B 3O2DA 4Y2DA 3BWAA 1P2CB 3EFDL 4BJLA 4RGNB 3TBVA 1RY7B 5C0CB 4X80L 3IETB 4KTEL 4PV8A 5E2WH 1JL8A 3BYYA 1QQDB 2FEEL 1J0JA 5T1MA 4GQ9L 5K9OB 2BVTA 5GIRA 4RFOH 4HGWA 1AKJD 3KJ4B 4I13B 4LLMB 4K94L 5EIIB 3H9YA 4ODBD 4WTZG 3HI5L 2WBJC 4GOSA 4M9OA 5FO8A 1U8QB 4XNXL 1V3JA 3AS3A 5E8EA 1UFUA 1YMMA 5GJTL 4D9LH 4M7ZB 1DZBA 3HRZB 4L8SB 3B6SA 3BT2H 2APWA 3LMJH 3MA7B 2R1YB 1QSFB 4R4BB 1PYWA 3C09B 5DC0A 2PETA 1DQML 4PG9B 2WWKO 2F19L 5TFSH 1KGCD 4JHZA 4XPTH 4HUXB 3VXPA 4DN3H 1LDSA 5CILL 3MRFB 4OZ4B 4UQ2A 4PJHB 4YQXH 3K81A 4RZCB 4LRIA 5KVEH 2WWMC 5FM4A 1XF3A 4M7KH 2NX5A 1YUHA 4H8WH 4KHXL 4GT7A 4BK5A 5D1ZC 2MNUA 3RTQD 1IBGL 3BZ4A 3UTQA 2YUZA 3EYUL 3HMXH 3SE8H 4YIQA 3KPSA 3UJTL 2DLHA 2APVA 4WFED 4WHYH 1ZHNA 3UTSE 1R0AL 1N2RB 1KYOK 5EDXA 2A74B 2Y23A 1U3ZA 5D6DC 5EZLB 4PJDF 1ZWIB 4DVRH 3SOBH 5JHDD 1FGNL 3OJDB 5HVHC 3M1BB 4B53A 5AYUL 2RB8A 4R3SB 4NO0D 5FCSH 4ODHH 3QDJA 3QWOB 4A6YB 1KLGB 5T1KA 4HBCH 3ZYIA 3JWDH 2NNAB 3ZHKA 1R3HA 5CGYD 4S1DC 3ZKMD 4QRUB 1UM5H 4WI4A 4X9BA 3BUYB 3TIEB 4TUKH 4AQOA 3GMQA 2ZNXA 3MJ9H 4G9FA 1I9RL 3D2UB 3IJHB 5DR5L 4TVPD 2ICWA 1S7SA 4JFYB 5C1MB 4WO4B 2AEQH 2OL3A 4OFYA 2E3VA 2HRLA 4FS0A 3MRMB 4HS8H 2NY6D 4HJJL 1IC5H 4BZ2H 1BGXL 1GGBL 4P2QE 1UQSA 3P30H 1RIVL 1YEIH 3WEXB 3TBTB 1QLFA 1M7IB 3BP7B 3SBWC 3BQUA 3DBXA 4IDLA 4QRPE 1I3GL 3T0DA 4OCXL 4IDJL 1B88A 5F7FA 2NZ9C 2ADJA 1D5MA 4F57H 4XBPA 3I2CH 4OKVB 4KRPD 2GFBB 1JHTB 4IRSB 3ULUE 2EXYD 5D5ME 5E1AA 1MHCB 1CLZH 4NQEB 5IBTL 4LEOB 1NC4A 1ETZB 5IMLB 1M4KA 5T5FL 1QLRA 2JKXA 3CFDA 4EBQH 3QXDB 3GBMH 5ESQA 1CYGA 3VFGL 4GAJH 4H0GA 2AV7B 1F90L 3CX2A 1EUTA 4WENB 4XPFL 4NCC1 2HJKA 2WIIA 1T7XA 1F4AA 3MRGB 3VWKB 2C3XA 4GW1B 1HYSC 1QEWB 2P44B 1YEEH 2BVQA 2E7LC 2LVEA 1MWAL 4OLEA 2X40A 4YHKL 5FYLD 4I9WD 2XOTA 2D7TL 3RL2A 5IB2B 3ZKNC 3LSOB 3NTCH 4X5XA 3VXRE 3TBYB 3ZKSD 2FR4A 1TZGL 3WDJA 4QHMB 2NY2D 3QUML 1JPFB 3VFWB 5IFAH 4X7EC 4OTXL 4GBXA 1AO7E 2H6PB 1UB5A 4LIQL 3D18A 5ECJE 1SJHA 5EOQH 2PF6A 3UAJC 3R0NA 4NFCA 4P2CG 1FH5H 4FQJL 4N1HB 4ORGA 4WY7H 1NQBA 3EO1A 3V7MA 4NIKB 4OLWL 2P24B 2R9HD 1O7SA 5JMRA 5IW1B 5JHLL 1L6XA 1U2CA 4LCCC 5C92A 5JQ6L 4OFKA 1MCCA 3IXTB 3P40A 4Z77A 8CGTA 4PGJA 4G5ZH 4FMFA 1OAQL 1Q9WB 4D0DB 4MDJA 4I3RL 3FN3A 3HZMB 1NMBH 1LO3H 3GRWL 1KCSH 1VACB 3PQYA 3O6FB 3QR2A 5B38A 1ZHBB 3FN0H 3PXJA 4G80A 2VZSA 3MRQB 2FBJL 1A02N 4F15C 4DQOL 3G04A 3HHRB 4GKNB 3JSSA 4DKDC 1E4XH 4EOWL 3V4UL 3CFKA 3TZVD 3IDYB 1B2WL 3LS5H 3MV7A 1ZE3C 1MI5D 2P4AB 4K07A 1YEFL 3FB7A 1A47A 2DQIH 5BVPL 2X4PA 4MXQD 3CLFL 5LGHL 5DK3A 5DT1L 5TQ0H 4L1HA 2VOTA 1AQDA 4LSSH 3MCKB 5ESVA 3U2SA 4ONFL 3IU3A 1H5BC 3WUZA 5BZDB 5EA0L 2H26B 1MRFH 3WYRA 3F5WA 4XZUB 5GRUL 4GRWF 2WAHA 3MRCB 3FT4B 1C12B 5DK2B 2E9BA 1J12A 1K8DA 4WFHE 3PG2A 3DUUB 1PKQB 3OJMB 1BFOB 4ZG1A 1H3PH 5HHMB 3H7BA 3CC5A 4LLYA 4NUGL 1A7RL 5JIHA 1K5NA 3Q3GA 3LKNB 4FZEH 1BJ1H 1YQ2A 4PRIA 5FCUH 1A1MB 3ZKXB 4K8RD 5D7KE 1G7HB 5CCKL 2DLIA 3QDGD 3EBAA 4XXDB 3HE7C 1Z3GH 2HVKA 3FZUD 4OFIA 4TOYL 4DKEH 3TJEL 2OSLA 1UZ6E 4YDIH 1HHIB 1EFXA 3VD7A 1INQA 1FP5A 2VAAB 2YEZA 5CD5D 3QCTH 3HCVA 1M71B 2BERA 3QPQD 4V1DE 2FLRT 2Z31D 3I6KB 1BREA 4LHQB 4L3ED 1TIUA 3LN4B 4AM0A 4NZTH 3MBXH 5BOPA 4M4RA 3X13B 4OB5H 4W4OA 3PWLB 4IOFD 1NGXA 4LHUB 1Z6JT 1S3KH 1W0WB 4JRYE 5IFJB 1CIDA 3HMXA 1ZA3A 1UJ3C 2ADIB 3O6LH 2ZCHH 4DZ8A 4PRHE 3CPLB 5MENA 3C6SB 1HXYA 4LCUB 1MCDA 4M5ZL 1SHMA 4OF8A 4MLIA 3C8DA 1F2XK 3G5YA 1Z5LA 2DBLL 4P23C 5IMMA 1IARB 4DUWA 1B3JA 4NKOB 5IQ7H 2XRAH 2FEDD 1OLZA 3C60C 3GSOA 1N0XH 4S1SH 5EUOF 3GIZL 4Y5VC 1FFQA 3BIKB 4YHPB 4YEEA 5T3ZE 4G8GB 4Y1AB 3T2QA 4PJ5E 1XCQB 4BKLA 3IDIA 4NRZB 4UTBL 3VXOA 5AG8A 3KWWB 2I5YH 1EA9C 3MX0A 3MJ9A 4NHCL 3HZVA 5C0DA 3F12B 1T4KA 3RRQA 3FQTB 4FFYH 3CD4A 2J8UB 5C0RL 2VISB 4OSUL 2WK2A 4LHUG 2N56A 4PP1D 3DO7B 1NMCB 2F54A 1QO3A 1FV1A 3R0MA 4V2CB 2R0LH 5J06A 4HIJB 4NSKA 2VDLL 1VB9A 1FBIL 1U8NB 1A0QH 1JI2A 1QRNE 3UTZA 1J1PL 5JTWA 5KS9F 3V4VL 3VRIB 3OJVC 2Z4QB 3Q48A 3KXFA 3QZWA 5HI5C 4RAVB 2ZCKL 4YC2C 4F8TA 4NT6B 3U9PH 1X5FA 2VIRA 3W9EB 2X7LA 2KZWA 1HOCA 1NFDF 4FABL 3SO5A 3I6GA 1NGYB 2AK4A 3T0BA 1IZJA 1DE4B 3GSNB 2NY4B 2DMCA 3RUGA 1J1XL 2DQGH 3L9RB 3MMEB 4HDIA 5FYKE 3ARDC 4OV5B 2AJXL 3BP5B 4FTVA 5D70H 2W65A 2XZAL 2WW8A 1CICB 3TBWB 3X3FL 4ETYA 1FVCA 2QR0B 4RFEB 1YQVL 3OKMB 3EOAB 2EEDA 3L3KB 1ZSDB 3PGCB 4NN5B 2QL1A 1OAXL 3EO0B 1IGYB 2B7DT 1PX4A 5E6IC 5A3IC 3L5JA 3LQAC 5JXEA 1FL5B 5I0DA 1UM4H 1RIHL 4X9GA 4JM2C 4RRPA 3R8BB 2WWMD 5DRNA 3ZDXF 4NBXB 4OD3L 2LV4A 4ZD3L 1JK8B 3N1GC 3UMTA 4H26B 3H7LA 1NGWA 2VQ1B 3F6IA 4XCEB 1RJYA 1SYSA 5GS0H 1IFHL 1YEHH 2V2XB 3TA3C 5D1ZD 1BIHA 4Z76B 4JAMA 4YPJA 3LVEA 3UTSB 4PGDB 3PL6A 1L9NA 5CZVH 3RWGA 4JFFA 4EQ3A 3RX8A 1KPRB 3Q2CA 1U8MB 3O2VL 1ZOXA 4LRNL 5LAXB 4PD4J 4Q6YA 4BUHA 1UC6A 3CK0H 1U95A 3U83A 2HJLA 2W92A 2ED8A 4R2GB 4UOJA 4NC1E 5HJ3B 4WI7A 4PJHF 5A2FA 4OCMC 1MFNA 5E9DE 3PJSA 4LNVA 2A9NL 5K9QI 3NVQA 5D7JC 1DQJB 2ZCLL 1A5FH 4HUNB 5SX4H 2R2HA 3L1OH 1A1OA 1AY1L 3BISA 4S1DD 3RVTC 4HIXL 4IRJA 1QA9A 4LU5L 1HXMB 1ZT4B 3D39A 3RWDB 3QDMD 2ENSA 2NY1B 3PGDB 4JO1H 3WFEL 2QSTA 2JK5A 1PLGL 1JZ7A 4R0LA 2DKSA 1K3IA 1DR9A 1YA5A 1DBMH 1OGAD 4Q9CA 1HK6A 2YK1H 3ULVD 1JPGA 3UCRA 1PEWA 5GS1C 4EN3B 4AH2A 5HPOA 4P2QB 4Z7UA 3ZSSA 4G7VH 1F4XH 1K4CA 5J12B 2BC4B 5JIPA 4QOKA 4KVCL 5CSZA 1T03H 4QRPB 1NC2D 3W0WE 3WUWB 4YDJB 3MLTB 3ARTA 3I02B 4YUEL 4JFDD 3BPOC 4KJYA 2AXFB 4C57C 2JIXD 3AAZB 3U0WL 4Z6AT 3BPLB 4MA8H 5KSAC 2V7NA 3CH8A 5L88H 1KB9K 5D5MB 4LLDB 2OR9H 3F7PC 3MXVL 1CFVH 4XCNA 2GQHA 2ORBH 3GI8L 2CK0L 3R06A 4AK1A 2A6JA 5DQ9B 1A2YA 1G7JA 4ELME 5GRWA 1CE1L 1D6VH 2FO4B 4M62H 1FDLH 4O9HL 2F5AL 5C7XH 5HD8C 4YNYA 3VG9C 1EXUB 4KVNL 4R90L 4UT6L 3ZL4L 5HDQH 2HT2C 1HYSD 2PYFB 3HB3C 3CVIH 1QVOA 4XBGA 4YXKH 3ARQA 3VXRB 4JKLA 4Z7QF 1QTYT 5T33H 1UZ8B 4JN2A 3H9HA 4MNQD 3GGWA 4ZUWA 3O3BA 2AGJH 4WHDA 3JV4B 4MQTB 5GGTL 4ZFOL 5GGQL 1S7RA 1CN4A 1AO7B 2BCKA 4QT5B 1RZIB 2R4RH 3RP1A 1DFBH 4MAYB 4HUWA 3VCLB 2XKNA 2R69L 3RWJB 1GZPA 1Q0XH 3WUWG 2W38A 4LPTA 4KV5F 5IEHB 3UAJD 4KJWC 1NDMB 2F5BL 3LKQA 4BQCA 1IE5A 4RWYL 4HIEA 4XPGL 2PR4L 4K9EC 1GXEA 4S11A 1ZHKA 5IF0B 1OD7A 1OM3H 4JHWL 1HH9A 3EUUA 1A7OH 1T6WA 2ED7A 3B9EA 3BIBX 3DECA 5CEZE 4OCYL 1CDCA 4Q9RL 2KUTA 1JP5A 4XNQA 4YR6B 1Q38A 1BEYL 3RKDC 2Q86B 5F96H 1AI1H 3CZFA 4QTHA 3NH7H 1YNLL 5DJ0A 3MLUL 3UBXA 3BEWA 3LHPL 4CKVX 3LRGA 3T0ED 4Y4KB 2F8XC 3O9WC 3LEYH 4N5UA 1CDYA 1FFNB 4PJ8D 5TE4L 1F6AA 3MLVL 4NQXA 4U1SB 3HS0A 3VFPA 4QXWA 4XAKD 2OYPA 1P6FA 3WXVL 1FZOA 2F9BT 4UT9L 2Q8AL 3WS6C 4O2CB 1LNUB 5HHOA 4Z7WF 5C08E 2UZIL 1YJDL 1I8IA 4PRBA 3SGDI 3QO1B 1KIQB 5IHUH 3SDAC 4LLWA 2G5RA 3I75B 2MKLC 4YFLI 2C3VA 5HYQB 4HLZG 4XNMB 3PV7A 2XQYG 3T4YB 1K8IB 5MP6H 4X7SH 1F8TL 4RQQA 5T1LB 1Q9OA 3BSZL 1IAMA 4G7YH 1MJUH 4ZUVA 2AJ3B 4K2UH 5FUZH 1GPOH 4HEPG 1ROWA 2Z92A 1NCUA 2BNRA 4PJIB 25C8H 1FCGA 4P5MB 2VLJA 2HKFH 2CIKA 5BO1H 5F9WB 4YGVB 4NGHH 3FQRB 1IC7L 3RZWA 2CXGA 2R0KH 3BPNB 1TITA 3KPQA 3HE7D 3ARBA 4P5KB 1DBJH 4NFBA 1FIEA 5JA8B 4V1DB 3DX8A 4FQXA 3U36B 1S7QA 2ZOKB 1QHPA 2XQBH 5DLML 4XCYA 1JHLH 5DA0B 4ZDHA 5DGRA 3U4BH 2XZZA 2YZ1A 2I27N 3TCLB 5HGBB 2X4OB 4JRYB 3DGGB 4XMLL 5DMJB 2X1QA 1JHKL 4KI5C 4YHIA 4F7CB 2A6DB 4P46A 4PRHB 1U42A 2F58L 1OQOA 2GTWB 2ICEB 4PJAE 4P9ML 5FUOL 4QRSA 2H41A 5A2JH 7FABL 2EH8H 4Z0XB 5DD3L 1HIMH 4PREA 4XNZC 4AJ0A 1G0DA 3P4MB 4P23D 5HI3C 4JQVC 1QBML 4PJ7A 5MEOB 1ORSB 3UTPD 3HC3H 3N1MC 1I1YB 1JGVH 3BRFA 2JCCE 1XF2A 2DI7A 4L8CA 1A3RH 2IADA 1RUKH 2XG4A 2ZP0T 4PJ9C 3S6CA 2YKLL 4JZNA 3KPNB 3RJDA 3C5ZB 2D4DA 4PJ5B 2H1PL 2Y5TA 2J4WL 1YDPA 1FGVH 1SEQH 2ERJB 4ZNEE 4MJ4A 5I1KH 5C0NC 4MX7A 5F7MC 5MHSE 1CD8A 4ODXB 4L3AA 3UJJL 2YXFA 1JYVA 2EYSB 3TF7C 2IPTH 1KNOB 2CDGB 4PB9H 4PJFA 4MJ5B 3HE6C 3SJVA 1RJZB 3QEUA 1A6TB 2R0WH 2VN7A 1R24B 3MRNA 2UWEA 1U6AL 3FQUA 1T89A 2VDQL 1FAIH 1G1YA 1KC5H 4D0BA 5KVFH 2Q1EA 3CVHH 5DMIH 4PGBB 3X12A 3BKJL 4FXGA 2IAND 4X6DE 3WL9B 4IOIA 3KNBA 4ELKB 2OK0H 3FO2B 5DVMA 4PTUA 3IRZA 1C08A 4PGEB 3FTGA 2ADGA 2Q76A 2OR7A 4DAGH 5HYFA 2AP2A 1QRNB 5J11B 4KGLA 2D0HA 5EPMB 1SBBA 1MFAL 3EOBA 3A67H 3GMLB 5E70A 2PYEA 5EOCJ 3ULSB 2XN9D 1QLEL 4JFQB 4WTWA 5DD6B 3DV4B 2YC1B 4L29A 3T65B 43C9B 4D8PB 3AS2A 2XWBB 4N0FA 4NPYA 2Y36H 3I9GL 2YUVA 3IT8D 4J1UB 1ZVSA 1M05B 5CD3B 5F6IC 2EDXA 3LOWA 1F58H 4WWKA 1YEJL 3FT3A 2IQAB 1F6FB 1HE7A 1KOAA 5DD1H 1DEDA 5D2NE 4QLRA 5D7SL 1IC1A 5GGRA 1J9CT 3H9SD 5I74C 4AEFA 1EHNA 2ZPKH 4JKWA 1SJEA 2VE6B 5KOVC 1VFAB 1W72A 5A3ID 4LSUH 2ZOLB 2YPLA 4JM2D 4NDMB 4WTZA 1KENH 3SN6N 3LV3B 3GSRB 4PJCE 5DRWA 1YJDC 4CJ1A 1VFMA 1YN7A 2VLME 1AGCA 1JPTH 3TA3D 3X11A 4UB0H 3Q5YA 4GS7B 3RGVA 3IGAB 1FZJA 4FZ8H 1A1NB 2XG5A 4XNUL 4JANB 1OT2A 4XH2B 3L5WB 2DTMH 2AJVL 1R5WA 4UIMB 1HCVA 2VDNL 4Z78B 1HHGB 2R2BA 4TPRL 4OUOA 1ZGLB 4G6KH 1JZ8A 2J7LA 4TQEH 3VFOB 1KJ2B 1GAFL 1FE8H 5E9DB 1RZFH 1K6QL 1BAFL 1NFDA 5HY9B 2XV6B 3DVIA 5CINL 3I84A 5D7JD 4ALAL 4U1NA 1DSFL 3RVTD 4A6YL 1I3RB 3ARPA 3N85H 3T8XA 4K3JL 3KJ6H 4LVOB 4UOW0 3P4LA 5C0CA 2QSCH 3IETA 3LDBB 1RQ5A 4LL9A 2FGWH 4JG0L 5K9OA 2P5WA 1JNHB 3KVQA 2AI0H 5EBWB 3MPCA 1A4KB 1JGDA 4U1MA 3SDCC 5EIIA 2FATL 5T5NG 4OZIE 4EQ2A 3QWRD 3IFLH 1CD0A 5E2VH 1LEIA 3VGEA 5JOPE 4QY8A 1U8QA 2W0PA 2ICWI 1NCTA 5DEZA 4UIKL 3LPWA 5BS0D 3W0WB 5GGRY 3GMRA 3TC9A 1AC6A 1VFBA 2PTUA 4EI6A 1BFSA 1X5XA 1KJ3H 4L8SA 3PDOA 4W81A 3MA7A 4L8BB 1T3FA 5DEFB 4PG9A 4H0HB 4JPWL 5KSAD 5BJTB 3QUYC 4HUXA 3HI6L 3MRFA 3UPRB 4C54A 4ELMB 2VXVL 1E6OL 4KRNA 4YXHH 2AXGB 3ZE0E 3W11C 5I1HH 4DGVL 1MREL 1T5XB 1UH2A 3GJEB 1X5ZA 3ARGB 3OKDB 5HD8D 2PW1B 3RWCB 3BXNB 3H2WA 4PY7B 3VGDA 3S4SA 2JLLA 2ZUSA 3K46A 1U8LA 3U30B 1NMAL 1IGFL 3BDYH 2HT2D 1ZAGA 5GS2D 2BVOB 1X9QA 4ODVH 2A74A 3K2UH 3HB3D 3ISWA 5F21B 5EZLA 1ZWIA 4KKAC 3WO4C 5D5MF 2HYMA 1CLOL 1GGIH 4JFOB 2WBWB 2VABA 4X98B 1JI1A 1T22B 3QWOA 1KLGA 4LEXH 5JHDE 2NNAA 4PY8J 4M9PA 4YGAB 5D7IF 2DYPD 2SEBB 4QRUA 1ES0B 4KJWD 2JJWA 4OLZL 4X6CB 4B41A 3BUYA 1AHWB 1FL3A 5LXGH 2X1WL 3MA9H 3T1WA 4UILH 1ZT7B 3TO4B 4NWTL 3WIFB 4XGZB 2OI9C 1TZIB 4G6FD 4JFYA 4G8FB 3L6FB 1BQUA 4WO4A 1EGJH 2HJFA 4KUZL 2Z8VC 3EGSB 3MRMA 1LO4H 2W9EH 2A83A 4TVPE 5C0IA 1C8PA 3STBA 2DJSA 3RKDD 5FGSA 3VXTB 3KR3L 1T7YA 3GMPB 1B0GB 1MHEB 3WSQL 5E6ZA 3DUSB 3WEXA 4YXLH 5C6WH 4OD2B 5ITBH 1JWUB 4HQQL 4KH2A 2E7MA 5FKPB 3O9WD 1CQKA 2ZJSL 3D9AH 4OKVA 5EU4B 3PF2A 1NBVL 2GFBA 4HJ0C 4LQFL 1JHTA 3HFML 2ICWJ 4IRSA 5E2TL 4Y4FB 3TVMB 4CL7A 1TMCB 4OUUB 4WNQB 1MHCA 4KQ3H 4NQEA 4NZJA 4LEOA 4MQXC 5IMLA 3U9UA 3MGAA 4BQ8A 1K4DA 3CVHA 3U6RA 5DQDH 4HXBH 3QXDA 3ELAT 2A6IB 2J1KA 2GJ6A 1Q94B 2AEPH 2HVJA 2D7MA 1MCRA 1WLHA 4Y5YA 4HK0B 3SDAD 1EMTL 2IFFL 3CUPA 3MRGA 4JGMA 3VGFA 3WJJC 1KSRA 2JJUA 1TVDA 3HPLB 2EIZA 4GW1A 1NCWH 1XIWA 3LS4L 2JELL 2FNBA 5ALBH 5IB2A 2HN7B 4PRNB 1G9NC 2FSEB 4QXUH 1R3JB 4KHTL 3TWCH 5FYLE 4I9WE 4RNRB 5EORH 5C0BB 4N8VB 2NY0B 3VFWA 4OZGE 3V6BR 1A6UH 2H6PA 4Q6IC 1JNNL 1CU4H 1IKFL 1U36A 1FIGL 4D2NA 2X9YA 5DJZA 2UYLA 4RMTA 2YD3A 3ECBB 3GMNB 4ZSOA 3GMOB 5T3XL 1UCTA 1XR8B 3E6HB 1YPZE 1WZLA 4QRRD 3KLAB 4BK4A 3O11B 5C6TH 3DX9B 4ZAKA 3UJIH 1J05B 2M8XA 1Q9WA 4D0DA 5D1XB 2B5IB 4FP8H 1FFPA 1GZQA 3EDKA 1MFDH 1VACA 3E2HB 4PJIF 3S3PA 5F6HI 1R3KB 1ZHBA 4KI5D 2VWEC 3C5JB 4K23L 5GJSH 3MRQA 1CR9L 4PJAB 1H3VA 3AS1A 4ZPTB 4J3XA 1UZ6F 3C8HA 4XAWL 3WXWH 4JPVH 3L95A 2O5XH 4I0PD 3EJJX 1DLFH 3MJ8B 2MCG1 4I3SH 3DXAE 1G9ML 3RWEB 3QFDB 3TPKA 1JZ5A 4TNVF 5HI3D 2JCCB 4N8VG 4ZFGH 5JIKA 4DGYL 3QAZC 1UEMA 1II4E 1J11A 4ZPVB 1WV7T 4TRPH 3UTTD 3DURB 1DL7L 5BZDA 4I5BA 5I8OL 4BELD 5I1EH 1IQDA 4KK6C 3HC0B 4K8RH 3UXFA 5CJQH 3FT4A 4MYWB 5I8KH 5DK2A 1J87A 4GUPA 5C0ND 3QEQD 4N0YH 1NLBH 12E8H 4Z95H 3QUZC 3E0GA 4X4MA 3DUUA 1YNTA 1UEYA 3B2UC 1PKQA 4J12A 1BFOA 3HE6D 3V6FA 4OLYL 5IFHL 2Z8SA 3IFNH 4X6DB 3O4OC 4N0RA 4V2BA 1RD6A 5GGUA 2VSCA 2W07A 4P4KB 4WV1B 4U4BA 4WFFE 5I15L 1WGOA 1QR4A 1WISA 5GGVH 3ZLQC 1S9KC 1A1MA 1G7HA 4EI5B 2G5BB 5GZNC 3FB6A 3OB8A 1G6RB 3IFPB 1U58B 3GKWL 1HHIA 3MNWB 1SYVB 4GRLB 4U7MA 2VAAA 3O81A 4KKLC 5EH1A 1M71A 4J3TA 1FO0H 3P11H 3I6KA 2Y72A 5J1AB 3HI1A 1V3KA 2B4CH 2MHAA 3AREB 4G3YH 1OSPH 3BN9C 1KPUB 3EOTL 5AAMA 3UDWA 2R29L 4FQ1H 2V2TA 3QQ3B 4L3EE 4MCZB 2ATPB 1J8HD 1W0WA 4U6XB 3HNTL 2Y25A 5IFJA 3SE4C 1RFDH 5ID0B 2EDTA 5D2NB 2HA1A 2OTWB 3C2AL 4OJFL 4M8QB 3JV0A 3CPLA 4U6VH 4D9QD 3BUTA 4LCUA 5F93C 4PS4H 4OI8A 4P57B 4DN4H 1KCRL 3BOVA 2VZOA 2IGFH 4URTB 5F6HJ 2AJYH 4P99A 5E2WL 1P9MA 4PJCB 2X4TA 1WT5C 2YOCA 1Y6MR 1S9XB 4BZ1L 4RFOL 2PCPB 4F7TB 4XC1H 5CHNB 4YHPA 3WIIL 4S1QH 1NUGA 2CRMA 2J5LC 4Y1AA 4UNVA 1NEZB 1XCQA 1I4FA 2EO1A 3DYMA 3SKJH 1P4IH 4JRXE 5IB3A 3QEGH 5I2IA 3AGVA 3O41A 2JB6B 1EGJA 1MCJA 3H0TB 3FQTA 3MODL 1PZ5B 1NFIB 5TFSL 1PAMA 1QHOA 2J8UA 4HF5L 1W2KT 2D7NA 3L3HB 5T5NF 1OAUL 3QFJD 4XPTL 2VITB 4TUJB 1W0YT 2BOBB 3W81A 1N5YH 3PABB 5EWIH 4YQXL 4LASH 3SQBA 2FL5B 4HIJA 4D9RD 3LD8C 2ZKHL 3ROLB 4KZDH 4M7KL 1U8NA 5TJWK 1ZLUK 2QHRH 4H8WL 5ICZB 1KCVL 1G1CA 4RAVA 3SE8L 3MRLB 4OZIB 1OD9A 4Q97A 4NT6A 3BQUC 3W9EA 1I9JL 2IPUG 4IJ3C 1LEKB 3BP6B 2CKBH 4M7JH 4O58H 3VFMB 1NGYA 1QFUL 2XNAB 4DVRL 4X4YA 3SOBL 1HH6B 4HCRA 1QPXA 3BPCB 3MMEA 4LNRA 5FYJH 3RZCA 1H3WM 3HA0A 1IILE 3WLWC 1NEZG 3BP5A 2XPGB 4ODHL 3AUVA 1MAMH 4M6OH 1CICA 3TBWA 4XPBH 4HBCL 8FABB 3JWDL 2QR0A 4ZUUB 4RFEA 3VU2A 5T1DH 3OKMA 2I9TB 3MRHA 2G2RB 3EOAA 1I7RB 2MPAH 3L3KA 3PGCA 4TSAL 1IGYA 1UM5L 3QUYD 3VD5A 5I16A 3E3QC 5I8EB 3QULA 3W11D 4TUKL 3IVKB 5IQ9A 1NGZB 3FB5B 3MJ9L 4ZTOH 1JK8A 4H25B 4K3GA 5I73C 1J0IA 2VQ1A 2VR9A 4MQ7A 4XCEA 1GIGH 3EYVA 4NNPH 2CIIB 5D9SB 1M1SA 2C4XA 2AEQL 3MCLH 3UTSA 1N59A 1M6OA 2YUWA 1BF2A 4JDVB 1KPRA 1QOKA 1MH5A 1IC5L 4KTYA 5I1GL 1U3HC 4KKBD 4BZ2L 4GBXC 3P30L 2DIJA 1IM9D 2CMRL 4Z7NE 2A38A 3FOLA 4NZRH 1RZ8B 4ELMF 3N9GH 3ULVH 5JHDB 4F57L 4X6FB 3I2CL 1DQJA 5J1TC 4LLVB 2RJMA 2YMXL 3BH8B 3GHEH 2RCSH 4UV4H 1UXSB 3FCTB 3X14B 1OARH 1CLZL 1J86A 1OTTD 1PVHA 1HXMA 1ZT4A 2LFGA 4PJBA 3RWDA 4LF3B 3PGDA 2IG2H 1GL4B 1N6QL 3B4NA 4Y2OA 4CUCA 5DHVH 1DQDH 2FCBA 3C08H 4GAJL 3RPIA 4P5TC 3QDME 2D3VA 5IESH 3WHXB 2YA1A 4LCIH 4MS8C 5ID1B 1YEEL 2DLGA 5A2KH 5C09D 1OGAE 2J6EH 4G42A 2BC4A 3SGKC 2NY6B 3WUWA 1JPSH 2YSSB 3B8YA 3MLTA 1JPST 4X6CF 4EVNA 5IFAL 3I02A 4R4FL 4GAYB 4S10A 4ZYKA 3AAZA 5EOQL 3UBXI 1G7MA 5D5MA 1B6DA 2VDMH 5E00A 1C5BH 4HJ0D 1NANH 2XY1A 1OB1A 4KRPB 4L4TE 4WY7L 5DQ9A 4PD4K 1V3MA 4MQXD 2FO4A 3UO1L 3VXME 2RFXB 3LN9A 4UAOC 4RGOL 4EUPH 4ERSH 1N4XL 4GW4A 4WEBH 2PW2B 1LO5B 5TF1H 1KFAL 1AGBB 2DM4A 4JY4A 4G5ZL 2XXMB 3M17B 1V3LA 2W60A 1NMBL 1LO3L 4J3OC 5H94B 1KCSL 4TNWF 5I66B 3JTTB 4JQIL 1BM3L 7CGTA 4HV8A 4P3DB 1A7PH 2PYFA 5DVNA 4TSBH 2X89D 3FN0L 3JZ7A 3VXRA 4PJEA 2WP3O 3SDYH 2GITB 2PUQT 4WFGD 1UZ8A 3DMMC 3ILPB 3I3BA 1XGQB 1RIUH 3JV4A 4OZGB 4NO5A 5JMOC 4LCWD 1QBLH 1RZIA 4R8WH 4MAYA 2NY2B 4JDTH 1WTLA 3VCLA 4KK5D 1KCLA 2X4NA 3HC4H 1OAKH 2DAVA 1KIRA 2L0DA 1KT2A 2EC9U 5IEHA 4RGMB 5E8DH 1NDMA 4TTGA 1CFQB 2WV3A 2BSRB 1YPZB 5TQ0L 1OP5K 4LSSL 3BH9A 1EEZB 4W4OC 4YAQA 5IF0A 1TTGA 5TPWH 4XVJL 4H8WC 2PTVA 5FM5O 1MRFL 1HHJA 3EYOA 2V5YA 5SWZD 1TXKA 3T77B 4YR6A 4PR5B 1PFCA 1QFHA 4PFEA 4Y19D 3WN5C 1H8OA 3Q0HA 5E0QA 5F9JB 2D2OA 2XY2A 2B20A 1XGTB 3U79A 2DQFA 1A6WH 5I76B 5F7KC 4Y4KA 3WNKA 1F11A 4RMRA 5FA3B 3W82A 5I6XB 3GSVA 2FH6A 1FFNA 2APXA 3DXAB 5C6PB 1I1AB 1UJTA 3MLSL 1H3TA 3TZVB 4Q0XH 4O51A 1Z3GL 2IQ9H 4O2CA 3DO3A 5EZJA 2YUXA 5D1QA 3SDXE 5M7QA 3OL2A 2V7HA 4YDIL 3QDHA 3RWHA 3IU4H 1PZUB 1I75A 1T0NA 2R2CA 1X5GA 4NZTL 4XRCA 3MBXL 4KK6D 5EC2B 4CN1A 5DJ2A 4OB5L 5HPMB 2F53D 4PJAF 5EBGA 1F4HA 1NGPH 5IVZB 3O4LA 4XNMA 4ZUSB 1UKQA 1S3KL 1RURL 3QUZD 3T4YA 1K8IA 4PTTA 5H37G 1VADB 3L3GB 3FB8B 3B2UD 5T1LA 4RMQA 3O6LL 2ZCHL 4NP4H 4OAWB 3KPTA 2NTSP 1D5IH 2AJ3A 3D69B 5I1CH 5BV7B 4HWEH 3NCYS 4P5MA 4XPHH 4Y89A 4YGVA 5AWNH 4F58H 3TYFA 4MJ6A 4W4NA 4DKFH 4FRWA 4GG6E 3GM0A 1AR2A 4ONHB 5KZCD 3RI5K 4APQB 3NBNA 5GZND 4P5KA 5F8QC 1N0XL 1P7KB 4V1DA 3VXQB 3QDAA 4KKLD 1YMMD 3U36A 4IOSD 2ZOKA 1D6EB 3BD5A 5GSRB 3O45B 3NAAH 3D87B 5HHXL 3BGFC 4K71B 4L3EB 2I5YL 3QNXB 4X6DF 3TCLA 3GSWA 5TDPA 4LP4A 1QR1B 1DP0A 2EKJA 2H8PB 3T1FA 5JXEC 5C0AA 3UC0L 4HKZA 4CU8A 1UA6L 2GTWA 2DQHL 2NX5D 1C16B 5SV4A 4CNIB 3CSGA 4R96A 2BY0A 2EDYA 5JOFA 2ID5A 3D3VE 3P4MA 1CGWA 3GB7B 3RVWD 4PLKC 2FECI 5DUMH 1I1YA 2ZG1A 3SCMB 2Z91B 4KY1H 4YPGA 1RUAH 4WCYH 3HNVH 1KCUL 4Z0BH 1ONQB 5EOTA 3KPNA 3MFGB 1X44A 3BZDA 3U9PL 3B3IB 4F7EB 4TN9A 3C5ZA 1DN2A 1OOAA 1AR1C 4HHAB 5FB8B 4MJIE 2P7TB 3I3DA 3VI3E 1KEGL 4ODXA 3WNNA 3QDJD 5T1KD 4JRXB 4HMEA 3QJFA 5DHVA 3WD5H 5DJ6B 2EYSA 3BMVA 2CDGA 2DQGL 4MJ5A 1RJZA 1S5IH 5E2UH 5D70L 3DRTA 1R3IH 1A6TA 2H3NB 3MBEB 5FHAH 2BNQA 2OJZH 1CD1B 4P2OB 3B9KA 1NH6A 4PJCF 3WL9A 2H32H 1KJ2L 4ELKA 1BBJA 5IT2H 4G9FD 1QSEE 4PGEA 1YEKL 5J6HB 3OAYK 4GKOA 4YHMH 5C9KA 1SEBB 1X5JA 5H2BB 4F37K 1UM4L 3V95A 4I4WB 2DDQH 4OFYD 2LAGB 1S7VA 2A1WH 1FYTE 3VXUA 2LQRA 5GS0L 5ADOH 1YEHL 3GMLA 5IM7A 1ADQH 5DD6A 3DV4A 2I9LB 2YC1A 3Q5OA 2APTA 3T65A 5CZVL 1ZGLM 1JNLL 2BY2A 4PGCB 43C9A 4LDOB 3BQUD 2DMBA 2XN9E 4IIQA 4OZHE 1K3ZA 4WI6A 3CK0L 4PV9B 3V79C 2WBJB 4J1UA 1CFTB 4TUOB 4OZFB 2IQAA 3WLWD 3FHAA 1ZEAL 1NC4D 1TJIH 3GK8L 2X05A 1A5FL 2ATKA 3L1OL 5TE7H 1S5HB 3RL1A 4YFEA 1MNUH 2DWDB 2VE6A 3CCHB 4BA8A 1L9MA 2P8MB 3GJFK 5IKCB 3U48A 4JO1L 2ZOLA 4NDMA 5EO0B 5GRXG 3LV3A 3GSRA 5CUSH 4WUKH 2W0FB 4ACPA 5ETUB 3SKOA 3MR9B 5F1KC 3RY6C 1TQBC 1DBML 4CMMB 2CSPA 4AMKH 5D71H 2YK1L 4LSDA 5D1ZB 3VRJB 1WCBB 1CK0H 4JANA 4M7LT 4NQVB 3AFLA 3F7VB 4G7VL 4UIMA 1F4XL 1INEH 2HFEB 5C07E 4Z78A 1U3HD 1XF4B 4GBXD 4XP5H 1TDQA 1L0QA 3H42H 1T03L 1ZGLA 2C3WA 5EULV 3VFOA 1HHHA 2EE3A 5E9DA 2C5DC 3WFHB 5I1DA 5JW5B 5L88L 4AIXA 5HVHB 4NN7C 1CFVL 4MCYA 5I1JH 2ORBL 1EV2E 3FRUB 3NIFF 4KDTC 4OZFG 1I3RA 2BSSB 2VL5A 4M62L 3MQIA 2HFFB 1FDLL 4OCWL 4OQTL 5C7XL 3X3GH 1VEOA 2P8PA 3DHJA 3VXSE 3QDMB 4BFBD 5EBWA 4NYLA 3PQYD 4WW2A 1A4KA 5CIPB 3HMWH 1B0WA 2NLJB 4WIQA 2E6PA 4MS8D 5CEZL 1RK0B