4G9FD

Crystal structure of c12c tcr-hlab2705-kk10-l6m
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
204
structure length
204
Chain Sequence
KITQTQPGMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIYQGSYDEQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMRDLRDNFNKFYFGSGTKLNVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title A Molecular Basis for the Control of Preimmune Escape Variants by HIV-Specific CD8(+) T Cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fD01
1CIUA 1EO5A 1HINH 3BH9B 3L3HA 4TRPL 4BJLA 3FKUS 1YNLH 3IETA 4DTGH 2RAMA 2EKJA 2ZPKH 3G6DH 5C1MB 3G5VA 4DKEH 1YEGH 2ZP0T 3VFMB 5EC1A 2MSPA 3MV7D 5ELIA 4EI5B 3VG0L 1UH2A 5KSVB 1A4JA 1D5IH 2P45B 4LARH 4JZNB 2HYMA 2EDWA 5L2KA 1EMTL 3MNVB 3UPRB 4JZOB 4JEGB 1ZMYA 4ZUUA 1WAAA 4GG8B 4FQXC 4OIBA 5C0IA 1EH9A 1A6VH 1SBBA 2ADJB 2UWEB 4O2CB 3I3DA 2CJUL 5JDJA 4X5LA 5IROA 5IG7A 5HDLA 1PJ9A 1NGQH 1QSFB 3D6GA 4HS8H 3X14A 2WNGA 4XMPL 2D2OA 3L3JB 3E3QC 1BZ9B 5EBWA 3V5DB 4B53A 4Z77A 3KPRD 4QHMA 4ZYKA 2F8XC 3W11D 1P69B 4NZDA 1INDL 1NCWH 4JO1H 1TZHA 2PO6C 4PRNB 5D2LB 1UKQA 2CK0H 4FMFA 5FGCE 4HKJA 1BFVL 2P47B 4L3AA 4RZCB 5ENWA 2P5WB 5C92A 5HYQA 5IB3A 4P46B 4PGDA 4FTVB 2QEJA 3UAJD 1H3TA 5ERWA 2VR4A 3L3KB 2Q6WB 3RY5A 4OB5H 3S37L 1A1MA 2XZZA 4NKIH 5C7XL 4HULB 1OF2B 3FT3B 4A6YL 3A6BL 1MSPA 2AK4B 4KQ3L 2YBRA 4Q6YA 5DC0A 5L0QC 2Q7NA 3QHFH 4W70A 1BGXL 4FQHA 4NQEE 5ANMA 4OF0A 2LE9A 4YGAB 4TULL 4MAYC 4PJ7A 4U3HA 3WXVL 2VXVH 1WC7A 4GW5A 1IGML 3CZFB 3FT4A 3OF6D 4OSUH 5JW4M 2CIKA 3WJLA 1CGVA 4JFPB 5DSCA 2XZQL 4I48A 1HXMB 3F6LA 1ITBB 3DARA 5HI4D 1DR9A 1A6WL 1MJ8L 3K81A 3V6ZB 5IHZB 4M8QB 4WHTB 4DUVA 1UVQB 3S96A 5A1AA 1U0QA 3G9AB 1IM3A 1R5WB 5DJYA 1UWEH 4HC1H 1NMAH 1ZLWH 5MEOA 3OGCA 5E56A 3W39B 5SX4I 1WCBB 5BV7C 4YUEH 2W0PA 4N9GB 3SE9L 3BIKB 4JAMB 4NM8L 1N8ZA 1U93B 1YC7A 4OZIA 3LOWA 3L3IB 4Y4KA 4Y4HC 4YH6A 1U8LB 1JPTH 1YNKH 2BK8A 3PHOB 4KK5D 3QXAB 5JHDE 5J13B 2DBLH 4JVPA 4FABH 4HF5H 3VD7A 2JCCB 4UQ2B 4X9BA 3P40A 3MUZ1 4UDUA 5MENB 2Z8SA 4UIKH 5DO2C 3MA9H 3VDCA 4R97B 1HNFA 3I2CL 3MBXL 1F4WH 1JVKA 5IJVB 3DMMB 2OQJA 4HIJB 1PZ5B 4PJ8A 1TQBC 3C8DA 3MMEB 2HT4D 3K2UL 4RIRA 2JIXA 2O61A 2OL3A 1G7MB 5B21A 4WWKB 3BGMA 1T6WA 2JJSC 2OJZH 2KL6A 1FSKC 1V7NL 3OR6A 2WP3T 1HYSC 3V95A 1MCPL 5DFTA 4PJGE 5DR5H 1T4KB 1NUNB 2R39A 1UEMA 4MJ6B 5GQBA 4NQSA 4ZS7H 2H1PH 1OQOA 3NH7H 4CKVX 5B3JF 5FO9A 4ETQB 3MCG1 3P4MA 1MVUA 3REVA 4X4MA 1NCAH 1V7MH 2RCSL 4PJHA 2FJFA 5D93B 1FNLA 5FYKH 2VR9A 2V17H 2LAGB 4K71C 3PGFL 5KSBB 3VFPA 1C5BH 4LMQI 1N5YH 1FYTB 4JN2B 1EGJA 4PLKD 2DLFH 2EE9A 3MO1B 3V8OA 1IGFL 2JE8A 1EFXD 1ZA3A 2V2WA 1ROWA 4YHNB 3WFDL 3D3VD 1U9KA 3P11L 4PFEA 3KHOA 1TTGA 5TDOA 1QVOB 2ED7A 3NIFF 4JJ5B 3VMOA 4GSDL 3MLZL 3T8XB 4ODUA 4PJ9D 3QUKA 3B2UC 1YQVH 2DS4A 2ZSWA 3TA3D 1CXIA 3ULUL 2NY5C 3VW3H 2ZNXA 3MSPA 4I0PB 3F7PC 1LO4H 1EHAA 1T89A 4KJYA 1QQDB 4LOUC 4XP5L 1QFPA 3T4YB 1NGWA 2QR0B 1ZT7B 3BPCB 4Z78B 1D5XB 2H26A 2GJZA 2LFGA 5H94A 2JB5H 4JRYE 1KCRH 4G7YH 1N0LA 5EBWB 1YMMB 5D2NE 4HUUA 3IRZA 2WIMA 4NQCA 5KVGH 4KKBC 3BP5A 5F7EL 1ZT1B 2OZ4A 4IS6B 4ZFGH 2UUDH 3BN9C 1K8IB 2FX8L 5D5ME 1OP3H 5CILH 4PGDB 4MJID 1CR9L 5HXMA 4NO2B 2J12B 3A67L 4MMZC 1CI5A 5CZVL 2ITDA 4TTDD 1WTLA 1A9BA 3WL9B 3VWJC 3MLSL 1GRWA 3ESVF 3ARVA 1B2WL 2HKFL 4OLXH 2VQ1B 4X7DC 4R7DB 3F6IA 1A47A 1S9VB 3O6FB 5M94B 1DLHB 1QSED 3R0NA 4LSVH 1WTGT 2G60H 3F12B 3MODH 1F4YL 2YPLE 3GHBL 4YDLC 4ZOAA 2Q3AA 4WUUE 5E5UB 1S78D 1ZSDB 2CIKB 3OZ9H 4BK5A 4LAQL 2CLZA 4U1SA 4GW4B 3TV3L 4D0CB 5K9OA 2L4OA 2F58L 4FN0A 3LQZA 4UINL 3S37X 5I18H 2ZG3A 1C1EL 3ECBA 1XGTA 4HXBL 4O2FA 1CDBA 3EFDH 2AAVA 1PG7L 4GBXD 1CDUA 3WV0A 3BZEB 1XR9B 5T5NG 4HGWA 1INEH 1DBAH 5I8CB 3GRWA 5LKNA 2MFNA 1OW0A 1CK0L 5I74C 4LHJB 4YHYC 4QRTA 1ED3B 3O41A 4XPGL 5GGRY 4G8GA 3EKCA 4MA7L 1RJCA 2BNRE 3C60D 4G80B 1AGDB 4OI8A 2FBJH 1HHIB 3DTXA 4W68A 1KEGH 4PJIA 4G8FA 4DGIH 5BRZA 4X98A 1SQ2N 1EEZA 5FK9A 4JPKH 5SWZE 2CKBH 1IM9B 1FC1A 3QDJE 4YWGL 2Z35A 1BQHB 4TNWF 1EX0A 4WO4B 4PJXA 1RSFA 3B5HA 4J4PA 2BVTA 4F2MB 4PJ5E 1CL7L 2OL3B 2W60B 1KPVA 3D85B 4WU5A 3CH1B 1FNSL 4M6OH 4HUNB 4NO0B 3RVUD 1NAKH 3OPZL 5INDB 4YPGB 3MREB 2AXHA 1XCTA 3CFCL 3VXOA 3RWFB 4S1SL 4APQC 2HMID 3TNNA 1T2QL 3JSSA 4AZ8A 3DXAE 3V6FB 2P46B 3U4EB 1RK1A 3DO7A 5F9WC 3MGOB 5EA0L 1A4KA 3OXRB 4H8WC 3L7EB 3ZL4L 2QJDA 4UV4L 2EDFA 2FJHA 5E2UL 1H3UA 4NQVA 4AEFA 5A2LH 2MHAB 3A6CH 2PW1B 2YK1H 5C86A 3SJVB 3TH2T 4G8IA 4RFEB 3THMH 5CZXD 4LHUA 3RU8L 1JUFA 5JA9A 2IH3A 4YBLC 3NCYP 1HKFA 2V2WB 3OKLA 1JI1A 3FCTB 4NQED 4ETYA 2CLRA 4L9LC 5HGDB 4QRRA 1DUYB 4ZUTB 1AFVL 3HRPA 4FQJH 1W0YT 4LKXA 4V1DB 4I5BA 5C0BE 4KTYA 1ETZB 1RY7B 2HRLA 2H2PD 4F7EB 2H6PB 1NH6A 3LD8C 4L3EE 4K23H 3BDYH 3QUYC 1D7FA 3HZYB 1A6UL 3W0WB 4EOWH 2Z8WC 1RUKH 4XAWH 3KPMA 5E94B 5IESH 5L88L 3F5WB 3DRQB 4IMKA 4JFEE 5GSVB 5EZLA 3AY4C 1A1NA 4BFIB 2DYPB 1Y0LA 1P7QD 4H0IA 5SV3A 1HHJB 5KSAA 5AYUH 3ZHLA 1MCSA 2BSRA 5DDHA 4CU6A 4ODSH 4PS4L 5C0NC 4GLRI 4BQ9A 4XPFH 3ARBA 4IRSC 1DBML 4Q97A 3DIFA 1MFCL 4NQCB 5FKPB 3MRQB 1UM6H 4U6TA 1A22B 5BVPH 3CFJA 4U1JB 1CLOH 3NCYS 3KDMB 1DVFB 4YHKL 5HYSG 3IXTA 3CLEH 5DA0B 5CD5C 4HPYL 4NHUA 2GITB 4DN4H 5HYEA 1KB5B 5JHDD 1XIWC 2WLZA 3MA7A 2P7TB 3EO9H 1EXUB 2NW3A 3U36A 4WW2A 2OSLA 2GUOB 1G7JB 1T03L 4PV8A 3BIAX 3DV4B 1HZHH 4PLNC 1P4BL 4LRNL 4EVNB 2NXZB 3HAEA 4NWUH 2HH0L 1OAXH 3NAAL 3KPQB 3MV9B 4JRXD 4QYOB 3MV8D 1DQQB 1X7QB 3L5JA 5JIPA 5JIIA 2HN7A 4O02H 2DI7A 3MRRB 2NY3C 3NGBB 2IG2H 3V7MA 1EHLH 4ZPVA 1MRFL 1RZGA 4LGPB 1JE6A 4JO2L 2CLZB 2B5IC 5E8OB 5K9OB 2FIKA 4N8PA 3MR9A 3C5SB 3QDAA 1LVEA 2LTQB 2GY7B 3Q5YA 1J1OL 5HGHB 1BD2B 3RWDA 3T0VA 1FORL 2GKIA 1X9QA 2LVCA 4X6EB 1EZVX 5E8EA 5HGAA 2CDEB 3TYGL 5E6IC 5E24E 2DQIL 4AK1A 5F6IC 1B6DA 4UB0L 4OLWL 1L0XA 2X1PA 2XTJB 4N0UE 2EIDA 3M17A 3I9GH 1J8HD 1E0OB 2R23A 4HKBA 1X6LA 4G8FB 5IQ9B 2C7UA 2K7QA 3P77A 5FK9B 3ABZA 2R1YB 2QQLL 2XRAH 1QBLH 1CXHA 3HB3D 5F7YC 2XYCA 1PG7X 1ITCA 3O9WD 3QNYB 3PP3H 4W4OC 4E42A 3UTSA 4W4NA 1NC2A 3VI4F 4UUJA 4I77L 1NGPH 2J7LA 4ZUVB 1H8OA 3FB7B 5BOZG 1JNNH 3TWCH 5D1XB 1TZIA 1NDGB 2FX9L 2JJUA 2OI9B 4ODBD 4X7EC 3QG6A 3GBMH 1ZHLB 5E0QA 4EDWH 3K1KC 1FE8H 3IVKB 1RZKH 5ICXB 3BZDA 3O8XB 4HEME 4X8JB 2YN5A 3UCRA 4OCWL 7FABH 4LF3A 1SEQH 1RK1B 2FDBP 3A6OA 4XX1G 4DWHA 3DVGA 3O3DA 5IWLC 1ZLVH 2DJUA 3AU1B 3U9UB 3ULVE 5LGJB 3CFBA 5DHVA 3VXUA 4W6XB 3WFCH 2A9NL 4QY8A 2AJUH 4LASH 5F7HA 5ESVA 3SKJH 5T1LA 1JGUL 1JN6A 2Q8AL 1S8DA 1RZJC 4RNRA 4C58B 5BJTB 3TJEL 4NCDA 2EXWC 4QWWD 5D7JC 1A8JH 1G1YA 1NQBA 1KF9B 4OLVH 2Y07H 4XVUC 3FOMA 1ZOXA 1GGIH 5I1HH 4ZAKA 3LMJH 4HZLA 2CDGA 2YPLD 3VXSE 4XMKH 5FKAA 1QBML 2V7NA 4NO5B 3QSKB 1MLCA 3RWGA 4WUUD 4PBWD 4WFHE 5GJSL 5FB8B 2F53A 2XFXA 1VADA 1HK6A 1MJ7H 4NNXB 5F1SA 1FO0L 1F4HA 3S36L 1IC5H 4HUXA 1JK8A 2JJTC 2X1XR 4AYFA 1Y0LB 4QRQA 2BVUA 4Q9CA 1ZE3C 1GOFA 1MFAH 3BN3B 5DLML 3O3AB 2DM4A 5BVJA 4EZMA 5F9DC 4PYHA 1RIHL 1BFOA 4LCUA 2AABL 3U1SH 1JWMB 5EFIA 5IHUH 5J1AA 4Q9QH 4OGYL 1N0XH 2VXTL 3Q5OA 3KNBA 4OBSA 4UTAH 2BNRD 4NWTH 2P5EB 3SDXF 1IZJA 5IBUG 3BPLC 1SJXA 3RGVC 2HJKB 1KT2B 3Q1SH 5LGHL 3GMNA 1J7VR 5EO0B 1YPZF 4LLMA 3CU1A 3SGJC 3P9LA 3QZWG 4ODVL 1YN6B 5SWZD 4DZBB 4WI9A 2EDXA 5FA3A 3QDJD 4P4KA 3T65B 3SBWC 4UQ3B 3PNWB 5GRUH 5C0CB 4EBQH 3CSBA 5E9DD 1HQRA 3ES6A 1S9YB 1D9KA 3L7FB 3NCEB 3HAEB 4ELMB 2P24A 4N0FA 5EU6E 4Z5RB 5IB4B 3U46A 4P9ML 1AXTL 4PJBA 4P2OD 4ELKA 3WIIH 4HGMA 4P2YA 4EJ1C 1MFBL 4W81A 3TO4B 4QOKB 4PBVC 4N8VA 1MNUL 1ORQB 3SDDA 4MB3A 2ESVA 3EYVA 2F54B 3BWAA 1CD1A 1UQSB 2J88H 2DQHL 2CIIB 5HGBA 4PRPB 3MRKB 2NY4C 2CMRH 4CDHA 1FFNA 2J8HA 2R8SL 3MCKA 5E5MB 3QJFA 1IVLA 2FH8A 3RZCD 1F8TH 2GY5A 1GYAA 3P0YH 2A6DB 3ESUF 4YXKH 1A3LH 2XPGA 1YJDH 2B0SH 1MHPH 1JNHB 1KTDA 5E6ZA 4P2RB 4C56E 5AUMB 3QWOA 5JDSB 4Q0XL 1OL0A 4O00A 2QSCH 5EOTB 2VZUA 4JO4L 1UC6A 4OGAC 2MQ3A 1SMAA 3S3SA 5EIVA 5CJXA 5I15L 4N1EA 5ICYA 1WEJL 3CSGA 3KPSD 3P3YA 5C9KA 2W9EH 2NCMA 1KJ2H 3O3UN 4XBEH 2J5LC 4M03A 5C0BD 1ZA6B 3RWIA 2E9WA 1P4IL 4HLZH 4PJCA 5DQJA 3ZE1F 4RAUA 5IIEB 5D9SB 3D9AH 3QUXB 3BP7B 3FHQA 3SKNB 4OT1H 3BZ4A 2J8UF 4X0KB 3GK8L 4OCYL 1W8NA 2Q20A 4JGJA 1S9WA 3QUZA 2RB8A 4HDIA 2QQQA 4ZSOB 1K5NA 5BS0D 2XN9B 4JFED 5E03A 1JZ4A 1A3QA 2F5BH 1Z9SA 3O6KH 2ICES 4KK6C 4G3YL 3RUGA 2DQUL 4MJ5A 3S8WA 4L3CA 5I19L 3PUCA 1DQJB 1CGTA 5E7BA 3JV6B 1S5IL 1FJ1A 1PKQB 1VPOH 1XF4A 5ADPL 5LAXB 1M7DA 3T1WA 3HUJA 4LF3B 1OT1A 3RL2B 2MTPA 3MYJB 2PF6A 5DJAA 1C8PA 1UJ3A 2CK2A 4BK4A 1RUQH 1VKXB 3S5LA 3TVMD 1QO3B 3TBYB 5J1SC 2BY1A 5CS7A 3WFEH 4MVBC 4NRXB 5GRZA 1HI6A 4Z0XA 3WHE1 2HVJA 5KS9F 4XNUL 1D5ZB 2NLJB 1OARL 3C5ZA 4NRZA 3RY6A 4UNVA 1JF5A 2VWEE 1DN2A 5DMIH 1U3HD 5TDNA 2EEBA 2BSTA 4XNQA 3AREC 3G6JF 3GMLA 2IFFH 4UBDD 3WN5C 2X4PB 4ZPTA 4M43H 1IGYA 5B22A 1AGBA 3WIHH 1EVTC 1UM5H 4KDWA 3CH8A 2VLKA 1TVBA 1X5JA 5DT1H 3RFZC 3I6KB 4W6WB 3VXRE 3RI5F 4R90L 2VDPL 4IIQA 1A0QH 5FF6B 1T20A 1JHKL 3DGGB 1D6VH 4LSSL 5LXGL 1KACB 3T0EC 1OPGL 2Z31D 5SWSA 4XT1C 4BQ8A 4IRZL 3ARDA 4FMKA 1GGBL 1HILB 3JWDL 2C3VB 1IZKA 4LSTH 5H37G 3ALWA 3CC5B 5I2IA 4LCUB 5IMLB 1T66C 3QEQA 2Z91B 4Y16C 5B3JE 5J1AB 2YC1B 2DM3A 1VGEH 2FSEB 5C07E 4NC1C 3QCTH 4RMTA 3QPQC 4XNYH 4D3CH 3UJIL 1DBJH 4NHCL 2GSGA 4X80L 2DQTL 5DK0B 4E41A 2V2XB 3E3QE 5C2BH 3S36X 1INQA 3DSNA 1CYGA 2NY1C 5C0DB 3FT2A 2VZOA 2A9ML 3FQNA 1D9KB 2AP2A 2BHUA 3MACL 5F7DA 2IGFH 2W9DL 3CMOL 4Y8AA 4ZUWB 5EZJA 3BQUC 3KYOA 1A7BA 2NXYD 4L8DA 5DRWB 1X5XA 1VFUA 4MWFB 4OAWA 5J11B 1TCRA 5MP6H 2RFXB 1T04A 2MKLC 4RMSA 2VXUH 2ESVB 2DRUA 2FRGP 4M1CC 3QO1B 3FZUD 4KDTA 5CHNA 4HZAA 4R4FH 4TN9A 5DZNA 5DJXA 3GJEB 4NKQB 5FECA 1QOKA 5CJQL 5IFJA 2AJSH 4K07A 1FN4A 3JWOC 3UJJH 1NFDB 4X6DF 4XNXH 2OR8A 5D6CB 5DYOB 5HI3C 4NDMB 3WKNA 1AQKH 4YXLH 5IK3A 1X5ZA 2R0WL 3WS6A 1ZT4A 5E4EB 1R0AL 4L4TE 4XGZA 3WLWD 1ND0B 1AO7E 5ICZB 4NM4H 3TBSA 2EZ0D 4IRJB 1OSPH 4YR6B 5JO5A 2UY7A 3ME0A 4F33A 4PP2B 2VDLH 4ZXBC 3AM8C 3HC0B 4UT9H 3KLHD 5KVFL 4K2UH 1E6JL 5CINL 5I76A 3RA7H 1M7IA 1N64L 1FRGL 4YC2C 1LE9A 5BQ7A 5TQ0L 2OL3L 3IDNB 1ZGLA 1SVCP 4PP1D 3ZKMD 3FFCE 2BVOB 5TF1L 3WNNA 5FA4A 1TZGL 1UFUA 2ADGB 5E00A 2YN3A 2ZUUA 1KGCE 2EYRA 3FB8B 1E4WL 4WWID 2DL9A 3QUZB 5F9OL 4LCYB 1EAPB 1T5WA 1Q38A 2HWZL 3DETD 3LKOA 3V5HA 4D9QE 1LQSR 3G08A 5IVXF 4U1KB 3KPRA 4Z7QE 2G2RB 3WDIA 1ZV5A 4CVXB 4XCEA 3ULVH 1R3IH 4KKCC 3L5XH 4JB9H 3DJ9A 1OAZL 3IDIB 4C83B 2HFFA 3ULUC 2EDBA 1KUMA 3VA2C 4CVWA 4YXHL 1UCTA 3IDYB 1WBZA 3GMOB 1OAYH 3P4NA 3REWB 1EGJL 1SMOA 4YE4L 4KU1A 4XXCC 4HC1A 1W0WB 5F21B 2I5YL 2PTTB 2NMSA 2GEEA 2YS4A 2LAAA 1IGCL 4D94A 5ACLA 4Q6IA 3X3FH 1KJMA 4FZ8L 4CUCA 3MCLL 3ARWA 4U1IA 2BXYA 5C0EA 3WKMH 1M4KA 5ETUB 2Y7QB 3O2VH 1S5HA 4NC2B 1CFTA 4DQOH 3FONB 3D0VB 3H7BB 3N1MC 4XP9H 5GGTH 2W0FA 1LO5A 2KH2B 4JG0L 4X7SH 3LAFA 3T2PA 5DD5L 3RHWK 1BMGA 1VFMA 4XP1H 2V7HB 1J05B 1HNGA 3LKSB 4KJQC 5F72S 5J8OA 2D31A 4LLYA 3GIZL 4MZ3A 1MI5B 3VFVA 1QFWH 2D0HA 4XP4H 1U91A 2EXYD 4QTHA 3FMGL 1U41A 3IDXL 2XNAB 5H35B 2D0GA 3F7VB 1XF5B 2OZ4L 2VJXA 4JZJA 4PJDF 1GGCH 1U92A 4FXKA 1KBGH 5L7XH 5KG9A 1U3YA 4H25A 3EOAB 1FDLH 3O4OC 4K7PY 3CFIC 4LEOA 5ILTH 4F7MA 4L4VD 5I1DB 3DROA 2IAMD 2BOBB 2O5ZL 1G7PA 2GCYB 5F9AC 1I8KB 4Y4FD 25C8L 5GRJL 3TBWA 5HY9A 1NUGA 4OTXH 4MNQE 3F7QA 3TO2A 1YEIL 2Q8BL 3QP3A 4UT6L 1HQ4A 1CICB 4EXPX 1INQB 3PL6A 4MJ4A 1MAJA 3U48A 2E27H 4U3CA 1F2XK 3FN9A 4KROC 5E99L 3KPPA 4NQXA 2X4OB 4Z7VB 4YDIH 5I1EL 3BJ91 1CE1H 2DIAA 4LLVA 2VLJB 5E6YA 1A9EB 3TBTA 1UYWL 5AG9A 1XF1A 5L8KB 3PWLA 4YIQB 1PQZA 1Y6KR 1LD9B 1ZHBA 3PG2A 1OSZB 4TSCL 3LH2L 3W9DB 3QQNA 1I1AA 3L95A 3QFJE 5KANI 1R3JA 1B90A 4GRMB 4G9DA 4ZMAT 4ISVA 2ATPB 3B8YA 5EORL 3W81A 1K2DB 3GRWL 4X5XA 4JQVA 2E3VA 3VWKB 1YY8A 3J7HA 3PWVA 1CXFA 3ARUA 2A1WH 1RU9H 3QAZB 1G9ML 3MFFB 5E2TH 5CMAB 1EFXA 1GAFL 1DBKH 2ZUXA 3QHZL 5DWUH 5I1GH 2CLVA 1EAJA 3MBEC 5JZ7D 3D3VA 3DECA 3ULUF 3SO3C 3UTTE 4PJFA 1CLYH 1DTUA 3HNTL 1FLRL 3OJDB 3MV7B 4TVPE 5CJOL 4KVCH 3BKJH 2WBJC 4P5MA 2DMBA 1WUNT 1MPAH 4F37K 2JKXA 5LGKA 4GMSH 5DVLA 3AC0A 4JDZB 2F74B 3B3IA 1SEBA 4GS7C 2IQAA 1M7IB 2DQJL 1WBXA 3TA3A 1LE9B 4NUGL 2XXMB 4LPWA 2GJ6E 1JF1B 5KAQF 4PJEF 4K94L 1EDQA 5FA4B 4MNGE 5F88A 2A0LD 3LB6C 3VXRD 4BKLA 1RV6X 1RZ8A 3ARZA 4M5ZH 1VFBB 3EO0B 1LEKB 2Q86A 2I9LA 3G5YB 3VXME 1ZWIA 3Q6FB 4UAOB 4KRPD 2Y5TA 1FIEA 5D1ZC 3HNSL 5IVZB 1NDMA 5LBSH 5C70A 1FZOB 4AEIH 5H2BB 2AV1A 3S88H 3C6LC 3MV11 4XZUA 2FLBT 4MQ7A 2AGJH 2AK1L 2VN4A 4F3FA 1SHMA 2YEZA 5T1DH 2BDNL 1MCKA 3ARGA 3BSZH 1C5DB 4JY5L 2ZKHL 1UA6H 4RFOL 4ERSH 2BOCB 3GZKA 4MJIA 2JELH 4RSVA 3QDGB 3HC3H 3OKYA 1MJUL 4OZGF 3SO5A 4GQ9L 4WY7L 5IV2A 4WRLA 4X8XA 3P30L 5FUCC 4U1GB 2R4RL 2MCPH 3ZKQD 2G5BA 2DB8A 3LEVH 4RFNB 5IB2A 1DQDH 3EUUA 1KXVC 1QSZA 4JO3L 4YHZH 2GTWA 1MHCB 4J8RA 3UX9B 2VDNL 1QSEA 4AJ0A 3M45A 2CRIA 1KLGB 3PIQB 1BBDH 4OZHB 2YUZA 1K4CA 4L8BB 2B1AH 3DHMA 5DD1L 2CKBA 2ENYA 2YA0A 1T1ZB 2H9GB 1J10A 5DZOA 3V8CA 4OF6A 2AKRB 3EO1B 1L9MA 3HI6H 3TIDA 1AQDB 1FFOA 2IPTH 2W1NA 3ARFC 3NOIA 4IDJL 4AG4L 1HH6A 2P8MA 2P4AB 4JRWA 5ESAB 3ZKXB 5AG8A 1RZ7H 4JR9L 4MX7B 4XNZB 4Y5XC 4HIXL 8FABB 4GBXA 2Z92A 4NN5C 5D7KE 3LPWA 2HRPH 3S34H 3VI4E 2FYYB 3GSNB 1NCDH 5TE7H 3M07A 3QPXL 4X5WB 1TETH 4JFOB 1F4AA 4FQ1L 2A74A 1U6AH 4L4TD 4Y5VA 3MRDA 4NNYA 1AO7D 4M93C 5HYSB 2FWOB 5C6TH 3GB7B 2R0ZH 1S7WA 3SE4C 1QHPA 2YOCA 2QADC 3C60A 2VITA 1HDMB 2E9IA 5FYJL 4JPWH 4P2QB 2R0LH 2BC4B 3OSKA 3K74B 4DVRH 4IOFC 4U0RC 1S7XB 4EUPH 2OJEB 4HD9A 5CBEA 1DDHB 4LCWD 4S1RL 3NCJL 2VLRD 1KENL 3I6LE 1I7RB 3WUWA 3FFCD 1KTKE 2DLTA 5DRZB 1G7LA 4QF1B 1FCGA 1KGCD 3FQRB 1BQLL 5GGSB 4R8WH 3RVXD 1C7TA 3MV01 1BFSA 4FQXB 2H2SC 3K8LA 4F7PA 1WT5A 2BMKA 3WEXA 3BRDA 3V5KA 2AXFA 3EJJX 4D9QD 4EIZC 3K8KA 1FQ9C 4ORGB 3PWLB 1FGVL 1HXYB 5CGTA 4J3VA 4K3EL 3VFSB 2X4NA 1K6QH 1QYGH 2NYYD 1IKNA 4YPJA 5LCVL 3HFML 3FFDB 1JFQL 1E28B 4M02A 5CGMA 1NGYA 3TH3T 3UBXA 3KG5A 1T1YB 5IB5B 4RGMC 2X05A 3D39D 3LEXB 3UYRL 4KVNH 2Y6SD 1F3DH 1D3CA 3QI9B 2ZUWA 4PRHD 5B8CC 1NC4D 4Z8FH 1RUPL 4H0GA 2ZOLA 5I8OL 5T1KD 1F4XH 4BQ6A 1IRAY 2IBGA 1N3NB 4OFYA 5HYFA 1UWXH 4Y5YA 1G7HA 4NQEA 1JZ7A 1FL5A 3D3VB 1QR4A 1SJVA 4DN3L 1CLZL 1I9RH 5BV7H 5FYLE 1EV2E 1IC4L 2QQNL 2YPKB 3D2UA 4OQ1A 2IEPA 4PREB 4PJ9B 4Z7UF 5CP7B 4IDLA 3MGTB 4F58L 4K8RL 2ITCB 3TESA 4X6FA 5DS8B 4XRCB 3VH8G 3SDXE 4LRIA 5C08E 3HG1E 5LQBL 4FXGA 3KS0J 4Z95L 1Y6NR 3ZO0A 4GAJL 1YPZE 4WUKH 4EI5C 4TYUA 1Q94A 3K80A 1FH5L 4XMLH 4RBPH 1J0ZA 4HFWA 3MROB 2BSSB 2NTFA 4U1LA 4FQQB 5L9DL 5JLZB 2NY0C 4Z7NF 1Z9OA 3X11A 5CAYB 5DD6A 1MREH 3FN0H 2Y5TB 4M7KH 2DDQH 5FDYA 1YY9D 2OXHA 3VFOA 4DW2L 1QD0A 4PB9H 4UILL 5ITFA 5CFHA 1OY3B 3VFWA 4H88L 1UKSA 3QNXB 5A2FA 2DWDB 1TENA 3NZHH 4NYLB 3QQ4A 3MLTA 1YMHB 3GJFA 3MC0A 2C1PA 5JHDA 1Q9LB 1J1XH 5DD0H 4R26L 4Y4HB 2WZPD 5EO9B 5IQ7L 1JI2A 2HVKA 2PCPA 4XP6H 4P46C 3X13B 1E6OH 1ZLUH 4XBGA 1DL7L 2WINA 2GT9B 4XPAL 1ZLSL 3SOBH 3L5HA 3SDCA 4FQ2H 3EAKA 3BKMH 3RWCA 3U6RB 3TZVB 4R0LB 1U8OB 3SQOL 1Q0XL 1GIGH 4PJGA 4HFUH 4AH2B 2XWBB 5GIRA 1T2JA 3ZE1E 1FFOB 2C9AA 3IF1B 3TT3H 3FO0L 3X3GH 3QFJD 5CGYC 1UWGL 3C5JA 4CGTA 3WS3B 4S1QL 3MJGX 3O6MH 2J8UE 1MIEL 4ZFZA 3N9GL 2NY5H 2Z92B 1BJ1J 4EEEA 1KIQB 1QRNE 2AXGA 1RHHA 5E2WL 3ROOB 3D25B 4M6MH 2X6MA 2HFGL 2X9XA 1JRHH 4M7LH 4RWYH 3TCXA 3HE7B 5GHWH 5CEYB 4YEFA 3GHEL 5KW9L 4NNYB 4QHKI 3OKOA 4P9HL 5BO1L 4MA3A 1BOGB 5DD3H 5ALBL 3SKUD 1I9JL 2AS5M 1EPFA 3EZJB 3V0WL 3UTTD 5IBUB 2MPAH 4X6BA 3QFDA 3MXVL 1P84J 3FO1A 5INCB 4TVPD 5BXFA 5B38G 5TQ2H 3QZWB 5CIPB 2CR3A 4G42A 4LLWB 3QULB 1TVHB 1UGNA 4XNMB 2GJ6D 2KDGA 5J13C 3HMWH 3T77B 2NQCA 5DTFA 5EZOH 3VMNA 1G7LB 1RULL 5KS9E 1XR8B 4Q9RL 2VE6B 2Z0BA 1IQWL 4H1LG 3E8UL 1Q1JL 3OR7A 1CT8B 4R97C 3SDAA 3VXMD 5B4MC 4LCCC 3CAFA 1ZHKA 4ODHL 3DMMC 1BX2B 3ZE0F 1NUFA 3QIBB 4JRYA 2BNUA 4NZRH 4X4ZA 3SDYH 1KNOA 2GK0A 1IEBB 2GFBB 5D2NA 4HT1L 2FEEI 5J56B 5DFVD 3CU7A 5DMGC 1XGQB 3MOQA 2ENSA 3VXNA 4MCYA 4Y7MA 4GRLD 5BZDB 2FEDC 1IAII 2R1WB 4PGCA 1VHPA 1FZJA 2DJ4A 4JLRA 2IQ9L 5D5MA 2UYLB 4KTEH 2ADIA 4KKAC 1WZKA 3CFKB 4P59L 3B9KD 4P3DA 1Z6JT 1T5XB 1EJOL 2IAND 4BUHA 2UWEF 3OTTA 5DJ6A 1U8KB 4QCIB 5JW4R 2O5XH 5FOBA 2B4CC 4WU7A 4I3SH 1M6OA 4ODTH 3GUTA 5D93C 1AIFA 3U7WH 4NQEB 1T22B 4HWBA 5FHAL 5JUEH 4DGYH 3L3GB 4JG1H 1FAIL 4GKSA 5D2LF 1UCBL 2YPLA 4L8CB 2QLVB 4X6FB 5GRWA 1NLDH 1Z2KA 1IAKB 5I75B 1JP5A 1CS6A 4WUUA 3IFNH 1P53A 1ONQA 3QEGH 3O81A 2NY6D 2E7LA 2ILLA 4KQ4H 4RGNC 5HHXL 1DP0A 5EZIL 1Q72H 4OLYH 3O0RL 4YDLB 3WXWL 1QR1A 3LKNB 1CBVL 3CUPA 1KELL 2NTFB 4P5TA 3DRTA 4BFGA 5ID0B 1CF8L 4O58H 1P7QB 4I13B 4TTGA 4RWHA 1U8NB 1YDPA 4JHAH 4OM1H 1UB5A 4M6NH 5IW1B 2PN5A 3CVIH 3HPJA 1PZUB 1MUJB 4P49A 4K55A 1TJIL 1LEIA 4I0PC 1JZ2A 3HTLX 4ZUSB 3BH8B 3KPLB 4RAVB 5C09E 2R2EA 1IEAA 2Z4QB 3DHJA 3QUYD 4TOYL 2ARJA 3BUYA 4TUKH 4U3XA 1M05A 5TDPA 1CG9B 3MLTB 4L29B 3GJFB 5DK2B 5F7FA 5JQ6H 4K7PH 2BNRA 2MQCA 3H0TA 4DFHA 4P23D 3VD4A 5HVWA 2KZ1B 6FABH 4X6DE 3RVTD 3CSYB 4NCC2 5A3IC 5IEKB 2R2BB 1JTTA 4H8WH 4IM8A 2C4XA 4PRIB 1D5BB 3OXSB 5E5RB 4XAKE 2EEAA 3QWRD 1NBZA 3AMKA 2YD4A 4JRXB 4PJ5A 3DX7B 3EDKA 3GSUA 3MV8B 1KJ2A 3LS5H 4P2OA 1WWAX 2X89A 3V7AG 1WBYA 3Q6GL 5D7LE 1ODAA 4XBPA 1RK0B 4NC0B 1BLNA 5EH1A 4FP8H 1DBBH 5TE6L 2YHGA 4R4ND 3ZHKA 3PP4L 3WSQH 4EQ3A 1UH3A 1BZ7A 3LKPA 2D3VA 3DXAA 3RTQD 1BEYH 2JCCF 2KUTA 4YX2L 5E8DH 2D0FA 3EOTH 1DQMH 2F8OA 1KG0A 2J6EH 2UZXB 3MRIA 2RBLA 5HHNB 3IDMA 2N56A 1VACB 4OCSH 4I4WB 4ZOCA 2D03L 3E6HB 4PY7B 5IVXE 5I16B 4OKDA 3TLRA 5FDWA 4FFZH 3NZ8B 5LWYH 1TJHL 4R4BB 2DM2A 3AS1A 4OI9A 1CGYA 4P5KA 1DEEA 3GO1H 4IOIB 1DUZA 1MEXH 2XI9A 3IXAA 1HINL 1QLFA 2ZOKB 1YNLL 3VGGA 4Z7WB 4DTGL 4PRDB 5C0BA 4CVZA 4WHYG 2VN7A 1J8HB 2ZPKL 1WSST 4X83A 4DKEL 1ZANH 3T0EE 4L3EA 2FLRT 2WANA 1D5IL 1P84K 2GAZA 4LARL 3UZQA 2YXFA 5C08D 4WV1A 3O9WB 4XC1H 3GKZA 3RWEB 4D9RE 1TNMA 4MSWB 4DAGH 4QXGH 1LO0H 3TNMB 2FX7H 5E4IA 3L1OL 1A6VL 4JFEA 5KSBF 5BCAA 3AROA 5C9JA 4M48H 4J1UB 3OR7B 2APXA 3WIHA 3IFOA 3PGCB 2AERT 4WO4C 1RJYA 1U8JB 1NGQL 3UEZA 2P8PA 4HS8L 1KNOB 2GK0B 1NAMH 5D2NB 5L2KD 4D8PB 1DANU 1DQLH 1F6LL 3D18A 1XGRB 4Z0BL 2FGZA 3VXNB 4MXQC 4RRPA 4RQQB 5E8PB 3IGAA 4JO1L 1NCWL 5JNYA 5D5MB 1RPQA 2CK0L 5CD3B 2ZG2A 2XA3A 2X2YA 2ZCLH 1N7MH 5FYLH 2X4UA 3TVMA 2WW8A 1ZTXH 5JPNB 1WAAF 1E4XH 1NEZG 4PJDE 4MD4B 4F9LA 3NCBB 3CIQA 4OB5L 1NBYB 3QXVA 4WU7B 4IJ3C 4JM4L 1U3HA 2B2XH 4P4RA 3C9NB 3QCUH 5C0JA 1FL3B 3OKKA 1ZLWK 1JYNA 2Y36L 1R5VA 3QHFL 1Z9MA 4KH2A 3GGWA 4R9HA 4Y1AE 4Q58C 4OFPA 5E1AB 1I3RA 5EG6C 1BVZA 4JFDE 1GGTA 1RJLB 5GGRA 5DVMA 3B83A 2DQDH 4WUUB 3C09B 5I66B 3KLAB 3FL7A 2VXVL 4KZDH 5F3HA 3RX7A 2DQEL 4PG9B 1T3FB 4OSUL 1QR1B 3CUPB 5A2JH 4FRWA 1KCLA 2Z31A 4L5FH 3I6GB 1MQKH 3E0GA 1CE6A 3HNVH 3X12B 4UTBL 5D8JL 3WBDA 1QRND 1QA9B 5IMKA 4HK3N 1T89C 3PDOB 1YEFL 4HJJL 1UWEL 4KKNA 4HC1L 1NMAL 2R15A 5F6HJ 5DXWA 1YECH 3VDBA 3BE1H 1AR1C 2VABA 3QEHA 3GFUA 3UTPE 3LHPH 4OCNC 4AM0B 4XVTH 2OK0L 2YKLL 4NRYB 1I1YA 4WFGE 4JFQB 4N0UA 5T33H 1Z9LA 4FA8A 5LVEA 3MLWH 1YNKL 1MOEA 4LMQE 1MWAB 2DBLL 4FABL 4HF5L 1MCOH 4WI5A 5SWZB 1W8OA 1DVFC 3QDJB 5E9DB 4G6MH 4NN7C 4KUCF 1HSAB 5IT2H 4UIKL 3MA9L 3WDJA 2P48B 4Y4KD 5IJKA 4H20H 3GSUB 4DUWA 1B3JA 1EEYB 5A16B 2QSQA 3HCVA 3ZKSD 4BM7A 2CXKA 5I71C 3HC4H 4BFEA 5HHOB 5JQHC 3TBVB 2FL5B 1RZJH 4OIIH 3VGHA 2PR4H 4HUWA 4JY6A 1LILA 2NXZC 2OJZL 3TN0A 3AXLB 5DF0A 1ZXQA 5EUKB 3JTTA 3GSNL 1I3GH 5GJTH 1FFPB 5DURD 4PTTA 4WNQB 3RGVD 1HWHB 4PJEE 1UXSA 4LSPL 4PJ8D 3SKMB 2E6JA 5FUOH 5FO8B 5SWQA 3MLVH 4ZS7L 2H1PL 2JIXD 5J4MA 5J57B 3RZCB 5E08H 3QA3B 5GRXG 5EUOB 5JXEC 3GIVA 1G1CA 3MRBA 3UC0H 3EJZD 1V7ML 2WUBH 1FNFA 3K7UA 3KWWB 2FJGA 3B9DA 3KXFB 3MRGA 2X40A 1L6XA 1OGAE 2LTQC 1C5BL 2ICWB 3BMWA 4ONGL 4UU9B 1N5YL 1I7UA 3NTCL 2DLFL 2NY2C 2C1OA 4ZOBA 3IDGA 5BMFH 1JGEB 3F7YA 1MHEA 4ZQKA 5IEHB 4Q2ZA 3KPSB 4QRPB 3O6LH 4HIEA 2BCKA 1VEPA 4OGXL 4LU5L 2KQMA 2UUDK 1MCBA 1A7RH 3FOLA 2HFTA 1UM4H 4HS6A 2IBZX 4DZ8A 1MJJA 3VXSA 3GI8H 4OZGE 1OP3K 1Z3GH 1IL1B 3GMQA 4WEBL 3VFRB 5F9JA 1WFUA 3ZTJG 1P2CA 4H5SA 4WJ5B 3VW3L 3D0LB 3EDEA 5BS0B 4U1HB 2GI7A 5GGTA 1B0WA 5CJ5A 3NCCB 1LO4L 3ZKND 3BD3A 3B9VA 4LPUA 2YA1A 2LVEA 1ORSB 1VEOA 2DF3A 5IOPA 5TGBB 3LPGA 4CAGA 3LS4H 5E95B 2HT2D 5KOVC 2VUYA 4DGVL 2JB5L 3GDBA 4YO0A 3MNZA 4G7YL 1JMXA 4QHLA 5ACZB 2EIZA 4K94C 1E4KA 3QIUB 4AENA 2OI9C 4AIZB 5C09D 3DUHA 4ZFGL 1YEDA 1CFQA 1U58A 5EN2A 1YUHB 1P5UA 5HD8D 3U0PA 4UDTA 4KK8C 3S4SA 2X4UB 2ID5A 2EO9A 3O8XC 4HX1A 2D9CA 5CILL 3BJLA 3G6JB 2ORBH 1PY9A 3EYQC 1BIIB 1I7ZB 1A2YA 4O2EA 1QEWB 4KXZH 4A2LA 2VAAB 3DV6B 2AI0H 2ZZUT 4IEFB 1S3KH 3SGEI 1KPUB 3BPLB 3RWJA 1URLA 3S98A 1WZ1H 3FAXA 4R3SB 4XAKD 3GI9L 4JCMA 4XB8A 2EKSB 5EU6A 1R5VB 4E0RB 3SPVA 5D7IE 2DTMH 5MEQA 2A6KA 2CQVA 3PWPB 3DUSB 1JGVH 1R3KA 3VXUE 4LLDB 4M5YH 3I3BA 5HHQB 2X7LA 3S6CA 4LSVL 5DEZA 2FBOJ 2G60L 3MODL 3NPSB 5DJ0A 2DWEA 4N0CD 1G9NC 4MS8D 3UTZA 4LLAA 3CFEA 3U83A 3OZ9L 3PV6B 5GS0D 1LO3H 4PYGA 5IM7B 1YYLH 1OAUH 5I18L 1Y18A 4KGJA 2WV3A 4NT6A 4ZODA 3BVNB 3MNWA 3EFDL 4FNLL 2G75B 2IAMA 5T5FL 2AQ3A 3RHWF 4C56A 4IMKC 4Y2DA 2H3NA 3O2WH 3OAZH 3BHBB 2Z9TA 1QLEH 1DBAL 1ZK9A 5DQDL 1SYVB 4AQOA 5I30H 2Y1VA 5D1QA 1HCFX 3PXJA 3G04A 4KRMB 5T3ZE 4ZD3H 2X4SB 3TJHC 2HT3D 2CJUH 4EN3A 1U36A 3T0ED 5ISZE 5KZCD 1YN7A 2FBJL 4LBEB 5EU5A 2Y06H 3WUZA 5ID1A 4OZFH 1FZKA 4YGVA 4M4PA 4JPKL 4XPBH 2CKBL 2UZYB 2YRZA 4KPHH 2NXYB 5GS0H 4WW2C 3RRQA 4G8GD 2K9UA 3BEWA 1BFVH 4Z7UE 4HUWB 3D48R 3EOBA 4YDVA 3CX5J 5BRZD 1HSBB 3K4ZA 4M6OL 5IF0A 5GS1A 1V3MA 1MRDH 3GSQB 3T3ME 1XGPA 1D5MA 2BJMH 2PW2B 2PXYD 5FUCE 1NAKL 5B39A 2EICA 3GKWH 3M8OL 3BKCH 4JQXA 3TO4C 3DSFH 4J4PD 4A6YH 3D5OF 4WHDA 3O2DL 1SY6H 4HIHB 1H5BB 4HJGA 4PRBB 3RVWD 2Y72A 3VFTA 5C0AE 3MJ7A 3T0WA 4JVUA 4U6YA 4B50A 4Z7NE 3ZSTA 1MCWM 3VFNA 4HBCH 2XKNB 5IFAH 2R4SL 5AEAA 3VXTA 4TULH 4JFXB 4LEXH 3THML 4XVSL 1I7UB 4ALAH 4L8SB 1UACL 5D72L 4V2BA 4HIIA 1IGMH 4MAUH 4XC3H 5CKAA 43CAB 4HIEB 3HRZA 1JRHI 2B1HH 3FTGA 3LSOB 4BSVB 4DKFH 4HH9A 4G6KH 3BIBX 4U6VH 2XZQH 4XVJL 4CMMB 4B41A 1HHHB 4KMTH 1A6WH 2AVGA 3PQYE 4QHNB 4LHUD 4K23L 3BDYL 3QWQB 2H45A 1W0VB 1CGXA 1P2CB 1Z5LA 2DLGA 4HWZA 5EIIB 4EOWL 2DJSA 3ALPA 3CPLA 4ENEC 1RUKL 3PJSB 3HZKB 3VRLF 4XAWL 2R9HC 4ZOEA 5IESL 3QUXC 1XT5A 5IB1A 1A1OA 1FIGL 5IMOA 1XGYL 3N06B 4ZXBD 5SX4H 1BQUA 5AYUL 4OJFH 3MNZB 2ZNWA 4G7VH 4ODSL 3NFPB 3OX8A 4QHUB 4YNYA 4NSKB 4U6XB 1V8HA 3EGSB 5DGQA 4XPFL 1OLLA 4BA8A 1KJVB 1LDPH 2XIDA 3KPNA 32C2A 1YEDB 5EBGA 5C07A 1UM6L 1DSFH 1JV5A 4JY4A 1CLOL 4WFGD 3U0PB 3MJ9H 3MBXH 1UB6B 4HV8B 3CLEL 1G6VK 3JWOH 3VXPA 2WIIB 2AJZA 3OGOE 1KTRL 3GJFK 3KPOA 5I1LB 3ARBD 5K9KB 3IAPA 1I8MB 5L2JA 4HH8A 1H3PH 2PO6A 1MCPH 4IHOA 1L0YA 1A6ZA 3BEVB 2YSSA 3NA9H 1HZHL 1S9KC 4LPTA 2YPVH 2A6JB 1FNGA 1NPUA 4ZDHA 3VH8B 4NWUL 3IU3B 1OAXL 1I1FB 3QO0B 1A5FL 3V0VA 4EUPA 5EO1A 4O02L 1CTNA 3RKDD 2IG2L 5K9QG 4X7TB 3GSWA 1RUML 3VRIB 2H32B 1IGJA 4KWUA 1EHLL 5IKCB 3PWJB 4WI2A 1U8HA 3ZHDA 3WD5H 4GKZA 5CSZA 5HYJE 1S7RB 4WW2F 2O26U 3BT2L 2XZAH 1WQVT 2X70A 3PP3K 3OAYH 2GHWB 4MAYA 4L4TA 4XH2B 3FQXA 4L4VB 1GSMA 3PHQB 4M3JA 3ZE0E 3L5WB 4ELMF 4Y19E 5F44A 3DX9A 2H3NB 3G5XB 4GSDH 4HCRH 4Y4FB 2FHCA 4POUB 1OGAD 3T4AA 1T83C 1HKLH 2PYFA 3WIFA 2OM5A 4QTIH 3QJHB 3FHAA 3ULUH 1X4XA 2HTKD 1QLRB 3ARSA 3BGFC 1KIRA 2Y9RT 3G5ZB 1OTUC 1RQ5A 2YRLA 3FFCA 5M95B 4JPIB 2ZUQB 1F00I 2UWEE 3BO8B 2NY7H 2ZWLT 3BP4B 5FGSA 3OJMB 2XRAL 1QSFE 1QBLL 5IW3A 1A64A 2A73B 3T1FA 4QRSB 4MD5A 5F7EH 1NGPL 4P4KC 1GOGA 1D9KC 3EBAA 5D2LE 2FX8H 3ZLQC 1S7SA 3RL1B 3VFUA 4PRAB 4EDWL 1XGPB 1CR9H 5I73B 2P5WE 1OTTC 1FE8L 2HLAA 2C3HA 5AYQA 1WIOA 4K8RD 1RZKL 5J11C 5FV2A 4FTVE 4U6HA 1R3LA 4LLQA 3CX5K 4CBPA 5FGBA 3UTSD 1NC2D 3G9VA 3W9EA 4EI6A 2HJFB 1SYSB 2EH7H 7FABL 3MXWH 1RZFH 1LP9E 4M7ZC 2JJSA 4J2XA 2LABA 5DRNA 1U95B 4LASL 1F4YH 1IKFH 5E4EC 5B38B 1C5CL 4LVHB 4RX4D 2AEQH 1T1XB 1Q9KA 1LWRA 1NUDA 1QRKA 4NJAL 4LAQH 3RDTB 4OLVL 2Y07L 4IRJC 5I6XB 2F58H 3KYAA 4UINH 1DZBA 3VXUD 2DBJA 5D7SL 1MRCL 1G7IA 5FO7A 2OTWB 1GGIL 3LMJL 4XXDA 1PG7H 4H1LB 3VXRB 4XMKL 3HZVB 3L3OB 3CK0H 1KYOJ 4HWZB 2NNAB 4KI5D 4MD0B 4KAQH 4M7LT 4GKNA 1MJ7L 3GSXA 5IB1B 1TMCB 5ADOH 1K4DA 4WDIA 4M61B 1IC5L 1NLBL 3G6AB 1OCWH 4PBXA 3QUZC 2EDQA 3NPZB 4IMLA 3GM8A 4YNYB 1X6NA 5F3BA 2F53D 2W65A 3MLUH 1FVEB 4HAFA 3IAGC 2AEIT 3U1SL 5BW7C 2JCCE 2XXCB 4MNQA 2X4TB 5T3ZD 4XWOC 4KJPC 1Q9OA 4Q9QL 5MENE 4HS3A 1N0XL 2CDFB 1NGZA 2APBA 3HS0A 1CL7H 4HWBL 3IDYC 4UTAL 1ZEAH 4JFHE 4NWTL 1XGUA 3KVQA 1V05A 1IQDA 3Q1SL 2O5YH 1AGEA 3TEUA 2FR4B 1ZVSB 3PWUB 5L2JB 4ESKA 1UJ3C 1FNSH 1FHGA 1NJ9A 2XQYK 1PX3A 2FIRT 5C71A 3OPZH 4IOSD 1CIDA 2YD3A 4EBQL 1WFNA 3CZJA 1FL6A 2Z8RA 3D87B 4ZDHB 5EC2B 3OWEA 4I3GA 1QFHA 4BZ1L 3LRHA 1M71A 4HK0B 5J7CC 3TIEA 2APTA 3ZL4H 3DVIA 3INUL 3QFJA 5ESQA 5E2UH 3RPKA 4P57B 3EHBC 2J88L 3VWJA 1JZ6A 4JPVH 5ALCH 4P99A 4BH8A 4WFEE 2D7MA 2CMRL 5C6PB 4KHXH 5KSBE 1AD0B 3AAZB 1T6VN 5T3ZH 5J3HD 1PGRB 1FYTE 5C0AD 3MOBH 4ZS6C 4IIQC 1BVLA 2PYEB 4PY8I 3SDDD 3BP6A 1AO7B 1AKJD 1S7UA 1CLCA 3A0OA 1A3LL 4FFYH 4YXKL 1YJDL 3DX6A 3UTTA 4N8CH 5I17B 3IS1X 1GZQA 2QSCL 3MZGB 4PGBB 3MBEB 2YUWA 2ATKB 1HOCA 1I8IB 5J9PB 4LCWB 2W9EL 3D69B 2AV7B 1KJ2L 2COQA 2VLRB 2IPKA 5F1IB 1FVDB 3C8KA 5IGXH 1VA9A 1NFDF 4D0DA 1LHZA 4PJAB 4MNGA 3PQYD 5FYJU 4MDIA 2EC9U 4LHUG 3PGDA 2QSVA 3D9AL 3QUMA 3VE0B 4OFDA 2F8VA 2VNCA 4OT1L 3VXMA 1U3ZA 2UVFA 1EBAA 1B0RB 3RIFK 1CFVH 2XG4A 5DMKB 5GRVK 1YMME 2IPUG 4R96A 2F5BL 3KAAA 3JTSA 1MHHB 3O6KL 5DQ9B 2ZSVA 4GLRH 1BBJB 3FO9B 1A7OL 5DJ2A 4MJ2A 2ICWI 3KYMA 1IILE 4O4YH 4D0BB 3D39B 3TT1H 3N85L 5J6HB 3B9KA 3O3EA 3MRJB 3VGDA 5FHBH 4F8QA 3I75B 4PRHB 1NC4B 3L3DB 1T03H 5IBTH 1CDYA 3EDDA 3FQWB 5HI5C 5T1KB 4LRNH 4OIAA 2XWTA 5HHPB 2L0DA 4TSAH 1GC1L 1MH5A 5DJ8B 1LMKA 3DX8B 1S7TA 5DJDB 1G7QB 3S97C 2EDNA 4PUBH 1RIUH 2W9LA 3VWKC 1XMWA 3UJTH 4LVOB 3WFEL 4LFHG 4WI3A 3RJDA 4B5EA 1FVCB 4APQA 3QAZC 5GRVL 1CZ8H 3PABB 3ZT5A 5J12C 5MHSE 1AHWA 2R0KH 3RIAK 1AGFB 3DYMA 4X4XB 5DMIL 4ODXB 3LCYA 1L9NA 4DK6A 3GSVB 5JR1H 3QNZB 4JO2H 2EDYA 5DFWH 3MRNA 5GSRA 2B20A 2IFFL 2I25N 1VENA 2HLFD 4GAYA 4M43L 3PDDA 5GGUA 5TH2A 1WK0A 3WIHL 1UM5L 4XXDB 3C5ZD 1J1OH 4GAFB 4YFEA 3BD4A 5C0GB 2HTLD 1N5AB 3HE6B 3MOAH 1NSNL 2XWJB 1A0QL 3HAEG 5FAAA 4L9LA 5KVDH 5HYJD 1D6VL 1KYOK 2Z93A 4TUJA 3TYGH 2VLKD 2DQIH 3QUYA 3BW9A 4Y19D 4UAOC 1VFAB 4LSTL 2J6EA 4CN6A 2CXGA 3B9AA 3W11C 3IJYB 2EE3A 4E5XA 3SE8H 1NEZB 5SX5H 2QQLH 2RHEA 1EERB 5SWSD 1IBGH 3AY4A 3LQMA 1VGEL 3QCTL 3ARDD 1JWSB 2QADB 4JANB 2FECI 3ILPA 4XNYL 4CNIA 1DBJL 4D3CL 4N1CA 4I77H 3UAJC 5T3XE 3QWRA 4C54A 3O3BA 4GG6B 4WVRA 4IRSA 3FQTA 3EYFB 5SV4A 1XH3A 4U1GC 4X6CB 1QSFD 4KY1H 1QBBA 1GZPA 1OGTB 1UEYA 4RFNC 4AIXA 4XCFL 2IGFL 1I75A 4ONHB 3RNQB 2DL2A 3EFFB 1VGKB 1F5WA 3IDJA 1XIWA 5EU3A 1BOYA 4E41D 5JW3H 1HIMH 1T7YA 4NKDB 3MRMB 5DEGA 3ZDYF 2G9HB 3RTQA 3NFNA 5IBLD 1DE4B 2VXUL 4OUUB 2W0LA 4I18B 4CVUA 2IJ0C 1JGLH 3I85A 4Y8DC 4X9HA 4P46D 3SQBA 1LK3H 1N59B 5I1AA 1CVRA 5DUBA 2LU4A 2AJSL 1CXLA 1F3JA 3C8HA 1Q0YL 4RGMB 3ROLB 3SJVE 1XF3A 1NAMA 2JB6B 4XNXL 1JPGA 5DJCB 2Q8AH 3MGAA 4Y2OA 3H9SB 4XNZC 1AQKL 4YXLL 3UXFA 4NFCA 3NMEA 3PWNA 2XTLA 4JFYB 4Z7VF 1RAMA 5GZND 3VCLB 2EDLA 4V1DE 5GXBB 4NM4L 1QBMH 3L9RB 4DCQA 1AXSB 2A6IA 3OKNA 5GJSH 5CEZE 3EYOB 3OKDA 1JPFB 4HXAH 3W0WE 3SDXA 5C08A 3IFLH 3HG1A 4GRWF 1IAOA 2GJ6B 4K2UL 4PIRF 3B4NA 4HLJA 2X4RA 5T5NF 1YPZA 3SE3A 5I1KH 2F9BT 1AI1L 3QUMB 4NBYB 4RMWA 1ACYH 3P4LA 5DEFB 5E6IA 2EE6A 2HT4C 2NW2B 3RKPA 3R1GH 1II4E 2NY0B 2EEDA 3P0GB 4R96B 2GSIB 3EJYD 2VXTH 4GRLB 2X4QB 1P9MC 2DQFA 5D6DC 2P49B 4OD1H 4OD3L 1R3IL 1NANH 4I2XB 4U2YA 1KPRB 3PXHA 1L7IH 4DOHB 3L5XL 4JB9L 5LGHH 3HLAA 2Q76A 1XZ0B 4HKXA 4W4OA 4RA3A 2DLEA 1MLBB 4NUJA 1NMCC 4ODVH 1JGDB 4S2SB 2IANB 1JWUB 3STZB 5I1JH 1OAYL 1FNEB 5KVEH 1KN4H 1FO0B 5HPMA 5MEND 3VXQA 3WLBA 4GXVH 3U2SA 2ICEA 4M7JL 4QXTB 1S7TB 4P9MH 4BZ2H 1AXTH 4DVBB 3MRPA 3QI9C 3UTOA 3NN8A 3MV9E 1OT2A 1PLGL 1T0NA 1LE5B 2FZ3B 3X3FL 1KFAL 4I1NB 4WWKD 1NFIB 1AHWB 3IJSB 1E27B 1I4FB 2DQHH 4FFWD 3O2VL 3OKMA 2V2TA 3GSOB 4YZFF 5GZOD 4QT5B 3T3PE 4KKAD 4P3CL 4JCLA 4WFFD 3QH3A 2VC2H 35C8L 1FP5A 5GGTL 4OI7A 4LSQH 1B0GA 43C9B 3KYNA 3CCHA 4GT7A 4PJ9C 4X7SL 4M6AA 3LN5A 3AS2A 4XP1L 3B6SA 1FBIH 4K9EC 1N6QH 2J8UA 1QRNA 1QFWL 4XP4L 1BD2E 3LRSB 4XCCH 4WFED 2WBKA 5D7JA 3O11B 4JO4H 1YNTA 2EYSB 4JGUA 4TUJB 1GGCL 4S10A 4NKOB 1KBGL 5L7XL 4N8VG 3BESR 1FDLL 5ILTL 1CD0A 2UV3A 4OZHF 1K3IA 3P73B 1A6TB 5CCKH 3HPLA 1Q8MA 4P23B 2XTJE 4CW1B 1OWWA 5CBAA 4K7FB 4Z7OF 1LK2B 4JJHA 2JJTA 5EWIL 2BY3A 5EBMB 5HVGB 3I02B 3IU4H 4AL8H 3IJHB 3TP4A 4CL7A 1BVKA 4TTDC 2DQUH 4FQIH 5KS9A 3WE6B 2B4CH 1ZGLM 3DURA 5FYKD 3SKOB 2E9JA 3V4PL 1EIBA 1IGIH 3P4OB 4BQBA 5DI8B 4YDIL 2JJWA 4RMQA 1YMMD 2BVQA 1CE1L 1ZS8A 5TFSH 4LCCB 3RGVA 4RGOL 3RTQB 3JV4A 1U8IA 4Z76A 3TZVC 3PL6D 4R0LC 1C12B 3C6SA 1A14H 2H8PA 3CFDA 3SBWA 1S78C 1AY1L 3DUUB 5F89B 4KJWC 3VRLE 1F3JB 1OARH 4DK3A 1KLUB 3CGTA 2WWKO 3TH4T 4G9FB 1H0DB 4GBXC 3R8QA 2ARWA 2A1WL 1RU9L 1I1AD 1UZ8B 3O6FD 3HE7C 1DBKL 1VCAA 5DWUL 5I1GL 2BXZA 2XT1B 4MDJB 3LKQA 3NCFB 3ZT6A 1CLYL 1CFSB 3T04D 4KVCL 3BKJL 1YEJL 4R90H 1FGNH 4LLUA 1MPAL 2AJYL 1OB1A 4AMKL 1KCKA 4DKAA 3L3HB 3S5LG 3BXNA 3C2AL 1KCVH 3C60C 3IETB 2CUHA 4ZFOA 4LKCA 4IRZH 1R24A 3G5VB 4MNHA 5EC1B 4RGNB 3ZYJA 1FV1A 1A4JB 4WCYH 1N2RA 5IMMA 1QNZH 2P44B 4POZD 3L5IA 5L2KB 3DWTA 4ZUUB 2FH6A 4L1DA 3NACH 5C0IB 5C09A 3S88L 5C3LD 4RCAA 3QIBC 2DQTH 1OQXA 5IG7B 2Q87A 3HI5H 1QBAA 3X14B 1IKNC 4NUJB 1UA6L 4ERSL 4X6DA 2HMIC 3VJ6A 2JELL 5JORA 1DEDA 4Z77B 3HC3L 4QHMB 4ZYKB 1SJHA 2I9TA 1IM9D 1TZHB 2DQCH 5C0CE 5T3XD 4HKJB 2MCPL 4ELME 5ENWB 3LEVL 2WLYA 1DQDL 5HYQB 3ARGD 4UT7L 5CZXC 5IB3B 3ILQD 4YHZL 5D7LA 5CEXA 3D85D 5ERWB 4RISL 5LJYH 4QOKE 1A1MB 4ONOA 1R5IA 4YHPA 1KIPA 4RMVA 3RBGA 4Y5YC 3OKMB 2F54E 1JZ5A 4MCZA 1BBDL 4O9HH 4UIMA 2GQHA 4OZFA 2YBRB 4PRPE 1J11A 1B0GB 2H2PC 5GISL 4FQHB 3KYNB 4URTB 1RIVH 3HI6L 3LN5B 5ANMB 1YEHH 2IPTL 4N5EC 5I75C 1FG2A 4PJ7B 1DN0A 3SN6N 4D9LH 1F11A 3OKEA 3IFPA 4NOFA 5F1NA 1WC7B 4GW5B 5IVXA 4P2RE 3W5NA 2HRPL 3S34L 1C16A 1L0QA 3LZFH 1NCDL 1NGXA 5TE7L 3WN5A 3FT4B 1MFEH 1NL0H 3WHXA 1TETL 4F7TA 5DUMH 1MCJA 5T3XH 1U6AL 2VISA 5KVFH 5DSCB 1J0KA 1E6JH 1SY6A 4I48B 3FAWA 2DI9A 4HW6A 4M4RA 5TQ0H 2OL3H 5C6TL 3MRFA 1C08A 3ULSA 4V1DD 3S96B 5TF1H 1IM3B 1TZGH 2AJVH 5DJYB 1N26A 3T0EA 5MEOB 3OGCB 2R2HA 4M9OA 5AAWA 3LV3A 3ARQA 4YK4B 1J87A 5F9OH 3W0WD 2R0LL 1N8ZB 1JIBA 4K3JH 1NEUA 4OZIB 1T2XA 5HVHB 4Y4KB 1BVKB 3Q5TA 4ZSOE 2VDQH 1ES0A 2IC2A 2XN9E 2YUXA 2ICCA 4CMHB 1U2HA 5AZ2H 1UWXK 4Y16A 1OAZH 2VKWA 3DPBA 4NQUA 1CL7I 2BVPA 4UDUB 5DMJB 1KV3A 5F93C 3MUHL 1PKQE 2PXYA 2I07A 2OQJB 4PJ8B 5DC4B 2XV6B 3JV4B 4Z76B 1K6QL 4RIRB 2JIXB 2H8PB 2N4IA 2O61B 3DLQR 3SCMD 4MYWB 3BGMB 1IGCH 3STLA 3OR6B 4KVNL 1H15A 5JPMA 4RBPK 4PJDA 2NZ9D 3BQUA 3S3PA 1B88A 5CEZH 1O0VA 4Z8FL 4NQSB 2YD5A 4CU8A 5FO9B 3P4MB 1MVUB 3P0VH 3REVB 4YAQA 1RZKC 3MJ9A 4IJ3B 4LVEA 4PJHB 2FJFB 3O4LE 5HTSA 4U49A 2FGWH 4Y1AA 4OKVA 1I9RL 5BV7L 4JFDA 3GNMH 4GUPA 3GIZH 3K8MA 1NMBL 3VFPB 3H6JA 2VL4A 5EPMA 4MA8H 1J5OH 2Q7YA 3KYKH 5JXED 3FMGH 1U8PA 3WMSA 4RDQF 1L7TH 4OFYD 1ZA3B 2OZ4H 5E8NA 1OP5H 1H9VA 1UXWA 4ACPA 4WUKL 3PDGA 5TDOB 1I3UA 4XMLL 4ODUB 2APFA 1ZLUK 3D2UD 1S9XA 3HB3C 1KB5H 2O5ZH 3O9WC 2VOTA 1BD2D 3FO2A 2BNQE 3QUKB 4ZXBA 3AM8A 3FB5A 1FAKT 3MRLA 2ZSWB 5GRJH 1MREL 4U31A 2WUCL 3FN0L 4M7KL 2DDQL 5EOQH 4OM0L 3BZFA 4Z9KB 4PB9L 1VERA 4KJYB 1B4JH 3B9EA 3FRUA 5C8JA 3HZMA 4ZTOH 5D2NC 1NGWB 3NZHL 2XTJD 4M1GH 3O45A 2H26B 2GJZB 4PR5A 5H94B 5JORB 2VZ3A 1J1XL 5DD0L 4HUUB 4HCRA 3BP5B 5I1EH 1PYWA 5HHVH 5JOFA 1HWGB 4FS0A 2AJ3A 4XP6L 3ISWA 1UYWH 4JKKA 1E6OL 3ZYZA 1V5JA 3ETBF 5JHLH 2BRQA 4NN7B 2W07A 3SOBL 1OD7A 5D1XD 4FQ2L 3AGVA 2ITDB 3BKML 1I8LC 4QWWC 3NIDF 5I71B 1PW3A 1A9BB 4UMGA 4G43A 1P4LA 1GIGL 4HFUL 1FPTH 2CGRH 4PJEA 3EYQD 3M1BA 1NFDE 3SDCD 3TT3L 1FG2B 4P3WA 3C09C 4HG4J 1GAFH 5CSBA 3S35L 1SBSH 1FLRH 1PEZA 4M6ML 4RWYL 4XI5D 4M7LL 1OGAA 3H9HA 4PGEA 5GHWL 2MJWA 1J88A 3RWHA 4U1SB 4O51A 2J1KA 2A38A 3LQZB 3N1FC 2FHFA 3ECBB 2R1XA 1XGTB 4QNPF 4O2FB 5DD3L 4NUGH 1K8DA 2NY2B 4K94H 2QKIA 2MPAL 4HGWB 4LAJH 4ODWA 4OZGA 3LV3B 3S3JA 3RNKA 2E6PA 2VH5H 4EKXA 5IW6A 4QRTB 2OR9H 4OQTA 5EBLA 3O41B 3HNSH 3LQAC 3GBNL 4NBXB 4G8GB 2OLDA 5EZOL 1LEGA 1H8NA 3WFBH 4YBHA 3DTXB 2BDNH 4PJIB 5BRZB 4X98B 2BRRH 4JY5H 4KKLD 1EEZB 5IR1A 4F57H 2C26A 2Z35B 4P2OC 5HJ3A 1P7KA 1NKOA 3TJHD 4Z7WF 1A6AA 3HN3A 3SDYL 2DICA 3BPNB 4PJXB 2ZCHH 3N0PB 4FZEH 4WY7H 3KLSA 1KPVB 4FFVC 4HQQL 4XCYA 2FB4H 4WI6A 4WU5B 1G9NH 3FN3A 4M62H 3ZTNH 2EYTA 4KTEL 3SDAD 4N9OB 4JRYD 4TVPL 1JHLH 3GMMA 1XCTB 5EU7E 3RZCC 4J23A 4NGHH 1AXIB 4OZ4A 3S7GA 4UNUA 3VXOB 2VLLA 3TNNB 2YMXH 1TIUA 2IALA 2E7HA 1F6AA 3OHXA 2IH1A 4I3SL 4RX4A 5HDBF 3DO7B 1A4KB 4ODTL 3GM0A 2EDDA 3U7WL 5D7IA 1W72A 2FJHB 4NQVB 1JNJA 4NQDE 4QOKD 4GUPB 4MMXC 3QUML 4DGYL 4G8IB 4JR9H 3MLRL 4LHUB 4HIXH 1GC1C 5D5MF 1JUFB 4HUVA 2IH3B 1IGTA 1MI5E 1NLDL 4JM2D 4YBQD 2DI8A 3IFNL 3OKLB 5FGRA 1UXWB 2C3XA 2CLRB 4QRRB 1TJGH 5FUZH 4KQ4L 3WFHA 4LKXB 4OLYL 4I5BB 4AT6A 1S9XB 5EU4A 2WBJA 4O58L 4JHAL 4OM1L 1G6RA 1BHGA 3OJ2C 1U8MA 3CVIL 3BZFB 5KBNC 2X10A 1AP2A 3KPMB 1BP3B 5FYJH 4YDJA 3SGKA 4H26A 5C0FA 3DVNA 3HAEH 3H7LA 1A02N 4NPYA 5EZLB 4P5TD 1A1NB 3MUGA 4TUKL 1I9IH 1KENH 5KSAB 5F7MC 5HGGS 1OAKH 2YZ8A 5JQ6L 4FG6D 2BSRB 5DDHB 4K7PL 1S7QA 3QIUC 4C57C 4LSDA 5ISZA 3QEUA 6FABL 5D1ZA 1KTLA 3ARBB 4EDXA 1BIHA 3QUXD 5HHMB 3DIFB 3BPOB 1NANI 2BP3A 3C6LA 4XCNA 2J2ZA 3TVMC 3CFJB 3CVHA 4H8WL 4XHJD 4Z7VE 1FGVH 2HJLA 3OAUH 3IXTB 4U05A 2VLJE 4NHUB 2WM0A 2XN9D 4U0QB 5LCVH 1JL8A 3GMRA 4F7CA 3LS5L 3MA7B 4Z7UA 5GGVY 2NW3B 3U36B 4WW2B 4X99A 2OSLB 3UYRH 4PV8B 4UBDC 3FQUA 1DBBL 2NX5E 3NFSH 4FHBD 4FP8L 3RZWA 3JUZA 4WW1A 4PJ5D 3WUWG 5FM5M 3WSQL 5I8OH 2X89D 4J3UA 5DRXA 2HN7B 1BEYL 3NPSC 5C0AA 5E8DL 3EOTL 4S1DD 5GGSY 3ARRA 3Q3GA 2J6EL 4J3WA 1AKJA 4LSUH 3LVEA 1S7VA 1CLZH 4PTUA 4XTRD 4ZPVB 1NBVH 4OD2A 1RZGB 5CWSA 4HG4K 4OCSL 1OGAB 1HN1A 5E7FA 3ZSSA 4AEHL 1O7SA 4FFZL 2VL5A 4TUOA 4F58H 2FIKB 3MV7E 4B7IA 4HKZA 3DXAD 2YD6A 3ARFA 3S9DB 1QKZH 3MR9B 5FV1L 3GO1L 3UBXG 3T2QA 4KK9C 1IE5A 5LQBH 1MEXL 2E8YA 3O4LD 4RDQG 4PLJD 2WBWB 3MLXH 3RWDB 1FH5H 3R06A 2QHRH 3QYCA 3PQYA 1ZANL 4YHIA 1HHGA 5IW6B 3T08A 5EUOF 3DBXA 5E8EB 5HGAB 3S35X 4U1MA 4XC1L 3WO3B 4DAGL 4QXGL 1NFKA 1QPXA 1LO0L 3SE4A 2FX7L 2E7BA 4J3SA 1BJ8A 2P8LA 3M17B 1GL4B 2R23B 3GSRA 4HKBB 5EOCJ 4M48L 2BNQD 4L3ED 2C7UB 3P77B 3QIWD 3MRHA 5KSUA 1G9EA 4YZFE 1MCQA 2NXYC 4M1DH 4K3DH 1QP1A 1NAML 1CXKA 1JMZA 4E42B 1DQLL 3UTSB 3CDGA 5IQ7H 1EEQA 1NC2B 3I3EA 3QDGE 4UUJB 4X9IA 2C4FU 3QQ9D 3FZUC 5T1MA 1TZIB 2CKNA 3UTQA 2CR6A 3QG6B 1DANT 3TCLA 4CRPA 2ZCLL 1IT9H 2SEBA 2OTUA 3HMXA 1ZTXL 4B7LA 1H5BC 1E4XL 3B2VH 3RPIA 4OV5A 5CJ8A 3LKRA 5J6GA 1JZ8A 3MJ8A 4OFKA 3HI1A 1T0MA 2IH1B 3SQOH 1MAMH 1YYMH 3WLWC 4QRUA 4R2GD 2HFEA 4OZHE 3DVGB 2IADA 2B2XL 5I1IH 3I84A 3O3DB 1W72B 1EJ6A 5GGQH 4LIQL 4G8EA 2EZ0C 1A7NH 3CFBB 5DHVB 5AD0A 3VXUB 3FO0H 3CDYA 4QY8B 3ZE2F 4Z7OE 5B8CA 4JDTH 4L8SC 5ESVB 3KLHC 1IGTB 1RD6A 5BZWA 5T1LB 4MQXD 4LNRA 1JN6B 3V6OC 3CX2A 1S8DB 4RNRB 4PV9A 2HFGH 2N1KA 3K4DA 3TFKD 4PP1C 3LN4A 3ZKMC 1Y6MR 4NZUH 5HYJA 3GHEH 3FOMB 3RIAF 4FQCH 2DOCA 4ZAKB 1IAMA 4L5FL 1ADQH 4HZLB 2CDGB 1MQKL 3BH9A 4WTZA 5FKAB 3HNVL 1DFBH 2V7NB 4Y19A 1G6RB 1MLCB 3RWGB 2D7OA 3U82B 2DQGH 1QZ1A 3U7YH 2F53B 2XFXB 4IRJD 1VADB 4LQFL 3VFMA 4EI5A 5KSVA 1YECL 3BE1L 4HUXB 1JK8B 4JZNA 4P2QE 3LHPL 4KRNA 4QRQB 4XVTL 3MNVA 4JZOA 4W6YB 5BVJB 1RULH 4GG8A 3WNOA 5T33L 4I8DA 2ADJA 1GVIA 2UWEA 1WWCA 1IQWH 3MLWL 4O2CA 1BFOB 3BGFB 5EFIB 1MCOL 4ODHH 3CVHB 1QSFA 1OM3H 4G6FD 1WISA 2FHBA 3KNBB 3V5DA 4H20L 5DUPH 1T7VA 2QQKH 5F70A 3GMNB 4PRNA 5D2LA 4LLMB 2VDKH 3I50L 3HC4L 2I60H 3P9LB 5FM5O 1RZJL 4OIIL 5FA3B 4P59H 4RZCA 3T0XA 4P4KB 5J0BA 1PAMA 2P5WA 3CXDH 3OG6B 1HQRB 3ES6B 4P46A 1IAIH 4O5LH 2ZUTA 4FTVA 2P24B 3OMZA 4N0FB 4HUKB 1I3GL 3KJ4B 4WW1B 4YHLL 3L3KA 2Q6WA 3U46B 4K7PX 2AEPH 2ZCKL 1MFNA 1BAFH 4PJBB 2PKDA 4ELKB 2GK2A 4GXUN 1OF2A 3FT3A 5FUOL 1GJIA 3AS0A 5C2UB 3NIFE 3MLVL 1LP9A 5E08L 2EXYC 2UZIH 4N8VB 1MVFA 3SDDB 1RFDH 3EYVB 3PE9A 5F7UA 3TN0D 3UC0L 5FHAH 3BWAB 1CD1B 3UZVB 3RI5K 4M7ZB 2WUBL 1TLKA 5HGBB 1JTPA 4I0CC 4HPOH 1UCBH 2R29H 1FFNB 2VL5B 3MCKB 1I3VA 3H3PL 3QJFB 2V9QA 3SEPA 4Y4FC 3JVGC 5HHXH 5EZIH 2XPGB 3CZFA 4U7MA 3ULVD 3O6LL 3C08H 4NQDD 1KTDB 1MIMH 1A7RL 4NFBA 3QWOB 4YDKL 4UV7H 3GI8L 1HXMA 3SY0A 5I8KH 1Z3GL 3V6ZA 5ICYB 5IHZA 3DI3B 4M8QA 4WHTA 1UVQA 1R5WA 2ZUQC 1U8QA 3BKYH 4I0KA 3RWIB 1O7VA 1WCBA 2YA2A 4PJCB 1EEUA 2VDMH 4N9GA 4TOYH 1CDHA 3BIKA 5DQJB 4RAUB 4JAMA 1U93A 3VXSD 4DEPC 4XX1E 3L3IA 2XA8H 1DJSA 3ZDZF 1AJ7H 3MPCA 3BZ4B 3LS4L 4WFHD 1WIPA 5DC9B 1U8LA 3PHOA 5KTEL 3QXAA 2BSED 1S9WB 4HDIB 1K5NB 2JCCA 4UQ2A 1JPSH 3RUGB 4MJ5B 3T0AA 5MENA 5I73C 4L3CB 4CADA 2E8ZA 3DMMA 4HIJA 2NZIA 2XY1A 1PZ5A 1CICD 1FJ1B 2BHYA 1XF4B 3MMEA 2ORBL 1M7DB 3RVVD 3HUJB 1G7MA 3MTRA 4WWKA 1CVSC 1S3KL 2Y5EA 5IFHH 5TE6H 4YHOH 4HBQA 3KJ6L 2X42A 3OAZK 5JW4Q 5DJAB 1UJ3B 3WDHA 5JZ7C 15C8H 1T4KA 3S5LB 4NN6B 4MJ6A 2DTML 2DD8L 4YX2H 2XQYG 2WWMC 4LVHC 3U79A 1HI6B 4Z0XB 5EOCL 4I3RH 1BM3H 1JGVL 4ETQA 2HVJB 4LDLB 4LCIH 3C5ZB 4M5YL 4NRZB 2N7BA 2NX5D 3F58H 5TDNB 3RDTC 2D03H 1T21A 3FRPA 5I6XC 5EU6D 1NCCH 2BSTB 4XNQB 2VLME 3VWKD 3GMLB 5F7KC 5KSBA 1PD6A 4ZPTB 5D71H 3ARTA 1FYTA 2A0LC 3OQ3B 4JN2A 1IGYB 1LO3L 1AGBB 3MO1A 1YYLL 1OAUL 2VLKB 4HLZG 1TVBB 4BFBD 2NR6D 5IUSA 4Y19B 4KRPC 4YHNA 4N0YH 4IIQB 3EDJA 4CU7A 2OXGA 1T20B 1QVOA 3O2WL 4JJ5A 5E1HB 3F62A 3T8XA 1QLEL 3QRGH 4S0SD 5SWSB 1J0YA 5I30L 2QBWA 1Z0MA 5I1CH 3OBAA 3ARDB 5IHBA 2R69H 5TPWL 5D4QA 4ZD3L 3L1OH 12E8H 1BJMA 4X9FA 4C56D 3KHQA 4Y2DD 4I0PA 5I2IB 1QQDA 3QEQB 4KHTL 4GRWH 3T4YA 1BJ1H 3V79C 2Y06L 5D1QD 3ELAT 2APWA 2QR0A 1ZT7A 5ECJE 1X4ZA 3BPCA 5TJWK 4Z78A 1D5XA 4XPBL 4Z0BH 1YMMA 2GSGB 4KPHL 5GS0L 4QXWA 5FOJA 5F96H 1A7QL 4E41B 1JZ3A 1IARB 4EN3D 1ZT1A 2CO7B 4IS6A 4V2CB 2W59A 4K3GA 3T09A 1K8IA 4XPTH 1U2CA 3FT2B 3LEYH 3FQNB 1MRDL 1YEKH 5F7DB 4HHAA 2BJML 2BFVH 3GKWL 3QDGD 4D2NA 3BKCL 4NO2A 5EZJB 3KYOB 4L8DB 3DSFL 1AD9A 1QFWM 2RGSA 4OAWB 4JM4H 1LP9B 1TCRB 1SY6L 4G6AD 1T04B 1JF6A 4NJ9H 3WL9A 2VDOH 2Y36H 5CHNB 2VQ1A 2DM7A 4R7DA 4HBCL 5DJXB 1S9VA 2YR3A 3O6FA 4GRWB 5FECB 5IFAL 1AC0A 5IFJB 1FN4B 1DLHA 2VZVA 4NOBA 4RRPG 4LEXL 3F12A 1IFHH 4ALAL 5IK3B 2YD7A 3U0TA 1ZT4B 5CUSL 4MAUL 2DQEH 1FCCA 4XC3L 4XGZB 1ZSDA 2B1HL 2DKUA 5E2VH 5J12B 2GJJA 4DKFL 4GW4A 4D0CA 3HHRB 4G6KL 4U6VL 4XPHH 3TBSB 4MHHG 3SY0B 4UTBH 4KMTL 5D8JH 1GGUA 4OBRA 3V52H 1X5IA 5JO5B 3Q2CA 4F33B 5L8JB 3BZEA 1XR9A 1YEFH 4HJJH 1U8QB 5I76B 5I8CA 4P2CG 4RAHA 3RVXC 5BQ7B 1ZGLB 2OK0H 2YKLH 1ED3A 2X09A 2IPUK 5E00B 3NIDE 2MNUA 4PG2C 2EYRB 2C3GA 1TQCB 4OJFL 1PFCA 2NYYC 4G7VL 4YFLI 3V5HB 1T5WB 3LKOB 4G80A 1AGDA 3G08B 1HHIA 1LDPL 3KPRB 4P2QD 2AJXH 4NP4H 1IM9A 1DSFL 1BQHA 3HR5A 4PRIE 4XCEB 1D6EA 3UO1H 2Y6SC 3HR6A 3MJ9L 4CADB 5FGBC 4WO4A 2HFFB 2V5MA 4F2MA 4JRXE 3JWOL 3MV8E 3WNPA 2W60A 3OAYK 3D85A 1BF2A 1WBZB 3P4NB 3CH1A 4FQXD 4F15B 3W2DH 1H3PL 5C07D 4C4KO 4QNPE 4NO0A 4HAGA 3GSNH 4EIGB 4JFFE 4OCRL 5INDA 4YPGA 3NA9L 3MREA 4LVOC 2YPVL 4LSPH 4Z6AT 1KB9J 3RWFA 5F8RC 2BY0A 4Q6IB 3V6FA 1KJMB 3U4EA 3MGOA 4U1IB 4KMQA 3OXRA 1T1WA 1VB9A 5C0EB 2PO6D 3L7EA 1T21B 3NABH 1S5HB 5GGVH 1B4RA 1CFTB 1QFUL 1X5GA 2MHAA 3QI9D 2PW1A 1H3VA 3AVEA 3SJVA 2W0FB 2HG5A 4RFEA 4ONGH 1LO5B 3WD5L 3NTCH 3HE6C 1IEHA 3QRFM 2XZAL 3BWUC 2D31B 3FCTA 4OGXH 4LU5H 4LLYB 5HGDA 3VFVB 1YY9C 1DUYA 4ZUTA 4Z7WE 1U91B 4QTHB 2LV4A 4G6JL 4V1DA 4HCRL 1ETZA 1J8HE 5H8DA 1CDIA 1I85A 2W92A 4F7EA 4JZJB 2H6PA 4Y88A 1HKLL 1U92B 4WEBH 4FXKB 4JKPH 5KG9B 4QTIL 4H25B 3HZYA 3W0WA 4LEOB 4MAYD 4F7MB 2FATL 2DTSA 3DROB 5E94A 2CRMA 1G7PB 3RBSA 3F5WA 3DRQA 3BUTA 1JYWA 5DA4A 6CGTA 5GSVA 3MUY1 3TBWB 5HY9B 4BFIA 3JWNC 2NY7L 2DYPA 1HHJA 5HDBE 2DIBA 3TO2B 2V5RA 4DGVH 4JGMA 1DQTA 2QHLA 3QT2A 5FKPA 3MRQA 1HQ4B 2D7QA 2WK2A 3H42H 3KGRA 4OCMC 4YEEA 3PL6B 1BFTA 2EH8H 4U1JA 5EDXA 4F9PA 3KLDA 4JN1H 3KDMA 1DVFA 3SCMA 3KPPB 2GITA 4XB7A 3UDWA 4HHAB 4NQXB 1KB5A 2IMMA 2P7TA 5J06A 4LLVB 4Y4HD 1EXUA 1AD9B 3TBTB 1PQZB 4PJAF 1ZHBB 3B5GA 3MYZA 2GUOA 1G7JA 4K9EH 2EH7L 4I18C 3GI9H 3DV4A 3MXWL 4R6UA 1NMCB 1RZFL 4EVNA 1I1AB 3L95B 1EO8H 2HKHL 1R3JB 3SGEH 3KPQA 1WFOA 3MV9A 1WGOA 2CD0A 4G9DB 4QYOA 4ISVB 1DQQA 1CXEA 1X7QA 5DO2D 2D7TH 4Z7QF 5CLTA 4X5XB 3NBNA 5JMRA 3MRRA 1RHFA 1YY8B 3TZVD 1IKFL 3OL2A 4OQTL 3PWVB 2WAHA 3E2HC 3U0TB 2AEQL 5JTWA 4B0MM 5JXEA 1H3XA 5L6YL 4X7FC 3S4SG 3T0DA 1EFXB 3W5MA 4KJWD 5E8OA 1HYSD 2CLVB 2PETA 1UJTA 4HJ0C 3C5SA 4JQIL 4QGYA 4PJFB 1KLFA 4FNLH 3WJJC 4P5MB 5T5FH 4JHWH 4S0TD 5HGHA 3CK0L 1BD2A 4KUZL 2VLMD 2R56H 3B3IB 1SEBB 5I0DA 2IQAB 3HE7D 4KAQL 5DQDH 2DMCA 1WBXB 3TA3B 4G5ZH 3ZYOA 2V6HA 3TGXA 2DKMA 5ADOL 4YHML 4X6EA 1SJEA 4CJ1A 1NCNA 2CDEA 5F88B 1OCWL 1A7PH 4BKLB 1RZ8B 2Q86B 2FD6L 2I9LB 5DFVC 1J9CT 1P6FA 1K3ZA 1ZWIB 4FOMA 4KZEH 4GRLC 2OCFD 3MLUL 1KJ3H 1NDMB 1FFQA 1GHFL 5IQ9A 2B7DT 2R1YA 2AV1B 3HR5B 1MCRA 4XZUB 1D6EB 4J6RH 4MQ7B 3VD5A 4HWEH 5E9DE 5C3TA 1W72L 3B9KC 2LQRA 3QNYA 4F3FB 4UOW0 2YEZB 3B2UD 3ARGB 1ZEAL 4L4JA 4MJIB 4ZUVA 3FB7A 4LVNB 2O5YL 5D1XA 5HHOE 1NDGA 5TE4H 2E7MA 4MNQD 1KOAA 1ZHLA 5IV2B 3BAEL 4LOUD 1CGSH 3QIBD 2XQBH 1L6ZA 3M8OH 3UMTA 5MI0B 3IVKA 4HUMB 4WGVB 1CU4H 2G5BB 5ICXA 3O8XA 1YC8A 2DAVA 5IB2B 3O2DH 4X8JA 1N4XH 1KEMH 4LGRB 1MF2L 1AHWC 4KV5F 1P1ZA 2GTWB 4JVWA 3WCYA 1T1WB 4J8RB 1KB9K 1QSEB 4YQXL 4KMLB 3AU1A 4KKBD 5EUOE 1J12A 4NZJA 1G6RL 3LIZL <