1LEKB

Crystal structure of h-2kbm3 bound to dev8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lekB00
3M8OL 1X3DA 5EUOE 2A6KB 4X6DB 3TGXA 3QAZB 1JPGA 4I0PD 4OD2B 5I8KL 4L3EB 1WAAA 4HD9A 3B8YA 3TP4A 5JHDB 1DBML 1KV3A 2BMKA 1FZMA 3MRKB 3T0AA 1NGYB 3MLZH 4OD3H 3CFKA 1FL5A 2FATH 2X4PB 3H8NA 1C5DA 4YHIA 1TTGA 1U58A 3SO3B 5IR1A 1ZGLM 3K2MC 4ZS7L 3MOAL 2CK0H 3GIZL 1AR1D 4JFFD 2DLGA 3RZWA 1UA6H 5I8CA 3M1BB 2ZZUT 1LP9A 1MLBA 4AIZA 1F2QA 2EXYD 4DKFL 1QBMH 4FFVD 4QHLB 1WQVT 4O2FA 3T4AA 3VG9C 1S7VA 1HHIA 3RWHA 1MEXH 2CRZA 1JGLH 3CFDA 1RZ8B 3H9ZA 1SJVA 4LSPL 2X41A 4Y4KD 3CH1A 2APTA 4YX2L 4MMZC 1J8HA 1T03L 2Z91A 2AS5M 3UX9B 4W4NA 1KT2A 3GMPA 3RVXC 4LIQH 5B38B 4MQ7A 4N9OB 1Q0YL 4MJ2A 1U6AL 2DB8A 5BOPA 1FL6A 3KYNB 4PV9B 3TO2B 5M7QA 4OLZL 1A47A 3IJHA 1UWEL 5C0BA 1G0YR 1KN4H 5J7CC 1XF3A 3C60C 1EX0A 2OM5A 3IRPX 3KYKL 4FFYH 5FUZL 5KW9H 3AY4C 1T1XB 4KKCD 2CLVB 1QSFE 4N5ED 3TIEA 2AQ3A 4M6OL 3DI2B 3O9WA 1QSZA 3BGMB 1T2XA 5I30H 3T08A 1BQHG 1CLYH 4IRJC 2DDQL 5HHVL 2HA1A 2X09A 1MELA 2IFGA 1VSCA 1YEKH 3QEGH 4WV1B 3V95A 4PD4J 3F58L 1I9IH 1UWXH 5FOJA 3EDFA 1RU9H 3O3AB 3P0GB 5C07B 2ZOLA 2NY4D 2R9HC 4WW2F 5E8DH 5DQ9A 3ARDD 4DJMA 1R3HA 2OTUA 4N0CC 5I73C 4U7SA 1JNJA 3ZYZA 3C2AH 4WI5A 1RUAL 2IEPA 2JB6A 2VDPH 2VZ3A 4UTAH 1K4CB 3LDBB 5T5FH 1D5XA 1CS6A 4BQ6A 1D9KA 2VDKH 3LKPA 5EIVA 4MNQB 1ORQA 2CKBL 4PJAB 1FIGH 1MJ8L 1ZS8A 4HJJL 4Y2OA 4GBXA 2ZOKB 4AMKH 1T21A 4PY7B 1A7PH 1GL4B 2CXGA 4GMTL 1UH4A 1QRNA 5FM5O 2HKHH 2GJ6E 1FVEA 1RULH 5DRNA 4PJXF 5I8EA 2Z0BA 1U95A 2VZOA 1KC5H 4IBLT 5T1LB 3SDXE 3WJJA 5ID0B 2JJTC 1BD2E 3QPQC 5FGSA 4K8RD 4P2QD 5IMKB 4PBVC 3HC4H 3GRWL 3WS6C 3FO9B 2MQCA 2HT2D 2Z31A 2FEDC 3KPLA 3P11L 4NN6C 4M1GH 2VTFA 4UIKL 2W9EL 5H94B 4NZUL 2YHGA 2HFGH 5FIEA 2DQFA 1JNNH 5CZVH 3B8SA 5C0FB 5K9QG 4EZMA 4XBEH 2EYSA 3ARGC 1A3LL 3RIAK 4P3WA 1INEH 2XIDA 1I3VA 4U1JB 4GSDH 1FRGL 1RZ7L 1MFBH 2ZNXA 3F7YA 4WGWB 4RIRB 3IKCA 4IRZL 2H9GA 1WZMA 5D71L 1ZT4B 3BT2H 3MUGB 4KJQD 3V7AG 4LEXH 1FCGA 3U1SL 4UV4L 5DMYA 1FNLA 2XY2A 2I07B 1XMWA 1U2CA 4RMSA 4NBYB 1I3GH 2XRAH 3ZHLA 3FQTB 4YDVA 4PJFE 4MAYA 1Z0NA 2DIAA 2GI7A 4G80A 3G6DH 3PDGA 4N0UB 2CO7B 3X3FH 3I2CL 1IJ9A 1FQ9C 3REVA 2Y7QA 3FO1B 3EJJX 3S4SG 4NQSA 3VXME 2UYLB 4JRXD 1PG7X 4FG6C 4XMPL 2AP2A 5ICYB 4WO4A 4BZ1H 3LSOA 1LD9B 4HWBH 1DQML 1RJYB 1NGWA 5IOPA 1Q9OB 2F19L 2BFVH 5CEXB 3QSKB 1EERB 1J8KA 3SE9H 1FFOA 4U1KB 4U1GB 2VH5H 4C54A 1Q72L 3MROA 3BP5B 1JPTH 2W92A 1ITBB 1CQYA 5KSVA 4D0DA 3PGFL 4YHYB 3TC9A 4RQQB 1SVCP 4L4TD 1AGBB 5LGJA 2EIDA 2Q8AH 3BJ91 4ZFZB 4OZIF 4WHDA 1LDSA 1LO4L 4QRSB 1A7NL 5IB5A 1PDKA 3LN9A 2AKRB 3PL6D 4QRRA 3FB6B 1YEHL 1NAMH 1CYGA 2CIIA 3MLSH 3IFPB 3UCRA 1OAUH 3O45B 5E8EA 1HH6A 1I7ZA 2VITB 3WN5B 4IIQA 3L6FA 2Y25A 4EOWH 4GOSA 1LO3L 3S35X 5F7EL 1LVEA 2VXQH 4ODSH 3M17B 2D4DA 1L7TH 3VWJD 1R5IB 1HHKA 2DQUL 2HLFC 3ARVA 2H41A 2DJUA 4JPWL 4PS4H 3WNMA 1QPXA 4K3JH 4WDIB 2HLAB 4UDTA 1XIWA 1FV1B 3MACH 4OZGF 5IFHL 2R8SH 3CLEL 5DJDA 3RTQC 3LEXB 4KMTH 1P7HL 4HUXB 1NCWL 5DYOB 3Q0HA 3TZVA 1KSRA 2GCYA 3BD5A 2BC4A 3PQYA 4QOKA 4RDQG 1NC2D 4OLYH 3DSFL 2Y72A 2R2HA 5CHNB 5GGTA 4PR5A 3S98A 3CZJA 5L9DH 3BW9A 5DHYB 2FCBA 4N8CL 1ZTXL 1S78D 1JHLL 4C56A 4JN2B 3IF1A 1BFSA 4NGHH 1PKQB 2GFBB 1O5DT 4O4YH 5IBLD 3BIBX 4WNQB 4XNUL 1KTLB 3LKRA 1UACL 3BH8B 5JTWA 1P84K 3VFGL 1WWBX 1OSZB 3QWQB 2B4CL 2R56L 5BS0B 4WEMB 4TUKL 5D9SB 2HP4A 4MA7L 5ESVA 4KJWD 1U3HA 5MEQB 3PV6B 2UVFA 4JY6B 3PWPA 4P4RA 2A73B 1C8PA 1GZPB 4PJ5A 4PJBF 4Y1AE 3OKKB 4HUWB 4PP1D 5GISH 3P0YH 4S1RH 4AG4L 3BP6B 4IMLB 3F6IA 4ALAH 3R0MA 1MHHA 4HUVA 5INDA 3OAUH 1FNFA 1M7DB 4XNXL 4JZOB 4ZD3L 3SDDA 2HN7A 5DHVA 3QUMH 3VGAC 5MERA 2AAVA 1T3FB 1JGDA 1FDLL 1NL0L 1AHWC 4LHUA 3KPMA 5JA9A 3WNLA 4ODWA 3GI8L 5HHQB 2FNBA 4F7TA 1RK1A 2NY0B 5GJSL 5DT1H 1RUPL 1VKXA 1NEUA 3EYUL 1CE6B 3RIAF 4AK1A 3CXDH 3EZJB 5E99L 2PO6A 1J5OH 1KJ2A 1SJHB 1QLFA 2VDRH 4PRPA 4LRNH 5JMOC 4EXPX 5HI3D 4NNYB 1JUFA 2W07A 5EOTA 5ITBL 4E42B 2X4TA 3P9MA 4RGOL 3OSKA 4MDIA 5LG1A 3WFHA 3K0WA 3KGRA 4NOBA 5I1DA 3JTSA 4S10A 4NO5A 5J13C 1S9KC 3LKNB 2RAMA 3U82B 1UB6A 2V5YA 3IDGB 2XQBL 4HQQH 4JG0H 3S36H 4HH9B 1UYWL 3OGOE 4YK4C 3S97C 3SE4C 1VPOL 4X6CA 1IC4H 3UO1H 5SWQB 3IFOA 1M7IA 4NPYB 1MHCB 2H32A 4RFEB 4Y4FC 1UKSA 1VGEL 1EDQA 15C8L 5IB2A 2OSLA 3S5LG 4P2OD 4GRWB 3HE6B 5FFLA 4NO0B 2GYSA 4LCWA 4ZPVB 4TTDC 1F4XH 4YE4L 5F8RC 4OIIL 1N26A 4FFWD 4Y2DA 5FUOH 4UNVA 3CFBB 4QHUA 2AK4E 4RMVA 4U33A 1D6EA 4TVPL 1Q1JH 5HGHA 4KI5E 5DRWB 1NLDL 2ILLA 2EXWD 3RU8L 5ALCL 1CD9B 4D0CB 5C2BH 3U30C 1YC7A 3KNBA 4LBEA 3O3BA 3GSQB 3UTZB 3OJMB 4BFIA 3QEUA 3W81A 2NXYB 5HHPA 1QA9B 1I1FA 3PWVB 1INDH 1G7MB 4HFUH 1B0WA 4Z7NE 3ZKND 2QQNH 3DETC 4WW1B 4JFQB 3VJ6A 3NPSC 5J11C 1XCQB 3HNVL 4UU9B 3RWGA 3THMH 4XNYL 1I1AC 1NCAH 4P5TA 3MLWL 1O7SA 2B5IC 1ZT7B 3L3HA 1ZLUH 3CFJA 2DKMA 1DFBL 4QXTB 1X5AA 1ZKAA 4KVNH 2DWDB 3V9FA 4B50A 3SKJL 1MREL 1OLZA 4FQJL 3W11C 8CGTA 5FYJL 4WU5A 4YDIH 4QCIA 5KVDH 5C0JB 4QRTA 5D6DA 3QEQA 3QO0B 5FECA 1FAIL 1MCQA 3VFWB 3IRZA 5E8PA 5HHXL 2VXVL 4M5YH 1N7MH 3VXNB 1T7WA 3V4PH 2VLKE 2R4RH 5HYJA 1RJZB 2WINB 4HUUA 3QQ9D 5DO2D 2D7QA 5DWUL 1RIUL 2IPKB 2COQA 4I48A 4JFFB 3CU1A 3DBXA 3KR3H 3H9HB 4X4MA 3RGVA 3UTPE 5HPMA 3OR7B 5IHZB 2KPNA 3B9VA 3FOMA 3OPZH 4Z95H 4Q9QH 1K4DB 2PCPA 2XKSA 2WZPD 4HKZA 4Y4HC 4EQ3A 1OT1A 4S1DD 3EYOA 3ARFB 1XGUB 4LU5L 3RL2A 1A1NB 4ELMF 3DXAB 4ODBD 4JFYB 3SQOH 2ADJB 2AXGB 1J05B 1FLRL 4NCC2 4EN3D 4GMSL 1A5FL 3VXPA 4JDZA 2MQ0A 4XVJL 5GGVL 2EYTA 1AIFA 5D1QD 3B9KB 4ZPTA 1CLOH 2XXCB 5FGCE 4CN1A 3ARYA 2P8MA 4L8DB 2FL5B 1Z9OA 4ZSOA 3VXUB 3DV6B 3TBVA 5DK3A 1ONQA 3V4VH 3B43A 3IU4H 3FRPG 4ZAKA 4WY7L 1KTRL 2VL5A 1QFWI 4LQFL 4LVHC 2IBGA 5FYLL 1QR1B 3N1QC 1DQTA 4HW6A 4PB9H 1U91A 3BOVA 1CU4H 3FCTB 1QSFD 1CE1H 1A1MB 4ZUSB 4MJ6B 1TVHB 1MCSA 4HSQA 5C0AE 4P4KC 2FX9L 2EDJA 3LKSB 5SWSA 3CX5K 4GS7C 1OCWH 1LEIA 4JY4A 3QUKB 1KFAL 2Q20A 3EOBB 4RMWA 3HNTH 1B6UA 1YNLH 4XP4L 4OSUL 4BH7B 4ORGA 2HJKB 1AGCB 2NY4B 5HHNA 4JM2A 4Y19D 2PW2A 5D7JD 2ADFL 5I76B 1HCVA 2I60L 2P5EE 2AABH 1MLCB 3MRNB 3O2VL 5KVMC 3T65A 5JDJA 2UWEA 1HINL 1ND0B 2AJVL 4M8QA 3UBXA 2A1WH 3W2DL 1MRDL 2PKDA 4G8IA 4O5LL 4X4XA 4O2CB 4JRWA 1FGVL 5JOFA 4PJIE 3W39A 1T0MB 3LKQB 5JXEA 3MV11 3HG1B 4OLUH 4LOUC 3U7WL 5CCKL 2GJ6D 5B39G 2QEJA 1G0XA 3ILPB 1BOYA 1QLRB 3DOSA 3L7EB 4XPTL 3QCUL 5CZXC 2FD6H 3S37X 2A74B 4MAUH 4F7CB 3NIFF 4PJDF 4MD4B 4DWHA 2NY1C 1DSFL 1QQDA 3EJZC 1G7QA 4OFYA 3BGAA 1YNTA 3GBLA 3JVGA 4KHXH 2DLIA 5MP6H 5GGUB 3VWKD 4P2QB 1CK0H 1T04A 1OAZH 3MYJA 2IQAA 3BSZH 5KVEH 5IEHA 3ZE2E 3V5DB 4D9LL 1Z6JT 5AWNL 4Q2ZA 1S7RA 5CBEA 1F4YH 3OR6B 4HT1L 4JR9L 1A4JA 2AV1A 2FRGP 1FO0L 1P7KA 2M2DA 1B3JA 4QF1B 4HS3A 2AJYL 1JGUL 1GGCL 4OCRH 1MI5A 2WBJA 5GJTH 2C26A 5T3XH 2P45B 4TVPE 1GC1L 5J3HC 3U46A 3RUGA 1J10A 1UWXK 2E7MA 3TN0D 2WLZA 2HJLB 1I7RB 4GAGH 1LO0L 1TVBB 2W9LA 4XRCA 3VH8B 5IMOA 5I1LB 4RFOH 5EU5B 5C1MB 3QWRA 3MRFA 4O2EB 4QRUB 2GEEA 3H9SD 1XGTB 4FABL 4PJ7E 2HJFB 1CFNB 3O3DB 1G7JB 2X4NA 1IGIL 3E6FB 4JO3L 3MRRA 3ARRA 1UJ3C 1CDBA 3JXAA 1JZ8A 3IFNL 1PYWB 4NWUL 3NFNB 3VXMD 3BRFA 4Y5YB 2YD1A 2BOBB 9CGTA 5DJCB 4L4VE 3SDAB 3GHBH 4KV5E 3DSNA 1K2DB 1MFEH 1K9TA 1HI6B 1ZHKB 3ZT6A 3VRJA 5IJVA 5FYJE 3FT2B 4AH2A 1J1XL 1OL0A 4G42A 3NCYP 1U8IA 1EGJA 3VD7A 2UUDH 4J7RA 3QH3B 3JTTA 4Z7WB 4CADB 3E3QC 5EN2A 1UWGH 2D03L 1I8MB 4TRPL 4L4TB 2HTKC 4W6YB 3C2SA 4P9ML 1BBJB 3TJHD 2CDFA 4Q6IB 4BH8A 1IT9H 2R23B 4WTXA 4Z5RB 1FVDB 2B7DT 1SYVB 1AXTL 5FKAB 3LB6C 2YS4A 1JL8A 1MCDA 2DWEA 4PJ8D 2XQYG 3NTCL 4KH2A 3QWOA 2DQCL 2PYEA 1G6RH 2QKIB 4MD5B 1G9ML 4P57B 5A3ID 1A3RL 1WUNT 5E2UL 4X6BB 5DSCB 5HYFA 5FHAH 1AFVH 3KLSA 4OGYH 5DJ6A 4NKOB 5C7XL 1IC7L 1JYXA 2C3HA 1B0RA 5KSBA 1OAYL 5B8CC 1AH1A 5BV7B 3BEWB 4NM4H 4YXKH 3W0WB 3WIHA 5BVJA 3IAPA 2BJML 1MH5A 1KPRB 1UCBL 3VWJB 3MJ8B 1M6OA 5D7KE 5EBGA 1IEBB 1DLFH 3FJTA 5D72L 4L3CB 4YHLL 3RNKA 2ARWA 4U6YB 3FFCE 4A6YH 3L95A 4M93B 1MIMH 4F57H 4X0KA 3E2HB 3R06B 3VFUB 2YWZA 4YO0A 3O4LE 1IAIH 4O9HL 3P40A 5ICXB 1RURH 5I1GL 4XCEB 1FYTA 4WUUA 2ZJSH 2GK0B 4RWYL 5CEZL 3PDOA 2XFXB 3K8KA 3ZSSA 3IAGC 2C3VA 1ZA3A 1S7XB 4Z7UA 5E9DA 5F44A 4ZMAT 4HK0B 4ZFFA 1R3IH 1MF2H 2RGSA 35C8H 4LSSL 1RUQH 1HSBB 2YKLH 4HZLA 2BVEA 3N9GH 1NCNA 3H3PH 2M8XA 3CVHB 5CBAB 2LAAA 5TDOA 3IDIB 2IMMA 5E94B 3D48R 3HZKB 4JFZL 1Q0XL 2V5MA 3AMLA 3MJ9A 5IG7B 3PWLB 3PWNB 1NFDF 1BBDH 1HK6A 3MXVL 4Y1AD 4PRBA 5L8JB 3EBAA 2BP3A 4R7NB 4QWWD 2GTWA 3WSQH 5H8DA 1XCTB 5ID1B 3AREC 5LQBH 4RGNB 5KN5A 2AXHA 5JHLL 4DZBA 3BPLC 5JA8B 4YXHL 3NCBB 3O41A 3CMGA 5IVXE 1NFIB 1UH2A 3CU7A 1AJ7H 3GSNA 3BKYH 3KLDA 3EHBD 1MFAH 5D1ZB 4M48H 3U4EB 2DM7A 4PRIE 1F11B 3G04A 5EO1B 3RNQA 3DO7A 3GSRA 5D7IF 4H88L 2X42A 2OL3B 2EKSA 4J3SA 1NSNH 2X7LA 4MSWA 3L3KB 2VQ1B 2HWZH 3V6ZB 2EO9A 4JLRB 5A43C 4G9DA 2QHLA 2JIXA 2MNUA 3EDDA 3HR5A 4PJ9B 5JW4R 3ARGA 3FO2B 3SCMD 3QFDB 3LKOB 2I25N 4MQXC 1CGXA 3MV8E 4JFPB 4LLDA 2BZDA 2DJSA 4GUPA 2X4QA 3F7RA 4KHTL 4YHZL 1PW3A 3A6CH 1FH5H 4YC2B 3DX6B 2A0LC 3BP7A 4LKCB 4Z0XA 1UKQA 2X89A 3BAEL 5DD0L 2DTSA 3MLXL 4G9FE 4TTGA 1FE8L 2F5BL 4FQ2H 1FLTX 4EI5C 3FFDA 3JWOC 3U4BL 1S7UB 2VDNL 3MLYH 5L2KA 2BVQA 2C1PB 3IXAB 4JM4H 4BFEA 3RY5A 1WCBB 2W0KA 5DC9B 4CJ1A 3IDNA 4C57C 1WAAE 5JUEL 3GMNA 3N06B 4GXVL 3GBML 5JIHA 2BY1A 5D6CB 3V79C 3E6HB 4LSUH 5CFHA 2AK4D 4AEEA 3MNZA 2W0LA 5I15H 1MCOH 1KPVB 3DUSB 2X1XR 3REWB 2P24B 4J3WA 4KI5D 5J1AA 3MBXL 5D1XA 4C4KO 5GRUH 4WWKC 5AZ2H 4RMUA 5I0DA 2F5AH 4OLVL 5EZIH 1NAKH 1G9NL 4UAOC 3H6JA 3MRMA 4M4RA 2DOCA 4QTHA 1IE5A 5JDSA 1NANH 1B4JH 3SY0B 4M1CD 4PTTB 3DX7A 5IB1B 3P4OB 2D0GA 2BNQB 5FO8B 5TJWK 1EEYB 5BRZE 1J8HE 5C0EB 3ARBD 3U0TB 1FNSL 1XGPA 3MGTA 5IFJB 4I77H 3QDMA 1E27A 4KPHL 1E28B 3N50A 1T1YA 4YXLH 1FPTL 3KPPA 3HS0A 1IC5H 4JCLA 4HK3J 5C0BE 1RI8A 2PXYD 3DVIA 1BLNA 3OF6D 4PLOB 3IJSB 4XP6H 4KY1L 2EH8L 4JN1L 5E4IA 1WZ1H 1UB5A 3QISA 3SKNA 5E8OA 2J8OA 2WW8A 1BF2A 3S6CA 2J6EL 4GW1A 2FSEA 4J8RA 4PJGF 1GOFA 2E7LA 3RTQA 3DARA 2NXZC 2VLKD 3IAQA 4RNRA 5DMGC 3BP4A 3CDGA 1AXSA 3BQUB 4ZFGL 4NDMA 1VFBA 3SE8L 1ZSDB 3UTPD 1IM9B 1CICB 3QJHB 3LN4A 5L0QC 1PSKL 5F7DB 1QHOA 5E00A 3BN3B 3OKMA 5F9WC 1S7WA 3G5YB 3LS5L 3OGCA 1JCKA 4APQC 4MCYA 3WHXA 1M71B 5J9PB 3IXTB 4M43L 4EN3B 1MFNA 4N8PA 4WUKH 2Y06L 3DGCR 4Q9RH 2BCKB 2HFFA 1QRNE 2FJGA 3WL9B 1XZ0B 2E27H 5F9DC 3ULSB 3MJ7B 2R69L 1J11A 4KUCD 3JV6A 3P9LA 4WW2B 5KJRH 1ADQH 5SWZA 3T0EB 2YPVH 4KKNA 4XPHH 2BRRH 4G8GB 1LDPH 1BOGA 3QAZC 3GSUB 4GKNA 4HIJB 1P7QB 4CW1A 4PJEF 4H0GA 3SDCD 5D96B 4W6XB 2H2SC 3RWJB 5ADOL 5C0CA 4JGUA 2ESVB 3RGHA 1F4AA 4R7DA 1QSFB 1QEWA 2PETA 1NBZA 4OZFG 1KJ2L 4LLVA 5C0AD 4AQOA 5BQ7B 2RJMA 3SO3C 1DBKH 3G08B 3RZCD 3C6LB 1UXWA 4FQLH 4FQXB 4F37K 5C92A 1IFHH 5EWIH 5GZOC 3DMMD 4HDIB 1JV5A 4HIEA 3LQAH 1OARH 1I9JH 4LSRH 4PJXB 4ZXBD 1MCEA 2XPGB 4PGDA 1AHWA 3ESUF 2Q7YB 1PLGL 4HWBA 3V0WL 1YECH 3S7GA 2DI9A 5J89A 4MNGA 5B22A 1XAUA 4HBCL 5DJ8B 4D0BA 2NY6B 4P23B 1BQHA 3J7HA 2KH2B 3MQIA 4RAUA 1AKJD 1OB1B 2ICCA 1S3KL 1T5XA 4ISVA 4KTEH 4L9LB 4Y19B 2WM0A 4WCYH 5D7JB 2NW3A 3VFTA 3HRZB 4Z78B 4X99B 4V2CB 1HXYB 3SE3A 2D7TH 4YBHA 3EAKA 3VFOA 3AU1A 2FIKA 3LHPH 3MXWL 3ULVL 5K33A 1OPGH 4QGTA 4U1LA 3EFDL 2H26B 3K3QA 2IH3A 4JQIH 4RGMB 1UVQA 3JV0A 3UZEA 2R0ZL 2GJ6B 4O02H 2EDDA 2P7TA 4OD1H 1NAMA 2A9ML 1PVHA 5CINL 1XGRA 1DDHB 2F54D 3VGDA 3K8LA 1LQSR 3B5TA 4NQDA 1MVUB 1O0VA 2CR6A 3KPSA 1A6TB 4U1HB 2YD4A 3GNMH 5GRJL 4IRSD 2YK1H 2X9YA 5K9JH 5AZEH 1RMFH 3KXFE 4AENB 4FXGB 2W65A 1Z2KA 5I2IB 3CCHB 3MGOA 3VWKB 4Z7QE 1G9EA 4WV1C 4XAWL 4HLJA 1QSEA 3VXQA 2F74A 3HE7D 1YUHB 3NFSH 5F7KC 4FQQB 1C08B 1N3NA 4G8FB 5E03A 4DGYH 5IB4B 1UZ8B 1RVFL 4GRLD 4OKVA 4U1IA 1QFUL 1V7ML 3I9GH 5JPMB 1LK2A 1NCCH 4TVPD 2HMIC 4DFIA 1A4KA 4QRRE 3LDBC 3U9PH 3L3OA 4UDUB 2BVOA 1OM3H 5EUKA 4YDJB 1EO7A 4PRDA 4XPGL 5IF0A 1NQBA 3HZMA 4U6VL 1U8NA 4XB7A 3OKEA 3H9SB 4XWGL 2WK2A 2WUCL 4NNXB 4XPAL 5DUPH 1AP2A 4PLJD 1Y0LB 2F53B 4K7PY 4OZIB 1I1AA 1H3GA 3UPRA 4JZJB 4G6JL 1N8ZB 2QSCL 3BVNB 3VXMB 1P1ZB 3U6RA 3WMSA 1SQ2N 5JLZB 1V8HA 3BZEB 5ISZE 1T0NA 4L4VD 4H26A 3P4LA 4LL9A 4UUJA 2HFEB 5AYQA 4D9QE 3BWAB 4KVCH 1B2WL 2FX7H 1H8OA 1RIVH 4QOKE 5EZJB 5FA4B 3DURA 5DR5L 3FT4A 3S4SA 5E1AB 4X4ZA 5FYJD 4PGCA 3QIUA 2OI9C 3MCKA 3PWUB 5C08A 4C4KT 2A77L 1SJXA 3VI4F 1W0VA 3L3JB 4L8BB 4C56E 1KJMA 1QVOB 3U7YL 5KAQG 1FVCB 5JW4Q 5T3ZH 4KWUA 3TBSB 4XH2A 1LGVA 3QUMA 2SEBB 1ZXQA 1QSVA 3LQAC 3V5KA 3NN8A 3OKLB 3L5XL 4DN4L 1G7HA 4OZGB 2V2TB 3ULUL 2ADGA 3UROR 1X5IA 3TNMB 2N56A 3HLAA 4Y4HA 2G60H 2PF6A 4OCMC 5GS1B 3BZDA 3GI9L 2GSGA 1EHXA 1CLZH 4PP2A 4PJ5E 4NT6B 4K9EC 4OLWH 4YHPA 1RUKL 1Z5LB 5KSAD 4R8WL 2DYPA 3OX8B 2CRMA 3MLRH 3MV9B 4NQTA 4M7KL 3O8XB 5D7KD 3VXTB 2R4SL 3LZFH 5ACLA 5DC0A 5DEGB 3TJEH 2OJEB 1F13A 4Y4KA 1KJVA 3FFCD 3RDTD 4LCIL 3OB8A 1EJOL 3BMVA 2P46B 4DTGH 1AGEB 2LAGB 2FR4B 4JDVB 3O4LD 4F37F 3HMXL 1GJIA 4JHZA 4YHYC 1FNGB 1N0XH 1B6DA 2VOTA 2GSIA 5GRWA 3RWDB 5E8NA 5LXGL 2D31B 2G5RA 1JN6A 1EFXB 5FF6A 3CFCH 4PRPE 3CMOL 12E8L 1UM6H 4HV8B 3I3BA 3IYLW 3QUZC 3Q2CA 1NJ9B 4MQSB 3RL1B 4X9HA 4WI2A 3TCXA 5C9JB 1E4JA 4ZO8A 3D39D 3LPFA 3EYSH 3WN5C 4TUJB 3C08L 3RVWC 3BXNB 3JV5A 1FZKA 3QJFA 4OGXH 1D5MA 1OGAE 5FV1L 5D7LB 4X6CE 3VE0A 4JJ5B 2DQTL 4XVSH 3BDYH 2Q76B 3UTQB 3HC0B 4ORZC 2EEBA 2VXTL 2CKBB 5FAAA 3WS3A 2CK2A 1EHLH 3ZYIA 3ARPA 2O5YH 3ULVE 1WBYB 1QUNA 4GW5B 4MXWL 3VXRB 4KKLD 3B5HA 1GPOL 1B0GA 1KCUH 3QPXL 5T1KA 3TH3T 4S1QH 1ZHNB 1N4XH 4EDWL 3FZUC 1M7XA 1R0AH 5J6GA 1YPZF 2IG2L 4PRID 1AD9A 3VG0H 1A9EA 3DRTA 4ZNEA 1P6AB 1CR9H 3QG6B 3TH2T 1T1WA 5TQ2H 5KZCD 4XP1H 1W2KT 4POUB 4XGZB 3QNZB 3B2UC 2GKIA 1GCFA 2OJZL 1JBJA 4NFBA 1G7PB 3H0TB 4URTB 3I3DA 3WD5H 1A64A 3S3SA 4EKXA 2X5PA 3L3GB 3NH7L 5IKCA 1GGBH 5J4MA 1E4WH 2EC9U 3AMKA 4X98A 3SCMB 3MLUH 3MV8D 1OF2B 1DUZA 1HZHL 1KELL 1VERA 1QBLH 4NWTL 4TSBH 1A9BA 1S9WA 2EC9T 4YQXH 4E41A 1CFSB 1ZA6A 5DGQA 3VXSB 4L29A 5EBWA 1CGSH 4KTDH 4G9FD 5EOCL 1FC1A 3IFLL 5D5MA 3MX0A 6CGTA 4MA3A 1R24A 3QCTL 5F70A 3TNNA 2VAAA 1OAXH 3WEXA 5JOEA 2VB5A 1IGFH 3FQNA 4PGZA 4O51A 3V52H 3RWCA 2YZ8A 2FJHA 4UI2A 3TA3C 1HSAA 2FJFB 2ENSA 3SOBL 1UJ3A 1EGJL 1F58H 4XXCC 2FZ3A 4G3YH 3QEQE 1VFAB 3VMNA 4NC1C 5DD1H 3ROLA 2CDGB 1U8OB 1UQSB 2NY0C 5BZDA 4EXKA 1YEFL 3OAYK 2AK4B 5J12B 1MCFA 1HWHB 5HYJE 5DK0B 3S5LA 5GZNC 2FGWH 3OTTA 3UMTA 3TLRA 3VH8G 1HDMB 2ZCLH 5EBLA 1UC6A 4K55A 2VERN 1B9ZA 2BY2A 4NRZA 3DRQA 2OR9L 1LNUB 1EXUB 3ARXA 4XCYB 2IAMA 5T1MA 4U1SA 3WIHL 1CG9A 5KSUA 3R8QA 5BRZD 2F58L 1J8HD 1F3DH 1MUJA 1EHAA 5LBSL 4KJYA 4XCNB 1I1CA 5K93A 3R0NA 3ARBB 4FP8H 4P46A 1TCRB 1DBJL 3LN5A 1YN7B 1JFQL 5IFAL 3I6KA 1R3KB 3WIFA 4HJ0C 1ZAGA 3T3ME 4OCNC 2YPLA 2QHRH 5I19L 3HE6C 4OFKA 5C0BD 4I3SL 4ELMB 3G6JA 4JPKH 2XZCL 4U6XB 2OZ4A 4R2GB 1ED3A 4AY0A 2PXYB 3WFCL 3VCLB 1OGTB 4GG8A 3O9WD 3MRQB 2FO4A 5IV2A 2P5WB 4M3KB 1YEJL 4U0RB 1KEMH 1CD1A 1UJTA 5SWSE 1SEBA 2B1AH 1Q94A 3VW3H 1MQ8A 4H20L 5F89B 2ITDA 4DCQA 4Q9BA 4ZO6A 1A7QL 3E8UH 1R5VA 3QI9B 3GKWL 2V6HA 2VLLA 3IVKB 4P3DB 2NXYC 4NO2A 3LIZH 1A14L 3ULUF 3H3BC 1TLKA 5D2LA 1P84J 5IIEB 2EZ0D 1EUUA 3MCLL 3NA9L 5AAWA 1RZJL 3CH8A 3FN9A 2VR9A 2UWEE 3QA3A 3U48A 1JWUA 2E8ZA 2CRIA 2EE2A 1D9KD 5E24E 2NY7H 4JKKA 1IAKA 4NZTL 1CXIA 3GMRA 2P8PB 2GAZA 3CSYA 4XC3L 1EFQA 1CFTB 3HPJA 1JHTB 2RR3A 3O6FB 4GBXD 5KOMC 4EIGB 4HAGA 4PD4K 3BKJL 3SPVB 1QRND 3OQ3B 3UYRH 3Q6FB 4QRQB 5GGRY 3DVGB 3U36B 2GJZB 2MKWA 2OBGA 3BI9X 2MCPL 2VXUH 1MHPH 1JWMB 3TBWB 2JE8A 1O7VA 1FC2D 3PHQB 4ZS6C 3OWEA 3QNYA 3LRSB 5DD3L 4CMMA 2V2XA 2ARJA 3HI1A 4PJCF 5CGYD 4E5XB 3SDCB 4GFTB 3TIDB 2VRAA 1D3CA 1BMGA 3AREA 4YEFA 3QB7C 2Z4QA 4NUJB 3NABH 2Z31D 5BZWB 1RIHH 1HYSD 4WEBH 1OAQH 5CJOH 3FRPA 3WIIH 5MEOB 5ITFB 2FLRT 3D0LB 4NJAH 2V9RA 1UXSB 5K9KA 1CL7L 3G5ZA 4DVRL 5JW3L 2DQJL 3UTSA 2CK0L 3QBTB 5L88H 4F9LC 1MI5E 1J0ZA 4PJDB 3N85L 1GXEA 1QKZL 4FFVC 1DVFB 1SYSB 2AEQH 3ARFC 3P73B 2MHAA 3VA2C 5DVLA 1QBML 1AKJB 2XZZA 4DGVL 1H5BB 3QFJB 4IOIA 3KPQA 1MEXL 1JPSH 3C8KA 1JGLL 2YUVA 4LCYB 3B9KC 1BVKB 4MAYD 1DEEB 1TJHL 1C7SA 2A6IB 3O0RH 1FN4B 4AEIH 1IEAA 3HNSH 3FHQA 3ZT5A 3WJLC 3T2NH 1G7LB 1UT9A 4AL8L 5IK3B 5C2UB 4U1NB 1DANU 3DIFB 1BJMA 1QBAA 3RA7H 1X9QA 1I8LA 2DLFL 2UZIL 4K2UH 1DANT 3T0XA 2F54B 4WO4D 1T5WB 2NY3C 1T4KB 2I5YL 3FONA 4F3FB 3FN0L 4LLAA 1KN4L 3RUGF 4FFYL 2QQLH 3P77A 2YWYA 5E70A 5B39A 3CZFA 3I85A 1NUFA 2Y5TA 3E0GA 2EDOA 4AJ0A 1P4LA 5D8JL 1YEKL 2AJXL 5DRZB 1PG7L 1OTSC 2W91A 2DAVA 3OKDA 2NY4C 3UJIL 1NDGB 2DQEH 4LP4A 1IGYB 4JO2L 4AEHL 5KVGL 3HUJF 3KHQA 4A6YA 4P2OA 3UAJD 1S7QB 1F3JA 3PABA 1F90L 4FA8A 1KIQB 2EDBA 2YEZB 3ELAT 3V6OA 1Z3GH 4WI7A 2YZ1A 4QRRD 2IGFH 5DUML 4YIQB 1KB9K 3DV4B 2X44D 3KLAB 1CGVA 3VRLF 5D2NC 4DK3A 3GDBA 4PGBB 1EO8L 3BUTA 5GS0H 3S9DB 4UTAL 5HDQL 1DE4A 3PE9A 5A2KH 5EORL 2PYEE 1HQRB 3NIDE 5BV7H 5C8JA 4DZ8A 3D85A 1WF5A 1XR8A 1D5BA 5GS2H 4HXBH 4TNWK 5DJ2B 1H3PH 3L9RB 4XNZB 4PJ7B 1J0IA 1H15B 3CJJA 2WIIA 1L7IH 2J4WH 2K3TA 4LAQH 4TSAH 2WQRA 4PREB 4Z77B 4ONHB 2NY5H 1EEUA 1XIWD 2BY3A 4M9PA 4UQ3B 3INUH 3HAEB 2IPTL 4OUUB 3STBA 4I0KA 5H35B 4L4VB 3TZVD 2JJSC 3ETBF 1VDGA 3PQYD 4QOKD 3S35L 1RK0A 1XGYH 3SKOB 4N1HB 4PTUB 3Q3GB 3GB7A 3ZKQD 3FB8A 4MX7A 1BM3L 1WBXB 4XMKH 4P49A 2HFGL 2VR4A 4HC1L 4IDJL 3O2WL 2H2PD 1J1OH 1G1YA 4C56D 4OUOA 5DDHA 2JJUA 3HN3A 4FTVB 4XMLH 4Z7UE 3CVHH 2DKSA 1NPUA 5E9DE 4BKLA 3FO0H 5ICZB 4W4OC 4B41A 5EUOA 2X4SB 1BIIA 5CJBA 1EJ6A 1A6AA 1NGXA 5BMFH 2NLJA 4DW2H 3GO1L 2BOCB 1F5WA 4X9BA 4XBPB 3T3PF 4DFHA 3G9VA 1U3HD 2B1HL 3X12B 1XF1A 3U2SB 1N64H 1UEMA 4ZOAA 3A0OA 3PWPD 2CXKA 4LLQB 1CF8H 1CFBA 4APQA 1A1OA 3CD4A 3CUPB 4PJ5D 5KG9A 2VZ1A 5EBMB 2W9DH 4X5WB 5E5MA 4NKMA 3MRDA 3WFEH 4Y5YC 4UTBH 1FG2B 5KSAB 1NCBL 4N68A 1BFVL 4Y5VB 2R2BB 3VD3A 1ZGLB 4OCXH 3RY4A 1QR4A 1RHFA 1HHGA 3SDAC 2WP3O 5FB8A 5T33L 4R26H 1KUMA 1W0WB 1KN2L 3SDDD 2E5EA 4ZFOA 4QT5B 2OL3H 4BZ1L 3MLTB 4HWBL 4X6DA 2R0LH 4LHUD 4L3EA 5EU6B 3RDTB 3CX5J 1PAMA 1ZEAH 2BFVL 5DTFB 1NFDB 3O4LB 3SE9L 3MRKA 3TWCL 5CP3H 1JPTL 4ODHH 4Z7VE 2DN7A 4KQ3H 4PG2A 4NKDB 1PQZB 3RVUD 2PO6D 4Q6IC 4XWOD 1LO5B 4YFLI 3W9DB 4PRPD 4JFEB 2NTFB 3GMQA 4NBZB 4WI3A 1CVSC 5A16B 1EAPB 4TULL 4XP5H 3RWEB 2DL9A 1J88A 2AQ2A 4TSCH 4HUNB 3MPCA 1RZIA 4LCUA 1CT8B 1NAML 4HIIA 1PG7W 1IVLA 5I1KL 3BPNB 3D39B 2YMXL 3MLSL 2B0SH 1RZ8A 1Q9WB 5GS0C 3C8DA 4QXUL 3ILQD 1MJUL 1ZHBB 1JF6A 5BV7C 3V8OA 1LMKA 3VWJC 3WLBA 4ZUWB 5CS7A 3QIBB 2VXQL 4ODSL 1XH3A 1S5HB 5IGXH 4XB8A 4YLQT 4PS4L 3B6SA 3ULVD 4PV9A 3TO2A 4JPVL 4K3JL 4LCWD 1Y6NR 4M93C 3E2HC 4Y2DD 2D2OA 3DNKA 2QQQA 4YAQB 3MACL 2NY5C 2R8SL 5EO9B 5TF1L 4LIQE 4UILH 5C0ND 4S0SD 3MA9H 1RHHB 2QTEA 4OGZA 3BGMA 4U6HA 5HYSG 1NC4B 5IP4A 4KDWA 2EEDA 1QACA 1N6QH 4YNYB 1D5ZB 1S78C 4OM0H 2AW2A 1T1ZA 1OQOA 5KZCB 1E6OL 4KKBD 2R0WL 1Y6KR 5IVZB 5AEAA 5IBLC 3SDXA 4TPRH 1K85A 4NGHL 5T1DH 1BD2A 1PKOA 2R0KL 1FIEA 1WZKA 4O4YL 2X05A 1K5NB 1SY6H 4NBXB 2EDNA 4HPOL 5EO0A 2DTML 5IHBA 1RZFL 4MMXC 3SGDH 1FO0B 5L7XL 1K4CA 4P5TD 4J2XA 2HVKB 2FX8H 4CJ0A 4MNQA 4TNWF 1J0YA 4X8JB 1I1YB 4PJAA 2E9IA 2R39A 5F88A 5I74B 1DUYB 2A9NL 4PP1C 4RGNC 4XZUB 1R3LB 5MENE 1DEDA 2LV4A 4U2ZA 3OZ9L 3DPBA 1P4BH 3CSBA 1AGFB 2YSSB 1KIRB 1F4WH 2CPCA 4OF6A 1J7VR 5IW6A 2BDNL 5FA3A 3UJJH 3MUY1 3K74B 4XPFL 1JPGB 3QEQD 4UBDD 2FECI 1MCJA 5D1ZC 5HGAA 3F7QA 4TOYL 5EU7C 5ID0A 2OS7A 1E4KC 4J4PA 4JO1H 3LV3A 5IMKA 2BY0A 3UTTE 1MJ7H 2C4XA 4GG6F 5HYJD 1U58B 1UM4H 2H6PB 3L3DB 1WIPA 4CMHB 1U9KA 5H94A 3RGVD 5I8CB 1QD0A 1LP9B 1MLBB 1VENA 3WDHA 3EYVB 2XA8L 4R90H 4AIZB 4NC0B 4EI6B 5IMMA 4L8CA 3CXDL 4PJ9C 5FGRA 4AIOA 5CJXC 5HI3C 1XR9A 1KG0B 3IU3A 4U1JA 4O2FB 3A6OA 3QR2A 1I1RA 1WISA 4RIRA 1S7VB 3HFMH 1P5UA 4YC2C 4PJGB 2WWMD 2V17L 2ZWLT 3PWJA 4XI5D 2Y36L 4DQOL 3EZ8A 2XTJB 4GAFB 4PJHF 3SQBA 3FQTA 2Z91B 4OQTA 1QLEL 4HQQL 3S36L 3HB3D 1IL1A 4MXVE 1OT2A 2NY2D 5HHOA 4ZAKD 2AV7B 1FL6B 4LF3B 1PEZA 4FFZL 5ABDE 1NEZB 3FO1A 4LVNB 1KEGL 5IBUG 5C0CE 4OZHF 4FFWC 4M6NH 5ICYA 3TIEB 4AZ8A 4R4BB 4Y5XB 1RJYA 2GJJA 4I8DA 5FUOL 2XN9E 5SWSD 3WYRA 2DBLL 2VJXA 4W6WB 2VE6A 1CVRA 4X80H 5TPWH 3NCJL 3AC0A 2R1XB 1T80A 1WFTA 1RJLB 2G75A 2AJSH 1ZVSA 4MNGE 4FQCL 1J0JA 4NKQB 1W0YT 2ZOLB 1MNUL 5C2BL 4PJEB 1T7XA 1IZJA 4JM2D 5DQ9B 1AGBA 1FSKB 4P5MA 4JY5L 2OTUB 3QHFH 1WBZB 1QYGL 2DM4A 4NOFA 4PLKC 4Q97A 4V1DE 2HT4C 2ZKHL 3WDJA 1JRHL 3QCVH 3TESA 2BX5A 4HFUL 3TBYA 2AKRA 2MPAH 2A2QT 1DQJB 5HI4C 3OJ2C 3DTXB 3QUZA 5F7MC 3QUYB 1ZS8B 5JXED 1ZMYA 2VZTA 3IFPA 3GK8H 3JWDL 1T21B 3O2DH 3O45A 5IW3A 1FVEB 5DRNB 1MFCH 5HJ3B 2HTLD 5I8EB 3ZKMD 3B4NA 4NZDA 4HGWA 1U95B 4NQDE 4KUZH 3KPSE 4NKIH 5I0ZA 5BW7A 5GSVB 3ZZ1A 1NBYB 3C6SB 3M17A 4OFYD 4ZOEA 1WFUA 3DGGB 2YPKB 3QRGL 4YDIL 4XPBL 4WDIA 3V4UH 4G5ZH 5I8OH 3IS1X 5LWYH 4G8EB 2MSPA 4OCLC 2ZG2A 3QUXB 3KPLB 4NJ9L 1T66D 1JF1B 4M5YL 1N7ML 1VCAA 2VIRA 2FH8A 4HUXA 5DD6A 2EDKA 4X9FA 3TT1L 3QQ9C 2YUXA 3S37L 3BQUC 3V4PL 5I18L 2R4RL 5KTEH 3TO4B 5CHNA 1CICC 1JNHB 1MI5D 2WBJD 2VLME 4FMFA 1CIUA 5DHYA 1OP5H 1ZVYA 4OZFA 3F7YB 2Z8VC 4JN2A 3IKCB 4Q9QL 2YOCA 1QOKA 3UC0H 3EO9L 1S5IL 2GFBA 3S34H 4E0RB 4WNQA 2Q3ZA 2MWCA 1OSPL 4TUOA 1I8IA 3IJYA 1KTLA 3JZ7A 2Q7NA 4I9WE 1E4XH 3BE1H 4JANB 5JIIA 3QWRD 1OSZA 3KJ6H 4OJFH 4Z8FH 4EBQL 4WI6A 1KTKE 2P8LB 5BS0A 4Q0XL 2F8VA 1IC1A 1LEGA 4WW2C 5B4MD 5JIPA 3T0EC 4G80B 1OAKH 3PV6A 4JY6A 4TNVK 3REVB 4LHJB 2Y7QB 2A73A 1YNKL 5LCVH 4YZFE 4UV7H 3VRIA 3DWTA 2X10A 5TE4L 3RJDA 5C86A 5D96C 4WJ5B 1QRKA 5IQ7H 3LRHA 4I3RH 3OXSB 4GRWF 2Z93A 3M8OH 4IMLA 2X1WL 4PB9L 4DVBA 2C4FU 1NGWB 5I8KH 4JZOA 3C6LC 2DF3A 3TA3A 4FQXC 2C4FT 5IESL 4XXCA 1DBMH 5JZ7C 1FFOB 5C08E 4B7LA 3GJEA 4PRHB 3MROB 1W72A 5I1IL 4HS6B 5KSVB 4ZS7H 3MOAH 2NY6C 4P23C 2ZCKL 1KCVL 5CD3B 2O93L 5LGJB 3HNTL 1JF5A 2BNUB 4L9LC 3DI3B 1DBAL 5D7JC 2ICES 5IB5B 1X5FA 4DKFH 4QTIH 5JXAL 2AABL 4D3CL 5JR1H 4NNYA 2CIIB 4E42A 4LDEB 2PYED 1YJDC 2X2YA 2A1WL 3O11B 4LEOA 4J3XA 4F58H 2VDLL 4LSPH 1I8KB 4RGMC 2OZ4L 3ARQA 3NAAL 4FXKA 2CUMA 4IIQB 3RHWF 2HH0H 4HPYL 1T03H 4ONGL 4YHKH 4OLUL 5CD5C 1OW0C 4X9IA 3D3VB 1YEGL 1F2XK 4UINH 2EYRB 5SWQA 1U6AH 4NPYA 3RVXD 4RFEA 4UDTB 5KS9E 1Q38A 5DJXA 2DLEA 2YRLA 3T4YB 2DMCA 3VWKC 5DJDB 3KYKH 1FL3A 5FUZH 2DI8A 1MAKA 4RFNB 1HKLL 3HE6A 5MP6L 4NO0A 4ZPVA 4M6OH 3C60D 3VA6A 4QHNA 2GCYB 25C8L 3PQYB 4HG4K 3BSZL 3TBTA 1LWRA 2DDQH 4NSKB 2H3NA 4M03A 4PR5B 2UY6A 4JGJA 1AR2A 4IRJD 1IGJA 3EW3B 3H42L 2L7JA 5E9DD 3F58H 3W5MA 5DRWA 2DQIL 2C7UB 2MTPA 1ACZA 5DVOA 5HGBA 1TZHA 5FM4A 1FFRA 5CLTA 3RAJL 2V7NB 3RVVC 1AQDA 3UTZA 2JB5L 4HLZG 2C5DC 3MNVB 1QA9A 4JCMA 5C09B 3D2UA 3EFFB 1Q9KB 2KUTA 1RUAH 4LLYA 4N0CD 4R9HA 1G7MA 3F8UB 4JFDB 3NOIA 5ESVB 4WW1A 2CKBH 4MJIE 1GGYA 1XCQA 4UU9A 4G6FB 1KYOJ 3PWPB 3NCYS 4U1MA 2DLHA 4PJ5B 4B7IA 4JZJC 2AI0H 3BZ4B 3FRUB 2Y07L 1HIML 2WNGA 3LPGA 3MOQA 2EDYA 5INDB 1CD0A 2WIMA 4OF8A 3LEYH 5CUSH 2G5BA 4F2MB 4G43B 4NHUA 2YD8A 2HN7B 5DHVB 3VD9A 2FO1A 5ANMB 5AD0A 2J2ZA 3CC5B 1JGDB 3QO0A 1KXQE 4LHUB 3KPMB 3GRWH 4ZNEE 3OKNA 4WI8A 1RK1B 1RUML 2R29L 4UIKH 3IDJA 1U8HA 3VXNA 2FEDD 3AGVA 3KAAA 1VKXB 3BMWA 4QNPE 3X11A 4QY8B 2PO6B 1A3LH 4WFFE 4OCWH 1KJ2B 2JIXD 1N5AB 1FRGH 1RZ7H 3ARGD 4NFCA 1IT9L 1JUFB 4F9LA 1HQ4A 1K4DA 4LNRA 2Z8WC 5D71H 2DJ4A 5C0IB 4N1EA 2BSED 3U1SH 4UV4H 4LMQI 3AM8C 4E41E 3PNWA 3ARFA 5GS1C 1U3JA 3SJVA 3JTSB 1A1NA 1YPZB 3DXAA 3QHTC 4JFYA 1J05A 2M1KA 4JKWA 2X89D 5GHWL 4GXUM 1LO2L 1U8MB 1DCLA 1AFVL 3I84A 3B9KA 5D5ME 4OGYL 2BHZA 1M7IB 3I2CH 3MRBA 5L2KD 4L8DA 2JCCF 3O8XC 2H32B 4NM4L 1NMAL 2P5EA 3VXUA 3DV6A 5I75B 1CXEA 3PXJA 5IB2B 4QHMA 1IGML 3T2QA 1KIPB 2CGRH 4XMPH 2IANB 4LCWB 1QR1A 4R96A 4FG6D 1DQMH 4Y2DB 4M62L 4A6YL 4TVSa 3FCTA 1F6FB 5HVWA 3VMOA 2F19H 4OGAD 1A1MA 3WLWC 1D6EB 4HK3N 4MJ6A 1TVHA 3STZB 5HTSA 5LVEA 3GSOB 4CDHA 4DKDC 3LKSA 2X4RA 2DQGL 5D1XD 1IKFL 4XP9H 2FHCA 4M3JA 2IC2A 3K81A 5LKNA 1KJ3L 1KLGB 2I9LB 4LBEB 4HGKC 3EOBA 2W1NA 3QEUB 1R3IL 4OV6F 3E3QE 1MF2L 5HHPB 2XXMB 1I1FB 4BH7A 1LO4H 2HJKA 1AGCA 3QDGB 1A7NH 2OR7A 4D9RE 5GGQL 1MLCA 1YEHH 3MRNA 1JZ6A 3VJ6B 1Z9MA 3KJ4B 1ND0A 2J8UF 3VGBA 5J6HB 3UJTL 1FP5A 1MCCA 3EOYG 2EDHA 4K7FB 3F12B 5D2NA 5EC2A 1NKOA 3L3HB 1OHQA 4EJ1C 1T0MA 3QDMD 3LKQA 2BVYA 2J12B 2AQ1A 3HG1A 3MA7A 4ERSL 2YPLE 4KRPD 5F7EH 3JV4B 3KPNA 3WSQL 3B2VH 4XCCL 2NX5B 2DQUH 3AAZB 3L7EA 3LVEA 4JPIB 4JPWH 3RFZC 4WU5B 2A74A 4QCIB 2EDFA 2HLFD 4OCSL 3E1F1 3QEQB 5FECB 5E8PB 5IFHH 2BSRB 2N7AA 4KQ4H 4U05A 2EEAA 1NCWH 3UTTD 3RTQD 4KZDL 3R8BB 1NBVL 1S7TB 2VLRB 4Z7WF 1TNMA 4ZYKB 2JJSA 1NSNL 2VQUA 1BWMA 4I48B 3K4ZA 3DBXB 4W68A 4N8CH 3RGVB 3I6LE 2RCSL 1ZTXH 5D2LE 1JHLH 4EVNB 5JORA 3SCMC 1S9YA 3ESVF 2Y6SC 5K59E 5GQBA 4XNUH 4F7MB 3RL2B 2Z35B 3L5HA 3MMEA 3G6JF 4MXQC 4X5XA 4W70A 3QDJE 3S88H 3ROOB 3BZFB 1TVBA 4JDZB 5F93C 3VH8A 1MWAA 5F21B 5T3XE 2EYTB 5I1LA 1AIFB 2ATPB 4MA7H 5EU5A 4ZPTB 5JOPE 4O2EA 4QRUA 2P8MB 5SWZD 4ZSOB 5LAXA 3NZ8A 2HJFA 1CFNA 3RWIB 3TBVB 4FQ2L 2NY2B 3E6FA 4ZAKB 3MLYL 5H37H 4WU7B 4PB0L 1GGTA 5BXFB 2YRZA 2VMFA 3CXHK 4UZGA 3C5ZC 1U91B 3ZE1E 4Y5YA 5C0CD 2V5RA 3WCYA 4XNXH 1V3KA 4EUPB 1KGCE 1FFPB 1ZLVH 5J12C 3KYAA 3SDAA 3EO0B 1FDLH 2VUYA 1NL0H 1K2DA 1HI6A 3EJYD 4RA0C 5I15L 1ZHKA 1KENL 5BJTA 5BO1L 2HRPL 3GI8H 4Z7OF 3UTSE 3FT2A 3AXLB 3CDYA 1NCDL 5ACMA 3MLPA 5GRUL 1NGQL 3EO1B 5TE7L 3S96A 4ORGB 2F5AL 2ZUQB 5HHNB 1I8MA 3DVFA 3K2UH 1CFQA 1BBJA 4Q6IA 1X4ZA 3PP4L 3T65B 3CPLB 3BKML 1QPPA 5ITBH 1FVDA 4M8QB 3FB5B 4X7SL 3UBXB 1SYVA 5FKAA 4RGOH 4G8IB 3AVEA 4X4XB 1HOCB 5JOFB 3W39B 2KDGA 1KULA 2HG5A 4R4FL 4MD5A 1GAFL 5C0GA 4HWEL 3GMOB 4P57A 3DYPA 2XQBH 3SGEH 1UYWH 2W59A 1VPOH 1TETH 2DRUA 5A2LH 4NKOA 4R2GC 5DRXB 4NQDD 3KPSD 2PXYC 3FOLB 4YXLL 1N6UA 2AXJA 3BEWA 1FFQA 5DK2A 4NQEB 3W0WA 3OJVC 1MAMH 1QQDB 15C8H 1KPRA 1ZT1B 4IOFC 3W82A 4H8WL 4Y4FD 4U0RC 3RY6C 4XP6L 1KCRH 1IEBA 3MRCA 5EA0L 3NFPA 4GH7B 5HXMA 1ZHLB 3P4MB 1T04B 4S0TD 3MYJB 4TTDD 1QSED 3BHBA 3EDKA 3QI9C 4M5ZL 2P1YA 3R06A 1BF8A 3TEUA 4K3GA 1NCTA 4ZTPL 5ICXA 1VEMA 5EOQL 1A4JB 2AV1B 4XCEA 4LKXB 1NLDH 3RU8H 1P7KB 5ALCH 2JJVA 2VLMD 4F7EB 2XFXA 1MI5B 1YEIH 5IVXA 2VLJA 1S7XA 5ETUB 3WDIA 3U46B 3RUGB 3V2AR 1BX2A 1TZIB 4RISL 1JZ4A 1NLBL 1HSBA 1FORL 2EDRA 3O6FC 1Q9LA 5DS8B 5IMOB 1LK3L 3WXVL 3CVHA 1MVFA 4JVPA 3HNVH 1U3YA 5E94A 4XNYH 3MLWH 3FT3B 3HAEH 2X4NB 5F7HA 5IG7A 1I1AD 3PWLA 3CVIL 3PWNA 1LILA 2VN7A 5I17A 2E27L 1GHFH 3ZTNL 5KJRL 1DFBH 1ETZB 2YPVL 3ZHKA 4XHQA 2BRRL 4PGJA 4R7NA 3CFIC 3SKJH 1MREH 1XCTA 4FQJH 5ID1A 4PYHA 2HKFL 3BO8A 2XKNA 3W11D 2GTZA 1GZQB 5B3JF 4CU7A 3QIUD 2XWBA 5IJVB 3OAZK 2ICWI 4YEEA 3O3EB 5D1ZA 3OG4B 5C08D 5MI0B 1GGIL 2UVEA 4G42B 3OV6A 5JQ6L 1U8IB 1ACYH 3U4EA 1E4KA 1F11A 4NQCA 5EO1A 3JTTB 3L1OH 1DVFC 3SO5A 2OL3A 5DWUH 1RIUH 3F7PC 4M7JL 3WFZA 2VDOL 4MVBC 1U8KB 1TENA 2EECA 2APBA 2CDFB 2EIZB 4X83A 1H5BC 2D7OA 4LVEA 4OQTL 3SHSA 3EYQD 5ACZA 4JQVA 4JAMA 4LU5H 5CP3A 3KG5A 3QFDA 1OP5K 3LKOA 4Y4HD 2CIKA 4JZNA 3NBNA 1YY9C 2GT9A 3QWOB 1FLRH 2D7TL 3V6FA 1EIBA 4XVJH 5GGVH 3DX6A 5TF0A 3BH9B 4HMEA 5DJ6B 2DYPD 3OB0H 4OZ4B 5KSBB 4YH6A 4O02L 4OD1L 1MH5B 3PDDA 1M6OB 1S7UA 4WY7H 1AI1L 2MCG1 3PGDA 4LQFH 4M02A 3ARUA 2YK1L 5F1KC 5FYLH 3RNKB 4BELD 1WGOA 4X6DE 5AZEL 1RMFL 3IXAA 3Q1SH 1MY7A 3HA0A 4L3EE 5BRZA 3NGBB 2OTPA 3L95B 4H0IA 2DD8L 4X0KB 5JHDE 3HZYA 4YO0B 4HIXL 4NP4H 2FX9H 3E6HA 4KK9D 1FYTB 4WUUB 1KPVA 3DUSA 3REWA 43CAB 2EDEA 1KFAH 2IALA 4Z7UB 4DGYL 1EK3A 3O6ML 5DI8B 4ZFFB 5D70L 5FO9A 4XP4H 3U0WH 4OSUH 1NCCL 4HZLB 5LGHH 2VC2L 4YR6A 1QFWM 4LLMA 3V7MA 2I60H 4LASH 4XXDA 3O2VH 3IETA 1HINH 1P6FA 1WCQA 4OT1L 1OM3L 3SY0A 5IB1A 5BVPL 3P4OA 3W2DH 4ETYA 3H3KA 4O5LH 4XNZC 4I18A 4MS8C 3C9NA 2BNQA 5FO8A 1FGVH 3LEVH 4DN3L 4DKAA 3TPUB 1JK8A 2BNRB 1HN1A 4PLJC 1JNLL 1SY6A 5F71A 4PRBB 3U0TA 4UT7L 2LE9A 5DUPL 2GTWB 3U7WH 5IFJA 3U83A 4NQUA 4LOUD 1WT5C 5KN5B 3QCUH 5F7WC 4DZBB 3ZDXF 4XBGB 3O41B 5CZXD 1DSFH 5T1KD 2P44B 5E6IB 4GW4A 1A7RH 2NY1D 4YPJA 4R6UA 4M6AA 4KVCL 1YN6A 2DIJA 3LMJH 4U7KA 3DO7B 1D7FA 3GSRB 4ZUUB 5ESQA 3ALPA 2EKSB 4D9LH 5AWNH 4HT1H 4JR9H 3EUUA 5L6YL 1GOHA 1FO0H 5C07E 4WFFD 4F80A 1I9RL 3BQUA 1F4HA 2AJYH 1JGUH 1GGCH 4G9DB 1T6WA 2JIXB 2VDML 2VDQL 1IM9A 1CICA 1GC1H 4JJHA 5FXCH 1V5JA 4KJPC 5F7DA 1CDJA 5C6PB 2FB4L 4E41D 4LLDB 2CH8A 5J3HD 4MZ2A 3P2TA 1LO0H 3HI6L 3GKZA 4MNQE 2G60L 4PJAE 1M71A 5J9PA 3IXTA 2EE3A 4CKVX 1IKNC 5ENWB 4KFZC 5F7LB 5FM5M 4NRYA 3HMWL 1AY1H 5KSAC 4H1LG 4Y5VC 2BCKA 3D18A 1RPQA 4HKXB 5DUBB 3GUTB 5E08L 4JO3H 4P2RB 1XZ0A 3FFDB 3VDBA 3L5WA 1VA9A 1QP1A 1MQKL 2FBJL 3MJ7A 1NMCB 3IFNH 2BVQB 5L2KB 3MLRL 4NWUH 4G8GA 4I2XB 2ZCHL 4BA8A 1W72L 2VAJA 3LZFL 4HIJA 1P7QA 2GY7B 3M45A 3TJEL 4F7PA 4HH8A 4LSDA 2CUHA 3RWJA 1GOGA 4DTGL 2ESVA 4LPVA 4X8XA 5CEYB 4BK5A 1HXMA 3G08A 3C6LA 1QNZL 2XZAL 1J1XH 4FQXA 5D1XB 2WBWB 3WFBH 4PJXA 2J3SA 4N8VB 2ICWB 4I5BA 2KBGA 2D03H 1KB9J 4TRPH 4ODVH 3KXFA 4P9MH 3MRMB 3AS2A 5HYSA 2XYCA 5DJ8A 5JDSB 4P23A 2XT1B 1OB1A 2IAMD 1VACB 3BPNC 3B3IA 4GQ9L 2VABA 1JPST 4WI4A 4D8PA 3EYSL 4Z78A 1KPUB 4GG6B 4X99A 1U8LB 3LB6D 3IDYB 1HXYA 4PJFF 5ILTL 3NTCH 4LLUA 4P46D 1G9MH 2FHFA 1A3RH 1A6ZB 1XGPB 4G6AD 2C9AA 1TQBB 4NHCL 1RSFA 1HILA 3MGTB 5E2UH 3QIBC 2OYPA 5HHOE 3QDMB 1A21A 2H26A 1EVTC 1IC7H 4Z0BH 2YPLD 1KXTB 1OAYH 2ICWJ 3HS0B 4KRPB 2IQ9L 1JTTA 2BJMH 1EZVX 1UCBH 1DDHA 4LCCB 1OW0A 1M05B 5AAMA 1KB5L 5D72H 1U0QA 3W9EB 3O2DA 1YEEH 5DURD 3SKNB 2HT3C 4S1QL 2KZ1B 3B5GA 4FXGA 4PJHB 7FABL 2K7QA 4GW1B 3CCHA 2W60B 3VI3E 4MNHB 2D3VA 4RNRB 1F6AB 3WV0A 3CDGB 1AXSB 4RWYH 4MD0B 4MJ5A 5CEZH 5TE6L 1VFBB 1YUHA 3I6LD 1RQ5A 1C08A 5FV2A 1UZ8A 4OZHB 5ISZA 2X40A 3LN4B 3WD5L 4LSSH 4WHTA 3OKMB 1NCUA 3G5VB 2FWOA 3OGCB 1OWWA 4XHJD 3MLUL 4MCYB 2O61B 4UDUA 1C5BL 1QBLL 1MY5A 4U31A 1X5LA 3MV7B 3VFVA 1GC1C 1NBQA 3C5JB 5T3XD 5FCUL 5I74C 1WIUA 4JFZH 3WHE0 4U3XA 2HFFB 1JGVH 5J56B 4H1LH 4BQBA 1CGSL 4YDLB 3JV6B 3P9LB 1XT5A 5SWZB 2AVGA 4DUWA 4NNXA 1BOGB 1Y0LA 4LRIA 1IGFL 1ZWIA 4CW1B 2GUOB 3IGAA 5JHLH 1F58L 3ARED 3BVNA 4YXHH 1P1ZA 4DAGL 5DQDL 1KGCD 2O5ZL 3BZEA 2BVPA 4F9PC 2Y4SA 1EHNA 2E6JA 1OTUC 4CMHC 5IHLB 5FA4A 5AYUL 5E1AA 3UTSD 4H88H 3ZDYF 5HYQA 3L3JA 4L8BA 1ULVA 5ECJE 1BQHB 3TBSA 1PKQE 4P2YA 2BK8A 1T5XB 4ISVB 2NW3B 1LE5B 2DIBA 3VFTB 4OZGA 4X7TB 5T3ZE 1N5YL 2XTJC 4FQ1H 5BS0E 3TPKA 3WXWL 1PJ9A 2FYYA 2VQTA 3AU1B 4MQXD 4JFHE 4KHTH 4YHZH 2FIKB 4PGEB 3TV3H 4OFVA 1CN4A 1MCPL 2AK1L 5GS1A 4N1CA 2IH3B 4FP8L 1P4IL 3BAEH 2A0LD 4DUVA 4NT6A 1DQLL 3QIWB 5DD0H 3MLXH 5JW5A 1UM5L 1G9MC 1Z5LA 3QDAA 2GW5A 2E7CA 2DMBA 4LVNC 2J5LB 3HZVB 3GSWB 3U4BH 1J0HA 3O4OB 3OX8A 4M7LH 4J1UA 3BKCH 1LE9B 4JPKL 3MV9A 5E4EB 4Y5XC 3O8XA 2R1YB 1URLA 5JUEH 5DEGA 4GXVH 1E0OB 1A3QA 4Y8DC 1OGAA 1SEQL 5HGDB 1KEML 2CKNA 1MRFL 2Q87A 2AGJH 1AGEA 3DHJA 3VW3L 1QSEB 4NC1E 3VXQB 4JDVA 1L4IA 1G0DA 4M4PA 4PJBA 4MLSA 1ZLVK 2X6MA 1FNGA 1N3NB 3MBXH 1FSKC 1BQLL 1TTUA 1VADA 1ZGLP 1LK2B 2IF7A 4PV8B 3VMPA 1EFXA 2O26U 3LH2L 1R6VA 4OLVH 4P59L 4Y16B 4TQEL 1G9NH 5DZOA 4MA8L 1W8NA 3B9DA 1Q8MA 2CLZA 3QUYC 1NJ9A 5KANI 4RZCA 3WNNA 3MBEB 3D85D 1CQKA 4OAWA 3FMGH 4PRDB 5IF0B 3HZMB 1IZKA 3P4NA 4JHWL 4TUJA 1MAJA 3OKEB 3BXNA 1FZOA 5M94B 4DOHB 3P30L 1FNSH 1AP2B 2B8OT 4QRPB 2Y23A 5D7LA 1WZLA 3UPRB 1N2RA 1HKFA 4KPHH 3IDXL 2IADB 2VSCA 3QXUA 2AEPH 1FPTH 3HC0A 5CGYC 2PR4L 5IT2L 1T2JA 1H9VA 2CKBA 2X1QA 5HY9B 5L2JA 4YPGA 4PUBL 1S7SA 3HCVB 3QUXC 3TVMB 4MB4A 4UUJB 4GW5A 4JN1H 4Z6AT 3FKUS 3DURB 3S4SB 1ZHNA 2D9QB 4PGCB 3QIUB 3TO4C 3Q6GH 3WIIL 2J6EH 1JMXA 4KI5F 3ZHDA 3KPRB 2X1OA 1AXIB 5C0DA 1KJMB 4I4WA 5GGSB 3CSPA 2NXZD 1HWGB 1MWAL 4G6KL 4ZFGH 3SE8H 4I0PB 3V5KB 3G6AA 2PW1B 5FKPA 1G7HB 3GRWA 4X6EA 5JPNA 5HHME 1PSKH 2C1OA 4Z7NF 5E56A 5FGBC 4J12A 3L3GA 4ZDHB 3LS5H 4M61B 1JZ3A 1JPSL 1DL7L 3NIGE 3HLAB 1TZGL 4Y4HB 1OF2A 5F1NA 3RRQA 3VFNB 4M43H 2OCFD 4APQD 2GSGB 2Y06H 3O0RL 4AEIL 3BPCB 3RKDD 3DX9A 4NCDA 3VXSA 3S36X 5DHVH 4G7VL 5TDNA 3T8XA 1BZ9B 2DYPB 4IS6B 5T5NF 1SHMA 3ISWA 5GRVL 3MRHB 3RA7L 4BFGA 2DQDL 3QO1B 1WK0A 4LQ1A 1VGKA 4F8QA 4Y4KB 4U6TA 3P0VL 4X4YA 4L3ED 5HYEA 5ADOH 1U8PB 2WUBH 4JRYA 7CGTA 1HNFA 1VFAA 2DM3A 2E7BA 2H2SD 3ZE0E 4NUGH 3C5ZA 4G7YL 3RJQB 1WVZA 2GSIB 1FGNL 1I7TB 4F8TA 2J7LA 3BIAX 3QXTA 3H9YA 5FF6B 5IVOA 4GS7B 2DQEL 3I50L 1PLGH 1FYHB 4JFFE 3V0WH 3QQ4A 5GZOD 4L5FL 4ZTOH 5E2WL 4K3EH 4LSTL 4HBCH 1HDMA 3UDWA 2QV2A 1S3KH 3BDXA 5DLML 2XTLA 3SJVE 2VISB 3DXAE 1FZJB 1LNUA 1OP3H 3GHEH 1EXUA 3HKFA 1G9NC 3HPLA 4IIQC 3WUWB 2EE6A 5F1SA 1FZKB 4OFIA 3QJFB 5A2JH 1DBBL 1D5MB 5FO7B 4HXBL 1PBYA 3MXWH 3FQRB 3OHXB 1H3PL 1CBVH 4XCNA 2DL2A 1F3DJ 4KUCF 2FLBT 4HZAA 2OK0L 3ARDB 4YGVB 3D9AL 3VXUE 4MDJA 4TSAL 1QFWL 1R3KA 2A9MH 5F1IA 3WS3B 5HVHB 1JYVA 4RFNC 3INUL 5IMLB 3OB0K 2P47B 5GRJH 2H8PA 3VDAA 4ELMA 1B0GB 2Z9TA 3LPWA 1OGTA 2EDTA 3MRQA 3FQWA 1UEYA 2JJWA 2P5WA 5DMIH 2ZSWA 4PBXA 3RY6A 5J6GB 2AERT 3Q5YA 1AD9B 1A9EB 4MCZA 1OY3B 2ZUTA 2JCCB 1T1WB 1J1OL 4XMLL 5E1HB 1BD2D 5A2IH 2IFFL 4P3DA 5IWLC 2OLDA 1QFUH 1V7MH 1YQVL 2LFGA 3GSXB 1T7YA 5IKCB 2F9BT 3RVTC 5IIEA 4X98B 1P9MA 5BMFL 1DUZB 3G5XB 4GJTB 5FDYA 4UOW1 2HYMA 3SGJC 1A9BB 5C6TL 3QDHA 4MNQD 1ORSA 4PJIF 5D2NE 1KCSL 3MRIB 1N64L 5F3BA 4RMRA 4XPGH 1CFTA 3O6FA 3TF7C 1S9VA 3C09B 3HG1E 4C83B 1HHJB 4XWGH 2WUCH 4O58H 4ZOCA 3BIKB 4QRQA 3U36A 2VAAB 2GJZA 4UTBL 3FQNB 4ONFH 5F7NC 3EDJA 4G6JH 4MB5A 5CJQL 1HSAB 5T1LD 3TBWA 4LLWB 2FZ3B 3BGFB 3U7AA 1IMHC 3H2WA 4Z76A 5I1AB 2F8XC 3LRSA 4HIHA 4CGTA 5GGRA 2J8UB 4J4PD 2R0LL 3ROLB 3S3JA 4L1HA 1RZKH 2YUZA 4JHAL 2CR3A 2C3GA 1CZ8H 1R5WB 1ZEAL 4OF0A 1RV6X 2F15A 4OCYL 4YGAB 5FOBA 5DR5H 1T22A 3S5LB 5I66B 3DO3A 4LGRB 4J3VA 2IJ0C 5MEOA 1PZ5A 3QNXA 4ODHL 4JRXB 4KQ3L 5IROC 4ETQB 3LRGA 1WFNA 4K23H 4BSWB 4M7ZB 2XA3A 1D5IH 5GRYA 3BN9D 3BYTA 1AO7A 4PJDA 2JK5A 4ENEC 4DN4H 3L5XH 4NRZB 2QSQA 1DVFA 2G9HA 4UQ2B 2IAMB 5T1MB 3ULUH 3X3GH 4OV5B 4U1SB 1CG9B 3LD8B 1H5BA 2ZSVB 3EGSB 4H5SA 1UG9A 2YC1B 2PN5A 3GIVB 5F7YC 4KJYB 4PJ7F 3O81A 1CTOA 1DEEA 3GI9H 4P46B 3O6KH 2A6IA 3T0DA 1FN4A 5HHOD 4EUPH 1K8DB 4HXAH 3I6KB 2XG5A 5I75C 3U0PA 3WIFB 1G7LA 4R8WH 5IK3A 4U1NA 2ORBH 4A2LA 3PL6B 3DIFA 5EIQA 4Q58C 1A6VH 3G6JB 1ED3B 1A6UL 4Y2DC 4TYUA 3SGDI 1DQQB 2R4SH 1T5WA 1WWAX 1T4KA 4Z9KB 4F3FA 3JWOH 1WV7T 3HC3H 4P48A 4HG4J 1CD1B 4LCIH 1EJOH 2GITA 2NZIA 1SEBB 1FJ1A 5F97E 1Q94B 43C9A 1XGQB 4S2SA 2ITDB 2Q8BL 2R2EA 3HMXH 1R5VB 2HRLA 2ZPKH 5JO5A 5HGGS 4FNLH 2VLLB 4OM0L 4KKBC 5LXGH 4Z7WE 5DEFB 1WLHA 4GAJL 4LAJH 4L4TE 4WRLA 1BAFL 1IGYA 1NGPL 1MHEB 1S7QA 12E8H 1BFTA 3CX2A 1KIQA 3KJ4C 1HCFX 3C60A 4J6RL 1IAKB 4R0LC 3AY4A 2OR8A 3DV4A 2VZSA 3KLAA 2CUIA 2GAZB 1NC2B 3CSYB 3QUZD 4PGBA 1XF4B 3ES6A 4YHOH 5L8LB 4IRJA 1KNOA 1EMTL 1DR9A 4NZJA 3FQXA 3RVWD 1A6WL 3GMLB 4FN0A 4NRXB 5DJ2A 4BYHA 4P3CH 3D0VB 5TGBA 3L9RA 1P2CA 4MYWB 2DQTH 2VYRE 4POZD 3W0WE 2E3VA 5IBTL 5F9OL 2VXTH 4CMMB 2NNAB 2V2XB 2MJWA 1TPXC 2ARJB 3HI1B 5B38G 4FQPA 4CVZB 3AUVA 1JZ5A 3HAEA 2Z4QB 4FXLA 3QPXH 3MFFB 4OUUA 5HSFA 5H35A 4KXZH 2AXFA 1BVLA 4JO1L 2ITCA 3RGVC 4PTUA 3G5ZB 1RZKC 3Q3GA 4PRNB 4ODTL 4V2BA 5AG8A 3FZUD 3AB0B 1WBXA 1JPFB 1V3MA 2MFNA 3OAYH 1P5VA 3VD4A 2VLJE 4FTVA 3ALWA 2OJZH 1T2QL 4GRMA 1SJEA 3B2UD 2X4SA 4J23A 3AFLA 2JJTA 2JLLA 3NH7H 2NZ9C 1MFDH 4IOIB 4B5EA 2WWMC 5T3ZD 1HZHH 2AJUH 4NWTH 1VEPA 5BS0D 4RMQA 4CNIB 2XZQL 2BOCA 3WS6A 4LHQB 5E5RB 1DQDH 4JFHD 4XBPA 4Z7VA 3ULUC 1IEAB 3U2SA 3HB3C 1MJJB 3ABZA 5HBBA 2I27N 3I6GB 2NY2C 4ZNCD 4PPTA 3ECBB 4ZAKC 3KDMB 4PLNC 3QXAA 3CUPA 5TQ0L 1EV2E 1TJGH 3PGCA 4X5WA 1PZUB 4RGNE 5CWSA 4CDGC 2R2BA 1ZGLA 1WSST 5IVXF 3SOBH 4U4BA 1EGJH 2PTVA 2VL4A 3TA3D 3P77B 5B39B 3CZFB 3MLTA 3TFKC 4S11A 5C3LD 5MHSE 5EU7E 4FZEL 5DMKA 1YEFH 4NQCE 5DTFA 2DQHL 5TPWL 1UZ6E 2X4UB 3OKDB 4GKOA 4KU1A 3DVNB 4L8SB 2ZUQC 2YRPA 5GZND 4A6YB 4P2OB 4NKDA 1F3JB 2B20A 3PABB 4JEGB 2HVJB 2B39A 1LO5A 5E7BA 3W9DA 3FTGA 3QHFL 3MREB 4JFEA 2VWEC 2NTFA 1HHHB 1BQSA 3C87A 3WE6A 2OR9H 1GIGL 3QCVL 4YHML 4BZ2L 4JFOA 1DE4B 2MPAL 3QHZH 2NR6D 5JXEC 5I1JL 1CT8A 1D5BB 1N0LA 2ERJC 5D7IA 5LBSH 3OL2A 3QXVA 3ZKMC 1DBJH 1JFQH 1ZHBA 2WIIB 5IFAH 4KMLB 4R97C 5CILL 1M1SA 2PTTA 3IS0X 3QIBA 1I9EA 3JVGC 1RJCA 1JZ2A 1S5HA 4HJ0D 1F6LL 1E4XI 4I3SH 1WAAF 2XZCH 3WFDL 1NKRA 3ZSTA 3HE6D 3WFCH 4NO0D 3L7FB 5EC1B 3V4UL 5AUMA 4YAQA 1WTGT 4LK4A 4YBQC 5EO9A 1RK0B 3D25B 5DEZA 5B3JE 3GB7B 3FB8B 1C1EL 3L3IA 4M00A 3SEPA 4H20H 5MENA 1NC4A 1LP9F 4MA1B 5DDHB 3J8F7 2BSSA 3GKWH 3OBAA 5GGTL 4BKLB 3EYFA 4PRAA 1BEYL 4FZ8L 5EUOB 1BIIB 1A14H 1IGCH 2P49B 5IVZA 1JGEB 2NXYD 3UC0L 5HHMD 3NA9H 1NGXB 3D2UD 3MCLH 3S34L 4XTRC 4PYGA 1TQCB 2QADD 5SX4I 2YA0A 5E0QA 3UTTA 4NZTH 2RHEA 3KJ6L 2BNQE 4Z8FL 4XC3H 1FO0A 5B4MC 4B53A 1FAKT 1A1OB 5KG9B 4EDXB 1QO3A 4ELKB 3BKJH 3DROB 4YWGH 1H3XA 2OMBA 4X8JA 1I1YA 4K7PL 4NKMB 3D69B 3MRDB 1NDMB 1DUYA 1MRCH 4KC3B 1NUDA 2YD3A 4UV7L 1JHKH 4LFHG 4JKMA 3BESR 3CXHJ 3LS4L 5I16B 1NFKA 1PEWA 5FB8B 1K8IB 2APWA 4GKSB 2OTWB 5DD3H 1NMBL 2YSSA 1KIRA 3KYMA 4KZEH 2NTSP 4ZS6D 3CLFH 5D1QB 4HKBA 2W38A 5MI0C 5TFSL 4LGPB 1KYOK 2FDBP 3K80A 5TH2A 3BRDA 1IAOA 4JFXA 4LPTA 4ODXB 3UYPA 4CVXA 1A6PA 5JW4N 1F8TL 2Q86A 2CQVA 5FHBL 1WTLA 2H6PA 2WQ8A 4JO4L 1CDIA 1CL7H 3L3DA 4U2YA 4F9PA 4DVRH 2OQJA 5E5UB 5JW3H 2DQJH 3NACL 2YXMA 4XNQB 4M1DH 3N85H 1A2YA 2LU4A 3EYVA 3GMQB 1BPVA 4EI6A 1QKZH 2APXA 1S9XA 1WITA 3HI5L 4QTIL 3MODL 1KG0A 1ZVHA 5DMJB 3ARFD 2XN9A 1U36A 4DGVH 2EC8A 1RZIB 3SJVD 4LCUB 5JR1L 3DXAD 2AJZB 4HIIB 3NZHL 4UIMB 3BFOA 4M9OA 3UXFA 4F58L 4ONOA 4XX1E 4OF7A 4PJGA 1U8JB 1TJHH 3B9KD 4DKEL 1JJUA 2HH0L 4P9HH 5EU3A 4YHKL 3QQNA 4AL8H 3WLBB 4XCFH 2P5ED 3MZGB 3VXUD 3T0EE 4V1DA 1XH3B 2ICEA 4G8GE 4AT6B 2AV7A 4UINL 3GMMA 2DLFH 1OTTC 2UZIH 3B6SB 3MRLB 3QG7L 4K9EH 4LF3A 4NO3A 3NGBC 2CJUH 4JG1H 3CK0L 2I5YH 1NEZA 1ODAA 2BVTA 3FN0H 3ZDXE 2NY3D 5E2JA 3TCLB 2ESVE 4R4BA 4Y5XA 4JKLA 4U6HB 4HS8H 4IM8A 5GSRB 1SBSL 3LCYA 5EB9A 4PJXE 5D8JH 1T1ZB 2AJXH 3EOTL 3SE4A 1PG7H 2R1XA 3WKMH 3C5SB 3SDXB 1RJLA 3K4DA 3UJIH 3GFUA 3DX8B 4JO2H 1OTSD 4AEHH 1BD2B 4KK5D 1G7IB 4Y4FA 5KVGH 5IQ9B 4PJEA 1F90H 2J88L 4OI9A 4U3CA 5EO0B 2JELL 5DUMH 1WBZA 4Y19E 5HD8C 3MRPB 1EO8H 1CXFA 4M6ML 5HDQH 5EFIB 5EORH 4LSQL 1RZJC 4OB5H 1DQJA 3T09A 3VFSA 3DTXA 1F97A 1CCZA 3QUYA 4Q7DA 5F88B 5ALBH 3HG1D 1OP3K 5EPMB 2AI0L 3JSSA 4NC2B 3TN0B 5HJ3A 1F00I 5IHUL 5DD5L 5IW6B 4NYLB 5FA3B 2EDXA 1IGTB 5E6IC 1S8DB 3GBNH 1VFMA 5GSVA 3LEYL 4IOSD 2W0FA 1NBYA 3C6SA 5HGAB 5CUSL 4L1DA 1CLCA 3BD4A 4H1LA 2IPTH 3DGGA 4PJFB 2YPKA 3MCG1 4Z7QF 1JWSB 3LV3B 3MYZA 4GAYB 5IEKB 4G8EA 1YY8B 1OVZA 3S35H 5HPOA 3QUXA 2ZP0T 1JF1A 1BM3H 1G84A 4FHBD 4HC1H 4IDJH 3O2WH 5IM7B 2VUOA 4L8CB 4MZ3A 5IMMB 5CP7A 3TO4A 2RQ8A 2OI9B 1Y18A 1CGWA 1JNHA 1XR9B 4OCWL 3IU3B 3NPZB 4OM1L 3ZL4L 1YYML 2JF1A 3WNOA 1UCTA 3S8WA 3PIQB 5C0RL 3PHOA 4CRPA 1UADC 2XKUA 4K3DL 4E0RA 4O00A 3GO1H 1C16B 3PWJB 1MPAL 1C5CH 2B1HH 4JANA 4KTYA 1CDGA 2AJ3A 5FGBA 1JVKA 4UB0L 2P8LA 5TDPA 3WO3B 6FABH 1BGXL 1IL1B 3H9SE 4ZUTA 2UY7A 4IHOA 5DJAB 4CUCA 1NMCC 5HHOB 3TYGL 2F53E 4OZIE 1VB9A 3TT3H 4OTXH 4DEPB 5FYJU 1LEKB 1NCBH 1BFVH 4P9HC 5DFWH 4WJ5A 3CSGA 5T33H 2F8OA 2CGRL 4PJ8B 3OXSA 1KN2H 1TJIH 4KRLB 3QT2A 4HWZB 3ARZA 3SDAD 1X5JA 2CO6B 4OGAC 5AG9A 3D87B 1A8JH 2BSTA 2ZNWA 4NQXA 2YXFA 5D1XC 1GYAA 2VE6B 3T1FA 3RI5K 5MEPA 4XP9L 3TWCH 3V0VA 2G75B 2Q3AA 4PRHA 1ZVSB 4K3HA 5FK9B 1Z0MA 4HS6A 3PF2A 5KS9A 1E6JL 1T20B 1J86A 3QULA 4P5MB 5CD3A 1YA5A 4X7FC 4YFDB 2ATKB 1DN0A 2BNUA 4U1GC 4OZGE 1J1PH 4TULH 3TBYB 3IDYC 3LQZA 1EBAA 4D94A 2QLVB 2R15A 1ZLSL 4N0YL 2OP4L 1CFVL 5D7SL 4EEEA 5I1HL 3QUZB 5I1KH 4K94L 4P4KA 1TQBC 4DGIL 2YMXH 3O11A 5I71B 4RX4A 2LTQB 1I8KA 5FYKH 4QXUH 2Q6WB 4I3GA 1CGTA 2YBRA 1MJUH 4NNPL 4BUHA 3NCEB 4KRPC 4HCRH 3ZMRA 5GS0D 3U9UA 4HGWB 4LCCC 3W0WD 4N90E 3D3VA 1IQWL 3B2VL 3ZYJA 3CIQA 5GS2D 3MV9E 3ZKXB 4UT6L 2EYRA 1G1CA 4JPVH 4WEUD 2PUQT 5F3HA 4MJIA 3MOBL 2DBJA 3T4YA 2E7LC 4GRWH 4KQ4L 5TF1H 2VIRB 5DD6B 5IJKC 4Y1AB 4PJBE 4R4NC 4NSKA 1L0QA 1ZANL 2K9UA 3MO1A 3ZDYE 2M26A 2VLJD 4OZFB 1E6OH 2R0WH 1YMHA 2C7UA 4KK8D 3WUWG 1U93A 3VFRB 2R0KH 5CGMA 4QXGH 4YUEL 4TUOB 5J1TC 2J6EA 1I8IB 3IJYB 2V7NA 4HPOH 1H3TA 3DUUA 4YBLB 5IWLA 5F9JB 2DTMH 1RZFH 4ZG1A 1IAMA 3VFMA 3MNVA 5C09A 1YDPB 3EFFA 1Q9KA 2EH7H 3S88L 5L7XH 2IBZY 4HFWA 4JFDA 5E6ZA 4YDLC 2VXSH 3RWFA 1LEGB 3SGJA 1SMOA 4X6CF 5D7LE 4WENB 4OF5A 4FQIL 3EOAB 1YMMA 2A9NH 3VRIB 2VSDA 5IB3B 3BZ4A 3FRUA 4YDKL 5KOVC 2CLRB 3OZ9H 4RGND 3ULVF 2Z93B 2BDNH 4DVBB 3MRGA 4XPFH 2WSKA 3VXRE 5F1OB 2LQRA 5GIRB 4TOYH 4F2MA 4G43A 4LARL 3TA3B 1AE6L 3EJYC 4X6FA 5ANMA 5D1ZD 4KK6C 3CC5A 5MHSD 2YD5A 3GJEB 4U7MA 2XY1A 3SGEI 1A0QH 2L0DA 4NQCD 1W72B 5CSZB 5CMAB 5EDXA 1I3RB 1BVZA 1IBGL 5E2VL 3PJSA 5M95B 4BK4A 1BZQK 2XA8H 2Z92B 3MTRA 4QO1A 5EU4A 4MQTB 4QY8A 4QEGA 4HF5L 2Q1EA 2R1WA 3K2UL 1QZ1A 1N5AA 4PJ9D 5IROA 1WC7B 1H3UA 2NYYC 1P53A 3SE3C 5DJ0B 5KANG 3FQUB 3OXRB 3M07A 3B9AA 3QZWB 3QEHA 5C0IA 4LEOB 3RPIB 1TVDA 3I02B 1NGZA 4NM8L 2V17H 4FXKB 1YPZA 3MNWA 4LSVL 2Y36H 3N1FC 1HNGA 1AD0B 3QIWC 4LVOB 4MJ4A 2H45A 5DFTA 3VXSE 4DQOH 3X14A 2H1PL 1QLEH 1RFDL 1U8MA 2J5LC 4YHNB 3UP1A 1U8QA 3O4OC 4HUMB 1TETL 4HEPG 4R3SA 4L3AA 5I1EL 5E4EC 3H7BA 4XC1L 2X1PA 4FFZH 5DJXB 1MAML 2CDEB 3GSVB 1BECA 1YYLL 3TYFB 1KEGH 3GJFB 1KIPA 2A6JB 2P42B 1FL3B 1KCRL 4JRYE 4JKPL 2IANA 4OF3A