1LEKB

Crystal structure of h-2kbm3 bound to dev8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lekB00
2D7MA 5L6YL 2OQJB 4PJDB 4PR5A 5GQBA 1UH2A 2W0PA 4APQB 4JY5L 1SM3L 3PGFH 4OM1L 1U8OB 3CMGA 1OWWA 3H3KA 5FA4A 2YOCA 3DPBA 2Q1EA 3AM8A 2FDBP 1MOEA 4XI5C 3KPSD 4XPGL 1KULA 4BH7B 4FQ2H 3D18B 1FC2D 2HH0H 4XVJL 1WFOA 4YO0A 2DS4A 5T1KB 4QRRA 2XTJD 5GS1C 1OCWH 3RWIA 1MFAH 3RAJL 1MHEA 1AFVL 2H26B 3UTTA 1PLGL 1X44A 1SYSA 1JTOA 3HG1B 1XZ0B 4NQTA 5HI3C 2FZ3A 5IQ9A 4UNTA 4NRXB 2EYSB 4Q9CA 3MRHB 4C56E 4RFNC 3RWFA 1AGDB 4D0BB 5IT2L 3UAJC 1RUQH 3E8UL 4HUXA 3QSKB 1GOHA 5F21B 2FR4B 3LN5A 1C5CL 3U0WL 1DBJH 5EORL 3FN0L 3WD5H 2HLFD 4HWZA 2K7PA 3MCLL 4Z7QF 2DTML 2APTA 5HHOA 5FM5M 3EDJA 3QNZA 3TBVA 2X4OA 5DUBB 2NW2B 4X6DB 4Z7VE 4QHLA 2QV2A 4JG0L 4H20H 2ATKA 3QJFB 3HC4H 2YC1A 5I17A 5D1XB 1XF4B 1AKJB 3WXVL 1BFSA 4IMKC 4MNQD 1CTOA 2CIKA 3UTPE 3W39B 1I8IB 3KPOB 1T22B 2ZSVA 3KG5A 2ZG2A 3QHZH 5HYJE 3ZYJA 5KS9B 3MRNA 5DD3L 1QSEB 3WFHA 2DYPA 5CEZL 5CCKH 5CSGA 4PJ7A 4KPHH 2AK4D 3AREB 5F1OB 4FXGB 4QRSA 1JVKA 2ICEB 5F7DA 2ENYA 4NBYB 3GEWB 4P5MA 4ZOBA 1MCLA 3O41B 2VZOA 1WBZB 4NKIL 3I75B 1NCNA 2J5LC 4C57C 3WLWD 1UJ3A 5IG7A 4HK0B 3VXSB 1J0JA 1JZ5A 5I1AA 1KCSH 2VDOH 1A4JA 1NC2D 1T1ZA 4RA0C 2I07B 3MRPA 3WFCL 4DWHA 3IDYC 2HJKA 3MA9L 1CT8A 4WHDA 2NNAB 3O6MH 3IRZA 3WNKA 3CFKB 2EDWA 1AO7E 1P9MA 4BZYA 2XACC 1TZHA 1DP0A 4Z7UE 3ARFD 4M4PA 4PJBA 5SWSB 4MCZB 5CZXC 3D0VA 2FX8H 2CPCA 5HHMB 1B3JA 4YHZH 1T7VA 4MS8C 1XIWC 5I1JL 3MRLA 1I1AD 2OL3H 1WZ1H 5FOBA 4OZGE 3SJVA 4JRXA 3UP1A 2LTQB 4LU5L 2AXGB 1A3QA 3CFCH 5L2JB 2DQHH 1JUFB 4MA7H 4WW1B 5LAXB 4LARL 1JGUH 4QHNA 4P2RD 4ZXBD 3TN0B 3QNYA 1T89C 4EQ3A 1NCAH 2VR9A 3GHEL 3PWVB 1VADB 4V1DE 2IQAA 1W0VA 5J6GB 4D9RE 1U8MA 5F7YC 3L1OL 4LGSB 1IC5L 1RFDH 3LRGA 1YECH 1OPGH 1ZSDA 3TEUA 4XH2B 4PY8I 3OKMA 4V2BA 5JNYB 4Y4HA 5ILTH 1V3KA 2X1OA 3PNWB 2A6IA 1NPUA 4KFZC 1UB6A 4PJXE 5CBAA 1YZZA 2IJ0C 3MLYH 3R0MA 3VXUA 2FLRT 3WUZA 5F3BA 3FOLA 2BXYA 3JVGC 4P5TA 2C3GA 2A9MH 4I48A 4M62H 3S35X 2FJGA 4NT6B 3MREA 2FJHA 3HAEH 5ICYB 4Q2ZA 2AJVL 4IRZH 4AM0A 5KJRH 4Z95L 1M4KA 3VGBA 4LNRB 5JDSB 4L8SA 2X4SB 1CR9L 3BO8B 2VE6A 3GRWL 5A1AA 3QWOB 4XBEH 1OT2A 4Y4KC 2OL3A 3ALPA 1YEDA 5CINL 3U0PB 1KTDA 2OSLA 3FB7B 1N5AB 4X98A 5GGTL 2CR3A 5DD5L 3BN9C 3LB6D 5JPNB 4AL8L 4P3CH 4CU7A 3UBXG 4MXWH 4QWWD 3QI9C 4NNYB 5GS1A 1AGBB 5HVGB 2Q3AA 1UEYA 1P5VA 3K8KA 3WNPA 1M05B 1QEWA 1D9KD 2VISA 2Z92B 3D69B 3FMGL 3FO2A 4GW1A 4OJFL 1NGPH 1OTUC 2ERJC 2VDLL 3CPLB 3V5KA 4UBDC 5GSRB 2EDNA 3GB7A 3R1GH 4CUCA 1HOCA 3D0LA 2IGFH 1EFQA 4UIMA 5C0BD 4U1KB 2VLKB 4PS4L 4ONGL 4CDGC 2IBZY 2EH8H 4J3VA 5TQ2H 3IFNL 3FO0L 2ZSWB 1NDMA 2QQQA 3BZFA 3CX2A 4NWUH 4N1HB 3S7GA 3HAEA 4NRZB 2FB4H 2VXTL 1SHMA 3QWRA 1BFOB 4OZHF 5I9QB 4PRIB 3B2VL 4ODVL 5JLZA 4I0KA 2EO1A 3ZHDA 1BD2D 2J1KA 4IRSB 4WTZG 3W9EB 3T3MF 3U9PH 5GGUB 1D5MB 1L7IL 4YHPB 4M6MH 2BDNL 3K2UH 3O8XD 5CP7A 1I8LC 1EO8H 3QH3B 3ARUA 3FFDA 1TITA 3PV7A 5I18H 3O0RH 2P5EE 1JWMB 3VH8A 1VHPA 1W8NA 3ORJA 3JWDC 3QO1B 1ZEAL 3HUJF 3IDMB 3T0BA 4X99B 4RWYH 3MROB 2I5YH 2NY0D 5D7SH 1ZLWH 4R90L 3MV7D 4DQOL 4KI5C 1D5ZA 1QUNA 2I24N 3VG0H 2PCPA 4G6JL 4H5SA 1I3VA 3HHRB 2R0ZL 1QKZH 5C0IB 2FGWL 5ESQA 3RZCC 4EN3D 3ZKQD 3MRKA 3PP4H 2E8YA 5A16A 4R7NA 4PRAB 3FQNB 3U30C 3N1FC 3BGMA 3FQWA 3RI5F 4U0RB 4WTWA 4ESKA 1A1MA 1NAKH 3JWOH 2EIBA 1U2CA 5D4QA 3WEXB 3QCTL 3DX7A 1IL1A 1T0MB 1UXSB 4IJ3B 1BIIA 5F6HI 3BQUB 1XIWA 4Y2DD 5IVXF 5JIHA 4PRHD 4ZDHA 1KSRA 1EUTA 4P3DB 3ARBB 4EDXA 4GFTB 1QRND 3ECBA 5CJQL 1TZIA 3ARTA 5MI0C 1H15B 3BPCA 1JRHH 2NMSA 3NZ8B 1WITA 1GGCL 3OV6A 1FVEB 1DQML 2GT9A 3MUJA 5C0DA 3BP4B 3PQYB 3S5LB 3TO2B 3M07A 4RAHA 15C8L 1MHPH 2R1XA 5CEYA 4D0CA 1VB9A 4UOJA 2ZPKL 2XIDA 3IFPB 1EEYA 1YEFH 1SVCP 2WQRA 4XPAL 1J8HD 1H0DB 4IHOB 2B2XL 1WT5A 3WDJA 4JPIB 3DBXA 4TQEH 4Y4FD 1P6FA 2EE6A 5FGRA 3T2NH 4MSWB 1U6AL 2CKBL 2F8OA 4H88H 5B8CC 1NEZB 2DM2A 5GGVL 4XNXL 4NQUA 2XYCA 1Y18A 4PJHA 5D71L 2ZUVA 5C3TA 1YYLL 2HFEB 2P44B 1HZHL 3HRPA 1FL3B 3D9AH 3RUGA 5HVHB 1FZMA 1G7LA 2HWZH 5F6IB 1WWCA 4KKCD 4X7SL 4E41D 4FS0A 1QRKA 1A1OB 4CVZA 4MNGE 4BQBA 5B38A 5C09A 1OAUH 5EUKB 4Z8FL 5F9OL 3ZZ1A 2LV4A 4I2XB 1MCKA 1F97A 1ORQB 4NNXB 4IRJB 1WGOA 3VGFA 3H9SE 4Y89A 2H45A 1U8NB 2CRZA 4UV4H 3CSYA 4D94A 3QFDA 3NCMA 4KWUA 5JW3L 1T4KB 4Y4KA 3ET9F 4J7RA 4I9WE 3U46B 1EHLH 5CIPH 5EOQH 2DIJA 3BEWA 3EJJX 5FDWA 4NUJA 4GKNA 1U3HB 4U1SB 1WCBA 2BNRB 3WKMH 2PTTA 1XEDA 3V6BR 1VGKA 4JKWA 4CDHA 2VITB 1NCCH 1A4KA 5C8JA 3QIWB 2MHAB 3KJ4C 1UYWH 2IG2H 3MRBB 5E2WH 1FPTL 3U7YH 5IHLB 4OZFG 3TYGL 3PL6D 1XF5A 1EHAA 4MHHG 3TCLB 2AJUH 1N3NB 4JDVA 2QHRH 5EWIH 1EMTL 1DVFC 5EIIA 4EI5C 1A5FL 4W6WB 2WINB 4Y16A 2IH3A 2X42A 3UTQA 4LSUH 25C8L 3L5XH 5K9JL 3TJHD 2XN9E 3OG6B 3O81A 1FNAA 3M8OH 4NQVB 4X0KB 2DQEL 5DQ9A 4JO4H 5FGCB 2D7TL 2ATPB 1A0QH 1MCOL 2YRZA 5EO0A 1X3DA 4I13B 1XGUB 2WIIB 1GGYA 3SDXA 3TVMA 4UB0H 4MZ2A 5DTFA 5J7CC 4JQIL 2EE9A 4ZO9A 2AEQH 3FAWA 3T0EB 5DMGC 3S34H 1RU9H 1MFEL 4F7TB 1TQCC 3QUZC 1HSAB 2KUTA 2OR9H 3OPZH 1AC0A 1HI6A 2EICA 2P1YA 3HB3C 3DX9A 2VLJA 4RRPG 4OUUA 3MRJB 4C59B 1A3RH 1FGVH 1I8LA 3QDGA 5CIPA 3H7BB 2V7NA 5D7KE 4PJFF 3GMOB 3HRZB 3VFWB 3CH8A 4P2YA 3EZJB 1IT9H 3BD5A 4I0PB 2CUHA 1G7JA 3INUH 4FFVD 5IB4B 1WZKA 1KCUH 1OAZH 4GH7B 1IMHC 3PWUB 2YPLB 4NBXB 1RUKL 3D39E 1S7TA 1KOAA 4GW5A 1W72B 4M61B 3IKCB 1G7PA 4KQ3H 5IHUH 4K3EH 4NJAH 4OV5A 3KLHC 4KTDH 3Q6FA 4TNWK 3SKNB 4UTBL 2P4AB 1MWAL 5CJOH 2OBGA 3RZCA 4OZIE 4PJIB 4QHMA 2EDTA 4F33B 2DM3A 4BQ6A 4FTVA 4POUB 3RBGA 1AKJD 3GBML 4GG6A 3L5IA 2YK1L 3AB0C 5JQ6H 3KPPB 4ZUWB 1JGLL 5E94A 3MRQA 1RI8A 3UTOA 5E8DL 1IGFH 1SY6L 1HQRB 3IETB 4EI6B 1QSED 3O2DL 3DLQR 2P7TB 3VXMA 3ARED 1KC5L 2F8VA 3E3QC 3IDNA 1N5YL 2IADB 3EO0B 5DD1H 1DBKH 2FBJH 4ONFH 4XNMA 5TE4H 2E9BA 1YYML 4PGCB 2IANB 3NMEA 3OGOE 2H8PB 4U7KA 4DEPB 1G0YR 5I8CA 2OJZL 3QQ4B 4O5LH 1HK6A 1QA9B 3NH7L 1PJ9A 3VXSD 3WFEL 4M5ZL 3NCJH 1RJZA 2IQ9H 5JW4Q 3G5ZB 4IS6A 1BVKA 5E5MB 4K7PH 2XKUA 4HT1H 4AQOA 4YDLB 1JFQL 4PGDB 2A73A 3BSZH 1GPOL 3L5HA 4AG4H 3QIBA 1E4JA 4HUNB 1S9YB 2A6DB 2XPGB 3O2VL 2PNDA 4HIIA 3BIKB 1MLCA 3S8WA 5CEXA 3RWJA 4FXKA 5CKAA 5SWZD 5F9JB 4R4FH 1FNHA 1A64A 1NAML 2OTUB 3G6JA 4TPRL 3BZ4A 3MBXH 3L3GB 5BJTB 5JHDA 4JO2H 3VD5A 3GMLB 3FB5B 3TZVB 3MLXL 4JGJA 4X8JB 3FCTA 5E00B 1CDUA 3SO5A 3VDAA 1IQWL 3BRFA 4UQ2B 4ODUB 2YUZA 2QQNL 1BGXH 3HZYB 2JB5L 5K9OB 4HH9A 1IM9B 4XAWH 4PJ7E 4GS7C 4Y1AA 4YR6A 4HKBA 1Z0MA 1NGZB 3W2DL 5E7BA 5D7JA 1Z9SA 4ZTPH 3PHOA 1F6AA 2HG5A 4WHTB 2RCSH 4KKBC 1VDGA 1PZUB 2X4QB 1BQUA 5D2LA 3ARVA 4ZOCA 2ZCLH 1DVFA 4UNVA 4X5XB 3FO9B 4G7VL 4EI5A 5IJVA 1WBYA 4H8WC 1YQ2A 4NM8L 4JCLA 4XWGL 4ZFOA 1FYTB 1G9ML 3NA9H 4EIZC 4JFDB 3WL9B 3ULVD 4UDUB 3I3DA 4LCYA 4CADA 3KDMB 1MF2H 3OKYA 3ZDYF 5CSBA 4S1DD 1C08B 3R8BB 2A2QT 3MACH 3EDFA 3OWEA 1JZ2A 2RBLA 1G7HA 4K8RD 5IMKB 4JKLA 4RGOH 3RWDA 3ZE0F 1KCLA 4H25A 2VLRB 3Q3GB 4RMTA 4X4XB 4GUPB 4KHTL 4XHQA 3MCKB 1TJGH 3LIZH 3BH9A 1S7RA 3QUZA 1SJHB 3QWQB 2ILLA 4N8VG 3IFLL 2GFBB 4L8BB 3ETBF 2HLAB 5IB2A 4HDIA 4PB9L 3WLBA 4HV8A 3SGJC 3SO3C 1Q1JL 1LGVA 1T6VN 1LO0L 2VZSA 5DC9B 3MYJB 3V4PL 4TUKL 2EIDA 2Q86A 3DVGA 4AJ0A 1G7IA 2D7PA 5T1MB 3FQTA 1TTGA 3W5MA 5EU6B 1PQZA 1JNJA 2F54B 3MYZA 5KSVB 3WDIA 2ADFH 1PVHA 2ORBH 5F7NC 2QADD 1KJMA 3IDIA 3CIQA 1C12B 2APWA 1RV6X 5D1QD 3OKOA 2HTKD 4LLYA 2GTZA 3OXRB 4LBEA 2J2ZA 4ZO7A 1A7QH 4RX4D 3L3DA 3S6CA 4QTHB 1VGEL 2Z8SA 2O5ZH 4G8EB 4N1EA 4IRSD 3ARDB 3F12A 3OBAA 4M7KH 1NCWH 4YBHA 1EX0A 1OM3H 2YXFA 1YEGH 3X13B 4OLYH 3LZFH 4LPYA 1NC4D 2DQCH 1NFDE 4RGNC 3PJSB 1T3FB 2WP3T 1C7SA 5EBWA 4QGTA 4XBPB 2B5IB 3ZKXC 2PXYA 3PWNA 1JNHB 2YZ8A 3CZJA 1FNEA 2WW8A 4JFYA 5JORA 3OXSA 1HHJB 3G9VA 2R1WB 1RZKC 4MVBC 2NLJA 3ZHLA 3TO4A 1OGTB 1NUFA 4A6YL 4K9EL 4DW2H 1K2DB 1OAYH 3GI8L 3MV9E 4PB0L 1KB5L 3SKOA 1IAKA 2ZUQC 5GGQH 1DZBA 3TIDB 2DI9A 2KPNA 3PP3H 2BNUA 2ZP0T 5JMOC 5HHNA 2ESVB 3B5GA 4JM2A 5CWSB 3BQUD 3MRRA 1H3VA 3ARBD 3WN5B 5SV4A 5DMKB 2GCYA 3NPSB 4QRPB 5D5MB 2DLEA 5HDBE 5FYLL 2WK2A 1KPUA 2WWMD 2GY7B 4G80B 4PRDA 1Q9WB 3BZDA 1MI5B 5I73C 1SJEB 2PW1A 4PLKD 1PAMA 3A6CH 3VXPA 3V52H 5DJ0A 5FGBC 5T1DL 3OKKA 3O6FA 2Z91B 2AV1B 4K7PX 1YQVH 3OKLA 1TZGH 4PG9B 1R0AL 3RKDD 4XP9H 1QVOA 1YY9C 5D72H 1ZLUH 1PZ5A 1H3UA 4M6OH 1EJOH 1XF3A 2XXMB 3UBXB 3U2SA 4PJDF 5IQ7L 3LRSB 5ESVB 3H3BC 3MXVL 5IVZB 3V4UL 4YGAB 4HXAL 5IR1B 5E2TH 3RY5A 3HLAA 3SN6N 4LLQB 4HIXL 4L3ED 1MFDH 4N0UA 4NDMA 1FNGA 2OLDA 4M6NL 5DLMH 1V7NL 4P59L 5EU7E 1RHHB 5BRZD 4GSDH 3NIGE 2O61A 2D3VA 2DB8A 4LMQE 2Y5EA 1KENL 3GMRB 5DS8B 4CRPA 4P9HH 2AGJH 4MJIA 4N90E 2R69H 4PLJD 1HN1A 1HSBB 4PV9A 3MLWH 5TGBB 1U3HD 2BNRD 3D2UA 2R8SH 3KAAA 5C0ND 4HWBL 4HS6A 4OF0A 5LXGL 4XCNB 3QIWD 4FZEH 4ZO6A 4JFEB 4RFNB 3GMPB 1I7RB 4FN0A 3P0VL 2DICA 4X6DF 4Q9QH 4NHCH 2AW2A 4QEGA 1ES0A 4JZJA 4WNQB 1K8IB 2GUOB 3HI5L 5C07A 3SGJA 1Q9KA 3MGTB 2HTLD 2F5BL 3U9UB 3T1FB 4LPVA 4LRNH 4XP4H 1A47A 4BK5A 5KS9F 4XB7A 4OM0L 3HPLB 4KVNL 4DGVH 5KOVC 5C0GA 1IGML 5GSVA 3MUGA 3B9KD 4YH6A 1OF2A 3SKMA 2BHUA 4YDKH 3DOSA 4Q0XH 4YIQB 1QBAA 3VWKA 4KZDH 3VRLF 3CVHL 3VFRA 4OKVB 5JDJA 2GTWB 4OFVA 3Q5OA 4X7CC 1LMKA 4M7LH 4X6CA 3T0ED 1B2WL 1ZWIA 1JZ6A 1U2HA 2FJFB 2DQTH 3ZDZF 1U42A 4CNIB 3QPQD 2EIEA 1KELH 5C09E 1LE9B 1LVEA 5CSZB 5HHQB 4PJ5A 2GYSA 3D3VB 2J5LB 3HZMA 4I0PD 5D6CA 4KDWA 1UACL 4OF6A 1DBBL 1NMAH 3RVUD 4A2MA 2IALA 4L4VB 4FQJH 4HIHA 4XVTL 2VXUL 4JJ5A 4YLQT 5ID0A 1FLRL 4X4ME 2HVKA 4O51A 2DI8A 4UDTB 3IDYB 2VAAA 2NX5E 5C1MB 5KZCB 3TBWB 3CFJB 4TSBL 3FFCB 4HBQA 2A9NH 2JIXD 3RL2B 1BVLB 3QJHB 5I2IB 5BZDA 1H5BC 3M17A 5FYKH 4Y5XC 4XCEA 1QLFA 1KN2L 4JCMA 5LWYL 1E6OH 3HN3A 1U8HA 3NFPA 1PD6A 1UA6H 2BFVH 3WFBL 1UM4L 3BJ91 3RDTA 4XPTH 1S7UB 2CDGA 4XVSH 1BM3H 2G75B 2DIAA 3I50H 3MJ6A 1JGDA 2K3TA 4G8GA 3OJDA 3SQOH 3U48A 4F7MB 2XZQH 3DMMC 1T5WA 3QDJE 2FECI 3LV3B 3B43A 4YFDB 4WCYL 2VWEE 4F37K 3THML 12E8H 2QQLL 1O5DT 2IAND 2EC8A 4JR9L 3FT4B 3NBNA 5E4IA 4NQCE 3T4AA 1XGPA 3U4EA 1S9XA 1EIBA 2Q7YB 5E8OB 5AD0A 4EDWH 2ITCB 4U6HB 4L8DB 3WIIH 3GMQB 4GLRH 3RWHA 4AMKL 1DJSA 2EDYA 1WFTA 2UUDH 3HS0B 2QQKL 3T4YA 1NLDH 3GIVB 3O3DB 4XC1H 1WWBX 3HE6B 1U95B 3WXWL 1RJLA 2Z35B 2APVA 3GZKA 4ERSH 1PY9A 1RJCA 2IPUG 3VI4E 1MCQA 1ULVA 4NQDB 4OZFB 1ZE3C 4XZUB 4FQLL 1F11B 5I6XB 1V3JA 4HUMB 2HJLA 3MNZB 5E4EB 3I6GB 3GO1L 5INCB 3S35L 3PV6B 4IMLB 1F3JB 1A14L 1TENA 5H94B 2AQ2A 4RBPK 3MLVH 4ZUTA 3SDCC 3H9HB 4LCWD 4LCUB 2V2TA 1NUNB 4BYHA 1ITCA 3O4LA 3LSOA 1G9EA 2VR4A 1UADC 1X7QB 1I7TA 4YDJB 1YEHH 1IM9D 1FZOB 2ADIA 3FQRA 3S96B 1R5IB 4KKAD 5JOFA 1A7NH 4QRUA 5CILL 3T0XA 5HJ3A 1M7XA 2V6HA 1B4JL 43CAA 4BJLA 5IMOA 2NY3C 4WO4C 3TWCH 3OR6B 3KPSE 5EH1A 2Z31A 5KSBE 4GAGH 5C0AB 1G84A 3F7VA 3DXAB 5D7IA 4R9HA 4IOSD 1CF8L 4KUCD 1LP9B 1NLBL 1ZT7A 4N0FB 3TV3H 1HXYB 3ZMRA 1FYTD 4YZFF 4JFDD 3R06A 4OCSL 5EFIB 5F96H 3RNQB 1JGEA 4OUOA 3T8XB 3ZE2F 4M3KB 4R8WH 5EU5A 1FL6A 3PGFL 5H35B 4JFZH 3TT3H 1R6VA 3HNSH 3QRFM 2JJTC 1OAKH 5IFHH 2FATH 4X7TB 2VLRD 2WAHA 4OFYA 1J8KA 4FQ2L 5E6IA 2X70A 1OCWL 2BCKB 3HCVB 3F7RA 3D25B 5FUOH 2VXSH 4Z77B 5LBSH 4PJGB 4MNQE 4PJEE 4WUUB 1T1XA 4HULB 3I84A 3G9AB 3RIFF 2HN7A 2BMKA 1RUQL 4MQ7B 5FB8A 1N6UA 5IB3A 3VWJA 1CCZA 3QXAB 1DBJL 2AK4E 3C8KB 4G9DB 1C1EH 3WD5L 1OP9A 3ZSSA 3RY6C 3KYMA 2F54D 4BUHA 2ARWA 2B0SH 1I85A 1Z3GH 4H20L 4ZTOH 2A0LD 3HC4L 5DMYA 3P40A 5GGSY 2NY2C 1H5BA 4WJ5A 3LH2H 4F57H 1HYSC 2WP3O 3RBSA 1I1YB 5F7FA 3ZTNH 4DFHA 2PKDA 3QHZL 4OQTH 3ARDD 4RQQA 3IU4H 1AR2A 3EGSA 3WHXA 1F2XK 5CCKL 4KPHL 4M93B 5C0EA 5FO7A 3I6KB 1DUZA 3S36H 1CN4A 1UWXH 3IAQA 4C56B 1YNTA 5CEZD 5JXEA 3ULUE 4XWOC 4X6EB 4DKDC 1DQJA 4NQEE 5IVNA 2A6KB 3V6FA 1NSNH 4M1DH 4FFWD 3IVKA 3MNWB 4HKXA 1SMOA 5F88A 1UFUA 3S3JA 5A43C 4CU8A 3T65A 5I76A 4QRQB 3NABH 5B8CB 2Y5TB 2VDOL 4LASH 5DURB 1EVTC 3RIAK 2M2DA 5DJ6A 3H0TA 4OLXH 3O6ML 1I9JH 4C54A 1IKNC 4P2RE 3BKMH 5JPMA 1DE4B 2VDQH 2ESVD 3T09A 3GSQB 2FX8L 5JW4N 4LVOC 3OKNA 2VZ1A 1T6WA 4D0DA 3REVB 1JZ7A 2VIRA 2OL3L 1WZ1L 2GJJA 2IPKA 5E8PB 4PD4K 2HFFB 5DDHA 4H1LH 1FIGH 4L4TE 1X5YA 4JPKH 4KDTA 4ZS7H 3WFDH 1EXUB 3CFCL 2DQHL 4MA7L 2MMXA 4LKXB 4OQTA 1MI5D 4NO5A 1JGUL 3RNKB 2ICWA 5DSCA 4NO3A 3V5HA 4HZLB 5DO2C 5I1HH 1NCAL 4M4RA 4HGWB 4JDTH 4DCQB 2A77H 1KIRB 1T66C 1MRCH 1JPFA 1RFDL 1YECL 1OPGL 3G5YA 4GRLC 2ED7A 1KYOK 3C5SA 5ILTL 2L0DA 4Z7UB 2HT2D 2R29H 3QDAA 3QUMB 1AP2A 5ACMA 4BZ1H 3C6LB 5BV7C 3SGDH 3VI3F 4NO2A 1I4FA 4WWKA 1FN4B 1HHHA 1JPSH 2ZOKB 4JG1H 2H41A 2VN7A 4U7SA 2EE2A 3MLYL 1J86A 1KNOB 4OZGB 5JO5B 5J9PA 2A9ML 2ZCKH 4PBWD 4JN2B 1J1PH 4M62L 1A22B 1XGTB 2YXMA 1IAMA 5KJRL 5C08D 3U82B 5HHPA 4PTUA 4LFHG 3I3EA 2GSIB 2VWEC 5IVOA 3ARGD 4JB9H 1OOAA 1T21A 4V1DB 4XBEL 3P73A 4H26A 3CH1B 3LKRA 1HXMA 2NW3B 1ROWA 2CKNA 3FZUC 4H1LA 1OAXH 4ZAKC 4IOFC 2VABA 3PIQA 4FQIH 4OCXH 4I5BB 5DJCA 32C2A 4P3CL 3V5DA 1PX4A 5HYFA 3F6IA 1SEQH 2CR6A 1ED3A 4MXWL 4PJXB 4ZUSB 1VPOH 2H2PD 2EDRA 3OKEB 4M1CD 4WW2B 2FYYA 4PJIF 4DZ8B 4GMTH 4RFOH 3V7AG 5EU3A 5FO8A 3O45B 4DVRH 3HE7C 3K81A 4NGHH 1VEOA 3R4DA 1U8QB 4NP4H 1J1OL 2KL6A 1XT5A 4PJ9C 3LKPB 3GJEA 3SKJH 1OSZA 3VMPA 1CFTB 3MXWH 2FSEA 3HAEG 2C7UB 3R1GL 5DK2B 2R2BB 5GISH 3RY6A 2IGFL 2YN5A 4BSWA 3DRQA 4DZBA 3NIFF 1KLUB 3EHBC 4PRBA 2EH8L 3SDAB 5TQ2L 2IBZX 1MAJA 2YD5A 2BY2A 2EDJA 1LD9A 4P23D 3SE3A 3MV7E 2FB4L 2X4PA 1CICB 3VH8G 1A9BB 4P2QE 4MX7B 4E42B 3T2QA 2VQ1A 5E1AA 3DI3B 3U9PL 4M6ML 3K2UL 2B7DT 3QO0A 3D3VD 5FO9A 4RCAA 4L5FH 5I18L 3O0RL 3B3IB 4KJYB 2VLLA 4POYA 1E6JH 1TCRB 1KJVA 4BZ2H 2DWDB 4CN6A 2C5DC 4BSVA 2BVOB 4RWYL 4LPCA 4O02H 5IEKB 2I5YL 2DQFA 5D7SL 1CFSB 2FBOJ 2JCCB 5KSUA 2D31A 4JFXA 3VG0L 3P0YH 2XTJC 1M6OA 4JRWA 3PXHA 1QKZL 2C1OA 1BZ7A 5GS0H 4MD0A 2R0KH 4ODTH 3PP4L 3DI2B 4ZPTA 4OV6F 5LQBH 1EBPA 4JZNA 2OP4H 3MBED 5ERWB 3MR9A 3FO1A 4K2UH 1RZIB 4ORGB 4XX1E 3L9RB 5HD8D 4RMWA 3GHBH 1NAKL 3JWOL 4JZOA 4XMPH 3MOBL 5F89B 3GIZH 2HLFC 3S36X 1J8HE 1OTTD 3V2AR 4HIJA 2ICWJ 5KOMC 3FB6B 2BVPB 2P5EB 4EVNB 1R5VA 5A2IH 5AZEH 4E0RB 5JTWA 2CD0A 1JRHL 3MRGB 4KKNA 4X9GA 5FKAA 1ACZA 4GS7B 1MHPL 4F3FA 4E41E 2DOCA 5GRUH 1E28A 4W6XB 1ZHLA 1YEFL 1L7TH 2O5YH 4JFFE 2IAMD 1JNNH 2QLVB 1FBIH 4TQEL 3WCYA 2Y07H 3IXTB 3HE6D 4PP2A 3T2NL 1KEMH 4HPYH 4FA8A 5B38G 5IFJB 4OZHA 4GG8A 1A6AB 1A7BA 5T3ZH 4NQDD 3WLWC 4YBLB 5BVJA 3MRIA 3BIAX 1D7FA 3WS3A 3HZVA 4LHUA 3D9AL 3ILQD 5ITFA 3HR5B 2AV7A 1X5JA 2HWZL 3DO3A 3QUXA 5DHYA 2W38A 4JO3H 5IBUG 2SEBA 4X8XA 5J1TC 3SE4A 4OFIA 3CMOH 3L3HA 1M1SA 2Y72A 3DSFH 2QEJA 1OAUL 3KPRE 1S78D 4WHCA 4XNUH 3S9DB 5BQ7A 1QFWI 4D9QD 5L8LB 4XP6H 1Q9LA 2R1YB 3HUJA 3ROLA 3ARFC 3FL7A 1T1WA 2DKMA 2W9EL 4UV4L 4MD4A 3FTGB 3W9DB 4KJPD 4ZFZA 5DZOA 1X6LA 1N6VA 5EOQL 4RAVB 5TH2A 5DA0B 1I1AC 2H32B 3WKML 2P8PB 4YXKL 1VERA 1K6QH 1FFQA 1R3HA 1YNKH 1NCCL 1UYWL 2IG2L 5E2WL 1S7QA 2CK0H 3U7YL 4KV5F 2ZKHH 4ZFGH 4JY6B 1TETH 4ZXBC 2AEWA 2AJUL 3GSNH 4MAUL 4KU1A 4U6YA 4EKXA 1ORSB 2QHRL 2ARJQ 1IEAB 5EWIL 1MVUB 1U8LB 5BXFA 1RK0B 3ES6A 4MNGB 5IVXA 1JTTA 1URLA 1CXFA 4M43L 2OI9C 3D48R 5C2BH 2CO6B 4LSUL 3MNVB 3L5XL 4NHUB 3O3AB 4LVNB 3IFOA 3M8OL 2E5EA 3SCMA 1YMHA 3QQ9D 1S7WB 5J89A 3A67H 3CK0H 1JBJA 2NZ9D 5F97E 4JO4L 1UH3A 5DJAA 4P4RB 3GKZA 1A0QL 4RWHA 4OLUH 1B9ZA 4WFED 5DJDA 1FVCB 2V5TA 2CDEA 1LO5A 4GRWH 1KG0B 1IM3A 1S9KC 4ZPVA 3QFJE 3CDGA 2R0LH 1U58B 1SM3H 4HX1B 4UB0L 3UPAA 4UUJA 3MCG1 3RTQA 2DKUA 4Z78B 3BDBA 2AEQL 4O4YH 2DQUH 1RU9L 3S34L 1MY5A 2OR9L 2EDKA 3C5ZB 3ILPA 3BP5A 3OPZL 3UC0H 1A3RL 1FGVL 4WTXA 4M1GH 5C0JB 2AQ1A 4NYLB 2XFXA 1WAAF 2GIYA 4WUUD 4PGBA 3H7LA 3DV4B 1IT9L 3VXOA 5LGKA 2WSKA 3INUL 1FZKB 3EYFB 1QSEE 5F1NA 2XN9B 1JPTH 3LB6C 1KCUL 1OAZL 4OCNC 2YUWA 5CHNB 5EOTB 2XWJB 4DGYL 1NL0H 2EKJA 1DN0B 4KQ3L 4MAYB 4NRYB 3JSSA 4K3EL 4NJAL 4QWWC 4KTDL 5IHUL 1CDHA 4WHYH 2ZUQB 1XF2A 3GSNA 5CJOL 3VXQA 1ONQB 4YPJA 5GRJH 2RGSA 1FG2A 1N8ZB 2PETA 3QEUA 5D5MF 5E8EA 1CXEA 1D9KC 5CS7A 2B1AH 2C3VA 3QQ3B 2YPKB 1U8IB 2EKSB 3RKPA 4ODSH 4YBQD 3PABB 1IGFL 2DL9A 4CGTA 4R96A 3RGVA 2HKHH 4F2MA 4R4BB 1T1YB 2W92A 1HILA 1T80A 5IHZA 5LJYH 2X4RA 3MLZH 4G9FD 3JWNC 5DD1L 1DBKL 2FBJL 4Z9KB 5SWQA 2FHBA 4ONFL 5DD3H 3VE0A 5TE4L 1HINH 3L7FB 4XXDB 2XWTA 1I7ZA 2ICES 1LK3L 3LD8C 3D39B 5DRNA 2JK5B 2E6PA 5LGJB 2X9WA 3VW3H 3O3BB 1ZA6B 4J8RB 3U0TB 4ISVA 5SWZE 1DUYA 3D85A 5AZ2H 4OZIB 5CD5D 3NCJL 2IQ9L 4MGXA 5A3ID 3O8XC 4MJ5A 5D93C 1JK8B 1ZGLB 1WVZA 3UYPA 4K7PL 5DURD 4WV1C 3PUCA 4HT1L 3L3OB 4NKMB 2C1PB 3TBSB 2XKNB 2PTUA 1I7UB 3BSZL 4ZFOL 5A2FA 3O9WA 4AG4L 4ZODA 3FONA 2NY0C 1NUGA 5J6HB 4WRLA 3MA9H 4J4PD 3WNMA 1RZ8B 4P5KA 3RWEA 2PW2B 2WBJD 1CFNB 3UPRA 2HVJA 1P84K 1ETZA 2OXGA 4JDZA 3NACL 4EN3C 2WV3A 4R4FL 3P30H 3KNBA 3VFTA 4PJFA 5C6PB 2GITA 2H1PL 4NBZB 1DEEA 1S7XA 3MBXL 1AGFA 3SEPA 3EYUH 5FA4B 3N06B 4JO2L 3V9FA 3DYOA 3NGBB 2X6MA 1ZHNB 4QRRB 1BGXL 4Y2DC 5AAMA 3RWIB 1BREA 3A0OA 1MHEB 4P57B 5EBMA 3ULVE 1SYSB 3CDYA 2LU3A 5IQ9B 5DEGA 3C6LD 5EOCJ 4ZTPL 3RWFB 1AXTH 4LLAA 1CDCA 5E9DA 2RCSL 5IW6B 1C5DA 4HUXB 3BPLB 2EZ0D 3H9YA 2XRAL 3LN5B 3OAZH 4ZXBA 3PDGA 2HFGH 2ZCLL 1CL7H 1IEBB 3BW9A 3MJ9H 3QNZB 5DI8A 1QFOA 2X4OB 4OI7A 4KJQD 4Y4FC 4QHLB 3P77A 3NA9L 1T04B 1ZVSA 1P5UA 5I17B 3DRTA 2BVQB 2Y7QB 3WO4B 1HH6A 5J1SC 1MF2L 3QG6B 2BSRA 3IJHA 4PJAE 1FZJA 4LEXH 4HD9A 4YNYA 4PJ8A 3RVWD 3MACL 1E4XI 3HMXH 4IDLA 1CE1H 1HKFA 3MRNB 4TNVK 5B3JE 5BS0D 4PJ7B 4G8FB 1LNUA 4KKCC 4RGOL 1ZLVK 1JV5A 3MLTB 2JLLA 3JV4A 1P7QA 4UI2A 5KSAB 3X12A 1F45A 3GGWB 1TJGL 3LIZL 3QULA 3DUSA 2F74A 3V8CA 4K23H 3RPIA 4ODHH 1CXHA 2JJSC 4CAGA 3W0WE 3IGAA 4HHAA 3QHFH 4XNQA 1NGWA 1Q94A 3QXDA 1UJ3B 1A6TA 5IG7B 5E2VL 3ME0A 4S10A 5I1AB 4DK6A 2D0HA 4HIEB 1KXTB 2NZIA 3MRPB 2ZUWA 3KPQA 1T7XA 3CAFA 4ZFFB 2NY4B 2P5WE 1U0QA 2EDEA 4PRPA 4ELME 5L8JB 4HKZA 4Y5XB 5ALBH 4Y2OA 1TZHB 2ADFL 1FFPB 2ORBL 3J7HA 4U1MB 3SDAD 3PL6C 5AEAA 1N0LA 3CFDB 5HHVH 1NCBH 3MJ9A 3U6RB 2AAVA 1S7VB 3WFZA 4LLUA 2PF6A 1A7QL 3MRLB 5FOBB 1LO4H 4U6XA 5KN5B 1CICD 2O5ZL 4R7DB 1FO0H 1RVFH 2N4IA 4X83A 4GO6B 3TJHC 3G04A 4P3WA 4M7KL 3CDFA 1JI2A 1NCWL 4O2FA 2AVGA 1OGAA 3S4SB 1OM3L 1PKQE 1YEGL 4NIKB 3HMXA 1AHWB 5C0BA 5FHBH 2YWZA 4OLYL 5F72S 3GM8A 2DQCL 5GJTH 3GFUA 2BY1A 5FM8A 4EUPB 1DBMH 2BVUA 1HDMA 4GJTB 5J0BA 1U3JA 5MEOA 2JKXA 1U8MB 3C08H 3QIUD 4BUGA 1A2YA 1G1CA 3OMZA 4N0YH 2I26N 3GSXB 4CJ1A 1BD2A 4Y4HB 4OLVH 4B50A 2MTPA 7FABH 5L88H 3BP7B 4Y7MA 2A6IB 5TE6H 2VMFA 2EO9A 4FQXA 2CIIA 3O8XA 3KGRA 5F1IB 4WV1A 5CBAB 1JWSA 2AK1H 3VXUB 4DW2L 4HF5H 1OAYL 3FOLB 2DWEA 1D5BB 4FFVC 5GGQL 2BC4B 4NZUH 4JRYE 1XGRA 3O3EB 3N1PC 2FJGB 5EDXA 1F02I 1Y6MR 2J8UF 4QHUA 1NBQA 4LAJH 2YWYA 2X89D 3L95A 2R0WH 5MEND 1HHIA 1NFDB 2W60A 1DN2A 2BP3A 1ZXQA 5F7UA 5TDNA 4AYFA 2OL3B 3RHWF 4HJGB 3KLAB 1FO0A 4P2OB 2JJWA 1Q0XH 2OSLB 4X98B 3C5JB 4YK4C 2Q7NA 4YDVA 4L3EE 5DJZB 5FYLD 1OB1A 4YHLH 35C8H 4ACPA 3A6CL 1A3LH 2VC2H 3V52L 1FE8L 3AREC 3KXFA 1YQVL 1TZGL 1L0QA 4PRHA 3H9ZA 1JI1A 5BRZE 3IS0X 3DIFA 5HPMA 4XP9L 1LP9F 3MV9B 4PREB 3TBTA 1QRNA 5D72L 4ZQKB 3SE8L 1CYGA 1IARB 1QEWB 2NY3B 4WO4B 5LGHH 5EO1A 1K4CA 4LCCC 3EOTL 1EJOL 1Z9MA 2VISB 3GJFH 5HDOA 3FO2B 1J88A 5GIRA 4G6KH 5E2TL 2CKBH 2Y6SD 2DLFH 1HOCB 4X9BA 2EC9T 1EZVY 3TT1L 3P0GB 5ENWB 3WDHA 2VSDA 3EYQD 4XGZA 4PGEA 1JL8A 5DLML 1MCSA 3GMMB 1A6VH 2J88H 4GSDL 5GZOD 3EFFA 4OT1H 1NDMB 3NTCH 4FMFA 4P46B 3BH8B 3TESA 3E6FA 1B0GB 4P9HL 2AGJL 2R69L 4BFEA 4PJGF 2YSSA 3KVQA 4KI5F 5HDQH 3MLWL 4U4BA 3VFMA 1CDYA 3EYVA 2DLIA 4MB5A 2R8SL 1A7OH 5CP7B 1F8TH 3DURA 4HKJA 2BSTA 1BVZA 2FRGP 2IF7A 5I8EB 4EIGB 4FZEL 3N1GC 3VH8B 1TTUA 4HAFA 1BMGA 4Q9QL 4NHCL 5T3XH 1RZKL 3OR7B 2DD8H 1WFNA 5MHSD 3UZVB 4I3GA 2I9TA 3LKSB 1D5ZB 4XBGA 2QSCH 1AD0A 1RIUH 3HNTH 3T0EE 2MKLC 4BFGA 1ND0A 3X17A 2BSSA 3TYGH 4WEBH 3AAZA 4CJ0A 4M5YH 3SPVA 4ENED 4LRNL 4YWGH 3NCEB 5K33A 3GJFA 4XP4L 1YN7A 5CMAA 4L8CA 4JLRA 1BLNA 4R7NB 4DGVL 2ADGA 1D5IL 3BGMB 4I9WD 2RB8A 4XPHH 3FQWB 5IK3B 2AEPH 3JXAA 4XP5H 4YDKL 4Q0XL 3TH2T 4KZDL 1R3LA 1BWMA 1HQ4B 1IL1B 5HTSA 4OTXH 2NY7H 4NKOB 4PY8J 3QCUH 5KAQF 2GJZB 3TJEH 4M7LL 2R15A 2ED8A 4J1UA 1J1XH 2WMPA 3ULVC 3C5ZD 2DQTL 4QOKD 4Z7VF 1IGJB 1BFTA 1EHXA 3NN8B 2OQJA 4PJDA 1KELL 3T77B 1ZTXH 4APQA 4ZYKB 4FP8H 5E5UB 4S1DC 1U8OA 4JQIH 3MFFB 3CUPB 2J12B 2J8OA 4LIQE 4CBPA 4D0CB 1NMAL 4K8RC 1OSPH 2F53D 4FQJL 1V7MH 2XN9D 1EEYB 1J7VR 1QSFE 1MRDH 4BH7A 3BDXA 3D18A 3DBXB 5T1KA 3MJ7B 2XTLA 4MAYD 5E5RB 1RUPH 4BKLB 2YRLA 1CDJA 2A9NL 3PHQB 2X4NA 3HG1A 1XZ0A 4XTRD 5FIEA 4NRXA 2EYSA 1F6LL 1FNLA 2NQCA 3CC5B 5C2UB 5FYKL 5GPRA 1E6OL 1G6RB 2FR4A 3AU1B 3VXNA 1UA6L 2BFVL 5I71B 4FQPA 5C09B 4WEMB 4XVSL 1BM3L 3I50L 2YD6A 2XKSA 1HNGA 2BVTA 3SQOL 2XZQL 3IRPX 5DUBA 5GRVK 1NANI 2QADC 3HNVH 3QUKA 4S1QH 3CSYB 5CFHA 5KBNC 3QJFA 5D1QC 2AJXH 5DUPH 4Z7UF 12E8L 1A6UH 4N9GB 5D1XA 2HTKC 1XF4A 4XPFH 4I18B 5GGSA 3BEWB 3QHTC 3W39A 1N26A 3TNMB 3KPOA 1I8IA 2PTTB 2E7BA 2NX5B 1FRGH 4GRLB 5KS9A 4IRSC 3D1MC 1LE5B 3X14B 4EDWL 3B5HA 4OZGF 2YD1A 5BV7B 1A4KB 3WIIL 5C8JB 5E99H 4FXGA 2ICEA 5GS3A 3PWPA 4JAMB 1XF5B 4XC1L 1QLRB 3WFEH 1OLLA 4M5ZH 4LCWE 3O41A 3FAXA 2WWKT 1F4AA 4Y16B 1HEZA 3LKQA 3UTQB 2VUYA 4OD1H 2HT3D 3OSKA 3WUWB 4K7FB 4QT5B 4W68A 3QDJB 2IPUK 4Y8DC 4HK0A 3LEYH 2XT1B 5E03A 4I3SH 1QFUH 3IKKA 1CLOH 2I07A 2H3NB 2MSPA 1QR1A 3X3FH 1JF1B 2NNAA 1PKOA 3CFKA 1FYHB 5EO0B 4NQCB 4PJXF 4UT6H 1UEMA 4U0RC 3SDXB 5SWSA 3TVMB 4MCZA 4WW2F 4ETQA 1MQKL 3BMVA 4QRRD 3BXNA 1QFPA 3BQUC 4U1IA 4GMSH 4IM8A 4RIRB 3F5WB 5DVMA 1YEHL 3UTTD 3ARBC 4RFEB 4G8IB 1A7NL 2C4XA 5EUOE 5I16B 1TCMA 2AXGA 3WJLC 4AH2B 2QQNH 3HE7B 3U4AA 4GRWE 5L2JA 1JUFA 2WWMC 4WW1A 4HEME 5LAXA 3RJDA 4HZAA 1PDKA 4PJ9B 4PLKC 3TWCL 2A74A 3TN0A 1S7TB 3PWVA 5HHOD 1G7PB 5DD6A 3Q6FB 4FMKA 3U83A 2B4CH 4NQXA 2Z93A 3RKDC 3TV3L 4XH2A 1YNLH 5JNYA 3BUTA 2CMRH 4FTVB 1RZJC 3DV6A 4G7VH 4KTYA 1DSFH 5E94B 4LEOA 3WIFB 4JFZL 3TT3L 5EPMB 1UG9A 3HNSL 2DYPD 2XOTA 4JANB 1OAKL 4N1CA 4GT7A 3VXMB 5IFHL 2FATL 3ZSTA 2Q8AH 4NT6A 1IC7H 5KSAD 2F54E 3DTXB 3QDMA 5ICYA 2D7QA 4X4YA 4Z7WA 4LNRA 5JDSA 2DLTA 1IGIH 2X4SA 2YEZB 4X7FC 3BO8A 5FUOL 3NVQA 5KSBB 3QWOA 3ULSB 2VXSL 5LBSL 2WLZA 5D6DA 4KHTH 2WQ8A 4PLJC 5FYJL 2P49B 1T83A 3EKCA 3BT2H 3C9NA 3DO7B 1NUDA 1MFBH 3U0PA 3FB7A 1U3HC 5D2NE 5EN2A 3CLEH 5JPNA 3NCBB 1AIFB 5C0NC 4IS6B 5L8KB 1NFIA 1C1EL 2NY4D 3RZWA 5JIPA 3MMEA 3QIWC 4YXHH 3WJJA 4NNYA 5CEZE 1FQ9C 2LAGB 4LL9A 3V79C 2VDMH 3MUHL 2A6JB 2B0SL 1G9NC 3P9MB 1M05A 1MLBB 3L3JA 1Z9OA 1BBDL 2OR7A 4ZTOL 4AK1A 2GAZB 4F57L 3LH2L 4F8TA 2Z92A 3D69A 3ZLQC 5J1AB 1MLCB 2HTLC 3RWJB 3SJVD 2A38A 3ZTNL 4FXKB 4YJZL 4JRXD 1IFHH 4LP4A 4OQTL 3VFUB 5GSRA 3IU4L 2YA1A 4R4ND 5GRYA 1JYNA 1BFVH 4YGVB 3A6OA 3MA7A 2VLKA 4U1KA 3FCTB 4MNQB 4PJEB 1BECA 1X5LA 3B9KC 4L29A 5I1LB 1NSNL 4M1DL 2AK4B 1BFOA 5IWLC 4RX4A 3AS2A 4HH9B 4PRIA 4R0LC 1P1ZB 3T0EC 1MELA 4Y4HD 4HKBB 4IRSA 5FM5O 3NABL 5D7JB 3MOAH 2C3WA 1D5MA 4YHPA 3QPQC 1MSPA 3JBG7 4FQQB 4RMUA 2X4UB 4LASL 3ZT6A 3QH3A 4BH8B 3RVXD 4DGYH 3C2AH 3VXUD 1JWMA 4OLXL 4I0PC 1I9JL 3RVUC 4B7LA 4P5TD 3QO1A 5DT1H 2DQGH 3BKML 4PP1D 4X99A 3MROA 2B1HH 4TVPH 1B0RA 5HYSB 4HUUB 4ZFOB 1FAKT 3B6SA 1QPPA 4LCYB 3EOAB 4CADB 1CU4H 5AUMA 3ARFB 4GOSA 2Z8RA 4RMVA 1FIGL 3NIDE 4NQEB 4OQ1A 4PBVC 4XT1C 3SDDB 1TXKA 4JPKL 1MRFH 3WFDL 1I3GH 4P2OD 2NY5C 1G7HB 4PRAA 5I1CH 2ID5A 4KQ4H 4AY0A 3BKJH 1X9QA 2D03H 4LFHD 4G6AD 1KN4H 1T5XB 2VOTA 3VJ6A 3WEXA 5I1HL 1P2CB 4LMQI 1T0MA 5F1SA 2A77L 4Y5VA 1MRCL 1MREH 4OCLC 3QUYA 2AJ3B 5C08E 4P3DA 3ARBA 3GSVB 4MNHB 2MWCA 2R29L 5DA4A 2A83B 3NZ8A 4BZ1L 5IB2B 1ZK9A 3OF6A 3WLBB 1DDHA 1DBAL 4DEPC 1JPSL 5D1ZA 3TFKD 3HI6H 3PQYA 3S5LA 1R0AH 3TO2A 4HLZH 2V5RA 3DVGB 2M1KA 4KVCH 4LK4A 4CU6A 3BAEH 3TPUA 5L2KE 3V6OC 2RHEA 1CXKA 3IFPA 2ZCKL 4L4TB 1J1PL 1JMZA 3OB8A 4JREB 4IHOA 4KHXH 1VKXB 2BERA 3JV5A 1KJMB 1X5GA 4KMLB 5B22A 1GVIA 2VH5H 4H1LG 2FEDD 4YDLC 3O6KH 1KTLB 4HUWB 3OKOB 3FB8B 2I9LB 4P46D 1NEZA 5F7EH 5FCSH 3QWRD 5K9KB 2DJSA 3L3DB 4JB9L 4S1SH 5F7WC 5JA8B 1FL3A 1FV1A 5IUSA 1OAXL 2CDFB 3OAYH 3MRMB 4FQIL 4OCXL 2X9YA 5TF0A 5EUKA 2P45B 3C60A 1X4XA 1J0HA 1SEQL 4I2XA 4TSAH 5EBWB 4BFIB 1FFOB 1VPOL 4IRJA 2H2SD 2DJUA 3MUY1 2PXYB 5C9KA 3IJSB 1EEUA 4JE4B 1U8NA 1R5WB 4HWNA 1FNEB 4GMTL 1H8SA 4RFOL 1T4KA 4DVRL 3W81A 4HGMA 4NCC2 4NGHL 4U1SA 4QF1B 4NP4L 1PSKH 3MJGX 2EDHA 5KVGH 5B39B 3SKJL 1NGYA 3KXFE 1A6PA 3MXWL 2UV3A 3GSWA 1WF5A 3H42H 4C83B 2Q6WA 4U6TA 4Z7OE 1A9EB 5C70A 1IAKB 2VB5A 2F5BH 1W72H 4LGPB 3TCLA 1N3NA 5HHNB 4BA8A 1O7SA 4OM0H 5FXCH 1ZHBA 4KC3B 2WINA 2ADJA 4KAQH 5CGMA 2GCYB 3CZFB 4WFFE 5I74B 3BD3A 4NQVA 3V0AC 4N8CH 5IESH 4OZIF 4FG6D 4PRDB 4CN4A 3BZEA 2ATPA 3S98A 2PW1B 4L5FL 4LAQH 3VXPB 1E6JL 4XNYH 3OKKB 4BZ2L 4UINH 2RAMA 3N0PB 1CVRA 5D93B 4O02L 5BZWB 4KRPD 5IWLA 1QVOB 1WFUA 5H8DA 3IB4A 4F7TA 3P0YL 1I3UA 4PV8A 5MERB 5EO9B 1XF3B 5GS0L 1J18A 1KLGB 2R0KL 4LQFH 4ODTL 5IM7B 3GMOA 2NY0B 3HRZA 3VFWA 3G5VA 3MV7B 3GUTA 1ADQH 3HLAB 5LQBL 2OP4L 5DEFB 4D2NA 5LCVH 4P2QB 4K2UL 5B4MD 1PY4A 2ENSA 1UVQA 3PWUA 2YPLA 3GHBL 4XMPL 5C09D 3ROOA 3GIZL 1U3ZA 1W72A 3Q6GH 1MIEH 3IKCA 4M61A 4AIXA 1NGXB 4MQTB 3VFGH 2YZ1A 3AFLA 1C8PA 3VG9C 1QHPA 4PJIA 5EBGA 1IKFH 5AZEL 2P24A 3GK8H 4F33A 4MJIB 2A0LC 3S37L 5KANI 4KH2A 3MUZ1 1N59B 3MLSH 4Y2DB 3KPPA 4W70A 3BMWA 2NX5D 2WWKO 2LQRA 1KCRH 3IETA 3MV01 5IHBA 4EI6A 3VCLB 4ZG1A 1UB5A 1QQDA 3ARDC 3K1DA 1DL7H 5GRUL 3GMNA 2P7TA 4P0DA 1I1CA 1L7TL 2O5YL 2W0FB 2IADA 1ZMYA 1ZLWK 4HMDA 1QBBA 2X9XA 5ISZE 1JNNL 3EO0A 3OQ3B 1FBIL 4LHUG 2Y07L 3TYFB 4D9QE 2D9QB 4N5ED 4LVHB 1ES0B 1KEML 2B5IC 5K9QI 4HPYL 4JZJB 1IBGL 4PGCA 5C07B 2IANA 4NC2B 4FFWC 2H8PA 3T3PE 4Y16D 4U6VL 1J8HB 5T3ZL 3QQ4A 4P4KB 3Q5TA 3MLRH 1GGBH 4NM4H 3V6OA 1NMCB 3CSGA 4JO3L 4PJ7F 3G5ZA 5I1IH 2UWEE 1A8JH 5C0GB 3CMOL 5E5MA 1ADQA 4WFGD 3DSFL 3VD7A 4XNUL 2PO6B 4O00A 4ZS6D 1WLHA 3KPTA 5A40E 4PGDA 1LEKB 4XP6L 1LEIB 2OX5A 4FFYH 3TVMD 1KJ2B 5IMMB 1QSVA 1N4XH 1S9YA 1BF8A 4X6CB 3JTSB 3G6AB 1EA9C 4JFFB 1JHKH 4PGJA 3BIKA 1RK1B 5HSFA 3WN5C 2XA8H 3MV8A 2H6PB 2QSVA 3NPSC 3QDGD 2VJXA 1CIUA 2OTUA 3KPLB 1GOGA 1T20A 5DJYB 5DRZB 3HTLX 1YNKL 4ALAH 3TZVA 3FB5A 4X6BA 2RR3A 1V05A 4X8JA 5TPWH 2CK0L 5E00A 2ZKHL 4ZFGL 5ID0B 4NNPH 3GSNL 2HVKB 5DK0B 3WS6C 3O4OC 1I1RA 2VAAB 3WE6A 2KZWA 3KPRB 1U9KA 5J13B 5K9OA 5C2BL 1H8NA 1IM9A 4KK6D 3T0VA 4QLRA 1XCTB 4E5XA 2F58H 4XMLH 4F7PA 1NGZA 2HT2C 1IQDB 4FTVD 1DLFH 3A67L 3CK0L 3M17B 4LP5A 5A2LH 4WHTA 4WUUE 4XCEB 3QRGH 2W65B 3QA3A 4ZD3H 2LFGA 4OLUL 2X4QA 4TUJB 1J0KA 4RZCB 1EEQA 4FXLA 3SKUD 3VXMD 2CDGB 2P8MB 4ZOEA 3RVVD 4X5XA 1YDPB 1JGDB 2R0LL 1YJDH 4LQ1A 5I1GH 1U8JB 4KGLA 1FNSH 1FYTA 3NFSH 1MCJA 2DQUL 4JFDA 4O4YL 3WL9A 4UDUA 5KVEH 5E95B 4ZSOA 4RA3A 3UC0L 5T5NF 2ZNXA 1YEJH 4GKZB 3ARGC 4M1GL 1FHGA 4LSPH 43C9B 5J4MA 4OGXL 4D8PA 5AD0B 5SX5H 4J3WA 5KG9B 5IMKA 1JHTA 4AZ8A 3PGDA 1JPTL 1YUHB 2VLRA 3K1KC 3Q3GA 4HUVA 4FRWA 4X4XA 4GUPA 1Y0LB 1NL0L 4G9FE 1CLCA 1DLHB 2GFBA 4L8BA 2H2PC 1NFDF 2BOCB 4L9LA 5GRJL 3KHQA 3QIBD 4M1CC 5IJKC 3QFJB 1EAPB 5TFSH 2B1AL 5DD0H 3CU7A 4M7JH 4ODSL 2X2YA 2HJLB 2R2CA 3DYPA 3IJYB 3DSNA 4PYHA 1LO2H 1TQBB 1DQQA 1U41A 3FHQA 5EU6A 1NBVH 5CZKA 4YHYB 1GZQB 5JHDD 2W07A 2HKHL 5KSVA 2R23B 4F9PA 3MLZL 4YK4B 1MH5B 2QKIB 5K59E 2I27N 1EO5A 1KCVL 1HINL 1JGVH 4P23C 1TJHH 3O4LB 3OXRA 1BX2B 1OQXA 1RZFH 2XG4A 4GBXA 4QTHA 4RGMC 4G8EA 3VW3L 3UXFA 4Y1AD 3V8OA 4YFEA 2BJMH 5JOFB 2DBLH 1EAJA 4QRUB 1GC1H 3ARDA 5D7JD 3ARWA 5AZ2L 3RP1A 4U49A 4LCCB 3QDME 5HJ3B 4NCDA 4WHYG 5FOJA 5IMOB 3DHMA 4Z7WE 4NJ9H 5HDBF 3UTSA 4PTTA 1U92B 1M7IB 3QBTB 3VFOA 1BHGA 3PJSA 4AEHH 1P4LA 8FABB 4XBPA 2Z31B 3BD4A 3F7VB 5D96C 4DTGL 1JNHA 3HC3H 1YA5A 1UCBH 1XGQA 3RU8H 4WI2A 1Z5LA 3QEHA 1HHJA 2R1WA 3FKUS 2XXCB 4X9HA 3ULUD 1A7RH 1F58H 4NQED 3P30L 1UJTA 4HJ0D 3SDDD 1WAAA 4DOHE 4CW1B 5HHXH 3AMLA 1KIQB 4OGYH 1K2DA 3EYUL 1L6ZA 3MBEC 3ZHKA 3EYOA 4JQVA 4LRIA 1XMWA 4W81A 3TIDA 1IE5A 1Z0NA 5SWZB 5HD8C 1L9MA 1CL7I 1S3KH 5CWSA 4U3XA 1OTTC 5E6IB 5FAAA 3WN5A 3E1F1 5C9JB 1CFQA 4QRPA 4XCCH 4MCYA 1LEGA 4B0MM 2FH8A 3NIGF 1X5IA 4AENA 1AXTL 4G80A 1NGQH 2J3SA 1Q9WA 5T1LA 2HFTA 2HN7B 1MI5A 1VACB 4UILH 1SJEA 4G7YL 5BS0E 4CVXB 1NBZB 1FFNB 2HFGL 4M02A 3WS6A 1CL7L 2Z91A 4L4TD 5H2BB 4PG9A 3MJ9L 2IAMC 5HBBA 4U3CA 3TIEA 1YC7A 3HE6C 4WU7B 4YC2C 3BISA 3KYOB 4WJ5B 5JZ7D 3JV0A 3LRSA 2KKQA 4LEXL 2G5RA 5IVZA 5IR1A 3BP6B 3HMXL 1CE1L 4LLQA 3ILQC 3EGSB 3WHXB 5I6XC 2DDQL 1WZLA 5FO7B 1DUZB 5E4EC 3N1MC 3I6LD 1ACYH 5E08H 4F15B 6FABH 1S78C 2FX9H 5CD3B 1RHHA 3O11B 4F8QA 3L5WB 4MXQD 4K23L 3SE9H 3NPZB 2P47B 2PXYD 4ODHL 3T2OA 4YE4H 3RL1A 4CVWA 3P4NB 3IVKB 2VTFA 3GMRA 3JZ7A 4HKXB 5DS8A 3QHFL 1QOKA 3OAUH 4KJPC 1S5IH 4FQCH 1VFAB 4XP1H 3DROB 3T65B 4GAJH 3CSPA 2QBWA 3TO4D 3VXRE 5ADOH 5DJ6B 3H0TB 4PJAB 5JR1H 5M7QA 4HFUH 4JFEA 3GMPA 1I7RA 1IAOA 5ALBL 3VXTB 4RAUB 1J1OH 3PWLA 1LDPH 3BOVA 5DHVH 5JPMB 4YHKH 2PYFB 5HHVL 1NCBL 2FX7H 3PG2A 4JM2D 4WU5A 2GUOA 4ZO8A 3AROA 3I9GH 4MQSB 2JCCE 3KYKH 3MGTA 3HKFA 5E56A 1LO4L 4WI9A 4WDIB 2QADB 4XXCC 3T1FA 1FO0L 5L0QB 5INDB 1RVFL 1K3ZA 3EJZD 1BAFH 1QZ1A 5D1QB 3W0WB 3HPLA 1UCTA 3QQ9C 2NZ9C 3QEQA 1OW0C 4H0GA 4IMKA 3CFEB 5IMLB 5FHBL 1L0YA 4MJ6B 5GJTL 5DSCB 4NO3B 1DBML 2F9BT 3V5HB 3UTZB 1AXIB 4OKVA 2GTWA 1RULH 3O6FD 4XAKD 2FL5A 3TNNA 1KTKE 2GSGA 2P5WB 1JPFB 3C08L 1Y6KR 4ELMB 4FNLH 3G5YB 5MENE 4YPGA 1NC4B 4N0YL 4RISL 3H6JA 4OLVL 7FABL 5L88L 5TE6L 4Y19A 1IVLA 2AXFB 1I4FB 1LE9A 4U05A 4WWKB 5DQDH 5CSZA 5FYKU 3C09B 3D3VA 1OTSD 2AK1L 4HF5L 1Q72H 5J9PB 3FT2B 4L4VA 1ZHKB 5DK3A 5FYLE 4P2QD 2XQYG 2W0KA 4NZUL 5HYEA 1IAIH 1AXSB 5TJWK 5DFVD 1PKQB 4UDTA 4YXLH 1YMMA 2J8HA 3TBWA 5DHVA 3CFJA 5HHPB 3FFCA 3UO1H 2R0WL 2XZAH 5D7LA 5FCUH 2WUBH 3RL2A 1BVLA 5IF0B 3QJHA 4MJID 2NR6D 3MOBH 3BPNB 1FCGA 2VL5A 3LKRB 5MEPB 5KVDL 3VI4F 3WKNA 2CRYA 1Q0XL 4H1LB 4YBQC 2VABB 3PIQB 2NY6C 5DJCB 2ZOLB 32C2B 4YHLL 35C8L 1X4YA 1A3LL 2VC2L 3KS0H 4M93C 2G75A 4I77H 3P4OA 5HPOA 2H9GB 1J10A 3GSOB 4F7MA 1EEZA 1PYWA 3LV3A 4MA3B 3SY0B 1S7SB 5HGBA 4GXVH 5CP3H 2E9WA 4GAYA 5LGHL 4JRYB 1T89A 5C07D 3BX7C 2Q76A 3A6BH 4G6KL 4P4KD 3GJEB 2Q7YA 1CGXA 5E8OA 4ZNEE 2X40A 4U6HA 4L8DA 3GMQA 5CD5C 2DLFL 1SEBB 5A3IC 3PP3K 4U2ZA 4UU9B 3DRQB 5FK9A 3PF2A 5DJXA 1NQBA 3HS0A 4JFOB 1EZVX 5KVMC 2PO6D 3O3DA 1A6VL 2J88L 3VWKD 3H2WA 3HE6A 3JVGA 3CXDH 1U95A 4OT1L 4YEFA 3NTCL 4L3EB 1LD9B 2Z35A 4OCYH 2L7JA 1ZLSH 5MHSE 3ZL4H 4X5LA 5I66B 5KSBF 4C4KO 2X4PB 2Z8VC 4NQDA 4JFFD 4J4PC 1DQDH 1HH9A 4L1HA 5ICXB 1H3GA 5HDQL 2WBJC 1F11A 5BRZB 1FSKB 4Q9RH 3U4BH 2XWBA 4IIQC 4LSDA 1A7OL 3MNZA 2P48B 1FLTX 2W9EH 1F8TL 2W0LA 2YD8A 5INCA 3PV6A 4IMLA 1F3JA 2FO4B 4QNPE 4QCIB 5H94A 3VRJA 4M8QB 1TVDA 3WSQH 3P9LA 2X1QA 1IRAY 4OI8A 3H9HA 5T3XL 1ZLUK 4LCUA 4YXKH 4UZGA 3JWDH 2DD8L 2J8UA 4WGVB 1MCRA 1OWRM 5KSUB 2D31B 2QSCL 3QI9A 5BOPA 1RIUL 1X7QA 3HNTL 3KPRD 4NSKA 2CLVB 2LABA 4YDJA 1CD1B 5CP3A 1FZOA 2HT4D 1QFWH 4WEBL 1R5IA 4Y5YC 3HMWH 4M5YL 4QOKE 4MDIA 4MAUH 5FUCE 4YWGL 2PUQT 2F5AH 3C6LC 4DUWA 4ZPTB 3OG4B 4GRMA 5EB9A 5TDOB 4M43H 4XPHL 3F65A 2MJWA 1JF6A 2BHZA 3FO1B 4PJEF 1BZQK 4LDOB 2E7CA 3CD4A 4RMQA 3PDOB 2AEPL 2EZ0C 2F53E 3CFIC 5EC2B 3F8UB 4XP5L 3RDTD 1ZANH 3OR6A 5DMIH 5DGRA 1K85A 5CBEB 5C0AA 4OTXL 2VDRH 1QD0A 2NY7L 3QCUL 2WZPD 4G8GD 3DXAA 3TJEL 1LP9A 2UZYB 3B9KB 4KJQC 1J1XL 4LSSH 4LDEB 3NCYS 3RNQA 2G60H 3BDYH 1Q9OA 1VA9A 1ZTXL 2GJ6A 1G9MC 4FP8L 1RPQA 3RJQB 3RVWC 4R0LB 5H35A 4KKLD 2D0FA 4OCRH 1OSPL 3EBAA 1MJ7H 1V7ML 4X7TA 1ZHLB 4RNRA 3SBWC 2R9HD 1MRDL 4FFZH 1QSZA 2X7LB 3EO1B 2AEIT 1RUPL 3DX8B 3F6LA 4WWID 3HCVA 3ULUF 2RJMA 4WW2C 3LDBC 4Z77A 3QFJD 4PJGA 3H8NA 3TA3B 3WS3B 4QXWA 4LHUB 2PYEA 5J11B 1WBXA 3LRHA 2GEEA 3T0DA 2JIXB 5EBLB 5HGGS 1Q8MA 5FYKD 4PLNC 4Z5RB 1GGUA 3LPWA 4ZOAA 1Q9LB 3HUJB 5I1KH 3L6FB 3SDAC 3K46A 3HNVL 2IPTH 4S1QL 5I19H 5B3NA 1H3TA 2AJXL 5DUPL 1D6EB 2EDLA 1A6UL 5DF0A 1QSFB 3O4LD 1YPZE 3F7QA 4XPFL 4ZUUB 3FRPA 3DECA 1I1YA 1YEEH 1CICC 1FRGL 3SGEI 3KYNB 5C0FA 4HS3B 4IOIB 5GGRY 5FHAH 1S5HA 1LK3H 5E99L 1EHNA 3DVIA 4C56A 4Y8AA 3DX6A 4K94C 4F80A 2E9IA 2Z31D 4LHJB 5CKGA 3ES6B 2A6KA 1JCKA 2W1NA 5EZJB 3QUMH 2BY0A 4QRRE 2YA0A 5ACZB 3QIUC 4OD1L 4MJ2A 5IEHB 4NO0A 3UTTE 5GJSH 4Z7VA 3SCMB 1YMHB 3LEYL 4JGMA 1MFNA 5B8CA 1K8DA 2FLBT 4I3SL 1QFUL 2Y5TA 5DVOA 5BCAA 1J0IA 1CLOL 5JA9A 1JWUB 4KK8D 3HA0A 3EDDA 4KMTH 5FA3B 3X3FL 3VFNB 2L4OA 1AI1H 5JMRA 1RSFA 3B9VA 1MHCB 4UT6L 5HYJA 3NACH 3AXLB 4K9EC 1A6WH 1DE4A 2H1PH 5HHOE 4UUJB 1S8DB 3GSQA 3MJ8B 5E6ID 2OJEA 2EEBA 3KS0J 4U1JB 3REVA 4GMSL 3CVIH 1K5NB 1EK3A 3ZDXE 4LCWB 5AWNH 2GI7A 1J0ZA 1X6NA 5GZND 2UUDK 4LKXA 4NZJA 3RNKA 3VWJD 3QDHA 4HZLA 1RHFA 4F58H 5CJXC 4PJCA 2DF3A 4DCQA 3W5NA 4JPWH 2B4CL 3GSNB 4O9HH 1AO7A 3MSPA 1YNLL 5CUSH 4DKEH 3QAZC 1P7HL 2XRAH 3QEUB 2CMRL 3QUMA 5E8EB 3C6LA 4JFHE 4ONHB 2J6EH 3M1BA 1FN4A 1BPVA 2ZOKA 2VSCA 1DSFL 2JB6B 4YBLC 3N85H 2WUCH 3JUYA 4BQ9A 4OZGA 1UKSA 1UXWA 2R56H 4S1RL 4Z76A 2Y6SC 2CRMA 4JVUA 3RGVB 1YY8A 4JN2A 1CXIA 5EUOB 4O2CA 2Q8AL 4I4WB 4TTDD 1IC7L 3UZQA 1PGRB 2AJZB 3EYQC 5JXED 1KIPB 4GRWB 4UT9H 2HKFH 5F70A 4PJBE 5GZOC 3ARSA 2V5MA 3VGDA 1IGIL 2GSIA 3L3KA 2CXGA 1I7ZB 2VQTA 1D5XB 5F71A 5DRNB 4V1DA 3MRFB 2OYPA 3BT2L 3SJVE 1RZ7H 1MFBL 4JRXE 5TQ0H 3PGCB 3CLEL 4K94H 5ITBH 4I5BA 4MJ5B 4Q7DA 3SBWA 4WVRA 1QBMH 1KB9K 4LHQB 2HMID 1KPVB 1N2RA 4YXHL 5F3HB 4ZUSA 1E4XH 3VFPB 3LQZB 5E2VH 3OKEA 2VDML 4M03A 2OTWB 4NFDA 2VL4A 4QRTA 4WW2A 4DZ8A 5GS2H 2VDNH 3O45A 3RWEB 5DVKA 3Q1SH 4LLMB 1U93B 5MEQB 3LN4B 1ETZB 1W0WB 4QTIH 3VFVB 4JDZB 1F00I 3LKPA 1IFHL 3VG9B 4ENEC 2J6EA 1S9VB 3KNBB 4LVNC 1CFTA 5KW9H 3W0WD 4LLDB 5BW7C 2C7UA 5DK2A 1BFVL 2VN4A 4G5ZH 3E0GA 3D5OF 4R6UA 3VXUE 2VZUA 1WJ3A 1KLUA 3SDAA 5F9DC 5D2NB 2EH7H 1MUJB 5FKPB 4XCFH 1MCHA 3ISWA 4PG2C 2P5WD 1KBGH 1QYGH 5DJ2B 3VRIB 1CICA 1AD9A 4NPYB 1A9BA 3FRUB 3C5ZC 3MOAL 1V3LA 3TF7C 5FUCC 1T7YA 3GNMH 4WWKD 2JE8A 3NZHH 1H9VA 2V9TA 5E9DB 4Q58C 2EYTB 2G5BA 3P4MB 1CZ8L 1ZT4B 3C2AL 3C6SB 1EBAA 4MD5B 4KJYA 4OIAA 2YRPA 5FUZH 2NTFA 1TCRA 3FOMB 2DQGL 5DT1L 5FEBA 2BVOA 3Q48A 1A1NB 1L4IA 4MDJA 5IEKA 4G43B 4Q6IB 5DI8B 1E27B 1CFSA 2B1HL 4TVPL 4OF3A 3T0AA 4ORZC 1OP3H 1WC7B 4MAYC 4H8WH 3PDDA 3GSUA 1ZVSB 3DRTB 5BO1H 1CU4L 1KLFA 5D9SB 2BSRB 4XTRC 3NFNB 3SQBA 2ZZUT 1VFBA 3ZKND 1MRFL 1I3GL 2EDDA 1UWXK 1CK0H 5ERWA 3UDWC 5I1CL 5HGHB 2ZG3A 4KQ4L 3BKJL 2D03L 3W11D 2CLZB 1KN4L 3V6ZA 4ORGA 3AGVA 3L9RA 1M7DB 3V7AE 2Q3ZA 1P7QB 2N56A 5F89A 3HZKA 3X12B 5CLTA 1ODAA 3QULB 2FHCA 3DUSB 3S5LG 2F74B 4YEEA 1MREL 2BVPA 2JJVA 2P5EA 3FB6A 4EVNA 1GYAA 2N7AA 1I75A 2FD6H 3IGAB 3P2TA 1YN6B 4E0RA 3QEQE 4JRYD 4IDJH 4PYGA 4WI6A 3U7WH 1G7MB 1FE8H 3RWCB 4GKOA 3O4OB 1Q94B 3QXDB 1MPAH 3CGTA 3ZE1E 3HI6L 4DFIA 3REWB 3ALWA 1WIUA 2IMNA 3SE8H 4KVCL 3BAEL 3VGEA 4AQ1B 1T2JA 1NEZG 4F9LC 1IGCH 3KPQB 4HS8H 4TNWF 3EOTH 2DIBA 4LCIH 5JW5B 4W4OC 1M71A 2Z8WC 4KHXL 1XAUA 2YR3A 3M45A 5C0CA 3RX7A 3QP3A 2VH5L 5AG9A 3N1QC 3O6KL 1SVZA 3QNXA 1TJIH 3DETD 4K3JH 2WBWB 5F7EL 1S9WA 4AIZA 4GXUN 2X1XR 4LLUB 1CGWA 3TT1H 2P8LB 4OIBA 4S1SL 1FORH 1WTGT 1EFXA 2HT3C 5C92A 5C08B 2PR4H 4S2SB 4O2FB 1JE6A 2EDBA 3ARGB 4TSAL 3AM8C 3BYYA 3NGBC 2R1YA 3CX5K 4JO1H 5L2KB 3FTGA 2YBRB 3W9DA 4U1LB 4HLZG 1JZ8A 1A2YB 5IBLD 4RAVA 5JHLH 3JUZA 2AS5M 3EO9H 1PSKL 5F8RC 3X11B 5KVGL 1RZKH 1JHLH 1AC6A 4LSQL 1JWSB 2VO5A 3LQMA 3H42L 3MRCB 1BZ9B 3ARRA 1W72L 4YHIB 3BPLC 1XCQB 1BQHA 2V7HB 4JY6A 4GKSB 1ZS8B 1ORSA 5J12B 4DAGH 2CUMA 2P43B 4MNGA 2OCFD 2X1PA 1RD6A 1D5IH 1RIHH 4MA1B 1ZAGA 4KAQL 2W60B 1Z6JT 2NPLX 3H9SA 4L3CB 1OVZA 4PJHE 3WO4C 3QG7L 4N8CL 5IESL 1I8KA 4P23B 4P4RA 1GGTA 3RUGE 4RGMB 2C3HA 2DN7A 1FVCA 4LAQL 2UY7A 4XNYL 3PWJA 1KG0A 1EVUA 4OD3H 3EFDH 4UINL 3KXFB 1U58A 5KSAC 1BBJB 4JEGB 5M95B 3DIFB 4Z78A 3R0NA 5HPMB 4NWTH 5CZVH 4LF3B 5IIEB 2BNQA 1K4CB 5DRWB 3GI9H 4M7ZC 5D96B 3P3YA 4I3RL 4LQFL 5C0JA 2F19H 4NYLA 5GIRB 3TA3D 5HVWA 1R24A 1UJ3C 3DV4A 5GS0D 4LHUD 1ADQL 1HHKB 3QUXD 1FZKA 3EYFA 5GRWA 1GZPA 5LCVL 2XN9A 1HYRC 1EJ6A 4YHOH 4CVUA 1JZ4A 1NCDH 5ANMA 2XWJA 3K4DA 2NY4C 3Q6GL 1MIEL 4NRYA 1U8PB 1P9MC 1CDBA 3MBEB 4HCRH 3F58H 3VFGL 2V2WB 1ONQA 4E9LA 4GXUM 1N8ZA 1IKFL 3GK8L 5DYOB 1QSFD 1J5OH 2W9DH 3MLSL 5HI4D 2EKSA 3EYVB 3DUHA 3PABA 1QR4A 1KCRL 1LK2A 1ITBB 1B6DA 3DURB 1DL7L 4R4NC 2NXYB 3CDCA 4WFGE 2BXZA 1AHWC 4R4BA 1T1YA 3FQXB 5FF6B 3RX5A 4TYUA 4HH8A 3SDYH 2VAJA 3SDXE 3I2CH 3V0WH 1MAMH 5FGBA 3BHBA 1F42A 2QJDA 3D39A 1E4KC 2ZUTA 5LGJA 2IAMB 1VCAA 5GRZA 2RFXB 1WWWX 4J8RA 4Y4HC 2B20A 3U0TA 1NANH 1A6ZB 2FECL 2HRLA 2VLJE 3GJFB 3HFMH 4LSTH 4V2CB 1YN7B 3MLRL 4FQHB 3SCMD 1GGBL 1MJUH 4JLRB 4NM4L 1BLNB 3QDGE 4YC2B 5T3ZD 3ULVF 4HLJA 4RMRA 5I1IL 2ZJSH 2ADGB 1JK8A 1ZGLA 3LEVH 1JN6B 4YX2H 4DUXA 1MEXH 2ZUYA 2CKBB 3QPXL 4OGZA 3RVXC 1YC8A 2C1PA 2XKNA 4JM4H 1R3LB 4P5TC 4GW4B 3R8QA 2KQMA 1I7UA 3U1SH 4FFYL 2V2XA 4PP1C 4LPWA 4NZDA 2WIMA 2DQJH 1N4XL 1NCUA 3RTQD 5J6HA 2PYEE 4HCRA 3WHE0 2JJUA 1GXEA 2GK0B 1JHKL 2PW2A 1CFNA 4L8SC 5ISZB 2PTVA 2XA8L 4FTVE 5HDLA 3RI5K 2EE3A 4GG6E 5GHWH 2R2HA 1MQKH 4XC3H 1QTYT 4ALAL 4UIKH 4PJAF 4P2OC 1INQB 5C6TH 2FIKB 5TPWL 2ZUUA 1OY3B 1ZHNA 4UT7H 1AR1D 4G6AC 5F7HA 1QACA 3VXME 5B3JF 4NNPL 2UWEB 3KLSA 2YS4A 5ELIA 5IV2B 1UWEH 1X5XA 4P57A 4MWFA 1BJ1H 1D6VH 4B7IA 3KJ6H 2X4NB 5EA0H 4X9IA 2F58L 4XMLL 1QP1A 4Z18A 1DLFL 3IU3A 2X09A 3K4ZA 1JTPA 2AABH 2WBKA 3GBNH 4U3HA 4XCYA 3TFKC 5IW6A 3WV0A 3MLUH 3QRGL 1G1YA 3MRDA 3TBYB 5GRXG 1RAMA 4ZD3L 2ARJB 4MB4A 4HG4K 3VXNB 3RGVD 2JF1A 4WI5A 3IDJB 5TE7H 1IEBA 4J3SA 5T5FL 1UT9A 1AGCA 3HC0B 5BOZG 4ELKA 1YJDL 5I1GL 1FNSL 4ELMF 3NFSL 2FEDC 3QUKB 4XMKH 1T04A 5KVEL 2BVQA 2Y7QA 4P46C 2RIKA 3QG6A 5GGSB 1YEJL 1F5WA 5C6WH 3OX8B 4LSPL 1ZA3B 3LS5H 1DTUA 3D85D 5DRXA 5I1DA 4G8FA 3G6JE 4EUPH 5JHDE 4OZ4A 3MLTA 3OZ9H 1OARH 5KSAA 1II4E 5FYJH 2GY5A 3PWPB 3GGWA 3BE1H 2BOBB 1IGTA 4X6FA 3KPMB 1JPGA 4QY8B 2IMMA 1FJ1A 4HXBH 1NDGA 2H2SC 3O9WD 1F6FB 2MQCA 5DR5H 1E0OB 1HEZB 2IFGA 3LKQB 1SQ2N 1GGIH 3RX8A 3BUYB 5TFSL 3FHAA 5DD0L 4JHWL 4Y1AE 4M7JL 5EU7C 4U0QB 2BRRH 4PJCE 3RVTD 4GQPH 4HIEA 1BBDH 3S3SA 1LO2L 1NBVL 4ZFFA 1QR1B 1MWAB 1SBBA 3NCFB 3JTTA 1UZ8B 1I1FB 4Y5XA 3EOBA 2AKRA 1NEUA 5DQJA 1FFPA 3UJJH 5D2LE 3BWAB 4U1MA 3GKWH 2NY6B 3CFDA 1GH7A 4TUOA 4ETQB 1JGVL 3BXNB 1CFVH 3U6RA 4WENB 1TJHL 1S7VA 4U1IB 3UBXI 1RZFL 3DMMA 5KN5A 3QZWA 4G9FB 4OBSA 1T0NA 4R7DA 3P11H 2BJML 2DBLL 1GC1L 2UVFA 5HY9B 3S4SA 2G9HB 5AAWA 4N0CD 4O2EA 4ETYA 3MODL 1YEIH 4FG6C 1AHWA 5E9DD 3VFSA 3QQNA 1U91B 3BVNA 4NJ9L 2JELH 4QXTB 4EUPA 2A74B 4NQSB 4AEHL 3AMKA 5DD6B 4HQQH 3MGAA 1RJYA 1E4KA 1GAFH 4NQXB 3HC3L 4KRPC 1TVBB 1WT5C 2IH1B 1UCBL 2Z93B 3RU8L 1B88A 3ZTJH 3V0VB 3GSXA 5IB5A 2WM0A 2X4TA 3BP7A 2NXZD 5ID1B 1A7RL 3DV6B 4GAFB 1F58L 1FDLL 2ED9A 5IKCA 5F1IA 4PJ8D 1I8MB 5HHXL 4KXZI 4LEOB 4OGYL 2WBJB 1D5BA 3BI9X 4AIOA 2BC4A 2ZNWA 4IIQB 5CAYB 3O3EA 5B4MC 3LEXB 4PY7B 1P7QD 5I71C 3QDMB 3K4AA 2VQUA 4X4YB 1S3KL 3EYSH 4Z7WB 2FHFA 4DVBA 3JWOC 2AJSH 1NAMB 3SDCA 1NFDA 2Y9RT 1JNLH 4XCCL 1CG9A 5KTEH 3WBDA 4HJGA 3KLAA 3C9NB 1QBLL 4I18C 4P2OA 2Q8BH 2I60H 1NGQL 4U1HB 5EN2B 3C5JA 1FCCA 3LKOB 4UILL 2C3XA 5DJZA 4Y5YB 4DK3A 3E3QE 1NFIB 4UQ3A 3MMEB 4PRPD 1K4DB 3I6LE 1DBAH 4DOHB 3LPFA 2BSED 4JY4A 3MV9A 5EULV 4PREA 4N8VB 4ZQKA 3Q2CA 3L3JB 4N5EC 4WO4A 1AY1H 1MCIA 3RFZC 4U1NA 2O26U 4QXUH 4Y16C 1ZGLM 4LNVA 2AI0H 5T33L 1OGAD 5EZOH 2EYRA 1UKTA 5ENWA 3MA7B 3QT2A 2R2EA 4F37F 1ACYL 4XRCB 5E08L 6FABL 2FX9L 3GMMA 4L29B 2MKWA 4ZS6C 1O0VA 2JJTA 3SE9L 3IXAB 5BS0B 4P46A 4YE4L 3BH8A 3TVMC 5L2KD 5IGXH 1B0GA 2YD4A 3WNOA 5EU4B 3OAUL 1S5IL 2DMCA 1R3IL 4FQCL 4XP1L 3KPNA 4OB5H 2K1MA 4GAJL 4L3AA 2X5PA 4FQXD 4TRPH 1BJ1J 4JHBA 3OAZK 4UAOB 3IT8D 3LDBB 5ADOL 4HJJH 2KBGA 5I8EA 3EAKA 2Z4QB 4W6YB 4HFUL 4KROD 5JR1L 1KPRB 1I3RB 4PGZA 1LDPL 2XZCH 1MHHB 4LSRH 3OR7A 5ICZA 4D9LH 4XAKE 4YHKL 1B0RB 2FX7L 5HI5D 4XNZC 3LKSA 1PBYA 3I9GL 3B6SB 3KYKL 4LPUA 4K07A 4X5WB 4KK6C 5AUMB 2VRAA 1RUAH 4EEEA 1JYXA 2XG5A 1HCFX 1BAFL 1F4YH 1G6RH 5J56B 2CUIA 1R3JB 1IEHA 5K93A 5C0CE 4OAWB 5ABDE 5IK3A 1J05A 1OP5H 4YHNB 3V95A 4N0UE 3VJ6B 4KK9D 1HQ4A 4AT6B 1IAII 3G08B 3VXRB 1RULL 4NKOA 3RVVC 3KXFD 5HGDB 1X4ZA 3OB0H 2GJZA 4Y5VB 4F7EB 3QUYB 4FNLL 2DAVA 1MY7A 1XGYH 3B8YA 5C3LD 1IGJA 4MHHI 3NN8A 4MJIE 3T77A 2LU7A 1DDHB 4ZYKA 5DQDL 5BV7H 5D1ZB 2E6JA 2YUXA 1V8HA 2FNBA 3CUPA 3MFFA 3QIUB 1FL5A 3JV6A 1TVHB 4I8DA 5DFTA 1Q72L 1P7KA 3TPUB 3B9DA 4WFFD 2Y23A 4LLVA 3QXUA 1IAIL 1G7QA 2EEDA 4OFKA 3MJ7A 2XQYK 4YXLL 3MO1B 2F15A 3UO1L 4BKLA 1AQDB 4CMMB 1IKNA 2XZAL 5FCUL 3PHQA 4NC1E 4A6YB 2WUBL 1VESA 3QIBC 1P4IH 5C07E 4WY7H 1MCDA 4DGIH 1KB5B 2ZUSA 3CC5A 1RZGB 1UZ6E 1FV1B 1MCPH 5MENB 4MZ3A 3QCVH 3BRGC 3L7EB 1UKQA 1G6RA 3U36B 3AU1A 3F7YB 5F7MC 4CMHB 3S37H 3G5XA 2NXYD 3AVEA 3C60B 4I77L 4DUVA 2KH2B 3OGCA 3EJYD 5IB1B 4Q74A 3UJTH 3MFGB 4R2GD 4NKDA 5C0RH 1CLZH 4GXVL 2MFNA 4N9GA 3CLFL 5BVPH 3S97C 3I85A 4X6CE 4I18A 4X4MA 3A6BL 1KT2B 3TNMA 2OMBA 2NX5A 4OFDA 4GRLA 4KUCF 4Z7NE 4XHJD 1LE5A 3QAZB 1NGYB 3X14A 1N64H 5EOCH 5D7JC 1IGYB 1IBGH 4PJ5E 3GSWB 5GGRA 5EUOF 2Q6WB 5M94B 4U6VH 2FEEI 4RGNE 2DLHA 4NUGH 2BNQE 4HFWA 4JAMA 4ODWB 4GRWF 1QLRA 2CH8A 3CXDL 4OGAD 1ZHBB 4OCYL 4O58H 1ZLSL 1SYVB 3ZL4L 1XR9B 1BOYA 2ADJB 3TH3T 3STLA 2VXVH 3PE9A 1R3KA 4K7FA 4QT5A 3WUWA 4AEFA 1PEZA 1DQDL 4FHBD