5I6OA

Crystal structure of copper nitrite reductase at 100k after 20.70 mgy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 92
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA02
4BWTA 4BWWA 4KNSA 2IDSA 4G7SB 2XV2A 1IUZA 1SHXA 4G7RB 5B7FA 2BP0B 3NJGA 3SBQA 2X87A 1WA2X 1GSKA 1L9QA 1M56B 4G70B 4W9ZA 2FTAA 1ZIBA 5LDUA 4G7QB 1DZ0A 3DIVA 4YSEA 2QT6A 4YSQA 2HRGA 2GIMA 1PZCA 3WKQA 3BVDB 3QJVB 2DYRB 4YSOA 4YSUA 4AKPA 3JTBA 2XUWA 1R1CA 3WKPA 2UX7A 3S3CB 1AANA 2B3IA 3GDCA 4G72B 4KNUA 3WIAA 1NIFA 1E67A 2BW4A 3NJHA 3NSFA 3QJQB 3SBRA 1A65A 5I28A 2DY2A 4CSZA 1W6LA 3IN2A 3IBOA 4CSPA 1SF3A 3FQYA 1BQRA 3CVBA 3FYIB 4A2DA 4JHUA 5I5IA 1ZV2A 9PCYA 2RACA 3NJFA 4DP4X 1CYWA 1J9QA 1N70A 2YAEA 1ETJA 3OM3B 4YSTA 4DP2X 4BDVA 3D12B 1AIZA 1J9RA 3QJRB 1PLAA 1WAEA 3PLYA 2Y69B 1A8ZA 2PPDA 1JZEA 3V9CA 4P5RA 1E5ZA 4L0PB 3ZBMA 1L9PA 1L9TA 1ET5A 1JXFA 5B3SB 3NYKA 3WI9A 2H5UA 1NICA 1JVOA 4YSCA 3NSDA 5AFAA 3ASOB 2PLTA 1ET7A 2BWIA 3AW5A 3X1FA 4JKNA 1TEGA 2JKWA 3NJJA 1L9SA 2Q9OA 2Q5BA 4NAJA 3QPKA 3T6WA 4ZK8A 7PAZA 3X1BA 2HLEB 1FFTB 4QLWA 5D4JA 3N2JA 1JXDA 4KO6A 3NT0A 2XV0A 1J9TA 2PCFA 1AS7A 4E9SA 5E9NA 2XV3A 1XMEB 4HAKA 3PAVA 4HHGA 1PF3A 1AQ8A 2IDUA 5A7EA 2FQFA 1KDIA 1TKWA 1PY0A 3CG8A 3FQ2A 3C75A 4DPCX 1W6WA 4E9YA 3NSCA 2QPDB 4YSAA 3TASA 1J5DA 3QJTB 2XLLA 1AS8A 2DYSB 3S8FB 4AX3A 1KGYE 1NTDA 4GY4A 1M9WA 1OF0A 1IKOP 1MG2C 2PPCA 2FNWA 1ILUA 2XX0A 1V55B 2J57A 4MFHA 2FJSA 2YARA 4PCYA 1NWPA 3KW7A 4JHVA 1PZAA 2PPFA 3EH3B 1FWXA 1GY1A 3ABKB 1VLXA 1A4BA 4F7KA 1WA1X 3FSWA 2AZAA 2IDTA 4GP5B 1TU2A 2GBAA 3ASNB 1BXVA 5IY5B 3GXUB 3MX0B 1JOIA 3OMIB 3FU9A 4A2FA 1KDJA 3FQ1A 3ABGA 2HX9A 3ZIYA 1ASOA 5FC9A 4E9TA 2XU9A 1SNRA 1QLEB 1JXGA 1A4CA 2P80A 2PCYA 2JXMA 2R7EA 2MRYA 3H4FA 5TK2A 2R7EB 4AKOA 5EHFA 2TSBA 1NINA 2P80D 1OCCB 1M57B 5I6LA 2B08A 3FS9A 3FPYA 2LLNA 2UX6A 4QKTA 1W8EA 4NERA 3CDZB 2VN3A 1HAWA 1SDDA 1ZIAA 3NJKA 3SBPA 3NJLA 3MBWB 3CVDA 2VSMB 1MZYA 1BAWA 2FT6A 3FPXA 5I6PA 2E86A 4N4YB 4FAAB 2GI0A 2Y1AA 4NB7A 3NP3A 3UGEA 1TEFA 4Q8BA 2AVFA 4Q89A 1PAZA 3T71A 4A2HA 1OCZB 4E9XA 2CAKA 4E9QA 4DP9X 4AKQA 1BYOA 2PP7A 4P5SA 2OJ1A 4DPAX 2FQEA 5I5JA 3S3DB 3OD3A 2YAFA 3PXLA 1J9SA 4M4RB 3V9EA 2XXFA 1SFDA 2VW4A 4G71B 4YSRA 4A2GA 5AZUA 2CCWA 4KO5A 2AFNA 2UXTA 1PMYA 1URIA 3AZUA 1WS8A 5F7AA 4EF3A 5TK4A 2EIJB 4GP8B 1BYPA 2VMJA 2WO3B 3AG4B 3UACA 2ZOOA 1JZFA 3BQVA 4BXSV 1XB6A 2PP8A 1HFUA 3UABA 2IH9A 2QPEB 2DWTA 1SJMA 5PCYA 2UXGA 2VW6A 1ZDQA 3WNIA 3WG7B 5I6MA 1YLBB 4A67A 3FU8A 1X9RA 3EF4A 1EHKB 2J5WA 1AZCA 1SDDB 2CBPA 3EH4B 4W1TA 2YAQA 3TBBA 3QJUB 6PAZA 1B3IA 3X2QB 2CJ3A 2UXVA 1JZJA 2YXWA 4M3HA 1GY2A 3NJIA 4KOCA 3AG1B 3CZUB 4AI7A 1QNIA 2BO0A 3T6VA 1PLBA 1MZZA 1AACA 4TXVB 2XWZA 3DTUB 2QDWA 5B7EA 4KO7A 2VSKB 2QDVA 5B7MA 2FT8A 4WKXA 3H56A 1A3ZA 3NSYA 5I26A 2XYBA 1PZBA 3N55A 1E65A 3NJMA 4DP6X 3IN0A 5B1BB 4HZ1A 3HB3B 2ZXWB 3S3BB 3ABLB 1AZRA 4DPBX 1CYXA 3UADA 1KBVA 3FSAA 1ASPA 4KNTA 2BP8A 1E5YA 3T9WA 1OCRB 3QJSB 1MG3C 2X88A 1OE2A 4E9RA 3X1EA 2FQDA 1OOWA 4BXVA 1AZUA 3NJNA 3AG2B 1ILSA 1IBZA 2IDQA 4GYBA 4A68A 4DP7X 2BWDA 2BP0A 2J56A 1JZIA 2CALA 2IWFA 1DYZA 4GXFA 6PCYA 4WTQA 1JZHA 1CUOA 3TU6A 1PLCA 8PAZA 1BQ5A 5B1KA 1ZDSA 3SQRA 3ERXA 5ANHA 3EH5B 1JVLA 1QHQA 3OQRA 1GYCA 1JZGA 1NIEA 2HZHA 1JERA 2BZ7A 4HHWA 4ENZA 3PPSA 1X9UA 4HCGA 5D4IA 1EZLA 1I53A 2FT7A 4F2FA 1KCBA 2I85A 3OMNB 5B1JA 2I7OA 3T6ZA 2UXFA 3QQXA 1IBYA 2FQGA 2VM4A 1NZRA 1SHWA 3U25A 1KCWA 4FA7B 1AG6A 2VW7A 3S8GB 2AANA 1OV8A 4YSSA 3FSZA 2YXVA 3FU7B 3H4HA 3PCYA 3FU7A 1RZPA 1OE1A 2GSMB 1AG0A 4DP1X 2GC4C 1HAUA 5PAZA 4RH4A 2HXAA 1AZNA 2HRHA 4UANA 2YAPA 1F56A 2MTAA 1IC0A 1AR1B 3ZDWA 1RZQA 2WSDA 1V54B 1T5KA 2H47C 3AG3B 2PPAA 3G5WA 3PAZA 1NPJA 2HX7A 1NPNA 5I6OA 1GR7A 4HIPA 2H3XC 4E9VA 3ZX1A 5F7BA 1ZPUA 4YSPA 1KYAA 2GHZA 2IWEA 1UATA 4YVNA 4HCIA 3RYMA 4GP4B 1ET8A 4A2EA 2FWLB 3X1NA 4DP5X 3T6XA 4F2EA 2J55A 1NIAA 1AAJA 1GS7A 2CUAA 2BW5A 2EIMB 2IAAC 2YAOA 3FT0A 3FYEB 5B1JC 2XX1A 4AZUA 2IDFA 4YSDA 1NIDA 4YL4A 3UAEA 2PP9A 1ADWA 2IWKA 5D4HA 4N8UA 1KV7A 2BHFA 1NDTA 1NIBA 3DKHA 2IH8A 3PAUA 1V10A 5B1AB 5I5MA 1AS6A 2YQBA 1BEXA 2EILB 3UAAA 1A4AA 2DV6A 1RKRA 2DWSA 1GS6X 4DP8X 5I6KA 2VM3A 3NP4A 4YVUA 2EINB 3FSVA 4PAZA 3IE9A 1WS7A 1BXAA 2YAHA 3AY2A 3HEIB 1L9OA 4KOBA 2GB2A 4A66A 4DP0X 5I6NA 1J5CA 2WO2B 2N0MA 3L45A 1OCOB 1OE3A 3KW8A 4HALA 1XB3A 2BP8B 2YAMA 3TA4D 1RCYA 2HX8A 2XXGA 4K9JA 1ID2A 1BXUA 5AKRA 1CC3A 1NWOA 3CVCA 2BZCA 4E9WA 1SF5A 3OMAB 1ASQA 1L9RA 1SFHA 4BWUA 4X4KA 2JFCA 7PCYA 3X1GA 1GS8A 1CURA 3JT2A 2W88A 2XVBA 1FA4A 2AZUA 2W8CA 3WNJA 2TSAA 3ABMB 2OV0A 3GYRA 1KBWA 2A3TA 2NRDA 4BDVB 3IEAA 1N68A 2GC7C 4KO9A 3TBCA 2PPEA 1MDAA 1AOZA 3CDZA 1PNDA 2OCCB 1GW0A 4UAHA 2ZONA 4HCFA 1PNCA 1WA0X 1PCSA 4BK5C 1XB8A 2EIKB 3EHBB 2ZWNA 1BQKA 4UF7C 1AZBA 1E30A 2I7SA
chains in the Genus database with same CATH superfamily
4BWTA 3RFZA 3ZHLA 3L5JA 1DL7L 3BSGA 4PN6A 5AG8A 1M53A 3DVGA 3FFCE 4G7RB 3MNVB 3L4WA 1U8LB 5EC2A 5HGAB 2XG4A 5SWZE 2HSIA 3APCA 3IJEA 1M56B 4W9ZA 1ZIBA 3SDAC 4G7QB 3ULVF 2G60H 1QNZL 5IVXB 5J57B 4CVZA 4MYWB 4BUHA 3DIVA 4P05A 3KL5A 4KK6D 3OWRA 4OM0H 4IMKA 3VFMA 1MJUL 3BEWA 4YE4L 2YMXH 2DQGL 4NC1C 5E8NA 4YMPA 1SDYA 3QJVB 5E8NB 3QQNA 4YLQT 2OK0L 4G9FA 1X4XA 4WTZG 1NFDA 4P2OC 4LSSH 5LXGH 5DFWH 2B3IA 3GDCA 3Q2VA 5F1NA 4IOFC 4L29B 5I28A 2EVFA 1KF9B 2R1XA 5HVHB 3LPWA 1QYGH 3EO0B 1Z32X 1W6LA 2AK4B 3LXAA 3DMMB 4RFOL 4FFWC 4MAUL 3VI4B 3ZKND 3DMMA 2O6CA 5EC1A 1X7SA 3ZK0A 1W0VA 4NQDA 3CPLB 3NG5A 4LMQE 1DDHB 4I5BA 4G8IA 3UP1A 4ZMWA 4O4YH 4OZGF 3QFJE 1ETJA 3RNKA 3CX5J 2WW8A 3L5HA 4WUUD 2A6DA 1KIUB 3L7EB 3PGFH 1TVBA 4TQEH 1WAEA 3DPBB 4ZDHA 4F7CB 1MHEA 4HS8L 2C7UB 4KQ3L 2CXGA 3KG5A 3PXJA 4ZFFB 4ZUTB 4IRZL 2JKIS 1B90A 4HUUA 2H26B 1G7JB 1GGYA 4GAJH 5HXMA 1RU9H 5KVMC 2FYYA 4PFEA 4OV6F 2FO4B 2E5EA 2Z4QA 3L7FA 1QBBA 3L13A 5CZRA 5J12B 4FG2A 1TR7A 3P3TA 2ZOUA 1JDDA 2BSBA 3LB6D 1P1VA 5T5FL 5L6YH 3C5SB 3LKPB 4G7YH 4TNVK 4N87A 5BMFH 4JPKL 1OCWH 3D39E 2ITCA 2MCG1 3NRQA 1R3HA 1QFUH 2CJUH 2WXFA 3FONA 3TNNB 3T77A 1MFMA 3X1BA 5F1IA 4J4PA 3OGCA 4P46D 3IBEA 1RZFH 1ZANH 4AVKA 1U4EA 4FMKA 4E9SA 2HKFL 5A2FA 1QLEL 1V7ML 3UJIL 4LEXH 2B4CL 4EKJA 2CRZA 2VDKH 3HRPA 3UBXG 3VXUB 1PY0A 1AXSA 3WO4B 3ARGD 4RMSA 3X3GL 5ES4B 5D7SL 3O3AA 2XRAH 3FF8A 1IGFL 5J12C 1AQKH 1U8CA 2H8PA 3DARA 4HAGA 2DYSB 2WXRA 2D7MA 3CVHA 3RVXD 3VFUA 4A6YB 5IWLC 5CP3A 4JY4B 1DQVA 4MLIA 1IKOP 2ZKHL 3CZGA 1AVAA 4K5MA 2OTPA 1KT2B 4NRXA 4PCYA 4FNLL 3DJTA 2CO4A 4R90H 5IFJA 1U8KA 1PZAA 4MJ5B 5C07B 3UX9B 3IAGC 2W0PA 2E7LA 4NZUH 4HIHB 5L2JB 1N6UA 4L9LC 2A73A 2CIKB 4G80B 3KL0A 3VFMB 5JPNC 3IAQA 3ZTEA 4ZX5A 1UH4A 2ENQA 1EZVY 1OSZB 4O58H 3DA0A 5KAQF 4P59L 2VCOA 3D3VA 3RIFK 1XV8A 2K8MA 3GGWB 1BECA 3QDJE 2OMVB 4WJKB 3VG9C 3ZQ9A 2EDOA 2AJXL 2PCYA 3RU8L 3T4YA 3QYMA 2MRYA 5TK2A 4Y2DD 5JW4M 2WKLA 1CBVH 1F0LA 3RIAF 3CX5K 3H9YA 2UY7A 2W0LA 4M6NH 3O0LA 4NC0B 4ODVL 1NMAL 4XXDB 5I1DA 3QUGA 3BVNA 2IG2L 3D4YA 1ROWA 2BVTA 4GJTB 1J87A 4ZFOA 2DDQH 4GMTH 4IBLT 4X9YA 4NQEE 4X98A 4XPGL 5HHOB 2DLGA 2WLZA 2OULB 1EEQA 3T0EB 1F13A 4L3ED 2AQTA 3RWCA 1INQB 3LNFA 4L18A 3DECA 4UV4L 4ZNEA 1LE5B 4KJWD 4X8JA 2VJXA 2RB8A 2F54B 3P9LB 4I0CC 5CU9A 3E6FA 3OKDB 4PJ8D 1WD9A 1LL1A 1KBKA 2UZIH 1O9ZA 2R69A 2BDNH 1OAYL 4N4YB 4ETYA 3ISWA 3RVXC 4Y5XA 3HI6H 4OF7A 5DZPA 4JX0A 1KSRA 3S5YA 3ULVL 1H5BB 3NA4A 2AVFA 1F4WH 1KXQA 5GZNA 2ESVA 3E9TA 1CG9A 4JCWA 2GW5A 1M05A 1NCDH 2EUZA 3AQDA 3TFKC 4IMKC 3DURA 4OAWA 5KVEL 4QGYA 5GSRA 4BYHA 1MFCL 3H2PA 4PS4H 3QG6B 3DMMD 4YHOH 3F58L 3VG0L 1PPIA 1R47A 1S46A 2FUQA 4KROD 4DNLA 4O2EA 2W0FB 4OZGE 2KDYA 1BMWA 1R0AL 1IV8A 1YAZA 2P47B 2WNWA 4KKLD 5AW2B 5B4MC 3RVUC 1PDKB 1J05B 1CGSH 2WXIA 2UYLA 3MLTA 1KENL 4WEEA 3VXTB 1BVNP 2DYPB 2UZYB 4H8PA 5J13B 2EIZB 3S96B 2B5IB 1DBBL 2O6EA 4P2QE 5ICZB 4QHMB 3ILEA 1IM9A 5G2NA 1IM9B 1AYOA 1EERB 1ZAGA 5DJ6B 5D72H 1EHKB 4XVSH 1SDDB 3J07A 4WI0A 3L3OA 2FDBP 2X2UA 4NKDA 2FUTA 2XZCL 5KSVB 4WCYH 3OB8A 4L8SB 1WZ1H 5DJZA 2VDLL 4OM1H 1QPXA 5KTEH 1EFXA 5BOJA 3DDGA 1LEIA 5LBSL 3V6FA 3GF8A 2VN4A 3CPLA 1COBA 1PD1A 2H3NB 5E2WL 4BELD 3QIWD 2VSKB 5B7MA 3JTSA 1BBDL 2Q8BH 5CEZH 4P2RA 5H37H 3QO1B 4F20A 2ZCKH 2COQA 1D9KA 3NJMA 4Z7UF 4DP6X 3IN0A 5ISZE 3C8DA 4NUGH 4XMZA 3TT1L 3ZDYE 3HB3B 1A47A 4M48H 1B0RB 2D03H 1FUNA 5JLZB 2ZIDA 3RTQC 3P11L 1AQDB 1QOKA 5TQ2H 1U8HB 1Z9OA 5GIRB 4KNTA 2ADJA 4HH9B 3GBMH 1F1DA 3JWDL 4P4KA 3KM1A 1T1ZB 1V5JA 3EYSH 3BPLC 3MZGB 4CMHC 3UO8B 1T7YA 3OPZH 4QJ3B 1MHPH 3X13B 2N7AA 5KYWB 1KGUA 1LK2B 4YC2B 2CALA 2IXQB 5DHYA 1EZVX 2AEOA 1QPKA 5H8DA 4H0HB 1FH5H 5I9QC 3B2PA 5D5MB 5J6HB 4V1DB 3C60D 2C3XA 4N2IA 2ODIA 3OLEA 4WF7A 3WL9B 3UH8A 2QGEA 1MJ8H 2X1XR 5C6TL 1KG0B 2YMOA 3OQRA 3TEWA 2FD6L 3MJ9H 1DLFH 4X6FA 4F1SA 1G9NL 5D7JC 4HHWA 4KTDL 4J3VA 5IQ9B 2PWEA 3DDFA 3PPSA 2VL5B 3FT9A 3VAEA 2G2RA 3IWUA 1E3XA 3O41B 1A6UH 4AC2A 4C58B 2X53A 3GEWB 1H8SA 1C16B 1JN6B 4LASH 3U4EB 3HB3C 1G6RA 2ZX7A 4JFDA 1VFOA 1OV8A 5IG7B 1M4KA 3FSZA 2VLRA 4F7EA 4OJEH 4JFFB 2JI3A 2YUZA 3MUUA 3SYQA 4B9CA 4PJ7A 4M7ZC 4MAYC 2CLRA 5MP6L 3JTTB 4ZSOA 2VERA 1XSOA 2BVUA 3BDYL 2FK9A 4G6MH 5AZEL 5D70L 3ECVA 4NHUB 2EIZA 3NCJH 4Y4KD 3S96A 2C1OA 4PJHB 2Z31C 1H3VA 2HFGH 5C9JB 2Y36H 4QYAA 2J2ZA 4FG6C 1OF2B 4GBXD 2C3VB 3KLQA 3CTTA 4JFOB 1K4DB 4HHAB 3HA0A 1NC4A 3N91A 2P49B 4JKLA 3QA3B 4EXPX 1EHNA 3BZ5A 1WLHA 2KLTA 5E6ID 3N40F 3ET9F 4YDKL 2ESVD 1T66C 4JG9A 5AYUH 2MNJB 5T33L 3SQOL 2Y1YA 5D7LD 1IE4A 4EI5B 1AO7D 1UATA 3EGXA 3FZUD 3KVPA 1HS6A 4H1LA 2AEPH 4A2EA 4AG4H 4HK0B 1R5IA 2D73A 3VMOA 1DQQB 2NY1B 2CKNA 4N2NA 1BQLL 1RZ7H 3BYTA 4TRPH 2CUAA 3CSYB 2R4RH 2XWEA 1A1OA 4GW4A 4J8RA 4JQIH 2R69L 4AYSA 5I2IB 2WUBL 3EDEA 1Q9KA 3MRKA 3VJ6A 4HJUA 4HKZB 4FFTA 1JVKA 3E2HB 1E4WL 1IJNA 4M8RA 4F9LC 2FEJA 4OT1L 4PEEA 4M8QA 4XP5H 4AT6A 4HUKB 3PHAA 4F33B 3FQTB 2QADB 2R39A 1KJ2B 4GW5A 5CSZB 1MCKA 2VITA 1BVLB 3OXRB 1RZGB 3RX8A 3VXPA 3QR2A 3VI3E 2F2HA 4AV4A 3GRWL 4ODXA 3AY2A 1G9ML 1NGWA 1A7PH 5KSAC 2K3HA 1H3GA 1WFMA 1TITA 3TV3H 4HALA 5EZIL 2XQYA 4BE5A 3MOBH 5SWZD 4A04A 4ZI8A 2OL3B 4PJGE 2IQ9H 4WFED 5GHWH 1HL8A 2ZE0A 1UGNA 1BZ7A 4QRPA 5FFOA 1YEHL 3UDWC 4HVBA 2VIRB 4E2OA 1G9NC 1R75A 5JR1H 3GFUA 2ZUXA 4QCIB 2B4CC 2WXKA 5BZWB 2R1WA 2CM5A 3ECBB 4RIRB 3HS0A 1Q9OA 4M6MH 4YHZH 4OM1L 5DD6B 3RL2B 2LT9A 4TNVF 1KIPA 3CLEH 4XE0A 3PWUA 4HIHA 4PV9B 3EHBD 5LGKA 3FRUA 5L8JB 5E0QA 3WELA 2G9HA 1SXNA 1T1XA 2EDTA 3FH5A 2HTKC 3NSXA 4MGXA 4CN1A 5HD8D 1YUHA 1QSFB 1PCSA 4N2OA 5IW6B 2DQCH 3ATAA 5DMGC 5LGJA 3JVFC 1JPST 3JV4B 1RZ8B 2H1PH 4IBYA 2E47A 2DQDL 1K8DB 1MW3A 1E9QA 4KNSA 1SHSA 4HF5L 3MQIA 3L4ZA 2CRMA 1NDGA 3APNA 5IMOB 4NBYB 12E8H 4FULA 3CMOH 2OMUA 4I7ZC 3IM1A 2EIBA 1FL3A 4AH2A 5C0JA 5GZOA 4PCKA 4IW4C 2AK1L 3QDGA 1Z5YD 2A7BA 2GIMA 1PZCA 3BN9D 4AQEA 3N5AA 1J0IA 4DVRL 3BVDB 1G87A 3QNYB 5GGSA 1P7QA 3WN5C 4BUQA 2EDJA 2YLKA 4GO6B 5F1KC 1PZ5A 4PJFE 4KV5E 3IJHB 3B8SA 4OJFL 3RVVD 2A9MH 3GO1H 2DKMA 4AENB 2KUTA 2DY2A 1XF5B 1N4XL 1ZCRA 3K46A 4L8CB 3ZYOA 3HHSA 4R26H 2CGRL 2F19L 3H85A 4S2SA 4LVEA 2VRQA 2ZXGA 5DQJA 2EYRA 1OK0A 1KEML 3QPQD 1SQMA 2DM7A 5ACMA 4JFXB 1CCZA 4KDVA 4XBMA 5CWSB 1MFBL 1UACH 4X42A 1PLAA 2A6DB 4L1DA 5JQHC 2RFXB 3SDDC 1JZEA 1IKNA 3VE0A 3LQAH 2NSQA 5JXAL 3SHSA 1L3NA 3VI4E 1QLRA 1QQDA 3IS0X 2NY3B 3TLRA 3F64A 2JJTA 1L7IH 4MQTB 1Z9LA 5DJXA 2XN0A 1W72B 3RWEA 1LWHA 1CICD 3QXWA 1BW8A 4Y1SA 1GVIA 1JZ5A 2E4TA 1AIFA 3N9GL 3TVMA 1GGUA 4NNYB 2EDNA 4N5UA 2VNCA 7PAZA 3BZEA 5DTFB 4N9GB 1KTLB 1KMGA 3ALPA 4L3EB 5T1KA 1X9LA 3FOLB 5BRZE 3B6SA 3NT0A 2BMKA 1IO4C 2H32B 1RUKL 4NNPL 3QDAA 5D1ZI 2JTYA 3R7RA 1JWMA 3S3JA 3DLQR 3SKJH 1PF3A 2YSTA 3ZLQC 2NSMA 3GWJA 3FCUB 4EOWL 5A6IA 2WB1A 3MODL 4QHMA 4WHYH 1SEBA 1E4WH 3NAAH 3GMMA 3MRRB 1XSKA 4E9YA 5L4FA 4N1EA 5C3IA 3O2WH 2EDKA 3NDYE 1D6VH 4BK4A 5E7FA 2YGOA 5D1ZA 1VGKB 4J6IA 2OXGA 4QOKA 3H53A 5IB5B 4KNQA 3GNML 3QULA 1CVSC 1E28A 1I85C 1J0YA 1ZOXA 1F11A 3DX7B 3HFMH 5F9OL 4WCYL 1J10A 5EEUA 1T0MA 5DD1H 3U9WA 1ZHBB 5EB9A 1YMMD 4M03A 4U05A 2FEEL 4G11A 3IJSA 2JMRA 4M6OH 4XN7A 4FQ1H 1JI2A 1UZ6E 4JL1A 3L7EA 1FL3B 3CSYA 1A9EA 5CZXC 1ZSHA 3X3GH 3EH3B 5DEFA 4J12A 1WO2A 1YN7A 1JK9B 1QHPA 5BZXA 3HLKA 2Y6SC 4XC3H 2IDTA 4DZ8A 4ELKB 4WI2A 4ZMYA 2WBJD 5IVXE 3GXUB 3QR0A 4G6FD 3WLWC 1IM3A 3T4AA 2CR3A 2PYEA 1VPOH 1RZ8A 1J18A 3ILQC 3VU2A 1SN5A 1KTJA 4MBRA 2OMZA 4X9HA 2I9LA 3QUMA 5K69A 4K8RC 3KE0A 4LDLB 3UGXA 3H4FA 1DJWA 1FZKA 3V52L 3C09B 1UM5L 3IB4A 3QFJD 1LO2L 3ULUH 2DQTL 1I7UA 1W80A 1VCBC 1ZS8B 4Z7AA 3NFSL 1M57B 5I6LA 4FOMA 3K6NA 1MRDL 1TJIH 1WEJH 1MCWW 4P46B 3X11B 1J0JA 2QPUA 5I17B 4LDCA 3O4LE 2R1YB 4R96A 5EEVA 4PB9L 1QEWA 5SX4H 3HAEG 1ZLSH 1ZIAA 5EH1A 1QQDB 4MNGA 4KTDH 2YZ8A 4FXGC 4KK6C 2H8PB 4QT5A 5I6PA 1CDBA 1FQ9C 1W2KT 3NQIA 5EFIB 2Y24A 4DGIH 3MI6A 1D5MB 5A2AA 3L2MA 3AUWB 4PJGB 1EEYA 1PAZA 5F0PB 1T0NA 1CG9B 3BUIA 1Z3GH 3CSPA 3O3BA 4QJ5B 3WY1A 5GGUB 2J72A 3MUJA 3OMZA 1SBBA 2F53B 1BLNB 2OJ1A 2QSCL 4E36A 3BRFA 1CICB 2VN6A 2XTJC 5JDSA 2XN9E 2HLAB 4XN1A 4NIYE 1OP9A 3GIVA 3LKRA 1C8PA 5IQNA 3ZTNL 4R7LA 4K3HA 3T09A 1E8XA 5E6SB 5I8KH 4G82A 2XC8A 1RUPL 3F62A 3QORB 2OZ4A 4I1RA 1KPVA 3EDFA 4XE5B 4JHZA 1BLIA 4QYOA 4EF3A 5C0AB 3ZQWA 1ZHLA 4Q97A 3ARYA 1S7RB 3AMLA 2CO6B 3B43A 4DVBB 2A9ML 2YWZA 1GHFH 2YEZA 4FQXC 5L88L 1AKPA 1CDUA 3LKOB 3LXUX 1KIRA 2EEFA 5JXED 5I1DB 3V55A 1QO3A 4MZIA 3O9WD 1CDIA 3BMVA 4OLWL 3TA3B 4LF3A 5DLMH 5ETUB 5I0DA 4S1RH 1YLBB 1QFWM 3FU8A 4YHPB 3Q13A 4QXGL 5L9DL 1TZIB 4PH8A 2KLRA 1DLHB 3BAEL 4XI5D 2AQNA 4ONHA 4JANB 4JY6A 4AOFA 4J1UA 1XX9C 1AHMA 5F93C 4LOVA 5FX3A 4OF5A 4WNQB 2A1WL 3H7BA 1MFDL 4AGNA 4AI7A 3BZ4A 4HS6B 4AYMC 1NBVL 3UZVB 3DI2B 2N0KA 1TCMA 2XQBL 1SVZA 1OAQL 3Q0HA 1KPRA 2A74C 4TL4A 32C2A 3CFJB 5KVFH 5B7EA 1DUZA 1PX4A 3V0VA 4G8GA 1I1AB 2FT8A 2KHAA 4ZOCA 3NSYA 4XVUC 3LD8B 3QXAA 3BLPX 1D9KB 1SOKA 3ULAB 2EVJA 4E0RB 4XBGB 2QQKH 3SGEH 5CJQL 2J20A 4W9HC 2X05A 1YDPB 2ZWKA 4N0FB 1FG2B 1ASPA 5E08H 2XQ0A 1Q0XL 2X4RA 1OE2A 3ESUF 4UV7L 4P2QA 5LXVA 3RGVD 3MCLL 3NIFF 1CQKA 1OOWA 5KBKA 1CFSA 3QZPA 1M42A 4CJ1A 3M1CA 4G6KL 4HJGB 4L4TE 2KERA 1OTUC 4N2HA 1OK8A 4ANVA 2OCJA 3H6JA 3HVNA 1S7UB 1CL7I 1N64L 3FQXB 4GI6A 1KCUH 5EBMB 1EBAA 3SGJA 4DPRA 5IROA 1DL7H 3THML 4ZUSA 3QRGL 4LLUA 5I0XA 1NL0H 3U0WL 3SDDA 1XDTT 2RD0A 1JVLA 2FATH 3FN0H 1KOAA 5DZLA 1ODAA 1FIGH 1QSED 2X6BA 15C8L 2VR7A 5KN5B 5EIIG 2DIBA 2NY7H 2X4SB 3QEHB 4NI3A 3V0WL 3BRDA 2IPKB 2NDGA 1UM6L 1QYGL 1ZTXH 3MRMA 2IFFH 4JPWH 4YXKL 4TV3A 2I5YL 5F9OH 1U93B 3ARUA 2I7OA 1B2WL 4LLYB 1RMFH 4GG6F 1RUML 4FZ8H 4GG6A 4FXKC 5EUKA 5DUMH 2NX5A 1HQRB 5DRZB 1FZMB 3GBNL 5C97A 3SODB 3HS0C 3N85L 4BEIA 3NFNB 3SBWC 2YD6A 5DLLA 3LKOA 3GLEA 1UKSA 3C60B 3EFDH 5D6CB 3WJLA 3MBED 3ELQA 5DFVD 2G4GA 5HHOA 1D5BA 4RH4A 4ZMZA 1I7ZA 1LK3H 4NM4L 1DN0B 3ZRSA 1AKJB 4Q6IB 5LQBL 3QUYD 1N6QL 5MEOA 3S2CA 2CIIB 2QVIA 4YPJA 4FKEA 4NFCA 4ZOAA 3ZZSA 4P2QB 1K4DA 3IVKB 5HHVL 5T5NF 4N0CC 4WHDA 5KW9H 3UTTB 3UO1L 4D8PB 2EDDA 5EEZA 3KXFB 1JV2B 3SCMC 1CFNB 3O2DL 2FBJL 2ZWSA 3ARGB 2Y2YA 2BNQD 3CFKB 2V9QA 5E9DA 3A6CL 4U6XB 3CFKA 3QZNA 4XNDA 3K5RA 1YSOA 1I1AA 2GIXA 2NYZA 2ZOKA 3VGBA 4DP5X 1YCSA 5EU7C 1AI1L 1UOKA 3FO0H 3U46A 4ZUUB 3MRBA 2FO8A 5JPMC 4POYA 3ZKNC 2NY3D 2XX1A 4KRNA 2YPVL 1R3JB 1KYOK 3QUYB 2XWXA 1BZ9B 3IFOA 4MNGB 3CV5A 4GBXB 4N8UA 4DN3L 2VM9A 1GAFH 1SY6A 2AXFA 2LAGB 3CAFA 5DK2B 4IJ3C 5MI0C 2VO5A 3LXCA 4TUJA 3CXDH 5DEJA 1J48A 2B9AA 1HNGA 5CSBA 3NABL 4OZIE 2LU7A 3MRCB 3T8VA 2EINB 1MHCB 4LDOB 2A4ZA 4JFFD 4FDWA 3M07A 4Z7IA 2ATKB 5DXWA 4WU7A 1RIHL 2WC7A 1MQKL 4IRJB 1MCWM 2C8NA 3UEQA 3RURA 4OLZL 2GY7B 1BVKA 3I6LE 1ID2A 2MH4A 1C8QA 5AENA 4K23L 3PHSA 4ZFZB 5C0BD 1QPPA 5HGHB 4LVOB 3MBEC 1HQ4B 4GSDH 4XCNB 5IKCB 4M5YL 4EBQH 3CFDB 3II2A 5ENWA 3U2SA 3S97C 4E5XB 4HEME 5DUBB 4TM9A 1IGIL 2Y5TA 2BZDA 2WQSA 1GS8A 1MLCB 4EN3C 1G43A 3NZ8B 4LXFA 1BZDA 1S7UA 2XQYK 2F74A 1WRFA 3BO8B 2QFPA 1XCTA 3C6LB 2AMGA 5I5RA 2NR6A 4ES8A 4N26A 2OV0A 3MGTA 3LKSB 4WK2B 3WNOA 4X98B 1NOAA 1KBWA 2VISA 4MMXC 2AJYL 1TSHA 2Q8AL 2L8AA 1HEZB 5JHLL 5IM7A 3F05A 4R9HA 3A67H 3P3YA 3MBXH 4HIEB 3HC3L 3WFEL 4ADGA 3G9VA 1T5XB 5EO9B 1JYWA 1PLGH 1X5JA 3EHBB 4Z95L 1XF2A 3D48R 5J9PB 2JKXA 1O7VA 3NACH 1J1OL 3HB3D 3EO9L 5F7HA 1IUZA 1C5CL 1SHXA 3MAWA 4HBQA 2C9VA 1E9OA 4PJ7B 4G8GB 4Z7OF 1GSKA 5CSZA 3A24A 2X4PA 5AL0A 1G6VK 2OZ4H 4AE1A 5F7EL 1OM9A 2L3BA 4LPTA 3KLLA 2OSYA 2PXYA 4YSQA 2ICWA 2F7OA 5CEZE 1KCRL 1XGTB 1ETA1 1NFDF 2IANE 2Z4TA 2NNFA 4S1DD 5EUOA 1LP9B 1TZ8A 3KLAA 1GJUA 3KPOA 4NQDD 2VIRA 3SBRA 3OVUB 5J13C 5DUBA 3MLWL 4R97B 2XTLA 3QZWA 3FQYA 1K85A 3LSOA 4QTHB 4AGQA 4NKOB 1J1XH 1ML0A 2ICWI 4KHTL 4H1LB 3CVBA 5IF0B 1JWSA 1X44A 4APXA 4DERA 3IJSB 2HKHL 5CILH 4BQ9A 5J06A 2J88H 4YSTA 3MTXA 3BAKA 1YEKL 1JZ7A 4JVPA 1XF4B 3PLYA 4DZBA 1AD0B 4PRHB 1RURH 1ET5A 1NM4A 3MRIA 4MDJA 3V0FA 4ZW3A 5B3SB 3WI9A 1Y18B 2BY1A 3LEYL 3N04A 4N8CL 4NQEB 2WKOA 3KGUA 3VH8B 4PG9A 1DJYA 2WKOF 2BWIA 1IGML 1WD8A 4L4VD 2L7JA 5DC4B 1KTKE 3PJSB 1NJ9B 3QRFM 3EYSL 1F90L 2WTPA 2G75A 4TLUA 4ZMAT 4OIIL 1TVHA 3GXTA 3SOTA 5F71A 1VACB 2X6MA 3N2JA 2OMUB 4XMLH 3F6LA 1R3IL 5BW7C 3GMNA 3FOLA 2AJVH 1WVZA 3FTXA 5FM4A 3RTLA 3F7YA 3O2VL 4HK0A 4POUB 5E9NA 2DLFH 2JCCB 4L1LA 4LEOA 3BIBX 5F7NC 2NW2B 5FYJD 3LZRA 4M4RA 4HFWA 5E5RB 5KVEE 3QAQA 2O61B 3MA7B 2HPTA 1U8PA 3PQYA 1JF1A 4Z3IA 2IV8A 2NTFA 4LNRA 3SDCD 2XHNA 2VXQL 3HOGA 4JO8A 4TPRL 2QPFA 4HJ1A 3VSVA 1KJVB 3W37A 2R1XB 4GNKB 1CFNA 3B83A 1MSPA 1PSKH 2YR3A 4G43A 4PJ8A 1CLOH 1MG2C 2W94A 1NEZB 2GTQA 5EOTB 5DQDH 1E5AA 3QG7L 4MFHA 2YKLH 3BGMA 1TZHB 3LRLA 4RQQA 1H15A 3HMXH 3W9EA 2FIKB 3FT2B 1A6UL 4P9MH 3U7WH 1SN0A 3SE3A 4QO1B 5FGBC 3ABZA 5C0BB 1SM3H 2AZAA 3QCUL 2Y5EA 2GBAA 4XVTH 1RVFL 1BXVA 2DL2A 2OI9B 3GKWH 2ZOTA 4QRUA 2FE0A 4UT6L 1U58B 3HR6A 4P23D 1JN6A 2BINA 3VGHA 4Q6KA 2NNXA 3ZIYA 4UILL 4U6YA 3GXNA 5GHWL 1JXGA 4OFQA 4V1DD 5GRUL 3VB8A 1VGEH 3SPIA 2X44D 2X0WA 1XR8A 4DVBA 5BV7L 1VADB 3CCHA 3OJDB 1MCIA 2DIJA 2WTRA 2OJEA 4X4YB 3U4EA 4Y5VA 1KFAH 5DGRA 5KVGE 1T1YB 3X12A 5CINH 3IDXL 5GGSY 1WAAE 4FCAA 4KAQL 5FA4B 2ORBL 1JGVL 4Y8DC 3PNWA 2MSPA 2VXVL 3Q8BA 1DQLH 5EZPA 4O2FA 3OHXC 2AXWA 5TE4H 3M46A 4I48B 2WPGA 1UXWB 3CDZB 2F5BH 2F54A 1ZJBA 3C08H 3K72B 3P9LA 5FFGA 5CD5C 5L2KE 1SDDA 3AFLA 2X4QA 1K9TA 5TJWK 4ZPVB 4O51A 3VXUD 4KQ4H 4I0KA 3WMQA 5AOKA 4BKSC 4KC3B 5K9KB 1E2VA 4TSAL 1LGVA 4H25B 5FAAA 4B5ZA 5HVFB 1NEZA 1EPFA 1O0VA 2MOGA 3HLAB 3LSOB 4NQTA 1JTTA 4PRHD 4Q89A 5KTEL 5J3HD 4I5BB 4A2HA 2WP3T 3ZHKA 3WFEH 1NFDE 1HL5A 1H3TA 4YGAB 4OD3H 3ILQD 1CGVA 4IMLA 1QRKA 2VUYA 3WFHA 4DPAX 1DJXA 1S7VB 2YAFA 1B4JH 3PXLA 3W57A 1IGFH 3MLYH 3V9EA 1D5IL 1KGIA 4FQHA 3GSVA 3GBEA 2Z91A 4NKIH 3KDMA 1MVFA 2HUEA 4NJAH 3VNYA 4M1GL 2VZUA 1XIWA 5C08D 1I1YA 2MTPA 3P73A 4AMKL 4WTWA 3U1PA 2XTSA 3PE9A 2EIJB 2Q8BL 2L0DA 25C8L 5HYFA 3ZVVA 1MIEL 4Y4HC 4OT1H 4S2SB 3E38A 4NUGL 3TT1H 4K2UH 3OGCB 1IM9D 1F6FB 5DD0L 1W8OA 3DBSA 2VJ0A 2H4EA 1MLBB 3CIQA 1UH2A 2CDEA 5KN5A 4GINA 4I48A 2XKUA 3HC0B 5IK3B 5AAMC 4OUOA 1FVEB 3B9AA 3B3BA 4X7CC 3W9DA 4JR9L 4EVNB 5CHNA 3KH4A 4I2XA 2PYFB 4FNPA 2YRLA 3O41A 2AABL 5CLZA 4I9WE 3FC8A 3UYRL 5CGYC 3WTTA 1H3PL 3GSOA 1GY2A 1WF5A 35C8L 1QSEB 3FQUA 4X0NA 2D3LA 4UT9H 1G1KA 5IWLA 1MZZA 1GAFL 3NPSC 5E4AA 1N0LB 1OD9A 1DBAL 4BFRA 3NCYP 5C0FA 4KO7A 5DWUL 4HA1A 4FQ2L 2KC0A 1BX2A 5F21B 1VHPA 3N1MC 2QKSA 2H9GB 2EUXA 5D8JH 1MW2A 2FEDD 5B1BB 4PV8A 1LWRA 3DUSA 1U8JB 4Z8FH 2ODHA 4P2OB 4AC4A 2FR4B 3FSAA 1KEGL 1G7JA 3N06B 3WNMA 1OSZA 1Y6NR 3ZDZB 3MOQA 3KNBB 3HR5B 4IDJH 5MERB 4NQCE 4AL8L 3IE4A 5K59E 4UBDC 1A6ZA 1BOGA 2MPAH 2YMXL 3DYOA 3HN8A 4H20L 4HWEL 5KVGL 4BXVA 3FKUS 3NJNA 3AG2B 1D7CA 3CU7A 1NMAH 2VN7A 5B39B 3F2LA 1I7TB 1PD6A 1JZIA 3PWPA 1H3UA 3BUYA 3G6DL 3KMDA 5LCVL 4U6XA 3WAKA 4POZD 5EBMA 2EXSA 3VH8G 2V4LA 4NAQA 5B1KA 4HLJA 4G42A 4PW9A 1QABA 4ZFOB 3WTYA 5HHPB 3A23A 4PR5A 5DWPA 1GYCA 4FLRA 1J86A 2W80C 4P2CG 4ATWA 4GW1B 5IVZA 3K8KA 5IVZB 4F9PC 3NA9H 1VFUA 2VXQA 4ISVB 1RUQH 2LQRA 5ICUA 3ZT5A 2VZ3A 2Z35A 1T83C 2FX7L 3L3OB 3ZYIA 1V8HA 5C0AD 4HUWB 3GUTA 2WQXA 4OGXL 4AEEA 3ARDC 1S7QB 1XT5A 1NAMA 2OMZB 5DVPA 4FXLA 5FYLH 4FQLH 1FVDA 2DWEA 2YXVA 2BIOA 3W39A 2XG4B 32C2B 1ZT1A 3CFJA 1FZMA 4KKCC 3WNNA 4R7DB 1JMZA 2N01B 2P7TB 3I85A 3K1DA 3V0WH 1FFQA 3N6YA 1BREA 1MUJA 1XGRA 5C08B 1QA9A 4Z7UB 3U36B 5IHUH 1HAUA 1SMAA 4FNRA 2OMXB 1HX0A 4NPYB 4BSWA 4BQ8A 4UB0L 3D2TA 3MNWA 1TKWB 4RAUB 2BCKB 1F56A 3AU1B 3CMGA 2NY2D 5JA9A 5KYXA 1V7NL 3CHOA 3ARBB 4MWFA 2DMHA 5CIPB 2H47C 4MD5B 5TDNA 2ZG3A 2WP3O 4JO4H 3Q06A 4BKLB 3E80A 5E2WH 4I87A 7TAAA 1NGZA 3BP5A 4NNXA 3CFEB 3UCQA 4HCRA 3E0GA 4Y19E 4M3KB 2D7NA 1WG3A 1DQML 2JKTM 3KD4A 4KVCL 3FZUC 4PSPA 1J8RA 4FQXD 2YMTA 4J3OC 2BY0A 4UU9B 2JSFA 3EDDA 3KYMB 1YPZF 2CHNA 1EA9C 4YHIA 2OJZL 5FKPB 2CU9A 3MREB 2BW5A 2EIMB 3Q2CA 4MA7H 1BAFH 4M9OA 4K0OA 4HW6A 2IPKA 5DUPL 2DB8A 2X4SA 4IDLA 5HI3C 4P2RE 4QRTB 4X6DA 3MJ9A 3PV6B 3QNFA 3PGFL 4NZTH 4TQEL 2YUVA 4UQAA 1KV7A 4GRWE 4YHYC 1NDMA 1V05A 2YUXA 3HNVL 3MRFB 4WUUB 5KSAD 3OC5A 3LHAA 3LD8C 1P5VB 2WCSA 4Z5RB 1GC1C 3I74A 3C8KB 2YQBA 4N8CH 2PWFA 4OD2A 3QJHA 3S4SB 4RX4A 3K2IA 4HZAA 3RRQA 4FXKA 4NZRH 3V6OE 1LD9B 2P1YA 4L4TB 4OI9A 1YQVL 3WUZA 4KVCH 4KH9A 3LH8A 2WO2B 1T04A 3V0DA 4M6ML 3F7YB 3W81A 1QFUL 1OE3A 5A40E 1FFRA 1FFOB 1NCGA 2OR8A 3O3UN 4K2UL 5FDWB 5FM8A 4PJHF 2LE9A 3TBTB 3B9EA 4LCCC 3SYOA 1AKJA 2GITB 2CK2A 4K9JA 1CE1H 3D69B 4LL4A 2F58H 5D2LE 1QBML 1ZSDB 1YVLA 3EYOA 4YXHH 3CUPA 2WN3A 2R0WL 1IQDA 1I85A 4HIJA 4OB5H 5TF0A 5HVWA 4GAJL 5FYLD 3F3HA 5ADPH 3A0OA 4FTVD 4OSUH 4KZDL 2FECL 1KY7A 3TOPA 2V5YA 2FLRT 4G6JL 3DJZA 3EBHA 5BNXD 5IFJB 4DGIL 5IQ7L 1RJYB 2J6EH 1YEIL 2BNRD 3ES6B 3TONA 1NCJA 4GXVH 3S88L 1YNTF 1F4XL 3EUDA 2Q7YB 4XBPB 3V5HA 5AW0B 3UAJC 1OY3B 3DSNA 2J8OA 4LLVB 2L7QA 4ZYKB 2XFGB 4ZSOE 3T8XB 4APQA 1G94A 2F08A 1A0QL 4HEPA 1MFEL 5CGYD 5DMGD 2GG1A 2ZWNA 4DK5A 2OQJA 1ND0A 1BQKA 1AZBA 5HP5A 3IU4L 3ILPB 3CFTA 4TUJB 5CZXD 1E9QB 3IRCA 4BKLA 1FV1A 2EVHA 1S7QA 5FM5M 1X9QA 4C56B 2JH2A 3MA9H 4YZWA 4LZKA 4UTBH 3MLUL 3NFPA 2O72A 4H88H 2HRPH 1JF6A 1MCOH 3UFIA 2FTAA 3VXRB 1BG1A 4PJEB 2J3SA 4N0RA 4RSVA 3TO2B 3G6DH 4PQXA 3M45A 4LKCB 5BS0B 3NH7L 3ML8A 5F96H 3RWIB 4JFDE 1NEUA 3GZOA 4M93C 1SY6L 2DYRB 3GM0A 2R0KL 4LVOC 3V7AG 1JGVH 4PGDB 4FTVB 4GRMA 2FECI 4G72B 4HAFA 4PJ7E 5DHVB 3WIHH 2WBXA 3NJHA 4K7FA 4K71B 4DN4H 3KXFA 5E6UB 1UWYA 2VJ8A 3BAEH 2WWOA 4YQXH 4U3CA 5IGXL 1KJMA 5I74B 1IT9L 3REWA 5I5IA 5ANME 4WJG3 1ZVNA 2NY4C 1OWRM 3F7VA 3UTSB 1WJ3A 1N70A 3T2NH 4F15C 3RVWC 1TZAA 4OZIB 2NUTA 2WINA 3KPRE 5TDPA 5E1GA 3O2WL 1KLFA 2AEQH 1UENA 2E4FA 4GW4B 4L0PB 4W93A 3AJ7A 1L9TA 5BRZB 1O7DE 1QLRB 5C0CA 2A6KA 2YQ2A 4MDIB 3MBWA 1U42A 4QLRA 5B4MD 3HJEA 2QVFB 4Z7WF 5EU6A 4EOWH 4QRRA 1S7TA 4WU5A 3D25A 2AAAA 4IU2A 4AT6B 2P8MA 4PG2A 2VLLA 4M8QB 1ACZA 5C0RL 2YN3A 2ERJC 2OW7A 1PYWA 1PIGA 3E3QE 2BOBB 4JHWL 3NJJA 4TN9A 4NAJA 1XCWA 2Z93A 2P28B 5D4JA 1UEMA 4X9FA 2E59A 2G5BA 4U6HB 2NY1C 3BWZA 4G59C 3O6MH 3PAVA 3WMSA 1LDPH 3Q1SH 3RL1B 5GGQH 2FQFA 1R34A 1Z9SA 3D2UB 1T83A 1M71A 1S9XB 3SE9L 1W6WA 2ITDB 1MY7A 2X42A 3CSGA 4Q14A 5I1LA 4LT7A 1ZSDA 5J1AB 3BGFB 3IMBA 3L3OC 4E5XG 4F93B 5GZNC 2JCCE 5I0WA 3UYRH 4U1SB 4LASL 1MWAH 4U1JA 2DZEA 2FJSA 4U1JB 1OAXL 1YEFH 3WLBB 3DX0A 4IRJD 5CJOH 5IM7B 4LPVA 4R7NB 1JSYA 2HVKA 1JBJA 2OTUA 1S7VA 2IPTL 1GY1A 2DWXA 3QS3A 4RDQF 5ITFB 1U92B 4PRDA 2BSTA 3DX8B 2EDWA 4KK9D 5DUML 4EPSA 1O9VA 3C2AH 3LMJH 2F7QA 1HZHH 3TFKD 3OR6B 3BMWA 4MB5A 3S3PA 4XCNA 1QLEB 5IKCA 3LVTA 1PZDA 3CMOL 2WLHA 3ISRA 1MJ7L 1IIKA 3QDME 4XP6H 4XNUL 5AVUB 3ZE1F 1VKXB 2FHCA 1A7OL 3BSZL 3K6IA 4NQXA 5ABDE 5ID0B 4JFDD 1DUYA 2PCFB 1M7XA 3EJPA 3UBGA 4GRWB 3KVQA 2B08A 3PABB 1L6PA 3NGBB 4HFWB 1JG9A 4X6FB 4IJTA 2NW2A 2LLNA 4MA1B 4HH9A 2NY0C 4I18A 3M1OA 2ZXAA 3ARGC 3ESOA 4ELDA 4QXVA 5GGSB 3ASWA 1S5IH 1LK3L 4NM4H 4NYLA 3MBWB 2IIJA 1IAII 3FT3B 2FEDC 2AV7B 1II4E 4GAGL 3TBVB 2ZP0T 3KLHC 5J56B 2IOMA 4YDLC 3FQUB 3BKJH 5LBGA 4HLEA 4IKLA 3D0VB 1IBBA 2SEBB 2VDQH 3U4AA 3CK0L 3CN0A 2OXHB 3T71A 2J8UA 4E9XA 1OCZB 4WEBL 2X6VA 3G5VA 1EHLH 2DN7A 3KVDD 1E50A 3AACA 2NY6C 4KTGA 3GLZA 1YQ2A 3Q43A 3MUHL 3S0PA 3RIAK 4EQ2A 2ZWYA 4AUUA 1J9SA 3MACH 4POZC 4HUVB 4U4BA 4HUUB 3MUGA 4R3SB 4Z7WA 5DYOB 1O5PA 1KCKA 3EO1B 5DJCB 3WUWG 3SO3B 3DBXA 2V7NA 5F0JB 1OAZH 1WBYA 5EPMA 5L2KA 3QAZC 2KYIA 1YEHH 3MRGB 1UFUA 3UTSD 1WZLA 4D0DB 1JZDC 3EGXB 3RPBA 4EBQL 4RRPA 1MQKH 2COVD 3AXHA 1S7WB 4G42B 1U36A 3FB6B 5HHPA 3ZRCC 2L04A 1DFBL 2WUCH 2YUWA 4CN6A 2N56A 3EOAB 4ANWA 4OFPA 4X7FC 1P69B 2ZUSA 2PMZA 2P5EA 2V33A 2J21A 3FTGB 4IKKA 4PTTB 5I17A 5ICZA 5DJYB 3VGAC 1ZXKA 2CIKA 3B5TA 4LARH 3WTWA 3OKLB 2ITDA 1DANU 1M1XB 2E7MA 1TG8A 3PRZA 1M2VB 2ED8A 4HPOL 4OVVA 4XI5C 4ZAKB 4FJ6A 1M2VA 3BVUA 5T8IA 4CBZA 4J6RL 4TSCL 3ZKQD 5SWZA 2JIXD 3ESPA 2F7PA 2HWZH 3HG5A 1F4WL 3NJIA 1F58H 2N3JA 4HGWA 1FE8L 4XR8C 3WFZA 1PKQE 1H5BA 4PPTA 3IDYC 5AVRB 5BS0E 1F3DJ 4FERA 1B0WA 1VDGA 2UZXA 1BVLA 3HNSL 2H32H 3HG4A 5BV7C 2KT6A 2IBBA 1E65A 1G9NH 1QTPA 2PYED 3N41F 1U3HA 3DX9A 5HHME 3QUML 3THMH 4K8RD 3ABLB 1AZRA 4KJQC 4KXBA 1MCRA 4ZUWB 4EUPG 2OL3A 1ZWIB 1QR1A 4Y4HD 4FG4A 4FNQA 1YO4A 2WJ7A 2NQDA 1TQBB 3HG0A 2NQCA 4LVNB 3O6ML 4UOQA 2BVPB 2X4UB 5B22A 1KJ3L 2XKNA 4WW2A 5F7WC 2WO4A 2ADGB 2WN2A 3L4VA 1ZV5A 3FT3A 3WXWL 1WHOA 3FU6A 2GSGA 4Z0XA 1VEMA 4HS3A 2OMWB 5IP4A 4CAGA 1XGZA 4MNGE 4LEXL 1JV5A 2DQMA 3U0PA 5INCB 4D7PA 2OSWA 5I1IH 5D7JA 3FTWA 2OXHA 3KPLB 4G1EA 1ZLVH 1FYTE 4AYID 2ICCA 2LHAA 4JPIB 5EORL 3QZLA 4ZQKA 1I8MB 1N6QH 3K3QA 4J4PD 4NUJB 5I8KL 2ZCKL 4AMXA 4G8EB 4XNYL 1OTUD 2BVQA 4OFYA 1ID5I 1EXUA 4M1DL 3ZE1E 4IBZA 2XIBA 4L0ZA 1F00I 2D31A 2GJ6B 4R7XA 2UXFA 1Q0YL 3PXHA 3MPCA 5GGVL 2EE9A 3QEQD 4OZFH 4UM8A 1W0VB 4NQDB 5LN4A 3L3IB 3D09A 4NBZB 3BE1H 5E4EC 3QIUB 1C5BL 3OR7B 5BJTB 4KDTC 4P4KC 1GIGH 3QIWC 3QUKB 4TOYH 1PW3A 1J0HA 4XPTH 5HYJD 4OV5B 4H1LH 4JREB 2I9TB 3BPCA 1NANI 3P77A 2WM0A 4J5VA 2OR9L 3FAXA 3HE6A 3SQBA 1WBZA 2A73B 1KPUB 3DROA 4DW2L 1KWKA 4K55A 4OCYL 3I9AA 1JNHA 2D0FA 2QZ5A 4QTFA 4U49A 5C9JA 2WYIA 4ZT1A 3RVVC 2WLLB 5DR5H 1T5KA 5DYOA 4FEMA 3BT2H 1A1MB 1CXEA 1N6VA 1JAEA 4ZPVA 5FS5A 1A7RH 4TNEA 4QYOB 4X5WA 2RQEA 5DD3H 1OGAA 4L8CA 4AM0Q 3FFOA 5GS0H 2WIMA 4OUUA 3H1ZA 3VTMA 4E5XA 1UCTA 4Y5XB 5MP6H 1A9BA 1UGKA 1L6ZA 4QWWC 3ZE0B 4MNQB 4H13C 3ORJA 4XCFL 2V2WB 3HAEB 1EJOH 3LZFH 3SE6A 3UPRB 4F9PA 1RFDL 2FWLB 3QZBA 4IHOA 3TEXA 5KVEH 1YEEL 2H41A 3C2SA 3D6GA 2KI6A 1NIAA 3QDGB 5FKPA 2DQ6A 3KCPB 1CQYA 1PEZA 3AWGA 5BUPA 4U1KB 4I13B 2C7UA 5IQMA 1MHHB 1F6AA 1XQ4A 4LHUD 4DW2H 4I2XB 3RA7L 2Z35B 4X50A 4WV1C 1YYMH 2BHFA 1NDTA 1NIBA 3L16A 1F2XK 2CH8A 2IV9A 1D5IH 3EOTH 4BZ2L 1RZIA 3LKNB 3LRKA 3CQQA 1PZ2A 2DH3A 3GBDA 3N0PB 4U7SA 3QFJB 1LHZA 4U2YA 5HDLA 4PSRA 1OTSD 5HHMD 4DUWA 4GSDL 3QUKA 3CJJA 4ZUVB 3SDYH 1OTTD 4LSQL 3MCKB 4XP4H 5IHZB 3UTPE 4XGZB 2VQUA 2Z7WA 3ETTA 3QXAB 4KOBA 4JO3L 4DP0X 2H45A 3DX3A 1SJHB 3D4GA 1MUJB 1XGRB 4ALAH 1FNLA 1OCOB 4OBRA 5A1AA 4G80A 3O6LL 5EULV 4L3CA 1JNHB 4U4IA 1AGEA 2XXGA 2QPSA 4RMQA 3O8XA 5EOCJ 3FQRB 1QX1A 4IOFD 4KJWC 1EEUA 1HHHB 5DVNA 2BVOA 2BZCA 1BQHA 5FUZL 1KY6A 4LSVH 2F5BL 4TSBL 4YBLB 4BWUA 3PDOB 5I23A 4YDVB 1FYTD 2JFCA 1FAKT 4NZRL 3V0HA 4P2AA 4HJGA 4X6DE 2K1MA 4CNIA 4UM8B 4JN1L 5AVVB 4GQQA 4TVUA 3FUMA 5GS2D 4NP4L 3N9GH 1UD2A 3LRGA 2X0VA 3BZFA 1U2CA 2H2SC 2LU5A 4PWEA 2JI1A 5EF3A 4YLBA 4U1KA 2C3GA 1CLCA 4OD1H 5EU4B 3FQWA 3V6OA 1KJ2L 1BD2B 3H3PH 3EFOB 1MHPL 4Z7UE 2EIKB 2WYTA 3ZMEA 2LFGA 5I8CB 4Z8FL 2HH0H 5ICYB 2ITFA 2OXGB 5HVHC 2E9BA 1CZ8L 4XH2B 3ESVF 3ULUD 4DWHA 4P57A 3BFWA 4A7QA 4UQ3B 2XV2A 4XPHL 5KBMA 1ZT1B 3LV3A 1HDMB 4NM8H 3WN5A 1TUPA 3QAZB 1JFQL 4N9OB 4AM0A 5LDUA 3AXLB 5LQBH 1FFNB 1HXMA 3Q5OA 1MNUH 2E7LC 3ARBC 1UWEH 4FFYL 1LO2H 4P2RD 4DZ8B 1F3JA 4K9EC 4AIOA 2QQLL 1MXGA 3FCTB 3IU4H 3LRMA 5IW1A 1WTLA 4N1CA 3KPOB 4AVJA 4MSWB 5FV1L 2OP4H 1OM3L 3O3EB 1UJ3A 2EKJA 3EJSA 5CEYB 3P54A 3SY6A 4AQ8A 4DKFL 3CLFL 4ESKA 12E8L 1Q9WA 2EDRA 3KPMA 3QFDA 5HHOE 4GIPD 4WY7L 2EECA 1F8TL 1FL6B 1DJSA 4H40A 1F1GA 5E8EB 4GFXA 4HKXB 2QSTA 4AQ1C 4YHNA 1ADQH 4WW1A 3GSNA 5CWSA 3QJRB 2CHWA 2C1OB 4PJHA 3QIBA 1DEDA 4P5RA 1IC1A 3V9CA 1BD2A 1BM7A 3H9SD 1JTOA 4K94L 3T0BA 1PG7X 1RK1A 2X0UA 3NYKA 2H5UA 2XTJB 2JE8A 4PRPE 3B7YA 4KK8C 5E9DE 1C5BH 1DJGA 1JHLL 1D5MA 3P0VH 1JHKL 4G5ZL 2XV6B 2X4OA 5ESVB 5KUMA 3FFDB 1I31A 4PJBB 2ZD0A 1AQKL 2X6AA 1RFDH 5L2KB 1IAKA 3MCLH 3WTVA 4M8VA 3RUGB 2BNRE 4Y2NA 5F2FA 3HBQA 1E4XL 5JQ6L 1AYRA 1XGQB 3K4AA 4CC4A 2OAAA 2QADC 4Q4EA 1RUAL 3LKSA 1NGWB 3L5WB 3H9HA 4U0RC 4UT7H 1N67A 1KXTA 1UA6L 1YNKL 2JJVA 4ODTL 5A7EA 5I1CL 3DRQB 2CBMA 3CG8A 5J6GA 2R4SH 2V5RA 1VPOL 3TXAA 5L4JA 4XAWL 5JTWA 2I07A 5CSGA 2QPDB 1WSST 4YSAA 2NYYD 4L8BA 4WKZB 3HE7B 4ZFZA 1OCWL 1LP9A 3NUKA 4XC1L 2QMJA 4QD2E 2ED6A 5MHSE 4X4ZA 1OOAA 4HH8A 4OIBA 5C0CE 2SEBA 4UILH 5AD0B 4QRRE 4L1HA 4Z9KB 5TQ0H 1RJYA 1NWPA 2B14A 1FHNA 4PGBA 1ITBB 4HEPG 2HG0A 2CG9X 3KW7A 1SXCA 2DQGH 4E41A 1P4BL 3QQ4B 3HNSH 3LHPH 3HG2A 5DSCA 5SWSA 3ULVC 1A4BA 1WA1X 1E8WA 2EZ0D 2QVKA 1DBKL 5IY5B 1Y1DA 2ZTBA 2FO1A 1TYRA 4MJ4A 3IFPB 4FG6D 5DUJA 3FQ1A 1UJ3C 4NZ8A 3NAAL 2KBGA 4JFZH 1EEZA 3TJEL 4HPOH 4JFQA 1EO5A 3TIEA 4G2AA 2WD0A 2QR0A 4M1GH 2HFTA 3MRGA 2HT3D 4BSVA 3EUUA 1HHKB 1VZGA 4N3TA 1MKFA 2P7TA 4AMKH 1NUNB 1A22B 2V9UA 4TUUA 4X2UA 4PJDA 4F2ME 5EOQL 2CK0L 1LQBC 3O6FA 2ZOWA 2J1KA 3AT8A 1S6NA 4GT0A 2D9CA 4HIQA 4KHXH 1JZ4A 1F4HA 5E2TL 1JNNL 4YH6A 4L4JA 2E7BA 4AV5A 4KJYB 2DQDH 3NJKA 5FGRA 3NJLA 2ZX8A 4MASA 4JUSA 5EU5B 1TENA 4FQIH 4QRSB 4YHLL 3VI3A 4J2QA 5F97E 1MFAL 1HNYA 4UNTA 3ZN6A 4BZ1H 3APMA 5B38B 4GQ9L 4FCHA 3UG3A 4EDWH 1U6AH 1EVUA 4KKBC 5LAXA 3DRTA 1T7WA 2OPCA 3QIUA 2ZYIA 4XOBA 1IVTA 5EC2B 1PBYA 5HGAA 2IANA 1A6VH 3ZE2E 4DP9X 3MRNA 1OGTA 3C60A 1RURL 3MFGB 2DLIA 2H9GA 1BYOA 4ZNCD 5KS9F 3VW3L 1FSKC 3KPSE 3Q3GB 5AWNH 2A9CA 5E9DD 5DEFB 3BGAA 1AZVA 3OKOB 2EEBA 2AGJL 3VFRA 3HI5L 4J3XA 4JAMB 1I1AD 3D9AL 1G7HA 4MXQC 5KANG 3V0AC 2EH8H 2NW3B 3SKNA 1F18A 3MXWH 4G7YL 3QISA 1I8IB 4RLDA 1SBSH 4JRYD 2RCSL 3VX0A 2YK1L 3VH8A 3VFTB 1N0XH 1UYWL 3PHQA 4NC1E 1KJ2A 1SQ2N 4GW5B 5C6PB 3BT2L 1MFNA 1R3HB 2F8XC 3DHUA 2N1TE 1E7UA 2VLRD 4NS0A 1HEJC 2GTZA 1YY9D 1JXJA 4KDTA 5EOTA 4X9GA 1WHPA 4NPJA 4XB7A 1HFUA 4RWYH 3JWOC 4Z77A 2ZCZA 5DO8A 3GJEA 4JRWA 3OKKA 3OKYA 2WLIA 3L5WA 1AHWB 1BIHA 1SXSA 1BM3L 1I1FB 2E8ZA 3MV9E 3T0EA 3K1KC 3KGTA 4AGMA 4MAZA 3MTRA 1JF1B 2F7RA 2CGZA 4GBXA 3QJUB 4IBUA 3ULSA 4IK6A 5TQ2L 1LO0L 4WO0A 2GAZB 3VGAB 3OZ9L 2WBWB 2R51A 4PTUA 5EFIA 1YEWA 3V4LA 5HPMA 3APFA 1B9KA 1SBSL 1GMIA 4QGTA 3TYGL 1T1WB 2DTMH 2XI9A 2JF1A 3KLKA 1RV6X 3PL6B 5D1QB 4JLRA 3ZJAA 2DQFA 2BRQA 4KWUA 2WKGA 4X6CE 5L0QC 1G6RH 2K7PA 3VFWA 4EZJA 3MMEA 4F80A 2IPUG 4ODXB 4RCAA 1LTXA 3CX2A 5FV2A 4D9RD 4BFOA 5BO1H 1VEPA 2I24N 3RE0A 1QEXA 1CR9L 3BKYL 4Q7DA 5IJCC 1T22B 1Z9SB 1CD8A 3MX0A 4WGKA 2MCPL 3V95A 5LN8A 3W56A 5MERA 1A7PL 4FLQA 3U4BL 5GISL 4N2FA 2Z91B 4BSJA 3MBXL 2VXTH 1OP4A 4E9RA 3SGDH 3K91A 3VFTA 4OLUL 1BDYA 1JWUA 1JZ6A 4Q56A 5DJ8A 3A4AA 4DT2A 3ZXAC 4DP7X 5D1XE 2R0LH 1U8LA 2R2BB 3MOAL 4P3DA 1CDCA 2E3VA 3VSQA 4HETA 1JZHA 3RY6A 1CLYH 1PLCA 5SWSD 3T2LA 5I1CH 3GSQB 1NCTA 4UZSA 4XMKL 5IVXF 2MEJB 3NBNA 2QHLA 3FHQA 4QRPE 5GGRY 3DXAB 3T2PA 1BJ1J 2HKHH 3R06B 4A6YH 4R5XA 4I1PA 3R06A 5I1JL 2RA1A 2F68X 4G9FD 1T0PB 3GB7B 4WENB 3RP1A 4B9KC 5I16A 3NGBC 4J7RA 3VM7A 2X6UA 1YEKH 4O51B 3UMNA 1D7BA 1IL1A 4LVHB 5A16B 3V8OA 5E08L 1IBYA 1XF5A 2A38A 3CZKA 2HN7A 3JYCA 1ZTMA 1ZLWH 1BFSA 2GBVA 4G1MA 2Y4SA 4LPWA 4QHKJ 3M86A 4PI2A 4AQ8C 4ELMB 4K73A 4LSUH 1ED3B 4ZD3H 2NXYB 5I0VA 3FU3A 3PHQB 5C9KA 4XN8A 1BVOA 4JPQA 4D7BA 2NXZB 4NZFA 1HCYA 4OZGB 1T0NB 1N59A 1UASA 3B5GA 1FN4B 3C9NB 3MGAA 4Y19B 4MS8D 5JOPD 2DLHA 2GC4C 3IYLW 4WTZA 5T5FA 5LAPA 3WEXA 4JO1H 3FDWA 5BVPL 3VFRB 3EBGA 4AK2A 1RIUL 2E7HA 3MNMA 1IKFL 2BFGA 3DOIA 2Y7SA 1Z0NA 1IC7H 4IOSD 3KDMB 3CXHK 4I18B 4QRRB 3GSVB 1HWGB 3ZDZF 4IBTA 3PS6A 4N0YH 4P2OD 2W0KA 1NFIA 1CTMA 3B9KA 4JFQB 3VI3F 5I73B 3ETBJ 2IQ9L 3P40A 1CE1L 3O11A 4XRCB 1TJHH 1JNNH 3EADA 3ECWA 3T4AC 5CEZD 4Z95H 4WI9A 1AGCA 5EZLB 5KS9E 3NN8B 4BFBD 3DV4A 5GGVY 1BCIA 2WZ6A 3HC4H 4WK4B 1KCSH 2NCEA 2D03L 5D7KD 1DUZB 2ISDA 3V0VB 2WXQA 2Z7ZA 1BV8A 1UXSA 1NGXA 1TQCB 3CBRA 4PLJD 3UPAA 2J55A 4W9EC 3U46B 3JWDH 1C12B 1TNMA 3FYEB 2XACC 3L9EA 5DJ6A 4L2YA 3EFDL 3DSNB 2AJ3A 3BAWA 1WE5A 3UAEA 4Y16A 4XN4A 3VW3H 1UJTA 2IWKA 1S7SB 1TZGH 2A9AA 4XCCL 3ZZQA 4PVBA 2LTQB 4HUVA 4NRZB 5DK0A 1IBFA 3BYYA 3PAUA 2ENYA 3UC2A 3QORA 5I71B 4HUCA 1FYTB 4WI4A 2YBRB 1XXDC 1NCBH 4ELMA 3HC2A 3RGBA 4GSQA 4JFDB 4X5RA 1IQWL 5IB1A 3KWXA 2X09A 1N0LA 3W39B 3WD5H 3OJVC 3V7AE 1PCXA 2HFEB 2JVUA 1UEYA 1WWBX 1JHKH 1AY1H 2KQMA 2OJEB 1T2QL 4BFEA 1JDAA 3HRZC 1SJEA 1L0YA 5I6NA 2QZQA 4YX2H 4I2XE 1KB5H 4LCVA 1LEGB 4XMPH 1ANUA 1LEGA 2AC0A 1FORH 1QR1B 2DQUH 3MRDB 5IW3A 3SSGA 2YAMA 5D5ME 1WFIA 4JQVA 5HGGS 3L3KA 4UT6A 3RU8H 5DGQA 4RGNC 1UA6H 3LZLA 1EO8H 1IIIA 4XP6L 4ZXBB 5I1HL 5F96L 1SF5A 4MMXA 4JM2B 3LKQB 4GOSA 4L1BA 1LK2A 4O58L 4TNFA 5B3NA 4YDVA 4Q9QL 2X7LA 3MRLA 3TBSB 4AYDC 2XVBA 3HNTH 5C09D 5AZEH 3EBIA 2OA9A 3BGMB 4I1NB 2P43B 4G9FE 3TIDA 3R0NA 4WWKB 2R69H 2W92A 2B59B 2NRDA 4X7SL 5TFSH 3CFCH 4ONFL 4KU1A 5AEAA 4MS8C 4ORZC 5INDA 1N7MH 4P06A 4UAHA 5ALBH 4GW1A 2DWYA 3V0JA 3STLB 4E42A 2KDGA 1NGPH 4JANA 1WA0X 4BJLA 5AVZB 1XB8A 3BHBB 3CFUA 1KTDA 2MNWA 5DK2A 5DA0B 2I60H 5GS1C 4XC3L 2E7DA 1NFIB 4OGZA 5H4ZA 1FV1B 1SN2A 4NDMB 4PLKD 3SDAB 3U82B 3CFEA 3OJMB 5C0FB 3GMOB 1AQMA 1R9FA 1J7VR 1N8ZA 4RAVA 4XWGH 2A77H 3AMKA 2GYSA 4U1HA 1U4FA 5DFVC 1SJHA 4QXUH 4XBGA 1FFPA 1GZQB 3C9NA 4PS4L 4Y19A 2VYRE 3VWJA 4WI8A 3QW9A 1EXGA 5M7QA 4B9PA 3MNWB 4LAQL 3P0GB 2NXZD 3H9SB 3HZVB 3CN1A 5BRZD 4I4WA 5CS7A 3EGSB 4TUKH 4WO4C 4BH8B 5MENE 2UX7A 2DJSA 2FGWL 1G7MA 1VB9A 2BW4A 3MRQA 3NSFA 3QEQB 3ZDYB 3IVKA 4FP8H 3ARRA 4NP4H 1SF3A 2OYKA 2F6AA 1NFKA 1KWGA 1B4LA 2D9QB 4FFZL 4O02A 1D5RA 4AQAA 2VB5A 1VFAB 2R23B 4BRVA 3BH9B 1MFUA 1L7TH 1IGCH 2J43A 3GSWB 3BT0A 1ZXQA 4J2XA 1I75A 4PJ9D 1Z66A 4LF3B 5ETUA 1BJMA 3SYAA 4ANKA 3D12B 5I1GH 5IIEB 4JPWL 4YXKH 5SWSB 5DSCB 1TQUA 4WFEE 4HZLA 5D1XB 3ME0A 5DURD 4FQ1L 4AXWB 2VDLH 4WQOA 4X7EC 4ZYKA 1YPZE 3AQZA 3L48A 1DVQA 4XTRD 4DKFH 4H0GA 1TQTA 1ODUA 1ET7A 1F8TH 3I75B 1KPVB 1UZ6F 1I7RA 3RGVC 3V6FB 3ZMRA 1KBBA 2AKRB 1M7DB 1D6VL 2UUDK 1L9SA 2WMPA 2J5WA 4YBHA 3W38A 4DQOL 1FFTB 3LZPA 3UO1H 4A63A 1W91A 3KWTA 1DO6A 3LRSB 4Y4KC 4AY0A 2EVIA 4J23A 4BZ1A 1FBIH 2BSCA 1AQ8A 2I26N 3JQOB 4H8VA 5LGHL 1JF5A 2VMCA 4GUOA 1DBJL 1MEXL 4NCC2 4KFZC 5EO9A 3PNRB 4UBDD 3M17A 5K33A 2DI8A 5H35A 2Y07H 2BNRB 2D0HA 1Z5HA 3NCEB 2WZAA 5C0EB 3WIFB 5DS2A 5HI5D 4GY4A 1YEDA 1BD2E 2VDOB 1YJDC 1UOWA 2ZG2A 4Y4FC 1G9MC 1KJ3H 3QFDB 4UDTA 1MJJA 4M93B 1H0DA 3ESNA 4YX2L 2YJQA 4KRPC 2PWHA 1UXLA 4CA4A 2VR6A 2GJPA 2BK8A 2LVEA 2VMDA 3GSXA 3LNGA 5D5MF 4ZNEE 4LKXB 4FQLL 4TF4A 2Y3AA 5B21A 3DX2A 2DEWX 3TNMB 1G0YR 4OZIF 4O00A 2GT9B 1C1EH 2VDNH 5DMYA 1A6AB 4PRNB 3QI9A 3T3PB 4U7KA 4F7KA 4L5FE 4XC1H 4LSPH 1OAYH 3QIUC 3MGOB 5IB3B 2APFA 4M6AA 1N2RB 1RZJL 4A2FA 3EGSA 5T3ZH 4LOFA 3F83A 1QRND 2CGRH 3I75A 1WC7A 4L8DA 4PYGA 4P9HH 3DVGB 1H3PH 4KRPB 3HZMA 3NSJA 2OLDA 4NKOA 1PSKL 4L3EA 1OPOA 1OCCB 4NO2B 3H3BC 1QO3B 4RMRA 4CVUA 4B6ZA 1P6FA 1VZHA 3IJ8A 4L1SA 4UOW1 1CBJA 1B0RA 1R5IB 1T2JA 1UZ8B 3C60C 4HJJH 1QTYT 4WFGD 5FO8A 5JLZA 1GTFA 4LFHD 1J8SA 1GKEA 2BVYA 5TDPB 2BNUA 4B9IA 5HYSA 1KLFB 2I27N 3L9RA 4L37B 1BVZA 1G0DA 4E41E 4R4BB 2MHAB 5AYTA 1Z6JT 3Q6FA 1IRAY 5AW9B 2PF6A 2V17H 3RGVA 2X1WL 4ZTOH 4WLCA 3WIFA 3DGDA 1I7TA 3GZQA 3JUYA 4IOIB 2XTJE 3QQ3A 4ICXA 1X5IA 1TEFA 1PY4A 4I3SL 3GI8H 5ADOH 2BNQB 3BW9B 2ZXQA 3WJMB 5FFLA 2OBGA 1G1YA 4L5FL 3MV7D 2E8YA 3LRSA 5L4IA 5J6SA 2FQEA 2HVKB 3S3DB 1EGJA 2CO3A 2WQVA 1WT5A 2F8OA 3W0WA 4KKAC 2AABH 1T5XA 4M4RB 4UTCA 5DZJA 2XXFA 4AVHA 4KKZA 2ZUUA 4GUCA 3CC5A 4ELKA 2DMGA 5FGCE 2IGTA 2X4RB 2CCWA 2Q76B 4RZCB 5ANMA 1NCWH 1NMCB 1KBGL 3T1WA 2UXTA 2QLYA 1URIA 3RWEB 3TIEB 1TCRB 1EEZB 5TK4A 1H8NA 4G6FB 4KI5D 5FHAH 2H6UA 3CCHB 1W16A 3KZ8A 3WYRA 1U8IB 1YEFL 1YMME 2NX5D 3EYUL 3HG1A 3UACA 3SPVB 3ZE1B 2MQGA 2VXVH 4TSBH 3QJFB 2P5ED 1QSZA 1A6WH 5LNEA 1UB6A 4U0QB 4FXGA 5CN3A 1WIPA 1D9KC 4NQSB 2IH1B 4L3CB 3VQMA 4L0YA 2Q7NA 1P7BA 3GD1C 2X4NA 3L6FB 1M9SA 2G4EA 3TC9A 1U30A 5DFTA 5E5MA 1U95A 1UZGA 2MKLC 3BWAB 2I69A 3VFPB 1YUHB 1TEYA 3OKMB 4PY7B 5I1AB 3MLYL 4H7VA 3ZL2A 4HC1H 4JKMA 2VKWA 1QACA 2P9RA 2ZF9A 2HAZA 5DQ9B 5FOJA 3X14A 1RJCA 2LR4A 1AGBB 3VDCA 4LU5L 2PO6B 5JW3L 4LBEA 4PJFB 2QDVA 1DVFD 1QKZH 1JK8A 3EG9B 1EZSA 2O6PA 5I26A 1TTAA 4YUEH 3STBA 4LKXA 5D71H 5F88B 4JVWA 3CH8A 4X4ME 3QVAA 4XNYH 2XIDA 1EUUA 3O4LD 4DPBX 5L0QB 1Q38A 1ZWIA 3I6SA 4PP2A 1B3JA 5LBSA 1EWHA 3T9WA 3LH9A 2C9AA 4HWUA 4D9LH 4JFOA 3LZOA 5JIHA 5E6RB 4IGBA 4OLVH 2DJ4A 5FM5O 2V9RA 4JDZA 5FCUL 1HZKA 1JGLL 2H2SD 3O4LB 4GYBA 3RVTC 1OGAB 1MCHA 3C6LD 4OQTL 4XWOC 5K1JA 5IESL 1NCAH 2P8PB 4Y2DC 1DVFB 8PAZA 5I1EL 2CRIA 3ERXA 3F85A 3T0WA 4JM2C 3DGGB 5ANHA 4KMLB 5MI0B 4KV5F 1O6SB 4FX5A 1ACYL 1HSBA 3WIIL 1CT8B 3KH3A 5DHMC 1A6PA 1M7UA 4G8EA 5AVWB 2J5LC 2WQ8A 2XA8H 2C9XA 2DIAA 3AB0B 1QRNB 1X9UA 2AMUA 3HJ0A 4HEMA 3REVB 3VFPA 1GOGA 2PABA 2B20A 3DK2A 4R26L 4RGMC 4F2FA 2ARJB 5F7DB 3IFPA 4PBVC 3NCFB 4JY4A 3QDMD 4O9HH 3ULVE 2LOEA 4JDEB 5J11C 1KB9K 4J4PC 4ZPTB 4Y16C 3C5JA 1N4XH 3WUWB 1AC6A 1GRWA 1FNGB 1ZGLP 4UOZA 5J0BA 1EXHA 1OGTB 4AIXA 1OP3H 1CXHA 1FP5A 3JWOL 5DVMA 4BHUA 2WVVB 1M2OA 3BPOB 3IFLH 1MCDA 2VT0A 5D96C 3DO7B 2X4NB 1N2RA 3L6FA 1FVEA 1NC4B 1V3MA 2N1KA 3F00A 1RZQA 2L4OA 2P24B 4PGZA 5D1QE 4E9LA 5D7LA 4JZNB 1NPJA 4FN0A 5D2NE 4Q0XL 2P5EE 3OAUH 3OPUA 5DVKA 1NMBL 5AVQB 4OUUB 5AYQA 5IZ7A 5EU6D 3ALXA 3UTQB 5H4YA 4MLSA 3KAAA 1CDYA 3GRWH 1A5FL 5C0BE 2IWEA 4QWWD 4RIRA 3ARSA 2CWRA 3BQUB 1YN6B 4MX7A 4PJGA 1NQBA 4RNRA 5DFAA 4D3CL 2NT1A 1B4JL 2VAAB 4RZKA 5T5NG 3QZMA 3VXTA 2X2YA 3UAJA 2MOVA 3HRZA 4OTXL 1KIUA 4ZDHB 5BS0A 3BZFB 5DD1L 1OLZA 2HJFA 2IAAC 5H2BA 1MCOL 4M7JH 4XWOD 4N0YL 4LLDB 4G6ML 1JD7A 2BHUA 5AAWA 1K4CA 4PP2B 2EDXA 3FUKA 1SYSA 4GPVA 4XTRC 1YYLL 3F7PC 3MRPB 5D1XD 4FEIA 2AK4A 3SJVE 1V10A 1BQSA 1ZLDA 4YIQA 1WAAA 3IDGB 6FABH 1IC4H 4ODUB 1MIMH 1AJ7H 2DV6A 2VITB 3GRBA 5EORH 3LS4L 5EU7E 5C0ND 1FJ1A 2X4PB 5DVOA 5FYKD 1FI8C 3FSVA 2XWJA 5F1OB 2FJHA 2YAHA 2A6JA 2J6EA 3SE4C 1GZPB 3EH1A 1FN4A 3EZJB 4ONGH 3IPEA 4WFFD 3QNZA 3L1FA 4HPYH 2Y7LA 4P2OA 3V79C 2AJYH 2FR4A 4PJXB 4TULH 4YC2C 4YHPA 1IM3B 2ZKYA 4GRLD 4UOW0 3OL2A 1JIBA 2BRRH 2GUOA 5GGQL 2NY0B 3LS5L 3CVHL 4MZ2A 4IU2B 4YHKL 5F44A 3INOA 4KHXL 5T1JA 5K9JH 1E2ZA 1C16A 4H88L 4ZXBC 3X1GA 2XG5A 2XNAB 5I73C 3KPPA 2P5WE 5GGRA 3CD4A 1L3WA 2W88A 1BFTA 1RSYA 3GSWA 5FHBH 2BSDA 3LDBC 3T2QA 5IB2A 1HZLA 5GRYA 5C0RH 2YPLD 3ZE0F 5IB2B 3HCVA 3ABMB 1F1AA 4PJAF 3DGCR 2R2HB 4OLZH 3ES6A 1N68A 2MKWA 1TZGL 4FE9A 3LEVL 3RWHA 1MWAL 5JHDE 1QA9B 1OW0C 1UD4A 3CU1A 3OLDA 2J1ZA 3MJ7B 4YAQA 4QTIH 3QI9B 5FCUH 4G8AC 4EAEA 5BV7B 5AB1A 3SE3C 1YC7A 3BKYH 4LLWB 2BY2A 3NABH 2VC2B 1E30A 4MVBC 1FSKB 2NY3C 4HWBH 4GKSA 2IDSA 4IQHA 4XN2A 1MY5A 4G8FA 3PY9A 2GTWA 5D93B 4FQXB 2R83A 5ALCH 3SBQA 3D1MC 3VACA 1IC5H 2PW2B 2XWJB 3WUWA 5DTFA 5ADPL 1B4RA 3D33A 2CKBH 3WEBA 4P5TB 1BQHG 1J1XL 1T04B 2NNRA 2XA8L 2Z8SA 3H55A 3M8OH 1THAA 3D85D 3EJZD 4LGSB 2V2TB 4QRAA 5IT2L 5F70A 3C5ZD 2G30A 5AVXB 1I8AA 1A3RL 4JFYB 5E2UL 4JGJA 4YSUA 2V8MA 2XUWA 3WKPA 1HHGA 2BS9A 1KLUB 4MA1C 3D4CA 4MSWA 5AALA 3B9KB 1BM3H 1U8CB 2XZQH 4OSUL 5F1NB 4GH7B 2WZ5A 4DESA 2ZKXA 5CLTA 2R4SL 1A14L 1IGTA 1DJHA 4A7SA 2L7UA 2IF7A 1T4KB 2V9TA 4HLZG 5AKVA 3E1ZA 3C8HA 5JZ7D 2DW5A 3TT3L 1OW0A 2EDQA 3GMQA 3RBGA 2Q86B 4NQCB 3BX7C 2EEAA 3TO4D 4M5SA 5ESQA 1CE6A 3OLGA 4B95C 1AIZA 1J9RA 3O6KL 3I6LD 4W9CC 3OV6A 3TBYA 5EF1A 4G6AC 4CBPA 4HWZB 5D93C 4AXWA 3E3QC 2A1WH 4IKNA 4Z76A 1HCZA 2W60A 2CIIA 4L48A 4JK0D 1JVOA 4JG0L 3VFNA 5AFAA 4X99A 4C83A 4O2EB 3OGOE 4OGYH 1RPQA 1NAMB 5E56A 4JJOA 5F9AC 4M43L 1O7DC 3UAJD 4DN4L 4WFHD 4ENED 4FNSA 2GQHA 2NY5H 3G5ZB 3T77B 1E2WA 3KJ4B 4DOHB 4XVOA 1RJZA 1J5IA 5HGDA 1UD6A 3U4BH 3BUDA 1PJWA 1JGEA 2VLJD 3FQ2A 3GMMB 3MRRA 1NL0L 3LMJL 2TRHA 1ZRUA 4R96B 3GRGA 1XGTA 5A2JH 1MRDH 5E5MB 1GC1L 1GGCL 1S7SA 2X5PA 1QSFA 5C3LD 3NIFB 4UM9A 2ZAHA 2ZQKA 1RK0A 1AS8A 1HIML 4KPHH 4WUUA 1NTDA 5CLXA 3RWGA 4BGDA 1UWFA 2Q3ZA 2Y3NA 4KKAD 5CILL 4FYSA 4IEFB 1TYJA 1KBGH 4B9GA 2YD1A 1J05A 1LQSR 5JHDD 1V55B 1HILA 2XWTB 4FG0A 3HS0B 1BF5A 1KT2A 1ZGLM 1MRCH 2PPFA 3EOAA 1GYVA 3AADB 2EYTA 4JDTL 2C3WA 3SPCA 1M6OB 4BQ6A 4Z78A 1DBJH 1MEXH 5KJ7E 1M6OA 3QEUB 2IAND 1KENH 2OTUB 3V8CA 4AMWA 3ABKB 1JYXA 5CUSL 4QR7A 5D71L 5BQ7B 3CN4A 1EJ6A 1HCVA 2OR9H 2HTKD 1QI5A 4XBEH 4OW6A 3BSHA 3FCTA 1KDJA 3MV7E 1FORL 4L8SA 1RY7B 4HC1A 2HG5A 1CFQB 4LLMA 4XNXH 1DCLA 1VFBB 5F0MB 4GG6B 5HGBB 3NIDF 2P8LA 2X1PA 4OD2B 3VXMD 4D2NA 3NCBB 5TF1H 5DS8B 3H3KA 1XIWC 1QWHA 1SZNA 4PJBF 1XZ0B 2DQEL 3ARGA 3ECUA 2R15A 3OPZL 3RUGF 4G1EB 2UZYA 4NO5A 4G83A 4Z7UA 4KI5E 1KCVL 3U36A 3OTTA 5T1DH 3MXWL 3FPYA 1KB5B 5EG6C 3ZSSA 1QBLL 4Y9BA 3FO1B 4I4WB 4H2AA 1DVFC 4GUPA 4OLWH 3KR3H 5I6XB 3BWAA 4JO2H 4JQXA 4L37A 2AJXH 1UQSB 5FO9A 4R0LB 4M5ZL 4K3EH 4Z3JA