5I6OA

Crystal structure of copper nitrite reductase at 100k after 20.70 mgy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
total genus 92
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA02
2PPAA 1PZAA 2HRHA 2VM3A 3NP4A 3AZUA 1J9QA 3FQ2A 1KGYE 3KW8A 3FYIB 4KNSA 3GDCA 2H3XC 2VSKB 1V54B 2QPEB 2CBPA 3AG1B 2GHZA 4GXFA 4A2FA 3FU8A 3EH3B 2YAEA 2QDWA 5A7EA 2XXFA 2YAQA 3GYRA 2IH9A 2XX1A 5AZUA 2PP7A 3CDZA 2AZUA 1PAZA 1SDDA 2YQBA 3UADA 3T9WA 3CG8A 1QHQA 4BXVA 4N4YB 2P80A 3FU9A 4AI7A 2BP8A 4YSDA 1A4AA 1GR7A 1PCSA 7PAZA 3NJLA 3RYMA 5I5MA 1ET8A 3CVDA 5B7MA 3ABLB 3WKPA 2PP8A 3S3CB 2UX6A 3IN2A 2XUWA 3QJUB 1JVLA 1JZHA 1IBYA 1KBWA 3GXUB 2Y1AA 1UATA 3DTUB 1AZNA 5EHFA 2VW7A 4E9WA 1ZDSA 2FQFA 2IWKA 3H4HA 3L45A 5I6LA 2IH8A 3AY2A 1KCBA 4WTQA 4YSEA 1QLEB 2XXGA 2Q5BA 2GIMA 1OE2A 1ZIAA 2VW6A 1CYWA 1OV8A 3WKQA 3FSVA 1ADWA 2JKWA 2R7EA 3UAEA 1DZ0A 2OV0A 3WIAA 1KBVA 4HCGA 2CCWA 4E9RA 3PAUA 1GW0A 2YAPA 1EHKB 2CUAA 3QJVB 3TBCA 1E65A 6PAZA 3TBBA 2BWDA 3CDZB 5PAZA 4AZUA 4DP4X 3FSWA 3D12B 3X1GA 4F2EA 5TK2A 1JZEA 1L9SA 4JHVA 2X88A 1L9QA 3NSFA 4K9JA 2DYRB 3T6VA 1PNCA 4HHGA 1ET5A 1GS6X 5B7EA 5B1KA 2HZHA 1J5DA 3NJIA 1NZRA 1JXDA 1RKRA 3QQXA 2YAOA 1SFDA 4GP5B 1OF0A 4YVNA 1IUZA 1AS8A 2GI0A 2FJSA 2J55A 4GP8B 4KO6A 4N8UA 5IY5B 2VSMB 4GYBA 1KDJA 1WAEA 1FA4A 2PLTA 1HFUA 4JKNA 5I6MA 1GY2A 2XV2A 2I7OA 1SFHA 2IWEA 4G71B 5D4HA 4DP2X 1QNIA 3IEAA 4KOBA 1J9RA 2OCCB 3BVDB 1XMEB 4Q89A 2IDQA 2TSBA 4E9QA 4UAHA 3FSZA 3S3DB 3H56A 3QJRB 2OJ1A 1L9RA 4YL4A 2EILB 1MZYA 3NSYA 1OCOB 1E5YA 4E9XA 1M9WA 5I6KA 1NIDA 3T6ZA 4NERA 7PCYA 4W1TA 1OE1A 1ASPA 3ABMB 3FPXA 2DWTA 2W88A 1TEFA 3T6XA 2R7EB 3ZX1A 4A66A 5B7FA 1BEXA 3T71A 4AKPA 4BK5C 1M56B 1MDAA 2HRGA 2E86A 3QPKA 4Q8BA 1BXUA 1PZBA 2IDFA 4AKQA 2P80D 3TASA 4BDVA 2IAAC 1KDIA 2FT8A 2EIKB 3NT0A 1EZLA 2AFNA 2UX7A 1L9PA 3FU7A 3PAZA 3ABGA 2PPDA 3FYEB 4CSZA 2FWLB 3EH4B 3NJJA 2J5WA 3IN0A 5I6OA 3ABKB 4KOCA 2AANA 3NYKA 1AOZA 1NPNA 1ILUA 2XLLA 1JZGA 3V9CA 4HALA 3UGEA 1AG0A 3CVBA 1SF3A 3JTBA 1DYZA 4AKOA 1TEGA 4PCYA 2BZCA 5F7AA 4NAJA 1HAUA 3AG2B 4YSRA 3FPYA 1X9UA 1PNDA 3FS9A 1JVOA 4ZK8A 5TK4A 1NDTA 1IC0A 3X2QB 1MZZA 5B1BB 1A3ZA 4QKTA 3H4FA 3NSCA 4RH4A 3QJSB 3MBWB 4G7QB 1FWXA 4YSUA 1OE3A 2A3TA 3NP3A 2NRDA 4FAAB 1PY0A 2MTAA 4E9VA 1JERA 2HX9A 2QDVA 1ZPUA 2FQEA 3S8FB 1X9RA 3ZBMA 4KNUA 1PF3A 1OCRB 1IKOP 4BDVB 3UABA 1VLXA 2FQGA 2HXAA 1JOIA 2GBAA 1E67A 3DKHA 3C75A 3NSDA 3FU7B 2DWSA 2TSAA 3AW5A 3NJHA 4PAZA 5D4IA 1ETJA 2VN3A 3BQVA 2FTAA 1JXGA 4HZ1A 4BWUA 4F2FA 5B3SB 2CAKA 2XV3A 4FA7B 3X1NA 1SHWA 1SDDB 4A2HA 1E30A 2DYSB 2B3IA 1WA2X 1NTDA 4BWTA 2EINB 3N2JA 4YSAA 3JT2A 1ILSA 2BP8B 3FQ1A 4HCIA 3FQYA 1L9OA 4DPAX 2QPDB 2RACA 5AKRA 2UXGA 3ERXA 3UAAA 1NIAA 4EF3A 4ENZA 2BO0A 1RZPA 4DP8X 1N68A 2BP0A 1BYPA 4DP5X 2PPCA 1I53A 1KCWA 1ID2A 4HAKA 1JXFA 1PLBA 2YAMA 1J9TA 5I5JA 4HIPA 2DV6A 3CVCA 1AZUA 1BQRA 2FNWA 5PCYA 4NB7A 4X4KA 4DP7X 3AG3B 4JHUA 5I6PA 1ZV2A 2HX7A 3IBOA 3PXLA 4UF7C 3X1EA 4DP0X 1ET7A 2BHFA 4AX3A 2GB2A 3OQRA 1AS7A 1AQ8A 6PCYA 3NJKA 3SQRA 1F56A 3HB3B 2UXVA 1XB6A 2YAFA 3ZIYA 4A68A 2IDUA 3IE9A 1RZQA 2LLNA 2IWFA 1URIA 1AAJA 2Y69B 2HLEB 2YAHA 3PCYA 4L0PB 2GC4C 5B1JA 2X87A 4G72B 2B08A 2FT7A 2WO2B 5I6NA 1V55B 2PPFA 1WA0X 5I26A 5I5IA 2VM4A 4GY4A 2JFCA 2YXVA 4F7KA 3OMAB 1JZFA 3SBPA 2H47C 4A2EA 3NJNA 1AZRA 4QLWA 1NIBA 3NJMA 5D4JA 9PCYA 1NWOA 4DP1X 2FQDA 5B1JC 2PCFA 1M57B 1NIFA 2JXMA 3PPSA 4YSSA 2YXWA 3NJFA 3EF4A 1CURA 3ASOB 4E9YA 2BP0B 4BWWA 3SBQA 4DPCX 2XWZA 2CALA 1N70A 3QJQB 3ASNB 2BWIA 4P5RA 3OM3B 2EIMB 1ZIBA 4E9TA 3S3BB 4E9SA 2GSMB 4A2DA 1J9SA 1OCZB 1V10A 4HCFA 2ZXWB 3NJGA 2PCYA 4A2GA 1JZJA 1BXVA 1KV7A 1NINA 4TXVB 1AR1B 5I28A 3X1BA 1FFTB 1BYOA 2YARA 3OMNB 2MRYA 2UXTA 4W9ZA 4YSCA 3OD3A 4BXSV 1BXAA 1PMYA 1NIEA 1GY1A 1IBZA 1XB3A 5ANHA 2ZOOA 2H5UA 3PAVA 3EHBB 3T6WA 1A4CA 1MG2C 2I85A 2ZWNA 5E9NA 3G5WA 1E5ZA 1TU2A 5F7BA 1ASOA 2AVFA 2J56A 2FT6A 4A67A 5FC9A 3AG4B 4YSTA 4G7RB 2XV0A 2DY2A 3N55A 4YSPA 1R1CA 1WS7A 1AG6A 3S8GB 1MG3C 4M4RB 1GS8A 1KYAA 1ZDQA 5LDUA 2W8CA 1PLAA 2Q9OA 1AANA 3QJTB 1AACA 2XYBA 1WA1X 2IDSA 2QT6A 2VW4A 1BQKA 1W6LA 8PAZA 3WNIA 4P5SA 4YSOA 4G7SB 1HAWA 5B1AB 2BW4A 2BW5A 3MX0B 2XVBA 1NWPA 3DIVA 2GC7C 1B3IA 2XU9A 1AIZA 1AS6A 2HX8A 4DPBX 1W6WA 1J5CA 1SHXA 2J57A 2ZONA 1W8EA 3X1FA 1ASQA 4WKXA 4KO7A 1JZIA 1WS8A 1OOWA 4M3HA 2CJ3A 1BQ5A 4KNTA 3CZUB 3ZDWA 2AZAA 4DP9X 3UACA 1CC3A 2WO3B 1NPJA 1NICA 3OMIB 4KO5A 3TU6A 3WI9A 1A4BA 3V9EA 4YVUA 2BZ7A 3PLYA 1OCCB 1SJMA 3FT0A 3EH5B 2EIJB 3WG7B 1AZCA 1SNRA 1AZBA 1A65A 2XX0A 4G70B 4YSQA 3FSAA 2I7SA 1CYXA 4CSPA 2PP9A 1PLCA 1SF5A 1CUOA 4HHWA 1GSKA 3KW7A 2VMJA 1T5KA 1PZCA 2IDTA 2PPEA 3HEIB 2N0MA 2UXFA 5AFAA 4GP4B 1L9TA 3SBRA 1GS7A 3TA4D 4UANA 4DP6X 1TKWA 1YLBB 1BAWA 1A8ZA 2WSDA 4KO9A 3WNJA 3U25A 1XB8A 4MFHA 1RCYA 1GYCA
chains in the Genus database with same CATH superfamily
4FA8A 3GHPA 5ES4B 4G43B 4KJYB 3KPRE 2R2HA 4YFLI 3QDGE 4GJTB 1IAMA 4N2HA 1LWRA 1YMMB 2Y5QA 3GHBH 3TIDB 1OP4A 1CCZA 4DKAA 1MAML 3GDCA 5IB3B 3LKQB 5FCUH 3QULA 4EI5B 5JHLA 2FRGP 5F7DB 1XZWA 3VM5A 5FYLE 2D7TL 4JKPH 1YPZF 4KDWA 4DETA 2BVTA 3P40A 1KLFA 1DE4B 1FJ1B 1MI5D 4GRWE 3SQOH 5J1AB 3D0AA 2FIKA 1OTUD 3LPWA 3MROB 3PREA 3HRPA 3RWFB 4YHZL 5KBNC 4OCXH 4DQOL 1NLDL 4L3CA 3CX5J 4JO5A 1S7QA 3IJSB 5AWNH 1RPKA 1XHHA 2XBTA 3B8YA 4L3AA 5I66A 3CG8A 4ZFFB 5D1XB 1U6AH 4FERA 5EBGA 2OJZL 2FJUB 3FU9A 4AI7A 2LVCA 4XWGH 1HYSC 2VDPB 3SE6A 1Q0YH 2Q8BH 1A7NL 4I18C 5I5MA 1KOAA 4AT6A 3L16A 1UOVA 5E8NB 5IBUB 3BN9D 5HHQB 2FBJH 4AG4L 4CN4A 2X2JA 3WKPA 4GSRA 5DJAA 4KUZL 5GZOC 1TIUA 5MENB 4TF4A 1H3PL 5BUPA 2E7LC 2X4SB 4GOSA 3QJUB 5EU5A 5C9KA 3L1FA 1RHHB 1CDJA 5EBLA 3ZMEA 2WXGA 1PLGH 1I8IB 4FQJH 4YPGB 1RZGA 3MKKA 3CVHB 5I6LA 5DHVH 2JCCF 1XR9B 2IH8A 5ABAA 1K72A 1BAFH 2PXYD 4N1HB 1T4KA 3CD4A 4I9XA 4ORGA 3WFCH 4QOKE 3RU8L 2UZXB 4HHAA 3HZVA 4CKVX 3RL1A 3R1GL 3WEOA 4G1MA 5BV7L 4AOFA 4EI6B 2VW6A 4YUEH 1HOCB 3T0XA 1KJ2A 2WUBL 4HJGB 1KJ3L 3L17A 5DO2D 1UOWA 4XOEA 4PJAE 1HCFX 4H1LH 4ZUTA 4ZX6A 1IRAY 1UURA 5I82A 3UC0H 3EOAA 3GZPA 2EC8A 3PWLB 4RCAA 4Z7VE 3W0WA 4MWFA 1KPRB 3TBBA 3KE0A 3IFLH 5EIIB 4Z7QF 2JB5H 4ZQKA 1CLZL 3ARGC 4HF5L 3NSFA 3L5XL 2VLRD 4O02A 1QVOB 4QXVA 1EAOA 3DYOA 1F1AA 1IGCL 4GKNA 5DYFA 4MS6A 3MLWH 5L7XH 3OKMA 4JG1H 2NZ1A 1J5DA 3VQLA 4LDEB 2BIPA 5LAPA 4OZFB 4NRYB 2D3VA 5HYJA 1OF0A 1ZLWH 4L4VB 1IV8A 4F58L 1DBAL 3TC9A 4KO6A 3MLSH 2VSMB 3QFDA 3T0EC 1KDJA 3SE3A 4HIJB 4LVOC 1SFHA 3QUGA 5CM1A 1M7XA 3IEAA 1MCFA 1MW3A 4S2SA 5CZKA 1RURH 1OAXL 3II2A 4PJDA 5C0EA 5MEPB 4Q89A 3TYGH 2CMRH 3N42B 3IFOA 5E9AA 4F20A 3ULUC 1WTLA 3ULVE 2EILB 4BCXA 3TEUA 1U8HB 2CM6A 3NCEB 3AB0B 3VXMA 4GQ9L 1AO7D 1OF2B 5F44A 1K3IA 2A0LC 3DBXB 5DHXB 2WP3O 3S4SA 4PJHA 3HW7A 1DQIA 1PTZA 1PKQA 2R7EB 3MODH 4NWTL 2GTZA 2PYEA 4TUOB 2LT9A 4PWJA 1TFPA 4BIKA 1AZVA 5I0WA 4UT9L 2B2XL 2XN9E 3B7TA 1FI8C 4ES8A 1OGAD 1ZHNA 2E8YA 5CXPA 4NP4H 3O4LD 1NUNB 1XGZA 3I2CL 4G80A 3QCVH 5IB5B 1GJWA 4YDLB 1TPXC 1UACL 3ABGA 4J6IA 2AJ3B 4AJWA 4ZTOL 2E6PA 2J1KA 3QUYC 4TSAH 2J5WA 2VMCA 4LKXA 2FH8A 3CFJB 4HWNA 4KOCA 5AYTA 3VFTB 5DJ2B 3FK3A 5FKAB 5DVPA 2QBWA 5C0CE 4LL4A 1JCKA 1SF3A 3SDXE 3MCYA 3JTBA 4M1GH 4HIEA 3ECQA 4LASL 5F7AA 3A67H 2HRPH 4MVBC 3P02A 1JWSB 3FS9A 4LHUA 1JVOA 4PEEA 3G5VA 4QXTA 1NDTA 4DN3H 1CFTB 4OZGE 3KS0J 4ZMLA 4YZFE 1F8TL 3VNZA 5HGAA 5M95B 3IXAA 4B60A 4N9OB 5JR1L 4TNFA 2ENYA 4UMSA 2VRAA 2X6VA 3BPNB 4PJIB 5FOBB 2GPZA 3DVNB 3NZHL 2YLHA 2BS71 5E4EC 2VR3A 1GAFH 4JFQB 2A3TA 5I6XB 4ZO9A 3L5WA 5AD0A 2DIBA 3V6OA 5FUOH 3LNFA 3RBGA 1SEBB 3KCWA 4WAFA 4DW2H 3OKKA 1ZLVK 3BEWB 3WJMB 3OQ3B 1NBYB 3GZOA 2DQEH 4E68A 3QISA 3QULB 4N5ED 3E9UA 1VACB 4GT7A 4PJ7B 3BDYH 4NM8L 1SY6A 2MNUA 2VISB 3HE7C 4HZ1A 1E9PA 1S9YA 2XQYG 1HEZA 2FIKB 5JOEA 3G7TA 4WZ9A 1FZOA 2VDNH 3RBSA 1R19A 1SHWA 2FO8A 5LHDA 1JHLL 3FU6A 4A2HA 1S7QB 4YL9A 4KTEL 3ECBB 2H3NA 2EINB 2R27A 4YSAA 1LDPL 1T6BX 4DK6A 4GMTL 1UFGA 2DMHA 5D1ZC 1AGBA 1S9WB 1YUHB 1F4HA 2XVGA 1U3NA 4P23D 5CR8A 2ZF8A 4AT6B 4WUUA 1RY7B 5D8JH 4O00A 3B9EA 3HG0A 4X7TA 3SGDH 1KCWA 2ATPA 1QZ1A 1UWGH 5EU5B 4N86A 3OZKA 4D0DA 1WIUA 2QVIA 1NA8A 1MHHA 2DLHA 4K8RD 3VFGH 1JDAA 2MQ3A 3AWGA 1ETZA 4KC3B 2BOCB 1P4IH 2F8OA 4OLXL 2ESVE 5EBLB 5BZZA 5T5FL 4ONFL 1RZKH 4G83A 4FI7A 2NY4D 1RZGB 4K71B 5PCYA 4U1JB 1MCEA 1F5WA 2EDHA 3PXLA 1H3TA 5J11C 3HRZA 1ET7A 1PW3A 4GQQA 4KI5E 4AX3A 3U4BL 4ORGB 1HE8A 3DRQA 4U1GC 3VB8A 3KJ4C 1MIMH 3H6AA 2E27L 4UINH 1DVFC 4M1DH 1FN4B 2VLJE 2YAFA 1Q1JL 2BERA 1Z3GL 4NJAL 5AZ2L 4EN3B 4OIFA 3HNTH 5DZNA 4PGDA 3WHXB 5CLYA 3PQYA 5E9DD 3F7RA 4UU9A 1E5AA 1T04A 4WU5A 3QB7C 5IK3A 4MMYA 4KHTL 3EOAB 3U6RA 2CNYA 2J44A 3NIFE 4CNIB 2WAQA 3WTWA 3N0PB 1OPGH 5EF1A 1IX2A 3BWAA 4MWFB 3GSWA 1IGYA 5ITFB 4PJ9A 2HKHL 1NQBA 3JWOH 4M6MH 1ZK5A 4W81A 5BZWB 2UWEF 1SUHA 4WY7L 4GKNB 3CLFL 1UCBH 4LLUA 4GXVH 2VZ3A 1FIEA 2B77A 3UTSB 5HYJB 3NIDE 2WINB 3C60B 3UYPB 3D25A 3CQPA 5KVGH 2VN4A 4AVKA 3RPKA 1HKLH 4FMKA 2XWZA 4PJ8B 1SM3H 5DEJA 3UO1H 3QFDB 3SGJA 1A6UH 3QZBA 3V0GA 3GBML 3MRFA 5D7HA 4WSGA 1E6JL 3NJGA 1DJGA 4N2IA 3IFOB 3WO4C 1OEZW 2P4AB 5I15H 1MCWW 4XGZA 2OYLA 2NXYC 4XXWC 2DBLH 4CVZA 5HHOB 12E8H 1PMYA 3VXMB 1NIEA 2N3JA 5IHBA 1MQ8A 3LX9A 4DKFH 4LCCC 2JTDA 1FFQA 2H5UA 2IC2A 3O6MH 4K55A 3S4SB 4TUUA 1PKQB 2DJ4A 1R24B 3FRPB 2L8AA 2WSKA 3BLBA 3L9EA 4PHXA 5ESVB 3HUJB 1E5ZA 4LSQH 5HVHB 4FYTA 5L2KA 4H20H 5C09A 1FL6A 3EYSH 2DBJA 1QEXA 1YHPA 2F0CA 1GOHA 4U1IA 4H0IA 4M4RB 4KZEH 3DHJA 2APSA 4LKXB 2W8CA 3TBYA 4F8QA 4HU2A 3PNRB 4GW5B 2IDSA 3VGAC 1ZHBB 5GIRA 1W6LA 2WUCL 3M8OL 3P4MB 4AQAA 4HKBA 3TIEA 1LK2A 5LB1A 1QFWL 4Y4FD 1HAWA 4Y5YB 4OZHA 3ARZA 4HIEB 1TJIL 4N0FA 3B3IA 2HT3C 2FCBA 4LHUB 4QXTB 3G5VB 4TNWF 1T1ZA 2BNUA 1INEL 2WXIA 2FJHA 3HKZA 5HGAB 3ZGIA 4KQ3H 3ZL4H 3MUGA 1MSPA 1HESA 3QRGL 3NABL 4J4PA 3DOSA 2J1ZA 3LRMA 1IC4H 1ZE3C 3F62A 1N9PA 1BG9A 2CJ3A 2E6JA 1UYWL 3GSNA 1JTTA 4IBVA 4LGPB 3L4VA 3FCUB 4AYID 4WWPA 2ZCLH 4H8WL 1FV1B 3QNXA 3MYZA 5DDHB 1EHXA 3ZY7A 4NN7C 4WNQA 4IJ3B 2K6YA 5CGYD 2BNQB 4G9FE 1MW0A 1JK8B 2VCOA 3OKKB 4YVUA 5IESL 3IFNL 1Q90A 5E51A 3KBHE 3U7YL 3N41B 1AZBA 1EJOH 4LLDA 5F7EH 2BSCA 4YSQA 4N2MA 2R56L 4E0RB 2CUMA 4DUWA 3CVIH 4NNYA 4DKDC 4QCIA 3RKPA 3PHOB 3V0EA 2CR3A 1WFUA 2IFFH 2XDHA 2QL1A 3KGUA 1S9YB 1HEZB 4HHWA 3MA9H 3V5KB 5BOZG 1FZOB 1NEUA 4JFYB 4X99A 4P2RA 3LEVL 5JXED 3X14B 1J1XL 3D39B 4Z7UB 4YGAB 1YEEH 4NUGH 4UNIA 5AFAA 2H3NB 3V95A 3EJYD 3G08A 5E1IA 1HSBB 4AYDC 3ZYZA 3HJ0A 1WQVT 2Y6SD 3ARBA 3U6XA 2BIOA 1D6VH 1B2WL 2EC9T 4KRNA 4NENA 1M05A 3QBTB 3MBEA 4WUUB 4OCWL 3DGGA 2EDFA 4X7TB 3MAWA 5TF1L 3FQ2A 2KZ1B 3FOLA 1UM4L 2ATPB 4D0DB 4X8CA 2HG5B 2CBPA 2W94A 1TJXA 5DSCA 1ETZB 1M2OA 1BM3L 4H7VA 2OYKA 4FFTA 3DETC 4ODBD 4Y19D 5IJKA 3P0YL 3HRZB 4K23H 1TO4A 3GYRA 5FYKH 3IJ8A 2PO6B 3D2TA 2AZUA 5IVXB 1UZ8B 5CBAA 2IOOA 4DAGH 1RK0A 3KBPA 3TCXA 1BMGA 4WDIA 3ZJAA 3B2VL 4PGDB 2A99A 2BSDA 4AEIH 3H0TA 4UU9B 1T04B 5BCAA 1AD9B 4Y5VA 4W6XB 3QUMA 3IJYB 5FYLH 3U6RB 3IDNB 3H42H 4FQXA 3WGUB 3VXRA 3GSWB 4O9HH 1IGYB 2PP8A 1UEYA 1V7NL 2HB0A 3KL0A 3H7BA 4GS7C 4PJ9B 5F7MC 1MJJA 3K1DA 1U8CA 1WBZA 2K9FB 2WYIA 3EYUL 4OZIE 3TFKC 1NCHA 3WS3A 4FTVA 2OQJA 3K81A 3MTXA 5A2AA 3KNBA 32C2A 3T0AA 4LLUB 2FB4L 2LU5A 4PWIA 3RDTC 3QZWA 1XBRA 1LO3H 4OGYL 2WXNA 3UJIL 5I18H 4IRJA 3MXWH 3VW3H 4QXGL 2VABA 4WRLA 3FH8A 5B8CC 3B9KB 3N1MC 3WKQA 3WNPA 3N85H 1CF1A 1W15A 3MRFB 4N0RA 4TL5A 5DJDB 3VA2C 3MLYL 1A6AA 5ACMA 3H2QA 1YNKH 5CJXC 5GRJL 5FKPB 4V2CB 3VWJD 5H35A 4KKBC 4XGZB 2FL5A 5EDSA 4XP5L 4GUQA 4J8RB 1NSNL 1QLRA 1QSFB 1U4EA 3TBTA 4M6AA 4A2MA 4XMKH 1AKJB 2E9GA 3T6VA 1U8PA 3IJHA 4NM4L 3QIUD 4Y2LA 4X0KA 5D2NE 3PL6A 1PY9A 4P5MB 1XGUB 2VDMB 3HVDA 1LEIA 3PP4H 4LQFL 3KD4A 2WY3B 5JA8B 2A9MH 2BSSA 3MLRL 2XKUA 1MHCB 3QQXA 1JYXA 4P48A 5L2KB 5LXVA 1ADQA 5C2UB 3B6SA 5C08A 3O0LA 2FJSA 4KKLC 1FL6B 4MXWL 1WV7T 5IY5B 1AKPA 1WAEA 1U41A 3VFWA 1GYUA 1W0WA 2IAMA 3P0GB 2EXWD 4XR8C 4D94A 5IBLD 4PG9A 1T3FB 5GJTL 3MCLH 4BRJA 3TBYB 1NCUA 3T3PE 1L6XA 3FO1A 5GIRB 5AAPA 1OD7A 2GABA 4AQAB 3ULSB 1O75A 2IDCA 4GQZA 4KUCD 1KELH 4E9XA 1T7VA 1SN5A 4R7XA 3CH1A 5G5DA 2IF7A 2W81C 4HK3N 1LL1A 5CUSL 5HI4D 3SDCD 4WLCA 3GMPA 2GT9A 4W9GC 4EE2A 3GNML 4HUCA 4M8UA 5CP3H 5GSVA 3MFFA 3MUGB 5JOFA 4CSTA 1SJXA 3BIAX 1OAUL 3N44F 3HMXH 5C0BA 1U3HD 3ULVH 4FYRA 2EE3A 3CFCH 5AOLA 3K0WA 3KVDD 4Y16A 2UX7A 4NOBA 4OBRA 3BP5B 2FUTA 2XY1A 2A9AA 4ECNA 4WNSA 1OQOA 1D9KC 2M26A 1CLOL 4OF7A 3GTNA 3X11A 3MV7A 2EKSA 3VGEA 3V4VH 4FJ6A 4PJFA 4OJDH 3A4EA 4R0LC 3H9SE 3QIWB 1MFAH 3CVBA 4FZ8H 2A6DA 5T1MA 4LLDB 1KZQA 1MCIA 2FSEA 2H2PC 1N5YL 2H1PL 4LZKA 3T8MA 3U30C 3B37A 4JY5L 3NCBB 2H0PA 2P8LA 3FPYA 1QFUL 1T5XB 4KK8C 5DK2B 4ZAKA 5GJSH 3B1UA 2W65A 2VL5A 4NDMA 1KGXA 2V9UA 1KJVA 2WB1A 3V55A 1I1FB 1NFIB 1R3LB 1AC6A 4PRPD 3HZKA 1F86A 2BOBB 4RFOL 5MP6H 3WS6A 1AMXA 4OIIH 3MBWB 3G08B 3OPZL 3TVMC 4KKRA 3HLAA 4IS6A 5DMIL 3H9ZA 3MBEB 1RIVL 1NFDA 1J0IA 4F57H 1YNLL 2LU3A 2GJ6E 4ANXA 1HN1A 5LNDA 5J7CC 4LLAA 3GM0A 4P2OC 3BGMA 3O9WA 4K3JL 2EDQA 3Q1SL 4FX5A 4PMEA 4K4KA 4F2MA 5DSCB 1JYNA 3C75A 4PAZA 3AW5A 3V0IA 3QJFA 1TNNA 1X6NA 1IKFH 4F3FB 2VM9A 3P4NA 4XNUL 1DO6A 4QAMB 4PYGA 1HL9A 3RZCB 3KH4A 3BRFA 1GZHC 2IV9A 4WV1C 2O5XH 4OU3A 4XN1A 4NQEA 4PRHE 4PLOB 3SKJL 4MD0A 1TYRA 1TUPA 1VAHA 3WEAA 1E4HA 1OAKH 1F41A 1MNUH 1D5XA 3K2UL 3BYYA 4MA1B 5E5UB 3QORB 2BNRB 1TTFA 3QR0A 1JRHH 4Y5VB 4I3SH 1L9OA 2KLTA 3QUMB 4YR6A 4CL7A 2JELL 1GL4B 3LEYL 3TO2A 3VXRB 5FB8A 1Z9MA 4DNLA 1AZZC 1P7BA 3H7BB 2VAJA 5BO1L 4XPAL 2KERA 4U05A 3RGHA 3U9UA 1WBZB 4J39A 2YAMA 3RE0A 4LLMA 2XA8H 3WS3B 3F7YA 1DQML 4NHCL 1RZKC 2V8MA 1JPSH 3TN0C 3VRIA 3EXLA 2FNWA 3AM8C 2XPGA 4ICXA 1YA5A 4V1DE 5EF3A 1T22A 3DDFA 1REIA 3QZWB 2JCCA 3UJJL 3AY4A 1ACCA 1TO5A 3O11A 4CKQA 2Q87A 3TM6A 4JNXA 1Q72H 1C16B 2EDRA 5ICXA 3VJ6A 2UXVA 4GFXA 1ICTA 3RWJB 2EEBA 4NN6C 1BOGB 1QUNB 3LZFH 2XWJA 1DQQA 2CA4A 4MQSB 1XEUA 4GAGL 4ODTH 5T1LB 3TL5A 3S2CA 3VVVA 2J8OA 4DEPB 1HOEA 1AXIB 2IVFC 1A6AB 4OV5B 1LO5A 3DMMB 1HWHB 2ZG3A 1LWHA 4NRXA 4JFHE 5B1JA 3M07A 5G2NA 3CXHJ 1JHKL 1P6AB 2FT7A 4AMKH 5KSVA 3DX8A 5I26A 2DDQL 3X3GL 3JWOC 1BBDL 1QLRB 4GY4A 3TBTB 1B0WA 5IW1A 2VLME 4X7SH 2V7NA 2WYHA 1Y18A 2WYZA 3OMAB 3V6BR 1EBAA 2HUEA 3WIIL 2H47C 2VLKB 5J8OA 4RGOL 1HJCA 1S5HA 3PL6B 3BZ4A 2YPLB 3Q8AA 1LEIB 3S5LB 1U42A 4HP5A 1J5HA 3PPSA 3ZHKA 1I4FA 1X4YA 4B95C 4Q4EA 2JIXB 2KDYA 1MQKL 1CXIA 2BSRB 2R69L 3B6SB 1VPOH 4Y1SA 5D1QD 2OMVA 1EEZA 3GZQA 2NLJA 2WO4A 2DQDH 1JF6A 5I71C 1W0WB 2IAMB 3ABZA 4U0RC 3Q05A 1OSZB 4AM0Q 4PS7A 2XETA 1XO8A 4PG9B 2R8SL 5DJ0B 2GK2A 4HCFA 3HB3D 3QEGH 4OLYH 2WNXA 3MLUL 3ARFC 1CGXA 1PDKB 2XTSA 3QDJD 4EEEA 3SYOA 1AR1B 4X6CF 4J8QA 2BMKA 2Z0UA 1X7SA 4W9ZA 3UZVA 3EO0A 3ULUL 3NFPB 2CO4A 5FYJE 5IQLA 3LRSB 4FQPA 3MLVH 1QBAA 1YO4A 1RMFH 1A7RH 3ASWA 3CH1B 2Y3NA 3L3GA 3KLDA 5G5DB 5LBSH 1UZ6F 1X5FA 4E42B 1ZA6A 1SGKA 3CHQA 3QCUH 3ULUF 1NCWH 3MFFB 5I8OH 1MIEL 4DVBA 3IK2A 1W72B 1XH3A 3FUDA 3AGWA 1HCVA 2MOQA 2JKTM 1S7VA 2CO1A 4TM9A 5C0BB 1C9SA 4MCMA 5DRZA 2NW3A 1XGQA 2O6CA 1R1CA 1WS7A 2ZICA 4Y16B 4JHWH 4M48L 1BZ7A 1G7QA 4OJFH 2AV7A 1E40A 3CFIC 3TA3B 1YMMD 6FABL 5FWRA 4M43L 4L48A 2V5RA 4TUKH 4K7FA 4UT9A 3LXAA 4HIIB 2Y06L 4BQBA 3UH8A 4EI5D 1YNTF 4G1EB 5D7KD 4L05A 4WTZA 4ZUWA 1U8QA 1G9NH 4MCZA 2A6DB 5CS7A 3T1WA 4MAYB 2XVBA 5EC1A 5K9KB 2H1XA 1SHMA 4BSWA 2A7BA 2P8LB 4ZAKB 2GG1A 3KDPB 4H88L 2W65B 5FDYA 4DJMA 1KJVB 3W0WE 1CVRA 3QWNA 2Z35A 5D1XD 2HN7A 5IROD 5HXMA 4BHUI 3HZKB 5BRZA 3SPVA 4C83B 5F72S 3FQUA 1LK3H 3FMGH 5CCGE 3BT2H 1NDGA 4CSSA 1U3ZA 4X9HA 1F13A 5GGQL 5MEND 3TEZA 3L3IA 1E4XI 4XP9L 4AIEA 1ECYA 1NFDB 3LPFA 1ZXKA 4X6BA 4LCWA 3ZKMC 2VDKH 3FFCA 3FUEA 4R90H 1J0KA 2EIJB 3H1ZA 4BFKA 3ROOB 4N2NA 2R2CA 3QJFB 5IM7A 4PJDE 3PDOA 4BYHA 2BY3A 4M5ZL 3HG3A 3MJ9L 2BSEA 2AEIT 1IVTA 2X89A 1F6FB 3H9SD 1YPZB 1FGNH 2XG4A 3EYFB 5HYSA 1C12B 3K1KC 3GMMB 4NQEB 4NBZB 35C8L 3SBRA 3BSZL 4L8SC 4P3CH 4D8PA 2ZKWA 4JDTL 2PYEE 4K73A 1LO0L 3CXDH 3R7QA 1C08A 3OJDA 2FGWH 2HFTA 3RDJA 2E75C 4MGXA 3HI5H 4PUBL 1TCRA 3RI5K 4YQXL 4LCVA 2I9TA 3U9UB 2ICCA 2WNGA 4MLSA 3QIBC 1S7WA 5D9SA 2BVUA 4XVUC 4U3HA 1ID5I 1NGPL 4MSWB 2M83A 4Z95H 5FX3A 1TYJA 4YNYA 3VXPB 2G3ZA 4L4VD 4M8VA 1Z9SA 1OAYH 1ROWA 3WUWA 5FGCB 2Q76B 5EO9A 2XZZA 2YEVB 3UEQA 3SDYL 5EBMA 2RQ8A 1PSKH 1KN4L 2JKNA 2R4RL 3OG4B 4S11A 2WLMA 4BH7A 1DQQB 4BA0A 4XNAA 5T5FA 2AERT 3OJ2C 1I31A 4PRAB 2BP8A 2Y6TE 4PU2A 4YXLL 2QELA 1LO5B 3D2UA 4BFEA 3QW9A 1DL7H 5CAYB 4GRMA 4FFYH 2NNRA 3NCCB 4PV8B 3CZFA 4YBQC 2F61A 2BRRL 3LAFA 2MCPH 3IN2A 1QI5A 5DI8A 5BV7B 2FHBA 5IW1B 2V7NB 1JZHA 4RFNB 4Z7QB 1ACZA 1RUAH 3MLPA 1T5WA 3TCTA 3V6OE 5DJZA 4Z78B 2NSQA 4MYPA 5LJYH 3CFQA 5K93A 1RJZA 3DV4A 3MCKB 4IBYA 2OMVB 2YGQA 2NLJB 1F6AB 3N43F 4U3XA 4ZSOA 1ES0B 4GLRI 2FX7L 2J1YA 4L37A 3H2WA 1MLBA 2ZKHL 5GGVY 4ZXBD 1LTXA 1P9MA 2X70A 2OKMA 2WXKA 3IDXH 3MTRA 3F7KA 1VFMA 3QUZA 4M00A 4GUPA 3C5JA 3UZVB 3EO0B 2WBWB 3LKSA 5B38A 3X1GA 3IMBA 2I27N 4OF3A 2EXTA 5IZ7A 3OWEA 4KK6D 3CDGB 4HIHA 2ORBH 4M8QB 3T6QC 1UB6B 2E7HA 2A9CA 1Q38A 1CFQB 2LABA 3MJ7A 4L2LA 2Y7QA 4TVPD 4ES9A 4F15C 5I74B 4DVBB 1XH3B 2NMSA 2HKFH 4JZJC 5DRZB 1XGQB 5TH2A 1HEJC 2DQHL 2BVEA 4K3GA 3ZUCA 4MNGB 1U8IA 4I2XA 5ACZB 1BZ7B 1G7QB 1R47A 5F9AC 4C54A 1DHKA 1R0AH 2E0PA 4PB9L 5K1JA 5L6YL 4LOFA 1TZIA 2OCCB 3E80A 4KVCH 4ZMVA 5LLIC 3MHZA 2XWEA 4H0HB 3BVUA 5BVJA 3GMNA 3A4DA 25C8H 1U8QB 1H6TA 1MJ7H 4I0PC 1SEQH 2C9VA 3CMOL 1SYVB 1LO4H 1FYTB 2ZXAA 2X41A 2AQSA 1N4XH 3FPXA 1IB5A 3PG2A 4HPOH 1RZIB 5INDA 2ADGA 3L4XA 5F9DC 3NK3A 3OPUA 2Z35B 4PJBB 2HN7B 3P1VA 4M93B 1BXXA 1PZBA 3ROLA 5BRZB 3TASA 1RV6X 3QJOA 2APFA 4PMFA 2GSIB 2D7PA 2VLLB 2YPVL 3BJLA 1YJDH 2EIKB 2KZKA 5HHXL 4F33B 3DTXB 5DD1L 5H4ZA 2EYRB 5AAWA 4LSTL 1LMKA 3L3IB 5EORH 1I82A 5DT1L 1A6VL 1MRDL 3OAYH 3VUAA 3NAAL 5C86A 1KEGH 3BXNA 2AANA 1ZT1A 4JO2H 2OLDA 1A4KB 1OB1B 3FFCB 3ZU8A 15C8L 3L6FB 4NC0B 5I1AB 4B5ZA 3LN5A 1D5RA 4NO0A 3BP4A 1SVCP 1C5BL 4U1NA 4KK5C 2EECA 2D03H 5BO0D 5IJVA 3PDOB 1FC1A 1MHPL 2OMZA 3LHPH 3KYNA 4KTDH 4PWGA 4CC4A 3KBFA 4JO1L 4DUVA 3UTZB 2XG4B 4KXZI 4QF1B 3PP3H 5AW3B 5IREA 1L5GA 5HYSB 1MVFA 5IHZB 3QJSB 5IVNA 2EEXA 2NDGA 5E2TH 4EIBA 1TQWA 2GUOA 2P5EB 1NH6A 4GAAA 2NQCA 4AY0A 1DJSA 3NGBC 3CFDB 4GEIA 4YSUA 3VXNA 4JO8A 3A6CH 3NRPA 1DBMH 1EJ6A 1VGKB 5CEZE 2EDMA 4WEMB 4PP2A 2RH0A 1KIUB 4QTIH 4HC1H 2XTJE 1XGYH 3FBKA 3FB6A 3PWVA 4LLQB 3S35H 3Q2NA 5C09E 3L3OC 4X4XA 3CUPB 1R5WB 2O61A 2NY3C 3RFRA 4CMHB 4A7GF 1JOIA 4HYTB 3UTSD 4GAJL 5HYJD 1GZQA 4YNYB 3FU7B 2TSAA 3C60D 1Z9SB 3WUWB 3EDKA 2YZ8A 4X8JA 2DQCL 5EO9B 4JKPL 4LEOA 1IFHH 3TJEL 3ARXA 4JY4A 1KB9K 3SQOL 1OTTD 3ZT5A 3AAZA 1UADC 3VWKB 3ATAA 5DC9B 3I02A 1S5IL 1G6VK 2VQ4A 3JBG7 5EBMB 4OCXL 2DYSB 4OZHE 1JN6B 5CJ5A 1NTDA 4KJQD 1QNZH 5AWNL 2OAAA 4Q6IC 5EBWA 1U6AL 4QGTA 1MWAA 2XSKA 2BP8B 4OLUH 3Q13A 3I9IA 5FFGA 1HH9A 5HHOD 3VXMD 1JD7A 4JQXA 1KIQA 3OXRA 1ETB1 1U58B 1RZPA 3SPGA 1CBVH 1UWYA 4NCC1 3BJ91 3CZFB 3QO1A 4KDTA 1K8DA 1C7TA 2X0UA 4DT2A 5D7IF 1ESOA 4HJSA 3A3YB 1QYGH 1CTMA 3PPEA 1T5WB 4X4MA 2DIEA 2UWEB 1N3NA 4Y4KA 5DJZB 4AYEC 1NEPA 1M71A 2XG5A 2Z4TA 2QQQA 4FQJL 5JMRA 4QHUB 5C07B 4EZLA 2BIQA 4NI6A 3LMJH 3D3VB 1RJZB 1BAFL 2IOMA 3DV4B 1MFCL 1OAQH 3FH7A 6PCYA 1GHFH 3WYRA 4BFRA 3KH3A 2UZIH 4GG6E 4LSSL 4W9EC 2A6IA 1KPVB 3BKJL 3F7VA 3V9FA 4RMVA 4YUEL 3MBXH 1RZQA 2VXVH 4MMZA 1F3JA 3I3DA 3BKCH 1D6EA 3EJPA 3K46A 2VMDA 2X70B 4YO0B 1ZHLB 5DFVC 4ZUSA 4P2RE 1TR7A 1KC5H 1UH4A 3UC0L 1H5BA 4OM0H 1WC7B 3S88H 4R5XA 1MJ8H 3C5JB 1TZGH 2YRBA 3LKSB 5B38B 1JZ7A 4LHUD 2R0LL 3IFLL 4BQCA 2RJMA 4KKCD 3GHEH 2ITFA 2JB5L 3T1FA 5IW6A 1H9DA 2EH7L 2AXFA 4PJ6A 1WFTA 4X50A 1R75A 3VDAA 4GI9A 2CRIA 3ARSA 5L7XL 4JG1L 1H6UA 1NAMH 3VD0A 1EZUA 3FU5A 3WJLA 1PIFA 4TRPH 4CVXA 5HHNA 5F1IB 4ELDA 4AXWA 2P8MB 3NJXA 3M46A 2XV6B 4NQQA 5TH2B 2BVPA 2VR8A 3E6HA 3MSPA 1IJ9A 4IOSA 1U8IB 2WGXA 3FT9A 4QRBA 2BNQD 1RZ8B 3HS0A 2I32A 3AC0A 4FQCL 4XMLH 2R4SL 1PG7X 4MTMA 1TZIB 3I3BA 2PYFA 3V5DA 1YEIL 5BVJB 4S1DC 3PYCA 4N28A 1MFDH 3VFSA 1I3UA 3P9MA 4GBXC 1TYEB 2ID5A 2X4UA 4Y1AA 4AGOA 4IIQA 1DVZA 2AP2A 2ATAA 5HPMB 1XB3A 5LAXB 1TITA 1JGDA 2W38A 3EHBB 4N8CH 3D39D 5DJYA 3BKML 4F8PA 3J07A 3MODL 2ADGB 5JPMC 2C7UB 2EDXA 3G5WA 3BH4A 2DWDB 3ZL2A 4WI4A 3CHXA 4MXVE 3REWA 1BVKB 3NQIA 4XWOC 2F18A 4ZOAA 3G5XA 1HNFA 4NP4L 2XV0A 2DY2A 2ROYA 3FT2B 3HCVA 3I84A 2B9BA 4FTVE 4WUUD 4WI8A 3RFZC 3LYRA 4JGUA 2J6EL 1HHGA 3BPLC 1F2QA 3QI9A 3MV11 4QPEA 1N0XH 4QXUL 4NQVB 1S9KC 5EEVA 4P9ML 3IDYB 2PCFB 2EYTA 3BXNB 1ZT1B 3OG6B 1RP9A 5D5MA 2NSMA 4PGEA 4XP6L 1GTFA 4IKNA 5DRWB 3E8UL 5F6IC 1G9NC 3C09C 2VWEE 5AALA 3P3RA 3IAGC 2G30A 4LVNC 4P5SA 4J3OD 3A24A 3WMQA 3LN5B 1NAKL 2BSTB 5EF2A 5I1IH 2V5SA 4U1NB 2RQEA 2C7FA 4H5SB 1T7YA 3EJZC 2PO6D 3BQUC 2OMZB 3EG9A 1TNMA 3C6LC 2C3WA 3C6SB 1VFUA 1UC6A 4DN3L 2J57A 2QEJA 5E00B 4ZNEA 3QQ3B 3WU1A 3PQYD 4ETQB 2VDQH 1CGSL 2GUOB 3K8MA 3N1FC 3IMVA 4KNTA 2WXJA 3UBGA 1GGBH 2EE0A 2FEEI 3FQNB 3SDAA 2E9IA 4N9GA 1KZYA 4NRZA 4L8DB 1BFVL 1GAFL 2BS8A 2P8PA 2X38A 4PJ9D 5D71L 1CC3A 2Q3XA 4RLDA 4XCCL 1IIIA 1F02I 1SOXA 1YSOA 4BFIB 3PWVB 5C08E 4L0ZA 1L0XA 5TDNB 2F7PA 5T8IA 4DQAA 1MCJA 4X4XB 1BMWA 5GS2H 4DW2L 3ZDYE 3GRGA 3L1GA 2DKMA 1IAII 4FYQA 2VTFA 2YBRA 2DQEL 4FZEH 5CD5D 2YHGA 4BFFA 1O9ZA 1MXGA 1A47A 2VDOL 4G8GE 4NLAA 3KLAA 4ZW5A 1T89A 3Q8FA 4R4FH 1QRNE 1SF5A 1KGJA 4WO4A 5JO5A 2VQ1A 3AAZB 3B9KD 4HETA 1PZCA 5KSAC 3QYCA 1RUPH 2UXFA 3HNSH 4WENB 5DGQA 3SKNB 2F5AL 4Q9RH 1L9TA 3OC5A 1HCYA 1MPAH 2X44D 1WFOA 4JRYB 3LQZA 4NQCB 2DJMA 2DN7A 1DBKH 5C0AA 4YJZL 3KGRA 5GGRA 3GJEB 1FO0H 1MWAB 3H85A 3LXBA 5LN8A 1XB8A 2B59A 1XEDA 1QSFD 4YAQA 4EDXB 1SJEB 4AK1A 1AKJD 3RB5A 5KUKA 5DMGD 1CDYA 5D8JL 1IBFA 3QO1B 2ED6A 1K8DB 2MKLC 3NEOA 3RG1C 2GJZA 4KXCA 2E7MA 1UWGL 1DFXA 5D96B 1A7OH 2YFOA 3QO0A 3VFGL 5L2KD 3EGSA 4UQBA 3MV7E 1CFMA 1RZKL 1RIHL 4I18A 1O7DC 4A2LA 4N90E 4I3RH 2VH5L 4E41A 3CDZA 5GZOA 4YBLB 3UG4A 4CUCA 3K72A 2CE6A 1BEYL 2UYLB 2E7LA 4M1DL 5TE7H 1NBCA 1LQSR 1TOXA 2A6IB 5JDSA 3RI5F 4XN7A 1MCWM 5FM4A 5IQ9B 7CGTA 4MMZB 3HNTL 1XF1A 1D6EB 3JUYA 4PW4A 3RYMA 5ITBH 4UDUB 1EMTL 2QFRA 4WWKB 2JQMA 2E7BA 2JK5A 4JFEB 3HS9A 2XOTA 5T3ZE 3FCGA 1OPGL 5C97A 3WN5B 1G7JB 4ISVB 2UX6A 4LXFA 4AW4A 2IBZX 3AROA 5AKVA 2IPTL 3JWOL 4M6ML 5FYJU 3APCA 4AENA 4WI3A 3CZNA 4D2NA 5H37A 2Y1AA 5JW4M 3JUZA 2DF3A 4RISH 2FEJA 4J4PD 2G60H 2NY1C 1NUGA 1UCBL 5DTFA 1J05A 3UMTA 3QDAA 3IXTB 4M61B 2GIYA 4CVXB 4NIKB 1QLFA 2OSYA 4F2ME 3QS2A 5GISH 2BVPB 1SM3L 2V37A 4BH8A 3ARGA 3VI4F 1A6UL 4JKKA 3FSVA 2EXSA 4BFJA 3DVIA 3GXIA 2F9BT 1QHPA 3PWJB 3QIWD 4H25A 3LD8B 2Z91A 1P1ZA 2PYFB 5E2WH 4X6FA 4E9RA 4PV1C 4XN5A 1RZ7L 2WLKA 5I1KH 3MRHA 2V0AA 4MJ5A 4RMQA 5I15L 4JY6A 3DX7A 5FW8A 5JIDA 2Y25A 4X6CA 5GRWA 4RMTA 3RWDA 12E8L 4IKIA 4IIQB 1X5MA 3L48A 3T0EA 4DKFL 1JGDB 2MQCA 2R51A 2XQYK 2WLHA 1SY6H 2RTTA 4EVNA 4NZTH 1HHHA 2HVJB 1E2VA 3T3MF 3LKRB 2QKIC 4PS3A 2D3LA 3BKYL 1WBXB 2AKRA 1A6TA 1RZJH 4ZPTA 3FTUA 5I76B 1N0LA 2XICA 2VKWA 4KVNL 3DO7A 4ZFQA 3NPZB 5DS8B 1N8OE 2WXOA 1KPUA 2DRUA 2NY0C 3ARPA 3HCVB 1ZLUH 3BZEA 3MBED 3N44B 3BIKA 3EYSL 1ZWIA 2NXZB 3QAQA 3AQDA 3BMVA 4JFUA 2ODHA 2XV2A 2OK0H 1G7LB 2WXFA 2KKQA 1WJ3A 4KZEL 5D2NC 2EYTB 3UEZA 2JCCE 1XMEB 5AW6B 3E3QE 2XACC 5DWUH 2G9KA 2J2ZA 4YL4A 5L0QC 3CZSA 4PBWD 4GSXA 4DKEH 1CF8H 1YZZA 4NAQA 1X5GA 2OL3L 3C2AL 4S0SD 2F19H 1YNTA 3ETBF 1HNYA 4W1TA 4LDOB 3B2PA 1N2RA 2J25A 3EG9B 1IIKA 5JHDA 3QUYA 4MQXD 1RUMH 2DL2A 2HRGA 2E86A 2WIMA 3QPKA 5C2BL 5CBEA 3VG9B 3BUYB 2ZP8A 4KQ3L 5DCCA 1ZGLA 3QORD 2BNRD 5IGXH 1IC4L 1E5BA 1L7IH 1YJDC 4XVTL 4FFZL 1KDIA 1B4RA 4B0MM 2YMTA 4FQXD 5KUMA 3UAJD 3FULA 3VXRD 5I1DA 3PAZA 4NRZB 2CHDA 1Q9WA 2Y36H 2ZCLL 2XWCA 1LE5A 2YD9A 5FUCC 4WWID 4OCMC 5JW3L 2A4CA 2Y2YA 1P0SE 2X4PA 3BC9A 3SGEH 3U9PH 3U7AA 1CD1B 1BVNP 3MRKA 1P7QB 3BHBB 1AG0A 3HPJA 4E5XG 3HAEG 1J9CT 1DYZA 1MCPH 2P3YA 2VITA 5F7EL 2EACA 4CN1A 3UCRA 3L3HA 4WWNA 1NANI 1PJWA 5EUOB 3JV6B 5ETUA 5TE6H 3CVIL 2CPUA 4LARH 4LK4A 3O2DA 3LCYA 3F58H 4WW2C 3SEPA 4ZTPH 2IFFL 5JO5B 4LCIH 3NESA 3S6CA 3MA9L 1CLYL 5T1LD 3RWCA 3X13A 4QKTA 3GSXB 2APWA 5CJOH 1FG2A 1ZRUA 1W8NA 2ZWSA 3CC5A 5BS0E 2V3FA 1YEEL 1ZHKA 1CGWA 3DMMD 2Y9RT 1WO2A 5C0AB 3LB6D 5GGRB 3R4RA 1ACYH 2X53A 2Y7NA 5D6CB 4DEWA 1MEXH 5K9OA 1PBYA 2YD1A 1FPTH 3MJ9A 3C5XA 4HD5A 4DGYH 2GI7A 3HE7A 4PIRF 4DGVH 4X9FA 3V0DA 1AXTH 3HE6C 1MFNA 3QQ9D 1AIFB 3PL6D 4OAWA 4FP8L 2YPLD 3BSZA 3WFZA 3MNVB 2IBZY 1MFUA 2FQGA 2W5PA 2C4FT 4JN1H 4MJIE 4QAWA 5D70H 4RESB 5EFIA 3HZMA 2DWSA 3RGBA 1IKNC 3GIVB 2JIXD 2VAAB 3LS5H 5KBKA 5D1ZA 2NY7H 3K6SB 1RLBA 3M1CA 3MRBA 5GGUB 4MQ7B 3BP7A 5CSZA 4WQOA 1N26A 3NCFB 4W9DC 5CEZH 4DIXA 2IAMD 4E41B 3C08H 5FYKL 1E30A 3K72B 4XNQA 3BH8B 4B9GA 1ZCRA 2X05A 4PRIA 5KBLA 1P4BH 4DAGL 2X28A 3DX9B 1HZHH 5D93B 3P77A 3QXDA 2A77L 5K69A 4GPVA 4AEIL 1CK0H 4LF3A 4KX7A 1R3IH 5ANMA 3LVEA 2HTLC 4RRPM 3WIHH 2JK5B 1HVXA 1ZS8A 2YUZA 2ZKXA 3U0PA 5F1KC 4XTRD 2AV1A 2ZKYA 3CN2A 1I53A 3CIAA 5D7SH 3QP3A 1DVFA 3WD5L 4GI6A 4GMSL 2DV6A 3STZA 5JXAH 5GGSA 1E43A 2ZTBA 4B50A 4WCYL 1L0YA 1JV5B 5A1AA 1EVTC 2XY2A 5C0BD 3T2NH 3B43A 4XI5C 1J05B 2JMRA 2CO3A 2PF6A 4LCWE 1FBIH 4Y16D 3AU1A 7TAAA 4G8FA 4AVHA 3LEXA 2XZAL 2JWYA 5L88H 1JZDC 1LO3L 3TA3D 5I18L 3MXWL 1XB6A 3VW3L 1FH2A 1VHPA 3ARGB 2NNAB 4UM9A 4XX1G 1Z5HA 1C7SA 4FNQA 1FSKC 1LO2H 3N85L 3EADA 1NUFA 2VN6A 4APQB 4MAYD 3VRLE 3I6SA 4LCYB 1OT1A 1YNKL 4MJ5B 1V55B 2UUDH 1NCBH 3HJEA 4OF0A 4ZAKD 3DX7B 1NGZA 4KXDA 3DJZA 1BDYA 2ZAGA 1R17A 1E3XA 2KQMA 4X7EC 4QTHB 3VD5A 2YXVA 3BAYA 1JZFA 3K6OA 4JPIA 4LLYB 5C0FB 5T5NG 3ZYIA 1P7KA 4A2EA 4YHLH 3HZYA 3L8QA 3NJMA 4LVOB 4EVNB 3PDDA 1GH7A 1HHHB 1FL3A 2P5WA 3IBEA 1NBQA 1VFBA 3SY0A 1DJXA 3KHQA 3SE4A 1Z0NA 3L7EA 2ZOTA 3V4PL 4YSSA 2X4TA 1A6TB 4ZPTB 3D06A 1N0LB 4HOWA 3DO7B 5CFHA 2WQRA 5KSUB 3TO4B 4AQ1B 3WJJC 2OMWA 4X4YA 5BVPH 1KPUB 4G11A 2JE8A 4XXWA 3RKDD 3BZEB 4GKLA 4OLEA 2F15A 1ZWIB 4LCCA 2OULB 4PY7B 1MF2H 4QJ3B 5IBUG 1E5CA 3Q44A 3FF7A 3VGDA 3WSQL 1DLHA 1BJ1J 3O9WD 4NHUB 3E9TA 1IQDB 3MCLL 1G7IB 5DD3H 3LH2L 4XN4A 2UVFA 3NA9H 3CPLA 2NZIA 1DQTA 4Z7VF 4KMLB 4EZKA 4ELKB 4RGNB 3GXFA 3LZPA 4TTDC 4G8EB 3VXTB 1YNTB 2GK0B 4RAVB 1TVBA 3GXTA 1HQRA 1GGIH 3CHOA 5JHBA 3CLEL 1TPXB 1JNHB 4K0OA 1N2RB 3EFOB 3DOHA 3GMQB 4NQED 5E9NA 5ECGA 5LO7A 4UYQA 1A3QA 4FL4B 1RZFH 5T1DH 3SD5A 1A14L 5CBEB 1E6OH 4BFOA 4PN6A 1P1VA 3GJFA 1Z3RA 3CDFA 5HBBA 1NGWA 4I5BB 1NJ9A 4B41A 3QC5X 3QARA 1KT2A 3CZJA 4M62H 1HXYA 3CFCL 1EZVX 8FABB 5I1DB 4XC1H 1C1EH 1Q9WB 3HI1B 4FKEA 3DJRA 3BDBA 3ML8A 1ZDQA 1SN0A 4N6QA 5EIIG 5F3HB 5L4JA 3TP4A 1JZ5A 5J3HC 1FVEB 3APNA 3MA7A 3IFPA 4X9YA 5EF0A 5AW0B 3V4VL 4C4KO 3ULVF 1BPVA 4ZBJA 1AGEA 3MRKB 4ZSOE 1EV2E 3HPJB 4Y2DC 4YDNA 1MFAL 3O4OB 4PV9A 3PP3K 4FZ8L 4MKMA 3V6FB 4EBQH 1WRFA 2VZSA 4XN9A 2DI9A 3L3HB 5E4EB 3ZKQD 3GK8H 4Z7NE 5EEUA 4OZFG 2XU9A 1RSYA 4TTGA 1FL5A 4G5ZH 4KY1L 2A9DA 3VXUA 3FUMA 3EBIA 1NC2A 2P24A 3JV0A 2VRKA 4PP1D 3RWCB 4OGAC 5ESAB 5EZOH 4ATWA 3CC5B 5GXBB 1UKSA 3DX1A 2MPAH 1DUYB 3T2LA 3VFNA 3HR5A 3ZDWA 2AZAA 2HG0A 4ZFGH 4KRPC 3UACA 2QGDA 4QHNA 1NPJA 5HHME 4UTBA 2EUZA 4WFED 1IQWL 4HV8A 3OSVA 1U8LA 3I75A 4DF9A 2GQHA 4F8LA 1IC5H 3KPPA 4JBSA 4Y2OB 4MDIB 4QWWD 1HI6A 4I2XE 3U7WH 3I9AA 3QRFM 1Y0LA 3HZMB 3HG5A 4JB9L 4PJ5B 1OT2A 1YY9D 4NN5B 4JL2A 3MN8A 5D1ZB 4BCYA 1B6UA 2VR6A 4IRSC 4R2GC 2D31B 4X80L 4AMXA 3MRBB 4DCQA 1NGYA 3VQ1C 4OZGF 1YMHA 4YZFF 1A5FH 3KW7A 2K8QA 2YD0A 5J89A 2VC2H 1OSEA 3RA7H 4CBPA 2YMXL 1SVBA 4QHMA 3UTTA 3IT8D 4PREB 2O5XL 3I85A 4PRIB 1GGTA 4DP6X 2VOTA 1H15A 4G7VH 3P77B 1CDUA 2ERJB 3QXDB 1KBBA 1K5NA 4N0UB 5J6GA 2OTPA 2C9QA 4GIAA 3RJDA 1P4LA 2F1BA 3QFJA 2QADC 4PD4J 5ANMB 3FTVA 4GI8A 4QRSB 2CQVA 1A1NA 5J11B 2ZX6A 1PZAA 3IJ7A 4D9QD 3MRMA 4HUXA 2LGNA 4AL8H 5IMKB 2NYZA 4HZLB 1DFBL 3FYIB 1DVFB 3QUXC 4XMZA 3WNKA 3STZB 5LBVA 5D7IA 1P5UB 1SUJA 4DGIH 4ZJ9A 3FU8A 4ELMF 3CV5A 2DD8L 5A7EA 5CWSA 1JPSL 1OCWH 2DLEA 2LE9A 1GC1C 2XXFA 1QEWA 1XL6A 3WE6A 1BFTA 3AU1B 4GAYB 4JFDB 3SKMA 1T20A 4UNTA 5EU4A 3F7PC 2PP7A 3VSTA 2CR0A 2DKUA 1Q72L 3C9NA 4N6RA 2PTUA 4XB8A 3RZWA 3O6LH 1BFOB 3LZFL 5E6IC 3AGVA 5AW9B 2GCYB 1GPOL 2QQNH 3UTPD 1GKEA 1XSJA 3VH8A 5DHVA 1F3RB 3N9GH 1DLFH 3UZQA 1U8JA 3ZMNA 2CGZA 3RDTA 3LNEA 1FYTD 3MFGB 2VR4A 2X12A 1NGZB 2IBGA 3CFEB 2YC1B 4BSVB 2NY6C 1TT6A 1O6VA 2Q2EB 4JPIB 4XP1H 5B8CA 1UATA 1N67A 1P7KB 1HKFA 3FOMA 4JM0A 4P3DA 4TSBH 5BRZD 1FL3B 2P5WB 4OJAA 1KYFA 2IEPA 3WLWD 3P0VL 3SY0B 2MOGA 3SIKA 3VGFA 2O5YH 2CHWA 2X4TB 5CJXA 3WO4B 4UDTA 3MNZA 1MREH 4B96A 4X4YB 2AGJH 2OMWB 1UXMA 3K71A 1KMGA 1VPOL 2QSCL 5T3ZH 4BE5A 4FQIH 1F3DJ 5B39A 1G9HA 5CCJA 3I6LE 1EZVY 2DQDL 2GKIA 1TQTA 3BIBX 3FFCD 2UZPA 3NSJA 1DO5A 5T3XD 3WIAA 4B6ZA 3QEGL 2N7BA 4OLYL 3CPLB 1PVHA 3NIFF 3WDHA 2XWRA 2CUAA 2ZUWA 3QJVB 2CKBL 4IRZH 1U3JA 5TK2A 4TLTA 2W07A 4NYLB 3AT0A 3AXLB 3BFQG 4K9JA 2Z7YA 3RL2B 3TFBA 2EABA 1RMFL 1A7RL 4HHGA 1XGPB 2PNDA 4A38A 4X7CC 5EEWA 2P5ED 2B1AH 2DI7A 3KYMA 3QCUL 1WFJA 5I8OL 1RZJC 5ELIA 1MFMA 2DJUA 3BUQA 3IRCA 4HX1A 4MCYB 3SYAA 1MAMH 4PS4H 1LVEA 1HXYB 3POCA 4MXQC 1N5AB 4ZW7A 1E8ZA 1I1CA 1VIWA 4OJFL 3E2HC 4FNUA 1N10A 3EDJA 3VXQA 5I8KL 5FM8A 3OSKA 3EBHA 3MA7B 4FD0A 4TUKL 2AMUA 4YDKL 5F7FA 5ADPH 1XCWA 5DO2C 1AGEB 1NLDH 4F7EA 5L2JA 2R1XA 3FTWA 3NSYA 2EICA 1OCOB 3D0VB 4PV9B 1G9NL 1M9WA 3L4ZA 2FWUA 4IMLB 3OR7B 4LHJB 3VWKD 4GRLC 5F6HI 3F6JA 3O6FB 5J13C 1D9KA 4L4TA 2XA3A 4NN7B 1BD2B 4AG4H 1XH1A 2VDRB 1ED3A 4KUZH 2WJ7A 4R0LA 1MCSA 4JFXA 1LK3L 3FMGL 2EE2A 3BT2L 4ZO8A 3NT0A 3HR5B 3O2WH 4DZ8A 3RHWK 4ZX3A 2DYPA 3CPUA 5DD6B 4JVPA 2OW6A 1TETH 5EU6B 4YK4B 1QBBA 4B9KC 1EANA 3GZKA 3K4ZA 4L3FA 1UM6L 3AT8A 3B1TA 1EO5A 1JZGA 2VDKL 4XBPA 5EUKB 2EVIA 3ZGHA 4PJGA 1JF1A 2CLZB 2ED8A 4R90L 3S4SG 3RNKA 1K9TA 1Q9OA 5C07D 3FRPG 2GW5A 1TVDA 3D3VD 4JFFE 1E28A 1KJ3H 1JPST 5JNYA 4WSKA 2FO4A 3TVMA 4DCQB 4PGBB 2F8VA 1YMHB 2W1NA 4NKOA 4ORZC 1ZKAA 3ZDXB 5AW1B 3RUGA 1YC8A 2E4TA 5HJ3A 3RPBA 2YZ1A 2NY2C 4HFWB 3FONA 4Q7DA 4RH4A 4Y1AE 4HPYH 1X4ZA 4JR9L 4YHYB 4P2OA 4GG8A 2H32H 4H44C 2VE6B 3RVXC 4AVJA 4HF5H 4WHTA 1MCOL 1K5NB 4I9WD 3L5XH 2R23A 4FQHA 3RVUD 3QUZD 5DZJA 4R96A 1JNJA 1IGCH 4WTWA 2ZYIA 3KLHC 3CXDL 4ODHL 1VCAA 4JPKH 1ROCA 2AHIA 2FGWL 2YQ3A 4M7LH 5IFHH 1TG8A 1DQDH 3OLEA 3HI5L 3FCTA 1GZHA 4TSCL 4WV1A 1A22B 5LQBH 1DBAH 4WF7A 1CFSB 2ROXA 1XCXA 2AI0L 3OHMB 4LHUG 4O2CB 4WTXA 2GBAA 1EAPA 4JM2C 4L3EA 3NSDA 4AGNA 4BV1A 1RK7A 4Z95L 3SJVA 5CWSB 4ALAC 2G2PA 1EJFA 1FNFA 1OAYL 1JXGA 5KW9L 1QEWB 5D5ME 1G0DA 4Z76A 5HGHB 3MO1B 2ATKB 4LOUD 4RVBA 3DUUA 4MA8H 4ONHA 1N8ZA 1PSKL 2AJUL 3VMPA 1ZAGA 2XKNA 3CIQA 4UT7H 5C0RL 1B0GB 3TN0A 1EXHA 3RY5A 3VH8B 4K94C 2CXGA 2ZYHA 3QCTH 4ZNEE 1E8XA 3UZQB 3ERXA 4UT9H 3VU2A 1DDHB 3EHBD 1N18A 3C5SB 2WNWA 1PQZB 2DQ6A 2EVGA 2MCPL 3TEWA 2G3MA 5B8CB 5CEYA 4LQ1A 4WK4B 1RUAL 5B21A 1FFPA 1B4JL 4H1LB 1MVUB 5DQ9B 2MNWA 4UF7C 1E5UI 6TAAA 4UDTB 2GB2A 1G6RB 5AVWB 3V4UL 5F9JA 3PV6B 3K71B 3KYOA 4X0NA 2X4NA 4NQXA 1HEHC 4UQ2A 1GGCH 1Z9NA 1CT8A 5E8EA 1A4JB 3IMUA 2Y69B 4NQUA 1TF4A 3VI4A 2QJDA 2YSSA 2ZYSA 1FLTX 4NO0D 5DFTA 5ILTH 3PU7A 1IAIH 1JYVA 3IF1A 4URKA 3KM2A 2NT0A 2V4LA 3B2MA 2W07B 4K3EH 2WZPA 1LWJA 3ALPA 3P11L 4J3OG 1XF2A 2LU4A 2X0WA 3A21A 5JORA 4XB3A 3HAEH 3LIUA 3SDDB 3VFRA 1IZKA 1ZLUK 2B14A 4KJPD 4KU1A 1NIFA 3ARFA 4LEBA 2ZSVB 4YBHA 1PYWA 4D8OA 2NY4C 3GSQA 1ZLSH 4E9YA 1NOAA 2C3VA 3CFTA 4HA1A 1Z7JA 3KPOA 2N4IA 3FT4B 4Z3TA 4D0CA 2ZF9A 3LIZL 4E9TA 3CSBA 1EO7A 1TTBA 4NT6B 1M4KA 5IMOB 1HIMH 2OR8A 1R0AL 4IBQA 2B3RA 4JG9A 1HZLA 1KV7A 1NINA 5KVFL 3D9AH 3OLIA 5TDPA 3MOBH 5L2JB 1JHLH 2R1XB 4L18A 1RJLB 1T66C 1IE4A 2WWMC 1MJ7L 2ALWA 3BVNA 4DGWC 1CMOA 3L2LA 1SEQL 2C8NA 2MTPA 1LDPH 1LO4L 1H8LA 3NCXA 4QO1A 3QJHB 4JK0D 4N3UA 1RH8A 4L4TB 2WQUA 3SOBH 1INQB 4HPOL 1M7IB 1NCJA 1S4IA 1UB5B 5EPMB 4JRYD 2H26B 4NQCD 4PPTA 1GVIA 4N2AA 1PEWA 3MV9B 2WP3T 1R4XA 2OL3A 4R0LB 1ITBB 4UT6H 3PGDB 4YSTA 5F93C 1RERA 4F92B 4NOFA 3U30B 4OLXH 1EWHA 1FZMA 1MG3C 4ONFH 1ZD6A 4FHKA 2WVSA 1CN4A 1IFGA 3DX0A 2DAVA 5BRQA 5EORL 3FN3A 3T3PF 4BQ6A 4UTAH 1AACA 3W9EB 1KEGL 3QXAA 1JAEA 4JO2L 3R4DA 3WNIA 4XBPB 3IDIA 4W6YB 3RNKB 1Q9OB 4PLJD 4PJXE 2NX5E 3ILQD 1E28B 3DJSA 3HNVH 5A6IA 2MH4A 1J0YA 3AS2A 2UV3A 5JNYB 1AIZA 4M6OH 2CDFB 2JV6A 4U3CA 3LHPL 1SYSB 4KTDL 3IMRA 2NCMA 2X6AA 4Z6AT 4P4KC 4M5SA 5HJ3B 4QRUB 4X6CE 3TYFA 5LNGA 4R97B 2HKHH 4RAHA 4WUKH 3T0EE 5E2TL 3EYVA 3LNIA 2VWEC 4WWKD 4WY7H 5KS9E 4FQHB 4JFED 3BUDA 4OD2A 1A7BA 3FCBA 5BXFB 1TCMA 1UZ6E 4WW2F 1XXDC 1KIPB 3A6CL 3PHQB 1DBML 4G9DB 2EO9A 2APBA 3P4LA 4HWEL 4QTIL 2VDNB 1XGYL 1WD9A 1WYJA 2J8UE 1D7CA 1FVCB 3EH5B 3V7AE 4Y5XC 2E76C 4P5TC 3GC3A 5FEBA 3EH1A 1JG9A 4J3SA 3WEBA 1SNRA 4L8SA 3L4WA 3FSAA 2DMGA 2H0EA 4DN4H 2YUVA 1LE9A 3FUNA 4U1MA 4OCLC 5DD0L 1T1YB 4HGMA 4FCAA 2WQWA 5SX4H 5EO0A 1QTSA 1IFHL 1AGFB 4IOSD 1IBGL 4XO9A 2GITA 1WIOA 4JJ5B 2VXQL 2WVUA 4GP4B 1PGRB 1N8ZB 5GSRB 5C0JA 3D0LB 3QIBA 4UYPA 2OSXA 1V5JA 1YLBB 1E9QA 5JHDE 4YEFA 3MRNA 4OLUL 1KCUH 4FADA 3D85B 3BVVA 4P59L 4LB8A 1PX4A 5I8CA 4W9KC 1Q1PA 4AL8C 2DEYX 1CBVL 3KPRA 3BZDA 3QDGA 2H3XC 5CGYC 4HK0A 4NN6B 3PE9A 4LLWA 5CEYB 5FLVA 1OLLA 1X6LA 3E7JA 4A2FA 2F7RA 1CG9A 2WLZA 3K3QA 4H40A 3MXVH 3FF8A 3TH3T 1KTKE 4XAKD 4ZFZB 2WUCH 3LMJL 5DZOA 2NXZD 4XMTA 3TURA 1F58H 2A1WH 1OAQL 2NDFA 1QFWH 4NQXB 2UZIL 2JVUA 1QHQA 5ICUA 1CT8B 1GYAA 1X5LA 3DK0A 5JXEC 2UUDK 4DKTA 2CDGA 3MBXL 2VXVL 1GR7A 3VI4B 1ZOXA 3BKCL 4RFEA 1UT9A 4NQSA 2WB7A 4AEEA 5KAQF 2Y6SC 3QPQD 5B7MA 3AQXA 2H4EA 3NABH 1PZUB 4YDJA 3S88L 2WTOA 1NANH 4I4WA 1TZGL 5KSBB 1UYWH 1YYLH 5K9JH 1XF2B 3V10A 1CDBA 4PLNC 5IMMB 1IBYA 5HI5D 5JORB 1J8KA 4EIGB 4NKMB 2CK0L 1B90A 5D55A 1E27A 4RSVA 1NKOA 3GLEA 1Y1DA 4MNQA 1MCLA 2J88L 4HEPG 4MZRA 1IM9A 3VYOA 3DDGA 4C56A 1BWWA 1C5DA 1NAML 1PYWB 2OSLB 3T3MB 4XE0A 2E7CA 4OI9A 5E5RB 3IFNH 2BH0A 5EV7A 3KPOB 3U7YH 2OJEA 1T21B 3DUSA 4QOKA 3KR3H 4NUPA 5LNEA 1WAPA 5GRUH 3IS1X 5I0ZA 2EC9U 1L7TL 2R9HD 4F37K 2RFXA 4UV4H 1P7QD 4ODVH 3KL5A 4CMMA 3V4PA 3Q0HA 5TDPB 3LEVH 6PAZA 1HL8A 2BWDA 1J1XH 4A7VA 3WXVL 1R33A 2JCWA 4DP4X 4JZJA 4S1QL 2DQGL 2VXSH 3BPOC 4NZUL 1N7ML 2X88A 3QZWG 1BG1A 4EUPH 1JL8A 4ANVA 1DVTA 4N8CL 4F7PA 1ERNA 4OW6A 3MRQA 2G3NA 3HBQA 3RIAK 5C0AD 1S8DB 4GP5B 4HGWA 3D50A 1A1MA 5TF1H 2DLFL 3EZ8A 4RGMB 4I0PA 2XIIA 1IAKB 5HVFB 4QHKJ 1BM3H 1QO3A 1GY2A 5LCVL 1U4FA 3TF4A 1CICC 1UXWA 4ZT1A 2H2SC 1XSOA 1JGEA 2CRYA 5C7XL 1N0XL 2HKAA 4PGCB 3PABA 5CP3A 3QXAB 1AGDB 1FDLL 3ELQA 2WZ6A 3QJRB 3FKUS 4M5TA 1L9RA 2BSBA 3QNFA 4RRPA 4R5VA 1CXHA 2HFEA 5DHEA 3HMXA 3IDIB 4J3UA 1H3VA 2LHAA 1HYSD 3BESR 3ZMRA 4KVPA 4AIXA 4ZMXA 1E9OB 1NOLA 5FA4B 3VWJC 3S5LG 4YIQA 4G59C 5I1IL 4E41D 4ZMOA 5FFLA 2ZCKH 2M2DA 1WHPA 1L6ZA 3CWGA 2F53B 1NCAL 2KZWA 4TUJA 3ZE1B 1QSEB 2B1HH 3QIUC 1QWUA 3V4VA 3LY6A 4G6JL 4P2YA 1I1RA 4X8GA 3E3QC 1SXNA 2UY7B 4TVPH 2VDQL 4N5UA 3EYVB 3QGVA 4XXDB 1GGBL 1H0DA 1ZK9A 2FDBP 2DMBA 3GMOA 4JUTA 2WMPB 1I7TB 1SLXA 4QHKI 4R7DB 3IN0A 4ZOBA 4R5TA 5I6OA 2FB4H 4IQHA 1EBPA 5E70A 5DXWA 3SSGA 2EXWC 2GHWB 5IBLC 4MCNA 3UTOA 1ZXQA 4OGYH 5CINH 3UJIH 3QZNA 2ZOLA 5F71A 3ZQWA 3PWPA 3BAWA 4L8SB 4UM8B 4U1MB 1UD2A 5D7LB 1G7PA 3MLYH 4KKNA 3RX9A 1BJMA 4Z7AA 2G9HB 5A2LH 4IGBC 3RHWF 5AG9A 3ARGD 1MZZA 2XWTB 3NCYS 4OZGA 4NKIH 4XP5H 3L3OA 5C0JB 3HNSL 4JFZL 2OR9H 4APQD 4F27A 1MPAL 1RL1A 1MCHA 2BVOB 4NKQB 1M3IA 1H9VA 1HHKA 4NM4H 1U3HC 1FO0L 1PY0A 2MTAA 3KBEA 2VIRB 2PR4H 4FG0A 3V0JA 5I8CB 1Q0XH 3HR6A 2C26A 4FNLH 4TLSA 5F9WC 2X2HA 5MERB 5HP5A 2I07A 2QSQA 3QDGB 4XH2A 4MXWH 4HK0B 5EZIL 1RIUH 4Q6IA 1TLKA 2BCKA 3F04A 1A7OL 3D18A 3SCMB 1HHJB 1CG9B 1L3NA 3VRJA 3ULUD 4PJDF 2O6EA 1RPQA 3TO4D 3FT3B 2FTAA 4IHOA 4ELMA 3KDMA 4FNRA 4BWUA 1GC1L 1YECH 3FQXA 5IJDC 1TQBB 1HTYA 2BIMA 4GRWB 1VCBC 4P2QE 2FX8L 3TBSA 3QR1A 2IMNA 2VLKE 1M6OB 4NO5B 4WW1B 1DCLA 5KBPA 4CJ1A 4Y2NA 5TE7L 1UT2A 3GXPA 5L8LB 4B0MB 4RGND 4L1DA 3VXUE 4NBYB 4NZFA 1CFNA 3RWHB 3ZE2E 5IOPB 2QPDB 4IK7A 3GNMH 4W70A 1YEDB 2D0FA 3ZLQC 1B9ZA 1I7UB 3DXAE 1XGTB 1RUQH 4DP5X 1SXCA 4BELD 1KULA 2ZAHA 4Z8FL 2YUWA 4OGQC 2LU7A 5HI3C 1TQCC 4OCYH 5GRXG 3TBWB 1KTLB 1WF5A 4AC2A 2OXHB 1PFOA 1XGRB 4RISL 2BXYA 1CLOH 2G60L 1MVYA 3AG3B 5FOJA 2KDGA 2ESVA 2AS5M 3X3FH 2BHFA 4G3YL 4UV7H 4NCC2 4AM0A 4ZG1A 1UJ3A 1KCVH 2A74C 2JJWA 4Z7WF 1R6VA 3IJ9A 3BUIA 4G8IB 5AOZA 5AKTA 5GGVH 1ONQA 1KYUA 5C0IA 4JY5H 1QR1A 2IWFA 2VLJA 4JREB 4A6YB 8CGTA 5J57B 2DWEA 1ZA3B 2COVD 2VDLL 2ZG1A 3OKEB 3T2PA 3A23A 4PJAB 4JHAH 5E2WL 2IQAA 3UTTE 1OK0A 1LP9E 5I1KL 3NFNA 4JZJB 1V3KA 4Z7VB 4N0YH 2GUYA 4Z0BH 2FSDA 3BH9A 4MA3A 3O81A 3OPZH 4B9FA 5TTRA 1IEAB 1A0QL 3H55A 3JTTA 5CGMA 5IFAH 5IVOA 2QVTA 1G9EA 3O3DB 1NL0L 4UBDC 1GZPA 1NWOA 5DMIH 1B2YA 4NZTL 1RIVH 4XXCC 5DLMH 1SXAA 1GMEA 1BP3B 1I8UA 3QWOA 3NZSA 3MOQA 2CKBA 4O58H 4XPTL 3KPSE 4FULA 1RZJL 4BWWA 3QUKB 4I0PB 4K3JH 5FA3B 1OP5H 1CL7I 5D7IE 4DK3A 4GBXA 1N70A 4PVNA 5BQDA 1JHTA 1RVFH 2QFPA 3O3UN 3V0HA 3M7OA 1EFXB 1RFDL 4FXGB 5LBSA 4C59B 1OCZB 2EADA 2OK0L 5JPMA 2A38A 4Y4FB 4P9HH 4GQPH 3FUIA 1I8KA 3MV8A 5DWUL 3F85A 3RX5A 3LN4A 2AJXH 3L08A 3OMNB 2HFEB 5D1ZD 4PI0A 2XQYA 3DROA 5TGBB 3SKJH 3Q6GH 4JRXA 4DKEL 2DQTH 3IS0X 3TNMA 1GY1A 2F19L 4M9PA 2PR9A 2WTRA 4K7PL 3NBNA 3RFZA 5KYXA 3ZSSA 1JXKA 3T6WA 4HG4J 3IWUA 3L3JA 2EDLA 3LJ3A 4ZMZA 1X5KA 4PRID 2JELH 2OBGA 3WKYA 5F7BA 1Z5LB 4XPHH 2AVFA 3LKPA 5K59E 2G75A 2WBJB 1P84K 5HJBA 2J1WA 1BVNT 2RHEA 2XN9B 3CN4A 5BQ7A 4Y9GA 5IGXL 4ABUA 2ZXDA 2QZQA 5D1QC 5ABZA 4CADA 2Y36L 3BQUA 1KYAA 3C6LA 1DVFD 4XVOA 2ALAA 3IVKA 2XYBA 2GSGA 4EZMA 3UJJH 1T2XA 2WXMA 2XWBA 4X98B 3DGDA 3U9PL 1K2DB 2ZOLB 2ZSWA 5C0CB 4H26B 3NGBB 1MCPL 3SDXB 1G7PB 2L04A 3RAJH 4HKZA 4JJOA 2BPBA 4JN2B 2X4QA 4BZYA 1H6FA 1GGYA 4LARL 2FBRA 4PRDA 4E2OA 3F58L 1JHKH 1M42A 2ZONA 3CQQA 3VD4A 1S6NA 4OZGB 1WS8A 2CUHA 2ZX7A 5CJOL 1BQ5A 2PETA 2GFBB 4FNSA 5E4AA 4KKAD 3ZIMA 1HHKB 4WKZB 4RGOH 1VEPA 1ACYL 1IMHC 4JFWA 1T1XA 1MEXL 2WO3B 1WUZA 1FPTL 1UUSA 4MQTB 4DGYL 3FFDB 4U4IA 4LNRB 4DGVL 1T0MB 3D30A 3WI9A 1A4BA 1WP6A 2R69H 4QRAA 1RJYB 5DZ9A 5KSAA 4XH2B 2P5WD 3LSOB 3S48A 4L0YA 4EI5C 2BCKB 3KWWB 4JN1L 5D70L 3D18B 2HMID 5DRXA 3VQMA 3VRJB 3R06A 4W4NA 4ZD3L 5JHAA 1JVKA 2QTVA 2NXYD 5HGBA 3AXIA 3NPSC 2ZPKL 2NY7L 2F58L 3MLUH 1GYWA 4ALAL 1DQJA 1TDQA 1GSKA 3FQXB 3MOAL 2PTVA 4QEGA 5FPIA 4DPRA 2K6ZA 2OYPA 3HEIB 3TBSB 3BE1L 3C08L 5SWQA 4EIUA 4CGUB 4JM2F 5C0GB 2AAAA 2ZJSL 5IROC 1K8IB 3CFUA 1P4BL 1U8KA 2CZNA 3IKCA 4PB0H 4DERA 3MU3A 3VI3E 1HYRC 5C6TH 4HJEA 4HKJB 1U8MB 1H8NA 2ADIB 4K94L 3KM1A 4TVSa 4HUWA 4BUQA 1TTGA 5F7NC 3L5IA 2YJLA 3MNMA 5D7SL 3W39B 4GSQA 4P5KB 5E2JA 1AFVH 3SN6N 5HYSG 2CRMA 3G04A 2BM3A 4HMDA 4I87A 2ESVB 1X5JA 2WD0A 4AV0A 3HPLA 2J73A 5CF3A 1FBIL 2XX1A 4PJGE 3EUDA 4HISA 5CP7A 1UJ3B 1SDDA 2YQBA 5L88L 4OZHF 2AXGA 4YPJA 4RWYH 5DJ6B 3G6JE 5C0IB 4UOW0 1CE6A 2F1EA 2VLJB 3NIGE 3KYKH 4H88H 1LO2L 2FYYB 3RY6C 3MPCA 3F8UB 3RUGE 5KVEL 3U4EA 1ET8A 5E8DL 4U4BA 2IQAB 3DJTA 1UWEH 2Q6WA 3RGVC 2CHZA 4TULH 4QKXB 1OZTG 3NIFB 1NCBL 1AMYA 3FB5B 1MY5A 3WUWG 4CVUA 3BH9B 4A39A 1MFVA 3MUHL 1NC2D 2O6DA 1BD2D 3OKYA 3JTTB 5GGQH 1X44A 4FLOA 3P3TA 3O41B 2Y0SA 2FHFA 3FC8A 1ZDSA 3HMWL 4XP9H 3PWUA 1J8HA 3QWOB 5CD3B 3AY2A 3TZVB 1BZ9A 2ICWA 2R83A 2ZX8A 3GBNH 3IGUA 2IH1B 2ZE0A 1A6PA 3FQ4A 3NIDB 4YSEA 1XF3A 4X6DB 5EU6D 2F8XC 2HJKB 4L3EE 4GG6F 3VFUB 1KGCE 3GI8L 3WKMH 1JHTB 3SJVE 4N0CD 3BLPX 1J87A 3TH4T 1CGYA 2WQXA 5ID0A 4HWBL 5IFJA 3SGKC 2IH3A 1MF2L 1W16A 4M5ZH 2OV0A 4K7PX 4XBMA 3Q43A 4BGDA 2CBQA 4ERSH 2L7JA 3DARA 2QKIA 5DD3L 2FZ3B 3L3KA 3IMWA 3EO1A 3LN4B 3UPAA 2CIIA 1XCQA 2DIJA 3IDJA 2KMWA 3AB0C 35C8H 5EC2A 3VXSA 3WIFA 3WLBA 2WTRB 2ZUTA 2W0FB 1GGIL 3UGUA 4OTXH 1RXLA 4Z5RA 3BPLB 5KJRH 5IW3A 1NBZB 1U8OB 1B88A 2B0SH 3DUHA 2H6UA 3NJIA 5D2NA 2YAOA 4UIMB 3VDCA 3I74A 1RZFL 4FHJA 4PBDA 4YQXH 4F37F 3KGSA 1E6OL 3FBQA 3QFJD 3V4LA 3C09B 3DETD 5E8OB 2LTQB 4LVNB 3EJJX 3WL9B 1NGPH 4YDLC 3M1BB 3GI9L 1HFUA 4ZMNA 3UBXA 1DJHA 4XC1L 5FW7A 4CADB 1QX1A 2K1MA 3BQUB 1QW9A 3C6LB 2WWOA 2AQ2A 5B38G 3SDYH 2CLVA 4X4ZA 3U36A 3O8XB 3GINA 4ADJA 3DHPA 4WI2A 3RIAF 5I2IA 1Z9PA 4M5YH 3T6ZA 3BFOA 1E7VA 4S1RL 2EO1A 3OAWA 3S36L 2ZXGA 4HKZB 4PWFA 2QGBA 1LEKB 2Y3AA 5B22A 3OGOE 4XNYH 4PRDB 4PLKC 2WKLA 2AMGA 4KK6C 1BGXL 3TFKD 2ICES 2VDKB 2YUXA 4MXVF 4NLHA 2APXA 3BPNC 3OR6A 5EZOL 3R8QA 1WK0A 3CFNA 2BZDA 4Q9QL 3MRCA 5I6XC 3RDTD 4LVHB 2IV8A 1I3GL 4ZFGL 4JQIL 2FWLB 3DRTA 3H3KA 3WV0A 3O2VH 2AXJA 5TD4A 5JLZA 4WW2A 2Z93A 3ARDB 2F54E 2JB6B 2X9XA 1I8AA 2KT6A 3L4TA 4G9FB 2X5PA 4YDVA 2EUVA 1IC5L 1OGPA 3TONA 4X5PA 4OI8A 4GIOA 2V7HB 4JFPB 3U7WL 1HWWA 2DQUH 3MLXH 2FX7H 5AW4B 3LPPA 3R06B 4YSRA 1JZ4A 3JVGC 5CU5A 4KKBD 4JPSA 1JNNH 2ZKHH 1KCRH 1PG7W 5IG7A 4KAQL 4HC1A 4LO9A 1U2YA 1FFOA 1A5FL 4CU7A 2WLLA 1A3ZA 3HE6A 4HOZA 3IDMA 2VC2L 4GKSA 3ATEA 1S9XB 3ILPB 2X9YA 3IKCB 1DJZA 3IMTA 5K33A 1IKNA 3L5HA 1JERA 5DRNB 4KMQA 3BO8B 5EN2B 1OK8A 2OMXA 2SODB 4DUXA 3PHSA 3NN8B 4ESKA 4U1HB 5SWZA 4M03A 3RWGA 3SDDD 5LGYA 3ZDYF 4BDVB 2GJ6A 4NUJA 4RX4A 2DQHH 2WTPA 4AL8L 2C3HA 4FQ1H 5FK9A 1IU1A 3SYPA 3WXWL 3NJHA 1DSFL 2IGTA 4PWEA 3QXVA 4DGIL 3G04B 4O2EA 1OCWL 4I0CC 2WLJA 3GPSA 3HPLB 2LFEA 2C1OB 2AAVA 1Z9LA