5I6OA

Crystal structure of copper nitrite reductase at 100k after 20.70 mgy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 92
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA02
3H56A 4FA7B 4UANA 3T71A 2RACA 4N4YB 4BXVA 4BWTA 1AG6A 1AACA 3QJTB 5I5IA 2H5UA 1SFHA 1JZEA 1SDDB 2ZONA 6PAZA 1NICA 2R7EA 4UAHA 1E30A 4HAKA 5AFAA 4DP5X 1URIA 3WNIA 1NIBA 2IDUA 2YAHA 4KNTA 3FU9A 3KW8A 2XV3A 2CUAA 3IEAA 3EH4B 1E65A 2LLNA 3PXLA 1ET8A 1SF5A 1NWPA 2BWDA 1NDTA 3T9WA 2Q5BA 5IY5B 2HRGA 2CBPA 1WA2X 2FWLB 1EHKB 1ZV2A 4TXVB 3ZIYA 2UX6A 1NIEA 1EZLA 3CVCA 5PAZA 3C75A 4A66A 3NJJA 2IDFA 1BYPA 1PLAA 2I7SA 1BXVA 3SBPA 1R1CA 2VM3A 2TSBA 1A8ZA 3PPSA 1CC3A 4WKXA 2OJ1A 4DP4X 2HX7A 4KO9A 1L9RA 1GY2A 3D12B 3FSVA 3FU8A 2N0MA 2FJSA 5I6MA 2WSDA 4KO5A 5D4IA 5A7EA 1W8EA 3NJLA 1BEXA 3NJNA 3TA4D 1V55B 3L45A 4A2DA 2XX1A 1BQ5A 3FSAA 2MTAA 3UAEA 2GHZA 2XXGA 4WTQA 1M57B 1W6LA 2GC7C 2VW4A 3NT0A 1NWOA 1TEFA 4F2EA 3NSYA 3ASOB 4YSTA 3NJFA 4BWWA 5PCYA 4YSRA 2BP0B 3CDZB 1N68A 1B3IA 3OQRA 3NJIA 3V9CA 1JZIA 1SJMA 1PY0A 2PPDA 1ASPA 2AVFA 3NJKA 4BXSV 4GP8B 4Q89A 5AKRA 3SBRA 3QJQB 2E86A 1L9QA 3S3CB 5EHFA 5B7EA 2HLEB 3X1FA 5B7FA 4DP0X 1JVLA 1ADWA 1CYWA 4EF3A 2DYRB 2CALA 3H4FA 4CSPA 4E9SA 9PCYA 3X1BA 2GB2A 5AZUA 2BW4A 5B1KA 1ZPUA 1WS8A 5TK2A 4G7SB 4YSCA 4BDVA 1M9WA 1M56B 2IAAC 2B3IA 3MX0B 1SFDA 3RYMA 2ZXWB 1UATA 3X1NA 2YARA 1SDDA 3BQVA 1ET7A 2VW6A 2IH8A 2XV2A 2FQEA 3JTBA 2W8CA 3FQ1A 1BXUA 3T6WA 1KYAA 2VSMB 1A3ZA 1KDIA 2BO0A 4A2HA 4JKNA 4DP2X 2PCYA 3CVDA 1PF3A 4NAJA 5I6OA 2FQFA 2PLTA 1FFTB 4PAZA 5B7MA 1PNDA 1J9RA 2IDSA 1AS7A 4NERA 1AR1B 1IKOP 3ERXA 4PCYA 5I6NA 2AANA 2DY2A 1GS6X 2HRHA 4W9ZA 2VMJA 3WG7B 2XXFA 3NP4A 1I53A 1KCWA 3EH5B 2VSKB 3CZUB 3AZUA 1KBVA 1AS6A 1RZPA 2JXMA 2HZHA 1GS8A 3ABGA 3QPKA 4GP5B 2P80A 3S8GB 1JXFA 1W6WA 4F7KA 2EIKB 2VM4A 1RZQA 1JXDA 2YAOA 3AG3B 4A2FA 2CJ3A 5LDUA 3FYIB 1J9SA 1AOZA 4Q8BA 3PAZA 1XB3A 1JVOA 3QJUB 1OCOB 2XVBA 2PPEA 3UACA 5B3SB 4P5SA 2PP7A 7PCYA 3WNJA 2XWZA 2GSMB 2BHFA 2EIMB 2BZ7A 3N55A 2QDVA 1IBYA 2GBAA 4KO6A 1AG0A 1OE1A 2MRYA 3AY2A 2FT7A 4ENZA 4DP1X 3DIVA 3FU7A 1KDJA 1WS7A 4YSSA 2BP8B 1OCZB 5E9NA 1X9RA 1ETJA 1ILUA 1ZIAA 2AZUA 3JT2A 4KNSA 4NB7A 3TU6A 1JZHA 1OCRB 1L9TA 1KBWA 2BWIA 2J55A 1QNIA 1MDAA 3G5WA 4GP4B 3BVDB 1JZGA 1RKRA 3FSZA 4BWUA 1NPNA 5B1BB 2BP8A 2FQDA 1E5ZA 3PCYA 4BK5C 2DV6A 3AG1B 3FQ2A 1SNRA 1YLBB 2XV0A 3ZX1A 4YSEA 1XB6A 1JERA 1JOIA 5B1JA 2PPCA 2Q9OA 1XB8A 3UGEA 4X4KA 1AS8A 1SF3A 4JHUA 2DWSA 1DZ0A 4G70B 4AI7A 4BDVB 1AZRA 4E9RA 1MG3C 2EINB 2GIMA 4YSQA 4ZK8A 1MZZA 4YL4A 3IN0A 4E9XA 4YSUA 1V10A 1WA0X 2TSAA 2ZOOA 2VN3A 3AW5A 1NIFA 2IDTA 3MBWB 2HXAA 3NP3A 4GY4A 3CG8A 2X88A 4A2GA 4YSOA 3FS9A 4KNUA 3NSFA 1SHWA 3NJGA 2OV0A 2EIJB 1OOWA 4F2FA 1AAJA 4P5RA 2FQGA 1AIZA 4HCFA 1ZIBA 4HIPA 3EF4A 4G7QB 4KOBA 4HALA 4YVNA 2XUWA 1ASOA 1KV7A 5I28A 3WI9A 1ZDQA 1ASQA 2R7EB 3ABKB 2ZWNA 3FYEB 1NZRA 1CURA 1A4BA 2UXGA 1HAUA 2PPAA 3TBCA 4A2EA 4RH4A 2PCFA 1AZNA 1V54B 1AZBA 3V9EA 4E9VA 2HX9A 1AZUA 3PLYA 1BXAA 3H4HA 1VLXA 2UX7A 3X1GA 3T6XA 2YAPA 2QT6A 4N8UA 1BYOA 1PLCA 3GXUB 1F56A 1FWXA 2I7OA 1BQRA 2YAQA 3FPYA 5I5MA 6PCYA 1BAWA 2EILB 2CCWA 1JZJA 2JKWA 2BP0A 2WO2B 4DPBX 5B1JC 2PPFA 2FT6A 2DWTA 3FU7B 2HX8A 5FC9A 4AX3A 1NPJA 1L9OA 2B08A 4YSPA 1GW0A 4DP9X 4FAAB 3T6ZA 2Y1AA 3NSCA 5ANHA 1OF0A 2W88A 1J9TA 3IBOA 1CUOA 4KO7A 4E9TA 3IN2A 1PZAA 1ID2A 2DYSB 1PNCA 3NJMA 2QPEB 4A67A 4G7RB 2NRDA 1TEGA 3QJRB 2J56A 2I85A 1IUZA 1N70A 4G71B 1J9QA 2FT8A 2XX0A 2GI0A 1IBZA 3DKHA 3SQRA 3NYKA 5D4JA 3AG2B 4AKQA 1X9UA 2YXVA 7PAZA 3DTUB 1NTDA 3NSDA 3UAAA 3OM3B 3X2QB 1FA4A 3PAUA 2PP9A 3OMNB 2YAMA 3TASA 2XLLA 2GC4C 3ABLB 1J5CA 2CAKA 5I6LA 1PMYA 3T6VA 3QQXA 2VW7A 2JFCA 1E5YA 3FPXA 1AQ8A 1GSKA 5F7BA 4A68A 1NIDA 1HAWA 4M4RB 1BQKA 3ASNB 8PAZA 1PZBA 1QHQA 2YAFA 3FSWA 1L9PA 2BZCA 3NJHA 2FNWA 4L0PB 2XU9A 2UXFA 4M3HA 3X1EA 1KCBA 1OE3A 2J57A 4AKPA 2IDQA 1TKWA 3SBQA 1ILSA 1IC0A 4QLWA 2P80D 1AANA 4UF7C 2IWKA 2Y69B 4QKTA 3GDCA 1RCYA 2AFNA 3QJVB 1E67A 3S8FB 1JXGA 1GS7A 4HCIA 1GR7A 2H47C 1PAZA 2YXWA 1HFUA 4KOCA 2IH9A 1A4CA 1WA1X 3UADA 4HCGA 4MFHA 1WAEA 1NINA 3WKPA 3TBBA 5D4HA 3ZDWA 1OV8A 2WO3B 4GYBA 5I6PA 1A4AA 1OCCB 4JHVA 2AZAA 3WIAA 1KGYE 2QPDB 3S3DB 2H3XC 4AZUA 5I6KA 3AG4B 3OMAB 4GXFA 5F7AA 3FQYA 1ZDSA 2IWEA 4K9JA 5I5JA 3S3BB 4DP6X 4AKOA 4DP7X 1GYCA 1XMEB 4E9YA 1L9SA 2QDWA 2YAEA 4HHWA 4G72B 3ABMB 2BW5A 3UABA 1T5KA 2UXTA 4W1TA 1PLBA 3OD3A 3OMIB 1OE2A 2FTAA 2IWFA 1ET5A 3U25A 2PP8A 3HB3B 1NIAA 3EHBB 4HHGA 4E9WA 1AZCA 1A65A 1MZYA 1PZCA 3IE9A 3QJSB 1PCSA 2J5WA 5I26A 3CDZA 1JZFA 3N2JA 4YSAA 1QLEB 5TK4A 2OCCB 4CSZA 4E9QA 5B1AB 1SHXA 2YQBA 2UXVA 1MG2C 3GYRA 1DYZA 3HEIB 4YSDA 3FT0A 1CYXA 1TU2A 4HZ1A 1GY1A 3ZBMA 2X87A 4DPCX 3CVBA 4DPAX 2XYBA 3PAVA 1J5DA 3EH3B 3WKQA 4YVUA 2A3TA 3KW7A 4DP8X
chains in the Genus database with same CATH superfamily
1E40A 1R24A 1RZ8A 2EEDA 2YMOA 3HG1A 3NH7H 4GRWH 4RAVB 4G7YH 3ARSA 3TA3B 4ZMTA 1AG6A 2CO7A 3HI5H 3QFDB 3RIAF 2PWEA 1AD9A 1K6QH 1RJCA 1RUKH 3WLWD 2RCSH 3MNZA 4GPVA 3UO1H 2OTUB 5L8JB 2XWJB 3JV0A 4XPTL 4JFHE 3VGEA 3S36H 5LXGL 3BESR 3RI5F 1UD8A 3A4FA 5DT1H 2G5BA 5TFSH 3KXFD 1IVTA 1ODUA 2X6VA 5HYJB 3OKMA 4H1LA 4PY8I 4KJPC 2R27A 5J6SA 5C07B 1U8QA 4HUNB 3DNKA 3LRSA 2BC4B 1XEDA 1LEGA 3CSYA 3GSRA 4P2QD 2UX6A 3IRCA 3O6FA 5DJZB 1LEIA 1AGBB 1FVDA 1NCCH 3CVCA 2X2JA 3NZSA 3SDDC 4FG6D 4LCWB 3ZN6A 4K3GA 3DC0A 3GMRA 1KLUA 2I7SA 2VYRE 1OO2A 2F1BA 2JF1A 5DJ8B 4Q9RH 1T0MB 5AOIA 1K5NB 2JXMB 4LAJH 4OI8A 1DQMH 2DMCA 4P46B 5EDSA 3S88L 4UUJA 1A5FH 1E9PA 4PJ8C 5JW4N 5FO2A 2R2HB 3L17A 3NDZE 1CLZH 5CGTA 5D4IA 1IBFA 3AXHA 5DYOB 4NQDE 3KXFA 3L9EA 3NJLA 3MBXH 3BYYA 1BEXA 4NUJB 1BQ5A 3QG6A 1U2YA 1XGYL 4WW2C 5TE7L 4PS4H 1JZ3A 4IK6A 3ZVVA 3FH5A 4PV1C 5GZND 1M05B 3EGSA 5IFJB 3ULVH 1BA9A 1KB3A 1HINL 4F2EA 4TMPA 5IQNA 3L7EB 5IR1B 2X05A 2C9UA 1OAZH 1R5VA 4B3VA 2FUQA 4OUOA 4ZAKC 1OTTD 4H8WL 4R90L 2Q8BH 4A6YA 4PY7B 4P2OD 1FGNH 2LV4A 3QUXA 4PP2B 2WD0A 1MNUL 1NUGA 2PXYB 5D96B 3V4UH 3CSFA 5KS9B 3D9AL 4Z76A 2LHAA 1B2YA 1UACL 3SPVB 1U8MB 1CGXA 1GHFL 1M6UA 2HG5A 1JDDA 3W2DL 3S3JA 4RQQA 1FNSL 4KVNL 5EB9A 1ZJAA 4MJJA 2M83A 3GGWB 1YUHB 5GGRY 2VZSA 5DJYA 4TSCH 3UJTL 1CFBA 4E9SA 3S37L 4JANB 5B1KA 4HWEH 1T04B 4XCYB 1JVKA 4P9HH 5E99H 3K4DA 1JV2A 3LN9A 5DDHB 3TP4A 1KB5L 1KZYA 4RGOH 1GSMA 1H8NA 4JG5A 4DCQA 3FCUB 4G1EB 3RX7A 4Y8AA 4KTEL 3VFUB 4CMHC 1NGPH 3ZDZE 1ZS2A 2VLJD 5JORB 4KKCD 2XV2A 4KFZC 4WFFD 5EU7E 2GITA 4NZ8A 4X5WB 4BSJA 3AM8C 2BO0A 3K2KA 3BO8B 2X28A 32C2A 1OSZA 5CJOH 4MCYB 3T0EE 3KBPA 5BQ7A 3N85H 4XMLL 4DOHB 2BIHA 2X4QA 5CSBA 3ILDA 2OR9H 4P2QB 2JSFA 1TENA 1YEEL 4RFEA 5MEOB 4LASL 4FNPA 5K59E 3CHPA 1R3LA 1D3CA 2MQGA 3S4SA 3N0PB 4XWGL 4X6DE 5JIQA 1P1ZB 1AC6A 3TBTA 1Q1JL 3EH5B 3GNMH 5BRZE 4YLQT 5IBUB 1F45A 2VL4A 3KVDD 5E4EC 2HZHA 5D71L 2BS9A 3PWJB 3VXUA 4NCDA 3HHRB 4M00A 4QXUH 3WTUA 2WM0A 5ACLA 5D6CB 1AOZA 1JK8B 4XNQB 3T8MA 1CFTA 1CB4A 4XMPL 1G1OA 1BPVA 4HMCA 1EMTL 1BZEA 1YEGH 5CP3A 1J0JA 1WTGT 1CXEA 2YUVA 3ARXA 3PJLA 3BZEB 5F7DA 3FULA 2CK2A 2CIIA 4P5SA 3PP3K 2Y1ZA 3D4GA 4IHBA 4R4NC 4MMXC 2VJ8A 4FL4C 4AOFA 2D31A 2JJVA 2V5YA 4Z7NE 4K5NA 1QSZA 1AG0A 4WWPA 3LS5H 3KYKH 2WGXA 3SOTA 4H8HA 1DTUA 2J5LB 4XTRC 2MCAA 4ZUWB 3KM1A 3WFBL 5CGYC 3FO1A 5E0FA 3NIFE 5CSZB 5C0EA 4YHIB 5AOLA 2YBRB 1J7VR 1T4WA 3N1PC 3L7FA 2EAEA 3QNZB 3V2AR 2QKSA 2N59A 5DRZA 1JZ7A 4D94A 1KT2A 5ANMB 4B9KC 3KEHA 1L6XA 4UM9A 1MDAA 3QG7L 3UROR 5L4JA 3FT2B 4JPIA 3AXLB 3STLB 2V3DA 3LJ3A 4XT1C 3HBPA 4P5TD 2ZE0A 3WE6A 5INCA 4YZWA 1DFXA 1VFUA 3IXTA 1D5BA 3ZE0F 1UEYA 2I60L 3S4SG 2DH3A 4MA8L 3F6JA 5TE7H 5T1KD 4ATTA 5IESL 4ZMQA 1B2WH 1UZGA 4H88L 4OV5B 1IC4H 1S7UB 4HOXA 5EUKB 3HNTL 5AAWA 1Q9KA 2FSEA 3MRCB 3P2DA 1DVFC 3SKNB 1UB6B 2AK1L 5G2NA 2BNRD 4WTWA 5EV7A 4XC1H 3UJIH 1YNKL 3BT2H 3C8KA 3JWNH 1GPOL 2ED9A 4BFBD 5EEXA 4BDVB 2NY4D 3T3ME 3TBSB 3IGUA 2XN9E 3ZGHA 1HHGB 2ZOOA 5IMKA 5GS0H 2F5AH 5HY9B 3D87B 1TTBA 3UTTD 4BM7A 1RZFH 1S8DA 4Y2DC 1A8JH 4X50A 2ZTBA 3BJ91 1G9ML 5KVFH 4MJ6A 4TUJA 3TH2T 5ETUB 5ESAB 3FQNA 5AB1A 1V05A 2DPKA 1ZIBA 1Q0XL 2F54A 2MPVA 4YVNA 4EXKA 4LCUB 3VWJA 3PL6A 3LPPA 3MRBB 2J2ZA 1F11A 5TD4A 1NCBL 3TNNB 4S0HA 3TJHD 4OQ1A 1QSEB 3H9HB 4R5TA 3IDUA 4I18C 2OMVB 3IDIB 3K2IA 4A7GA 2YJLA 1NM4A 2FR4A 1E4KC 2OZ4L 1V54B 3U4AA 4QDGA 4Y5VA 3ARWA 3HI5L 3VWJD 4FNQA 3JV6B 4N8UA 1BYOA 5LG1A 4HA1A 2YAQA 1DJXA 1RZKL 5AW9B 4PLNC 2A73B 4J3SA 4PREA 4K3DL 1BM3L 1OARL 4DW2L 2O5YL 5FYKE 1E0OB 3DOSB 1TFHA 1BX2A 2AV7A 2YRPA 2DQIH 3WEMA 2KHAA 3DETD 1GW0A 4PBXA 2EEBA 3SGKC 5T3ZE 2DWYA 4FN0A 2DQMA 2CBOA 4Y2OB 5DZNA 1NGZA 1E5UI 2EDBA 4PV9B 4DVRL 2NY5L 1ZSDA 4JPVH 1MCNA 3KCPB 4JVWA 4H0HB 4O2EA 4A7UA 2WQWA 2W65B 2DTSA 4CADB 5IB1A 3U6XA 1JI2A 1OAUH 4NZTH 3G5YB 1MPAH 2CXKA 4C4UA 3MV7A 1S5IL 1HEHC 3SE9H 4YDIH 2VZUA 3WDIA 1H8OA 1X6NA 5DQ9A 3WNLA 1MCJA 2X2HA 4WWID 1MIEL 1SUJA 2JH2A 2EDLA 1P6WA 1TJHL 5KS9E 4ZMWA 5IJVB 5AOZA 3P0GB 5AVWB 3ZHDA 3S3PA 4XI5C 1OGSA 3MLSL 1R24B 1RZ8B 3L2LA 5FV2A 5IOPA 3O6LH 3T6VA 2H2SD 3KG5A 3O11A 3RURA 4Q9CA 3CSTA 2NY3C 3AMLA 4HYTB 5HHMD 3LXAA 3ZDZF 3GS4A 2L7QA 4WO4D 2HFEB 3OR6A 2RAMA 4P9HC 4N8PA 5AL0A 4DGIH 3K2UL 2WBJB 5HHOD 4PJIB 1I1FB 2ZAGA 3QRGL 1JPGB 2ALAA 2G5BB 4BK5A 2X42A 4JVPA 3RVUD 1NPUA 4XP1H 5BS0E 4JGNA 1NBVL 1WBZB 3P3TA 4KGJA 2DWXA 2AQPA 1N7ML 2W0KA 1FCGA 5D7KD 2LE9A 4HJ0D 5JHMA 1BSIA 5C0CD 4ZFFA 3MLYL 4GKNA 4JREC 4R7LA 2H1PL 5DJZA 1DEEA 1BF2A 2YK1H 3P54A 2W80C 3K5SA 2VDRH 4EUPB 4F7MA 4QLWA 5IEHB 2GIXA 5DJ8A 4H1LB 1JPST 4N2IA 2E27H 3LKNA 4XGZA 3SDDA 3T09A 3VA6A 3ZZSA 4UTBA 3GHEH 4Y0GA 4NRZB 3TN0B 3IXAB 4WLCA 1OSYA 2WO3B 1QBLH 1UJ3B 4KRPC 1ZGLA 4YXKL 4N2FA 1YZZA 4N2HA 2P47B 1T0MA 3KPMA 2APTA 2IGFH 3NOIA 1AQHA 5DEGA 1N4XH 3ZKXC 3EXJA 2ARWA 2BVEA 3IDMB 4DEPC 4KMLB 2CGRL 4Y4KD 1ZDSA 2JMRA 3N43F 4WEBH 2NQDA 5E2VH 2Y5TB 1BJ1J 5I9QC 4WTZG 5E5UB 1T2QL 4X7SL 4X98B 1R47A 2QDWA 2P5PA 2BW5A 1B9ZA 3BAJA 5DO2D 5E8NA 2A1WL 3VG9B 4Z77B 1YYMH 1GOHA 4PJBF 2L7JA 4Y2DD 2LVCA 5FYKU 5DC4B 4I2XA 5D1XC 4H26A 3PGCB 1TJXA 3EDFA 4KROB 3UTSB 4OI7A 1AZCA 3L5JA 4QTFA 4RQQB 1Q0XH 1AHKA 5L0QB 3L8QA 4JREB 2HJFA 1EZSA 3ZE1E 4OIBA 4B6ZA 4XHJC 4Z76B 3VG9C 3VXOB 1MG2C 4M8QA 5DO8A 2D8KA 2P5WB 2NY5C 2QQQA 5LBSA 2FYYB 3MGOB 1FNHA 1HK6A 1YEFL 1XL6A 1MXGA 2AXHA 3IPBA 3CZGA 4LLWB 4UM9D 4K7PY 2V2WB 3MACH 2B1HH 2DD8L 4UT6L 5FWRA 1CS6A 4ZSOB 1TF4A 1G6RA 3EO1B 3U82B 1WO2A 1T4KA 1MCHA 1B4LA 1DLHA 2NX5B 4EDWL 2W60B 3L81A 4X7SH 2NUTB 2Z0BA 4JDZB 2WQUA 5CSGA 1UGKA 2WO4A 4M1CD 1NBZA 2V9QA 3PY9A 3N6YA 1GYUA 3SDYH 1KIRA 3JWNC 4GKSA 1D5XA 2P45B 1AMXA 1OLZA 4NEHB 3WV0A 3OGCA 3MRKA 5LGHH 3BO8A 2BZDA 4GLRI 3V0DA 2ADJB 1JGEA 1HQRB 1A4JB 2CPUA 5MENA 1F02I 3N06B 1QKZH 1ACXA 4UTBL 1G4RA 1G87A 2JLLA 1MFDL 3F8UB 4R4ND 3VG0L 4CKQA 1CIDA 2WQAA 5D6CA 5DD0L 4XNYH 4UV4L 3S34H 3PNWA 3EJYC 3QS2A 2J6EH 5ID0B 1BIIB 4Q6YA 2J8UB 4WTXA 5FFLA 2ZCZA 5D1QE 1XGTA 5GRYA 1TO4A 3B9AA 3PWJA 3VXUB 3HPLA 2P8LA 3EFOB 4F9PA 1KLGB 2WGNB 4BD4A 2BSSB 1J05A 4M7KL 4ONHA 5HVWA 5L88H 3OJDB 2R0ZH 2NXYD 3RU8H 1I8AA 3HHSA 4TNGA 1RUQL 4WAFA 3GXIA 3BDYL 3TA4D 2AK4D 2ICEB 3VRJB 2YC1B 3HAEG 1U3HD 1R5IA 3EFFA 1LGVA 2MTAA 3D3VB 2X5PA 2P24B 3E8VA 4L2LA 4JB9L 3JV5A 5IMLB 5IMOB 1IAIL 3K1DA 3SDCD 3TURA 1T66D 1M7DA 1CPUA 3CNKA 4ORZC 3I50L 1PLGH 2YD9A 5EIIG 1AJ7L 2WVUA 2DQCH 2ZF9A 1B4JL 1DBKL 1GGTA 2MPAH 1U91A 4EDXA 1EEQA 3EYVB 1QW9A 1UD5A 5CSZA 4YK4C 3PP4H 5LCVA 4LAQH 1ZHKA 4XOCA 5IJCC 1MHHA 4G80B 3QJQB 2EXYC 3IAGC 1IFRA 5AENA 3DXAD 2YRBA 3BKJH 3OZ9L 4Q74A 4U6VL 2AW2A 5E6IC 4B9JA 3GZPA 2X40A 5JHDB 3P4NB 3QIBD 4KVPA 3X1FA 5EUKA 4ZMAT 4UZSA 1ANUA 3CLWA 5FECA 5BZDA 3ZTNL 1U3HA 2CGYA 1BOYA 1EAJA 1S7VB 2F8IA 3MLWL 1AQDB 3K8KA 3OAUL 3PQYB 5GJTH 1JPSL 3GJFK 5KWYC 4YSCA 4PJ5A 4EQ3A 2VLKD 4GEJA 4IRSA 5D7JA 4HEMA 2ZG2A 3MRMB 4MDJA 5IBLD 1MCWM 4YDZA 1OTSC 3X12B 5HI5D 4FXGA 4LQFL 4XN7A 1ZRUA 4XMVA 3S35X 1RIVL 3MRJA 4FXLA 1GRWA 4FQXB 4UNVA 3GMOA 1LO2L 4JO3L 3T3MF 1I8KA 3HBGA 1NC2A 2Z91B 3ZTJG 3LQAC 5B38A 1TQWA 2Z6FA 1AS7A 1Q9LA 3PWVA 1V5JA 4R2GB 3U7YH 1G7HB 1XCWA 4MA1C 4JQIH 2B14A 1VKXA 4LSTL 1JGLH 3NTCL 4P48A 4OGXH 4X7CC 1NH6A 4AGPA 4P46D 5HGAA 1U4EA 4R2GC 2VSKB 2V8MA 3GF8A 1I8LA 1CK0L 3NZ8A 3OAZK 5IB2A 4NLHA 3U9PH 1UYWL 3TV3L 2BNQB 5AYUH 5I1AA 5CJQL 4QTHB 5EMYA 2YAOA 4ZDHA 5C9JA 5LDUA 2XPZA 4Q8BA 2CLRB 5E00A 3RHWF 3BEWB 1JVOA 5SWZA 1OWWA 1UASA 1SBBA 2QZQA 4BA0A 4S2SA 4FD0A 3H7BA 3TYGL 3JV6A 1NFIA 2A6JA 1RIUL 3BSZL 1X3DA 4OM1H 3NIDB 2XWZA 4B9PA 1SMAA 2FGZA 2GTQA 3Q8BA 5CJ5A 1U4FA 3RA7L 2EIMB 3LVTA 1CN4A 2CRMA 1IBYA 2OJZH 4EZKA 4X6CE 4E0RB 4Y5YA 2D7QA 1OLLA 3AY2A 3CC1A 4WWNA 4KJYB 3DIVA 3D2UD 4PGDA 4PJIE 2XN0A 4OAWA 4J8RA 5D6DC 1YNKH 4DKDC 4YSSA 3BZ5A 1A3RL 2AQTA 1DUYA 1DVFA 3QYNA 1J5IA 4MBRA 5KN5B 4JFED 3BEVB 4JRYA 3ATBA 2LAAA 4Z18A 5J13C 2F15A 3QDMD 5KBLA 4U6YB 2PYFB 5I1CL 4LVHB 3FFOA 4Y4HD 5CJQH 4F7PA 3HB3D 5IB1B 3FF8A 4M4PA 4AH2A 4J3OC 1P5UC 3S7GA 3VW3L 3KGTA 1LP9A 3FQ2A 2IAND 4BH7B 1NCJA 4LSTH 5KSBA 1U8IA 1WZ1H 3L4TA 4L8DA 4KHXL 1X7QA 3TGXA 3QHFL 1JWSA 4PJXF 5IJVA 1MI5B 3PL6C 4FFZH 3K80A 4MNGB 1IL1B 2BCMA 4RBPK 3VI4B 5D1ZB 1JPGA 1FIEA 5J06A 3UTPD 3RWIB 5AW8B 4ZFZB 4EBQH 1JTTA 4FMKA 4AM0B 5HYIA 5T3ZD 3BSZH 1FJ1A 3Q6GL 4LHUD 4XVTL 1MRDL 3QUYC 3ULUE 1CFVL 4GKNB 3WCYA 3QUZD 3UO8B 4X6CF 5HGBB 5K93A 3UBXA 4LESA 4OY9A 5FYKL 1FAIL 4PCKA 1KTDB 5IKCB 5C0CA 1BQSA 2G3ZA 1KTJA 1NDGB 3MLWH 2JCCB 1S9XA 5G4NA 1QFOA 3M88A 3SD5A 1A6WH 3IMUA 1D6EA 2LU7A 4P9ML 5LUMA 5C2BH 1U8JB 4RZCA 3O2WH 4PJEF 1MHEA 1THCA 3DROA 2Q86A 1P53A 3V9EA 1DBKH 4NFCA 4PUBL 3VXMB 1JD7A 2DYPB 5HP5A 3D6GA 3MXWH 5GS1C 1BF8A 1K6QL 3LYRA 1KXQA 4UU9B 3BSHA 2CO1A 2K3HA 3ZQWA 3FQXA 2XG4A 2Y25A 1TSRA 4ZX6A 2EIZA 1IJNA 1RHHA 3AT0A 3QUZA 3WEAA 4JFZH 4YC2B 3QZNA 4XB8A 4PW3A 1LNUB 4LHUA 2HRLA 4NYLA 3EOAA 2YGOA 2P7TA 2YJQA 1RK1A 1HL5A 1TZHA 1PTZA 1J8SA 1RIHL 2ADFL 4KTEH 4UQIM 4QHPA 4J3OD 1KMGA 1M1XB 3DMMB 4P3DB 4RGOL 2R4SH 2YKKA 2F6AA 3KWUA 1ZLUH 3SDXF 4M1DL 3FJTA 1I8MB 2A83B 4JRYE 2G75A 2YD0A 3FO9B 5K5YA 2C7UB 2E74C 3BUPA 2B7DT 5SWSB 3VU2A 1F13A 3KH3A 4R3SA 3GXDA 4F7EB 3E2HC 4QOKA 3GIZH 5DZVA 1IUZA 3HZKA 1LE9A 2X70B 4FQXC 4G71B 5JQ6L 2HWZL 5AOJA 3ARGA 4YUEH 2GI0A 1SEQH 2B59B 2AEWA 3VXRA 1ODAA 1ADQH 4NGHH 2Z31B 4UTAA 1DZBA 2FYYA 3MGOA 5I8CA 4DUVA 1QKZL 4UTBH 5FYLH 2WUBL 2YPVA 4WSJA 3ZOAA 4HDIB 4UOW1 1QRNA 4ICXA 3LKSB 3MUZ1 4TVPH 4KKZA 3DARA 3SE3C 1SYSB 2YAMA 1QG3A 1DJGA 1F6AA 3KLAA 4JCMA 4FG0A 1DFBH 3LKRB 5GSRB 1KJ3L 1MRFH 2BP5M 3VQ1C 2W60A 5AVTB 1TEYA 4R7DA 2WCPA 4L4TA 1FZKA 5FB8B 2JFCA 2VDOB 4NC1E 4HLZG 2CNZA 4OZHF 5JOFB 4U6XB 1NEPA 4FX5A 1NBZB 5IHZB 3BP6A 4LNRB 1ZGLP 4KY1H 2ZT9C 4ZYKA 4YHKH 3RL2B 1KCVH 3NRQA 4OZHB 1D5XB 2QQKH 3O8XC 4Y19B 4FC3E 2K8MA 3U0WH 3P30H 3MRKB 2AQ3A 1E6JL 1VADB 2BSED 4CU6A 4HH9B 5EEWA 1OQOA 4RRPG 4Q0XL 1A4JA 1W8NA 2EE3A 3L4CA 1ZA6A 4K73A 2FH6A 2Y2YA 4L0PB 3MA9H 4ZUUA 1CQKA 4X7DC 3ARBD 3HE7C 1HYRC 1EA9C 1FBIL 1OE3A 4OFIA 4FFYL 4Q6IC 4AKPA 1P7BA 2J21A 1A3QA 1TKWA 2PMZA 3QXDB 5JR1H 3HC3L 1HZKA 4TLSA 2XZCH 1JGEB 1E5AA 1HQRA 2VDQH 3CBKB 1GYWA 2Y69B 1PDKB 3N9GL 5AKSA 4FTVB 5FEBA 1FGVH 2G9KA 1IFHL 3I2CL 1ETB1 4DKFH 2VDPL 5ECJE 4L3ED 3BAEL 3SDCC 1XF5A 4IRJA 1NINA 5D4HA 2MQ0A 4J4PA 4ISVB 1ZT7B 1OAJA 2AEQL 3F85A 1SUHA 2V37A 2J8UA 4I1RA 1N2RA 1HH6A 3WTTA 4HH8A 1SJEA 5HI5C 1NL0H 3EDKA 2EUWA 5CU9A 5IVXB 3ECWA 5E08L 3SDXA 1ITBB 3UTQA 1F3JA 4DH2A 4OZFA 4HG4J 3CFTA 2IADB 3D52A 5J6HB 4Z95L 1FYTD 4NBXB 4N28A 3O81A 2ICEA 4KAQL 2AGJL 2ZOKA 4XOEA 4GQQA 4CMMB 4GQPH 4WUUB 2P5EE 5HDLA 4O5LH 3QHTC 2NY7L 5IT2H 4H13C 4ODSL 4F2MB 2PETA 4W93A 1R3IH 5TPWH 2RH0A 1RIVH 4JVUA 3EJUA 4X6CB 3EHBB 4JBSA 1AY1H 3LXBA 3GI8H 4F1SA 3LAFA 4JFDA 5J8OA 1QEXA 1VFMA 1CD9B 5JTWA 2Z93B 1MHHB 2PN5A 2B9AA 2R56L 4N6RB 4Z8FL 4UDUA 5IJDC 1I4FA 3MCLH 3QXAB 3TBVA 1UJTA 3PWLA 1X4ZA 4TSAL 4DAGH 2VUOA 1KF9B 3P4NA 4ANKA 4KZCA 2VDRL 2W94A 3KDMB 5BZWA 1F3RB 2E6PA 5E1QA 3TVMD 4N2EA 2VMEA 4OR1A 3RNKB 4X6DF 1BQHA 3MRJB 5D5MA 3MV8D 4LVHC 1FIGH 3GB7B 3PJSB 4MAYD 2Y3AA 5M94B 4M93C 4ZTPH 4OTXL 4R97B 3EF7A 3ZMEA 5BV7B 1NUNB 4DPRA 2CJSA 4BFJA 5I75B 3TM6A 4PJ9B 2FJHA 4FQHB 2GIYA 1V8HA 2W07B 3UBFA 4TNWF 1NBYB 1VF5C 5FO7A 5FGBC 5D93B 4IKIA 2VLLB 1QRKA 1E65A 4QUOA 3PXLA 4KK8D 3SO3C 1GCYA 1CIUA 1AXSA 2PR4H 1J8HD 5EN2A 2HRGA 4TOYH 2CBPA 1ETZA 2Z91A 3MLSH 4KC3B 2BK8A 3BVNB 1PX8A 1DQLL 1FORL 5EBWA 4QTHA 1BFSA 1HWHB 4U1SB 4RGNC 3EW3B 4ORGA 2ZNWA 2AJ3B 1A6TB 2UZXB 2Z3FA 3R0MA 5I66A 1YEHL 2VNCA 4DP4X 4KO9A 3NN8B 3NFSH 2BNQA 3DBXB 3T04D 4Z8FH 2Z64C 2J1WA 1IGMH 3LNHA 5EEVA 2IFFL 2UYLB 1F4XH 5I6MA 1LWJA 1OAQL 4JFFB 5D7JC 5A6MA 1AXTL 3WS3A 3Q1SL 3RWGA 2DI8A 1ZEAL 1FO0B 2QSTA 3QRGH 4XN5A 4E0RA 3NJNA 4KK6D 1S46A 4X7EC 3KGRA 5E4OA 1DBJH 1GGBH 1VGKB 4EZJA 4BGDA 3NPSC 2X3CA 4TL4A 4FP8L 4GRLD 1R3HB 3V6ZB 4F37F 1X5HA 3C8HA 1UM5H 3MVSA 5CMAB 4NUGL 2FJUB 5KN5A 1UFGA 2IC2A 1TEFA 4HFWB 1T1XA 1NCTA 2F7QA 3ASOB 4KJQD 2LFEA 5EIQA 4UQBA 5IUCA 4TVPD 1XXFC 4GAGL 3D85B 2VDKH 4PGDB 3MOQA 4C57C 4DEUA 2XETA 5E1IA 5DSCB 3KBHE 1LTXA 2CUMA 4IS6B 1B0GA 3FSOA 1Y7VA 3RWCB 4N0CC 2WBJC 2X4NB 5AEAA 3LRKA 3L5HA 4GSQA 1NL0L 5B7EA 3UJJL 5IHUL 4NSKA 4U2YA 4B7IA 5MHSE 2WXNA 2PYFA 2G4EA 1N6QH 5FHBH 3Q9PA 4FQPA 1WITA 4NNXA 1FGVL 2HT4C 4PJAE 4FOMA 3RDJA 1HDMA 4ZXBA 4Q14A 5H4ZA 4HZLA 4RA3A 3I9IA 2XZCL 4LPWA 2LLLA 3JTSB 2NY4C 2E6QA 4AGOA 4NQXA 1K9TA 4HX1B 1WC7B 3OC5A 1G7IA 1XHHA 3QDJB 4DOHE 5EOQH 3BGFC 3FT1A 4N0UE 2P5EB 2XPGB 3QZMA 3MV11 1JTPA 4BKTC 4L37B 4TNVK 1I82A 5GHWL 2X7LB 3MN8A 5DHVB 1L4IA 5I0ZA 4NN5C 3B2PA 1VFBA 3BIKA 1TQSA 5B39A 4WHCA 1U93A 5K9JL 2PCYA 3O6FD 5AB9A 3GEWB 1GTNA 2E9IA 3CVDA 1AD9B 4GBXD 4KI5D 3PHQA 1H3UA 2F8VA 1PVHA 1FFPB 4G8GD 2WWOA 3MRLA 5CP7A 4JKMA 4OZFH 2XWJA 2XVLA 2WP3T 2Y23A 4XX1E 4EIZC 3QDME 1RJYA 2ICEC 4UQ3B 4CU7A 2ICWI 4ENEC 4P5MA 1MHEB 3W0WE 5CLZA 5HYJA 1I53A 3F12B 5E5MA 4PIBA 3CZUB 5FO8B 2VN5A 5IF0B 3QJZA 5TDPB 2W0FA 2C9PA 2YKLH 3S37X 4ZTPL 1LEGB 3O6FB 2VRKA 5CEYB 4X5QA 3A5VA 3TXAA 5EO9A 4J6RH 3HG1D 2ZPKL 4LF3B 4G8GB 2O5NA 3KHQA 1RHFA 1T7ZA 3MNMA 5KVFL 1TQCB 2EDDA 1IB5A 4MA3B 4FQIH 1KGCE 4KZEL 2YO3A 4XXDA 3LEYH 1Q9OA 4OLUL 3WNJA 5DFAA 2PTTB 4AEIL 5ADPH 4P3DA 5DURD 4O00A 4ZW3A 3RVVD 1RURH 3Q3GB 5ANME 4O4YH 5DYOA 4C56D 2W91A 4LO9A 2A83A 4KO6A 3HMXA 4JX0A 5DQDL 5FUOH 2FL5B 2X4TA 2P7TB 3ESNA 1PZ5B 3FQRB 4OZHE 3SE8L 1UZ8B 3PL6D 2FNBA 1KN4L 2ZIDA 3RIFF 4QRPA 1DSYA 5LNDA 1WZLA 2O4EA 1O7VA 1MCBA 1PY4A 1L9TA 2WXQA 3HMWH 4UZGA 3T5WA 3WN5C 5C2UB 5SWSA 4XVUC 4IOIA 2WIMA 3RWFA 2K7QA 2BWQA 4IGBC 3ZPDA 3V0VA 2X70A 4W68A 2YEVB 2EUVA 2X89A 1DQQA 4LMQI 2KQNA 2MFNA 1E5ZA 5FPIA 3KLAB 4LPUA 5J89A 3ZSTA 1D9KB 4F8NA 5HDBB 1S9YA 5JHDE 5DR5H 3O2WL 4OF6A 4B60A 5A3IC 2Z7WA 4H8VA 3O6KH 1VEPA 3HLAB 3KR3H 5AW5B 2Z9TA 5FGRA 2A77H 3ES6A 3ZMNA 1DZ0A 5KJRL 4NI6A 2QVTA 2AVGA 1P5VB 4Y19A 3OHXC 4Y88A 3BAEH 5DDHA 1KPVB 1I9IL 4DGYL 1CQYA 3QFJE 3VUAA 2DWEB 5F88B 1ZJBA 3AW5A 4HKJB 5JORA 5IHZA 4YSOA 5E2UL 3US9A 3IMWA 4ONOA 4UOQA 3SPHA 1MFAH 5HVHB 2YRZA 5F8QC 2XTLA 4GSDH 4F2FA 4G43A 4G7QB 1GJIA 1OK8A 4W6XB 2Z0UA 1UTDA 2BS71 5JIHA 4AGLA 4P9HL 4F7TA 5LAPA 4WDIA 3CXFA 1DR9A 4F8OA 2CXGA 3KLQA 4KHXH 1E27A 4TNFA 1P7HL 3ZDYF 1T20A 1CURA 3UAJA 5E7FA 1XSOA 3QZPA 1J18A 3GSXB 1PG7H 4P4RB 4V1DE 3TBCA 1WJ3A 1XF2A 2XN9A 4KVCH 1P84K 5SWZE 1IC4L 4D0BA 1TQBC 4K2UH 3KJ4B 4FFVD 4ZI8A 4G83A 3CVHL 2XRAH 3BXNA 3D07A 2UX7A 3BGMB 1J0HA 5C6PB 4PI0A 2CBQA 2K45A 2AK4E 1XH0A 1A7QH 1SQ2N 3F2LA 5EU3B 5MEPB 1EHLL 4FXTA 1B6DA 2HG0A 5BUPA 3MO1B 3UTZA 1KJ3H 4MKTA 3K6SB 1CR9L 2ICWJ 4TSBL 3U7YL 4GQZA 3QNFA 2AJSH 5E6ZA 5J0BA 3C5ZC 1U92B 4GUPA 3HN8A 1UWEL 4KKBC 4OB5L 3RVTC 5FWQA 4BUQA 5BMFL 1INDL 4QCIA 5ALCH 4HUVB 4R8WL 4MNHA 2Z4QA 4E9TA 1PZAA 2FJGB 4OD3L 3VSVA 4KX9A 3MUGB 5J1TC 1P6FA 4DGWC 2QPEB 1KTLB 4MB1A 5EZOH 1S7XA 2H6PA 3QWQB 4GBXA 1TYJA 8FABB 1KXQE 3FU6A 4WI6A 2C9XA 3W39B 2QLYA 4U6TA 4Q6IA 4RDQF 1DQML 4LBEB 1YRKA 3S88H 5IHBA 3SQRA 5GRUH 4P5TB 3T77B 1ZSHA 4M6NH 4Q9RL 1TCRB 4AKQA 3E6HB 7PAZA 2F58L 2XVKA 4J6IA 1UA7A 1C7TA 1NSNH 3NZUA 3S96B 3KLDA 3P9MA 1RIHH 3FQUA 4IK7A 5INCB 3QEHB 3IXTB 2F1EA 4JY5L 2LLGA 4N0FB 2XZQH 5I6LA 2HT2C 5FLUA 1XCQB 3PHOB 4OV5A 1YY9C 1SHSA 1G7PB 4JN1H 3T8XB 3FH8A 4JFPA 2MPAL 1KCUH 1U8CB 3C8KB 3FTGB 3AQZA 5F89A 3VD1A 2VQ1A 3MFFA 4Y9EA 3N43B 8PAZA 5I0DA 2CDFB 1JL8A 1NANH 1SYVA 3CQQA 7CGTA 4U3SA 1MRCL 2FWSA 5I24A 1PSKL 3DO4A 5DMJB 3C6EA 2R2BA 3FB6A 5KYUB 4M3HA 2OFQA 4EN3D 1XH2A 5EBWB 5I6XB 5EBGA 1FL3B 3TA3C 2ZSVB 3SOBH 4TUJB 4F15B 4X4YA 3SODB 3WY3A 1WH0A 1ZK5A 2GJPA 3KMDA 5GZNA 3TZVD 3N50A 3MQIA 2AJ3A 5C0CE 3PV6A 1UXSA 1OIOA 2J2ZB 4GG6E 4Y4KA 1BEYH 3BVNA 1WD9A 1JE6A 3C6LC 3LNIA 4NZFA 2YXWA 4K8RD 5C0ND 4XPGL 4DGYH 2UYLA 5DJXA 3MR9B 1XR8A 3LEXA 1HKLL 5CJBA 4AJWA 4KVNH 4FQJH 3V0HA 3IJ9A 1Z2KA 5I6PA 1K4DB 2A9MH 3M8OL 3AU1A 3GZQA 3QCTL 3ZTNH 1WTLA 4YE0A 4U1NB 3D48R 4LGSB 1UWXK 3NRFA 2LW3A 3G9VA 2V2XA 2DRUA 2JB6B 5AZEH 3VXQA 1B0RA 4QPEA 4UNTA 4L3CB 4LSPL 5CKGA 4PJBA 1YEEH 3SDDD 4C4KT 2QKIB 3IPEA 3D5OF 2IWEA 3DOSA 1XMEB 3TZVA 4XMLH 4PRPD 8CGTA 4OGZA 5F3HB 5EFIB 4DQOH 4ZW7A 2H41A 4W1TA 3F58H 5LGKA 4N22A 5G4OA 4IHOA 2FEEL 1USZA 4HHGA 4LRNH 4NZDA 1GYAA 2FATL 2EYTA 3CIQA 4AG4L 4XNMA 5HJGA 5F9WC 1TVHB 2YIHA 2HVBA 4GG8A 4B9ZA 1SPDA 5B1AB 4LDCA 1J0IA 4FEMA 3BRFA 1P4LA 1OT1A 4MAYA 2VQ4A 4XE5B 5DJ6B 3T2NL 3KPPA 5I15H 3MV8E 4ZODA 3L2NA 4B9FA 3CJJA 4JFWA 2XWTB 5DJ0B 3WKQA 3CN3A 2X0VA 4H4NA 4UZUA 15C8L 1NDMB 3QE5A 3H56A 1EGJH 3ARZA 2X7LA 4PRPA 3UBXG 4U3CA 1IBDA 4NDMA 3NFNA 1YEDA 2H5UA 1IC5H 2R7EA 3D1MC 4MVBD 1E30A 2BVUA 4GKZB 4TTDC 3JTTA 1KJ2L 5E03A 1AHWC 2Z92B 3BE1H 4XAWH 1T2QH 1G9NL 3D7PA 4BZ2H 1USQA 5B39B 2E56A 2MOVA 3MJWA 1WBZA 1XGYH 3FUKA 4WEBL 3HNVL 1I9RL 3FZUC 3PHQB 4YHLH 3B2UD 1GC1H 3DGCR 1YPZE 1D6VL 3UGUA 3DTDA 4YFLI 3MACL 1A9EB 5IREA 3ECBB 1WIUA 4YPGA 4TTGA 3VFVA 4HU8A 3S35H 1KPUA 1FZMA 2WWKT 3BH9A 4RFOH 5DXWA 1F90H 2ITFA 3SBPA 3MRQB 1EZUA 1A8ZA 2N3JA 2TSBA 4HAGA 3WJJA 3CFCH 3CMOH 1DJWA 1ZPLA 3VFGH 1TLMA 3NMEA 3KPRB 2DMHA 2E76C 1GVIA 2YSSA 4WI0A 3O2VH 4JPWH 3JWDH 4FYTA 4HV8A 5JPNC 4AXWB 3DX7A 4JHWL 2J1KA 4CDHA 3F7VA 4N2OA 1MW1A 4ODUA 4PWFA 3O3EB 3QW9A 1UKSA 1J8HB 2OI9C 4WO4A 3QDJE 1CT8A 1HCZA 4X9BA 5DT1L 1JWUA 1ULVA 4NCC1 4FI6A 2J20A 4N9OB 3ZDXF 1NWOA 5JQHC 3O3DA 3DO7B 3T3MB 1EHNA 3QS3A 4P4KC 4LSRH 4YDVA 1UKTA 3RPKA 1EEYB 2R29H 5CLTA 3U4KA 4YFEA 3FQRA 1Z0MA 1E8YA 1OZUA 4DGIL 4DIXA 5J11C 2HVJA 3LIZH 2WP3O 4JZJC 1MWAB 3LKPA 2X41A 1H6UA 1D9KA 2FEDC 4FFWD 3KLHC 3L08A 2CKBA 1NFDE 3W1ZA 2P5WD 5ITBL 3CXDH 3PRZA 1PFCA 4ALAC 2OI9B 4NBYB 3SO3B 2CJUH 1N9PA 1NFKA 3BP5B 2DEXX 2IF7A 4O2FB 1ZPUA 1P5VA 3VXOA 2DWDA 3B3IA 2FX9L 1VACB 2QADD 3P0YH 4X5LA 4WHYH 1AGCB 3LN4B 3VFRB 2ENQA 3NFSL 4URKA 4O4YL 4X5XB 1KOAA 3GI9H 3U4BH 2PXYC 5D96C 2XJLA 4B41A 4AVKA 4KI5E 3T6WA 5GZOD 3UBXI 2IMNA 1A3ZA 1OK0A 4E42A 5CZXC 3V5KA 1IM3D 1F86A 1H5BB 1XGRA 3ZIMA 1A7OL 3FUHA 3C5SB 4ZXBC 1NFDB 2I9LB 5F70A 3ZKXB 1XD1A 4PM1A 5FHBL 1CLYL 3CVHA 2DQIL 3K8LA 3DECA 3UDWC 1PAMA 3CLEH 1W80A 3MUY1 3JUZA 2OMXB 1RERA 1IRAY 4G6JH 3LNDA 3OGCB 4GAJL 4PJAF 4Q6KA 4KAQH 2Q8AH 4E68A 3F7YA 4QHNA 4KZ0A 1A2YB 4XO5A 1A7PL 3DHUA 3S8GB 4GP5B 3TCXA 1JNNL 1JK9A 3RKDC 2EDTA 1AD0B 2OL3A 3SJVB 5MEPA 2OMWB 1NMCB 2VUKA 3U83A 4APQD 4LPXA 4BKLA 5HYQA 1XZ0B 5EBLA 1CFSA 1BIIA 1J1PH 1G1CA 3TEUA 5CNHA 3PABA 4UBDC 3MJ8B 3BXNB 5GS0D 1A47A 4L05A 4TV3A 1BWMA 4JRWA 7PCYA 3QK0A 2B1HL 4UT6H 3JVFC 2PCPB 4JRXB 4S1DD 2O6EA 5GGUA 3MCLL 2NNCA 4ZFOA 4QCIB 1R9FA 2WINB 3N55A 5L7XH 4JM4H 3TPKA 3VGHA 1M2VA 4I1PA 4RFNC 3Q9QA 2X6BA 3A22A 3THMH 4YDJA 4BJLA 4OJFH 1RZFL 4LBEA 2K6ZA 5FX3A 1ZIAA 3FMGL 4X9FA 1DJSA 4D0CB 4WV1B 1M7DB 1JZHA 5IG7A 1C9SA 4KRNA 2BSRA 2GVYA 1TCRA 3KYNA 2IFGA 3IS0X 1P4BH 3GKWH 1IE5A 4GIAA 1ZLDA 5K9QI 4KK6C 5BRQA 1E6JH 1WT5A 5IEKB 1HZLA 2N4IA 5EA0H 1DCLA 1I9RH 1T89C 2I69A 4YHLL 1NCHA 2YOCA 5D72L 4Q6IB 3G3LA 5J12C 2VITB 4JFXB 2AABH 3K72A 2V17L 1ML0A 2P8MB 3DV6A 1XCQA 2EEXA 2WLHA 5DEJA 3BOVA 4WHTB 4KZDH 4RWYL 1JERA 2L4OA 2PPCA 3MBEA 4M43H 1ACYL 5E5LA 4C56B 2Y36H 1N4XL 4RZKA 1E43A 1U33A 3MFGB 4ANUA 4OD2A 3US0A 2H32H 3P2BA 5JIKA 3QJOA 1CG9A 5EC2B 5F89B 2VQ1B 4PJ5B 4Y1AA 3T2LA 3NCJH 4ZK8A 2AXWA 1SLXA 4LLMB 3MUHL 4WGWB 1HJBC 3KGSA 3WJMB 3DLQR 1NIFA 3MODH 3U0TB 1KFGA 1FH5L 1WBYB 4NN6B 2NYZA 2X2IA 5A16A 1SEQL 3LPOA 3HAEH 1EDHA 4PRHE 4MD0B 1FL5A 3VE0A 1E28A 1KFAH 1SOKA 3NJGA 3KDPB 2ZXBA 3KYKL 3DPDA 5F1IA 4ZD3H 1A66A 3H42L 4H0GA 3TX4A 1BZ9A 3MNWB 2P4AB 3EO9H 4HUWA 5I28A 3QFGA 5TH2B 3T1WA 3ABKB 1XT5A 1N26A 1K4CA 4JFYB 3VXPB 4QI3A 4A7TA 3ZE2F 3ZE0B 4LRNL 2MCPH 2K6WA 5EU4A 2BY1A 4TRPH 3DIFA 5I2IB 1MJJA 2CHZA 5E94A 4AIZA 3TFBA 2JJWA 2F53A 3V5DB 4W81A 2WQRA 1ZA3B 5C09E 5I19H 3FFCE 2W38A 35C8H 3MJ9A 2I60H 1AP2A 1TYRA 2EZ0D 4IQHA 5HYSB 2UZIH 2VDNH 4OCWH 4P49A 4L3CA 4ZDHB 4QNPE 5C9JB 5E70A 3FUIA 5E8OB 4XP4H 3S97C 2FHFA 2BP0A 4GIOA 4V2CB 5CD5C 1TJHH 2YLKA 2NYKA 2HLFC 2D9QB 4OFQA 1YN6B 1TFPA 2W95A 2WZ6A 3AQYA 3UYPA 1TJGH 1NPJA 4NQCB 1NFIB 5DUJA 3CFQA 5BRZD 5C0JB 2OK0L 3BFOA 1A6WL 1FCCA 1R3KB 2B2XL 3C6SB 3P0VL 3RIKA 3WFCH 3CN0A 5F9JA 1ID2A 4DGVH 2PWHA 1GGCH 2NRDA 5F3HA 4MMXB 1U21A 1LM8V 1EGJA 4OFKA 2G60L 3S5ZA 1XF3A 3CLFL 1DUYB 1DVFB 1KSRA 4JO2L 1QLEL 4F1ZA 4M5ZH 5IROD 2IALB 3G7TA 4H40A 4GXVH 1IE4A 3V4PB 5JNYB 3FUJA 2DICA 1DQTA 4XNDA 4PW9A 1G6RH 1NTDA 1UGNA 1TVHA 2FK9A 3KS0H 3TBYA 4PJDF 5KYWB 4MQXD 4UV7H 4P2OA 2GTWA 4XBPA 4ZBJA 4URTB 1D7FA 1G0DA 4I0PB 1LP9B 5DJCA 4XNUH 3NFNB 4JCWA 2AGJH 4LDOB 3QIBB 2IAMD 5HHNB 5JW5A 4WGKA 4UQDA 1UD6A 1Q94A 1NCNA 4LOUD 4Z95H 1UA6L 4LOFA 2OZ4H 4XP5L 4KKLD 4PWHA 4NAQA 2AXFB 4L3AA 2CJTA 3VI4A 3WIFB 2VDLB 5EU5A 5E08H 1S4IA 3DXAA 3TYFA 1FNLA 2Y7QA 2ZXGA 4ZS7H 5IK3B 4N25A 3RWIA 3WGUB 2OTPA 2J88L 2RTTA 2XXCB 1T80A 4YGVA 4HBQA 3NJHA 4ACPA 4XOAA 5JHAA 2DEWX 2XIBA 1NSNL 4M6NL 1HHKB 5FOBB 3VFVB 4NNYB 3RZCD 3ZTJH 4NQEB 3RDTC 2PYED 2W9EH 2KPNA 3IJEA 5FGCE 1ZANH 2VO5A 4NO0B 2J3SA 2WY3B 1RCYA 1ZVNA 5KANG 4JEGB 4LEXL 5KTEH 4AQZA 4N2DA 2EVIA 1U9KA 1AO7E 3MHZA 2VR3A 4OM0H 4QRTA 5D55A 2O5XH 5L2KD 1BVNP 3WKPA 3GO1L 4MFHA 4HV8B 5C0BB 1XTLA 3SY0A 5E24E 5DK0A 1LO4H 1UACH 2DM7A 1PX4A 1AZZC 3ZRSA 1NC2D 2QPDB 3MRQA 4BQBA 4DO6A 2H3XC 1ORQA 1UADC 4QGTA 4A7QA 3GRWL 2XG4B 3HZYA 4GXFA 4JG1H 2FHBA 2LQRA 4DK3A 2ZOLB 1A7NL 4MLIA 4QRRB 5DJAA 5IESH 5TF0A 2WTOA 3MLXL 4LHUB 4NYLB 1DDTA 4HPYH 4E9YA 5TFSL 2D3LA 2LU5A 4YH6A 4G72B 2A74C 3QG6B 4PGZA 1CXHA 4AEEA 4MS8C 5HJ3B 2I5YH 2OR7A 4MSWB 4N1EA 3DMMA 3U25A 2V6HA 2AAAA 3M45A 2AKRB 4H25B 3B9EA 3V0JA 2CKBB 4B27A 1NIAA 5JIPA 4KQ4L 3WE1A 1I8MA 5I26A 5DZOA 2WXKA 3OLDA 3QO0A 3ZU8A 3F84A 1M6OB 1CFQA 5DFWH 5DEFB 1SHXA 2A6DA 1JFQL 3TL5A 4U1GC 3U1SL 2Z1PA 4LLYB 2WLIA 1FAIH 4EI5B 2A9DA 2E7LC 3VFRA 1S9WB 1OAXL 3SGDI 4B97A 4KV5E 2W9EL 5KZCB 3VGGA 3S9DB 2BNQE 2Y9RT 1R0AL 1E9OA 4UANA 4ZAKB 1W16A 4GW1B 4IRJC 2R59A 2ERJB 2X38A 2HT2D 4BWTA 3CN2A 3ESPA 3L1OH 5T3XD 2EVGA 1BLIA 4O9HH 4JRXE 4UAHA 5ID1A 3VFUA 2YGNA 4IKKA 1AE6H 2CQVA 1GYVA 1FYTE 2R69H 4F5CE 3V4VH 3EG9A 4N1HB 4R7VA 5FV1L 1WBXB 4NM8L 4QOKD 4NM4H 3IDGB 1H0DB 4H7VA 3C9NB 4KK9C 4PJXA 1XGRB 1L7TH 4ODVH 3GXTA 3VNYA 1D5RA 2DQFA 2HJLB 2Q5BA 2YD1A 5HTSA 3W0WA 3F7KA 4ZQKA 3VXNB 2XPYA 2WKLA 4PVLA 3VFTA 4XNUL 1I85C 1EHKB 3ZKQD 1FF5A 2GKIA 5I1JL 1HILB 5PAZA 3L9YA 5DWUH 1PLAA 5I8KH 4C83B 4RMUA 1PG7X 1HHJA 1NGPL 5DVLA 3TNMA 5I1GH 4OSUL 2VM3A 4R2GD 4EVNB 4S0TD 3WFHB 1QSED 4FJZA 3B7YA 4QHNB 4WKXA 1EAQA 1ZVSA 3WELA 4NKIH 1QHOA 4LLVA 3H85A 4M5ZL 1HN1A 1FN4B 4JRXA 3REWA 5KSAB 1CFVH 5D7IA 1YJDC 4H8UA 1ZT4B 2XKNA 3BWSA 3AS1A 5ELIA 1CFSB 1GGUA 2ZYIA 5DVMA 1HH6B 4F2ME 3L45A 3MJ8A 3FSAA 4N2LA 2XY2A 1J1XL 1RZGB 4L4VA 4WTQA 2ED8A 4EUPH 2NY2B 1O7DC 5C7XL 2WVSA 1G1KA 3VFNB 2D31B 4MDIA 4WV1A 2VDOH 5CBEA 2QR0A 2LAGB 5BS0A 1W0WB 5TDOB 4I2XE 2EC9U 1M2VB 1A7BA 5HDQH 4OD1H 1Z5YD 1BPLB 3C87A 2EXSA 2EABA 4YDJB 4XBMA 1ASPA 3QWNA 1J8HE 4PJ8D 4UQAA 4HIJA 3DTXA 1LMIA 3ARRA 4PTTA 3SQBA 4QRQA 3DV6B 3KYNB 5C0BE 1QYGH 3B7UX 1UOWA 1EZVX 4HIHA 2V7NA 2VLRA 5GQBA 3I02B 1KELL 2RB8A 3S5LA 1CYWA 4HLEA 3FT2A 4JPIB 3HR6A 2NNRA 5IEKA 3AXLA 2IQ9H 1BP3B 1V3MA 2Q7AA 1Y6KR 4G5AA 4P2RE 2C4FU 1EFXA 4PYHA 3TJPA 1HU8A 4LPYA 1CG9B 2R0ZL 5EC2A 4UDUB 3W57A 3MBED 2NNAA 3RDTB 4Z7AA 4PWGA 1QUPA 1TYEB 3PWLB 3ZKNC 3DOIA 3DRTB 4K7PX 3X1NA 1AKJA 3QI9D 3AXIA 1SDDA 3Q1EA 1T83C 3GQFA 4G8EB 5IFAH 2WNKA 3S6CA 3GSOA 4K7PH 3SKNA 3FMGH 4YHZH 4KHTH 3DX4A 1FL5B 3AU0A 2PR9A 4POUB 4G3YH 2BRRH 3Q8FA 3GHBL 4FKEA 4JO2H 4ZMLA 1I8UA 3FRPG 4RGNB 3ZTDC 3MNWA 5L7XL 2FJHB 4OKDA 1GMEA 2B0SL 4Q7DA 4O58L 1WE5A 4OCRL 1PNDA 3IM1A 4FI8A 3OPUA 1NBYA 1Z3GH 4MD0A 4Y5XA 3SCMA 2DI9A 1QO3B 1A1OB 1JF5A 2IDCA 2DY2A 1Q72L 5HVGB 5I2IA 4AIZB 1VFAA 3O2DL 2EIEA 4XR8C 3WO4C 3V5DA 3ILQC 4LCUA 1MCFA 5E9DA 1F11B 1IGFH 3GMMB 3LB6C 4PN6A 4LAQL 1U8PB 2Q87A 4XVJH 4GSRA 3FU5A 3O6KL 4DJMA 4G7YL 4OCLC 1CCZA 3BDXA 3LN5A 1JXDA 1EAPA 3PWUA 4ANXA 4U1SA 2Y1VA 1DL7H 3VFPB 4TUKL 5FGCB 1XB3A 4ORGB 3MKKA 5FKAA 1JPFA 4MXQD 5J4MA 3QUMH 3ML8A 3NESA 3NH7L 4Y5VB 3TEYA 1SLWA 4OIIL 4Y89A 3UACA 3BFWA 1MUJB 5KUKA 1NGYA 2HP4A 4PRPE 3HG1E 4HUUB 4UB0H 4A39A 4PLOB 1TETH 5T1LB 4KMQA 4MRCA 1GA2A 2EXYD 1DBBH 4PJ9D 4CW1A 3C6SA 5J11B 2BMKB 2IPTL 3CZJA 3CD4A 4Y1AD 2X4SA 3NIDF 4Y16B 1IBGL 3APCA 4PRHD 1BX2B 1T5XA 3MV7E 1YECH 3LZQA 2MWCA 3V0WL 1UJ3C 2BHYA 5K39B 5JO5A 1OCWL 4PJ7B 4HT1H 4JO1L 3L16A 1ETJA 3V6ZA 2O72A 5E23A 4OIFA 1JHTA 1T7YA 1G9HA 3RZWA 3WAKA 1QW8A 4WHYG 4N2KA 1G5GA 3UBHA 4ENED 3FHAA 2BNRB 2BWIA 2WYZA 4XNYL 3UC2A 1TZIA 1UWYA 4QHLB 1J1PL 2VJ0A 5F96L 2V0AA 5E6RB 4CADA 2Q3ZA 1RKRA 2WTRA 2R2EB 2R29A 3HOGA 4NC0B 4XNZC 4XHJD 1OB1A 4J6RL 3AG1B 3UTSE 2CGRH 5T1MB 5JW5B 4PBVC 4Y2LA 1Q0EA 3MX0A 4JFEA 3FH7A 1ZVHA 5E7BA 2UY6A 3VFOA 2RJMA 3WKMH 5JHLL 3NDYE 3CC5B 5T1KA 4ELMF 4IKLA 1QBLL 2QVMA 2YPVL 3C08H 1FLRH 3TYFB 3HUJA 5GS2D 7TAAA 3BZ4A 1A6AA 3GC3A 3E8UH 4YSUA 4POZC 3KNBB 3VX0A 2Y24A 2VN3A 4R6UA 1P7QB 1Q94B 1VA9A 2ZCLL 5IV2B 5C0DB 3SE9L 1UT2A 1MCRA 3QEUB 3RKDD 2M1KA 1JZDC 2QKIC 3NSFA 5EU5B 1S9VA 4B3EA 1KCRH 1YEKH 4JRFA 2YMXL 3AWEA 2HN7A 4P5RA 1VFBB 3BIKB 4KK8C 4NXSA 3U2JA 1GGIH 4APQA 4LCCA 1T03H 3D69A 5F3BA 3NCXA 2W9DL 2BSTB 4JG9A 1O5PA 3DSFL 4QRTB 2DL2A 2XJKA 5IJKA 3NA9H 4E36A 4M9PA 3MKGA 1DANU 3WMSA 2ZUWA 1WFIA 2YRLA 1OP5H 4A2EA 2YN3A 3IJEB 3JWOC 1DHKA 3OHMB 2A2QT 2YOAA 4XGZB 5DVPA 4TVSa 3B2VH 4ZUTB 5KVDH 2ESVA 3Q13A 1B4RA 2H9GB 1G84A 3IXAA 2ZOLA 1JDCA 2ZUUA 3CSBA 3LQMA 2Y2WA 3O4LD 5DJAB 3ZR5A 4F80A 4QRRA 1E4HA 5GGSB 3QDJD 4AUJA 1DBML 2AJXH 3HVDA 3TO4C 4X9HA 5I74C 4BZ2L 4Y1SA 3QXWA 4PVMA 3HKFA 3BQUD 4R7XA 3QFJD 1PZ3A 2D7PA 1ORQB 1JZ5A 4ODTH 4XXDB 4LARH 1N3NA 5JMRA 1BG1A 4PV8B 4HKBA 1HL4A 3T2QA 3I9AA 3L4XA 2DLEA 1HCVA 3F7LA 4G8IA 3VFSB 3IN2A 1NCBH 4XBGA 3CUPA 2DYSB 4LPVA 3CFIC 3HE7A 5E8NB 1XCTA 1OQXA 2P5WE 1H15B 5I75C 2XWRA 3JSSA 1YYCA 4R83A 1YEIL 3MRGA 2JTDA 2NSXA 2NY0B 3P3RA 2WLIB 2HA1A 2X1XR 4HW6A 5HHOE 1ZAGA 1NEZB 1VHPA 3NPZB 3QZBA 1AH1A 4XN2A 1CLCA 2R39A 1A64A 2UY7B 4Y5YC 1RZ7H 1X5GA 4PJHB 5EOCJ 2BJML 3MLYH 2V5MA 3KGUA 3LB6D 4R7NB 5HYJE 3SB3A 2VDKB 3PE9A 1INQB 4XI5D 3TASA 5E1GA 1OARH 4IJTA 3EOBA 2HLAB 4RISH 5BO1H 3D4CA 3N1GC 2XN1A 1PMYA 2QPFA 2D4FA 4Q9BA 1WWCA 2G2PA 1UWGH 2WWKO 4X9IA 4BFNA 3TBWB 5H35A 2CDGB 3IPFA 4A04A 5FA4A 4G5ZH 4AJVA 2ZYSA 1CTNA 1FNGB 5CEZH 4JQVC 1BD2A 5AW4B 5BZXA 5IMMB 3QUMA 3PHAA 1H0DA 3LNEA 3N42F 3QWRA 1RJLB 5GGRA 3SKUD 3UPRB 1J5OL 3MYZA 4DK5A 3QH3A 4HJGA 4AMKH 4OD1L 5C0AB 3MLRH 5TE4L 2C9VA 3ARBC 2UXFA 1WDAA 1ZLSL 4WW1A 3GHPA 2GK2A 2CUHA 5F96H 1PZUB 2WZ0A 2VZOA 3F00A 4LCYB 4BH8A 3OB0K 1RFDL 2WUBH 1AQMA 3QJFA 5DD1H 4G82A 1CMOA 1HHJB 5L2KE 3GIZL 1W0VB 2GEQA 4KXBA 4U7MA 1NGWA 4WU7B 4PD4K 5IBUG 4AQ1C 3ILPB 2CLVA 4PP1C 1KTCA 3C60B 3EH1A 3CDGA 3UADA 4JHAL 4BHUA 3FN0H 1HHIB 3PIQA 4LOVA 3VTTA 3UJIL 3PFUA 4L1DA 2ZCLH 3DMMC 5FUZH 2BNQD 1ZTXE 3WIAA 3RY6A 4WFGE 2A7BA 3WDHA 5KAQG 4P57A 4UQ2A 4L4VB 4JW3A 1SXZA 1ZT1A 3CHRA 3EHBC 1S78D 3UC0H 2EQDA 3VFNA 1BQHG 5KYXA 1ROCA 1ZWIB 4FNLH 4HEPA 1N59A 1U3ZA 2ZCHH 1SOSA 4LIQH 4ODXB 3O2DA 4OJDH 4RMBA 2QFRA 5HI3C 5GGVY 4KUZH 2B39A 5E1HB 1RV6X 3UTZB 5D1ZD 5J5EA 4YAQB 2WC7A 1YA5A 3A4EA 4XWGH 3Q5YA 4FA6A 3L48A 1I3GH 4GIPD 4DERA 5LLIC 4KRMB 4LNVA 4EN3A 2X9WA 5E9AA 3OSKA 4N8VB 3I6GA 4RAHA 3OHXB 1SN2A 2SEBB 3TZVC 1IM9A 4M1GL 4P9MH 1PKQB 3P9LB 5E8DH 1MFNA 2FJGA 3ZW3A 3O4LE 3I02A 2GT9A 4XVJL 2DMGA 1BVLA 5KW9H 4JKLA 2OCJA 3CDCA 2IVFC 4GAYB 4CVWA 4EDXB 3EGXA 4YDKL 3ZZLA 4GRWB 4KUCF 5LDSA 4O58H 4OCRH 3DTXB 4JFTA 2UXVA 3O8XD 4GXUN 3QDMB 4OFDA 2XKUA 5FFOA 3T77A 4P5TA 3DRQA 3VI3E 1CYXA 3DRTA 4RVBA 4W9GC 3HE6B 3QQNA 4GI6A 1ADQA 4DPCX 2DIAA 3NACL 4DPAX 4GUQA 5B8CC 1L0YA 2DMKA 2IH3B 1TNMA 3ZRCC 3N9GH 4F58L 1FL6A 4JY6B 1Y1DA 2ENSA 3NBNA 1XH3A 1YMMD 1TOXA 2I27N 2OR8A 4DN3L 2VR5A 1NC4A 1KXHA 3INUH 4IKNA 2GJ6A 3B37A 3RVXC 3Q2VA 1JZEA 3VMNA 1SDDB 3JQOB 5IOKA 2DM4A 2Y7LA 3GSOB 2ZWKA 3GWJA 2W59A 3ZT5A 4V2BA 3VD0A 2ETWA 5KJ7E 4GFTB 4KFMA 5IVNA 4FXGB 1URIA 1QA9B 1HIMH 3QRFM 1B0IA 2BVOB 3L3HA 3VJ6B 3QEQB 4DUXA 1A1OA 3Q2CA 4AQ1B 3FQ4A 4O51B 4FG4A 3EDJA 5FA3A 1SYVB 4OF0A 3T9WA 3TCLA 5IY5B 4JG0H 3B2UC 4QHMB 4OV6F 1QVOB 5B38B 3KPRE 5EZLA 3FTSA 3ULVL 5C0BD 2EKSA 2WXMA 2VJXA 4R0LB 2CDEB 2KDYA 1QO3A 5TE6H 5KG9B 1S7TA 4U1MA 4OH2A 4Z3GA 4ABUA 1A3RH 2D9CA 4I0PC 5FKAB 2C3XA 2OW7A 3C5JB 4P23C 4LPCA 4XCEA 5EO0B 3PPSA 3HFFA 3GMMA 4X6EB 3RGBA 3HI6H 1MAML 1T21A 5AG9A 2AQNA 4OZ4A 3GFUA 5DMGC 5T1LA 2XWCA 3D18A 3GSNA 3LN5B 5D9SB 3ULAB 5KVEH 2WSDA 4UWQB 1A4KA 4HKZB 5A7EA 1DVXA 3FRUA 3T2PA 3JWOH 3QPXL 1JPFB 4JPSA 4NN7C 1JPEA 2TRHA 5JOEA 2GUYA 4G8FA 5CP3H 1GPOH 5I73C 2XXGA 4HUUA 1M57B 2YA1A 2FJFA 3CFEA 4PJGE 5TTRA 5JPNA 5IM7A 25C8H 3DWTA 4EOWL 3VFMB 4KK9D 4A2LA 2J7LA 1DQDH 3L9RB 4YSTA 4AT6A 1SN5A 4WK0B 2IQAB 3CDZB 1T5XB 4K9EC 4NZUL 4JS7A 3IU3A 4QXUL 1MFVA 5JO5B 3EGDA 3QULB 3WGVB 3NJKA 4EI5D 3IDNA 2NY4B 1C16A 1XD0A 2NPLX 2DJUA 3O8XB 4BHUI 1GZQA 4YC2C 5CBAB 5ICYA 2J88H 4JG0L 3S3CB 5AVXB 1WWWX 3RVXD 4Q56A 5CHNA 4UMGA 1AR2A 2BOBA 2ZXEB 1KBGH 3CFJB 2J43A 3IJYB 4LOEA 4NFDA 5JW4Q 4CSPA 2BW4A 3AY4C 5JLZB 2X6CA 4LEEA 5K59F 4JFQA 5ENWB 4AE0A 1JD9A 3ESOA 1SRDA 4J8QA 2UWEF 3BZ4B 3MX0B 4JFEB 3OKEA 2YARA 5FHAL 3L3KB 2PW2B 5D6DA 4E41B 1JWSB 1FYTA 4XPGH 4EQ2A 1MI5A 4F5CA 4QT5B 1OALA 1J10A 1IL1A 5EZPA 2W8CA 5F1NA 3VTMA 4F27A 4J3OF 4ELKB 5EEZA 5L6YH 3WXVL 4PRPB 3UMNA 2CMRL 2Y22A 1YJDH 3TIEA 4NDMB 2NXZB 1F8TL 3DHPA 4A2HA 3STBA 3ETTA 1A6AB 3HS9A 5KSUA 2H6OA 2LTQB 1FG2B 2G60H 3IVKA 3QZWB 3BH4A 3MRNB 4MD4B 2HFTA 3T2OA 3U7WL 3CFBA 4U6VH 1RLBA 2CO3A 2V9RA 3NAAL 4NLAA 2R0LH 2OMZB 3EXLA 5DI8A 5EG6C 3NP4A 5E8DL 1M53A 5IBLC 5IKCA 3AZUA 3VQ2C 3WUWB 1RZPA 3QZOA 2I5YL 1FHNA 4AW4A 3N41F 5F3BB 3BSGA 2IOIA 3EOTH 4H8WH 5MERA 3VFWA 1WSST 3R8BB 1RZQA 4QEGA 3AG3B 4K9EL 3F83A 5L2KB 1KPUB 1JXKA 5EC1A 5I1CH 5HDWA 2AERT 3HG4A 1CF8H 3DROB 4DHLA 4KTGA 3WIHH 4MQ7B 3VXMA 1FZJB 4Y7MA 4Y4FA 4Z7QE 2APBA 1QSFB 4PYGA 4D3CL 5KANI 1KEGL 3NCMA 1X5XA 4LU5H 4HKBB 1DP0A 5D93C 4OLEA 3NEEA 5CD5D 1KEMH 4I8DA 4DP1X 3O6ML 4H44C 12E8H 3KPLA 5JHLA 1OP3K 1OAKL 3KPOB 4PV8A 1CT8B 1T2XA 4PJ8A 4KNSA 2VIRB 5CEZD 4QXGL 1DQIA 5D1XD 2UZYA 5HD8D 1IQWH 2ZSWA 2C3VA 3KYOB 1KBWA 1OD7A 3CUPB 3WSQL 1XGQB 2GFBA 4Z7OB 1HOCA 4GP4B 3G5XA 1QFHA 1I1AD 4U3HA 4CL7A 1YAZA 3QNYA 4GMSL 4IGBD 4W9IC 4TQPA 4UIMB 1CLOH 3ATEA 3W56A 4OLYH 4AYSA 3KYMA 2XDHA 2WYHA 2GJRA 3BUTA 1QPKA 4P5KA 1CR9H 2XV0A 3D39D 3QNXA 1CK0H 2QELA 1O6TA 3T3PF 2ZUXA 5I8CB 4PLKD 1P7KA 1EHLH 1TVBB 4NQSA 4L1SA 4OGXL 1MCQA 2VLJE 3V7AE 4R7NA 3UCQA 4POYA 2ZX7A 5C97A 2OP4L 5I17B 3L6FA 3IB4A 1KZQA 4NJAH 3WTXA 3ROLB 2GBUA 4AI7A 3ZRFC 4M7JH 2CBMA 1MG3C 2VZTA 4HJGB 5CCKL 1MZZA 3LN4A 4L4TB 1NGXA 2SODB 2VISA 5A6IA 3FO0H 2PO6A 3TBWA 1U8QB 1YMHA 1LO4L 3FO2A 3O0RH 1GKOA 3QIWA 1F4YH 4MNQE 4NKOA 1GC1C 4H20H 3EYUL 3GSRB 5MHSD 1UVQB 2JKIS 5DGRA 1OGTB 1BD2B 4CN4A 3IE4A 3BIAX 3DJ9A 5JIMA 4L5FH 4IDJH 2E0PA 4NJ9L 2EE9A 3M07A 3BPLC 2WIIB 2XN2A 2XUWA 1KN2H 3MMEB 3EBHA 1E3ZA 3HPJA 3DDFA 2D3VA 1GAFL 1EK3A 1U41A 1ZDQA 4NPJA 1EEUA 1IC1A 3S2CA 3NACH 2WVVB 3LPWA 5D1QD 3LMJH 4ESKA 3CDGB 2PPAA 4TLTA 1PEWA 2HAZA 3LQZA 4NFBA 5ESQA 4KXCA 4DGVL 1T0NA 2YD3A 5HHOA 5CWSB 5E1AB 2Y1YA 5KVGH 1L0QA 4FTVA 1SDYA 4NZRH 1J48A 2H32B 3A21A 2YAPA 1FE8L 2R4RH 4UQ2B 3WFDH 2VWEE 3FN9A 3SDAD 1ND0B 2OL3B 1QBML 3FPYA 2EADA 3KJ4C 3IKKA 3H53A 1F4WH 1NKRA 2OXGA 1N59B 4BKLB 2H0FA 3ULUL 4PGCB 1FFQA 4NO2A 2JKWA 3QDGD 1QFPA 3HG2A 3RPIB 1XGUB 1IGJB 1D7BA 3U36A 4AL8C 4AV5A 4DPBX 4KY2A 3NIGF 5FC9A 1IGYB 1EVUA 4PG9B 2DL9A 3SDXB 3LD8C 5H94A 1OL0A 3CZKA 2Y1AA 4FZEH 4J2XA 3JV4A 1XAUA 2XQ0A 3LZRA 1PKQA 1CUOA 3K2MC 3P9LA 4RGND 5D70L 3C60C 4LOUC 1LDPH 3NCYS 3ZHLA 5JOPD 1NJ9A 5ESVB 5LBSH 5E95B 2ESVE 3FT3B 4XCYA 3M17A 1JNJA 2N1KA 4JM2F 1HOEA 4QHKJ 2WK2A 2FT8A 4J4PC 4KK5C 4BINA 2TAAA 3L54A 4QR7A 1E4WH 3DRQB 3FCBA 3HJ0A 4QXTB 2BSRB 4N9GB 1X9UA 4QMEA 3EDEA 5DRWA 4JPKH 2Y4SA 3QFJA 4JFDB 1FA4A 5DD0H 1TITA 2P3YA 4X0NA 3CZFA 1SLVA 3N04A 3A3YB 3DPBA 5AB0A 3MV9B 4GLRH 2GC4C 5DZAA 1DQLH 1FORH 1KIQA 3PXHA 4D8OA 2XA8L 4ZPTB 2GJ6B 1PEZA 3F7RA 3H2QA 2OMYB 4UT6A 1AQ8A 2X4QB 1LDPL 1GSKA 4DTGL 4WWKC 5MEOA 1BQHB 4ILDA 5FKPA 1NMCC 4AQ1A 2CRYA 3L3OC 1BQKA 4M03A 4Y1AB 1F1AA 1NC4B 4Y16D 4BSWB 4BFIB 1HEZB 5C0IA 4PJ9A 3FSWA 4K8RL 4NENB 1CGSH 4AL8H 4LSUH 4HJ0C 4GI8A 3RILA 4ZFQA 3O3BA 1ECYA 2EKSB 5FO7B 3EYFB 4QRPE 4JFFD 5I23A 3S98A 3CFKB 2AK4B 1U8HB 2IG2L 3OKLB 4OLZH 3SDCA 3HVNA 2P80D 4JHZA 1AANA 3KXFE 2WLLB 4RISL 1RZ7L 2WZPA 4MZ2A 2XTJC 3OMZA 5GJSH 3W9EB 1Q4NX 2B16A 4KRPB 4M29A 3U9UA 2EO1A 2EDNA 2H47C 2Q6WB 1I3VA 3IF1A 3JBG7 3CQPA 2IH9A 1WA1X 2B1OA 3ZKMC 4LKXB 1DQJB 5FYKD 1KJVB 2F74B 3ECQA 4I0KA 3IGKA 3OKNB 3IT8D 3MODL 5IVXF 4JHVA 3T08A 1DO6A 3HZVB 3ETSA 3MRFA 3A23A 3B7RL 3FO1B 4Y1AE 2Z31C 3NN8A 4FXKB 4M56A 4H8WC 3B9VA 4S1SL 3L7FB 2JV6A 3FW6A 2N01B 4IDJL 3MU3A 4NJ9H 4NBZB 2A38A 2BVQA 2FO4A 3FU3A 3VFMA 5A7BA 5JW3L 3QAZB 3L9RA 5I5JA 4DP6X 4DP7X 4BGLA 1ACYH 1IV8A 2V5SA 1OSPL 1SY6A 4AENA 5ACZB 3UG4A 3STLA 1HL8A 5ICXA 3E8UL 1EHXA 2VZVA 2WOYA 3KHOA 1HX0A 3CVIH 3MYJA 4WWOA 2DKMA 4JMXA 1OE2A 1QFWH 1A7PH 2OXHA 3WIHA 3HMXH 3RY6C 1TU2B 3B6SB 1LD9B 5DRNA 3IE9A 1A1MB 3U0PA 1WISA 2BCKA 1PCSA 3MRCA 3V0FA 1TJIH 3CDZA 1UD2A 3BWAB 1NEUA 3CHSA 4LKCA 1UB6A 4M1CC 3IU3B 5B38G 1LEKB 5E2WL 4CNIB 2YXFA 2AEIT 5DHEA 1WHOA 2EDFA 3I6KB 4GQ9L 1DVZA 3BH8B 1KJMA 2OMTA 4UT9H 4G6JL 1BVKA 1AGDA 3JWDC 1MCOL 3AB0C 3DSFH 2EEAA 1FFRA 5C9KA 4YSDA 4Y16C 2CHXA 1E90A 1BYNA 1YEJL 5IFHL 1R19A 4LL4A 5I1HL 1XR9B 2V4LA 2R9HD 1H5BC 3QCVH 4X9YA 3CVBA 3S0PA 4IBWA 1GOFA 1QFWI 4NNXB 5TQ2H 3H9SE 5D7HA 5E51A 2YS4A 1TVDA 2R15A 3F6IA 5F1NB 3UDWA 5LBVA 2CZNA 3BKML 2CWRA 4N4YB 5DJCB 1BFTA 2FEDD 4FFWC 4YXHL 3LZOA 3TLRA 3KLHD 1MJ7H 3IFPA 1J12A 1VERA 2CLZA 5AW0B 5KSBF 3WLBB 3V0WH 3P77B 1OGPA 4MJIE 3J7HA 1G7IB 2PW2A 4E41A 1EO8H 1Y18A 4UYQA 2IPTH 4HUXA 2NZ1A 1NIBA 3FU9A 1HESA 3TTYA 2Y7QB 3KWVA 3HG1B 4MXWL 5ITBH 5LNEA 1KELH 3H9SA 3LKQA 4LU5L 1ZOXA 4XMKH 2D3NA 3UAFA 1AXIB 3FQTA 4OUUA 2EYRB 5HHPB 3AM8A 2EH8H 4YHNB 2MSPA 4DZ8A 3T0ED 2X4RA 3T4AB 5CP7B 2NZ9C 3BRDA 3LIUA 4GQRA 4OBRA 2OZ4A 1SJXA 2J8UF 4MJIA 1DEDA 3DSNB 1RK0A 4NNYA 1U42A 3PPEA 2WZPD 5I30L 5EC1B 1ORSA 4HQQL 3HZMB 4FQ2H 3BN9D 5FF6B 4QO1A 1YCSA 4UM8A 4MASA 4ODHL 5IF0A 3BWUF 1P2CA 2W0FB 3U1PA 5DFTA 5GGSY 1AHWB 4GG6F 5HHXH 4FKKA 5JPMB 5L2JB 4JGJA 5JUEH 2WNGA 3G6DL 4LF3A 2QHLA 1IC7L 2E7LA 1CI3M 4IMKC 2W65A 1O0VA 5J13B 1T89A 1UA3A 4XP9L 2GUOB 4WUUE 2P8PB 3S48A 2NSMA 5T3XE 3HZYB 4XCFH 1Q0YH 1RQ5A 2GC7C 3E3QC 1ZLEA 3R7QA 4U3XA 3EBGA 5DTFA 2WLNA 3GSNL 1FBIH 4X9GA 1B3IA 1GGYA 4AYFB 4Q97A 4JGUA 1F90L 2K4AA 2C4XA 5D2LB 2X6AA 4KDTA 3KPOA 4PJ9C 3QQDB 2NUPB 4ONGH 3UZVA 3E3QE 3QWRD 4H20L 4P5KB 2E86A 3HNVH 4D8PB 1AO7A 1CU4L 5EHFA 3R06A 1D6VH 2GCYB 2JKRM 2QVFB 2WWMD 1G9NH 3LSOB 3WUWG 1HOCB 1DLFL 4RIRB 4EF3A 1A6UH 2QQLL 4IOIB 4Z7UE 2R1WA 3JZ7A 4XXWA 1X5LA 2FIKA 2WCGA 4FGMA 2JJSA 4MTMA 1RU9L 2WBJA 3V0VB 2VXQL 1XGPA 3L6FB 4PS8A 4PJGA 5J9PB 4HPYL 1RAMA 3QQ4A 1FO0H 4N0UB 4EI5A 2J8UE 2QV2A 1J9CT 1M9WA 1MVUB 2F0CA 5T5FL 1U8MA 4Y4FC 5DZLA 2ZXWB 1TUPA 4MMZC 1XAKA 3BPCA 1HXMA 3DVGA 1MJUL 4P4KD 5D4QA 4RMTA 3ES6B 4NZUH 5AVZB 5DJYB 3KLSA 1GIGL 4H5SA 1L0XA 4HUMB 2W0PA 1OANA 2ORBH 3L4UA 1DQDL 1E9OB 1Z0NA 2C3HA 1DE4A 3QIWC 5KJ4A 4BZ2A 4HK3N 1SXSA 4G42B 3V7MA 4X4ME 4WF7A 1NGXB 2VISB 3SDDB 3BD3A 3I6LE 4L4JA 1WFOA 1IQWL 4HKJA 4NKOB 5B7MA 4G6FD 4F33A 4N2CA 3WTVA 1IKOP 1QUNA 2ZYRA 4K0OA 2I07B 4OD3H 2AANA 2FYVA 3EZ8A 2GITB 4O2CB 1XTMA 1T0NB 3N44F 2KBGA 2QTVA 5AAWC 1FGNL 3ARED 4S1RH 1KBVA 4UT9A 1G7JA 3ABGA 5CGYD 1E27B 4EKXA 3EAKA 2IBGA 4A2FA 4FTVE 3N40P 3TEWA 3F3HA 5CZVH 3HG0A 3FCSA 3BCDA 3QG7H 3TWYA 1M42A 3TNMB 1I7TB 5C3IA 1OCOB 1Y1UA 4PQXA 4XC3H 1NCDL 1ZLUK 2GHWB 1G9NC 4JKKA 2YGPA 3DX8B 4PJ6A 3UYRH 3X3FL 2CK0H 3H0TB 4N26A 1F2XK 3FFCD 3DX9A 4HPOL 4KKBD 4XNAA 5GGQL 3JV4B 2GSIA 4F8PA 4Z0XB 2WQVA 4JO5A 1NAMH 4MXVF 1BV8A 4IOSA 1A02N 4XNQA 3MO1A 4I0PD 4KPHH 2V3EA 3AGWA 3G6JB