5I6OA

Crystal structure of copper nitrite reductase at 100k after 20.70 mgy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 92
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA02
1BQ5A 1TEGA 4YSUA 1NIEA 1L9TA 2UX6A 1BXAA 4A2EA 2CAKA 1HAUA 3QJSB 1L9QA 2IH9A 5B1AB 5I6MA 1NWPA 2JKWA 3X2QB 1GS6X 1HAWA 3V9EA 1WA2X 2FQFA 1NTDA 1AZUA 2TSAA 4BWUA 2IDTA 1SHWA 2N0MA 5F7BA 4DP7X 3DTUB 3X1BA 3ABKB 5I5JA 4DP1X 4DP4X 4YSDA 2YAOA 4BWWA 4G7RB 3H4FA 4QKTA 4G72B 1WS8A 4DP8X 4YVNA 2BP8A 5LDUA 3CVCA 2DY2A 2HX9A 4CSPA 2VW4A 1M57B 3IN2A 3FQ1A 1TKWA 3FU8A 4BWTA 1J9RA 3ABLB 5AKRA 5IY5B 3TBCA 4DP9X 1UATA 4YSRA 1E65A 1JXGA 4AKPA 1TEFA 2GB2A 3PCYA 2FJSA 4A66A 2DV6A 4HHWA 4A67A 4AX3A 2AZAA 2GBAA 3N2JA 2UXGA 2PPFA 2J55A 1SFHA 3OQRA 5D4JA 1X9UA 5I6OA 2EINB 1DZ0A 1ZV2A 3OD3A 1JOIA 2XXFA 1RCYA 3AG2B 2BHFA 3NJFA 1J5DA 2AANA 2GHZA 1SFDA 2HRHA 3UABA 1W8EA 1RZQA 1AZBA 2HX8A 2QT6A 3C75A 2ZONA 4DPAX 1ETJA 1JZHA 3AG4B 3BQVA 3JT2A 1IBZA 4KOBA 4E9YA 1KV7A 4G7SB 2HX7A 2H47C 4KNSA 1NWOA 1SDDB 2UX7A 4KO7A 3T71A 1A4AA 4E9TA 2PCFA 2DWTA 2PPAA 4DP6X 2BW4A 3ZX1A 4F7KA 1VLXA 1I53A 4HALA 3NJNA 5I6NA 2FT6A 5I5IA 2DYSB 2PP9A 2YARA 2YAPA 1A8ZA 2CJ3A 2R7EB 2WO3B 3MX0B 4TXVB 1AG6A 1DYZA 2BP0A 3IBOA 3OM3B 1A65A 1ASQA 5F7AA 1PAZA 2HLEB 3NSCA 5AZUA 1SF5A 2WO2B 2YXWA 3NJGA 3S8FB 2VN3A 4HCFA 5E9NA 4YSCA 2J5WA 2IAAC 3CZUB 1IKOP 5AFAA 3S3BB 2FTAA 3NJMA 3QJQB 2HRGA 1AANA 3TU6A 3X1FA 1L9SA 5D4HA 7PCYA 2OJ1A 2QDWA 1M9WA 2BP8B 3UGEA 3ZIYA 3G5WA 1JVOA 3X1NA 1AG0A 4GP4B 1FFTB 4Q89A 1J9QA 2IWKA 2UXVA 4HIPA 2PP8A 4E9SA 3AY2A 4KNUA 4A2DA 5B7MA 4AKOA 1PNDA 2PPDA 5TK2A 3S8GB 1PLCA 1KGYE 2Y69B 2JXMA 3NJHA 1KYAA 1IC0A 1J9TA 2J56A 1BYPA 2W88A 9PCYA 3WKQA 5I6LA 2FT8A 2XV0A 1BXUA 2QDVA 2DWSA 3GDCA 2YAMA 3SBRA 3UAAA 2PPEA 3FSAA 1W6LA 1GY1A 5D4IA 2GI0A 1AACA 1KBVA 8PAZA 4G70B 2IDFA 3HEIB 1URIA 4CSZA 5I6KA 4YSSA 2R7EA 5I5MA 4EF3A 4HAKA 1J9SA 3FSVA 4E9VA 2J57A 1ADWA 5EHFA 1MZZA 1AS6A 1BYOA 5FC9A 4YSEA 4GXFA 2YXVA 4MFHA 1PY0A 2IDUA 5I28A 1SF3A 2UXFA 4BDVB 3EHBB 4GY4A 2IWFA 1J5CA 2PLTA 2HZHA 2QPDB 4FAAB 2P80A 1EZLA 2EIKB 1ET7A 3TA4D 4E9QA 1PMYA 3UADA 1AQ8A 3PAZA 1GS7A 2IWEA 5ANHA 1AIZA 3FU7A 3NP3A 2BP0B 1AR1B 1OF0A 1WA0X 2CALA 3NSYA 3AG1B 4M4RB 3T6WA 1OV8A 1JZEA 2BO0A 1QNIA 3FSWA 1T5KA 2XUWA 3PXLA 3FQ2A 5B1JA 3FYEB 3NT0A 4NERA 3QPKA 3EF4A 3QQXA 4A2HA 4QLWA 1M56B 4KO9A 4PCYA 2B3IA 2MTAA 3EH3B 4A2GA 4KO6A 4GP5B 1GW0A 2GIMA 2BW5A 4K9JA 4JHVA 2AZUA 3PLYA 1PLAA 2ZWNA 6PAZA 4YSTA 3WI9A 2XVBA 2PPCA 1NIDA 2FQGA 3WNJA 4DPBX 3NYKA 4BDVA 1QLEB 3MBWB 1CURA 3FYIB 4NB7A 3CDZB 1PLBA 1E67A 3ABGA 1GY2A 3FPYA 3PAVA 4AKQA 1NPJA 1WS7A 4E9WA 4E9RA 2I7SA 5B1JC 3FPXA 5I6PA 2UXTA 3PAUA 1GYCA 1OE1A 1JZIA 2FQEA 1MG3C 2IDSA 3RYMA 1V54B 3WKPA 1AZCA 4FA7B 3QJRB 1CC3A 1AS7A 1R1CA 2WSDA 4GP8B 5PAZA 3ZDWA 2AVFA 1W6WA 2YQBA 2EILB 1L9PA 1AS8A 1N70A 1CYXA 3NJKA 4W1TA 1ZDSA 1WAEA 3S3DB 3WIAA 3NJJA 3EH4B 4KO5A 2XXGA 3FU7B 3ABMB 3NJLA 2OV0A 1OCRB 3WNIA 3TASA 2Y1AA 2X87A 2XV3A 3OMIB 2HXAA 3U25A 3SBQA 4DPCX 4YSOA 3SQRA 3QJTB 2CBPA 1F56A 1PCSA 1CUOA 1NIFA 1E5ZA 3CDZA 1ILUA 3CVBA 3NJIA 2I7OA 4YSAA 3BVDB 2E86A 1ASPA 2H3XC 2JFCA 1AZRA 3IEAA 4P5SA 3PPSA 1N68A 4KOCA 4L0PB 3S3CB 4DP5X 3T6ZA 2I85A 5I26A 4AZUA 2BWDA 2GC4C 3ASOB 1JZGA 1KCWA 1WA1X 1JXDA 1E5YA 1NDTA 1NZRA 2VM3A 2NRDA 3KW7A 2XLLA 1MZYA 3TBBA 1AAJA 4N4YB 2VMJA 1EHKB 1OCZB 3GXUB 4NAJA 4UANA 4BK5C 5B7FA 3FT0A 4BXVA 3FS9A 4X4KA 3D12B 2RACA 2GSMB 3AW5A 4YSPA 2VSKB 2ZOOA 1GSKA 4GYBA 1PZBA 3ZBMA 1PF3A 4G7QB 2EIMB 3HB3B 1A4BA 2YAEA 5B1BB 1JERA 5TK4A 4DP2X 1KDIA 1ET5A 5B7EA 4YL4A 3UACA 1ASOA 1ID2A 1AZNA 1NINA 2LLNA 3ASNB 1KCBA 2YAQA 1PZCA 3CG8A 1A3ZA 3T6XA 2GC7C 2QPEB 1JVLA 1NIAA 2PCYA 4G71B 4KNTA 3OMAB 1E30A 4P5RA 1PZAA 4ZK8A 1MDAA 1SHXA 3NP4A 2IDQA 3CVDA 4M3HA 2XX0A 4HHGA 1V55B 2XYBA 1IUZA 1NPNA 3X1GA 4ENZA 2YAHA 3T9WA 2XX1A 2CCWA 4DP0X 6PCYA 1L9RA 1RZPA 2PP7A 3X1EA 2B08A 2FWLB 2H5UA 2XV2A 2VSMB 2XU9A 4JHUA 1B3IA 1PNCA 2W8CA 1BAWA 1X9RA 2IH8A 3FSZA 3ERXA 4A68A 3GYRA 1A4CA 4JKNA 2MRYA 4Q8BA 4HCGA 3H56A 5B3SB 1OCOB 4UF7C 5PCYA 4UAHA 3EH5B 1IBYA 2AFNA 3SBPA 2FNWA 4RH4A 3AG3B 1JXFA 3JTBA 4YSQA 3H4HA 1FWXA 3V9CA 1KBWA 1FA4A 1ZIBA 2A3TA 3NSDA 4W9ZA 1NICA 5A7EA 1XB6A 1JZFA 2P80D 1BXVA 3IE9A 1OCCB 1AOZA 2BZ7A 1RKRA 1ZPUA 3QJUB 4HCIA 4YVUA 2OCCB 1JZJA 2YAFA 4PAZA 3WG7B 1GR7A 3AZUA 4F2EA 2VW6A 1L9OA 1V10A 2XWZA 2FT7A 1HFUA 3IN0A 3NSFA 1NIBA 2DYRB 2Q5BA 3DIVA 4HZ1A 1OE3A 1ZIAA 3OMNB 4N8UA 1OOWA 1XB3A 4BXSV 1BQRA 1GS8A 3KW8A 1XB8A 2Q9OA 4E9XA 4WKXA 1KDJA 2VM4A 2BWIA 1TU2A 2ZXWB 1SJMA 4A2FA 4F2FA 3QJVB 1ET8A 2BZCA 3FQYA 3N55A 1YLBB 1BQKA 5B1KA 1BEXA 1OE2A 2FQDA 1MG2C 3DKHA 2TSBA 2EIJB 2CUAA 1SNRA 4AI7A 1XMEB 3UAEA 3FU9A 1ILSA 1ZDQA 2VW7A 2X88A 1QHQA 1SDDA 4WTQA 3T6VA 7PAZA 3L45A 1CYWA
chains in the Genus database with same CATH superfamily
2G30A 4JM2F 3HFFA 3ZR6A 3LIZL 3PWJB 2V9RA 1MRFL 2WBWB 4PY8I 2PTTB 1WAAA 4ZOAA 4ANWA 2G3NA 4X5XA 1JNLL 1KT2A 3LY6A 3HI5H 3MX0A 3HRZB 4ZMXA 3QRBA 2E27H 3VE0A 2VDQL 3FHEA 5EIIG 4XB7A 3FDWA 5E2UL 1QLFA 5C92A 1XSKA 2I32A 1WA2X 3BO8A 1UACL 5EG6C 1KN4H 2YFOA 1XX9C 3EO1A 3IDGB 4F7EA 3FB6A 4K73A 3LRMA 1IJ9A 4G43A 5DJYA 3E1ZA 1ZTXL 4ZMVA 4JKKA 4KDWA 2CO3A 3V4VA 1F4YL 5AW3B 2XBDA 2MJWA 5BV7B 3TIDB 3D33A 3D05A 3HN3A 3RY6C 2YUVA 4LLWA 4B60A 2ZICA 3S36X 1WFJA 1UQSB 2UYLB 1Z0NA 4FC3E 2HFFA 3CWGA 4OKVA 2AITA 3BUYB 4OB5H 3BZ5A 3WHE0 5AKRA 2FX7L 1X44A 1XXFC 2OK0H 1BLIA 1LK3H 3VI3E 5EBGA 1JYNA 4QLRA 5TE7L 5CEYA 3J2PA 4JHWH 1JXGA 2VLRD 1GZPB 2R2CA 2F19H 4LEOB 1NGZB 1EZSA 3II3A 1JYVA 4A67A 1S7UA 4NJ9H 3S9DB 5KSVB 4HWEL 4PJAE 1QEXA 2YA0A 2Z31C 3C08H 4UYQA 5INCA 2ZXBA 3DX0A 1R5IA 4KK6D 4LP5A 5H4YA 5I6OA 4Z3EA 4N5ED 4ODTH 4BBWA 3HCVB 2X3CA 4NP9A 2BHFA 3LIZA 3AB0B 4UOW1 2WVSA 1SJEB 2GHZA 4YO0A 5BRZE 1W8EA 1U8IA 1IB5A 4IK6A 2VXSH 3PYCA 3EKCA 4LSUL 1UKTA 2Z93B 4AENA 4QJ5B 3AG4B 4MTMA 1UB6A 4KKBC 2MOGA 4CVXA 3OGCA 4IDJH 5L9DH 2AJSH 1NWOA 4J3WA 1CGVA 1T7YA 3QDAA 1JGDA 4IRSC 4F5CA 4JCMA 2O5ZH 4PJHB 3FRPG 4V2BA 3POHA 4DGWC 4BZ2A 2LU3A 1ZT7B 4MMZB 1QTPA 4D9QD 3ESVF 4DP6X 3B34A 1KB5L 1XGUB 2N3JA 2UY7B 4HALA 3HC4L 5J11B 4U0QB 4ZFOL 3L7FA 4IGBB 1KLGA 3FUMA 3RY5A 4FLQA 4XVJL 4RDQF 3RGVD 1HSAB 3STLA 5HHNB 1P4BL 1IQWH 3MV7B 3DJZA 1J05A 1SF5A 2W9DH 3ESOA 4QRPB 4XO8A 4W9FC 4XNMB 5GHWL 2J7LA 2V3DA 3AMKA 5I16B 4OD2A 4LDCA 4NRZB 5EF1A 1IKOP 1A66A 3LEVH 4JFEE 5FS5A 2NZ9C 3QZOA 3SDCB 1DEDA 1MFAH 4X8JA 5L2KE 3MJ9H 3AXLB 4HKJB 1EIBA 2GEQA 1FFPB 1N0XL 2WN3A 2AABL 3GQFA 4TULL 4TLSA 2ENSA 3TCLB 1AG0A 1I8UA 4LVHC 3L5HA 1LEGB 1FE8L 2FX8H 4X5PA 3CLFL 3TS8A 4N0FB 4MCYB 3RDTB 4A2DA 4OM0H 3UG5A 1E4XI 4FMFA 1ACYH 4WY7H 3E2HB 1SVCP 4HT1L 4L5FL 3K91A 1H6FA 6CGTA 3ARBD 1J9TA 2BM3A 5I6LA 1SLXA 4WWOA 3LB6D 3KWVA 5KVEH 5T33H 3O3AA 1LEKA 2VLJE 4RZCA 1FFOA 2B39A 3HBZA 1TTUA 3WL9A 1KB5A 2WXFA 4PGDA 1KIUA 4PGEA 1IGIH 5EUOB 3FOLB 4ZFOA 1Q94A 5C1MB 5T5NF 3WU1A 1LO4H 2P45B 2BNQB 4HAKA 4NUGL 4KC3B 3MRHA 2L7JA 3K4DA 4DGYH 1KJVB 3KLAA 1N10A 4KY1H 4PJFE 1OAZH 4K15A 2A0LD 1NH6A 4PGCA 4FA6A 1U8CA 4MFHA 2ZCLH 3RBSA 1I9RL 2Y7MA 4S1DC 1UOVA 4IBVA 4JPQA 3WFZA 2X7LA 4F8PA 1J5CA 4FAAB 3LPWA 2I9LA 1KV3A 3ZKMC 2OJEB 4GKSA 3HZVA 3JTTB 1CFSA 2Y72A 3VGBA 2GTWA 4OTXH 1JPTH 1U8LA 3R18A 1R0AH 2YEVB 5DYOA 2CSPA 5LVEA 1NAKL 3LRLA 1Z9NA 2BLFA 3ULVL 3VD2A 5IMOA 1OF0A 4G3YL 2HA1A 4A04A 1JGUH 3RZCA 1R3HB 1H3PL 4R97C 1T5KA 3S5LB 3PV7A 4FFYL 3T3PE 5L8JB 2B9AA 3FQ2A 1E6OH 4KK9D 1GGBL 4U6TA 4U3HA 4MZRA 3UO1H 2YBRA 1IGTA 4V1DA 2IANA 2NY0B 5IB4A 4KI1A 2NUTB 5ACLA 1KBGH 4YDVB 4A2GA 4F15C 1O7VA 3WTWA 3FAWA 4NHCL 3HNSL 2ZG3A 1T20A 1QTSA 2CLRB 2XA3A 4LMQI 4BQBA 1QPPA 1FG9C 2FK9A 3OAZK 2WUBH 3VXNB 4UV7H 3W9EA 5I1CL 1RY7B 5DRWB 2DQDH 3TBTA 5KAQF 4E0RA 1WHPA 1U8QB 5I75C 3MBWB 3QXAB 4N20A 4NB7A 3E8UL 1G1OA 5DK3A 4HUWB 3NOIA 4MB1A 4XXCC 2WTRB 3ZRSA 4UQ2A 2HWZH 4PGBA 4YHKL 3U1QA 2DBLH 3ZDXF 1EO7A 3L95B 2ICEA 2WLJA 4WFFD 3MV7D 4UT7H 2MCMA 1IM9D 1R24A 3HKFA 3MLUL 4JJ5B 35C8L 5TDPA 3NH7L 2ADIB 4NNYB 4OJAA 2OTUA 3V6ZA 3MJ6A 3U0TA 3QIWC 4J23A 2J20A 2ALWA 3MI6A 2ZWKA 4B6ZA 2ZD0A 1QRKA 3OKLA 1ZHBB 1ED3A 2WSDA 1F13A 2Y5EA 4FFYA 2HT3D 4HK0A 3VQ1C 1WWWX 3WY2A 2VMEA 4R84A 4XMTA 1LO5A 3MACH 2B1AH 1KTLB 3VD0A 1KCSH 3U7AA 3MLXL 2M8XA 3IMBA 4B0MB 1Y6KR 2LGNA 3WJJC 2EUWA 2RCSL 4P3DB 3HPJA 4LCIH 3IT8D 3PIQA 4KO5A 4M6OL 3UBGA 2AK1H 3MREB 2NNCA 1OCRB 2G60H 2P8PB 2VC2L 4WEUD 4ODUA 5F6HJ 1OB1B 2NW2B 4HCRH 3EOYG 3MGAA 3FONB 3CVIL 4LDLB 4IRZL 4PJEF 3PJSB 3U25A 2Z8RA 3QIUB 4JCLA 3SBQA 1NFDF 3W39A 4HIEB 1N6QH 2OMTA 4FRWA 2P44B 4AWJC 4MJIB 3VWKC 1BGXH 4MJ5B 3LCYA 1WC7B 2ERJB 3QG7H 3QGVA 4NKIH 2ENYA 3O6MH 2QQLL 4QHUB 1TCRB 5FUOL 1Z32X 1KCWA 3DSNA 3BCFA 1KJMA 1NDTA 1MI5E 4CMHC 1A7QH 1JFQL 2CIKB 5CP7B 3TJEH 2HLAB 3VW3H 3WXVH 3HE7B 3ULUH 2PWGA 1NJ9A 1KBPA 4LNRA 2R9HD 3ZE1B 4YAQA 2WCSA 5FIEA 5HYJB 1PZBA 3P3RA 1NCNA 1Q9LB 2ZE0A 3WUWB 4CGUB 4OJFH 1G7LA 3WFDH 2DMBA 3ATDA 4G8EA 1NMCC 4HXAL 2MCPL 1ETB1 5AW4B 5JXAH 1FGNL 5HI5D 3UACA 3VH8G 3PHQA 1NINA 2HT4C 1BA9A 1R3IL 4TLTA 4L9LA 4WNJA 3TA3C 1BZ8A 4W9GC 4CJ1A 2GC7C 1NIAA 1UOWA 4HW6A 4KNTA 5D5MA 4BSVB 5JOPD 2IPTL 1UA6H 2WKOA 3HNTH 4IRZA 1P5UB 4HAFA 5C0CA 2NY0D 1L7TL 5IQ9A 2XBTA 4MCZA 2Y1YA 3L1EA 2SEBB 5DVOA 3ZVVA 1IGYB 3OJVC 3A4EA 5EBMB 2OMZB 1FVEA 3O0RL 4Y1AB 1Q72H 4XGZA 4XWGL 3KPPA 1WZ1L 4FG4A 1LWRA 3GMPA 3HE6A 1M1XB 3K6OA 4IBZA 4NJAL 1ZA3A 1FZJA 4IKNA 4NBXB 3FCBA 4EOWL 3BEWA 3ME0B 4PJGE 3IKCA 3RPBA 3QHTC 1OD9A 3ZSTA 1JNNH 3AMLA 4Z7OB 3AS0A 4ZW8A 4FP8L 3V0GA 4F37K 5F7HA 3IGAA 1H0DA 1GHFH 3EJJX 2EACA 3LMJL 4GRLA 1DDHB 4BFRA 4ELDA 4FX5A 5IB2A 2ICWA 2EYTA 1KY6A 4DEWA 4NKDB 5B38G 5G4NA 1ZWIB 5GS1B 4RDBA 2VT0A 3DHJA 3S5ZA 3KJ4B 1A3LH 4L4TA 1HHGB 4X6DA 4Z9KB 4PI0A 2ESVA 2OXGA 4S0TD 4AXWA 4M62L 3ALXA 4DKDC 3PL6C 1E3ZA 1AE6H 2JLPA 4MS6A 5CLWA 4DIXA 4Z8FH 1RU9L 1ZSHA 1FWXA 1N3NB 2A6DB 1IKFH 4XNZB 1S9VB 2J25A 3AACA 4Z18A 4FKEA 4HDIB 2CUIA 3Q8CA 3UYPA 5LBSH 5CCHE 4J27A 5DC2A 5HHXL 3OPZL 3BVXA 1TPXC 3JSSA 5D1XD 1WT5A 5ECJE 4ZNCD 2Z31B 5KN5B 4PB9H 4B9IA 2A73A 1H6TA 4HIJB 5KVGE 2Y5TB 4OQ1A 5IKCB 4PLJD 5C0JB 5T3ZH 5JHDA 4O2FB 3VX0A 4JO4L 4XZUB 3QIUD 3RL1A 3T5WA 3UCQA 5DA4A 5GS0L 1M7UA 4MJID 1OCWL 4ZO6A 1ZLSH 1ZKAA 1XB8A 3SE3A 2XN2A 3TVMB 2WK2A 4YHPB 5F70A 3ARQA 4L1HA 4O4YH 3UMTA 2H2SD 1G7MA 3GBNL 2IOOA 5HSFA 2ZXDA 4J2XA 5EMYA 3FQYA 4XCYA 5HD8C 3JWDL 4JFZL 4U3CA 1MREH 2IXQA 1BEYL 3Q5OA 5B1KA 4ENED 4GKLA 2G9HA 3MNWA 1TDQA 4IRJC 5D7IF 4ZD3L 3C6LC 4GS7C 1H9DA 1NCWL 4EQ2A 3MCLL 1NBCA 1RERA 2NT0A 2ILLA 4X7TA 2WLIB 2NY5C 3IMSA 3NGBB 3HE7D 2X88A 2X40A 5C9KA 5HTSA 1VEOA 3D51A 4A6YH 1J8RA 5AL0A 5HYJD 5HDBE 5JQ6L 1BQ5A 1TEGA 2G3MA 4HFUH 5E2VL 2QHRH 2H6PB 4TPRL 1NIEA 3CFEB 4RAUA 5BV7H 4X98A 1S9WB 4K07A 3ULSA 2B1HL 1F3DJ 4CU6A 5EO0B 5AG9A 5KYXA 3PWLB 2I5YL 4FQHA 4RMUA 5A7BA 1VADB 3HS0C 1EO5A 1EX0A 3K74B 4P8QA 3HHRB 3P77A 5EFIA 1QP1A 1LO0H 5D9SA 1MSPA 4N9OB 1F11A 3ARPA 5BW7C 3O8XB 4DW2L 2DQFB 2RB8A 4FMVA 4YSDA 1WWAX 2RGSA 2PXYA 1N7MH 2B3RA 2DMCA 4N8VB 4Y1AD 4Z5RB 5A16B 2XPGA 2R56H 4FNUA 1HXMA 1T0NB 1X6LA 1JZ2A 3HG4A 3BKCH 2H1XA 2VDLB 3MRQA 3QCTH 1GGTA 4TTGA 1X5LA 3FU0A 5MEPA 3MYJB 5FYJH 1YCSA 1CL7H 1YEDA 3VFVB 3CXDL 1HSBB 1TTCA 3VGEA 1WG3A 4FLSA 3DIFA 4GXUN 4M6AA 1RZFH 3ARBA 4J3OC 5DVLA 3D2TA 4WI3A 4DNLA 3OD3A 4W9KC 1JOIA 1QQDA 1TU2B 1E7UA 2NDGA 3GRBA 3QULB 4GMSL 4OCWL 5DQDH 5AB1A 3QUMH 1E4KA 5F0LB 2P1YA 5IF0B 4NO3B 1QX1A 4XBEL 1U21A 3CSYB 43C9A 5F89A 4YFEA 4Z7VF 3HRZA 1JF5A 3RIKA 1HWGB 3O2WH 2ZG1A 4NOFA 1A9BA 5LAXB 3U30C 4GSDH 2E9JA 3K8MA 1CWVA 4Y16C 3IDGA 4KQ3H 3HNVL 4AK2A 1QSFE 4D3CH 3WFBL 3A47A 3BIBX 3HOGA 3IFOA 4TNGA 3WD5L 1ZXKA 15C8L 1HQRB 3OPUA 1YEGH 1FCGA 1VLXA 2DH3A 2GAZB 2Z31D 4CUCA 4HU8A 4O5LH 4EZKA 2HG0A 1IILE 2WJ5A 1QWHA 2UYLA 2R7EB 1KGCE 3BUYA 5MENA 1KEGL 4ORGA 3F5WB 1DYZA 2DWDB 5FM5M 3S7GA 4F27A 3CPLB 2RR3A 3TNNB 1WITA 1J0HA 4H5SB 1VENA 4LEOA 3SDDC 3W37A 4U49A 2WLNA 5IOPB 4JVPA 5ISZB 3SE4C 3IDYC 3TVMD 5KSVA 1IEHA 4OU3A 2ITFA 4IEFB 3TN0C 1OF2A 3ZT6A 3GJFB 4WF7A 2QEJA 2X2YA 3D07A 4N25A 5DD3H 1SJXA 2BP5M 1IQDA 2EEFA 4Y9CA 2QDWA 2XVKA 1D7BA 4BUGA 1FHNA 3HG0A 3UGEA 3LH2L 3LNGA 2JJSA 2K3HA 1TJHL 3RWHB 1HOCB 1GGUA 4J3VA 4GKNB 4Y4HB 2OMXB 4U1NB 4GMTH 2ITDB 1BCIA 3EFDL 1CXFA 2MNWA 4LESA 5IEKB 4X9FA 3G08A 5ABAA 2I25N 1UUNA 3RHWK 3QDGE 4G6KH 2J21A 3HAEB 2VRQA 5L88L 1A4JA 2W9EH 3F64A 3L7EB 4YXLH 3A67H 9PCYA 2A38A 5C8JA 2M83A 3TL5A 2COVD 5DTFA 4Z95H 1FL6A 2Z7UA 1OLLA 2YMTA 3GDCA 4PBXA 4RMQA 4MMZA 3T1WA 5CIPH 1W6LA 1XGUA 3AQXA 1E4XL 1DBKH 4PRPE 5FYKD 1P69B 1Q1JH 8PAZA 2AJZB 4G70B 2Z0BA 3HEIB 5FXCH 3UZEC 2R4SL 3ZTJG 1NBVL 3B2VH 4YK4B 4QTFA 1FNLA 4EF3A 5IW1B 2E7LA 4M8VA 3VI3B 5HHNA 4B7IA 3Q7JA 4BZ1H 4Z7QE 3O8XD 3KS0H 5IFJA 2X1WL 3MGOA 1IM9A 3KBHE 2J71A 3CFJA 4JANB 3EW3B 5EZIH 4LPTA 4PJAB 4NRZA 5FF6B 1PY0A 4EN2A 2J43A 4AYMC 1GKOA 1CLZH 3O4LE 2OMYA 3SQOH 5GRVK 4D8PA 1S7RA 4LZKA 1MDTA 2QPDB 2Z8SA 3D69B 3NCEB 2YC1A 4K94H 3WIIH 3O41B 3GXDA 1K72A 5BRZB 4MAUL 3TCLA 1RJZA 4BFIB 1W9XA 2FEDD 1P6WA 4QRFA 1FL3B 1W0VB 4N0FA 4P5KA 2YK1L 3L4ZA 1L3WA 2IO5A 1HZLA 3PJNA 1OV8A 3DHPA 4P2OC 4Z7NF 5HP5A 2F8XC 2OCJA 4NXKA 1U3HB 3MO1A 1W91A 2OMWB 4P5TB 3GSUB 4HLEA 1T2JA 5HJDA 5C0AE 1NFAA 1SEBA 4XPBH 1NFIB 3JWNC 2F58L 4U1LB 5HHOE 3MA9H 4L37B 2YGVA 1IAOA 1T7WA 4S1DD 4J39A 2OM5A 2CDFB 1J5OH 2Z6FA 1YYML 1M7DA 3ZKMD 2C7UA 5CJOL 3ZGIA 1Y1DA 3EGXB 4GG6F 4LRNL 4Z3FA 4XMKL 1J8HA 1DQTA 3DGGA 3RVUC 5IV2B 3T0AA 4IYKA 5FKPB 5C3LD 4H20L 3QR2A 4ICWA 4JFEB 5T1DH 3L45A 2EICA 5ID0A 5EULV 1UC6A 2VKXA 1XCQA 2B8OT 4NZ8A 3GSNB 4DUXA 3MCKB 1IAIH 3NZHH 4WFHE 3O11A 5CLTA 3GPSA 4X6BB 1I8AA 2ITEA 3GMLA 1IGML 3KWUA 3U7YH 2C3HA 1ROCA 3CAFA 5F93C 4E9WA 4YHNB 3FTYA 3CFMA 4H0IA 2D7PA 3UZVB 3FNKA 5DFWH 4YX2H 5ISZD 5DDHB 1JPFB 1F45A 1GYCA 2Y5QA 4YDZA 3DBSA 1L0YA 1JZIA 3SZ6A 3SKJL 4JG1H 3DUHA 3RYMA 2HFEA 4LLQB 5CU9A 1AXIB 2AV1A 3MLRL 2VLJB 1P4LA 3L4UA 4QR7A 4Y4HD 3IJHB 2DKSA 4IU3B 1AS8A 2VRKA 3MTXA 4W1TA 3BD4A 4FL4C 2NUTA 3HVDA 4PS7A 3GB7A 2PW1B 3D1MC 1KUMA 2Q3AA 2XTJE 4P04A 4K7PX 5GGRY 1FJ1B 1EAPA 5JHBA 4ODVH 5DHDA 1I1FB 3WNIA 4FNLH 4PJFB 2QPSA 3WN5B 3F01A 3MSPA 3VXNA 1WAPA 3DUUA 3HB3C 5IW6B 1QABA 4AVKA 3B9DA 2W5PA 2Y7OA 5DRWA 1XGQB 1AQKL 4M4PA 5IUCA 3PL6B 4ZAKB 1U8QA 3MBWA 2V9TA 1UWXH 3D08A 3I85A 5C6TH 2YSSA 2CJUH 2DIBA 3MLSH 1Z1WA 2EUVA 1ASPA 3K2KA 3VWJB 1YECH 5J6HB 3L95A 5DLMH 2XWJA 4LL9A 5TE6H 4DGVH 4FULA 3CFNA 4JM0A 4J3BA 2F6AA 3CC5A 1NLBH 4UQIM 4IKIA 1NZRA 5L0QB 1IBDA 2IPKA 2X6AA 3N41B 5ICYB 5HY9B 1XH1A 1MCEA 4NHUB 1WFNA 3T3PB 1OWRM 2X6UA 1LJMA 4HETA 2WWMC 4PJ6A 4OLVL 1ZHBA 3ZZLA 3NCJH 1VACB 5IBLC 1P84K 3AREB 4EDXB 4OZIF 2V37A 3C5ZB 5F7NC 5TK4A 4P3DA 3VWKD 1ET5A 1RUPL 1K8DB 4O2CA 3ZO0A 5D1XA 2XN9E 4JMXA 4P5TD 3BZEB 1UT9A 1XCXA 5IR1A 2NW2A 1G7HB 5HYSG 4M3JA 3ZMRA 1AD9B 4PJ7A 3OMAB 2IADB 4LVNB 2GTZB 3X3GL 2DQEL 3KR3L 3QNZB 3IDXH 2XN1A 1TXKA 4MJ5A 1SHXA 1BQSA 3LVTA 3CVDA 1BDYA 3NCYS 1S7WB 1E40A 3LOWA 1TCRA 4OCSH 3CH1B 4RAHA 4JFED 3MROA 1K9TA 3C5JB 4P3CH 2PP7A 3MA7B 4JL1A 1AP2A 5IMKB 1WEJL 2H3NA 3HS0B 2HLAA 5A2CA 2HVBA 2HT4D 4KU1A 4PRBA 3HI1B 3QUXB 4K5LA 5CCJA 1M71B 4YHLL 2C4FT 4YE4H 3VD9A 1ZT1B 4UTAH 2DOCA 3D9AH 1KN2L 4X5RA 4XN1A 5EBWB 5F7UA 4IKJA 2VDRL 3WUWA 1Q9LA 1B0GA 3ZE0F 4KJWC 1JSYA 1C5CL 5I1LB 5JDSB 3V4PL 5PCYA 1ONQA 3FO1B 3Q6FA 3WIFB 2PCPB 5BOJA 3KLHC 4HIHB 1X5XA 5GRUH 3T4AC 5KVDH 1MJ7H 4TM9A 4DQOH 4OGXH 1K85A 3GO1H 3NABH 4XX1G 2WBKA 2QPFA 2VLJD 1JZFA 5CN3A 3LV3B 4OQTL 3JWOH 3IE9A 2BZ7A 3P73B 3KS0J 3E3QC 1X7QB 1ZV9A 2TRYA 3SPVB 3LH9A 4WTWA 4Y1AA 4LMQE 1GYVA 1V7NH 4F9LC 3OB0K 1IMHC 1WV7T 2VMFA 4WAFA 5SWZE 3MRBB 3CN1A 2XVGA 1BZEA 1MI5B 1A7PL 5DK2A 5H37H 3EG9A 1QACA 4A7SA 4BCYA 2FUQA 3PL6D 4ZAKD 5FEBA 1U8KA 3KPSB 4P9HL 4XNQB 5CBEB 1BQLH 4MHHG 1EZVX 4YHZL 1KCRL 5H94B 1H15A 1DDHA 3EDFA 3VWJD 3OB0H 3SDXE 1R3LA 5F7LB 3H85A 2LV4A 4F2FA 3D87B 3EOAA 1HWHB 1W0WA 3K80A 4NKDA 1ZWIA 4F8QA 1R9FA 5FB8A 1F41A 1HHGA 1S9YA 3TEZA 2C8NA 2CHXA 3V4PA 4MNHA 1MFVA 2CHNA 4JPKH 1EPFA 8FABB 4L3EE 3RY6A 1VEPA 1DBBH 3VJ6A 4WDIB 5E5LA 3D50A 4WFEE 5CXPA 1JZ7A 1S9VA 1GOHA 4U0RC 2GY7B 3B5TA 3BVNB 4JZJC 3UZQA 5F2FA 1TSHA 4OQTA 3ARED 3S35X 2JIXB 5D70L 1KCLA 3F7LA 2VL5A 2ED8A 4XXWC 1YQVL 2Z31A 1AI1H 1E5BA 3QWNA 4GKZA 4WW2B 1WJ3A 3MRMB 5KUKA 4PJGB 1JAEA 2ZXAA 4ZS7L 5HJBA 2Y5TA 3LDBB 1JK8A 5C0JA 1E42A 3DK2A 3TWCH 2IDTA 4XZUA 5F7BA 5F72S 3QEQE 4JY5H 3DX8B 3BSGA 4K9EH 2K6ZA 4PJIA 2E6PA 1Z9PA 1NUGA 1WS8A 1JF6A 4GW5A 4FDWA 4LOUD 4Z7UE 4YHPA 5KOMC 3VTAA 1M7XA 3ZT7A 4YLCA 4HJEA 1A6ZA 5KBPA 4LEEA 3EO9L 5AD0A 5T5FH 4JB9H 5IQNA 4IRSA 3OKDA 2ARWA 4C59B 1OANA 4FQ1H 4LVOC 4OZGA 2HPTA 1NCOA 4OVUA 4NZUL 2JKRM 4YHMH 43CAB 5KS9B 4AC4A 2YLHA 4NNPH 2JKIS 2J8UF 4HHWA 4K3EL 4LSDA 2B5IC 3QUXD 4J3UA 2JCWA 1DVFB 5CP3A 1XH3A 3CHOA 4J3TA 4AT6A 4P05A 5I8KH 2J55A 4WV1C 2Z4TA 5LKNA 3RVXD 1CZ8H 2RQ8A 1XCTB 3KWWB 5E8DH 1X9UA 4Y19A 3QDJA 1OW0C 4GSXA 2WWKO 4QNPF 1JPGB 3HJ0A 4PUBH 4RMTA 5KANG 4KI5E 3QFGA 4NX0A 3A0OA 3D3VD 3L2LA 1VADA 4D0CA 4DPAX 3MDJA 3NG5A 1OTSD 4KNSA 1DJSA 5EZOH 3FO0L 2H26A 3JVFC 3BIKA 5DA0B 1OAUH 2Y6SC 5DHXB 5HPMB 3IYLW 2WXPA 4B3VA 4UM9B 4Q2ZB 5FUCE 5GRWA 1C9SA 1A0QL 2EDXA 4DKAA 3QXTA 3GKWH 3H6JA 3CU7A 1TQSA 1SMAA 1H3VA 2IQAB 2YRZA 1WFOA 4N8VA 4NQEA 3ZN6A 1PD1A 4NGHL 5A16A 4YQXH 4JJOA 1T0NA 1XBDA 2QVIA 2PN5A 3NA9H 4M5YH 1A8ZA 5DRXB 3D2UB 4WHCA 2HRPL 3OAWA 2XQYA 1PAZA 3NSCA 3MYJA 2XA8L 3KPSD 2VN3A 5J57B 3IS0X 3PFQA 1A47A 1GC1H 3HAEH 2H6OA 2NXYC 3KGUA 2X5PA 5FM8A 4C56E 4TQPA 5DR5L 5HDBB 3UERA 3MBXL 1GH7A 5D2NE 5D4HA 4U6VL 5EN3A 4NZTL 1X6NA 3N50A 1AJ7H 4DZBA 1FFRA 1M9WA 3BP5B 1T6WA 3VFGH 4EI5B 4P4KC 4Z3JA 5C08A 3NTCH 5D7SH 2ZYHA 4TNEA 2O5YL 2X28A 2RBLA 3CSYA 1P84J 4OGYL 1UGNA 4XWOD 5E1HB 4NP4L 1PNDA 5IK3B 3UTSA 1ACCA 3QXDA 1RMFL 3S8GB 1P5VB 1PLCA 4PHXA 1DBAH 1SOQA 2VN6A 5LAXA 1QI4A 1I3VA 3BPNB 4JFQB 2HKFL 1KYAA 3KPOB 5EPMA 2JIXD 3OAUH 4WNQA 3SDDD 1HC1A 2FBRA 3QNYB 4M5SA 3EDJA 3UAAA 1HQRA 2WTPA 3LQZB 4H8VA 4LAJH 1AGDB 2J8OA 1IC7H 4BZYA 4D0BA 1JDDA 5CGMA 1URIA 1VPOH 4S1RL 5EO9A 1RVFH 1BFSA 1RULH 2R7EA 3SYQA 5EEZA 1Y0LB 2DWDA 5DJ0B 2QFRA 5DO2D 5EBLB 3SGDI 4U1MA 2OSLB 3CTTA 3BP4A 5IOPA 4Y5VC 5EU7C 4FQJL 4U3SA 5FCUL 5C6PB 1RIUH 4ZFFB 5A6LA 3KM2A 3ULUF 2NNAA 5JUEL 3U0WL 1A1MB 2KERA 4NNXB 1PMYA 1KIPB 1UXSA 1HOCA 4FN0A 2V2TB 2D7TL 3BD5A 4LRIC 4Y4HA 2BSEA 2ITDA 3MJGX 1I3GH 1KPRB 2Y23A 3D34A 2UWEE 1FBIH 4G8IB 5DSCB 5IEKA 1DQVA 1CLYL 4XXCA 2NY7L 1EFXA 4JZNA 4MNQB 3RJQB 2QTVA 1QSFB 4BQ6A 1OPGH 1E9PB 1MVUB 1NLDH 4LLUB 5IFAH 4K2UL 3JT0A 2B2XH 3L9RB 3VXME 5CD5C 2DJ4A 2P26A 3K8LA 5CGTA 3GZQA 4ACTA 3LKNB 3SB3A 1KTDA 3FXIC 2JB6B 3I6KA 1OT1A 2SODB 2AJZA 4UZGA 3T65B 4XHQA 4YGVB 2WOBA 4OGZA 2FWOB 4D9RE 5FO8B 3QZBA 3ZUNC 1CGYA 1N2RB 2C9QA 2BNRE 4M7KH 4UM9D 2ZUQC 4ZMQA 4NDMA 3MV8E 4Q0XL 2FX9H 3WJJA 2VQ1B 3BC9A 4BSWA 3L3IB 2VZTA 1DANU 5IROD 1SXCA 2XBZA 3L3OB 5GRYA 1KXQA 2CO6B 4P2OD 1TYEB 4PJBA 3U82B 3OSKA 3DJRA 4OGAD 5BJTA 2N56A 4K5OA 5J8OA 4ELMA 3WXWH 1JGLL 4KHXL 3D2UD 1FG2A 1IT9H 1E8YA 4FCAA 4HEMA 1NPJA 5AG8A 1BVNT 4ZQKA 4EKJA 1NPUA 2XZQL 1SQ2N 1FL3A 4DWHA 2EVFA 2OJZL 1PQZB 4F91B 3ZXAC 3L5XH 5C7XL 2Y7LA 5F3BB 3QDGB 1V3KA 2YKLL 3I02B 3QQDB 3VWKA 5IHUL 5IQOA 1UTDA 3B1UA 3WLWD 1OE1A 4F37F 4JG0H 2E9BA 4I8DA 4JO1H 5DMYA 2G5BA 3GSUA 3LNHA 3RVUD 3BDYH 1CDGA 4X4YA 5PAZA 1DSFL 5JIQA 4IBQA 4PRPB 4H88L 1A7BA 2C9UA 1JWSB 4XN4A 5DQJB 2A9NH 1EBAA 2C3WA 3LIZH 1ZDSA 4GAJL 3SJVB 5AOZA 3UJIL 3QZNA 5HGGS 3NJJA 3VQ2C 1RZIA 2OV0A 4Z7QB 1A1OB 3PS6A 4N2LA 4OV5B 1JNLH 2NTSP 5ANME 4MSWA 4XB8A 4UBDC 1X9QA 1NCJA 2VDQH 5IQ7H 5IV2A 2IVFC 2C9RA 5E2UH 5FKPA 2CE6A 2XT1B 5HGDA 3V10A 1UACH 2AAVA 4Z7WE 1JG9A 1R5VB 4X99B 3J8F7 3MCKA 2B0SL 5HBBA 1F4YH 3I3BA 2GUYA 4U1JA 4DKEL 3US0A 2AK4E 1UA3A 1D5BA 4L0PB 2OYKA 5E9DA 3S3CB 2I85A 4MA8L 1KLUA 4PBVC 4ODBD 1WUNT 2BWDA 3MRFA 1KJ3L 3HVNA 2FX7H 4ZPVB 2MNUA 3HBPA 1CD1B 1IBFA 4UOJA 4CC1A 3TH2T 1I4FA 4I2XE 4W9IC 5C0AB 2DJSA 2E7BA 1TZOA 4HWEH 5HHOB 3TV8A 2HKHL 2WQVA 2W59A 3PWVB 1MCRA 3ZRFC 2O5NA 3VXQB 2XWCA 3ZKNC 4MXWL 3UP6A 1G7IA 1I9JL 3Q8EA 1JGVL 4MNQD 4KRMB 1KBKA 3OHXC 2BRQA 1QSFD 2VLME 2PKDA 2V5TA 4LSUH 1XTLA 1EUUA 5KBMA 1J88A 2K0RA 1IGCL 5IW6A 4A39A 1C5DB 1HHIB 5A43C 2VRAA 3AVEA 5MEOA 5B39B 1F86A 2COQA 3PL6A 4ZAKA 5GSRB 4EXKA 1KGCD 2OXHB 1HU8A 2GEEA 4OFYD 3RI5K 5FECA 4ODHL 4XO5A 2B59B 1ZPLA 5J6HA 2XX0A 3HC4H 4Y9BA 1UURA 4M48L 3V0FA 4XBMA 2XYBA 1DL7L 4X7CC 4XVJH 4PJ9B 3F8UB 3NPZB 4KK8D 3S4SA 3ZMNA 1P4BH 5J6GB 5HY9A 3FTVA 3MRNA 1LMIA 3WS6A 2IGTA 4WU5B 1U8JB 4L3CB 5IMLB 5GHWH 2VSMB 1BWWA 3H3PL 4MXQC 5KVMC 4N9GB 3ZPDA 5MP6L 1KF9B 1YNKL 3HN5A 5AVWB 1QFWM 3PU7A 4A68A 1M4KA 2WC7A 2VQUA 4PJHF 4G1MB 4OSUL 1U92B 3AREA 3GM0A 3HUJA 3NZSA 1WIOA 4WJG3 4TULH 3QA3A 3QDGD 1JTOA 1XF3A 1J87A 1UFGA 3GSRA 1K8DA 1FE8H 3F12A 4NN5C 2MPVA 4CSSA 1TFHA 3CLFH 4PTUB 3MNDA 4HA1A 5K9KA 4AMXA 3QDME 3VM7A 1V3MA 1KELL 1O7SA 4NLAA 1TO5A 3C2SA 4V2CB 4HMCA 5DRNB 3R0NA 1NKOA 1AGCB 1L0PA 4HT1H 4IRJA 1MJJA 5IGXL 4PRPD 4WWPA 3PWUB 1AD9A 2IADA 3RL2B 3QJUB 2GTZA 4X4ME 1CS6A 2CKBL 5D93B 5DZNA 3SJVD 4AMKL 4N2CA 1N0LA 1GR7A 1YPZA 2Z1PA 4R2GB 1ETZB 3DJTA 5DC4B 1H5BC 2DLHA 5T1LA 2EUXA 2WXOA 3PV6A 4S0SD 5HHVL 5DMIL 1HFUA 2DMHA 1WISA 3MC0A 4R4ND 2DYRB 4KXCA 4KJWD 3LKQB 1HTYA 3H3BC 4NUGH 2HJFB 3RWDA 3C2AL 4IMLB 4AQOA 1GCYA 3IPFA 3HS0A 3IDIB 3EXLA 2XRAL 4L8SC 4PRHE 4UM8B 3SN6N 3QUXA 4WSJA 3JVGC 4NCC2 2QKIB 1M71A 1OAQH 1I9RH 2VM4A 1BQHA 1ZT1A 1FFQA 4XNBA 3D39A 4R8WL 3VNYA 4OIIL 3UEZA 5IW3A 4NO5B 5BW7A 3AU0A 1TKWB 1MY5A 1TVBA 3LRSA 4RGMC 1EWHA 4M61B 1RLWA 3TCXA 5AKVA 4U1HB 3GMNB 1G9MC 2H8PB 3BSHA 5JDSA 2EDEA 3SY0B 3TP4A 3FO1A 2ADFL 3SKOB 2YEZB 3QUKA 1OHQA 1KGWA 4HIHA 1FIGL 5E6ZA 5E8EA 3D3VA 5ELIA 4XC3L 5C0AD 4J12A 3ULVH 1NL0L 1UCTA 3O4OC 3V0WH 1YEWA 2V9QA 1NBZB 3LV3A 1B6UA 1H3PH 2GVYA 3H9HA 1TZIA 3UH8A 3L8QA 4FFYH 3P11L 1RFDL 2CKBA 1QFHA 2YXMA 4X9HA 1N5YL 1GGBH 3F7VB 3ZL2A 1G6RL 4YDJB 1YC8A 5D7LB 2FLMA 2IH9A 1DDTA 2XZCL 4YL9A 5T1KA 3IU3A 5I6MA 5DHVB 1BECA 3MRBA 5CEXB 1Y18A 3HNSH 3UP1A 2UZIL 5I30L 1C12A 1NTDA 2AEIT 4MQ7A 1RK7A 5INDA 1JWMA 3ROOA 1ZLUK 2PCFB 3KPSA 3VSTA 2A9ML 3O9WC 3ARGB 4IDLA 4W9EC 5H94A 5I1CH 3JV6B 4YVNA 1EXGA 5C09E 1MW2A 4Y16A 1O6SB 3T3MB 3IN2A 5LNDA 5JYMA 4WENB 2R0ZL 4PJ9D 4YHKH 1QR1A 3FT2B 4X6FB 5LUMA 4NQSB 3LXCA 5IVXB 1MNUL 4EI6B 1YNLL 1ZLUH 1S7VB 2FO4B 4CMMB 2AC0A 3MLUH 2DV6A 4YBLB 3VGHA 1HI6B 35C8H 3H2PA 5IM7A 3AC0A 3NH7H 4Y5XB 3T0BA 4U7KA 2R2BB 4FHJA 4GLRI 4R83A 4XBPB 4B9FA 4ZYKA 4HFWB 2WZ6A 2WIMA 3UTOA 1BSIA 5CLYA 4OZHF 2XXFA 2JIXA 1P0SE 3SDDA 2BCMA 2W0LA 4WU7B 4K7PY 4KQ4L 3SE4A 3PGCB 3VNZA 3CFUA 3ILEA 3UAJD 3LD8B 4GINA 2DQIH 5SWZB 3TN0A 3MLXH 3L9BA 4QRQB 3MRMA 2RCSH 4WEMB 3P4OA 4O2EA 3MXWL 4M6OH 2A9AA 2WQAA 2CWRA 1KCKA 4D2NA 4PH8A 4G7YH 4IBLT 1U41A 2VC2H 2OMVB 5IQMA 4MJ2A 4Q97A 3V95A 5L4IA 3BW9B 4QYAA 4OLZL 1SYVB 1YG9A 3DIDA 5DS2A 3T0XA 5GGVH 3CVIH 5B4MC 4R2GD 3SDXB 4BFOA 4AE1A 4PJCA 5ICXA 2PWDA 4QRSA 3Q8FA 1F00I 5D7JB 1UB5A 2WO3B 4YXKH 3UBXI 2Z92B 3B9VA 4R0LC 4B95C 3ZTNL 5IQLA 3MRDA 4TQEL 1ASQA 5F7AA 4WO4C 3VXSD 5KS9A 4L3EB 1TQWA 4ZFZA 2KHAA 4FEIA 4HCFA 3HMXL 3NEXA 1ZHLB 2CNYA 3I3EA 4HJJL 4FFWC 5BZDA 2FO1A 3NJMA 3GGWB 3SHSA 3FN0L 1JFQH 5HGAB 1YMHA 4QXWA 2ADGB 4MB3A 1TZAA 2CUMA 3ARTA 2XJLA 2RFXB 2YIHA 4QY8A 2W81C 1L3NA 1JPGA 4JM2C 4KPHH 3U36A 4I48B 1OTTC 4Q89A 4DUVA 3VSQA 4U6HB 2D7NA 3AY2A 4X4XA 1IVLA 1BMZA 3GS0A 2PWHA 2FWUA 4UT6A 4XODA 4M29A 3D0AA 4HXAH 1FGNH 3QEQB 1VFBB 1FVDA 3WE6A 4OCYL 3WGVB 1A6UL 4QUOA 1R3IH 2HAZA 3ZDXE 2VJXA 1A6PA 1T03H 3CDCA 2VLLA 4UTCA 5GGSY 2IPTH 1LQBC 5D7LD 4R96A 4P2OA 5DFVC 5AW6B 1L7TH 4ABUA 1U0QA 4UUJB 5DRXA 4MZIA 4P4KD 2GT9B 3O0RH 4XO3A 2F18A 4XWGH 4E9VA 1WZ1H 3MPCA 1FN4B 5EHFA 3S96B 4NJAH 4CAGA 2OL3B 4EOWH 5HGBA 3ARGD 1NANI 3DX9B 3HMXA 1WFTA 1NGXA 4KROC 4HD5A 3WS3A 1JIBA 1A7RL 1FFNB 1JTTA 3MMEA 4FP8H 4KXBA 1EZLA 4K71C 5AW2B 2ATKB 2DKUA 3LMJH 5IHBA 5FV1L 5EEYA 1QBLL 5D7KD 4ZMOA 1DE4B 4I0PB 2EIZB 1AIZA 4WK4B 4JDZB 4K8RL 5JZ7C 3D0VA 3NIGF 1BVKA 5IK3A 1AMXA 1K8IB 4KKQA 1LP9F 5MI0B 4PJXE 1MCPL 1WQVT 1H9VA 4JFQA 5D7HA 3U46B 4F93B 2I24N 4KJPC 4Z7AA 5BS0A 3NIFE 5I0VA 3F65A 3KPOA 4UQBA 3EGDA 1B2YA 2GUOB 3H2WA 4Z7OF 3CDGB 1WBYA 4EUPB 3T8XA 2FHFA 3BEVB 3H42L 2BSCA 2IBZX 1G9EA 4XC1L 4X0KB 1M56B 5SWZD 4QLWA 3KNBB 4KO9A 4MA3B 1LQSR 4ZT1A 3OPZH 5HHXH 3F58H 4M93B 3O6KL 5JIKA 2GIMA 1U8HB 2BVUA 2EDOA 3ALWA 3MNMA 4RRPA 3TEUA 4XNAA 3F6IA 2VXTL 2WZ0A 3J7HA 5FOBA 2BVQB 1EZVY 4FEMA 2AQ1A 2OSLA 1IFRA 4GG8A 4UILL 4H25B 1OZTG 4HH9B 3WI9A 2AJYL 2GG1A 3T6QC 1E8XA 2WQRA 4C56B 3Q06A 3PDGA 1JV2B 3BUBA 4FZEL 4JO4H 3R8QA 1AZVA 1LDSA 5GS0H 4PRAA 1F2XK 1UM6L 5D2NB 3SQBB 3BXNB 5CR1A 5F9DC 4ZFFA 1V05A 4U1KB 1OAYL 1CD8A 1OCWH 2IAMC 3DPDA 3IJ9A 5D7JD 2WM0A 2B16A 1A1MA 3DX2A 4U2YA 5CD5D 3CN0A 1IVTA 2J1WA 4K23L 1T5XB 2V2TA 2WGNB 3GBNH 2WJ7A 5I66B 4ZUVB 3JWDH 3QJFA 4JFZH 5E94A 1HH6B 4S2SB 1HHHA 4I9WD 2PETA 1QYGL 3PWNA 1CBVL 2DQ6A 4ZDHA 4MNQA 1KB9K 4ZD3H 5JQHC 3L5WA 3ESPA 3H7BB 1NCWH 1SXNA 1UT2A 2NSQA 3MCLH 1E9PA 5HHPB 4OUUA 3TTSA 5CD3B 5D1QC 5CFAA 3L9RA 4DERA 3ZDWA 4LGSB 2VE6B 3U6RA 1UKQA 5JQ6H 2EP6A 2JB6A 4TPRH 4JAMB 4PREB 4B9PA 2X4QB 1F6LL 4OFYA 4YGVA 5BZXA 4ACPA 4LCUA 1U2YA 2FWOA 3QEQD 4HOZA 1PKQE 4FQCL 2E7CA 4HMDA 2QQKH 1ZLVH 5KVFL 3FCGA 4RGOL 4BGLA 1R75A 3OC5A 1CG9A 2VQ1A 1VDGA 4YC2C 4IS6B 2CBPA 3L3OA 1U8PA 5GIRA 4OAWB 4DW2H 1BG9A 2J4WL 2P48B 2JI1A 4QHKJ 1LHZA 5JIHA 4B9GA 2PYEE 3E38A 3M86A 1N68A 3QPQC 3CFQA 3GMQB 2JK5B 4BK4A 2J8HA 2NY1B 2UWEB 1PQZA 4YBQC 1JZGA 2W0PA 2DDQL 2VM3A 2WQXA 3RU8L 1IAKA 3EO0B 2K78A 1J48A 1GSMA 4LCVA 1JRHI 4FXGB 1FVCB 5E00B 3VXMB 4H26B 3CXDH 4KI5D 1YNTF 3AQZA 1EHAA 2HVKB 3WJLC 4PRPA 1YUHA 4JDVA 4I0PD 5DUBB 1ODAA 1QI3A 4XRCA 1Y1UA 1JERA 4OCWH 3SJVA 3K4ZA 2CHDA 4GMSH 3VQLA 4TVSa 5FUZL 2EYSB 3F7PC 4UB0L 4XBEH 2WLLB 4YE0A 2BNRB 4OV5A 3PY9A 4RGMB 4A7VA 2FGWL 4N1CA 2OBGA 4G71B 5EOQL 3WNOA 1KPUA 3HNVH 4MA7H 1TQVA 3HC3L 4I18B 3L1FA 4ZUTA 1HJBC 4KUCD 3SDAC 3KZ8A 1XGRA 4PRIA 1F3JB 1LO2L 4MMYA 1OO2A 1RJCA 2EIBA 2KZWA 3ABZA 1BAFL 2BHUA 3DHUA 5BQ7A 3EDDA 3C09B 4GQZA 4OUOA 1G7PB 1KEGH 2YOAA 2ICWJ 1OK0A 4FQXB 5LBGA 5TQ0L 5C7ZA 3OJMB 1CD0A 1O0VA 1U8MB 5JW4N 2FWLB 2D31B 1A1NB 5GZOC 5AVRB 1BIIA 2PF6A 2AEOA 3KVDD 1CLOL 3C60B 4F9LA 4JHUA 1NQBA 1WD8A 4P23B 2F7PA 4LKXB 5D2LE 4HWZB 1F4AA 4LO9A 4MB5A 5FO2A 3L3KB 3GM8A 2APFA 3MYZA 3INOA 1GMEA 4HCGA 1AKJA 3VXQA 1BF5A 1V7ML 2X2JA 3ARDB 4CBPA 3BJLA 3O9WB 3LH2H 1TJHH 1J0KA 3BQUC 3QAZB 2V2XB 2AFNA 2BSTA 4AQZA 5ANMB 3B9KC 2XWRA 4UQAA 4W4OC 3QWRD 1SXSA 1JPST 5DHEA 4L2LA 1FA4A 2OZ4L 5LGJA 4DQAA 1OM9A 5A7EA 4Z7WB 2O6EA 5L88H 1HHIA 1Y6NR 2DLEA 4N85A 4NEHB 3TPUB 5B39A 4YVUA 4CC4C 2NY3B 2FO8A 3HBGA 3WG7B 2OXHA 2AK4B 1FNGA 3FO9B 1JF1B 2AI0L 3FW6A 4F3FA 4F80A 2AF2A 5TF1L 2FT7A 1B0RB 3IN0A 4JZJA 1I1AB 4JKLA 2R4SH 2WV3A 3OKMB 1JGEB 2X1XR 1NDGA 3U83A 2OKMA 4JO8A 4BFEA 4XXWA 4GBXB 2A7BA 4L05A 4BXSV 3HC2A 3KW8A 4I2XB 4Y2DC 1U8JA 5DJAB 4B41A 4JREB 2Q86A 5AW0B 4N9GA 3S36L 1ZK5A 5MERB 2ODHA 2ZXWB 4LBEB 5AZEH 3ZDYE 2YPVL 1RLBA 4F8TA 2X4PB 3A22A 2NY1D 5CAYB 3K5SA 1AC0A 2TSBA 1ORQA 4MAUH 1PYWB 1T21B 5J7CC 5JNYB 3DVGA 1QR4A 5C70A 1YA5A 1YY8B 5DHVH 4H8UA 1F42A 2GJ6E 2Z35B 2YK1H 3IXTB 1HQ4A 2VR8A 3L08A 4M6NL 3VI3F 2VJ0A 4KZEL 2MHAA 1ZHKB 3VXMD 1TJGL 5E7FA 1H3GA 3B2XA 2MKLC 1AGCA 3KAAA 5IJBC 3PWUA 4W70A 2HN7A 4YSUA 3RL2A 4NPYB 2YRLA 4XCEB 4M02A 4N0UE 4NQCB 3WSQL 3GMRB 1DJWA 3B83A 1MKFA 2DIEA 2F58H 1K2DA 4WV1A 4XP5H 2XQ0A 4MNGE 2BNRD 3WUWG 3GI9L 3EBAA 5CBAA 5KBNC 4HUUA 1NWPA 3V0VB 1YYMH 1HAWA 1FZMA 5IVZB 2ZX8A 3LKQA 5GGRA 5CJOH 2NR6D 3ZR5A 4QXTA 4LRNH 2HJFA 2QFPA 3VXSA 3ABKB 4WHTB 4IMLA 4XMKH 4BFBD 3E9UA 4HJTA 3FQXA 1T1ZB 5AAPA 2E56A 5T3XE 4HSAC 1BLNA 4ZXBC 2JKXA 3NCWA 4H20H 4Y7OC 4KVCL 3LHAA 1MH5A 4IHOB 2DW5A 3G5ZA 3N91A 3VXTB 3QE5A 2WWNA 4NO5A 4RGNC 2YPVA 1TKWA 4LARH 4M61A 3JTSB 2VZVA 5TFSL 4FGMA 2H8PA 3RILA 3BD3A 3SY0A 3TO4B 1IGMH 5GJSL 3MUJA 4YSRA 4N0YL 4EBQL 2YEZA 1XFPA 3C60D 4WFGE 5J89A 1B90A 1BP3B 2QQQA 3VU1A 1GJWA 3KBEA 2YN5A 1UYWL 4P23D 4Y89A 3KE0A 5BVPL 4M7ZC 1KB9J 3B3IA 1NBZA 4XH2A 3SKJH 4WWKB 1R34A 3HG1A 4EDWL 4JDEB 3IS1X 3AG2B 3ARDD 1RCYA 4APQB 5EEVA 3NJFA 2Z64C 4OF8A 3O9WD 1U95B 4EO5A 4GFXA 3OF6D 3MLRH 3EYQD 3F7VA 2ZT9C 3C6SB 2JLLA 4P5MA 2NXZC 4L1BA 4XN7A 5ACMA 2JJVA 3KHQA 5D7LA 2BVPB 5CSGA 1ZOXA 1XF4A 2Z8VC 1ETJA 4PY8J 3CHXA 3ATFA 4ODWB 4L8CA 5AVSB 2VDMB 4G7SB 3K6SA 4P4KA 5CEXA 1VFAA 5FDWB 1CE6B 3TBSB 4BFKA 1SDDB 1Q8MA 4XAWL 2NY3D 5FGRA 2PCFA 3IMVA 4TUJA 3BH8A 1F90H 5I0YA 2AK4D 1NCDL 3JV6A 1IAMA 5CWSB 1AQKH 1WVZA 2ZOKB 2FT6A 2P5EA 1CICC 1I1AD 2I07B 1DJZA 4QMEA 1QRNE 4J8RB 4RX4D 3OM3B 4Z0XB 1T0MA 3MLVL 4ALAH 1VEMA 4GBXD 4NQSA 5IVXA 1OAKL 3S8FB 2A4ZA 3V2AR 1SEQL 4LXFA 4L4VE 4MAZA 3LVEA 2XWBA 5I1JL 4XI5C 5EU5A 3S37L 4HZLA 1NUNB 1AANA 4JFXB 5JXED 1N19A 1THAA 1S7SA 5ESAA 1KACB 5DZAA 4ZBJA 3DSFH 3NMEA 2PTUA 3NCBB 4OLVH 4DK6A 1ZT4A 4WU7A 1XGYL 3G04A 4Y5VA 5IJDC 5GRJL 2XKNA 2BFVH 5KTEL 3LAFA 3LNEA 2VLMD 1PLGL 3DV6A 3OGOE 3FH7A 4WUKL 2P8LB 4C83A 2R23B 1GKEA 4JY4B 5LQBL 3LEXB 1XR9A 1AXSB 2ZOTA 1RUPH 2IMNA 4L4JA 2O30A 3F05A 3QZPA 4WO4D 1L6ZA 4JFTA 1RIHH 4LRIA 4Y4FC 1IEAB 3E6HA 3TZVC 3QBTB 4NSKA 2A6IA 4NQCD 1ZGLB 4XCNA 2A77L 3NBNA 1CI5A 2OTWA 4LE8A 3T3PF 5I1AB 2DIAA 1D5ZA 5BNXD 5KYUB 3X3GH 2CPCA 1HINL 3LX9A 1ROWA 2DQEH 3KR3H 2ZP8A 1HL4A 3D85A 1VGEH 3GIVA 3ZKXC 2WN2A 3CBRA 3DRTB 3BKJL 3RY4A 1J9SA 1BVLB 3FSVA 2UZYB 4P2CG 2F08A 5C0IB 5I24A 3EFFA 4LCYB 3T04D 5EZLB 3TEYA 1SXBA 2CHWA 3CLEL 1QBML 4GXFA 5DEFA 1QA9A 3TYFB 3STZB 4EE2A 3RGBA 3EHBB 1P7HL 1KC5L 1N59A 1WGOA 3NVQA 5HGAA 2DQUL 2DWXA 4G6JL 1TJIL 4KRPB 3UBXA 3LN4A 5EC2A 4AIEA 1D6EB 2RFXA 2G5RA 5TH2B 4RFEA 4N8VG 4GO9A 4EIBA 3SO3B 3PAZA 4I48A 3TO4D 3T77B 3RFZC 1BPLB 3EFOB 3UBHA 3KDMB 3FU7A 2VDRH 4BH8B 4DJMA 4OZFA 1IFGA 2YD4A 2BVYA 4G8FB 1G5AA 3U48A 1C5CH 3V4PH 4ZMYA 2EAEA 2XQYG 3L9YA 2QVTA 3EIFA 1JZEA 3DYOA 3MRKB 3UTTE 4Z3IA 5I1IL 1I8KB 4JO3L 4GOSA 3W5MA 3Q01A 4WWKD 1VZHA 4APQD 5DHMC 2V3FA 4C57C 1LEIB 3MV11 5ESQB 1PJ9A 1NM9A 2V7NA 4NERA 4FERA 4KWUA 5I74C 4KROD 2IQ9L 4GXUM 1NFKA 4KTDL 3MOAH 4EMZA 3EH3B 4DKFL 2ZNXA 3CNKA 1MFUA 4YUEL 2MQCA 3KCPA 2F9BT 2GT9A 4MQXC 3G6AA 1FN4A 2CQVA 4H1LB 1LDPL 5JZ7D 2F54E 2HP4A 2OL3A 2VH5L 5GGUA 3QQNA 1HDMA 4LLMA 4APXB 5F9WB 1I8IA 3WELA 4OZIE 4KJPD 1X7SA 2WXJA 4P9HH 1WFMA 4YHZH 3RI5F 1KCRH 3RWEB 2NX5A 3UC2A 1CFQB 4L2YA 5GRZA 2AJ3B 1IJNA 2AQRA 3CMOL 4FFVC 3DXAB 3QUYB 3Q5YA 4DGIL 4I0PA 2YPLD 4NO0A 3TFKD 2W07A 4XHJD 3VYPA 3DURB 3GHBL 3DMMC 3T4YA 3WMSA 4L8BB 1KIRA 3U46A 3EYVB 3G6JE 3ZDXB 5CP3H 1S9KC 4KUZL 1F1GA 4GQQA 2UUDK 3CDGA 2R2HA 1KPVB 4I0KA 2QSCH 3DO4A 4EUPA 5L6YL 4CJ0A 1MCBA 3E8VA 5J1AA 3VYOA 4FTVE 4JPIB 4X0KA 1BX2B 2EQDA 1WAEA 3KNBA 4XNUL 5FHAL 3RWGB 5D70H 3KMDA 3S3DB 2JKJA 1DQIA 3IJYB 1U8HA 1PIGA 1YQVH 4AIOA 2OFQA 3IF1B 5DGQA 3GWJA 3HTLX 2UUDH 2BVQA 2VL4A 4ZS7H 4MDIB 3T08A 4LPUA 4OFDA 2AXJA 4YPGB 5FAAA 4AM0B 4HUVB 3WNLA 3ZE0E 2O61A 1MHCB 3SQBA 4KX7A 2D4DA 2W95A 2E76C 2J1XA 3RIFK 1TQCB 4NT6B 3ZGHA 3P3YA 3RUGE 5GGSB 1P4IH 4DP5X 3U9UA 3T6ZA 2D2CC 3QI9C 4PFEA 3EO9H 2HFGL 4PJEB 3Q3GB 2BSSA 2IV9A 3REWA 1NFDB 4WW2F 1LO3L 3KW7A 2QTEA 3R06B 3EHBD 4NZUH 4WHYG 3SD5A 3NIFB 3ALPA 1YN7B 2IG2L 4PWIA 4AEEA 1S3KL 2QVKA 4KRPD 4K3EH 3QWRA 4QAMB 5CUSL 1SUJA 5K1VA 1PZDA 2W0KA 3FCSB 1JN6B 1S9XB 4AIXA 2CXGA 4WJ5A 3IETA 3ZHKA 5CD3A 1WP6A 3EJYD 3OJ2C 1OL0A 3NFPB 2B1OA 5DQ9B 3ZBMA 1TJMA 2VE6A 4O9HL 1B9ZA 4JRYE 4MS8C 1JV5B 3B7YA 2WYZA 2HG5B 4PREA 2X4QA 4X80L 5CF3A 2E46A 2IPUG 4HKXB 1JRHL 3F7RA 4XCCH 1AZNA 2CR6A 4B27A 3QPQD 3BVTA 5E8NA 2E74C 1IGFL 5FLUA 3TNMB 1G9ML 2G2RB 1JVLA 2WY3B 1I7TA 4Z78A 3FO0H 5ALBL 2HJLB 3N85L 4IS6A 4X6CA 1PZAA 5DI8B 4B9JA 3AU1B 3O2DH 4B97A 2IC2A 1A0QH 1QHPA 4ZK8A 2X70B 1RHHB 4PGJA 3P2TA 5D4QA 8CGTA 1QSZA 4JFYB 2XNAA 1U6AH 1CR9L 3GMQA 3BHBB 4UYPA 5JPNB 4UNUA 4AMWA 1NPNA 4IJTA 2Y25A 5ACZB 1Z9OA 5B1CA 3D09A 3HZKB 4N2KA 1I9IL 2HRPH 3VFUB 6PCYA 1IFHL 2YPKB 2YN3A 1XD1A 5CGYD 2VSCA 1BZOA 3GSVB 2XA8H 5FFOA 4OBRA 2AERT 1FVCA 1PNCA 2GFBA 1BFOB 2FE0A 3OB8A 1Z5HA 4H26A 5DD1L 3V5HB 3SD2A 3VVWA 3VXMA 5M95B 5DS8B 5DR5H 2HVKA 3DXAD 3QUYD 4PWFA 5GGTL 4CU8A 3QO0B 4U6VH 1RSYA 1H3UA 4NZTH 4FMKA 4L0ZA 2V7HA 5B3SB 3ILQC 4L8SA 1NCAL 4TLUA 3QEGL 3JVGA 4PG9A 2O5YH 1PKQB 2CGYA 2FNWA 3BMWA 3GEFA 4OGYH 4NP4H 5MEQA 3BWZA 5AENA 2EEDA 2NNFA 2CRYA 5B8CB 3AXIA 2NR6A 3N0PB 2HKFH 4WI8A 2LU5A 1OCCB 3R19A 3VFRB 1KYUA 3GSQB 4KV5F 3DA0A 2G2PA 2PABA 2OCCB 3H53A 4MAYC 1OGTA 2YKKA 4NC1C 5HDBF 1A25A 2WKOF 1F3JA 2PYEB 5F1NB 1L9OA 4CW1B 1F3RB 1NBYB 4AV5A 3SO5A 5I2IA 1X9LA 1GIGL 4MLSA 2KS0A 3S88L 4HIIB 4POZD 5JHMA 4N8UA 1ZIAA 3FUIA 1FYTB 5FA3B 4XVTL 1HXYB 1M1SA 1OOWA 4JRFA 2W0FB 4QNPE 3CQQA 3ZYJA 3K71B 1NCHA 3QEUB 3UYRL 4YJZL 3FB5A 3G5VB 2EZ0C 4P23A 5DVMA 2Q7YA 1PKOA 4HWZA 3NIDE 4FQJH 5FCUH 1SY6A 1PPIA 5EDSA 1WIUA 1XZ0B 1D5MB 5I1DA 1M2VA 4ZTEA 3B7SA 2W92A 2KI6A 5LJYH 2FQDA 5JUEH 3DKHA 3U0WH 4S1QL 1O7DC 3O9WA 3VG0L 1UXLA 3OF6A 1AIFB 4U6XB 2NLJA 3FHQA 3WDHA 4KJQC 3COOA 5LDSA 2EVJA 5IUSA 3CFBA 2Z7YA 3NRFA 4FG6C 3B2MA 5E1IA 5JR1L 1CLYH 3OKNB 1Z5LB 2IDCA 2JJUA 2BOBB 2IBZY 3PHSA 4X9BA 4JFDB 3BLPX 4L1TA 3V52L 4K2UH 4NAMA 1L6XA 5D7IB 1IM3A 1HVXA 1BXAA 1HAUA 3UPAA 2YD1A 1KFAL 1T1XA 3OG6B 5HDQL 4K5MA 3G5XB 4GT7A 4LOEA 3DYMA 2CDEA 2JKWA 1GS6X 4JZOA 1RZKH 3NQKA 4OZ4B 1JGEA 3CJJA 2TSAA 1YRKA 3NEOA 5F8RC 3ZRCC 3ARSA 5I5JA 3H2QA 4DZ8B 4W9CC 1SVZA 5DJAA 5F6IC 2AXFB 4Q0XH 3RFRA 3PNRB 4XAKD 5H2BB 2WXHA 2BP8A 1KTKE 3H7LA 2X4PA 5F3FA 3V5DB 1JGLH 2J1YA 4KHXH 3VD3A 1T4KB 5CZXD 4F57L 1PZUB 4XTRC 1PYWA 3GFUA 1SXZA 4JRXE 4XPTL 5AVXB 3TO2A 2XZQH 1JCKA 1TEFA 2VDMH 4DCQA 1U93B 2GITA 2OJZH 2Z35A 1PEWA 4O02B 2GBAA 3RNKA 3TBYA 1ZHKA 1CFTA 3OQRA 4HHAA 4R0LA 3BZ4B 3WYRA 1BJ8A 1QSEB 2F2HA 1BOYA 4WO4A 2O6FA 2GSGB 4NPYA 2XG5B 3BZFA 5DF0A 1IC4H 4NQCA 3IJSB 1BQHG 3PABA 2WINA 1DSFH 4IKKA 2DS4A 1FNEB 3KD4A 2HT2C 3VO0A 1I8MB 4H88H 1TT6A 3KYOB 2A2QT 2MH4A 1IBZA 1FSKB 4GAJH 4HS6B 4ZO9A 3UJIH 3EJUA 4UTBL 2X42A 5IVZA 4JM2A 3RFZB 4JVUA 3IU4H 4LBAA 3ULUE 4S1SL 1NBQA 4DH2A 1DFBL 5LGYA 3BGMB 4IMKC 4RRPM 3RX5A 2PYED 3QG6B 3ZDYB 1I53A 2VJ8A 4Z7VB 3DVIA 4WWID 3NJNA 5FK9B 1AOHA 4E36A 2DF3A 4Q6IC 2YAPA 3AS3A 4XPHL 3SGJC 5D7EA 3VH8A 4DSYA 3UX9B 3BPOB 2B0SH 4XCFL 2MOVA 3QCVL 4WI9A 4Y2OB 2BP0A 3N04A 4DKEH 1FYTD 1W72L 2HLEB 3N5AA 4JFFA 4NS0A 5AZUA 4FF9A 5CKAA 4LU5L 1S7QA 3GHPA 4YDMA 2H0PA 1U58A 1UXMA 3D06A 1FAIL 1ULVA 1KJ3H 5AFAA 2JKNA 1GTNA 2FTAA 3EADA 4KAQL 4MHHI 1RI8A 2WMPA 5TE4L 1XD0A 3LQMA 2VAAB 2OJ1A 1FO0B 4N0UB 1CT8A 4PIBA 2HVJB 5F9OL 3X1NA 3Q5TA 4WQOA 4MJ4A 5FPIA 2HKHH 1UH3A 2KPWA 1F8TL 4MNGB 1PU0A 2D7OA 4HIQA 1J9QA 1RUQL 3IPBA 5B7MA 3GLZA 1T66C 4L23A 2X89D 4FYSA 1N12A 4ODWA 4MXWH 3CZEA 1I9JH 4G6AC 3H6AA 5EN2A 5FDWA 4Q74A 3TBSA 3NZ8A 4JFDD 5FFLA 4GSUA 1PW3A 5K9QG 4UMGA 2C3VA 4D7BA 5B38A 1AR1C 4KKZA 3WTUA 5C0EB 4XI5D 1MF2L 1IGCH 4FXLA 5EOTA 5GSVA 4LPXA 5DD5L 3CLWA 2GKIA 2OLDA 5E95B 5I73B 2EDNA 4ANUA 4MD5B 3V6FA 4ADIA 3IMTA 2I07A 4L1SA 1OSYA 3N1GC 1E6JL 3MV9E 4H44C 4UDUB 3IJEA 1W72A 4M48H 2YPLA 4QHNB 4Z3HA 1DL7H 5JW5A 3HLAB 1BZQK 2NQDA 2FB4L 2UXFA 3L3GA 4MMXC 4DESA 4N22A 4Y4FD 4X0NA 3TZVD 1ET7A 5EU4B 5MP6H 1JL8A 1FF5A 4DO5A 1M6OA 3ARYA 4LL4A 2O26U 5LCVL 3N6YA 4OSUH 3V6OE 4AJYV 3VA6A 1MCJA 4I87A 5T3ZE 2P8LA 2YUZA 4Y4KC 4DEPB 4JY4A 2JCCA 3ARUA 2IAMA 4AC2A 3U7WL 5C0ND 3JXAA 5H8DA 1QSED 5DJCA 4GRWE 4YHYB 1RUML 3S3SA 1KELH 4HSCX 5C0RL 3CN3A 3QARA 3KG5A 4DAGL 2OI9C 2KT6A 1NSNL 5I71C 1B4JL 5IGXH 2QV4A 4FQLL 3M88A 2AGJH 4U1SA 4DUWA 2X4RB 2CKBH 2O72A 4Y5YC 2MFNA 1HXKA 2IH1B 4AMKH 4OLXL 1QRNB 1EZUA 2ICCA 3PHOB 4DTGL 3MJ8B 5D1QA 3VXOB 4YOKA 5C0IA 4J3OH 2ZWNA 3FTGB 5HHVH 2JXMB 1R4XA 4L4VB 4OJCA 5DMIH 4F33B 3US1A 4GUPA 4YSTA 1KMGA 1UM4L 4YHIA 3L6FA 2FQGA 3QQ4B 3WNJA 4DPBX 4BQCA 1CURA 3C2AH 3U4EB 5E6SB 3ABGA 4HUNB 2XRAH 3WKYA 3VDCA 1E27A 1XF5B 3FL7A 3PAVA 1WE5A 4PSRA 3VFPB 4AKQA 5D6CB 5CZVL 5C0BB 1R17A 2B20A 1IBGL 5EU6E 1USZA 3T77A 4OIIH 3EFOA 3KDMA 4OJEH 4BH8A 2FEEI 3FPXA 5B1JC 3CUPA 5LCVA 1IEBB 4G8FA 4KKLD 3BAEL 3JWNG 3LKSB 2ADFH 3MRKA 3P9MA 4ZTPL 5K9JL 5E6YA 5G4MA 3KPNB 4MQXD 3S34L 2BXYA 5I76B 2M1KA 1MFDH 1V54B 4XC3H 4YDNA 3WDIA 1NL0H 3CHSA 5TGBA 5ESQA 4AIZA 2V5YA 1HYSD 1EAOA 1YDPB 1SOKA 1GZQB 3L5JA 1G0XA 3F6LA 1N70A 4AYFB 1YJDL 2ZIDA 2AEPL 1NCTA 2IFFL 3L9EA 1TQBB 5J3HC 2ZWSA 3P11H 4NQDE 3WIAA 1RFDH 5LNGA 4GRLC 2ATPA 1N5YH 4RNRB 5FYJE 5LHDA 1G6RH 4PS4L 3IJ7A 3F62A 2E4FA 4LLYB 1P7QB 1T80A 2XZCH 3WJLA 2JMRA 5IT2L 1XIWB 5T3XD 1YAZA 4G1EB 1E9OA 1DUYB 2V5MA 2VSDA 2UZIH 3APFA 4CNIB 3DX6B 1F6AB 5KSAB 1UVQA 4M1CD 1UJ3C 4YWGL 2A9MH 2Q8BL 1KXTB 3U2IA 1TTBA 3CCHB 1BMWA 3RWEA 3IEAA 4URKA 1CFQA 4P5SA 3RVWD 3TCTA 3PPSA 2BINA 3UAFA 2ICES 4S11A 4LEBA 2Z65C 3DXAA 4B50A 2JJTC 2XFXA 3QWQB 2BDNH 4JQVC 5SWSA 2GC4C 3ASOB 4CN4A 1WO2A 5DJ8A 4UIKL 1JXDA 3SDAA 2R0ZH 3UTTB 1X4YA 4RRPG 3DURA 1A4KA 3N40P 4L8BA 1ADQH 5AZ2L 1MNUH 1YNLH 2F15A 1EHKB 4QRTB 3QFJE 3AY4C 1K4CA 3H9SA 4HS8L 4AY0A 3RPKA 1Q4NX 4G9FE 5E08L 5DMGD 4QOKB 3BUIA 2GPZA 3DVNA 5GZOA 2BHZA 4UZSA 1A4BA 2YAEA 4JPIA 5DJXA 1ITBB 2XHNA 2X2UA 4KQ4H 3ATAA 1JTPA 1RUKL 2A74B 2MQ3A 2V4LA 3IF1A 3EUUA 4L9DA 4KK6C 2F54B 1C16B 4N5EC 3VRLF 2VR9A 2X6MA 1T1WA 4YPGA 4CN6A 1TZ8A 4OZIB 3BQUA 1MHCA 4NCC1 3QR0A 5KJ7E 4OLZH 4RISH 1OGPA 2ZYIA 3B9KA 2ZKHL 1YN6B 1QRND 1E4WL 1W2KT 2ZX5A 5GGSA 2CDGA 4B9YA 2WXLA 3CDFA 4F7PA 1YUKB 2V3EA 4JEGB 4L4VD 5A2LH 5LB1A 4HF5L 3VRIA 1IUZA 1J1PL 4CC4A 4GQPH 4PJEA 3MUGA 3O3UN 4PV8A 3N06B 2QGEA 1NFDA 3P4MB 3ZTNH 3DGCR 4TQEH 4QWWD 2H5UA 3VDBA 5GS2H 4F58H 4PRNA 3G6JB 2AV7B 1YN7A 3DYPA 3O0LA 5F7WC 3HMXH 4DK5A 2V2WA 2ZF8A 4HJJH 1JN6A 1S9XA 4HC1L 3RGVC 5C0BD 3EXJA 4LK4A 3FN0H 3ZKQD 2A6KB 3GXMA 3KPLB 1KIQB 1P6FA 3D0LB 4Y2DA 5EV7A 2DQGL 1JV5A 1SGKA 3SDXF 4IOIB 4ADGA 2HG5A 3IE4A 1JZ8A 2YGNA 1M7IB 5DJ6B 2LU7A 3NRQA 3PGDB 1D9KB 2WHVA 12E8L 2B14A 3BWUF 2P9RA 3WO4C 7TAAA 4JN1L 1ZIBA 3AJ7A 3TNMA 2E8YA 1QKZH 2G2RA 1OAJA 1AHWB 1N18A 2WLYA 3HHMA 3FU6A 3ZE0B 5T1MA 5E4EB 3EGSB 5F88A 3SYOA 3X12B 4Z23A 1JZJA 3JUYA 1ZANL 1VB9A 1MAKA 4PJ7F 1RHHA 3TT1L 2KZBA 2WSKA 4KJYB 3BRFA 4QRRE 3ARBC 1ZD6A 1XIWD 3B8YA 3BHBA 4DVRL 1R19A 1IRAY 1DJYA 4HZ1A 3ILQD 3LB6C 2ODIA 3HZKA 1EJ6A 2BERA 4NM4L 2Y1VA 3JZ7A 4HOMA 3BWAA 2AXGA 4OZHE 5KSAD 3F83A 3GSVA 5DD6B 5CJ8A 3HRZC 5AVQB 2A83B 2DN7A 1GOGA 4P99A 2QGCA 1FGVH 4P48A 1JGIA 3H1ZA 5JA8B 3V5HA 4XNYL 5EO1B 1A3QA 4HC1A 4JRYB 5DS8A 3QB7C 4G6FB 4M8QB 1A7RH 1QFPA 3QO0A 4Z7UF 4DN3L 3FC8A 3SGDH 5EOCL 2KZ1B 3P40A 3UTTD 4ZXBA 1QBLH 4MKMA 2DICA 5G5DA 5BV7C 1XMEB 4FNQA 3UAEA 1ZJAA 4ICXA 2X4SB 4QRUB 4K8RH 1JNJA 2DL9A 4XMZA 1K4DA 4LCCB 4Q6IB 1QHQA 4QXVA 3VGDA 2YZ8A 3BKML 1JUFA 3FQNA 3OKEA 3QIBB 2ZUXA 4XB3A 5L8LB 1C08A 5F96L 1CMOA 2IFGA 1MCPH 4QOKD 1PEZA 1HL9A 5EA0L 3X3FL 3DTXB 2VZUA 3DC0A 2IWGA 4MX7A 5AVTB 2BOCB 1JWUB 2XETA 3QQ3A 2XN0A 4HKBA 4UNTA 4G7VH 2JQAA 2R1XA 5F1NA 1CXHA 3H42H 1NBYA 3KYMB 4QHMA 3DV4B 4XC1H 5F97E 2F54D 4HIIA 3QZWA 3V9EA 4JMNA 4N8CL 1T89C 4OFVA 3O6KH 2JJSC 5E9AA 3AB0C 3MBEB 1A64A 1FYTA 2N0MA 3PQYE 4LDOB 5E70A 3L3HA 2CO7A 2VXTH 1OSZB 4UOZA 3VRJB 3KWXA 4AEHL 1DSYA 1RZJL 4M6ML 4UILH 3KLSA 2PR4L 2W80C 3QEUA 1AGBB 2AJYH 3VU2A 4UQ3A 1SJHB 3G5VA 4FG6D 1NCCL 1XO8A 1TETL 4LSTH 2K8QA 4P2YA 5B39G 2J2ZB 3KPMB 1UM6H 4CSPA 9CGTA 1XZ0A 3LKOB 1D5MA 3ROLB 3K2UL 4N2FA 4NZJA 3FU8A 5E03A 1OAYH 4J5VA 3ABLB 2K4WA 1I7ZA 5F7DB 3DJ9A 1YEIL 3IDMA 4Y2LA 5C97A 1SM3L 4MMZC 1D7DA 4IIQB 1Q0XL 2Z7ZA 1TNMA 4N6RA 4K23H 5C07E 2X1QA 3CSGA 3GLDA 3V5KB 4JY6A 5J11C 1F0LA 2X4NB 2YHGA 4J3SA 1GRWA 1OEZW 3FTXA 4LVEA 2X89A 4IGBC 1JHTA 4N90D 3VFSA 4AYGA 2UXGA 1CICA 2KLSA 1A6VL 1QYGH 1CBVH 2Y7SA 1FRGL 3IRPX 1Z5LA 3OKNA 3QXWA 2BOBA 4HIXH 4I3RH 4N5UA 4JFDA 2VN7A 1DZ0A 4JLRB 4CKVX 4TOYL 1SOXA 3GSOB 2AANA 2GI7A 4NI3A 2DM2A 5D7IA 3ARFB 1QLRB 4FFZL 1CIUA 4QRAA 4OLWL 3SDCC 3W0WA 1D9KD 2AS5M 3MFFB 3IDJB 2CBOA 4UDTA 5FW8A 3GF8A 4H8QA 3VQMA 1CXIA 4J7RA 3DK0A 1MHEB 1T83C 3I6LD 2E6JA 5BO0D 5F1OB 3OZLA 2NMSA 2Q20A 4R3SA 3ZIMA 1ZHNA 3P1VA 1QLEL 3K72A 4FQCH 5CZKA 4LCWE 5HJ3B 2XWDA 3RDTC 4MZ3A 5KVFH 2C1OA 4XN8A 2DWTA 2AXFA 2R0LL 2DLFL 2BNUB 4RGOH 4X8GA 4WO0A 2CIIB 3WEXB 5KAQG 1S46A 3E2HC 1NM4A 2FSEB 4OFIA 4PJIF 5KYWA 3NIGE 1EO8L 1T04A 3MZTA 1MAML 1NDMA 1U9KA 3N3EA 1ZVSB 3QUHA 1LP9E 1NEUA 4ZMTA 4Y4FA 3V5DA 3TZVA 2NTFA 1D6VL 3IBOA 2FL5B 1Z3GL 3TOPA 1UZ8A 4AW4A 1YEFL 1ESOA 5CMAB 3NJGA 2R59A 3IRCA 4Z3TA 1ICTA 1OGAE 1U93A 4OZGF 1JK9A 4O02A 3D4ZA 3FT3B 4N6QA 1DBML 1A9EA 3H9ZA 2DDQH 5E2WH 5A2IH 2HRGA 3K6FA 3RU8H 5T3XH 2ORBL 4JRYD 2C7FA 2DQHL 1QSEA 5H35B 7PCYA 4G6FD 4OCRL 3FQWB 2H7WA 3VI4A 3HPLB 4GP4B 3IJSA 3QUZB 1IBHA 2UXVA 4E9SA 2R69L 4FFZA 4OFKA 2QVMA 3RBGA 1I8MA 1NAMB 1G9NC 4Z76B 1BVNP 2CUHA 1TQUA 2PW2B 3WKML 1FH2A 3IMWA 1VHPA 5FUZH 3LZFL 4UB0H 1QUNA 4ZFGL 4XMLL 3RFZA 2WZAA 4KRLB 4ZUWB 5JHAA 2BRRL 5BZZA 3RIAF 4NKMB 3GRGA 2FGWH 1AGEB 2PPEA