5I6OA

Crystal structure of copper nitrite reductase at 100k after 20.70 mgy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 92
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6oA02
1TEGA 1AR1B 5PCYA 1KDJA 1E65A 1AG6A 4FA7B 3U25A 1JZEA 1X9UA 2DY2A 3CVDA 3MX0B 5B3SB 3FS9A 1KBWA 2HLEB 1AS8A 2HRGA 2OCCB 4HHWA 4ZK8A 1YLBB 2BWDA 1L9TA 8PAZA 3NJFA 4YL4A 4E9RA 3AG3B 2CJ3A 3UACA 2EIMB 2XV3A 1AACA 1GYCA 2FQDA 4GP5B 4JKNA 2PPFA 2VSMB 1HAWA 2GC4C 3H56A 3KW8A 1WAEA 5B1JA 1MZYA 2W88A 1SHXA 4KO9A 4A2EA 4G7SB 5E9NA 1PLCA 2IDFA 1ASQA 3EH4B 5I5JA 1JOIA 1L9QA 1RZQA 3WNIA 4HCFA 4AKOA 2XLLA 1SNRA 4E9XA 1J9TA 1X9RA 2JXMA 1AANA 3ZDWA 2FTAA 3IE9A 3QJRB 2UXFA 6PCYA 4HCIA 3NSFA 4E9QA 2XX1A 1AZRA 2H3XC 1E67A 4JHUA 3NJMA 5B1AB 4DP0X 2X87A 1BXAA 3V9EA 4GP4B 1NIEA 1KCWA 1JVLA 1JXDA 2I85A 3H4FA 1GR7A 2XV2A 2YQBA 4PCYA 2ZONA 1NICA 3PLYA 1IBZA 3TU6A 4HCGA 4YSAA 1GS8A 3NJNA 3OD3A 4W9ZA 4WKXA 1OOWA 1AG0A 4YSTA 1B3IA 2DWSA 4YSPA 4DP4X 3TASA 5I26A 3GXUB 2N0MA 3PAUA 3QJTB 7PAZA 5B1BB 5I28A 2VW6A 1VLXA 2QT6A 1SFHA 3FYIB 2FT6A 5F7BA 5AZUA 2PP9A 1A4BA 5FC9A 4A2FA 3NJKA 4AZUA 5IY5B 2UXTA 1KCBA 1R1CA 1AAJA 3CVCA 2GIMA 1SF3A 1J5CA 1HAUA 2YAOA 2B08A 2X88A 4AKPA 2MRYA 4P5RA 1GS7A 3NP4A 2J5WA 3AY2A 4A2DA 3X1BA 3PAZA 4E9YA 2J57A 1E5YA 2PP7A 1NIAA 1QHQA 2IH9A 3FU7A 1F56A 2DYSB 2XV0A 2WO3B 4G7RB 4UANA 2YAHA 2CALA 1JZJA 2AVFA 4N4YB 3X1FA 3UAEA 2BHFA 3ZIYA 1CC3A 1ET8A 1OF0A 1EHKB 2FQFA 3TBCA 1CUOA 2CBPA 3QPKA 3HEIB 1W6LA 3FPYA 3CDZA 4KO7A 1ZIBA 3GYRA 4HIPA 2XXFA 1W8EA 4KNUA 1ID2A 1PY0A 1QLEB 5B1JC 3NP3A 2AANA 1NIFA 2BW5A 3PAVA 4A2GA 1QNIA 1AIZA 1NWOA 1XB8A 2PLTA 4CSPA 4DP8X 1SFDA 1FWXA 3ERXA 4KNSA 1SDDA 1BQRA 2TSAA 1PZCA 2CUAA 3S3CB 4DP9X 4E9VA 4F7KA 3X1NA 1UATA 2Q9OA 2PPEA 1J9RA 1E30A 3H4HA 4M3HA 2IAAC 3BVDB 2YAPA 3JTBA 4F2FA 4NB7A 1EZLA 3T6ZA 3WI9A 4E9SA 2BP0B 3UADA 2PP8A 1PLAA 2PCFA 2QDWA 4K9JA 4N8UA 2FWLB 2R7EB 2XVBA 2YARA 3FYEB 3G5WA 1N68A 3N2JA 4GY4A 1SHWA 5PAZA 1HFUA 3S3BB 3S3DB 2I7SA 1OCRB 3EHBB 2DWTA 2UXGA 3FSVA 4HALA 3FT0A 2EINB 1GS6X 3QQXA 4DP6X 4YSCA 1J9QA 1L9OA 2XYBA 4BDVB 1CURA 1BQKA 1CYXA 5B7MA 2HX9A 2VW7A 3DKHA 2EILB 3QJUB 2PPAA 4QKTA 3PXLA 4KO5A 1WA2X 4YSUA 1AOZA 2BZCA 4F2EA 1PCSA 2Y1AA 1FFTB 3EH3B 1ETJA 3NSYA 2VW4A 3TBBA 4YSSA 3FSZA 3OMAB 3ZX1A 3SBRA 3S8GB 2DV6A 3WKQA 3WKPA 1ET5A 2PCYA 4E9TA 5LDUA 4DP2X 5ANHA 2UXVA 1NIDA 3EH5B 4JHVA 3NYKA 3L45A 1NPNA 2YAQA 1PZAA 1ILSA 1ET7A 3FPXA 3T9WA 1JXFA 3IN0A 4GXFA 2J56A 4HZ1A 2YXWA 3T6VA 2Q5BA 2PPCA 1GY2A 3ABMB 2YAFA 1A3ZA 1GY1A 4AX3A 3TA4D 1W6WA 3AW5A 1OCCB 4KOBA 2HX7A 5I5IA 1PMYA 3NSDA 5D4IA 1V54B 2YAEA 3D12B 1WS7A 2AZUA 3DTUB 3CZUB 2FQEA 1RKRA 2Y69B 1NWPA 2CCWA 3FQYA 3JT2A 1V55B 1AZCA 4ENZA 1OE1A 3ASOB 3NJHA 2XWZA 2BZ7A 3T6WA 2GB2A 1BQ5A 3OM3B 2IH8A 1ZPUA 3AZUA 3UGEA 3AG4B 2XU9A 1M56B 3OMIB 1IBYA 3AG1B 1JXGA 5I6MA 3QJQB 2FT7A 1BAWA 2GBAA 1ASOA 4Q8BA 4EF3A 1M9WA 2GC7C 1A8ZA 5EHFA 2EIJB 3S8FB 3ZBMA 2A3TA 4YSDA 2YXVA 6PAZA 3EF4A 3FQ1A 1ZDQA 3FU9A 2GSMB 4G70B 3HB3B 4PAZA 4UF7C 1OE2A 2B3IA 4A66A 2W8CA 4BWTA 5B7FA 2H47C 1JVOA 4UAHA 1PNDA 2BP8B 4YSEA 3NJJA 1NIBA 3GDCA 7PCYA 1KDIA 3AG2B 2VMJA 4YVUA 1XMEB 2RACA 2BW4A 4X4KA 2P80A 2ZOOA 2BWIA 2QDVA 3FSWA 4G72B 3WG7B 4NERA 2XXGA 3IBOA 1AZUA 4QLWA 3SBQA 2IWEA 5I6PA 2IWKA 1A65A 2XUWA 1IKOP 2NRDA 2UX7A 1N70A 4G7QB 2VN3A 4E9WA 2FQGA 2BP0A 4RH4A 1PNCA 4KOCA 4BWWA 1A4CA 4YVNA 1KV7A 1PLBA 1AS7A 2QPEB 2R7EA 1KGYE 2IDSA 3T6XA 2VM3A 3FSAA 5AFAA 1NPJA 2XX0A 1M57B 2HRHA 1XB3A 4DP1X 4DPAX 1MG2C 3IEAA 1GW0A 4YSQA 1RCYA 2FNWA 5D4JA 2PPDA 1ASPA 3OQRA 2FJSA 1A4AA 3X2QB 3V9CA 4DPCX 5I6LA 2H5UA 4BXVA 2BO0A 2WSDA 1RZPA 1ADWA 4BDVA 4KO6A 1E5ZA 1JZIA 1IC0A 3ABKB 2UX6A 3FU8A 2AFNA 1NINA 2FT8A 4BWUA 2ZWNA 4BXSV 4A67A 1CYWA 1NDTA 3X1GA 1ILUA 4CSZA 1BEXA 2I7OA 5B7EA 1L9SA 5TK4A 4HHGA 4DP5X 2VM4A 1MZZA 1ZDSA 2WO2B 5A7EA 1KBVA 1L9RA 2HZHA 3QJVB 3SBPA 1TKWA 1DYZA 1J5DA 1MG3C 2YAMA 4GYBA 4DPBX 3NSCA 3ABLB 4YSOA 3PCYA 2AZAA 3MBWB 1OCZB 1WS8A 4MFHA 5AKRA 1AZBA 3UABA 1PF3A 4NAJA 3OMNB 3CVBA 3IN2A 1ZV2A 2E86A 1JZGA 4G71B 1NTDA 3X1EA 4Q89A 4W1TA 1AZNA 2DYRB 3ABGA 1WA1X 1NZRA 3DIVA 1JZFA 1T5KA 1OE3A 1PZBA 3ASNB 3KW7A 1PAZA 1WA0X 3C75A 4DP7X 3NJIA 2HXAA 4L0PB 4FAAB 3FU7B 5D4HA 3FQ2A 1ZIAA 3SQRA 2ZXWB 3T71A 2EIKB 2VSKB 1I53A 2JKWA 1KYAA 1TU2A 5I6NA 4WTQA 4AI7A 1JZHA 3RYMA 3WIAA 2IDTA 4AKQA 3CDZB 3WNJA 1AQ8A 4KNTA 2J55A 2P80D 1TEFA 2GHZA 1URIA 2IDUA 3UAAA 1BYPA 3NJGA 4P5SA 1GSKA 2TSBA 3NJLA 4M4RB 4TXVB 1BXVA 1IUZA 2MTAA 1OCOB 4BK5C 3N55A 4YSRA 5B1KA 1V10A 3CG8A 3QJSB 4GP8B 5I6KA 2CAKA 1SJMA 2IDQA 1J9SA 1SDDB 3NT0A 2IWFA 5F7AA 1SF5A 1OV8A 2GI0A 2OV0A 1DZ0A 4A2HA 1FA4A 1BXUA 2BP8A 2HX8A 1XB6A 5TK2A 2LLNA 5I5MA 1BYOA 4A68A 1L9PA 2JFCA 3PPSA 1MDAA 2QPDB 2OJ1A 3BQVA 4HAKA 1AS6A 1JERA 9PCYA 5I6OA
chains in the Genus database with same CATH superfamily
1BIHA 3FCSA 3KPNB 3UZQA 2CSPA 5ELIA 4C47A 4LBEB 4IDJL 3EXJA 5T3XL 4GW5A 1TLKA 1YLBB 3V4VA 4AL8H 8PAZA 3BP7B 1MUJA 1MW1A 2YJLA 3BGAA 3MODL 5TTRA 4H1LG 2C4XA 4W93A 3J27A 3QUHA 1FJ1A 1AO7A 3C2SA 1E43A 5C0NC 1PZ3A 3WNOA 1EEYB 4JQIL 1HHJB 4PRID 1CLYL 3J8F7 3EJRA 5D6CA 4XNYL 1G4MA 1I3GL 5J1TC 4KO9A 5FFGA 1D9KD 1OVZA 3RUGA 2VLJB 3W39A 3S3JA 1WH0A 1LMIA 3IFPB 5D1ZA 5FLVA 5CINL 2XZQL 3PDGA 4HCFA 4AKOA 1RQ5A 5IG7A 1N59B 2MQ0A 2V2TA 1AANA 2GJZB 3ZMNA 4AC4A 5CN3A 1IC7L 3BX7C 4XPTH 5EIIB 4HDIA 2F68X 3RRQA 4MMYB 3VH8B 4JJOA 1LYQA 4DPRA 4GMSH 3PU7A 4F1ZA 2BFGA 5E4OA 3RA7H 3P02A 1IGJA 5EZLB 4ALAL 1PJ9A 2K8QA 1FZMA 4Q6IB 2P46B 3RJDA 4HEPA 1KXHA 4Z0BL 4LSTH 1YY8B 3OV6A 1NIEA 4PJFA 3OTTA 1ED3B 3UBGA 2F2HA 4ZNEE 1GTNA 2WO4A 2FX7H 4CC0A 4JFYB 2VDLL 3GMPB 5EOTA 4UNUA 5GZOC 1CFSB 4R9HA 4I3RL 1E7VA 3UBHA 1B0WA 3UG4A 1CD1A 7FABL 3LNGA 5I82A 1SM3H 5HHOD 4XRCB 2W9DH 4AQOA 4BFBD 4GBXD 3HS0B 2Q7YB 2CA3A 4NWTL 4UT6L 3ZLQC 3MLWH 2Y7QB 4X99B 4DKEH 3G9VA 5ITFB 2PF6A 3VGAB 4GSDL 4OM1H 3RWEA 1QPPA 2VW6A 3WIFB 1SFHA 3VI3B 5F7BA 2F15A 1UOVA 5IMLB 5DQDH 4YDIH 5AW5B 2XQYG 4X5XA 4A2FA 4AZUA 3SDDA 2Z7WA 1O5PA 2FWSA 4QRPE 2BMKB 3INUL 4WI3A 1XBRA 3IFOA 3PGFL 3F7KA 5IIEA 1C12B 1I3UA 1WZKA 3UZVA 3WOVA 2MRYA 3WTTA 3D4ZA 4U1MA 5DS1A 5BZDB 4ZD3H 2J5WA 1PX3A 4Y2DC 5ABZA 3PFQA 1P1ZB 3QPQC 3NPSC 2AITA 1NIAA 4DCQA 3P4MA 43CAA 2XN9B 4NN7C 3AWFA 3LKOB 3OKEA 3F6JA 4D94A 5MHSD 1INDH 1R6VA 2CHWA 3AVEA 3GO1L 3MMEB 5C0RL 1NOFA 1EEZB 4NC1C 1RV6X 3ECVA 1CC3A 2XBDA 4B0MB 2EZ0D 4FF9A 4OB5L 2DEWX 4PIRF 2HG5A 1U8CA 4WO4A 5C07B 4FNRA 2BXYA 4OTXH 4PRPA 5E1AA 4F9LA 2QQLH 4O02B 3B83A 3GYRA 3WU1A 3KL0A 4XCNB 3NCXA 3IKKA 3P54A 4AEFA 1IL1B 5DLLA 3FO0L 1DJWA 4M4RA 1U8KA 5BO1L 3C6LC 5F3HB 1TNMA 2KPWA 2FUQA 3FT3B 3QQ9D 4CSPA 3M45A 4MHHG 3HZ3A 1E6OL 1EUUA 3OKNB 2YEZB 4FX5A 4YHYB 3MGTA 2NXYD 1U8HA 2CR6A 4F7KA 4DP9X 1MPAH 4G6KL 3BPCA 5KJ4A 3HRPA 1C8PA 1CDUA 1O9WA 2NZ1A 3H4HA 4M3HA 5D9SB 4FQIH 1CF8H 4PJ9B 1N6UA 1HEJC 4JFFA 1MNNA 3TVMA 1H0DA 2CLRB 5J1AA 3UAFA 2APSA 4MXWL 4LF3B 5AZEL 5FOBA 5TDNB 1S5HB 4NM8H 4Z76B 2PWFA 5E1IA 4BRVA 5C9KA 2XBTA 2DQUL 3RBSA 3CBKB 3TLRA 3GQFA 1K6QL 2E8ZA 3BZ4B 3FRPB 1XEDA 3IT8D 5CHNB 2VH5H 1JF1A 4GY4A 4J6IA 5D72H 1XMWA 3G9AB 4OCYL 5AG9A 5JOPD 4Q0XL 2WLIB 1A6AA 3AT9A 3NCWA 1PZDA 2I7SA 2DWTA 2UXGA 3RDTD 3IRCA 3ALXA 3O0LA 4W9LC 1BGXL 2O6PA 3P0YH 3L3GA 1UOWA 1G5AA 1IILE 2Y06H 4GH7B 2E46A 2UY6A 4EN3A 4BCZA 2DQJL 4KXAA 4FTVD 4Y5VB 4NUMA 2CXKA 2PPAA 4H2CA 3MHZA 4CU6A 5I1CL 3SKOA 1ACYL 3WDIA 5D71H 3OC8A 1VSCA 5KSVA 3KJ6H 1GPOH 3U30B 3WY2A 4K7PY 4HJ1A 2P8LB 2UVFA 2ZCLH 4NQSB 4DGVL 1I8KA 2Z31A 3OZ9H 3O3EB 5TE4L 1ZV5A 5JHDB 3PWUB 4XO5A 3VQLA 3O6FA 4WEEA 4UDUB 4GO9A 4KQ4H 4PJHE 1GIGL 2R27A 1GOHA 3QG6B 4YO0A 3RGVB 4RGOH 2WOYA 4TVPD 3U1QA 3KPMA 4G11A 1H6EA 3K6IA 3CHXA 4OT1H 1A4JB 4WU5B 4DESA 4HUWB 4JM2A 3UP6A 5HGHB 1Q0YH 2ICWJ 3MRQA 3US9A 1SEBB 4JLRA 1FH5L 2D4FA 3TIEB 4YEEA 1A6ZB 3IU3A 3OF6A 4GG6A 2UUDH 2VL5A 4NBYB 2YGVA 2P5PA 3IN0A 2DM4A 4QF1A 3B2UD 4MXQD 4X6BB 2YO3A 2WKOA 4NKMA 1QD0A 3RI5F 4F7TB 2XNAA 4D9RE 1RPQA 1MFEL 3DO4A 1C1EH 4FFYH 4KJYB 2OYKA 3JT0A 1VJSA 3UP1A 2JB5L 3DTUB 4MD0B 2BVPA 4PJ5D 3PABA 1QEWB 5KSBA 2E6JA 1EZUA 3GS7A 1VIWA 1OE1A 1QBMH 4KXZH 4Y5YC 3IGFA 5MEPB 1CWVA 1PFOA 2EO9A 4K5NA 2BZ7A 1HXYB 1XR9A 3PWPB 4Y9GA 4ICXA 5HI3C 1I4FB 3W0WE 1JXGA 3NK3A 3CH8A 1E0OB 5FWRA 3RNKA 3P9MB 3IWUA 4FADA 2BCKB 3A67H 4D0BB 2R69A 3OR6B 1USQA 5BZXA 3S8FB 5HI4D 2B4CC 5I2IB 2DMGA 3TYFA 2P5WA 5IOKA 2DQCL 4IK6A 3ZTDC 3AADB 4NC1E 3FUKA 3B9KA 4OCWL 4QXGH 4HKJA 3CK0H 4Q6KA 3H2QA 3HPLB 6FABL 1N5AB 4LOVA 1DQIA 4G2AA 2B3IA 4HWBA 1BFSA 2VLKB 1XVSA 4UAHA 3IGLA 2P47B 1KXVC 4UIMA 1I7UB 3BQUA 1UM5L 3ZQWA 1WISA 2A77H 3IFNL 5A2FA 5IHZB 2ZKWA 1LEIB 3EFDH 2FEDC 3E8UL 3C8KB 2CZNA 3LCYA 3MCLL 4IHOA 3RIFF 1AI1L 4PJAB 2W5PA 2I9LA 2G4GA 3FUDA 2KT6A 1ZK9A 1JD7A 2DS4A 1F90H 3ZKMC 1UJ3A 4QOKE 3DPBA 4NO2B 3BZFB 3ECWA 2IWKA 1MY5A 2DIAA 3MRGA 4HIJA 3R7QA 1MKFA 5MENB 4AOFA 1F3DJ 3MO1A 4KKAC 3SGKA 3N40P 4K8RC 2YOCA 2SEBB 1LP9E 3VJ6A 2NNXA 1MCWW 3HHSA 1M05A 3E6FB 4OGXL 3WE1A 3ZDZF 1DBAL 4APQC 3QCUH 4AITA 2ORBH 4UILH 3UAJD 5JHLH 4YIQB 4DKFH 1J86A 2VM3A 3FSAA 5KYXB 3FONB 3KPPB 2XWRA 1T6VN 1UURA 3RZCD 2MTPA 3BP6A 2JXMB 1OD7A 2H3KA 1U3NA 3AQZA 2R23A 3ARZA 4MMXA 4O00A 5C3TA 4AL8C 4Z6AT 4POZC 4H8WH 1NCHA 3FU8A 5B38G 3KPRB 4YDLB 3DGGA 4OIBA 3ILQD 4WWKC 2A6IA 5T5NF 4LPTA 1Z9MA 3L9BA 5IMMA 1ZMYA 3MJ8B 1MRCL 3BUYA 4RGMC 1X3DA 4LHUB 2E7CA 2NY5H 4JZOA 4NBXB 4QRRA 2EDWA 5B7EA 1SJHB 2WVUA 1BZ7A 4KROC 2EIZA 4DP5X 3ROOA 1BM7A 2WV3A 4PW4A 5JPMA 1G7QA 2GK0B 2JV6A 4P3WA 4D8PA 5DS8B 1LO0L 4WTZG 3S2CA 1MCWM 2WO2B 3ARRA 4Z7WE 2QQKH 5B4MC 3LQMA 5D1QB 3S88L 3H7BA 5DRXA 1P69B 4GXVL 5EC1B 2QV4A 2A73B 2OTUB 2W0FB 4LSUH 4ELKB 2NNCA 3SYPA 3UYOD 3KS0J 3O8XC 1CDGA 1MHHA 3EOBB 3KLHC 1PTZA 4MQ7B 1KF9B 1NBYB 3BEVB 4N9OB 4UMSA 2YOAA 1Q9WB 4YE0A 4PJEA 1YPZF 1AXSA 3BD3A 3D5OF 3IE4A 4WEBH 5IB4B 1DSFH 2BNRB 3II2A 5F7HA 2BVEA 2WBJA 2Y22A 5AQ0A 5H37G 1RZJC 3OJ2C 3ASNB 4NKIH 3UTTB 5K59F 4P06A 4OFQA 4QRPD 1NBCA 4TUJB 4L18A 4M29A 2EDQA 3HBZA 1L7TL 3ARSA 5HDQL 2ZG2A 1YC8A 3W38A 1OT2A 4ZMPA 1I53A 3QE5A 5I6NA 2VXQA 3GD1C 5D7JC 3U4EB 5HYQB 2X09A 3FQNB 5J9PB 3UC0H 3KLKA 5FUZH 2F8IA 3QZWA 1UWEL 4PGDB 4PS4H 3VFGL 1QRNA 5GGQH 2J55A 4FTDA 2Z9TA 4YS4A 3BHBB 5TE7L 5EZOL 3WDJA 2QGBA 2C1PA 1CFNB 4CADA 1DQQB 3DX8B 2WWKT 4W6XB 1XD0A 3GLAA 3VI4B 3W9EA 3PFUA 1BX2A 3RL2B 1AKJA 2M83A 4PBDA 5B1KA 4PP2A 1WBXB 5DVKA 2FJGA 2P44B 1KBGH 3B7YA 5IB5B 3W9DA 2JJSA 5K9JL 5IFHH 5CGYC 3RTQC 5LGHH 2AKRB 4HJJL 5DT1H 4OF7A 1OV8A 1UCBL 1LMKA 1D5MB 3OL2A 4F37K 2EJ1A 3NRPA 1I8IA 5EF2A 4LEEA 1DVFD 1RHHA 2NY7L 1XTLA 3MJ7B 1XX9C 1G7JB 2Z34A 3OJDB 4NQDE 4RDQF 5GGTL 4HAKA 4MBOA 5EF0A 4AMKH 2KBGA 1R3LA 1OTUD 4H7VA 5BVPL 5PCYA 5I1AB 1PYWA 2OMYB 3MUJA 4NRYB 4U3SB 1IIIA 3U25A 1CDHA 5CEZD 1AZZC 2MNJB 3FS9A 5CZRA 1JGUL 3LNDA 1UG9A 2YUXA 4HX1A 3IFLH 3T4AA 4KZCA 5BJTA 5C3LD 1R3JA 3DVGB 1HN1A 3MJ9H 2EXWD 3R18A 4FI6A 2AAAA 3FF7A 1HWHB 4G6JL 3SIKA 3V5DB 3VE0B 5C6TH 4EQ2A 4M6NH 1GYCA 1UXWA 1Z9SB 5BS0E 3BFOA 5FB8A 1TTCA 5A2AA 2UWEE 4MNGA 5T33H 2J72A 2ZOKA 1LEGB 2AJSL 3MRLA 5F7EH 3Q5TA 3PJSB 4GI8A 3VWKA 5IKCB 3I6GB 4LKCB 1UM4L 2Y7MA 1IAKA 2ZG3A 3GEWB 2VLLB 3ESOA 3ENEA 4XNDA 4BINA 2ZUVA 3RILA 3SE9L 1MF2L 1Y1DA 1BYNA 2OYPA 5C0ND 1X9RA 1DVYA 2VR6A 3KG5A 5EUKA 4XAWL 1JV2A 2JB6B 4BE6A 4YC2B 5FHBH 1ZWIA 4M7ZB 3HRZA 1RJZB 3CJJA 4S0HA 2VCOA 5SWQA 3BDBA 1HKFA 4U1GB 2NY3B 2AXFB 2VXUH 4FFZH 4IRZL 4BH8A 4X7FC 5DJDA 3SE3C 5C0CA 4K7FB 3UYRH 3RWJA 4B3EA 1RMFH 4PD4J 3FU6A 4DVBB 2FK9A 4NUJB 4ZTOL 4F57L 1MI5A 3Q2CA 2WZ5A 4GP4B 1Q9KA 1T2JA 5DEZA 3AT0A 4MDIA 1EFXB 1LO2L 3S3PA 3FMGL 2VSCA 3LKQA 2B0SL 4YNYB 4WKZA 2ZONA 5DJYA 2F5AH 3MCG1 4LDCA 4IDLA 3JV4B 4L3CA 3M07A 4H8VA 3PV6B 4BSVA 3VB9A 2C34A 1FZOA 3HE7B 5AOKA 1JMZA 3BFWA 1A7OL 4NJAH 1T03L 1UJTA 5GSRB 3WSQL 2YD7A 2H32A 1ORQB 1P5UC 1U8QA 4FJ6A 3ZUCA 2VC2L 4PJ6A 1YC7A 5B1BB 1CFBA 3FO9B 2HJLA 3SDXE 5T3ZH 5K9OA 5A16B 4JFPA 4UT7L 5GZOD 1FUNA 3KHQA 3F7RA 1NANI 4JM4H 1Z3GH 4ZQTA 4D9RD 1DBKL 4IBTA 1AAJA 3DSNB 2XDHA 3GI9L 3BDYH 3MRDB 1KEGH 4GKOA 1HEZA 2E27H 3QDME 4XCYA 4YQXL 1JGVL 4FERA 1H15A 1O9ZA 1I9EA 2X88A 4AKPA 1Q90A 3ZJAA 3FT4B 4WW2C 5E9DA 3HI1B 1P5VB 4A2DA 4JHWH 3X1BA 2J57A 4PU2A 4AIZA 4OKVA 3EF7A 1CTMA 4RMTA 3H53A 2Z91A 3FU7A 4G8FA 5I30L 1F56A 2DYSB 4QHMB 5HPOA 1M6OA 4G8GE 1JRHH 1SJXA 4A7UA 2PNDA 5T1DH 5EZIL 2Q6WB 1EHKB 3LPOA 4PGBB 2NDFA 5DVPA 2EKJA 2KPNA 4ZXBB 1SVBA 2QVTA 3L6FB 5C09B 4HS3A 4Y2DD 5T1KD 3QPQD 3O81A 1ZIBA 2XXFA 4AYBA 5HYSB 5LCVA 2DWEB 3EO0A 3PYCA 3I9PA 4AM0B 4G7YH 1KN4L 4HD9A 3L3JA 2Z4QA 1A6UL 2DL2A 5BV7C 1IQWH 1DE4A 3EGDB 3H1ZA 3QI9B 4XXCA 1XB8A 2HWZH 1SMOA 3KYKL 1FWXA 3EYQC 4I0CC 1U93A 1XGQA 2RFXB 3S3CB 1FAKT 4EUPH 5AUMA 1ND0B 2G5BB 3GSXA 2VXVH 4J23A 4AEHL 5IJCC 3C6LD 3O6LL 1UASA 1OB1A 3K4AA 4OLYH 3MLZH 3HLKA 1QFWH 5D5MA 3T6ZA 4L3FA 1KJMB 4KRPB 3MZTA 4O9HH 1C9SA 1QSZA 1UWGL 4RISL 4LLVB 4QOKD 2ZSVA 4GIAA 4ZS7L 3RFRA 2BJML 1H9VA 1BFVL 2OQJA 1S7VA 1L0PA 1XCWA 1B0GB 1WZAA 4JB9L 4ONFL 1NFIB 4TMPA 1ZTXE 4P2OB 3LEXB 4F27A 3QJFB 1M71A 1EAQA 4LAQH 1QSEA 2CKBH 1F8TH 2XZCL 5H2BB 5C70A 5DMKA 4XMTA 3VFUA 3C5SA 4O2CB 3F58L 2XYBA 4HC1A 4XCEA 3ULUH 4N2HA 1CYXA 2BCMA 4TTGA 3BXNB 4MJ4A 3MV7E 2OJZL 3WFCL 2J8UE 4W9CC 1K5NA 4HFUL 2VDLB 3CAFA 5DJ2B 2X10A 1BP3B 2IG2H 4PB9H 3E3QC 5DD0H 2BNUB 3OHXC 1XEUA 2H9GB 4YHIB 2HVJB 4MNHA 2BZCA 5CCKL 4NUQA 4XPAL 2NUPA 1FAIL 4ZJ9A 3Q05A 4OQ1A 3MVSA 1T4KB 1FFTB 1QEXA 3MQIA 1RH8A 1U8PB 2I24N 5J6HB 5G4OA 4HJIA 2XPGA 3SOTA 2F7QA 4RFNB 4WFEE 2GCYB 1TKWB 3EGXB 1M6UA 3QUXC 3FU5A 1FGVL 4N87A 5E8EB 4ZMTA 1HU8A 1NPNA 2BH0A 1UA3A 1GJWA 1IT9H 2IFFH 3IJ8A 1TQBB 3CFIC 4AENA 4M3JA 2F5BH 5C08E 1UADC 5E8NA 4L9DA 2FATH 2ZXEB 4FJYA 1XGPB 4AG4L 2OLDA 1IBGL 2WIIB 1XGUA 4QO1A 1S9YA 1I1AB 5FO8A 3AQYA 4LP4A 4XO8A 1J8HE 4Y9FA 4BYHA 5CFHA 3M1OA 1J5HA 2NTFB 4QHKJ 1V54B 2X4OB 1XCTB 3FCTB 5LAXA 1DFXA 5AW4B 2P42B 4F2MA 5AB9A 3HNVH 3GXTA 1V55B 1MCFA 1MJJA 1N7MH 4JZJA 3FKUS 3CDFA 4MZRA 3HPJB 3ASOB 4RBPH 5FR3A 1FYTD 5HXMA 2K9FB 2UZYB 1TITA 2NX5A 3ZTJH 3FO2A 1BA9A 2FGWH 1FFPA 1VPOL 1NL0L 3IXAB 4B96A 3B7TA 1G1KA 2IBGA 3L5XL 5DYOB 5BZZA 2AJVH 3IAPA 1MFBH 2VN4A 4HCRA 3WXWL 2R0ZL 3GSQA 5F71A 4G9DA 1GGTA 2KC0A 4C56A 1CU4L 1U3JA 5EO1B 4OI7A 4MSWA 5HDRA 2FO4A 1WGVA 1KGJA 3WIIH 3O6KH 3II3A 4MS6A 5HI3D 2IGTA 2LLGA 1H8LA 3KLQA 2GSMB 4DTGL 3I2CL 3LQZB 2OI9B 3HB3B 4I13B 4W70A 3KE0A 4M8QB 5GSVB 4Q9RL 3QDAA 1GZHC 1FNSL 1CG9A 1T1WB 3B9DA 1GSMA 1ZEAL 2DTSA 3DV4B 3NIFE 3A3YB 2BP8B 1U8LB 2ESVA 2FBJL 1ONQA 2CH8A 4NZTH 1WFJA 4IMKA 1Y18B 4MA8H 5EUOE 4B9GA 2JCCF 5I71B 4YWGH 3GDCA 1J5OL 4IU3A 4K3DH 1JXKA 3BI9X 2ADFL 1M2OA 4M93B 2BY0A 2RACA 3TZVB 3DWTA 2BW4A 3ESVF 3GI8L 2EIDA 1FP5A 5ICXB 4ODTL 3K2UH 4KVCH 2OXHA 3SGJC 1HHGA 2XXGA 4N86A 1NCWH 1GOGA 4JFDE 3LZNA 4XMLH 5EPMA 4P2AA 1IAIM 5BQDA 2NR6C 2Z93B 3MFFB 1QLEL 4XZUB 3US1A 1WF5A 4HKBB 2VN3A 3TTSA 4Z3EA 1DQJB 3CZLA 5E8DH 2DM3A 1JN6B 2VAAA 2FE0A 2FEDD 2XKNB 1MVUA 3H3KA 2PYEE 2OX5A 2BP0A 4RH4A 1A4CA 2DLHA 4U1LA 3SSGA 4XN4A 1S7QB 3C2AH 2R7EA 4I1PA 3ZKMD 3OGCB 2DIBA 3UPAA 5ENWB 2JELH 2QSTA 5D55A 1MRDL 4DP1X 2HRHA 4FN0A 4U1KA 2YUZA 4KKAD 1TZAA 1YYMH 3FCGA 2CO2A 3FTXA 4K8RD 3T8XA 3VXNA 2YXMA 4Y4KB 3FQRB 1FFOB 1ODAA 2W81C 3BISA 3DBXA 3RGBA 4UQIM 3VFOB 1QSFE 4FKEA 1WQVT 5HJ3B 2WSDA 5C2BH 2O6EA 1DO6A 1R9FA 2CO6A 1GVIA 3L4ZA 2BS9A 1QP1A 5I16B 1E9PA 3OLIA 3DDFA 4JL1A 5LG6A 4LQ1A 4R7DB 3AU1A 3Q01A 3SGEI 1Z9LA 1E40A 3SBWA 2DQFA 5IGXL 1I85A 2YD6A 5JMRA 2YPVL 2HTKC 2XVKA 4NQCA 2GFBA 3B6SA 3BD4A 1CGWA 3E3QE 3NFSH 3UROR 4MJIB 1F02I 4ZAKC 1CXFA 4MZIA 4POZD 3VRIB 1I9JH 3C60A 3BWAB 3D4GA 4O02H 5E6SB 2NY2C 1KENL 4Y1AB 3LEVH 4GRLB 4WWKD 5C71A 5FYLH 4UTBA 2OK0L 2KMWA 1EV2E 1F4HA 1PCXA 1S7XB 1X5ZA 2G3NA 1MG3C 1H8SA 2C7FA 1E4KC 2P8MA 3AWEA 4FCHA 4MJJA 1P84J 4J3TA 4G9FB 4KROD 3KYMA 4UBDC 1EQWA 3KLAA 5F7DB 1P4IH 1CGSL 2K78A 4OQTL 5DQ9A 2QPFA 1SY6L 2B3RA 1MCLA 2G60H 5B4MD 3L5HA 3IMTA 3QCTL 4XNMA 2H6UA 3DO7A 1JHTB 1X5LA 4R7XA 5E6IB 2FLMA 5DVOA 5H35A 3Q0HA 1MFDL 1M3JA 4W9GC 4RWYL 5L2KA 1JZFA 1MAKA 1WD9A 4LEBA 3K72A 3O8XD 1T7VA 4HLZG 1P4UA 4OJDH 3KLHD 2AGJH 3SDYH 4IM8A 1KEML 3POHA 1NFAA 3WELA 3B1UA 4L0PB 3LD8B 2DQIH 2ZYHA 3QDMD 1Q0XH 1JHLL 2X9XA 3GSUB 4AW4A 4CILA 5IM7B 1SUJA 2FH8A 2GTQA 2K8MA 1E8YA 2NYZA 2D03L 3FH7A 3GBML 1IZKA 2ICWA 5AW1B 3E0GA 3RX8A 1G9NC 3NFNA 4P4KC 4G8GD 3RAJH 1GZQB 3EOYG 3KWWA 5FX3A 5G5DB 3GIZL 2HMIC 5EA0L 2L7EA 4JG9A 1NUNB 4TXVB 3NN8B 1BIIA 5C3IA 3AMKA 1MCOL 5D7JD 3MOAL 1AGFB 3STLA 3VFRB 4UM9B 2EH7L 2X53A 1FYHB 4Z7UE 3VXRA 2EVJA 2AK1L 4XXDA 5F7AA 3PNWA 3HLAA 2IXQB 1A6VH 3N1PC 4D0CA 1QO3A 1K8IA 2OZNA 5FCUH 1N3NB 1N0LB 5I8EA 5DD3H 3OMZA 5I6OA 2Q8AL 4HUUB 4P9ML 5HYJB 1HSAB 2X12A 5CGYD 4WSKA 3RTQD 3D69B 4R4FL 2XQBH 3ALPA 4NO0D 1KBWA 3ZPDA 4HS8H 5JXEC 3IETA 5DJZA 2BWDA 1L9TA 3ZTNL 5EC2B 3LRKA 1A6WL 2XV3A 3HNSL 4KH2A 2D9CA 3FN0L 4IRSA 1BZEA 4DGWC 4YFLF 5GRJL 3SGDH 5GHWH 2Q20A 1F3JB 3BAEL 4MA7L 3OB8A 2VLME 1XGYH 4F5CA 1SHXA 3IMRA 2IAMB 3BIKA 5AZ2L 3U46B 1RVFH 3U9UA 5TE6H 4PJXF 4HJGA 4HUMB 2EO1A 1HXMB 2IV8A 3V6FB 2GTZB 4IIZA 4ODWB 4X8JA 4E9XA 4DGIH 2J1KA 3MOQA 1YMMB 1G7IB 1CLOH 3E1F1 4FI7A 3DMMA 4YDVB 2NNAB 4KUCD 2OSWA 3TEYA 4AEIH 3BVNA 5K1NA 2CO7A 2B59B 2PWEA 4ADGA 4P3DB 1XSJA 3F85A 3QUMA 3NA9H 2YK1H 3KPLB 4R0LA 1UYWH 4GG8A 1AC0A 3CUPB 4UUJB 4KXDA 3TT1L 5DYFA 4I0PA 3FQTB 3TM6A 4S1QH 5IUSA 1DP0A 4U3HA 4QRQA 4OZHF 2AXJA 3TO4C 1A3RL 2F58L 4ZUUB 4LIQL 5I18H 1K9TA 1XAKA 3JVGC 1EMTL 4OJEH 5F96L 3NDYE 1KLFB 4FZEL 4QNPF 1VCBC 3QJTB 5C08D 2JKXA 2BVQA 2GSIA 1R3HB 2PO6A 5LGJA 1OP5K 1TQVA 4JO4L 5H94A 2D73A 5FUCC 3N85H 1IM9B 4X9BA 3BPLB 4KKBC 1JWMB 2F74A 5DVMA 3FRUB 1ZLSH 1DZBA 4YAQB 4TOYL 1OF2B 4FLOA 2ZF9A 3HC0A 2WQWA 3DV6A 1BVNT 1F13A 1H3UA 1ZANH 2OMZB 3SDCA 5C8JB 3TBWB 4LEXH 1CD8A 2BZDA 2R56H 1WWCA 4MB3A 3RG1C 1OQOA 3WIHL 2GEEA 2YAHA 2CALA 1ZJAA 3X1FA 1QLFA 4FC3E 3QH3B 1YRKA 3JTSB 1A1MA 3CD4A 5L9DH 3ATDA 5JQHC 4FQXA 1W80A 5T3ZE 4JQXA 1K3IA 3QFJE 3IS1X 3BCFA 3KPSA 2VMFA 1QBBA 2EIBA 1FN4B 4OF5A 5JXAH 4IOIB 3M86A 4JO2H 1U8OA 4GUPB 2R0WL 1WIUA 1QKZL 3BLBA 3GK8H 5CR8A 2EH8L 4OCRL 5A2LH 3MNMA 4FQHA 4Y16A 1NCAL 2W65A 3OAZK 3ZDXB 5I6XB 4U0RC 3KWVA 3LS5H 2OR9H 2CHNA 2JIXD 3N6YA 3PHQB 3QDJE 2NY0C 3BGMB 3SJVA 1FC1A 3VRJB 1HL9A 3OB0K 4K9EC 1X5JA 1W16A 1OAQH 1VFMA 2IAAC 5C0GA 3GMLA 3D39E 3KCPA 5DHYB 5IW1B 3K6SA 4NKOA 4UINL 3U0WL 5HGGS 3ALWA 4FI8A 2VWEE 4RNRA 4J8RA 3BOVA 2BINA 1AP2A 3CZNA 1L6PA 3EYQD 2YSTA 1PZ5B 4LSPL 4ETQA 4WWNA 2I25N 4JFDD 4JKKA 1I7TB 2ZUSA 4QUOA 1FZJA 1TO4A 2BLFA 4RRPA 4NQEB 1S7UA 2YLKA 4POYA 1HKLL 3VMNA 2JH2A 3TYGH 4PJ7E 1SPDA 3CSYA 2IH1B 1NCDH 3BT2L 1ZHLB 2PYED 3DUHA 3S3DB 4A6YA 4CNIB 4ERSL 3MN8A 5I75B 5ALCL 3H9SE 3EHBB 4JZNA 1TTUA 2ZPKH 1TFHA 4ODSL 3FT0A 2WQSA 5L88L 2ARJA 4YHKH 4XCCH 3R1GL 4L05A 3WUWB 4AJ0A 5ITBL 1OGAB 4KKLC 1KPRB 3ARBB 4JFXB 2WVSA 4M5YH 4P5TA 3QO0B 1TJGL 4Z78A 2ZKHH 1NAMB 4LSQH 3SDDC 1GAFL 1RURH 2QKIB 2AEQH 5F1NB 4NCDA 5IHUH 2PXYD 1HCVA 1QSFD 4ES9A 4ABWA 5F3BA 3T0WA 4TSBL 1FV1A 2EYTA 4MXVE 4ZZFA 3OHMB 2X9YA 3FSOA 3GUTB 1AD9B 4R5VA 3TCTA 4I77H 3QNYB 3GB7A 4JM0A 3EH3B 3QHFL 1PVHA 1CICA 5DZ9A 3L95A 4CSSA 4ZMQA 1CL7L 2AEWA 5EOCL 3FSZA 1KGIA 1PFCA 3ORJA 1RXLA 2FNBA 3SO3B 3DROA 3WKQA 4G42B 4HSAC 4QRTA 4WDIB 2W80C 4KKNA 2FWUA 2NZ9C 4M00A 2BSSA 4JKPH 4L4VA 4UTCA 1FNLA 4WO4C 2GQHA 3D25A 2HT3C 2X38A 4F9LC 3TESA 3ULUE 1RULH 4OVUA 2ZSWA 3QUYA 1NEZA 2AXGB 3IMSA 1QTPA 1GY1A 3LKNB 5HHXH 1KIUB 3QUXD 1OCCB 3O9WA 1ZY9A 3QDGE 4PVNA 4OFDA 2YBRB 3HZYA 2EXYC 3BE1H 3I84A 1G87A 4CDHA 3ZKXC 4PLKC 3G6JE 4EDWH 2WINB 5KVGH 5KYUB 4GKZA 4FHJA 4YHLH 4ZSOA 4DUXA 3MROA 2IGFL 5FUCE 4NQUA 1OAZL 4QRSB 3QJZA 1UQSA 3WFDL 1SJVA 3TVMC 2WXIA 1RUKL 5C6WH 2IH8A 2LFEA 2WVVB 3CFBA 1UB5A 3FUFA 2Y1VA 5DEGA 4LSRH 4RIRB 2EVHA 5HPMB 3KYAA 4BGDA 5TDPA 1R5VA 4PJIF 3MNWB 1DL7H 3I6KB 5D7EA 2DQHH 5DUBA 3ZYIA 2AV1B 3HMWL 1T1YB 1HT6A 1ZT4A 2XRAH 3EOTH 4F9PA 2M8XA 3NIGE 2Y1ZA 2Y36H 1Z9PA 3O2WL 4XI5C 1BAGA 3KBPA 3WEBA 5E5LA 5K5YA 1IGTA 4FYSA 3D2UB 4Z7VB 2UZIH 4MRBA 5ISZA 4F8NA 1I8MA 1LVEA 3DHPA 4P2QD 2WCSA 1OEZW 3FFCA 4P07A 3GTTA 4EN3C 1HOCB 2W94A 5TJWK 2OMUA 1FNEA 2F1EA 4NI6A 2R2CA 4OJYA 5KBNC 3KDMB 1RUQL 3ATEA 5J7CC 3UTOA 2CK0L 3RUGE 2KDGA 1MEXL 3MRFB 3BKMH 3ZL2A 4QYOA 4H13C 3HG1A 4Y19B 5FAAA 3ZHNA 2GAZA 4TQHA 1D5ZB 2Z31C 4GAAA 4EIZC 2KZWA 4AQ1B 3HC4H 3O6FC 5E2UH 5EBLA 2X1WL 4Y5VC 5KUMA 3RWFA 1NAKH 4M8UA 5SV3A 3GSOB 2VLJE 1NCTA 3AQXA 5FO7A 4JM2C 5CF3A 3G5VB 1KV7A 3OXSA 4LCIH 4E41B 2QPEB 1F00I 4HHAB 4JPKL 4QAWA 2AVGA 1Y0LB 1CFQA 3OKMB 5CUSL 5D2LB 3IJSA 2NR6D 3HZKB 3NIDB 3RGVC 4ZOAA 4QHNB 5AW2B 2Q0ZX 1L0QA 2J88H 1ZT7B 2R9HC 1ASPA 4G6AC 5TFSL 2VDML 3GZQA 4O2EA 2FJSA 4X6CF 5I6LA 4TM9A 1EHNA 1EGJH 3CC5A 4K3JL 4UOQA 4ZRGA 4CC4A 5BOZG 1ZHNB 1WTGT 4Q9QL 4CC1A 3B34A 1EDHA 4KVNH 1MHCA 3MLTB 5KYYB 4MBRA 1KJ2L 2OSXA 5E00B 4PREB 2A6JB 5CKGA 5EU6A 4NZUH 1AHKA 4HJUA 4QHUB 1G6RL 4J4PA 2G0KA 4A7QA 3E9TA 4LLDB 5DEFA 3KCWA 1U8NA 3UCQA 4QTHB 4OZFB 1XV8A 3PP4H 2VR7A 4LRNL 1Z5LA 2VM4A 3HCVB 4K3EL 3VI3E 1T6WA 4I48A 4CU7A 1LK3L 4YFDB 3NZHH 2FRGP 4YHOL 3R7RA 4WCYL 4N6RA 2X3AA 3MREB 1QFWM 3SE6A 1Z3RA 2HTKD 3S4SG 3T04D 4UQ9A 4ZAKD 3B9KC 4U7MA 1RLBA 2Y23A 3DOSB 1YPZA 4GAJL 1NC4B 1CBJA 4HJEA 1DQML 3GRWA 4FNLH 2NY2D 2GKIA 4KVPA 4XH2A 3UJTL 1ZRUA 2NNFA 3MODH 4Y9EA 3WIFA 1C08B 3BVTA 2ZNWA 3QXUA 4W1TA 4X6EB 2Y2YA 5CP7B 5A2CA 3BQUC 4M5SA 4PYGA 5DRWA 2R1YA 4UBDD 1TXKA 1CLYH 1QI3A 4FXGA 2YC1B 3CN3A 3C9NA 1E42A 4HH8A 2IADB 4PJBF 5DK0A 5FYLE 2BVUA 2DKUA 5F9OL 1UJ3C 4GQRA 5JORB 4JFTA 3FUJA 4WTQA 3ZDYF 4F7PB 3QEGL 2W38A 5EBGA 2Z64C 4JFFE 3SGKC 2OAAA 1DJIA 4XVTH 5L6YH 2KKQA 3ECUA 3CWGA 4ALAH 2H6PB 4JDEB 1CIDA 2TSBA 4Z0BH 1FL6A 4UT9L 4WI2A 4XCNA 4P2RA 1SYSB 1GMEA 2H1PH 3HHRB 4G82A 3HW7A 1UKTA 4P2YA 1OCOB 1VB9A 1LE9A 3QFJD 3E38A 2VDLH 2RHEA 3ZKSD 3DYMA 1UWYA 1EJ8A 4ICWA 5ICZA 3TO2B 2Q1EA 4I3RH 4P4KD 1PDKB 4OD3H 4AH2A 7FABH 1BCIA 3B37A 2YEZA 4MMXC 2R1XB 5HHPA 3L3OA 4HETA 1BXUA 1FE8H 1E3ZA 4OR1A 2HMID 4PLJC 3GUFA 1JFQL 4KAQL 3QDJD 2I69A 2FBRA 4S10A 1BQSA 4BZ2H 1YEFH 4Z8FL 1JERA 3EYUL 5FFOA 4UU9A 4IU2A 1N18A 3REVA 4Q7DA 2BNQA 2QR0A 3D39D 4JAMA 1DBJL 5CCHE 2WQUA 4ZK8A 2GITA 2IALB 5JPMC 1F4YH 2BRRH 2AK4B 4U6YB 4FL4B 4B97A 3AG3B 4JRFA 3O6MH 5CSGA 3PG2A 1LGVA 3OSVA 3ILDA 2AV7A 3HVNA 3L81A 2H2PC 2UUDK 3QEHA 4GP5B 5IREA 3VXMB 5DJ6A 5EEYA 1GC1H 5H4ZA 4ZDHA 3V10A 2Y5TA 1S7WB 1CF1A 4UV4H 4KQ3L 4ANWA 1IGFL 5EDXA 5JXED 5HVHB 2C1OA 1BVNP 4KTGA 3WFBH 4EOWL 4HGWA 4HUCA 4LPUA 4UQ3B 5EFIA 3P1VA 4OBSA 1S5IL 1DVQA 4YPGA 4ORGA 5IT2L 4JN2A 4O51A 5CGTA 2O30A 4BQ8A 1A7NL 1X5XA 2WBJC 3JWOC 4HKXB 3BYYA 4LASH 4BFJA 5BO1H 4PG9B 4WNJA 1OLZA 3MRPA 1EDYA 2WXPA 4X4ME 4FQQA 1U4FA 2VRAA 3JSSA 1ZTMA 5JIHA 3PWNB 1PD1A 3A23A 3T0EA 2OXGA 3WLWC 2X2JA 2F53A 3H54A 4IW4C 3IPFA 4L3EB 4W9IC 1KB5A 3ZE1B 4DN4L 1QZNA 4HA1A 3IDGA 4WV1A 5SWZB 5GRVK 1KG0B 1TCRB 4QCIA 5CLWA 3U0TA 1FO0B 4TUKH 2P45B 2W92A 5KW9H 4HCGA 2ZKXA 3NEEA 4H25A 5DD5H 2V7HB 4ZPVB 3B8SA 4DOHB 3EO1A 3SKUD 2OZ4L 4MDJA 2DWSA 2GBVA 1EXUA 2NSQA 3T2OA 5IFAL 4R90H 4AYMC 5LQBH 4JFSA 4N8VA 1P7KA 3FUMA 4I8DA 3EGSA 5AZUA 4BFNA 2JJSC 1FI8C 1DQVA 3NH7L 2PP9A 2JQMA 3CBRA 5EIIG 4LLYB 2V3DA 4IRJA 1X7TA 3TO4D 3TH4T 4NI3A 5DK2A 4WGVB 3CFKA 3KYOA 1J1XL 3GTNA 3QHZL 5IMKB 5B39A 1RJYB 4HG4J 2JI1A 1IAMA 4CRPA 1BBJB 1M2VA 4LNRB 3D50A 1U2CA 2D7PA 3AREA 1EO5A 1E5YA 1IEBA 4R96B 1DJZA 4OZIA 2R2HB 2R29L 4NO5A 3QUZB 1H19A 4E0RB 3CVHL 4KKBD 3V4PA 2VLKE 2EDKA 4G7RB 4ZO6A 3T0VA 5JQ6L 4V11A 3T4AC 1BZQK 2V17H 3OR6A 4H40A 2P8PA 1DEDA 5KS9B 5KBKA 4PY7B 2PW1A 2E7DA 1WV7T 5AL8A 1JK9A 3L2LA 2QELA 4B0MM 4DT2A 5GGVY 1M7UA 2H3NB 3U0PB 3HPLA 3QWRD 3VWKC 1ORSB 1I9RL 1NMAH 2BDNL 1NIFA 2AQPA 1FVEB 3FH8A 4U4BA 4N9GB 3CFCH 4PY8J 1FG9C 3O3DB 4JG5A 1ZLVH 3MRNB 2KQNA 5I0WA 1I7UA 2I5YH 3JWDL 4JY5L 5MENE 2VMDA 1KCKA 2ENQA 1D7CA 2OMTB 5DJXA 1PKQB 4BSWB 3L8QA 2ZX9A 3NQIA 2A74B 3RL1B 3HRZC 1L3NA 4O5LL 4HT1L 1DVSA 4NIYE 3MCKA 3IGAA 1DLHA 4Y4HA 5BRZB 4NB7A 5KJRH 3ZE2F 1TZIB 2VRQA 4KY1H 1AYOA 2EDFA 2L7UA 3ZRCC 2J1YA 1UACL 2NY0D 2PP8A 4M7ZC 2WLKA 3FUHA 1LD9A 4U1GC 2AERT 2YARA 1QYGH 4IK7A 3FYEB 3QARA 2GJ6A 1CVSC 2EEXA 2HFGH 3MA7B 2C9XA 4P23B 3FB8A 5CAYB 5PAZA 3KPRE 5E24E 4BUQA 4RGNC 5T1LB 4NENA 4F8OA 1MNUL 2XY2A 3QULB 1Q1JL 1F1DA 1T0NB 3NRQA 4X6FB 1J5IA 2DBLL 3F6LA 2VDOL 1JGDA 4D2NA 1HNYA 4N8CL 1WFMA 5GGUA 3S5LB 3O11B 2Q10A 1CURA 2WLLB 2G5RA 2Y07H 3U2SA 4GAGL 4WLCA 1KB3A 2AXWA 5I1LB 3AMLA 1Z0MA 3W37A 1MH5B 3GMQA 2EDLA 3LS4L 4UNTA 4Z1PA 5ANMA 5D1QE 4F20A 3S96A 3PXLA 4BGLA 4YN3A 1AGCA 1A9VA 5IZ7A 1HNGA 3TT3H 1FNAA 3RU8L 3QG7L 4N90E 2E56A 4PRIB 5IQ7L 4JG1H 2ITCA 4KKLD 1JDDA 4RMQA 1JTOA 1U4EA 2EEFA 1DQKA 1JPTH 1D9KB 1IIKA 3TBYA 3T3MB 3SDDD 2Y24A 1QNZL 3FRPG 2GK0A 3R8QA 3IFNH 1NANH 5HDBB 3MLXH 1WFOA 4CVZB 1HCFX 5LWYL 2J2ZB 3EH5B 4JHVA 4R3SA 4ESKA 1RZ8B 2YAQA 3HI5H 2V9RA 4UOJA 3IDJB 3MV8A 4FQ2L 1KCSH 1KN2H 4L8SA 1CLCA 3FPXA 5HGDA 4JFOA 1BZDA 3L3HB 1J1PH 4G6ML 3KBHE 4LPVA 2J5LC 3ABMB 1TVHA 1VRSA 1R3KA 2IPKB 4CBPA 3SYOA 4H5SB 4KOBA 2NZ9D 4NS0A 5EU3B 3CDGA 4OGXH 5D4IA 2DD8H 2Z7UA 4WO4D 5FW6A 4PRPD 2HT3D 4FABL 1DQDL 1UEYA 2OCJA 3O2DL 2H7WA 3BRFA 3UCRA 5HHOB 1WC7A 4GBXB 5EF3A 4TNVF 1QFOA 3BSHA 5CIPB 3ARPA 3QI9C 4HXBL 2G2NA 2F08A 3VI4E 1WD8A 1KFGA 2HN7B 4H0IA 4JANB 3UGEA 2EXYD 4M02A 5DRNA 4EO5A 4PJGB 1S2EA 2J21A 3J2PA 2V5TA 5JW3L 2BOCB 4MYPA 4PLKD 1ASOA 2HRLA 2DYPA 3G5XB 5DDHA 3TC9A 4XMXA 2XACC 5EHFA 4F80A 1XZ0B 3DUUB 5EOQH 1E4XL 4JFQB 4JFFD 3BPNB 3TVMD 4AEEA 3CSGA 3L5IA 2YRLA 3R0MA 4KXBA 5EO0A 4U6HA 4LGRB 4MJ5A 2EE3A 2CJUL 3QWOA 1N67A 3UO1H 4H1LB 3S88H 4NSKB 3FN3A 4XOBA 3VSVA 2JCCA 4MQXC 4ATWA 2EE2A 1A3LL 2XWTA 1KMGA 1GGBH 3GBLA 1TETL 5JO5A 2X0UA 5DD1L 4DVRL 3THML 1OALA 4L29B 4XI5D 4QY8A 5FF6B 2E7LA 5D1XA 2AJYL 5DF0A 2JVUA 2NLJB 4HH9A 2DLFH 5HVGB 1R34A 3G5YA 4PRDB 2ZOOA 1DUZB 1JV5A 1SQMA 4KH9A 2PKDA 5C6PB 4ZW8A 3V0VB 2V37A 4PJCB 4WHCA 4EN3D 4OV5B 4I18A 2KLTA 1JI2A 5EBMB 1DVZA 1SLUA 4ZODA 1A14H 3V52L 2J3SA 1EUTA 5AVTB 1A21A 5GS2D 2AEPH 3T2NH 1OAYL 2VERN 2NXYB 3U83A 1AGBA 4KK9C 3QQNA 4NP4L 4U2YA 1NBVH 4XO4A 1U9KA 5HJBA 1JS4A 3FB6A 2Z31D 1OO2A 3QYNA 2WNWA 3Q13A 2O5YH 3O6FD 5DUPH 2X6MA 4WY7L 1ZVSA 4MS8C 1QUPA 1YEJH 3CXHK 4DPAX 4U1HA 4ELMF 3P11H 3CHPA 4NWUH 1MCPH 3I6GA 4GRMB 4NKQB 1DSWA 2APFA 4HEMA 1S7TB 4JM2D 4ATTA 3X2QB 1U8JA 8FABA 2DN7A 4I2XB 4NHCL 3GMOA 4RMRA 4UZGA 3PL6A 4FGMA 1LE5B 3CXDH 12E8L 3D0AA 3OF6D 4ABVA 1CDJA 1R0AL 2A2QT 2UX6A 4LPCA 2FJFA 3RGVD 3US0A 5I8KL 1XSOA 4F7MA 1XR8B 4Y1TA 4I89A 1K4DB 4JZJC 3SOBL 5CLTA 2R9HD 1CYWA 3EOAA 3RDTB 5K9JH 4G6AD 4K7FA 4I4WB 5EORH 1FIGH 4HJJH 3VFSB 5LXGL 3BH8A 3VD9A 3L7EA 4LLAA 4NQXA 2Y5QA 3BMVA 1Y6NR 1F11B 4FTVB 5E9DE 1IU1A 3EYOA 3BEWA 5GGTH 3WUZA 2CHZA 5LG1A 4ONHA 4I5BB 1MELA 4ZOBA 4OGQC 5C0DB 3PV6A 2EYSA 2ADYA 1T2QH 1FLTX 2OP4L 4JPQA 1H5BA 4L5FH 2RH0A 4TRPL 3MLSH 4GUCA 3HI6L 3TJHC 4XN8A 3UABA 2XT1B 4DEUA 1PF3A 3HZMB 4L0YA 4HSQA 3BAJA 4YHML 5FXCH 3AQDA 3UBXI 3MLRH 2KQMA 4W9DC 3GSWB 4KHXH 1D6VH 4XMPH 5DD6B 4PRNB 3HB3C 3B9KD 1EVUA 4BFIA 4LHUG 1K3ZA 4Z3JA 5C09E 3PHSA 4Z7OF 3DX4A 2VQ1A 4GNKB 3W57A 1NJ9B 5CSBA 4TSAH 4P2CG 5GRZA 4AL8L 1XL4A 3T71A 1AGEB 2UYLB 3IJHA 1AFVH 1TU2A 3GHPA 4QHMA 3BQUD 2BRQA 4PJ5B 3CDZB 1FFNA 3DRQB 3C6SB 1BMWA 4MTMA 1LDSA 1W72A 1IUZA 1NAMH 4G43B 4CW1B 5I1EH 3JUYA 1G43A 5BMFL 4XPTL 3ZSSA 4XXWA 5IESH 2A9AA 1VGEL 1XDTT 3KPOB 4GMSL 5I15H 1KLUB 4HIXH 2OV0A 1G7PA 4JKLA 2X3BA 1IGYB 1JNHB 2ICEB 4M9PA 4OGYH 1Y1UA 4ANVA 4LSTL 5MEND 3NQKA 4A68A 4MA3A 4EBQH 4JRYB 4CAGA 3EH1A 1YEDB 2C26A 4PGZA 2V5SA 5DTFB 3SODB 2WLZA 5LBSL 5F9WB 3MRJA 2FX7L 4JQIA 3VMOA 2EDMA 3H2WA 3K71A 3SBWC 1I7ZA 3AJ7A 1I85C 2PN5A 2WCPA 2X44D 2D31B 1FG2B 1FL3A 2GW5A 2YPKB 2OCCB 3IMUA 1SM3L 2W9DL 1GZPA 4JQVA 4PLJD 3C60C 1OP3H 4UDTB 4QTFA 1PIFA 4D9QD 3MLWL 2ZWKA 5TGBA 5E2WH 3T1WA 2XWBA 3T4YA 2ZXCA 3N40F 4DKEL 3BH4A 2X4QB 4N22A 4OM1L 3LEXA 4QRRD 2OSLB 4YEFA 3T3PB 3SGEH 5EIQA 1H3XA 5AYUH 2X7LB 1QAWA 5DQDL 3MRCA 4YDIL 2HT4C 5IW6A 4APXB 1IAIL 1KXQA 3KPRD 5D7HA 5DHVB 3P73B 4PJXA 4MD4A 2YPLA 3H0TA 2RGSA 5I1DB 3UTPE 4XT1C 1RZQA 2WSKA 3OZKA 1SJEB 3KMDA 2H2PD 5J56B 1J9TA 4ZD3L 3NVQA 3ZOAA 2YD1A 3LRSB 3NCMA 3ZDWA 1YVLA 1KT2B 5TQ2H 1MFCL 2H9GA 4GQQA 5F72S 4KJWC 4RBPK 3HMXH 4HU2A 4DAGH 4OW6A 1INDL 3VCLA 1NOLA 4UT6A 5E6ZA 3TCLA 4LKXB 4UM8B 2AP2A 3RZCB 4JHUA 3SYQA 2IH3A 4N1HB 4N90D 5JIQA 2HYMA 1A4KA 2GTWB 3IXTB 3KNBA 1ETZB 2QQLL 4TLKA 5F3FA 3RWGB 1E4XI 2WBJD 1JXDA 2NXZC 4L8DA 1MIMH 4WI0A 4WUUA 2NX5E 4AEHH 4DK6A 3O3BA 4OZHA 4EI0A 5AD0A 4PRAA 4G7VH 3TF7C 1UXSB 4WI9A 1MCHA 2Z1PA 1IEHA 3MUUA 5C0JA 3JV6A 5FEBA 2CXGA 3MRBA 2R15A 4Q56A 1I1YA 2X4UB 2N0MA 2UY7B 1LNUB 1MPAL 2FT6A 3FCBA 1BFTA 1CFMA 1XCTA 1QRND 4JB9H 5DS2A 3S98A 4FQIL 1CF8L 1T22A 3K6OA 5HHNB 1T1XB 5KEZA 1HSBB 2KZBA 3FTUA 1VZGA 3UL4A 3B7UX 1D6EA 4NM8L 1AKJD 1PL3A 3FTWA 3OKOA 3U36B 3OKDB 2N59A 1T7WA 3TBSB 2R1WA 4E42B 5BUGA 1S3KL 4HWZB 4B9FA 2VH5L 5D72L 1JPGA 1MJ8H 2HKHH 5MEOB 4F37F 1KB9J 3WTUA 1THAA 1ESOA 4AIXA 5ILTH 2YA1A 4QEGA 3QUKA 4G6FD 2Y06L 4IRSC 1ADQL 2AAVA 4HIPA 4Y7MA 1HILB 1OGTB 2WGXA 4LSSH 5G4MA 2RBLA 1X5IA 1FHNA 1AZVA 1UOLA 2BY2A 1E4HA 5D71L 4EDXA 5JW4N 1FVCA 3KJ6L 1GPOL 4ZS6C 2ZCHH 2EC9U 2ZCLL 3G6AB 3LZFH 4AXWB 2BFVL 3OZ9L 3DRTA 1CPUA 2N01B 4U1SA 3MUGA 4XPGH 3T0XA 4WNSA 2O5XH 3ZE0B 1R4XA 1MAJA 4OZFH 4AC2A 3DMMC 4J3OH 3VWKD 1LJMA 4Z5RA 2IAMC 4RGOL 3BJ91 4OCSH 4OT1L 5JDSB 2XWJA 1Q0YL 5ICYA 4J28A 4MB4A 4MCYA 5B38B 1KWGA 3NFPA 4IEFB 2ZKYA 4R0LC 3S97C 3LXAA 4K9JA 3SCMA 5L2JA 4OD2B 5TDOB 3DTXB 1X5KA 3VGHA 2OR8A 1A47A 2QSVA 2YSSA 1AIFA 4I0PC 1OSZB 1Q9LA 3P3SA 4NN5C 4NQCE 1FL5A 1DVFB 4WU7B 4RZKA 2WXQA 5C0CD 5KVEH 3FH5A 2P49B 4NQVB 1TQTA 4S1RH 1C1EL 3FQXA 2C3VA 1OCRB 2QJDA 1L5GA 1VPOH 4FFYL 1AHMA 1MI5D 3UEQA 1T20A 3WFEL 3BAYA 1J0YA 4IBLT 1ZE3H 3KPTA 4MJIE 4ZFFB 4OAWA 1ACCA 2PO6C 4WK0B 5EEZA 3DJSA 3G5ZB 2L04A 3LN5A 3MV9A 4Y1AE 3L7FA 2KZKA 4RGND 3KGTA 4HJSA 4D0DB 1WICA 4MCMA 5BV7L 3I2CH 2QHRH 2VN6A 4Q9RH 3WHXA 3AB0C 4ANKA 2B5IC 1CLVA 2X89A 4G9FE 4J7RA 2OFQA 1A1NB 3A67L 5AOJA 5GRVL 1XIWA 1G7MA 2KHAA 2C7UB 2WXJA 1R24A 2XSKA 4S1DC 3SDCC 3BWAA 5CLZA 1TZ8A 3SBRA 2ADFH 3FB5B 2MQCA 4GRLA 1KJ3H 5LDUA 2YZ8A 3JWNC 2NNRA 3OX8B 2IQAA 3CK0L 1NIDA 3QIWB 3QQDB 3HZVA 3JUZA 2G9KA 5E9DD 3ZYZA 1X9QA 2ZAHA 1MVFA 2VDNL 3KWXA 4FQXC 4JQXC 1PZAA 5M95B 1CN4A 3F64A 3K7UA 2DWXA 5DZVA 1E2VA 3FJTA 4QIRA 1WITA 1D5XA 4YLBA 1A3ZA 4LLQA 3EZ8A 2XFXB 5E1HB 4X7TA 2A77L 1TZHB 3EFDL 3SKNB 4AZ8A 3MCYA 4GQPH 4ZUTA 4Y16C 2VDKB 1HI6A 3CVHB 3D12B 2VERA 1KTJA 4BEIA 5IJVA 3ATBA 2FQEA 3LRGA 1F90L 4OI8A 2WXGA 4WHTA 4R7LA 1GGCH 3VXRE 3GF8A 1IO4C 1U2YA 2H8PB 2PWHA 1BHGA 3BUBA 4JPIB 4J12A 5KYWA 1L6ZA 1IBYA 2JTDA 4PJIA 4DEWA 3EG9A 3QCUL 3LDBB 3SQBA 3UO8B 1WJ3A 2ORBL 4UILL 5JHLL 1YA5A 4DKFL 1TYJA 3CX5K 4O2FA 1N0XH 1JGEB 2GC7C 5HP5A 1ZLDA 3V0IA 1UXMA 2C3GA 4PYHA 1NCUA 3QI9D 4DZ8A 1M7IB 3UBXB 1IAII 4LFHG 2X1XR 3CU1A 1RHFA 5CP3H 4JDVB 4WVRA 1KCUH 2OMWA 1CVRA 3TS8A 2RB8A 2QADC 1F6AA 4NCC1 3NA4A 4WFFE 3GJFA 3FB7B 3H85A 1VEPA 3ZVVA 1QG3A 4P5TC 2EDRA 3HKZA 2P5EA 4A04A 5I75C 5DZJA 4JFWA 4DSYA 2NY5L 5HY9A 1N0LA 1ZA3B 3NPSB 3EJZC 3OXRA 5GGVH 1QSED 4IBVA 4LE8A 3CLFH 2XN1A 4NN7B 5EIVA 4ZFOA 3P77B 4MQXD 5AAWA 5F9DC 2QQKL 3B1TA 3BO8B 4AYEC 3DIDA 2QKIC 2J43A 5ADOH 1FO0H 1CICC 2C9UA 2RQEA 2VDOB 1TO5A 4G7QB 3F12A 4LSUL 4Z95H 1QHOA 1U36A 1UUSA 3LQAH 4K5PA 3EJQA 2E9GA 1XF5A 1PLBA 1TLMA 1L7IH 3LSOB 4PTTA 3VA6A 2IO5A 4WEBL 4R4NC 3QUYC 1DSFL 1KPUA 3IEAA 3N0AA 4PB0H 1BLNB 2D03H 4X6CA 4Y8AA 5IEKB 4CGUB 4OF8A 1OKEA 1X4YA 4OZGF 1U30A 1IZJA 4KK9D 4NKIL 4ODBD 4QOKB 2IANA 3O9WC 3V9CA 3QNZA 1P2CB 2GIYA 5KBDA 4H0GA 3ZY7A 5F1SA 3GIZH 3F5WB 3ZN6A 4PBWD 1UD3A 4KFZC 4CA4A 4MS8D 5EA0H 3UTPD 1LP9B 4QRUB 5K39B 5D6DA 3BKCH 5ETUA 5FECA 3PQYA 1MWOA 3G04B 3WEXA 1NGYA 1SXAA 1LWHA 1KPVB 2OJEA 3UC0L 2RJMA 5FUZL 2CRMA 4PS4L 1KNOA 1IKNA 5GGQL 4L37B 2ENPA 3KLSA 2XA3A 5KSUB 4NZDA 4LFHD 3U82B 2B1HH 3ES6A 4FKHA 4MAUH 1KOAA 4KI5E 1AXTH 4AWJC 2Y7LA 4M1CC 3V0JA 3EBHA 2Q8AH 4HWEH 3ULVF 1RIHH 4ZUUA 4F9PC 4U7SA 3ULAB 2NX5D 4GYBA 1EHXA 5IFHL 4R4FH 5LGHL 1TEYA 3JWNE 2CO4A 1YJDH 1RZKH 5ESQB 4PWJA 2CJSA 2P1YA 1ZV2A 2QL1A 3GS4A 3EYSH 4H8UA 3U6RB 3CH1B 1HX0A 4FLRA 5DT1L 3HNSH 4NNXB 4AMKL 4AT6B 3UOAB 3TBTB 2VUYA 1IM9A 2HKFH 2W59A 4PGCB 1J0IA 4MA7H 2WQVA 4AM0Q 1VACB 3TJHD 4Z7WB 3KW7A 2CM6A 4PJBA 1A8JH 2BWQA 3VXUA 5D7LA 1T0MA 3IFLL 4RSVA 2IQ9H 3QZOA 1OL0A 3AS2A 3IDMB 4KZDH 3V0EA 5C8JA 3MJ9L 1MWAA 2ESVD 4GSQA 5GPRA 2BIHA 2VITA 3HNTH 4M6NL 2CUMA 1NEUA 5MERA 3EYFB 4L5FE 3HB3D 2ATPB 2IDTA 5T33L 1TSRA 2PTVA 3ULSB 2CBMA 5F7EL 1NGPH 5K9QG 3WN5A 3T77A 4JDZB 4ZUVB 1KV3A 4AQ1C 1GSKA 2MCMA 1FYTB 1KY6A 1TVBA 3MTRA 2XVLA 2J1WA 3MRHA 3H6AA 5AKSA 1EAOA 4KXZI 4HUXB 4GP8B 5I6KA 4BK8A 2ADIA 1CE1H 1CQYA 3FTGB 1CGYA 2CHDA 5EOCJ 4ANUA 4CC4C 3VX1A 1J8RA 2VXUL 4FFZL 4Z7NB 1SF5A 4M1GH 4Y5YB 5KYNA 4NM4H 1BSIA 3FFOA 3UYRL 2B77A 2HX8A 4NQEE 1RMFL 5TK2A 2AJXH 4XPBH 2JFCA 1RK1B 3GHEH 2NOYA 1T1ZB 1TEGA 2DOCA 3RPIB 4J4PC 4JO4H 2AEOA 3SQOH 4BA0A 4MAYA 3F3HA 3M1BA 4K5MA 3BJLA 1XD1A 1OGAE 3HA0A 2LVCA 3WNNA 3D0VB 2BSEA 1ZT1A 4NJAL 5SX4I 3NESA 1KJVA 2ADJA 4NPKA 1KACB 4KBPA 4C4KT 4FLHA 4CMMB 4BZYA 5T3ZL 3QORA 3GSRA 2VISA 4NQCD 4IRZA 2AC0A 3TEUA 4PRBA 5C0AA 4JM4L 1Z3GL 5E4EC 1PG7H 1WEJH 4B50A 5AOMA 2V3FA 2MCPH 3C60D 4G7SB 4UOW1 1B3JA 3BDYL 4GKLA 5DHMC 2XHNA 1GGUA 5I1JH 5J13C 2E27L 4B60A 1KEGL 1RU9H 2XBZA 3OR7B 1K8DB 1XF1A 1DN0B 1HQRA 5CIPH 4N2IA 2ZTBA 5F1NA 1GHFH 2F6AA 1ZLEA 4PWHA 3NCEB 4JHWL 4XN9A 1U58A 1FNHA 2HT4D 3UC2A 4YDJA 3NACH 4FXGC 1RY7B 2LE9A 3CU7A 1QKZH 4AQAB 1SOKA 1JRHL 2EH8H 3D9AH 4HIIB 1NPUA 1CLZH 2H3XC 1GXEA 2X2YA 4C8XA 1E67A 2UWEB 5T1DL 3LKSA 5IEHB 4PV9B 2EO7A 2Z6FA 1ZE3C 3G08A 5JLZA 5L2KD 1RD6A 2HA1A 3HR5A 3CDCA 4G42A 4KTEL 2FSDA 5H4YA 2A9BA 3F7YB 4KJWD 4EXKA 1RP8A 5CBEA 3RWHB 3DBSA 4WHDA 4G7YL 2IFGA 4LSVL 4H1LH 4OLEA 1IQWL 1W0VA 3NJNA 3GGWA 2FR4A 1IKFH 2CWRA 2D8KA 4RZCB 3DUSA 4BFGA 2PR9A 2X28A 2NXZD 2PCPA 2F9BT 2X0VA 1CGVA 3NTCH 1HKLH 2WYIA 3TGXA 4OU3A 5FC9A 1ZLUH 2VXVL 2BERA 4WWKB 1QLRA 1NGXA 4EZJA 1BXXA 4PJHF 1JWSA 3L3OC 4PV1C 1HAUA 3B3IB 3LZLA 3MLZL 1CB4A 1QFWL 3I02B 2ZYSA 3MC0A 4JO5A 4OLYL 3TN0A 5L88H 3CPLB 3LIZH 4KROB 3WKYA 1GS7A 3K5RA 1WK0A 4LCYB 4MMZA 3O0RH 5D96C 1TMQA 2ZWLT 4OIIH 1BVOA 5IQMA 4Z7VE 3VXRD 1BZ9B 4CGTA 1FPTH 2AABH 3AM8A 3N5AA 3ZKQD 3DX0A 4URKA 5DSCB 1FNGB 1T21A 1USZA 4BQ6A 5A7BA 1QWNA 3IDIB 4X4XA 3VM5A 4TSBH 2BHFA 2GUOA 1T1YA 3O8XB 3PGDA 2FQFA 2CKBL 1F8TL 1QHPA 4LAQL 5HGAB 2G75A 3EDKA 2YEVB 3SZKC 5K9KA 4F7CB 3BSZH 1ZGLA 4UI2A 3ULUL 4G8EB 2XFGB 4KNUA 3CFMA 3ZDZE 4JDTH 4Y19E 2JKLA 1TQUA 1XCQB 3DXAA 2DJSA 4YBLC 2XC8A 1E2WA 2IG2L 2YXFA 5DD0L 4QT5B 4U49A 1QNIA 1ETA1 3FOLB 4WFFD 5D7IB 2A83A 5HJDA 5EBWA 4IRSD 4G8GB 3QA3B 3JWNG 1MHEA 4BJLA 4PLOB 1U42A 1UT1A 2WTPA 1IFRA 4IBQA 5HHVH 1YSOA 1J9RA 2LGNA 4E41E 3PWLB 1QUNB 2Y2WA 1Q38A 5I17B 2WNKA 5D2LE 3N42F 5D7JB 3NIDE 1BBDH 4ZS6D 2YUVA 4HIHA 1CT8B 2DI7A 4HZAA 3T0EC 4ZMZA 4ZPTA 2IFFL 1IT9L 4HV8B 5FYKD 1E6JH 2F5BL 4UMGA 3DPDA 3DMMD 4XBGB 3WNMA 2AXHA 3TIDB 3G5WA 3VG9C 3VXTB 3MNVA 5CILL 2DAVA 2MJWA 2PR4H 4TVPH 3VXSA 3HZKA 4UQBA 3RTQB 3TWYA 2FECL 3SKMB 4NO0B 2X05A 3HNVL 2KZ1B 4MQSB 5GQBA 3P4NB 1N7ML 4HFWA 4GW1B 4I0PD 3GWJA 5CMAB 5CO1A 4IMLB 5B7MA 4PMFA 3LPWA 4K94H 1I8AA 4IRJC 1YZZA 1UXLA 3EFFB 2FGWL 4MNQA 1K85A 4JVWA 2YS4A 1L3WA 2VABB 3TEXA 1HXKA 4P04A 1JK8B 4F58H 2AJVL 2R2BB 3KPQB 1MFBL 1QWUA 5GS1A 3FO1A 4OUOA 2PO6D 3K2KA 4GKSB 4OZFA 3AREC 2WZPA 2FSEA 2O5NA 2NY6C 4JVPA 4KKRA 5DMIH 5FA3A 3FUIA 5KVEE 4R83A 3FT2B 1RUQH 4NN6C 4NZRH 1JPSH 2ERJC 3O6KL 4RMSA 2PCYA 5KG9B 1E9OB 4DP2X 1XF3A 3QJHB 3MNZB 4M62H 1QQDB 4XP9H 1QR1B 2DJUA 4WWID 2J8UB 2DLGA 3IBEA 1X6LA 2BIPA 3T9WA 1ET7A 1X7SA 2YJQA 5T8IA 3WUWG 4NZTL 3SDCD 4S1DD 2YXWA 2NQDA 1GY2A 4YWGL 3K1KC 1YEEH 3QQ3A 4K3DL 2O61A 1CR9H 4ZMXA 1KGWA 1FBIH 4NOFA 4BK4A 5DC0A 4X6DF 5ACZA 1MCNA 5E4IA 3C5JB 4NYLA 5FYJD 3K2UL 1WZ1L 4KVCL 5E8PA 4FQXD 1RKRA 1CDYA 5FHAH 1NCWL 4K71C 4XMLL 3QR1A 2MHAB 2XWDA 3T6WA 2GY5A 3MBEA 3K6DA 4Y4HC 4JUTA 5E8DL 4B3VA 1BQ5A 1YJDC 1I1FB 4K3JH 5C08B 4Y16D 3HN3A 3BP4A 3AG4B 2VLRA 1JCKA 3DX9A 5DQJB 3C2AL 3RFZA 4M5TA 1BM3H 3IAGC 2OMXB 1NKOA 1Z9NA 2JELL 5JIPA 1ROCA 1WTLA 1BFOB 1YEWA 1TOXA 3D18B 1INQB 1NSNH 3JV0A 1YYML 3PP3H 5DHVH 5AWNH 5GGSB 1P5UB 3SY0B 2F0CA 3VFWB 1IEAB 4TUOB 3L08A 3NZ8A 5L0QC 4B41A 1WIPA 5C2BL 3BUQA 1M1XB 3PS6A 5HDLA 1I82A 2CUHA 2P7TB 3QSKB 2E9IA 1LK3H 3N1GC 3T8VA 4DGUA 4BWTA 5BW7A 2WLJA 3N1QC 4ONOA 2YD0A 1YDPB 3FTVA 5KUKA 2EDEA 3FQWB 3NJJA 1NIBA 4FFVC 4NFDA 2AK4E 3RX7A 5HBBA 4WW2B 4ZX4A 3IVKA 1HQ4B 4YHPB 3CHQA 5C0IA 2IDCA 1J8KA 5GS3A 1YQ2A 3NFSL 4NT6B 2QADD 1OSPH 2P80A 1AGDA 5CU5A 1I9JL 3VXME 1K2DB 3ME0A 4NQED 1NFDB 1FCGA 4PTUB 4WNQA 4P5TD 4QLWA 3LEVL 4E5XA 3L1FA 2IEPA 5FYLL 4J8QA 5AKTA 1VKXA 2WSPA 1I7RB 2VE6A 3IJYA 1BD2A 3U7AA 1A9BA 4YDZA 2JIXB 4FQPA 2ZXDA 3Q6FA 4G80A 4A7SA 3EJZD 2A4EA 3NIFB 3MRKA 4BWWA 5FO2A 5EUOB 1ES0B 5AENA 4OI9A 2G60L 4ELMA 5BV7B 3T65B 1QFHA 3ZMEA 3IJEA 1S7WA 4PR5A 1CICD 5DVLA 3VQ1C 1XB3A 2OCFD 3VU2A 2YPVA 1IBHA 3LZOA 5DUMH 5HHQB 3KEDA 2MKWA 2ZX8A 2YN3A 5DI8A 4L3EE 3UTSA 3ZE1E 3SDYL 1KBPA 1Q9OB 3IJ7A 3RKDC 3MRIA 3GKZA 4AYFB 3GJEB 3JXAA 4U6TA 1VADA 4L4VD 5GGSY 4F8LA 3CE1A 5SWZE 3BKYH 2DQIL 3LX9A 1Q0XL 1W9XA 3RNQB 3NRFA 4OZ4B 4URTB 1U8IA 5DJAB 1DCEA 4R4ND 2PYEB 2ZWNA 3QUYD 5D7SH 3VG0H 2BVOA 2VDNB 5KN5B 4CSZA 2R0LH 4R4BA 2K6WA 3S2AA 4KMQA 3O9WD 2HT2C 4OQTA 3T09A 3ZGHA 1ZV9A 4ZUWA 4LHJB 4AW7A 4RAVB 1SY6A 1MCJA 1MZZA 5CN2A 1ZDSA 3RAJL 1Q72H 6CGTA 1WCBB 2ZD0A 3S36H 3ESMA 4KAQH 2PXYB 1NDMB 4Z8FH 4X0KB 4QHLB 2CDFA 2QZQA 3HG2A 4Y8DC 3QJVB 1CD0A 2I07B 4EIUA 5BXFA 4HZLA 5D2NA 5FO9A 5A43C 5IVZB 2YAMA 5CJOH 3TH2T 3W81A 3HE6A 3QB7C 4KFMA 1HYRC 3MBWB 1A6VL 3VWJC 1A3QA 4XNQA 5FCUL 1PZ2A 4LCWA 3P40A 2EE9A 5AVYB 3MA9H 4LL1A 4M1CD 3DECA 2IV9A 3OHXB 5F88A 2R59A 1PS3A 3ZHLA 2E7LC 2XG5A 1K4CB 4N2KA 2H2SC 4J1UA 1HC1A 2HFFB 1HZHH 2VXSH 2XQBL 1WFNA 43C9A 3LZQA 5BQ7B 1EJ6A 4HS8L 3AACA 5ISZD 2Z92A 4J3OG 4WEUD 3NJVA 3WJLA 1ZIAA 4N2EA 1N64H 1GGIH 4GEJA 3SPVB 3QUXB 2JKWA 3I9IA 1S8DA 4I18C 2ZAIA 4UTAH 3AABA 3D85A 2QBWA 5GHWL 1M7DB 1SBBA 4JFZH 4FD0A 4NXKA 1Q94B 3CMOH 3O3AA 4KNTA 3RP1A 1XGYL 3MSPA 2WAHA 1P7QA 3SDXF 2EVFA 3HG1D 1PKQE 5CEZH 1EDQA 2FECI 1KGXA 1RVFL 4U4IA 5E9AA 4ODXA 5TE6L 3L5JA 1NOAA 3ILPA 1OQXA 1JWUB 3WY4A 3ZSTA 4Y5XA 5BRZE 4XVUC 2APXA 4NO3B 4AYGA 5E56A 3NGBB 3SDAA 4DGIL 4UCFA 4YMPA 1CLOL 3CZFA 4JL2A 4N9GA 1SDDB 2WJ7A 1LL1A 2ED7A 3K46A 3ZR5A 4Y19D 2VMEA 1CO1A 1EPFA 4KK5C 5IROA 2IWFA 4QAMB 4AEIL 3UYPB 3PL6C 2YD2A 5AOLA 2OL3B 2OZ4H 4L9LA 3WE6B 3NA9L 2YK1L 5C2UB 1U92A 2YGOA 4AJYV 4RFEA 4JFHE 2DLIA 3EW3B 1X44A 2LABA 4JJ5A 1O6SA 4IS6A 5HYFA 1KYOJ 1FZKB 2W0KA 1KDJA 3SB3A 4EVNB 2GT9A 3AS1A 1I9IH 1JZEA 4P2QB 1RJLB 3QVAA 5DFWH 1V3KA 1ZHKB 1T3FB 3F7VA 2BC4A 1Z9OA 2ZWZA 5EU4B 2VZVA 4KV5E 4QD2E 5I18L 1Z6JT 3TBVB 5CJ5A 1EZVX 2NYYC 5K33A 1JXJA 2WB1A 3BMWA 4J4PD 2PPFA 4LHQB 5JOFA 3CFTA 2GC4C 3KXFA 4M7LH 1CI5A 2VDKH 1H5BC 3CVHH 2ZIDA 1EA9C 1HH9B 1E8WA 1WO2A 3GIVB 3N85L 4L23A 1JFHA 4A2EA 3FAWA 3PV7A 2IDFA 3PJNA 1HEHC 3T3ME 5I5JA 1ZLSL 3K81A 1JOIA 1BQHB 1S7RA 3CCHA 3A6BL 3KGSA 5HDBE 3TNMA 5I0VA 2NW3A 3OPZH 5ESAB 4HU8A 2DZEA 3X14A 1ZANL 4S2SB 1T7YA 6PCYA 5ID1B 1ZHBB 2VQ4A 3AUWB 4U31A 4J3XA 4RDBA 3LV3A 4ZTPH 3GMMA 2EUVA 3EZJB 4M1DH 4JY5H 4N0RA 3E8VA 4IKLA 5L9DL 3Q6GH 3IPEA 4B9ZA 1TFPA 1HHHB 4HGMA 5JNYA 3Q1SH 3E6HB 1NC4D 3DX6A 3LJ3A 4TS6A 3Q8BA 4ELDA 4ZW5A 1E28B 4HT1H 5GIRB 1ODUA 4JO2L 4R6UA 1MY7A 2XG4B 1MREH 2CPCA 4Q14A 5HHOE 3GK8L 1U8MB 4N0UA 4LB8A 4FCAA 1OOWA 3LS5L 4JFEB 3ARFA 5HHME 2V2XA 4LCUA 3PHOA 3Q2VA 1JCVA 2ZOLB 1YYCA 1P53A 4XXWC 4PJGE 3AT8A 3DVNB 5EB9A 4PJDB 1OAQL 3WIHA 4N6QA 1XF2A 3T0BA 4XODA 2GIMA 4ABUA 3I75B 2QPSA 3P9WB 3U6XA 1P6AB 4KGLA 4P2RD 3HFML 4NRZB 4RFOH 3V9FA 4GRWB 2VDOH 2C9RA 1XBDA 2PETA 4ZAKB 2OTWA 2WMPB 1Y6KR 1XGTB 5CBAA 2H26B 4DQOH 5BVJA 4GAGH 5TH2A 3MRRA 3X13B 1IGCH 1F4WH 2E4TA 2F54A 5J57B 3TYGL 1TENA 3KYNB 4UANA 1NCDL 2QKSA 3QNXB 4Y1SA 4JQVC 5F1OB 5KOVC 3BFQG 3LYRA 3RU8H 4ZO8A 2ZPKL 4B7LA 5IV2B 3L4VA 4YHKL 1W6LA 1BJMA 2LHAA 5EO9B 5IR1B 2BNQD 4LLMA 5B39G 3WJJA 1DEEB 3CFQA 2ZKHL 3QK0A 3V6OA 5EDSA 1A1OB 3NP3A 4LSQL 4H1LA 2AEQL 1RZGB 1DLFH 4IBWA 4PJCE 2BOBB 5IHUL 2VL4A 3TXAA 2XIBA 3IRPX 5JW5B 4FXKA 4A55A 1KBBA 2PLTA 1BJ1H 2BXZA 5DA0B 4GXUM 4BH7A 2CJTA 5FCSH 4I77L 2HFEB 2K6ZA 4MJ6A 2NLJA 3P4LA 4KZ0A 4NGHH 4XE0A 4EI5A 1DUZA 2AK4D 3O41B 1YYLL 2LLLA 3CFEB 1E4WH 3QQ4B 2YEQA 4BM7A 1XH1A 4M4PA 3V0HA 3V79C 1TJIL 1EZLA 3DIFB 3BGFC 3QFJB 5FKAA 4G1MB 3WI9A 1EAPA 4OCXH 2Z4TA 3VXMD 1QA9B 4P4KB 3REWB 1PLGH 3BP5A 3UADA 3AXIA 1BVLB 5SWSA 3DURA 5A6IA 3NCJH 1TMCB 1RULL 4P9HH 4DQAA 4HOXA 15C8L 1T7ZA 5ERWA 4KDWA 2CBTA 2Y5EA 5IJDC 3N2JA 4F15C 2ZJSH 3QDJB 1SHWA 3QEUA 4HXBH 4XAKE 5C0BA 5HHXL 5C0EA 5F6HI 2V4LA 5FW8A 2R2EB