2KMWA

Solution structure of at3g03773.1 protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
b'SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At3g03773
molecule tags Structural genomics, unknown function
source organism Arabidopsis thaliana
publication title Solution structure of At3g03773.1 protein from Arabidopsis thaliana
rcsb
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kmwA01
2CG9X 1X5MA 4ELDA 1WFIA 3AACA 3AABA 4JUSA 4YLBA 3VQMA 2XCMC 2BOLA 3VQLA 3L1EA 4JUTA 3GT6A 3Q9QA 2WJ5A 5DS2A 4PBDA 4M5TA 2KLRA 3IGFA 4MJHA 3L1FA 3GLAA 2Y22A 4RZKA 4YE0A 1SHSA 1RL1A 3QORA 3Q9PA 3EUDA 2WJ7A 2JKIS 2CR0A 1WH0A 2N0KA 5LUMA 3QORB 4I88A 2RH0A 4M5SA 2KMWA 4PCKA 2K8QA 1EJFA 2N3JA 4YDZA 4ZJ9A 4YL9A 3N3EA 4FEIA 3J07A 3L1GA 2O30A 2MNWA 2Y1YA 3QORD 3QORC 5DS1A 3W1ZA 3GUFA 4YLCA 2Y1ZA 1WGVA 1GMEA
chains in the Genus database with same CATH superfamily
4LU5L 2I5YL 1J1PL 1MN4A 1T7YA 5A2AA 2ADYA 1IAII 3TYFB 3X1GA 3G5WA 4ZO9A 4NKDB 2O5XL 5E7BA 3RIAF 1KPVA 1FNHA 3CFCH 3RWJB 2NYZA 4XP5H 3RFZB 3K7UA 1E4XI 3O3EB 1ZV9A 4TVPL 3WD5L 3I74A 1NCBL 1DUYA 3HIZA 4FFVC 2CA3A 3TVMB 2W95A 1TSRA 4YHML 1KPRA 2X7LB 1P0SE 4UT6A 3D48R 2P8MB 1KB5B 4XBMA 4S0HA 4P5RA 5T1DL 3KW8A 3PREA 1CPUA 3VXUE 3ULUD 1U8IA 1RZJH 1F3DJ 2PYEE 3V2AR 1CDCA 3BPLB 4KKLD 5JIIA 4RFOH 4PRIE 4OJFH 4LF3A 1OV8A 2DI8A 2GEEA 3UFIA 2XTJC 4PJIA 3GK8H 3RP1A 1F6LL 2BNRA 4P2OA 4YR6B 2BNRB 4P2OB 2OXGA 3TEXA 3DYMA 5IIEB 3S4SA 3MV8A 1IT9L 4NNXB 2ZJSH 2DWDA 4DSYA 5E1HB 4XNZB 1HFUA 3OAZK 3K2UH 1X4ZA 2WXOA 4TNVF 5B38A 3RWJA 4WHCA 1YDPA 3LHPL 3ARDC 2CDEB 3QH3A 5DEFB 5L88H 2DM7A 4HZ1A 5ANME 4DP6X 1SLUA 1I7UA 2JIXB 3ZL4L 1S7QA 2EYRB 2CO3A 2ZXDA 2FUTA 4MWFB 1FH5L 1RP8A 2XTLA 1NDGB 5FO8A 1B6DA 1AI1L 3B9KC 5C0DB 5ALBL 1N67A 4DCQA 3FFOA 4B9ZA 3LNIA 1NL0L 3NRPA 4ENEC 5FF6B 1MH5A 3IJHB 3QCUH 4ANVA 2GAZB 4MAZA 5HI5C 2J55A 3SE9H 3QQ3A 3C6EA 4ZMYA 1PTZA 3KWWA 3F7YB 4ANUA 3MUHL 1GGBL 4Y5YC 5DSCB 1KBVA 1DJGA 4JCWA 1TJMA 2DBLL 3WLWC 1Q8MA 1XMEB 2VDPH 2VC2L 1KCSL 1Y07A 4PEEA 4QHMB 4N6RB 4BIKA 4EF3A 2BXZA 2WD0A 3BIKB 3SO3B 32C2A 1EO5A 3OX8B 5E6ID 1CFTA 1E0OB 1HWHB 1A6AB 1YJDL 5EO1B 4BZYA 3LNFA 4CN4A 3NSJA 4MJ6B 2A6DB 2F1BA 2KZKA 5AW2B 1PL3A 4DGVL 5TF1L 1YECH 2YD8A 4YL9A 5DRXA 4JRYB 4K8RL 3C6LB 4LRIA 2NX5D 4PVNA 5IHZA 2WTRA 3MCYA 1YEJL 3QJXA 2HMID 3LS4H 2GJRA 5ICYB 4ODVH 5LNEA 5E2WH 4ORGB 5KZCD 2J21A 1C7SA 4JQIA 5F88B 1NFKA 4FQQA 4KKZA 3QPXH 3UAFA 5J9PA 5JHBA 2X4SB 1NFIA 2RCSH 3DV6B 2CLVB 1GIGL 5DHVH 3EJSA 3MJ9A 4XXCA 1ZANH 3FO9A 3GXNA 3MMEA 1J0KA 2X5PA 3P4NA 3U4EA 5HHQB 1SMOA 4RETB 3D09A 3V9EA 5KEZA 5LGJA 5FLVA 1LK3L 3CIAA 3H8NA 4A6YL 4YHLL 1NSNH 2AITA 2F54B 4FTVE 3SE6A 5KW9L 1HINL 4HFUH 2YXMA 3SQOL 2Y24A 4S2SA 4XHJD 2N7AA 3WIHA 1GTNA 1K3IA 2H2SD 1A7NH 4XZUB 4XCFH 3VO0A 3PDGA 1WD9A 3SKJH 4I0PD 4AYID 4ZUSA 3O8XA 1OHQA 4YGVB 4HOZA 1DQLL 4PJHA 5JZ7C 4PD4J 3N04A 1DVTA 3VM5A 4AVKA 3MOAL 5JYLA 2NX5E 1E5CA 1BPLB 3VXQB 3TWCH 1R3HA 4Q97A 5D7IB 1FYTE 1I1CA 1E8WA 4DN3L 3QT2A 4J1UA 1FIEA 4YFLI 3QRFM 5D7IA 1A64A 4HWNA 3K1DA 3PFUA 4WFED 3SIKA 4BINA 4JHVA 2V3FA 4GB9A 2L3BA 4NQEB 4XAKD 5LO7A 4KXZH 1IEHA 3GZPA 2NNAA 4WGVB 5JW4Q 4AQ1B 3IDNA 4M5YH 3OXSB 1J0IA 1ES0B 4JHAL 5I75C 4PCKA 3F7VB 5JPNC 5HSFA 4R4FL 3LN4A 4HH9A 3WJJA 1FRGH 3M1BA 4I8DA 3X2QB 2HVKA 2WVVA 3WY3A 3KHQA 3FQRB 1MW1A 2BOLA 5E0FA 4TSCH 3WFHB 4OCRL 4P4KB 4FYTA 2Y06H 5CEZE 3NJXA 3S98A 1FYHB 1G0DA 4LGSB 4XPBH 5IESH 4TTGA 4NENA 1HNFA 5CD5D 2JLLA 1X6LA 4NRYB 1W72L 1P1ZB 1P6AB 2PYFB 5C0BE 1G5AA 4HJ0C 1BD2A 1A9EA 4W9IC 3DBXB 2KMWA 1RSYA 1CO1A 3BVUA 4LU5H 4OD3L 5DHEA 2GC7C 3N1PC 5EUOB 1LO4H 3BVNA 5I19L 4NZTH 3DECA 2ICWJ 1KJ2L 4YPGA 4K5MA 4I77H 1ZJAA 4MXVE 4UINL 5C08D 1RHHB 1XB8A 1PZ5A 4JQVC 3PG2A 2XX0A 5B1JA 3ET9F 2C9UA 4LQFL 4Q6IC 1DQDL 3RKDD 2IAMB 1J48A 3FUIA 3PU7A 2BNQA 3FSAA 3QC5X 5D1XA 2RGSA 2BZCA 5KYUB 3NIDE 4EN2A 2X4QB 2MFNA 3UTZB 2DEWX 4S11A 4H8VA 4K4KA 2ZKHL 2CK2A 1KB5A 4F2EA 1R24A 3NJMA 2WVSA 2C8NA 4Z3IA 3S4SG 5E1AB 5KG9A 3RVUD 3QUKA 4YLQT 3KPSA 1EBAA 5E99L 5DUPH 5JW3L 3QUYC 4CJ1A 2ICEA 4AKOA 4EN3C 3R19A 2IAMD 3ZHNA 5DI8B 1S7RB 3IJYA 4RZCB 3F2LA 5GGVH 3CHSA 4Q9QL 1VSCA 4S0TD 3L2NA 3H9ZA 5I1LB 3THML 5JPMC 3VD4A 5C0AE 2UZIL 4TPRL 5KSAC 4ZMPA 3CPLA 3DHMA 3ULVE 3JT2A 4G1EA 5EO9B 4MRBA 5AOZA 2AABL 2ZP8A 2RD0A 5GS2H 2RH0A 5DJYB 1T89A 4LLWA 3K6NA 2PCPA 4L23A 3QIBC 1VKXB 1UYWH 3NH7L 2LW3A 2M26A 3W0WD 4BE5A 4MQ7B 4XP9H 4NOFA 3RVXC 2OMXB 4OZHE 2EYSB 4X5WA 4KNQA 4HPOL 4TL5A 1KT2A 3M17B 3NGBC 4UMGA 3VDAA 1ZVSA 1GC1C 1O5PA 4PJEA 3UTQB 3DVIA 5DRZB 4KJWC 2A9MH 3OV6A 4N1HB 4PGJA 1A3RL 4DJMA 5E8NA 1UCBL 3B7UX 4CVXB 3MZGB 4G82A 5FB8A 5AOJA 1Z5HA 1A3ZA 5TQ2L 4HUUA 5F70A 5HHOB 2MNWA 1C16A 2F5BL 2HLFD 5DS1A 1A22B 2CO6A 4MDIA 2QKIB 1XB3A 4YHZH 1L0XA 2EUWA 1KACB 5ETUB 1T2XA 2ZXAA 3MODL 5FEBA 1NFDB 1PYWB 2B1OA 4BZ1A 4AMKH 4R96A 1EDHA 2QT6A 1DBKH 2YKKA 3VG0L 4TNFA 1Z9SB 4F20A 5LXVA 2ZXQA 2VM4A 5EUKA 4JZNB 4NP4L 1U8PB 2OJ1A 1J11A 4CAGA 2VLRB 2GTZA 4JDTH 1JV2A 3C5SA 2WNWA 4JO2H 4AEEA 4QCIB 2Y6SC 5AKSA 1CFSB 4OBSA 1JWSB 4MD5B 4XBEL 4L8DB 4PJFF 4WFGD 3BQUB 3S5LA 5FO9B 3N0AA 1ETB1 1R17A 4A38A 3VI4B 5C6TH 3NP3A 2F15A 2CG9X 4ZTPL 1G9MC 1CICC 3UAJC 1C5BL 3VQMA 3ELQA 4XNYH 1K6QH 3RURA 2XTJB 5DQJB 4G2AA 3FT2A 1WBXB 4NT6B 1I9JL 4I3RL 3WBDA 5AW0B 2MCPH 4O2EA 2YFNA 4L1TA 1QLEB 3CFBA 4FFYL 4XP1L 1BZQK 2IXQA 3FFCD 2H8PA 3ARWA 2A83B 3Q3GB 3HG3A 3KPOB 4PLOB 5FHAL 4V2BA 4YDJA 4DAGL 3CK0H 1AZZC 1ET7A 2XQ0A 4ZFFA 2DL9A 3GPEA 1TJIL 4JE4B 5DGRA 4HT1H 3MV7B 4ELKA 3P4LA 5HHNA 3VI3B 4OI7A 3UJTL 1BZ7B 3MXWH 3N9GL 1IEAB 2WN2A 5HHNB 2WWMC 1DQLH 5C6PB 3GSWB 1V3KA 3CN0A 4WHTB 1OALA 4WTQA 2YBRB 2K78A 1JNLH 1BIIB 4G7VL 3JYCA 3K91A 3VFNA 2ESVE 1VFMA 1YC7A 3ZO0A 2CUIA 3O9WD 4GUCA 2BS71 4CN6A 1ZVHA 2XHNA 2AJ3B 2CDFB 3W39A 2CU9A 4M7LT 3ME0B 3WS6A 4JFOB 3RL1B 1MJUH 2H2PD 5I1AA 5KVDH 3P73B 4KC3B 2MWCA 2Y0SA 1LQBC 5TE7H 1MFDH 3BVDB 3GS4A 3S2CA 5TDOB 2ED8A 4Z7VE 5GGQH 1LO3H 1QYGH 3QDGB 2BFVL 4ZNEA 1SOKA 1DFBL 2Q86B 4MJ5A 3MSPA 4UTBH 3KBPA 3C6LC 3MQIA 1R3JA 1JPST 3L16A 4MSWA 3CDGB 2B3RA 2R2CA 2X1QA 1B0GB 2ICCA 5E5MA 5F1NB 5J6GA 2V17L 3ESOA 3QO1A 5AB1A 5LG6A 4O2FA 5I0YA 1YN6A 4P3DB 4OLVL 4KO9A 1CICD 1S3KL 4I0PA 3UAJD 5LLIC 1CI5A 4AIEA 1UHVA 1KCVL 5CCKH 2FWLB 2Y5EA 2X1WL 3UADA 4CC1A 4AY0A 5IQMA 4LB8A 4FTVA 2WANA 2FQEA 5J6SA 1X5KA 3FQTB 4BQCA 2BOBA 2WWKT 3FC8A 5BMFL 2P24A 4XVTL 4UMSA 2O5YL 4TQEL 5FGSA 5EBWA 1I1AA 2VH5H 1ZVYA 1DE4A 1EAOA 4P9MH 4I77L 1D5IH 2BNRD 4P2OD 3MJ8B 4LLMA 4UINH 4NDMB 1AP2A 4M4RB 4LK4A 2YEQA 2MQGA 4QRTA 1DJZA 2BJMH 3NEOA 4RMRA 4PJDB 5KVMC 4TNVK 3T0ED 2E4FA 4RMQA 3IMRA 2YA1A 1D5BB 4EO5A 3VTAA 1RZKH 1BPVA 1P7QA 1QSEA 5IHUH 5IQOA 2FIKA 1OGAA 2JKWA 4K3GA 4ZRGA 5GHWL 4ONHA 4K3HA 5AL0A 1H6TA 2FH8A 2ZKXA 4KTGA 4X83A 2VDRB 4FZ8H 3CJJA 2BRRL 4U1NA 3WTYA 3LRSB 4HP5A 5T3XH 4LARL 5C2BL 3DA0A 4PJ9C 1CL7H 2ZF8A 3IKCA 4Q9QH 4LOUC 1N0LA 4Q4IA 5ESVB 1J86A 4GINA 4N8VA 5F9AC 5KS9B 2COVD 2EDFA 1I7ZA 3V6FB 5LWYH 1VZGA 2APBA 2DL2A 3BP4A 1KJVB 3SKOB 4JQXC 4P46D 5J56B 1FG9C 3APFA 3CU1A 2E86A 4U1SA 4XVSH 2GI0A 4CN1A 4X8XA 3SOBL 4KZ0A 3RG1C 3PJLA 1PQZB 4Y4KC 1AZCA 4K3JH 5B1BB 4HWBL 5AW8B 4D0CB 1V3JA 4GRLB 4IBYA 3SKNB 2Y1ZA 4YO0B 3KLHD 2KKQA 2VMFA 3GMMB 2IG2L 3CZGA 4KJYB 1Q9LA 5CXPA 4DP2X 1LQSR 3L3IA 2CBOA 3VFPA 1KDIA 4HIIB 4OZFH 4PJCF 1NBCA 3JV0A 4LFHD 4PJGA 3HC0B 4TVPH 4HKXB 5FM8A 5E1AA 4EKXA 1AIFA 1WT5A 1MHEB 2GUOB 2BW4A 5D5MB 4P46B 4PS4H 5A6MA 1JTOA 5LCVH 3ZDYE 3UTTD 3HS8A 4WUUD 1M6OB 1MELA 3JZ7A 4TNEA 1OP4A 2BVEA 1NEZG 3IGAA 1QATA 3PV6B 1WISA 4L9LC 4A04A 1N6QH 4GSXA 2PCFB 1CC3A 3MA7B 5AWNH 1NCDH 1M2VA 2BVPA 3IU3A 3Q48A 4IU2A 3ARFB 1IL1A 2Q3ZA 1MW2A 1QP1A 5CWSA 5ENWB 4F58L 2EYRA 4N9GA 2AK1L 3O2DL 4OTXL 5C9JB 3DIDA 4JY6A 5CZVH 1W0WB 1BD2B 3L4YA 3ORJA 2L7UA 5ABDE 1QSEE 1UWYA 3VXRB 4OM1H 3BEVA 3IRZA 4NZ8A 4K7PX 5B7FA 1MDAA 3PAUA 1S78C 1OP3H 2I60H 3UDWA 4RX4D 3KBFA 1MUJB 1DVFB 1UJ3C 4RISL 1NOLA 5DD5L 1XSKA 4X6CE 2DD8H 2A7BA 1IZJA 1NMAL 2NY5C 5F7LB 3GJFK 4MNHB 2MNJB 4JDEB 3PWPE 4F91B 3MLPA 3MTRA 4EOWL 1AG0A 3DX8A 2DLEA 5TFSL 3BPOB 3DKHA 3T8MA 4LRIC 4MA3B 3CK0L 5GGUB 1U8IB 4A2EA 2NR6D 5BUGA 5IW1A 1QWUA 4G8IA 4V1DB 3F7PC 2YJLA 3UAAA 4YXHH 1MCNA 2ZYSA 5IW1B 2MKLC 2JK5B 1TO4A 4E42A 3RA7H 4S1SH 1NMCB 4JM2D 1MNNA 3DVGA 4YSQA 1YN7B 4GAJL 4N2HA 1ACCA 4D3CH 1DFXA 2CA4A 1KC5L 2H4EA 5AZEL 3L3JB 1Q9WA 4HKZB 5FB8B 4CDGC 1TTRA 4OCMC 4IU3B 1EGJA 1GS8A 3BPNB 4WFFE 4Y5YB 3ZU8A 4YSEA 1UA6L 1RZPA 3PUUA 3MOBH 5DVMA 4J3OC 4W93A 1UH4A 3BCDA 2ZG3A 4RIRA 1CQKA 4NUJA 1HE8A 3NJGA 4MHHG 1JNNH 1UM5L 3HR5B 2WQRA 4IRSA 2Z9TA 1MRCL 1XDTT 4OT1L 5EBLA 3WN5A 2DTMH 3QVAA 2QKIC 4AT6A 1EMTH 2LOEA 1L3NA 2H6OA 3A6CH 4XVOA 5EN2B 4P5MA 3GBEA 5IB1B 2XPZA 3LQAH 4J6RL 1NDMB 5C0EA 2IDQA 3DX6B 3FSZA 1LO3L 1VEPA 3UP6A 1OAQL 1AS6A 3L3OA 3BZEA 5KVGL 2XQYK 3Q1SL 5T1LA 5EU5A 1ZANL 1P2CB 1RXLA 1N6VA 3K4DA 4NQSB 5C08A 3ZYOA 3CIQA 1AZVA 1IGTA 4LIQL 5CZRA 1IB5A 2VAJA 3C2AH 2GABA 1YJDC 4NNYB 5HI3C 2NY7L 5IQ7H 1QI5A 1S7SB 4I2XB 3B56A 4GT0A 4HKZA 3VXSE 4J3TA 4M6OH 4AQEA 2BNQD 2Q3AA 3Q6GH 5CZKA 2YPLE 1AY1L 1J87A 3GUFA 4FQLL 4K23H 3CVCA 5SX5H 3VRLE 1PBYA 5ABZA 5FUZL 4Z7UE 3PWLB 4AV4A 2AEWA 4YHOL 1M1SA 1FZJB 4XNUL 2FNWA 1YUHA 4PJEF 3ROOA 3TO4A 5JPNA 1MJJA 3TH2T 1WC7A 4BZ1L 5C0GB 1JGEA 3CVIH 3M8OL 4Q14A 2CLZA 3F62A 3UEZA 5D9SA 5ISZA 3QPQD 2WOYA 2VUYA 3X11B 4C83B 2HKHH 1XO8A 3AQYA 1J8SA 1E5UI 3PRZA 3WKQA 1CXKA 2YUZA 4N85A 4TN9A 2BVOB 4WUKL 1H5BA 4TRPL 3TBTB 3ULSB 4HEPA 5IV2A 3BHBA 4DGWC 5E1QA 4E9QA 4U6XB 2O5ZH 3BE1L 3D4CA 3CFQA 5HI5D 5I1DA 2X88A 3QQ4A 2VLRD 1GS6X 1JERA 5F7DA 1LP9A 4MNGE 3ZMNA 4U1NB 4BSWA 1SFDA 1WA2X 4LARH 4FQXB 2A0LD 1FRGL 2HJLB 3CZSA 2M83A 1HH6B 3OB8A 3QR1A 1M2OA 3RX7A 3MAWA 3EYUL 1E4KA 3GS0A 5ERWB 3ECWA 2QVFB 5MEOA 2OMUB 4Y88A 2J2ZB 4PV9A 4KH2A 2CKBH 4X4XB 5DC9B 4P8QA 1A4JB 4G8FB 1D5RA 3ZUNC 2I7SA 4PLJC 3QIUA 4PJDA 2DDQH 3P2DA 2AVFA 2PPFA 4MMXB 1A02N 4KZEL 3EDEA 3F7RA 1E3ZA 3B9VA 3HRZB 4NDMA 4BSJA 4PQXA 3EOAA 1MREH 4ZSOB 3X13B 3A6BL 4N68A 1GJUA 1I1YB 3TNNA 4PJEE 1HDMB 4LCWD 2P8LA 3KVPA 4UYQA 2V5MA 1XH0A 1FORL 3KCWA 5E24E 2ZOUA 3B9KD 3UGXA 3HG4A 3HZVA 2BSEA 3P0YL 4WO4C 3RWIA 2OCJA 1P7QD 1ZIBA 5KSAA 4HK3J 3BN9D 2MTPA 1MJ8H 1XGUA 1WBYA 3MLRH 3HS0C 2P52A 4WV1B 3OZLA 3PHQB 2XJLA 1P4IL 2NZIA 1T89C 2ARWA 3A6OA 2Z93A 4Q0XL 1I7ZB 1AD0A 4XZUA 5GISH 4F7PB 3FQRA 3BW9A 2IDTA 3AG1B 3NPSC 2VITA 1VEMA 5J6GB 2HUHA 4RMVA 5GZOA 3GF8A 3HMWH 4NQCD 1NSNL 4XMXA 4XC1H 4NLHA 1ITCA 2Q2LA 4FI6A 1CJYA 1CLCA 1U3JA 1WTLA 3DVNB 5J3HC 4F9LA 2ENQA 4K94H 4OLZL 4AQZA 3ALPA 3GSNH 1AQ8A 4WU7A 3SKMA 2EKSB 1P4BL 3NSCA 1QPPA 1T1YA 1A25A 2GSIA 3D6GA 3A67H 4K15A 3RX5A 3N43F 1KPRB 2X7LA 3EXLA 4N3UA 2R29A 2HVBA 5D93C 4HIIA 3T3PE 1B0RA 3RWGA 3PWJB 2D9CA 4XODA 3GEWB 4PWJA 4CMHC 4DHLA 1X7QA 4G8AC 4XPHH 4UQEA 1CE1H 3VSVA 5GXBB 4GG6F 4QPEA 2VZSA 1FDLH 2GSGA 4IOSD 4QXGH 2P5ED 1A7OH 4AV5A 1WA0X 5I82A 1OQXA 3LMJH 2OJEB 1ML0A 5T3ZH 4F2FA 5TFSH 3HHSA 2B4CH 5JA8B 4PIBA 3VFSA 4OIAA 3REWB 3LNHA 1DUZB 2OMYB 3SCMA 5E6RB 3VYPA 4EBQL 4HIHA 1FVEB 4BZ2A 1GCYA 2XICA 3MNMA 3NCXA 1ZT4B 4WU7B 4IYKA 4P4KD 3BP5B 4UAOB 5EBMA 3NRQA 4YJZL 4OVVA 4TSCL 1AVAA 1UFUA 4Y4KD 2EVJA 4NM4H 3LV3A 5DMYA 1HJBC 1E9OA 4XPBL 3GSNA 5BV7C 4I4WA 3OPZH 2Y7MA 4JDTL 5CF3A 8FABA 1UGNA 4MVBC 1J05B 3VW3H 3C6SB 3ILDA 2P4AB 3HAEB 4G9DA 5KYXB 1LE9A 4DT2A 3EOBB 1MUJA 2ZUVA 1RL1A 1RSFA 4MD4B 3HKFA 4PMEA 3CSYB 1Q9KB 2F7OA 3LVEA 3D12B 2W9LA 4KY2A 4F8PA 3KPRD 4UM9A 3EBHA 5MP6H 4MXWL 4Y4HC 5I1JL 3C9NA 4GKZA 4JFDD 4YXKL 3ZT6A 1P4UA 1C5BH 4YO0A 4JY6B 3ZDZE 1BG9A 3U30C 4BJLA 2VDOL 3LZRA 3GMPB 3HG1D 5JQHC 3DVGB 4X0KA 4KXZI 5CZXD 4AJWA 3KR3L 2WO2B 4RCAA 5C0RH 3FCBA 4DTGL 2NSMA 2ZKHH 5CGYD 2HVJB 3KE0A 1CFNA 1WICA 1A65A 1N5AA 3P4MB 3WY4A 1I9IL 4OFVA 4HIEB 3LEXA 1HCFX 1T21B 3RLSA 5CEZH 2ZSWB 2CDGB 2LR4A 1ZMYA 4JZJB 5GZND 2VR4A 2F54D 4AW7A 2GB2A 1YC8A 3MRMB 3GHEL 1M57B 5E6ZA 3RTQD 1JYXA 2VLME 3UGUA 3OKOB 3TC9A 3MFFB 1JG9A 3FS9A 5HDQL 4H20L 3TASA 5LN4A 1M4KA 1A7NL 3EFDL 2E8ZA 2X44D 1O6SA 4NKDA 4OZ4A 3V0WH 1U8NA 5I1IL 4X9GA 3DO7A 1RIUH 2R8SL 2FYYB 1ZGLA 2NDFA 1IVLA 4L1DA 4DVBA 2FWOA 4HKJA 5ANHA 5E2VH 1F13A 2DJ4A 2WQUA 3BPNC 2IBGA 5CSGA 3SJVB 4AM0Q 1KJMB 4FXGB 4ATWA 3MNWA 1NGYB 3C6LD 4P2AA 3QAQA 3K72B 3GKWL 2YSSB 3BH8A 1JPSH 3CXDH 4ZQKA 4Y9CA 4OQTH 2A9AA 2WWKO 3GMRB 5KUMA 5DJCB 4Z7QE 1Z9SA 3HVNA 4ELKB 2CBQA 2DIBA 4BQ9A 4YBQC 2BHUA 1E5AA 2QHLA 2F5BH 4P59H 3T0WA 5DWUL 5H8DA 1YNLH 1BZDA 3TNMA 5IB5A 1A6ZA 5AVXB 3U36A 3ULVH 1KCVH 2F2HA 1UWEL 1DBKL 1IILE 4Y2OA 4XMLL 4KZEH 1S7XA 2JKTM 2XJKA 4BUQA 5FFLA 2CK0H 2GQHA 3QFDB 1RMFH 3W5MA 1AE6L 1SDYA 1AMYA 5BMFH 5TH2A 4A2GA 4JHWL 4WI3A 3HN8A 1TZIA 2FYYA 2GJ6A 2R23B 2XZAL 3C09C 3Q8AA 5ELIA 5GS1C 3DSFL 4NKIL 5BJTA 4A7UA 3BLPX 5I8KL 5DEGB 1U0QA 3AJ7A 4JKPH 4WEEA 4URTB 4NENB 3QJOA 4RESB 4V1DE 4EKJA 1Z7JA 3L7FA 3DXAE 4LEXH 3I50H 1TETL 3IKCB 4KXCA 5HGHB 1S5IH 4JDZB 3QFJE 2K3HA 4RX4A 4KO7A 3VH8G 1XEDA 5D7KD 5KUKA 2Z91A 1SDDA 3DOIA 4KGJA 2CM5A 3A21A 1WF5A 4Y89A 3LDBC 3MRIB 3TT1L 3W11D 1Z3RA 2C9AA 4G8FA 2CO7B 3MRPA 1CL7L 5HYSA 1JZ6A 4NB7A 1UATA 3L4VA 4HCIA 4R7NA 4R6UA 3VXUA 4HCRL 1WT5C 3LZOA 4MD0A 2IV8A 4E41A 4FQXA 3TTYA 5C0CD 2CO2A 3O2VL 2AQNA 1FVCA 4LIQE 4LP4A 3ENEA 1Q0EA 4OFIA 4GUPA 3U4BL 1U36A 4JVPA 5L6YL 2YO3A 3L5WA 4AK2A 2WO4A 4BA8A 4L9LA 4XN8A 8CGTA 4FQCL 3SY0B 2EC9T 4JFQB 3QJQB 1EFXD 2JKIS 1T7XA 4R5XA 4QXGL 1UWXH 1AQDA 4KUCD 2BVOA 1QBBA 2NXYD 3R1GH 2FR4B 3QCVH 3RWFA 4MCYB 1BG1A 3U2IA 5BJTB 2VXSH 2X53A 3TV3H 1MHCA 2WVVB 1F6AA 1KY6A 1DQMH 3T3PF 3UOAB 3QARA 1JGUL 3DPBA 3LKOA 3QZNA 4YIQB 1S9YB 4P23A 1NC2D 4Z0BH 4R7DA 1QRNB 4KHXL 3Q9PA 3D18B 3L17A 4KVCH 3TP4A 2NLJB 3PWPB 4FTVB 1UQSA 1IGIH 3WD5H 3STBA 3DIFA 3ARGD 2P1YA 4B97A 2YRLA 4P3WA 4JFXA 4EEEA 3HS0B 4POUB 4H88L 2MMXA 2WTOA 4B9PA 2HB0A 1S9VA 3ZE0F 1TZAA 2PW2A 3D4ZA 4FNLL 3ZDYB 4YHZL 4AV0A 1R34A 5I73B 1WAEA 2BS9A 3EUUA 3IDJA 4M93C 4NHCH 1INDL 3QUZC 5AKRA 4KAQL 4M8QB 1QNZH 2Z65C 4UM9B 2XA3A 1CLYH 3G5YA 4IOSA 3T1FB 5AD0B 1IBYA 4ZW8A 1LK2A 4YE4H 5HVGB 2XIIA 5B22A 4NPJA 4PV8A 2MCMA 2X0VA 3LIUA 4OZIA 4WLCA 1NGPH 2ODHA 2OR8A 3WAKA 4M6MH 5D2NB 3CZEA 5LCVA 5D6CA 2CJTA 2MCAA 3UBHA 4ZS6D 3LIZL 1KB9K 4XCCL 1ID2A 3BZFA 1UH3A 1KULA 1I9RL 4NM8H 4FFZA 2WXJA 4YSTA 2QKIA 1T3FB 4AL8H 2Q0ZX 1SHXA 3ATDA 4L4TE 3RVTC 4HEME 2A9NL 1OT2A 3ZRCC 3RZCC 1AS7A 4FFYH 5PAZA 5DT1L 2P47B 3ARBC 3GSNB 3N85H 1NL0H 1RZIA 2E7DA 4HGKC 4DF9A 3T6XA 1GL4B 3ML8A 5BS0E 2R4SL 2N4IA 2VDKB 5FIEA 4XNQA 4MNQD 4TKWA 1T1YB 3K80A 3M86A 5EHFA 1DQJB 3D2UA 4H20H 5K1NA 2MPAH 3QEQE 2OMXA 4X5WB 2XKUA 4GKLA 2NY3D 3B9DA 5DMIL 1MXDA 5A2JH 1NJ9A 1MCFA 5E6UB 4JFDA 5L2KD 4OV5B 3O6ML 1AZNA 2E0PA 2LU7A 3NTCL 2EIBA 2ALWA 1EZUA 1EAJA 1XGPB 3A0OA 5H35B 5C92A 2YN3A 1C8QA 3FTUA 2C26A 3AMLA 5CLZA 5BPPA 1HXYB 4X6CF 2XTSA 3J27A 4QXVA 5CBAB 1NEZB 1SJHA 3P2BA 2ZYRA 1Q9KA 1PYWA 4K8RH 1NBYB 3G6AA 1SXNA 2ZYIA 5DJAB 2HFFB 3EHBD 4CNIA 3QZMA 2YAFA 5KBPA 4L29A 2Y36H 4UB0H 4FTDA 3T77B 4PS4L 4JHUA 3TWYA 2BSED 3O4LB 3VYNA 2EH8H 4JFFE 1OEZW 5HDRA 1PD6A 4U1JA 1H3PH 3OKOA 3L3JA 1T2QL 5F1OB 5GZNA 4MJIA 3OR7A 3CQQA 4QRRE 2GTZB 2QADB 3CDZB 1RD6A 3HBZA 1Q38A 1RY7B 3ZKND 2QADD 1EJ8A 4KFZC 4JMXA 4WRLA 3ECBB 2DQEL 1CXLA 2G5UA 3K6SB 1K4CB 2AXGB 1IQDB 4KRMB 3B2UD 4NQCA 3RL2A 4KROC 1W8NA 4HDIA 3AFLA 2FJGB 4HGWA 4LOEA 3WFBL 2CHNA 2B15A 3EHBB 3JXAA 4JVWA 4B3EA 3NZHL 3AQXA 5DVNA 4ODWB 4XH2B 4CU6A 3RNKA 1VGEH 4TV3A 3VGGA 2HKHL 1T0NB 5LBSH 5TQ0H 3ECUA 2QSQA 5D71H 2HLAA 3QFGA 2NY1D 4ACTA 1Z32X 4HZLA 4PP2A 2JB6A 3ZZSA 4TRPH 3RILA 1RPUA 1CURA 2YZ8A 3GXDA 3UCQA 4OGAD 1INEL 1ZT1A 2EYTB 2JB6B 3CFNA 1HH9A 3JV5A 1P5VB 4U1HA 4C55A 1GOFA 2H6UA 3GWJA 4FGMA 3U36B 4OLUL 3LHPH 5L88L 2EH7L 4K8RD 4DEPB 3RY6A 1E28B 5I0DA 4JMNA 3SGKA 4XVUC 1F4XL 3HJ0A 4OCWH 2FQDA 2P28B 1KTLB 3NCWA 1BQLL 4M6AA 3F58L 4OKVB 5IBLD 4M5YL 3HMXA 2UZXA 3POCA 2GJJA 3VXPB 4MCZA 5DD1H 5D8JH 4QYOB 3O0RH 4YDLC 2FLRT 3WTVA 5CEXB 3U4BH 1T1ZA 2VLRE 1LYQA 2AQSA 3QJRB 1GOHA 3B2PA 4FQCH 3MLXH 4QRUB 4C83A 2GW5A 4KI5F 1XR8A 4BK8A 5D9SB 2NW2A 5KAQG 2BIOA 1OOAA 3MRNA 4Q6IA 4XRCA 1XTMA 2IWEA 5CD3A 1JGVL 5IEKA 1FL5B 4NO5A 3D4YA 3MLWL 1JF6A 4C56D 1EEYA 3O8XB 2YR3A 4HXBL 1NGYA 1L9RA 2R56H 2OLDA 4UM9D 4U1SB 3WEMA 2HT2C 1TYEB 1EHLH 4KVPA 1CDJA 3Q8CA 5EPMB 2OFQA 4KHXH 5C0FB 1QFPA 4KK9C 2JB5H 5D96B 1XF2A 3HN3A 2VTFA 5LAXB 3OJVC 4PWHA 3NZSA 4JRXB 5I75B 4A68A 4GUPB 4RQQA 3VI3A 1KYDA 4RRPM 5TTRA 1MVFA 4E36A 1BREA 3KWTA 2VZVA 4MA1C 2R29H 3U25A 2F53A 4M61B 1BFVH 1DN0B 4YLCA 1FNSL 1REIA 4PB0H 1FHGA 1NC2B 2D03H 1AS8A 3G04B 4ORGA 1G6RL 3LKQB 3B2VL 4OJDH 2VN7A 2W80C 2ZT9C 4MSWB 2OTPA 3P9LA 5EMYA 2DQIL 3OSKA 2GJZA 3P9MB 1UM4L 1I7RB 1U3HB 3PAVA 3Q13A 1X5XA 3RTQA 1FO0L 1JD9A 3GSUB 5EIIA 4NQXA 1DQIA 1CF8H 4N9OB 1WBYB 1KDJA 1FIGL 3IJSA 4J3BA 3OR6B 3CMOL 5AW1B 3RWIB 4PS7A 2VL4A 3PP3H 5FYJE 3ZVVA 2Q7AA 5B38G 4HIJA 4OGYL 2HT4C 5T3ZL 1LWJA 4FLRA 1RUKH 3C08L 5I30H 3POHA 5CEYB 2XCMC 4FQ2L 2R1XB 5I6LA 2W60B 3PGDB 3ECQA 5LXGH 4L8SA 4HFWB 4GS7C 1JVKA 4QHUA 3S3SA 3KZ8A 4CGTA 3ARGA 3JQOB 3HFFA 3PYCA 4G80B 3KGTA 5D1QE 4MMXA 1VLXA 3U4AA 3S34H 4A1RA 2J5WA 2PWGA 5DO8A 2YMOA 4U1GC 4BZ2H 1DJHA 4KJWD 3F05A 3O6KH 4FF9A 1R3LB 4GJTB 4OD2B 3FTGA 1MFUA 5D1XD 4LRNH 4UIKH 5TE4H 5F9OL 2DWEB 4PJBB 2V5SA 1XGTA 3WENA 4L8BB 3VGHA 2PTTB 2NY2B 4X8JB 1KB5L 2X89D 2BIPA 1DSWA 3NQKA 3LNDA 3HCVA 1SZNA 1F4AA 1XAUA 1BWWA 1HKLL 2F19L 3F3HA 5EZIL 1TMCB 1T04A 4IGBA 3TBSB 1E2ZA 5KSAB 1N3NA 1QW9A 4JO1L 1OP5K 2ITEA 2A1WH 2C7UB 5FGRA 2ZF9A 4EI5D 3GUTB 1NDTA 2EDEA 1VB9A 5IBLC 3QNYA 1F0LA 1L5GA 4A2FA 1PX4A 1NCHA 4NIYE 5JHLA 2IOMA 2Q7YB 4ISVA 1N19A 2CR6A 1PMYA 4UB0L 1IL1B 4J7RA 3GSUA 5EIIB 4ELDA 3KR3H 1LP9F 4PN6A 4UTAA 3EKCA 4LHUD 5I18L 4LLQA 5IVXA 1ORQA 1FNEB 2P9RA 3RTLA 3BPCA 1CIUA 3US1A 3B8SA 2G3XA 4UQ9A 3D0AA 4WCYL 6CGTA 4DGYH 2OAAA 2ED9A 3MFFA 3KDMA 4HF5L 5DI8A 4LKXB 3SDAC 2HTKD 3FO0H 5JW4M 4DZBA 4I1PA 4XNMA 4MNQA 4POZC 3HE6B 3QI9C 4G72B 1Y6NR 4PRHD 3UTSD 4PJGB 4U6YA 2J6EA 1QFOA 3WFBH 2OP4H 1E4WL 2X4TA 3AABA 2AKRB 2AXFA 2ZUQB 1S7SA 4I2XA 2AKRA 3OXSA 4Y4FC 2V5TA 3SO3C 2IAMA 5M7QA 1RJZA 2P26A 4LQ1A 2JJUA 4P05A 3B2UC 4A66A 4NPYA 4ZAKD 2H1PL 3V4LA 2P8MA 5F1SA 1NIDA 4TSBH 4X4ME 1RPKA 4RSVA 5F0PB 1Z5LA 4LSRH 3M17A 2PXYB 2X4NB 2LE9A 4W6XB 4N5EC 2KPWA 5AENA 5FCUH 1JP5A 5EIVA 1BQ5A 4OV5A 3GB7B 4WEBL 3AS1A 2DY2A 3RVVD 3U4KA 4DWHA 3UBXB 2FK9A 1JNHB 2EUZA 1W0WA 3NJJA 5EWIH 3HJEA 2W65B 4WHYH 3B34A 2GSMB 1A7PH 3VJ6B 5TE6L 5SWZE 5CNHA 1YMHA 1TPXC 2WTPA 2VLJD 2PXYD 2FJSA 1TJHH 4A7TA 4W9GC 1UD2A 5KTEL 5IIEA 1JZ4A 3DJZA 1NFDA 2BVPB 4KVNH 1M53A 7FABH 3HHMA 1RZIB 3F64A 2AMUA 1IE4A 4G9FE 4HDIB 1R3KA 2B59B 2Y7NA 3O3EA 2VR9A 3KXFA 3O3UN 2DPKA 1ZLEA 4I9WE 4A67A 4BQBA 3ALWA 1UG9A 2X09A 5F7BA 9PCYA 3H7BB 5DHVB 5DLML 4ADIA 1LILA 2X2IA 3LEVL 3RDTA 1N2RA 2X4QA 3UTZA 1CXEA 2YD1A 3DX6A 1J1OL 3DO4A 1A2YB 3A4EA 2VDLL 1S6NA 3TCXA 4ZFZA 2IFGA 2IAND 3HRZC 1ET5A 1F90H 5FYKH 3VFGH 5T3ZE 5GS1B 2ZOKA 4GIAA 4NNYA 2ESVD 4LHUB 3JT0A 3IXTA 1P9MA 3I50L 3K6OA 1BIIA 4N6QA 2D0GA 4YS4A 2LU5A 5LQBH 2DIAA 2VDKL 2Y72A 1CTNA 1G7MA 2H1XA 3NDZE 4AM0B 1MY7A 5GRYA 3G08A 2J88H 1F58L 1CFTB 4HHAB 4KBPA 5EO1A 5A6IA 5EIQA 5IMMB 2WINA 3IYLW 5HPMA 4L5FE 4C8XA 5EN2A 5DZLA 3DLQR 5I8CA 3ZHLA 4G7RB 2CHZA 3CU7A 4C59B 4B9CA 2BH0A 1EVTC 1EX0A 1NGWA 4M5SA 1MCPH 1NM4A 2FH6A 3MV8E 4LO9A 1PVHA 4BHUI 4BKLA 4JKNA 7PCYA 5TDOA 2Y1YA 1G6RH 2LGNA 4RMBA 4KO5A 5GQBA 3WNMA 3VB9A 1J5IA 3E3QC 4XMWA 4IQHA 2JKJA 3CDGA 5I1GH 5J9PB 2CH8A 4HT1L 4YBHA 3HNSL 4BHUA 1S7TA 5C8JB 4LLYA 3N41F 2PW1B 1IUZA 3IU4L 4YDJB 2DQUL 2PWEA 3QBTB 4XN9A 1D9KB 1XGYH 5CLXA 4AEHL 1KIPA 4YHYB 1Y1DA 4E5XA 4X4KA 1K4DA 3MACL 4AC2A 3RUGF 4A39A 4XR8C 4K5OA 1HCZA 1HH9B 2QPDB 4I18B 5J1TC 1XF2B 2F58H 4FYQA 4G43B 4HJGB 1HTYA 9CGTA 2HX9A 2CWRA 2C4XA 3NOIA 4M7KH 3VFOA 3HC3L 1EQWA 2XWBA 2FBRA 4EUPA 2NQCA 2XTJE 4U1KB 2AEQH 2F6AA 4TS6A 4G5ZH 4BK5C 4AXWA 4PLKD 2APFA 5LBSA 1QEWB 1GXEA 5DF0A 1I7RA 1OAYL 5EUOE 2RQ8A 3NAAH 2P5WE 3R18A 5HYJB 2YD9A 3UC0H 5BUAA 5F0JB 3QDAA 4WU5B 2BP0A 3D34A 4ONFL 3L5WB 1IBZA 5DUBB 4Z23A 3WEXA 1G0XA 4JO1H 4ETQB 2H32B 2P7TB 4X4YA 1KGWA 1MG2C 1DTUA 2K6YA 4CC4C 3W0WE 3GZQA 43CAA 4JM2F 2WNXA 3KGSA 1I8KB 4YE4L 4U1IB 2ZXCA 2UY6B 2OM5A 1Q1PA 1AQHA 3B9KB 3NACH 1JCKA 1F6AB 3FZUD 4NO3A 4I88A 3UP1A 3RAJL 3NJNA 4Z77A 2XSKA 3TYGH 2H6PA 3SKOA 2E56A 1VFOA 1BEYL 2PW1A 3CFMA 2HTKC 1OAKH 3X13A 4RBPK 2HN7B 4L0PB 1U3HC 3K5SA 3V6OE 1EAPB 1TO5A 4L4TD 2X2UA 3SKNA 2AS5M 4I0KA 3R7QA 4WDIB 3GBLA 4U31A 3VXMD 1PLAA 4LHQB 2OZNA 4X4XA 2A73B 1OSPH 3NEXA 3QUMB 2IGLA 4R7XA 3BP6B 1KYOK 1QFHA 5FKAB 2GTQA 3KYOA 4J4PD 1W80A 1JZ7A 2C4FT 1WHOA 4IRSC 5FYKD 4Y5VA 4Y2DA 4YDIL 4B9IA 3IWUA 1HHJA 1PFOA 3C5JB 5CFAA 2XETA 3PUCA 1U3ZA 4EI5A 4L4TB 2WLLA 1MWAH 5D2LF 2GCYB 4R8WH 5PCYA 5DRWA 4D0CA 3PV6A 3IFLL 5CBEB 5GRJH 4DGIL 3AGWA 3AU1B 1E2WA 4PJCE 2J25A 3AW5A 5IVXB 1RIVH 1EHXA 2WZ0A 3EO1B 1NLDL 2PPDA 2VXUH 1WYJA 2CHWA 1WWCA 3L08A 1Z9MA 1C7TA 3N1GC 1GAFH 4RAHA 1ADQL 3MRQB 1YYLH 4MJIB 3F6JA 3C5ZD 3BWAB 5I1LA 5HPOA 5IFJA 2OKMA 4FE9A 3ZL1A 1FE8L 1ZHKA 1QAWA 4XXDA 2V4LA 1G7IA 4OJEH 3IXAB 2CQVA 3S4SB 2VISA 5IMOB 1K4CA 2AXGA 2BNUB 2CJUH 1BOYA 3MNZB 4BKTC 4MAUL 2QV2A 3B3IA 4YSUA 1JVLA 4OI8A 3VTTA 2WBWB 3GKWH 4XCNA 4XBGB 4LPYA 3Q7JA 2BNRE 2GIXA 3HI6L 3IDJB 3Q1SH 1SYVA 1XCXA 2FX9L 5SWSA 5A2CA 4OQTL 1NBVL 3J7HA 4KI5E 2MOQA 4GRWB 4PMFA 1NUFA 1MG3C 4PJHF 3H7BA 2BNQB 4LIQH 4LP8A 5G5DB 4UDUB 3FO1A 3L3GA 1CDIA 1NJ9B 4P57B 3U1SH 4A63A 1DBBH 1K5NB 2G2RB 4IMLB 5K1JA 3VXRE 4X8GA 2OPCA 3D51A 5EU4B 4X0KB 3QXDA 1LO0L 3K4AA 3RJDA 5JQ6H 1SM3H 5B1AB 3UPRB 1ZGLB 3CVBA 3IPFA 4LCWA 5DTFA 4M5TA 3T9WA 4KXDA 4O51B 5DU7A 4GG6B 5H35A 4PCTA 1EEUA 3ATAA 2L7EA 3QI9B 1E90A 1X5HA 1JNHA 2DI9A 5G55A 4XXDB 5DC2A 3RI5K 4XNXH 2BSTB 3T8XA 3ZR6A 5AB2A 4OFDA 1N5AB 3ZKXB 1YQVL 3HUJA 1F1DA 4PRHE 5AL8A 4L18A 1L6XA 2V9QA 3I9GL 1T7WA 3U48A 1JHLH 3VFTB 4FABH 1OY3B 2E4TA 4KI5D 2PXYA 2X4NA 4HBCH 1UH2A 1ZWIB 3HTLX 4WHYG 2D3VA 4YAQA 3OC8A 1YEWA 3ULVD 2GT9B 1SQ2N 4GRMA 1UA3A 4PI0A 3H9SA 1FNGB 1YHPA 1YMMB 2OR9H 3HC4L 4Z5RB 1KLGA 3S6CA 4PBXA 2WVTA 4YDMA 2NY3B 2G3NA 5DYOB 1LK3H 3GMNA 3QIUC 4MJ5B 4Q56A 4AC4A 1KLFA 1MCJA 1TLMA 5GGTL 1L9NA 1T83C 2PTVA 5IHLB 3ASNB 3TT1H 3T4AA 3QORD 4G8GA 2X4SA 1NUNB 2BLFA 1HOCA 3SSGA 4YXHL 3BAEL 1XF3A 2ZCLL 5CINH 3EYUH 2R1WB 4KJQD 5DMIH 4GIPD 5T1MB 5DVLA 2X0WA 3EZ8A 1AR1C 3WFDL 2FX8H 3CFJB 2CKBL 1AO7B 3OMNB 4XAKE 2DQUH 1TMQA 1RZ7H 2YEZB 5C2UB 2BPBA 2QEJA 3RWEB 3L3HB 3IDMA 2VLMD 3OKKA 3WNNA 1EK3A 1HHGB 3FULA 5GRUL 2E7LA 1J1XL 3FRPG 1MRCH 4PRBA 3ETTA 4JKKA 1MFCH 1UKQA 2QMKA 2F8OA 1VFAA 1Z0MA 3KS0H 3LS5L 5C0GA 4TVUA 2FEEL 3MOQA 3PY9A 3H4FA 2XV2A 5FLUA 1GOGA 1KYFA 3QQDB 4JY4A 4X9FA 4QWWD 3H3PH 5C09E 5LN8A 1GYVA 5BV7H 2Q1EA 1XBRA 2ZG2A 3L4XA 3MLVL 4Z7WA 3KXFB 3EYSL 2QDVA 4Q0XH 1WS8A 1YVLA 3HI5H 2DM4A 5E94A 2MEJB 3KWUA 1JWMB 2FD6H 5H37G 2NNRA 4YIQA 1I85C 2D03L 1JMXA 1OD7A 1C08A 3UTTB 4ABQA 1MPAH 4M4PA 2KERA 3LRSA 5EC1A 1MFAL 1NKRA 3QQ9D 4HWBA 4I1RA 4MMXC 5SV3A 5GZNC 4GMTH 1TTCA 1A9VA 3D39A 3ZK0A 4OLEA 4M3JA 5EH1A 2RTTA 4MB4A 1T0OA 3D2TA 2ID5A 1O6TA 2WB1A 4K71C 1QLRB 2AQ1A 3QIUD 1JI2A 1IGML 3COOA 2RAMA 5AEAA 1JZEA 3UH8A 4N2CA 4P23B 3MCKA 4P3CL 4YR6A 5I30L 1BFSA 1Z66A 3GSRA 4Q9RL 1OAUH 2W88A 4Y5XC 1G5GA 2BIQA 4JPWL 4F8TA 4UQ2A 1ETZA 2NXYB 4NKMA 4ZAKB 1RFDH 2PYED 4P07A 4HG4K 3GJFA 2WAHA 1JZFA 1JGLL 4OFYD 1OSYA 3FJTA 3QH3B 5DEFA 3T3MB 4C58B 1RUMH 4EDWL 1YPZE 3I6SA 2GVYA 3CVHA 3CZFB 4FC3E 4IJ3B 5HTSA 1F1GA 3GXUB 4IRZL 1J5OL 2F54A 4UUJA 1TVBB 1MCWM 2P7TA 4M61A 4X4YB 2DYPB 2LFEA 3ROLB 1I8IB 5C0CB 1YEGL 2DYPA 2XNAA 1NCCL 2QQLH 4GG8B 1JZ3A 3RY6C 4AVIA 1GC1L 2K3TA 4DKFH 4S10A 4Y2LA 5GRJL 3BD5A 3KLAA 3MBXL 4NSKB 1OGAB 4PJ5E 5DJXB 4OU3A 3KPSB 2GUYA 3VG9B 4M8VA 3GI8H 5ECJE 3RVWC 1N5YL 3QUMH 1KELL 1WFNA 1OPGL 2WKGA 3BWSA 3DSNB 4JFPB 2R83A 2UXVA 1TJGH 2PYFA 4N0FA 4WWNA 4G6JL 1OB1B 3L9BA 4X5RA 4HPOH 4BM7A 4F9PA 1MW0A 3BGAA 1RZGB 1GGIL 1URZA 4OQ1A 4QOKE 4LL9A 3G5VA 3IK2A 3QK0A 5HDWA 1SHWA 3OKEB 5KSAD 1P4LA 2PP8A 1NEPA 1JTPA 1UOVA 5HVHB 5FKAA 4OFPA 1NIFA 1SEQH 1FZOA 2NY2D 5H4ZA 1VADB 3FTGB 3BUYB 3MX0B 3B4NA 5D1XB 4GI9A 3ULUC 5DJ6A 3SCMD 1HYRC 2C5DC 3J2PA 2CGZA 2NNAB 3STZA 1I7TB 2ZX7A 3TBSA 1Z1WA 3VVWA 1IC0A 3ULVC 1D7FA 1KIRA 1OP5H 1I53A 2NLJA 4L0ZA 1KBKA 2Q7YA 3QPKA 1UB5B 3Q5OA 5E4EB 4J4PC 4J5VA 5DFAA 3SODB 4KUZH 4FYSA 5D1ZB 1U91A 4FKEA 3ELAT 3LD8C 3TYFA 5JDSB 2IWKA 5LGYA 5C07E 3HR5A 4IRSB 3DETC 2PYEB 3IFNL 4X98A 3V7AG 2DQFB 3GMOA 1ZDSA 4LKCB 4L1SA 2R2EA 1CE1L 1YO4A 1XD1A 3US9A 3PF2A 3RNKB 1G7LA 3L9RB 4KKQA 3EOAB 4V2CB 4JJHA 2X6UA 4YHIB 2IOIA 3UZEC 2OJZL 2CALA 4TNWK 3T0XA 4X6DF 4OGXH 2OCCB 3II3A 3B3BA 1SHMA 4LFHG 4ZX4A 1CBVL 3EO0A 3P11H 4G6ML 2FL5B 1D7BA 3OSVA 2X4TB 3ZKXC 4CGUB 3FZUC 1RUAL 1KTDB 4ELMA 1TR7A 5I1CH 3FQUA 4TUOA 3ZE0B 1ACYL 3GM0A 5DA0B 4QTHB 3LYRA 4JRXD 5HHOA 3E2HB 1IM3B 4HLZH 4JDEA 4FQJH 5DHYB 3FFCB 3CN1A 4PUBL 5AZUA 2EICA 2FBOJ 4K3EL 5CHNA 1E8XA 1CR9L 1EH9A 4Z7WF 5MENE 3O0RL 2VITB 4ZMTA 4N4YB 2CDGA 2KZ1B 2DH2A 1D5ZB 1HZHH 1F4HA 1N26A 4DK6A 2VN5A 1JFHA 4X98B 3S35H 4XCEB 3O8XD 1ZT4A 5E00A 4ZS6C 5HGDA 2XBDA 1LEKB 3L3KA 1OM3H 2EYSA 3ATEA 4M7LL 4J3OG 3FQXA 3HG1B 3SCMC 2EXWD 1RVFH 3ZTJG 1ASQA 3F84A 5I18H 5KWYC 5IBTH 2CLRB 1X5LA 4JM4H 2EACA 1ZGLP 2VIRA 3UL4A 3CLFH 2EP6A 1DBAL 3B7YA 3BT2L 3GTVA 1BMWA 3WN5B 1M7XA 4R0LB 5BV7L 5EBGA 3IGLA 5KANI 3DGDA 3GYRA 4QYOA 1QVOB 5LBGA 3ULUH 1JK8A 2VDMB 4NZDA 2K4WA 4FQXC 4LBAA 4KUCF 3QORA 4G8GD 2G9KA 3VSTA 3BFQG 3LKPB 1TQTA 1D3CA 2VDRL 4CRPA 1C08B 3MJ9H 1HL8A 3RB5A 1E30A 2OV0A 2XXCB 3A22A 1FFQA 5JIKA 2E9BA 2R1YA 4N6RA 5FDWA 4IDJL 5L4MA 4BBWA 3DX2A 2BX5A 1R3JB 3F5WB 4Y4KB 3W9DB 2A4EA 3O3DA 3G5ZA 5ALCL 4GRLC 3X12B 1HXKA 1MWOA 4NQSA 1FNSH 4U1HB 4XVUD 1ZS2A 5JZ7D 3L5XL 5I6KA 1TVHA 2YGOA 1A3LH 4Y2DD 5AQ0A 2XFGB 3WY2A 2VDQB 4J3WA 4AYFA 3FTSA 4AEHH 3GEFA 1BF8A 4BQ8A 3E8VA 1WD8A 3IJEB 4WUUE 5AVRB 1NUGA 2CLRA 1D5IL 5FM4A 1HIML 2H5UA 2WXFA 2WXPA 3MV9E 1C5CL 1FO0H 3EH4B 4ACPA 5DD3L 2IOOA 1RJLB 5EWIL 4WI4A 4ZD3L 5FYJU 3S3BB 4KMTH 1AFVH 4NAJA 4OF8A 2P5EB 1R4XA 4XCEA 3BVTA 1S7QB 5HDBB 5FECA 1T1XA 3QXTA 1NMBL 4EXPX 2LT9A 4UM8B 2O6FA 2HT4D 4GQRA 2V3EA 3VFVA 3ZE2E 4HCFA 4IJTA 4X6EB 2OMVA 1DQKA 2CKBA 2OMWA 2N1KA 2GAZA 2Y4SA 2NUPB 4F27A 3UJJL 1WWAX 5MHSE 2AAVA 1O9WA 3G5ZB 4WFHD 1XGQA 1IFHH 1WZMA 1A14L 2VJ0A 2EXWC 1IC5L 3BH4A 5DJXA 1JXGA 3Q01A 1WP6A 2AC0A 5C1MB 2X3AA 4HULB 2YLHA 2AFNA 3ZW3A 3ERXA 5EPMA 3TA3C 5MEOB 3MRFB 1KB3A 4M00A 3ZE2B 3DSNA 1XMWA 1U8QB 4YSRA 3QQ9C 2XKNA 4JG1L 4JDZA 2CBPA 4HWBH 1ZLWH 4HZAA 3EYVB 3FN3A 4NWUL 2JMRA 2VE6A 3MYJA 2IPKA 4UTAL 2HCZX 5BQ7A 4POYA 3WNKA 2KYIA 3EGDB 2DICA 3VCLA 3AACA 5CGTA 5FOJA 2Q76B 4OCSL 3EGDA 3L1EA 3BUIA 4GG8A 5AW4B 4MJID 4ZNCD 3VG9C 1TZIB 1I8IA 2GJ6B 2R23A 4MXVF 4KX7A 4W9DC 1HDMA 3EGSB 4TM9A 1DVSA 3EO9L 2KL6A 1BLIA 2H0EA 3FPXA 5EU6B 4ETQA 4U3CA 1D5XB 2B9BA 4B0MM 1OSEA 4PJXA 4X5QA 4AL8L 4HALA 2R2BA 2YAOA 2OCFD 3CZFA 2J20A 2R4RL 1ZT7A 2C7UA 1PEZA 3EDJA 5EEXA 3UTPD 2IQAA 3DI2B 4W68A 2ED6A 1WS7A 2V33A 2N1TE 7CGTA 2Y7OA 2FHFA 1Q1JH 4XP6L 1SDDB 4FQXD 5T5NF 5E8PA 4L0YA 3O2VH 3GJEA 3OKEA 3VXMB 3QO0B 2EINB 5AYUH 3EGXA 4ZUUA 5LBVA 2OMBA 3WXWH 1PZ5B 3NH7H 5DMGD 3MKKA 2AQ3A 5ICYA 5JYMA 3JUZA 3S7GA 4J1UB 3K4ZA 5DD5H 1EJOH 1G9EA 1CVSC 4JPSA 2FO1A 3IETB 3V8CA 2MHAA 3OKMB 4NKMB 3AMKA 2YGVA 3QIWC 4KTYA 3UBXG 5C0NC 4L3CA 4PJ8A 4G6AD 4QF1A 5LDSA 5HGAB 3ZZQA 1COBA 3P73A 1J9RA 2PO6A 3GT6A 4W9HC 3SGEI 2DTSA 4CW1B 2UZPA 2WCSA 3LQMA 5EUOF 1J5HA 4XPFL 1G1CA 4NRXB 1DQML 1TPXB 1TQBC 4GW4A 5ANMB 3BKCL 2D9QB 2EE3A 3C5JA 2DQJH 1NC2A 3G04A 4ES8A 1BQHG 4LSUH 3GUTA 4GT7A 5EU3B 3PP4H 1T2QH 1IC7H 4MB3A 4O00A 5D7EA 4H1LA 2D7QA 2NOYA 1P5UC 2K4AA 5IHWA 1QRND 1ZLUH 1UEYA 4AEIL 4HC1L 1EHNA 4H5SB 4OZGB 4TLTA 3V5HB 1R3KB 2B59A 2OMYA 4F37F 4NO0D 2HZHA 5DGQA 2PPAA 2PETA 5EEWA 4H26A 4KO6A 1HEZB 1W72B 5CMAA 2HN7A 4AMWA 1CYWA 3L3KB 1OM3L 2CBMA 3D2UD 3FCUB 3GZKA 1G7LB 4P9HL 4NHCL 4KJPC 1NH6A 1Q72L 4QXUL 4U6TA 2VN4A 1Q9LB 3FUNA 5K93A 5ITFB 1CLYL 1SRDA 2ZOOA 3GI9H 2FATH 2F74A 3BT2H 5AAPA 3DO7B 4NCC2 1G87A 4N2OA 3LVTA 4HWZA 4P04A 2HH0H 1WBXA 3CXHJ 2D3JA 3TS8A 4JVUA 4YHNB 3WLBA 5LQBL 4P5MB 1UA7A 2ROYA 4PCSA 3FQUB 3W82A 2E7LC 3U9UB 4FQIH 1B9ZA 4JFVA 3SE9L 4UYPA 3RDTB 3OHXB 4MMZC 4PJ5D 1XZ0A 2HVKB 4X4ZA 5IFHL 3P54A 2I9LB 4MA3A 4PJAE 3EF4A 4Z0XB 3SDXF 5EU6E 2VXQA 2X2HA 5AALA 2CM6A 2ZWKA 2KBGA 1RULH 2XI9A 3DPBB 3S97C 4AI7A 1V8HA 4WFFD 2YKLH 1F4WH 4A2DA 4Y9FA 5AZ2H 3B6SB 2FB4L 1TENA 2OMNA 1O0VA 1JNLL 4G7VH 4N2DA 2ZOLA 4XNMB 3BKJH 1GZPA 3AU0A 4LASH 2JELH 4V1DD 3S5LB 5IJDC 2VXUL 1A6UH 1DJIA 1FV1B 4UQDA 4Z7VB 2WY3B 5JDSA 1KPVB 2EE9A 1G7MB 5GS0C 4MASA 5T3XE 2K8MA 5J6HB 1PAZA 2NY6D 2D31A 4JZNA 5JNYB 1NKOA 3LS4L 4W6WB 4PRNA 2EEDA 1WTGT 1XGRA 2FLBT 1XSIA 4HUMB 3QUXD 4M5ZL 5FYKU 3BUPA 4IOFC 1CFSA 3V6ZB 5F7UA 4WTWA 2ITCA 4LCYB 1LE5A 1GJIA 1NQBA 2P5WA 3B1UA 4ZFZB 2IANB 4J2XA 4JO3L 3QUKB 5JIMA 4CVXA 3I84A 3QIBD 4YHLH 3CSGA 4A6YH 2Y07L 4LMQI 4L37A 1IC1A 1WBZA 5DQ9A 1HINH 2DQMA 4HFUL 4MDIB 3SQOH 1CFQA 3E6HB 4YDKL 3KD4A 4FHKA 5C3LD 2WUBH 2PTUA 4K07A 1XCWA 2VLKE 1NCAL 1ADWA 4HYTB 5HPMB 1Q9OB 1WGOA 1J12A 3KYNB 1DN2A 3H42H 5IJKA 1N12A 4UM8A 4L8CA 2DYSB 5IQ9A 3SYCA 2YOAA 3UTTE 3BC9A 2Y1AA 1G9HA 3QWOA 1WZLA 4OCXH 1OSZB 4Y9GA 1S7UB 1SXZA 3DMMA 3QGVA 3SBWC 4EN3B 1I8KA 5EOQL 4P5TB 3RPIB 1X7TA 4GRWH 2HRGA 3KVDD 2VQ1B 1ZSDB 2P8LB 1DJWA 3WJMA 1BYPA 1QSFE 3MBEC 3ABGA 5EU7C 2QZ5A 4EUPG 1BVLB 4C56A 3MYZA 5HGBA 1A6VH 3I02B 3RTQB 1PAMA 3Q5TA 2TRHA 2CIIB 2YAMA 4ZDHB 2M1KA 4JHAH 1L0YA 1UM6L 3RWHA 4BV1A 1U8CA 3F01A 2VOTA 3MNVB 1QNIA 5C97A 3FB5B 3MXVL 5ACMA 3V0VB 3IN2A 2DV6A 3KG5A 1EO7A 1ZA3A 2FT8A 5LDUA 2R1YB 1K8IA 2A5UA 4KK5C 4D0BB 3B2MA 4F5CA 1Q9OA 4O02L 1TCRB 1X5JA 3MRIA 5CUSL 5TE4L 3NFNB 3KEHA 3UMNA 1ZJBA 5H4YA 3GTTA 3NESA 4KKAD 5DQDH 3TJHD 3QNXB 3MLZH 5GGVL 2VO8A 3JWDL 1KPUA 4NFCA 2CGYA 3N06B 1KSRA 1VESA 1EJOL 1C5DA 4RA3A 4FKHA 5GJTH 2WXHA 3ULSA 4TF4A 3LZQA 1QLEH 3PS6A 2VQUA 1D5BA 1GGIH 4QGTA 3UYRH 4I3GA 3FMGH 1DL7H 1YYLL 3QQNA 3S88H 4URKA 3IDYB 4WFEE 4NQEA 5EULV 5I6PA 2JJWA 3EO1A 4GMSH 2PWFA 4Y1AE 3WEXB 1UTDA 4OLXL 1R3IL 1KUMA 1SF3A 2IH8A 3MA9L 3KXFE 2YPKA 3MRRA 3WMPA 4B96A 1A6PA 3SY0A 4ABUA 4OSUL 4ERSH 5KJ7E 5KYWA 2FO4A 3NN8A 2HFEA 2WXNA 2C1PA 5FUOH 4K9JA 5IOKA 4EI5B 3LKQA 4RFEB 3GGWB 4UOZA 2J2ZA 3X1FA 4U1IA 3TXAA 3X3FH 4GXUN 3TFBA 2EZ0D 3UZEA 3OTTA 2AJSH 1HWWA 1S7TB 3EIFA 4EUPB 1CICB 3ZTNL 4KWUA 5IB2B 1CXHA 3BRFA 5FGCE 4OZFB 2F53D 4NC1E 5CJQH 1PLGH 5BVPH 3FN9A 1M7IB 3OG6B 5FAAA 4ZW3A 1JF1B 3QZWA 1A4CA 4X42A 2CDFA 4F92B 3SE8L 1ECYA 3FU7A 1MNUH 3DIFB 4MXWH 1JDAA 4U33A 2W60A 3PGDA 4YXKH 3ARBD 3T71A 3WFZA 1J8HA 4IHOB 3N42B 3IFPB 2CAKA 1LDPH 1TQUA 3L3DB 1RZGA 1GSKA 1M9WA 4PWIA 4ZX6A 3RE0A 3WLBB 5DJ0B 1X5IA 3VD7A 1DSFH 4R5VA 2J1KA 2UWEE 1CBVH 4X5PA 5I0XA 1M71A 3A4FA 3B9EA 1IKNC 2QLVB 3MUY1 1ZKAA 4IBQA 1B0IA 1CFVH 2R0ZH 3EOTL 5BZXA 5IKCA 1L6PA 4PBDA 3WIHL 3Q2VA 2EXTA 5FOBA 1H3WM 2B5IC 2QZQA 3P4NB 3FB7B 2NMSA 1AHWB 2HA1A 4MXQD 1X7SA 4NEHB 3R8BB 1QKZH 3MLYH 1QRNA 2WLZA 1ERNA 7FABL 4DKFL 2HRHA 5BUPA 1ORSA 4OKDA 4B9FA 2YSTA 2FCBA 4F7TA 4Y1TA 1V7MH 1EAQA 3MGTA 5GS0D 1GW0A 1HZHL 3O3AB 1USQA 5DLMH 4JR9H 3SPVB 1OWRM 3NJKA 4X6BA 5FO7A 4X7DC 1HILB 3WEAA 2I07B 3MXWL 3N9GH 4WF7A 3MNZA 2IC2A 3ZJAA 3ARZA 2XPGA 4X6FB 1E5YA 1VENA 1Y1UA 2IADB 4JBSA 2ADIA 5EF0A 2XVLA 3OGCA 4GQ9H 1A8ZA 3S5LG 1FNGA 4GRLA 4RGMC 2VRKA 3PGFH 3CFTA 1KXHA 3TX4A 1VDGA 3GDCA 1KY7A 1N8OE 4NZUL 3U9PH 3CX5J 1U8NB 3ZYJA 3BQUD 2WQVA 1UVQB 3E8UL 4PJ5A 3TESA 5E56A 1PZDA 2A2QT 4Y9EA 4PRPD 3HFMH 1IBGL 1FLRL 2FJFB 5DZVA 3SDYL 1S7WB 2VN6A 5I26A 5FK9B 2Z1PA 5D1QC 3D06A 5AVTB 1SEBB 2OTUB 4G1EB 1SVBA 4X7TB 2IPUG 5F72S 3VRJB 3MA7A 4X7SL 1ZLWK 5L4FA 4CA4A 4L5FL 2XOTA 4DERA 2UZXB 3UTSA 4G8IB 4A2MA 4HIHB 1BBJB 4W9FC 1U30A 1YDPB 1HOEA 4G42A 4RGOL 4Z7QF 3DX7A 4DN4L 5IVZA 4XWOD 2FZ3B 4OZHF 3U6XS 3ZGHA 1A6ZB 2DLFL 3CVIL 4H8WL 3HI1A 4GMTL 4L3AA 5IOPB 2R15A 2WLYA 5DDHA 1QA9B 3LKSB 4TQPA 4GI6A 4JCMA 4KJYA 5TH2B 4M62H 4DP4X 2CO1A 4HWZB 1JPGA 2FDBP 2HRPH 4XVTH 2IANA 2J72A 2O5YH 4TQEH 4FQ1L 1SY6L 4XWGH 2ZD0A 4LLVA 4YDVA 3JV4B 1A6VL 3BHBB 5FCUL 3SPJA 1H6FA 4IIQC 2C3VB 3QHFH 2GK0A 4IRZA 4OZFG 4JPWH 1UOKA 4ODWA 4XH2A 4CVUA 3BWZA 1XGRB 1I1AC 3L3HA 3VSUA 5CP3A 3VD5A 2WSKA 5HI4D 5BCAA 3IT8D 1WWWX 4PJ8D 4PGCA 5I1CL 2FGZA 2B1HH 3SDCD 2X70B 4PJXF 2PO6D 1U8QA 2IAMC 2X40A 4UT6L 2YARA 4CC4A 1BM3H 2H2PC 4FCHA 3CCHA 3MV7A 1J5OH 1UACH 3CHQA 3VD3A 3AY4A 4FG6C 5J1SC 2AANA 5IVOA 3WSQL 4BWUA 4F1ZA 1CQYA 7PAZA 3P4MA 2JKSA 3TF4A 5L7XL 3IF1A 2GYSA 1UZGA 2AJXL 2EIZB 1KGUA 3VA6A 5F9DC 1MSPA 3K8LA 1IIIA 3LEVH 1WAAF 4XO5A 4YHPA 1WRFA 5EORL 5T1KA 5I1KL 4F80A 1MCQA 3QQDA 5LJYH 1NOFA 3IAPA 4CSZA 4GKNB 3AQDA 3WL9A 4ADGA 4XO9A 1M56B 4PJ9A 2O4EA 4AT6B 4LLVB 2EIJB 4YDVB 1GJWA 2GT9A 5E6IA 4L9DA 1YAZA 5I1AB 1NZRA 3NUKA 4LCCB 4NQXB 3K74B 4Y16B 1I3VA 3P0YH 1KELH 2G75B 5B39B 3GDBA 3VMPA 2YSSA 3BH8B 4UIMA 3ARBB 3S37H 1BLNA 2MQ3A 1R3IH 1KXQA 3MA9H 4MHHI 4RAVA 3TJEH 2C3HA 1XIWC 3UIZA 1MIMH 3BZEB 2YWZA 3IDMB 4Q2ZA 5CFHA 4NYLB 5BXFA 2LU3A 1FBIH 5CEYA 5DZNA 2ZUTA 3TIEB 2VDRH 3V9CA 4GNKB 3QZWG 5HVHC 3LNEA 1IARB 5BOZG 5BRZA 3CFDB 3BD4A 5GGVY 3TV8A 3H7LA 3MBED 2OQJA 4G80A 1FJ1A 1ZOXA 4QD2E 3HMXH 4M48H 1LEGB 4UV4H 4WJ5B 4GXVH 5HDOA 4PJ7A 3U6RA 1UJ3B 3FUEA 3ZDYF 2YEVB 4ZO7A 4N0CD 3KNBA 4MX7A 4IKKA 1F02I 3DJ9A 4FEIA 4AE0A 4G6FD 4HUVB 3EG9B 4JFSA 3V4VB 1RK1B 2PF6A 2AEOA 4L8BA 5DFVC 3HG1E 3SZ6A 1ZLDA 4H2CA 3CVHB 4Y8AA 4NNPL 4WU5A 1JUFA 1VZIA 2X41A 4Y1AA 3U7WH 3SOBH 4MZIA 4DP5X 4OZGE 4FA8A 5I9QB 5BVJB 4H2AA 4MWFA 3CBRA 1FFNB 1A21A 1X5FA 1QFUH 3AM8A 5BVJA 1XGUB 1AP2B 4M4RA 3HUJE 4NQED 5T3XD 4N8VG 1NMCC 4FQQB 1AQDB 2IALA 2VSMB 4R2GC 3GSXA 2E9IA 3CFEB 1EDQA 4RSYA 2E9JA 4DW2H 3NIGF 5F8QC 4DKTA 1MW3A 3GJFH 4FP8H 1NM9A 4PJ7B 5KJ4A 3QULB 4F7KA 4DEUA 3B5GA 3O11A 1OGPA 3MLTA 2F7PA 2XBZA 4KMLB 3WXVH 4I0PB 5KVFL 4H8HA 4HLZG 3STLA 1XVSA 4HJ1A 2LLGA 4EOWH 1G7PB 2B8OT 1W0VA 1ZE3C 2IQAB 4KZCA 4HK3N 1NCBH 2NTSP 2W91A 3UG4A 5JO5A 3G08B 3UXFA 1SXBA 4WUUB 3MUGB 4I4WB 1MLCB 3PLYA 4PRPE 2BWDA 2JF1A 4UQCA 3SPIA 3LEYL 1P4LB 4ONFH 4LNRA 4WENB 5GGSB 4FMFA 4JY5H 5GGRB 3ZT5A 5IHZB 4GAJH 4XCNB 3BPOC 2H3NB 2Q6WB 2Q8BH 4D3CL 1MZZA 2DQFA 3GMOB 4FQJL 1QSFA 4N1EA 2BWIA 4KOCA 2PXYC 2VO5A 3P0VH 3SPHA 3QDMD 5ID1B 1HL5A 5INCA 4K8RC 3FQ1A 4JFDE 1MY5A 4PWEA 3SQRA 1KENH 3ES6A 5SWZD 5I76B 4HIXL 3V4PL 2PMZA 1P7KB 3BUYA 2XQYG 3MX0A 4JFOA 3RL1A 2DQTH 1SOXA 1U21A 3QZLA 2V8LA 1ECZA 3CFIC 1IT9H 5A16A 1EMTL 1UXSA 3WJLC 3ZDWA 1SN2A 1KMGA 1BGXL 2Z8WC 3T4AC 1H3GA 4I0CC 4ZTPH 3TBVB 4L48A 3CLFL 3VD2A 1EFXB 3JBG7 4HGMA 5IFHH 5FKPB 1XH3A 2DF3A 4L4TA 2OX5B 1T6BX 4M1GL 1E67A 2OR9L 4PV9B 2QHRL 3VXMA 1QX1A 4N24A 3FTWA 4LNRB 4WNJA 1WQVT 1MOEA 4J3OD 2ICWI 3EJTA 5IJVB 3TJPA 3SKMB 4X9BA 5T5NG 1BJ8A 2FZ3A 1IFRA 1XXFC 1BDYA 2LVEA 3QJVB 1VFUA 2FEEI 4OZIE 4N0YL 4LCIH 2PR4L 2WSDA 1V54B 2VAAA 1U95A 3BN3B 4XNUH 2LQRA 5DJ8A 3UZQB 1G0YR 1PIGA 2NNXA 1DVFA 4F8OA 4NN5C 3LQAL 3BAJA 1EXUB 3O0LA 3VB8A 4NPYB 4WV1A 4NC2B 4OQTA 5HJ3A 3FU5A 1HIMH 3TO4C 1WCBB 3CLEL 4PRPA 1AYOA 2GFBA 4PBVC 3ZYZA 5F9WC 4JQXA 4PD4K 2EADA 1SBSL 2V3DA 3FW6A 4J39A 2BVTA 1T1WB 3F12A 3M1CA 2YIHA 2BK8A 5DJAA 4CNIB 2WXRA 5HBBA 3IMBA 3C2AL 3MRJA 4Y5VC 1IGYB 5AAMA 5TE7L 2WQAA 3QXDB 1RZKC 2Y7LA 1ZHBA 2FSDA 2QFPA 1IKOP 1QYGL 5MHSD 4U1JB 1BQHB 2A74A 2ZWNA 2X1XR 3H9SE 5DD1L 1W6LA 5I24A 4Y2OB 5EDXA 2WGNB 1MLBA 3RJOA 2EUXA 4YVNA 4YSPA 4W70A 5L7XH 1WFJA 1T3FA 3OPUA 5ECGA 1CTOA 5DJZB 1KTLA 3QDHA 3F85A 3SPVA 4AUUA 3WTSA 2X2JA 3K6SA 2JXMB 4NAMA 2XZCH 1U4EA 1ZCRA 2XZAH 1JK8B 2ZX9A 3GSQB 1CD8A 1TNMA 1AC6A 4OI9A 2WKOA 1TZHA 1B4RA 3RUGE 1J18A 5AAWA 2H0FA 2ZP0T 5L0QB 2YD7A 4XT1C 4PH8A 2MQCA 2OJEA 3T65B 1ACZA 3G5YB 3T1FA 3VGAB 1MIML 3ARRA 3N55A 5CU9A 3O9WB 4Q7DA 3VAEA 4LESA 3MRDA 1JRHH 3EYFB 1YPZF 5BZDB 4Q9RH 1HAWA 1Q0YL 1XR9A 4YFDB 4MB5A 2YC1A 2IDFA 3PJSB 5HYQB 3H9SD 3MV7D 4UQ3A 4R90L 3QDMB 3FFCA 5BZZA 1FGVH 2FVNA 4MX7B 3GD1C 4AVJA 1DO6A 4DFIA 1AGEA 2YKLL 4YZWA 2BS8A 4U3HA 3WKYA 3C12A 1D5ZA 1AGEB 3LRMA 1DVUA 4FZ8L 4AIOA 1Z9LA 2BRRH 2QGDA 1E27B 5T1KD 3HKZA 4IDLA 4Z7OE 5A1AA 2MPVA 4JREB 2YK1L 2WLMA 4QTFA 2AGJH 2P44B 4XOEA 2NUTA 4BH8A 4D7PA 2OSLA 4WW1A 2ORBH 3C60B 4A7VA 5C2BH 4PJ9D 4PRBB 1ETA1 2W9EH 5T1JA 3KWVA 3HVDA 4LCYA 4XP6H 4ZFFB 5LB1A 2Y06L 3WHE1 5F2FA 5KVGE 3VWJC 3OLDA 3VI4F 2CR0A 4BXVA 1F6FB 2A77L 3CSTA 1JZHA 3D39D 3MRDB 4OD1H 3QDME 5AVYB 4RFEA 4YDZA 3BIBX 5D4JA 4XZ4A 4B6ZA 4NQVB 4F24A 4J8RB 2ZIDA 4TXVB 1VIWA 2ZOKB 4AENB 4NQVA 2X4PB 5T1MA 3SGDH 3QA3A 3EGXB 4NGHL 4ZUUB 3VRIB 4NBXB 2AJUL 1ETJA 4LOFA 1U92B 2WQXA 2VRQA 3BZDA 2OULB 5IK3A 2ADJB 3EW3B 2G5RA 1JPTL 2B4CL 2QVMA 4P2RD 1HHGA 3X3FL 3EJQA 1FA4A 4J3OF 5D7LD 2AQQA 1TIUA 3TH3T 4L3EA 3SYQA 3RWDB 1ITBB 4JRXA 5F9OH 5HHOD 1AHMA 1YEFH 2DQGL 3FNKA 2ETWA 3FQWB 5KVEL 1KB5H 2H9GB 3DC0A 3V7MA 2ZNWA 4BFRA 1S9VB 2NY4C 1NFDE 3FCTA 4AKQA 3M7OA 1ONQB 2QQNL 5D2LA 4OJYA 1Z9OA 3INUH 2JQMA 3BQVA 1U2HA 1H19A 3UBFA 4FXTA 4WI0B 1TVBA 3IJ8A 3FQ4A 2YPLB 4FI8A 4PY8I 5JW3H 4QHKI 5KSUA 1PNCA 1MHPL 2CUHA 4F2MB 4FG4A 3TPUB 1NEUA 4N0UB 5IEKB 3NCBB 4MCZB 5IROC 4PLNC 2OTWB 4LP5A 3UYPB 4QHPA 4F58H 2J44A 3VTMA 2DQHL 2X4PA 1NFDF 4TPRH 5TJWK 1MXGA 1TEYA 2VXQH 3D9AH 5E8EA 5D4IA 4X0NA 3LKOB 4M1DL 4WEUD 4FRWA 1ZLUK 3IMWA 3Q8BA 3H3KA 3AZUA 1AZUA 1HXMA 2O6EA 4PGDB 4Q2ZB 4Q8BA 5IWLC 1L9OA 1AGFA 2VABB 1CS6A 4Y16D 4WCYH 1G7IB 4JM0A 4ZUSB 3INOA 1PY4A 5CR8A 5KS9A 1IEAA 4JHZA 3ABZA 4F2ME 1NICA 5TK4A 2ZX8A 1KG0A 3KLAB 3PHSA 4H40A 3BSZL 1HQ4B 2XG4B 1IBFA 4L4VA 1BAFL 3EF7A 3FL7A 3H3BC 4RWYL 1A3RH 4MNQE 1VERA 2ZUSA 1IAMA 1SFHA 5JLZB 3WGVB 1KN4H 1OHZA 1ZHLB 3BAIA 2EDMA 4OUUA 4XN1A 4NWTH 5DQDL 1MAML 2F8VA 3BDYH 3O6MH 4YXLH 5DJ6B 5AZ2L 3SDCB 5HGAA 1U4FA 4N5ED 4JFFD 2DYRB 2NY6C 1Q90A 3NFPB 4GRWE 4KHTL 3BP6A 4H1LH 2JELL 2Z92A 4XO8A 5I1JH 3L6FB 5D5MA 2MTAA 1OO2A 5I74B 1YNKL 3I6KB 4MDRA 4ONOA 2FR4A 3E6FA 2GFBB 2UY6A 2YUVA 5CBEA 4AYGA 1TQCC 4NZUH 3U9PL 3QORC 1P7QB 4UNUA 1XFPA 2WBJA 1FV1A 1ZK9A 1A0QH 4J2QA 5IGXL 3C8KB 3E3QE 1E6JL 1RJCA 3GQFA 4TSAH 2DIJA 5EZJA 3A6CL 1F11A 1L3WA 4J3VA 4OZIB 1JGIA 1F41A 2VL5B 3SDYH 5JHLH 4TYUA 1NAMB 3BWAA 1M3JA 4JG9A 4EXKA 5K9OA 4KK6D 5I6XC 2AMGA 3CDZA 2VWEE 4WI2A 2Y6SD 3DBXA 2P80D 1CN4A 2YD5A 5FWQA 5IOPA 3ULUL 2DOCA 4WDIA 2ZQKA 4B53A 4WFGE 2OMUA 1GGUA 4F57L 3FSOA 3HS0A 5FYJL 1RLBA 1ZRUA 1KNOB 3P4OA 4PREA 4DAGH 1YNLL 2QKSA 3FTXA 4G8GB 1SYVB 3QDJE 2UVFA 3VUAA 2EEXA 3MRLA 4NUGL 4QRTB 3ULVL 1O5DT 5IEHA 2WUBL 1H0DB 5DQ9B 3UJTH 1HXYA 2R0KL 2WJ5A 2X6MA 1DVXA 4FD0A 3OWEA 5CZXC 3AY4C 2DLIA 3VE0B 1OTSD 1ZK5A 2A9CA 3B83A 4JQVA 4Z0XA 4F9LC 4OY9A 2FIKB 3CZUB 2ZE0A 5E2VL 2FRGP 2XX1A 2SEBB 5IW6B 1DSFL 4NBYB 3ARTA 3EBAA 3VU1A 5F6IB 3MRQA 1IX2A 3AADB 3UZQA 2IBZX 5ESQA 1AD9B 2EH7H 2L7QA 5E00B 3M6DA 1MJUL 5I66A 1AZRA 4ZSOE 5C3TA 4KMTL 4WUKH 2E75C 4R90H 1E9OB 4Z3EA 4IIQB 1QSZA 3FB8A 4H1LB 4OFKA 1T21A 3WTUA 2Q8AL 4EI0A 4R96B 4ELMF 2DMBA 2BSRA 5I5RA 3OMIB 1NLBL 2YQ3A 4MD4A 1UKSA 3AREA 3V9FA 5D70H 2H0JA 5CMAB 5FW8A 5E2TH 3BRGC 4OD2A 4QAMB 1XSJA 3WV0A 5BOJA 1QBMH 2GBVA 1ZLVK 1OZTG 4Z78B 2ZOWA 5KZCB 4BDVA 2F74B 3IU4H 5JUEL 3MJWA 4ZI8A 1HOCB 4BGLA 3EH3B 4YE0A 3IKKA 5JXAL 3P1VA 5L6YH 1RK0A 1E43A 3AG2B 3T0VA 4EQ2A 3IMTA 4JRYD 1JN6B 2B77A 4Y5XB 3QCTH 4IRSD 3QDMA 3A6BH 5KS9F 3LSOA 1VPOL 3CDCA 1F3RB 4NGHH 2ARJB 1SN0A 3NIFF 1WGVA 2EO7A 1A4KB 4M7LH 4WI5A 3IJEA 3HHSB 2G2PA 2L7JA 2HLAB 1A4KA 4IJ3C 1ZXQA 1M05B 1NGXB 5DMKB 5JQIB 3APMA 4LOUD 4I18A 4P2YA 1THAA 5L8LB 2BVQA 3GHPA 4I89A 1HCYA 4WI9A 5FA3A 3SGJC 4Y1AB 2B0SH 1JGUH 4KKPA 3D50A 4M8UA 12E8H 1JWSA 5CEXA 1EZLA 2F0CA 4IBWA 4M29A 1KBGH 2JLPA 2WC7A 3IJYB 4RZCA 5I8CB 2WMPB 3MROB 2CRMA 4LSQH 4UT7H 1E7UA 3ISYA 1MCKA 1HHKA 1T5WB 3H9HB 4E9LA 1Z9PA 1A2YA 4W9ZA 4XC1L 4ZZFA 1V3MA 1RV6X 4JM2B 5D5MF 4F37K 3MPCA 4KKNA 3DWTA 5FYLD 5AG9A 4ZOCA 1U8KA 3QP3A 4ESKA 1QVOA 2A6IB 5C0AD 1YEDA 5FHBH 3HZVB 1CF8L 3F7YA 4PR5B 3GLAA 2GK0B 1V5JA 2EQDA 4KX8A 1MCSA 4ZQKB 1NDMA 4PY8J 5C0EB 5TPWH 4M1DH 4EIZC 3KPMB 1UFGA 3BIKA 4FQ1H 1UEMA 2JH2A 3QJSB 4XWGL 4RAVB 4CU7A 4H8PA 3HB3D 4QHMA 1UT2A 2B4CC 3PDOB 4AM0A 5DRZA 3K81A 3W1ZA 1URLA 4DW2L 2QSCH 1FYTB 3OAUL 4Y4HB 4N0UE 1DVFD 2I26N 1QFWI 4J12A 4DUVA 4XRCB 1DCLA 3OB0K 2YJQA 3DROA 5IQ9B 3CH1B 1NAKL 4YGVA 1A7OL 5KYYA 3U30B 3VXSA 1ZS8A 4HUUB 3VXRD 4JAMA 4JFHD 1P5UA 3A4AA 5DD6A 1JPEA 3MRPB 5FYLL 3ABLB 4F2MA 1YMME 4HXAL 3MV8B 1IZKA 1R5IB 5D2NC 1IQDA 5CCJA 4YFEA 3KNBB 1OGSA 3RIFK 1IAIH 3VXOB 5DWPA 3UPAA 3IDIA 2F54E 1VRSA 2WLIB 4MJIE 2DJUA 4YH6A 3VXOA 1EZSA 4LPVA 4QIRA 2AJXH 4RNRA 3BDYL 4DK3A 1WJ3A 3SY6A 1NCWH 3S35X 1YPZA 3OG4B 5DHVA 3QR0A 4LAQH 3V0IA 5HI4C 4NHUB 5AWNL 4W9CC 2NY1C 4DKAA 2H3KA 1L4IA 2Q86A 5AOMA 4LDEB 3FRPB 2MPAL 3DUUB 4ZODA 2DWTA 1GH7A 2VLKB 3PDOA 4PG2A 2AK1H 1A3QA 4EIUA 1UB6A 5I23A 4G43A 4HJGA 5I0WA 3W2DH 3W3BA 2YRZA 3LIZH 4PU2A 3QIUB 1I1FA 1Q72H 4QXUH 4MAYD 4MMZA 2JSFA 4FQHA 5DVKA 3UIYA 2VGLM 1A9BB 3HRPA 2I7OA 1R3HB 4EN3D 3K72A 1J9QA 2IADA 4NKOB 4WW2B 3D7PA 3KM2A 1R5VB 3B1TA 5IFJB 4GRWF 3EFFA 3FO0L 3D3VA 4FULA 4JRXE 5FYKE 2GSIB 3CZNA 5D6DA 3MUGA 1PKQE 3A24A 4MS6A 5HHVH 1AGDB 4MNGB 1KIUB 1M1XA 4BA0A 1AKPA