2KMWA

Solution structure of at3g03773.1 protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of At3g03773.1 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein At3g03773
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kmwA01
4I88A 3GT6A 4FEIA 1WH0A 4YLCA 5LUMA 4PCKA 3L1EA 1SHSA 2XCMC 3QORC 4M5SA 2CR0A 3N3EA 3Q9QA 3L1GA 3QORD 4YL9A 5DS2A 1X5MA 5DS1A 3W1ZA 3VQLA 4PBDA 3AACA 3QORB 1WGVA 2Y1YA 2Y1ZA 2CG9X 3GUFA 2N0KA 2Y22A 2N3JA 2JKIS 4ELDA 3GLAA 2RH0A 3QORA 3AABA 1WFIA 1GMEA 3Q9PA 4YLBA 3VQMA 2KLRA 3J07A 4YE0A 2K8QA 4YDZA 3L1FA 2WJ5A 3IGFA 4JUTA 4M5TA 4JUSA 4MJHA 4ZJ9A 1RL1A 1EJFA 2O30A 2BOLA 2WJ7A 2MNWA 2KMWA 3EUDA 4RZKA
chains in the Genus database with same CATH superfamily
2J57A 3UCRA 3QO1A 4W81A 1XR8B 3DXAE 3PPEA 5HI5C 5IVXB 5K59E 2RAMA 5I6OA 4BWTA 5T1MB 2OZ4L 1SUHA 2Y7OA 1PKQA 3QFDA 1I1RA 2XJKA 4ZUUB 5DMJB 1CDJA 5AUMB 3RL2B 4RQQB 3QZNA 4E68A 1WFOA 3IVKA 4L4VD 4NNXA 1CWVA 5CJ8A 4GBXA 3ESVF 3BWZA 4HJEA 2PO6D 1E8XA 2NMSA 1FIGL 2WBJA 1JZ7A 4QCIB 1S7WB 4U1IB 3WNKA 3L3GB 2VLLA 3BX7C 4M43H 5KVDE 4JHUA 3X13A 2IMNA 3ZJAA 4NRZA 3HBGA 2PCXA 3LNDA 4MJIB 1ZKAA 3LS4L 3MLXL 5TF1L 5D55A 3VXUD 1R3KA 2JH2A 4K2UH 3RX8A 3FRPG 5TDPB 3UIZA 2IAND 1EHNA 3CFKB 1BIHA 5GGSB 5DLML 2BHYA 3OKKA 3HG1D 3LZLA 4G7YH 3V6FB 4ZMOA 1SYSB 2KZKA 3QQ4B 1W72H 4ODVL 4WDIA 3MV11 1PBYA 4LL9A 3SDCD 3ALWA 4KY1L 3KLHD 3RGBA 2AF2A 1RK0B 1QLFB 3BMWA 3JUZA 4FQHA 2WNXA 3VGHA 1M05B 1S46A 2B14A 3EBIA 2XX1A 3PPSA 3WEAA 4BM7A 1DBAH 3N43F 4W9ZA 4DFHA 5J6GB 3VGFA 2R0ZL 5CFAA 3AREA 5E9NA 2OI9C 4OQ1A 3WNOA 3LN5A 1DQLH 4OFYD 3MCKB 2XSKA 1T6WA 4C4UA 5B3JF 5EO9B 3ECWA 3VWKD 1UH3A 3OKLB 3HE6B 3M7OA 2WXFA 4GUQA 2P4AB 4C55A 3I85A 5DHVB 2R56L 4FI7A 3CGTA 1BM3H 5LNEA 2ZXGA 4QJ3B 5FM5O 3CN3A 4U6YB 1J05B 4A68A 1M3IA 1QEWA 3QCVL 2VM4A 5FOBA 3PAZA 3IT8D 4BFRA 1QO3B 2VDOL 1NKOA 3IFLH 4NQXB 2BMKA 5BRZE 3FQUB 3ARDC 3VGBA 3KXFE 3RVTC 5I71C 2QKIC 3O3AA 1EV2E 4QRAA 4M7LT 4MSWB 4ISVA 3N42F 1LP9B 4GUOA 3BPNC 1Q94A 5CN3A 5B1BB 2XXCB 5B4MC 5JZ7D 4ADJA 4QEGA 1TZAA 1KTBA 2F1EA 3N40F 3UTQB 4GRMA 4LBEA 4HKJA 5IKCA 3WN5B 3RZCA 3TBYB 3C60B 4PMFA 4HIXL 3MLXH 5TF1H 5JORB 4K3DH 3ZE2E 4UIKL 4WEEA 3I02B 1UXWB 5C86A 1ASPA 4MNQE 5DLMH 3WGUB 2OW6A 1D5IH 1QRNB 4GSQA 3NJMA 3Q5TA 3KVPA 4G8IA 5GGVY 4QWWC 3G6JF 3MACH 4UB0L 3VFNA 4AQ8A 3QRLA 2QSVA 4K3JH 1W72B 3U1QA 4HPHA 4XN5A 4ZSOA 1XQ4A 4PHZA 3BWSA 5IVZB 2QPEB 1NSNH 3U48A 1G4RA 3C08L 1BBDL 3T0DA 3AAZB 4Y9CA 4DPCX 3L8QA 1ZGLA 3GBLA 2NX5A 1OTSD 4YHPB 2RFXB 3U6XS 4KXCA 5HGBB 2V3EA 2OYPA 1HXYB 1E2VA 1J9QA 2Y5QA 4QTIL 4NZ8A 4YPJA 4C56A 3D39D 2CRYA 3WS3A 5EIVA 3N85H 3OL2A 1ZT4B 3ZVVA 2B0SL 2A9DA 3WUWA 2VLRA 4GSDH 2H2PD 2WYIA 3WTUA 2ZUQB 5E1QA 3VFOB 4EN3C 4KJWD 4WHYH 3G5ZA 2NW2B 3MLTA 3KGRA 5J11B 4G8GB 4H20L 1HXKA 2P7TB 3WTWA 1N5AB 4NHCH 4WJKB 4WFFD 2WYHA 5HGDB 5I74B 1ERNA 4DP5X 2ITFA 2B39A 4MQSB 2XVGA 3CBKB 3OD3A 3COOA 4KQ3H 4M5SA 4S1DD 1X5AA 1PDKA 5ISZD 1TVBB 1ORSB 2XWBB 3HFFA 3PWNB 3IN0A 5KUKA 2NXYD 1ZLVK 1I9JH 2BNQE 5J0BA 2Q8AH 1PCXA 3PWUB 2FX9H 3P4MB 3HC4H 4G3YH 4YHYB 1FC2D 4HIXH 1WRFA 4OFIA 2OXHA 2Y72A 4KFMA 4O02H 4UIKH 5EZLA 3BOVA 1MAKA 4LVNB 3TV8A 1RMFL 1NC4A 3MCYA 3P54A 4TULL 2E4TA 5GRJH 3X11B 1FL6B 4YZFE 5FB8B 1T5KA 1F3DJ 3L95A 4WHYG 1TTBA 3H9HA 1AHWC 5IBLD 1HWWA 4JLRA 2MKWA 4LHJB 4D9LH 3AC0A 3H9YA 1IAKB 4ANWA 1J8HE 5G4OA 3O8XC 3AREB 4A7SA 4RIRB 5KAQF 1RLBA 2DBLH 4FXGC 3UTOA 5CJ5A 2KLRA 4IRZA 2Q86A 2WJ5A 4UMSA 3IU4L 4XMXA 5B4MD 2VISB 4MAZA 3RTQB 3IDYC 4XP9L 5E6ZA 3JV4A 1XHHA 3SDCB 5I1LB 1P5VA 4OGAC 1MZZA 2B0SH 5ICXB 4QAMB 2E7CA 3EFFA 4PJDA 1G5AA 1NFKA 4XBMA 2DF3A 2DM4A 3S3CB 1T1XA 5DK3A 2X4OA 4G71B 2EO1A 1NCAH 3MLZH 4F2MB 1AR2A 5HPMA 4U1GC 1N8OE 4G42B 5T5NG 1M7IB 2WXRA 5IQMA 4HVBA 1PZCA 4L1HA 4LCUB 1BEXA 3DX4A 3FSAA 4NHCL 5C0RL 2F6AA 8FABA 1NEPA 4JRYD 2PYEB 1FGVH 1WGOA 1VLXA 5AW3B 4DQOL 5D1XB 4RA0C 1DSWA 5BCAA 3WENA 3NRFA 2AEOA 1V10A 3HFML 3F7KA 4FP8L 5DJ2A 5FW8A 1MFBH 3DIFA 2CIKA 3B9KB 3GSOA 4B5EA 2LHAA 2K7PA 1QHPA 4KTGA 2FECI 2OMZB 3T77B 3C5ZB 3LNHA 3OMNB 4NM8H 2UVFA 5K39A 3SDAC 1TO4A 1I9JL 2W91A 4HJUA 4HIQA 2FX9L 1S5IH 1MQ8A 4J28A 5FFGA 3OX8A 1KB5H 2J20A 3ELQA 3VI4A 4OVUA 4ONHA 4UQ9A 5KBDA 3KLHC 3GNML 1YHPA 3VXMA 1AGBB 3ULVF 2EDLA 3ARSA 1RMFH 3CHXA 2GTZA 4GAJL 4ZNEE 5GRJL 4C59B 4M3HA 5AVVB 3VXRD 2V5YA 1GZHC 5EFIB 4NLAA 4MCMA 4J7RA 3JVGA 4X4XA 3LH9A 1PZSA 2Q8BL 1M7DB 5MEPB 1PD6A 4Z6AT 2IAMC 4YDVB 2CLVA 1NCDL 1UASA 1WWBX 4R0LA 3C5XA 2CK0H 1MFVA 2ZCHL 1SLXA 4JFWA 5FAAA 2B5IB 3IU4H 2FJUB 1UFGA 3GZKA 2BVYA 2IBGA 5JR1L 5F1SA 2J6WA 1MFAH 1MXDA 1SXSA 2ZYHA 3AY2A 3ZR5A 4A55A 3J8F7 4N2NA 3DX7B 4X7FC 4JKPH 3V4VA 3I75A 1EMTL 2J1XA 4OQTA 4BQCA 1X5YA 1PJWA 1NCAL 4P46D 1JYNA 4OCRH 1OWRM 3PAUA 5I1AA 4LDLB 3BEWB 5C0RH 1QP1A 2WGXA 4M1DL 1XGPA 1JS4A 3LPOA 2BMKB 2P5WB 4AX3A 2CDGB 1I1YA 4YGVB 3G5XA 1M53A 4PRHB 2XFGB 3HN3A 4KKAC 1MFBL 3UO8B 3FT2B 3B9VA 4G8GE 3ABLB 3T1WA 1BQ5A 4N5UA 4UM9D 1CB4A 5I1JH 3TM6A 2EYTA 3LN9A 1QBML 4OFDA 4JGNA 4IMKA 1KIUB 2Z35B 1FLTX 3QEQA 1TF4A 2JQMA 3BVNB 2KQNA 3S4SG 1S5IL 4FQCH 2WTRB 2A74C 4UIMA 3FJTA 4L5FH 3FRUB 5CEZD 1KB5L 1KEMH 3CDGA 4PP2A 3FOMA 3Q6GH 3IMTA 3U30B 1EEYA 3HEIB 4NHUB 1CYXA 4ZFZA 4P23D 3GBNH 2OMVB 5DMKB 2HJKB 1Z0NA 1J1XL 4YX2L 3TF7C 1MRDL 4Z0BL 1IAKA 5T5FL 5EU6B 4DPAX 1MCOL 4FABL 2PP8A 5DZPA 2GJ6A 1MDTA 2Q8BH 2K9FB 3UJIH 3BPLB 3QEGL 4UM8B 1NBCA 4D9RD 1HT6A 1HHHB 1N26A 2DLFL 4G6ML 5D70L 2WIMA 3X3FH 4KTDH 2CK0L 1L9SA 1F6LL 3RPKA 1X7QA 3KWWA 3GZPA 4PD4K 5IFJB 4EN3B 5IB2A 1F11A 3N43B 3UYRL 4FG6D 2C3VB 3VI4E 4L0ZA 2VR9A 3DGCR 3NJIA 4G42A 4IRJA 4UNUA 4XAKE 1KIQB 2J4WH 4Y19E 5FXCH 3BDYL 2PW2B 2HB0A 1XZ0A 1A1MB 5AB9A 1NC2A 5LNDA 3ILQD 1SJVA 2J1ZA 1J8HA 5IJBC 3F7LA 3RQ3A 4KKRA 4ZPVA 2YQBA 3QDJB 5JW3L 4K0OA 3HVDA 4IEFA 3AB0B 4H4NA 4M1DH 3QJQB 5DC0A 1M2OA 3JV6B 5J1TC 2NY2C 4JFEA 1IX2A 5I1IH 4U3SA 1EAOA 4GP4B 4HHWA 5IJKA 1IV8A 2Z31D 3SKOB 3UZVA 3UZQA 3CMOH 1TETH 3BW9B 4PJFE 1ZHBA 2PPEA 3SD5A 3MUUA 1WZKA 2SEBB 4CADA 1VCAA 5EO9A 1OAYL 3HBZA 3LHPH 4LVNC 4PJCF 3IDYB 4Y4HB 4HFWA 5EF1A 4QJ5B 4FQCL 3DURB 5J7CC 2M8XA 4ORGA 4L5FL 4W4OC 2VB5A 3CX2A 4EIUA 5ESAB 3KPRB 1Z9SB 1ROWA 3H7LA 4E9QA 1WAPA 4HH9A 4H1LH 5DF0A 1DBJL 2QMKA 2ENSA 3D85D 1H5BC 2ERJB 3U82B 4GAAA 1J1XH 4JFUA 4TSCL 4BJLA 1C9SA 3Q5OA 3FHAA 3M1BA 1U92A 3TNMB 1MCOH 3BXNA 4FABH 3O3AB 2E46A 2X38A 4Z0XA 3ATAA 2VW7A 3FU3A 3L6FB 2DM2A 2RIKA 3QJFA 1MWAA 1SN2A 2XHNA 4KNUA 4KTDL 4FXKC 1U8NA 2WTOA 3MKKA 3OKYA 3WMQA 1C8QA 1XF3A 1ICTA 4TNWK 5GZOD 3JTSA 1BQSA 4YDNA 1RUAH 2FL5B 4FTDA 3O0RL 4I18B 3KYKL 1TZIB 2WD0A 1X9LA 4RISL 5I1AB 1HZLA 1F6FB 3TTYA 2C8NA 3LDBC 5JHLH 2BLFA 5TE7L 1M7IA 2PXYB 4DZ8A 3RBGA 5MI0B 3UPCA 2P49B 3UMTA 5JW3H 1G43A 2XLLA 4BRJA 1NCHA 1HHJB 2PWGA 2NY0D 4TQPA 1AD9A 1INQB 4N8UA 3HE7B 4P2CG 3BISA 3FQTA 4LLYB 2H26B 4XCCH 3EFOA 4V1DA 3MGOB 4QYAA 5F9WB 5KOVC 2IOMA 3HZKA 2DQDL 5DVLA 4IOIB 2XA3A 4MXVE 3ARBC 4AE0A 2JK5B 4KJYA 4JREC 2GTWB 3IWVA 3TT1L 1YMMB 2CAKA 2F7IA 4P4KD 2YHGA 5BOPA 1E67A 4PS7A 2XQYK 2WXHA 1OD9A 1A47A 1AGBA 4AZUA 1N5AA 3IJ9A 1R3JA 1RI8A 3WJLA 4C56E 4F24A 4JO3H 1CGTA 1T0NB 3H9SE 1C5CH 5IK3A 5J4MA 3BKJL 3OAYH 5EMYA 3GGWA 1XIWA 3MQIA 3MUZ1 4NQED 1NFAA 3FPXA 1JSYA 5AAMC 2OTUA 3PWLA 3VXPB 4FLHA 4L05A 3I9IA 5I71B 3WIHL 2CLVB 3UTSE 1I7UA 1KLFA 2XG5B 1OE1A 3V55A 3RWHA 5JZ7C 4KKBD 4M5TA 1Q9WA 4KJWC 5AW6B 2Q7YB 4KO9A 1KENH 5GXBB 1JVKA 1LO5B 1WUZA 3LKQB 3ZDYF 3H3BC 3GTNA 3O0RH 4W4NA 2UUDK 3KYKH 1NC2B 2X6MA 1I53A 4KGJA 2FEDD 1I8UA 4L9LB 5IV2B 2K8MA 1NCGA 2ZXBA 3MV9E 2Q6WA 3EUUA 5JHLL 2YC1B 4OCSH 3FRPB 4LCCA 5HD8D 4GRWF 1S5HB 3GSVA 4LLDA 4YLBA 4IBUA 2BINA 1IM9D 3OB0H 1D5XA 4HT1H 2VLMD 1DJIA 3PGCA 4ZXBC 3WNNA 4LFHG 1EBAA 5CAYB 1O7VA 3MBWB 4WWPA 3RJOA 3P30L 4OGAD 2Y0SA 4AQ1C 4E9VA 4XCFL 3ZDYB 2Q86B 4BSVA 5AB0A 1QYGH 2AGJH 2FAUA 4NRXA 4X8JA 5F6HJ 5JPNC 5IR1B 4MS8D 4XP5H 2VDMB 4PU2A 1S9WA 4AYGA 2ALAA 3RY5A 5I1DB 1DANT 4G9DA 3QDJD 2HN7B 1FNAA 2JJSA 4KNQA 1J8SA 1T1XB 2G75A 2R2EA 4TPRH 1X5HA 5BRPA 4BSJA 5HYJD 1TPXC 1EEYB 4NHUA 4NKIL 4D0CA 2WGNB 1KJVA 4K94C 4PG9A 3VA6A 2Z31B 3S5YA 1KIPA 2DD8H 4ZYKB 2DMBA 3BKJH 3K46A 2X9YA 5AKSA 1YJDC 1FFQA 1E5YA 2BCKB 4PJBA 4U0RC 3RDJA 1ESOA 2KT6A 3MLSL 1SEQH 5AZEL 4CL7A 3VD7A 1KYUA 5BOZG 1E27A 5EC2A 4YJZL 4UM8A 1KJ3H 1T4WA 3GSRA 5SV4A 2WANA 4PJBF 2OZ4H 1XGZA 3J7HA 2JIXB 2XXGA 2WXKA 2RH0A 5IFJA 4DVBB 3CPUA 3WIFB 4J3OG 4JDEA 4O5LL 4JFVA 3GXMA 3L81A 2I24N 2AJYH 4I2XA 1WD8A 2A9BA 4HKZB 1Z9LA 1FIGH 1KGCE 4Y16D 4M43L 1W0WA 1OTUC 1E4HA 1VSCA 2D03L 2VDLB 2O4EA 3RVWD 4F27A 3T0EB 5AVYB 5MEPA 2XQBH 4NB7A 5EIIG 1KJ2B 2JCCA 1YY8B 1CL7L 4MDIA 3KLAB 4JGJA 4JFEB 3QXDA 2UY7A 4ZO6A 4XCFH 3HG2A 1NOLA 4HS6A 4XMLH 4K9JA 4FXGB 4AQEB 2D7MA 1OF2A 1W72L 4HHGA 4ODVH 1MCHA 2IPTL 4XP5L 3UBXB 5EOTB 1ZA6A 2DM3A 4XMVA 1G7JA 2VDMH 3AXLB 1YYLL 3UG5A 5GSVB 5F6IB 4HEPG 2F9BT 3HW7A 5A2KH 1K4CA 5BXFA 4MDRA 3I75B 1R3JB 4MYWB 4HDIB 5ANMB 3SDDC 3I9AA 1DBAL 4KOBA 4TPRL 1HS6A 1GTFA 3Q8AA 3HE7D 4NKIH 4NKOB 4MCYB 4NDMA 4Y9BA 3FUJA 3R0NA 4NQVB 2CJ3A 3EO1A 5SWSD 4AC2A 1JRHH 3K4DA 2VRQA 3KPNB 3PGFL 2B20A 5DK0A 2R1XA 3W81A 3TCLB 4LXFA 4FLOA 4HOWA 3MLSH 5I0ZA 4YBHA 1WITA 1YEHH 4U1LA 5HHVH 1R3LA 2YQ3A 1GC1H 3IDNB 4GBXC 4KKCD 4NM4L 2W1NA 4YXHL 3QCVH 4MXVF 2GUYA 5F9DC 4BFBD 2Y4SA 3R06A 3S2CA 1M7XA 2CJTA 3TFKC 4ZFOA 1E28B 3JTBA 2FEEL 5C0DA 3IFLL 4PBXA 2VMJA 1BF5A 1JVOA 2I7OA 5EEVA 1UOKA 3QISA 2NNAB 4YC2C 3ZZLA 3S3DB 5TQ0H 4PP2B 4PGBB 1AR1C 3KCPA 5CBEB 4Z77A 5DD5L 3UZEC 1NBQA 4LAJH 3LRKA 3FULA 4FCAA 4LARL 1S5HA 4XH2B 3LEYH 1LE5B 2V3DA 1N6VA 3A0OA 3F2LA 4KKAD 4P57B 2HT3D 5B7FA 3EOAB 4N2BA 3EJZD 3HG1A 2D03H 2FK9A 3MXVH 5EU6E 5I28A 4F9LA 1LE9A 1TYRA 3RHWK 1Q8MA 4K3DL 3DIDA 2C9PA 4F33B 4ZFFA 2OKMA 4C4KO 4A7TA 1FSKC 4EE2A 5DUML 2LFGA 1LYQA 1D5IL 2APWA 3MGAA 3M46A 5A40E 2PWEA 2UZYB 1DVUA 3Q7JA 1CT8A 2YGQA 4UB0H 2HN7A 2RGSA 2W65B 2ZPKH 2IPTH 4FQLH 4K3JL 1XWVA 2P24A 3B4NA 4QRQB 4YFEA 5EU4A 2OJEA 4ZJ9A 3TL5A 1Z5YD 1NSNL 3MKGA 2UYLA 1YMMA 3C08H 3LIUA 1BBDH 1A6WL 3P3TA 2WQSA 2M1KA 2WBJB 1V27A 1IGYA 2H32H 3DV6A 4NNPL 4F8TA 2XIDA 3RL1A 3RWIB 2VLLB 4LSRH 1BVZA 1RD6A 1S9VB 4Y16C 2CUMA 5E8PB 3VGGA 3EHBB 4Y5YC 4ZMTA 4FFYA 3G5WA 3QQDA 3N85L 5GSRA 2ZF9A 1H15B 1JRHL 3DA0A 3C6SA 3SYPA 4H8VA 3GGWB 4JY4A 4FF9A 4GSDL 2GFBB 4E42A 1E90A 2MOGA 1JWUA 2DQIH 1LMKA 1E5AA 4PY8J 1XH1A 1GC1L 1FQ9C 2E74C 4YR6A 4NM4H 4LHUB 2XG5A 3B2XA 2VZUA 2FHBA 4NYLA 2F53B 4D94A 3P4LA 3DX8A 4MVBD 2VWEC 4X0KB 4KTEL 2IBZX 1MAJA 3LD8B 4GKLA 4JRXB 5EN2A 1VESA 3KHOA 3RGHA 5TQ0L 1JWMA 3VD2A 1BHGA 1UWEL 4AH2B 1VEOA 1W0WB 3MRPA 4LB8A 4DZBB 2V9QA 1I3GH 2ENJA 2LLGA 4FFVC 1LM8V 2Z4TA 3LEYL 2ZG1A 5MHSD 1GS6X 2QZQA 5I5MA 5HYIA 3OKNB 2EINB 1YEWA 1KLGB 3KLAA 4JMNA 3MXVL 3HC4L 4CMHC 1F3RB 4Z0XB 3FO1A 3ZRSA 5H35A 4XNDA 4HKBA 1OT4A 4GQ9H 3OJVC 4IU2A 5EG6C 1U8IB 2G3MA 2NNXA 2PYED 5EO1A 3VQLA 1KCKA 4H0LC 6FABH 3D25B 4CKVX 3P3RA 2ZPKL 3H4HA 4FQLL 3OZLA 2XI9A 5JOFA 5EZPA 5FKPA 2HLFD 2AJ3A 5F71A 1NEZG 4S1RH 1JWSB 4K55A 4XZUA 1KF9B 4D9LL 4OZFG 3D4ZA 4GRLC 3R19A 4MCYA 1BZ9B 1LP9A 4X50A 2G5BA 4OD2A 2PWHA 1WBZB 1HILB 5BW7A 4H1LG 4AEEA 1NUFA 4X0NA 3ZPDA 1E9OB 4PJXA 3CLEH 2A6KB 3PWPB 2F7RA 3C60A 4FKKA 4WTZA 2NY3C 2VDPB 3BKYL 4L4TB 5HHPB 3MROB 4J23A 3V0VA 4PJ7E 4NBXB 1WGVA 3ZE0E 3L7EB 2KQMA 4ZTEA 3R0MA 3IMBA 3KLLA 4HUMB 3SDAA 1PIFA 4JO8A 1J5CA 3MLZL 3G6AA 4YFLI 2GY5A 4Q4IA 3TNNB 1I7RA 1A6PA 4KJYB 1CF1A 4JPSA 5K9QG 3FB8A 4MZ3A 5D7EA 2X4PA 4KTEH 4V2BA 4RMSA 1FGVL 4IOFD 4DQOH 1VF5C 3PDOB 3HFMH 3HHSA 1OAJA 4FP8H 2EDKA 4JB9H 1QD0A 2VLKD 2QVTA 4IRSA 1NANI 4RA3A 4BXSV 4AQOA 4O58L 4PRPB 4X5QA 1I3GL 4C56B 2EE6A 3N55A 5IK3B 2EO9A 2F5AL 3JTTB 3PDDA 3F64A 2C1OB 4ZMAT 4FULA 4EJ1C 3VGEA 3P4OA 3ZKXC 1K8IA 3V6OA 1EA9C 3O9WA 1AQHA 3OSKA 2FGWL 4GQ9L 3EAKA 3N9GL 5IIEA 1ECYA 1CT8B 2PTUA 2IOIA 1DTUA 5LNGA 2CIIA 4GAJH 3VXUE 2ZT9C 6FABL 4FXGA 3IAPA 4AQEA 2ZYIA 3E6FA 3G04A 4AW4A 2LU5A 4HS3B 5TDNB 1DVFD 4X8GA 2WWOA 3FFCD 1MY7A 1ZLDA 3QXAA 1G7PB 4S1RL 4L29B 4FTVB 1OTTC 2WQRA 1NCDH 3D6GA 4PP1D 2DWSA 5HGGS 2CGRL 1AZCA 1QI3A 4LPYA 1ZVSB 2AMUA 2J8UE 4JX0A 1U8KB 4NDMB 4N2AA 3TA4D 1MFAL 3AS1A 2PCPB 3BKYH 4KBPA 2XXFA 3MREB 3QH3B 4LHUA 4JKPL 1D5MA 1EMTH 2FYYB 3BQVA 2G9KA 4XN8A 4HU8A 1THAA 2Y2TA 1QSFE 2IOOA 5C0ND 5A7BA 3ETTA 1CI5A 1NOAA 1CTNA 4GLRI 5IW1A 3SDYH 3A67H 1TFHA 4MGXA 1VZHA 4JB9L 1A9BB 5D2LF 4OF8A 3MXWL 3D9AH 5ESVB 2Z1KA 5HGHB 5I1JL 3PFQA 1YPZE 1GVIA 2XKNB 3R4RA 2F5AH 1QBMH 2VXSH 4UDTB 1BJ8A 1NPJA 3C2SA 1CGSL 3EOTL 2GAZA 2LU4A 1QACA 1H8SA 2GCYA 3C8DA 4H8PA 2CUIA 4F2FA 2NSMA 1HE7A 2OJ1A 3RGVD 1TLKA 1RZJC 1KEML 2HTLD 3BFWA 1VFAB 5IG7A 4WJ5A 1A9VA 3N9GH 3HNTH 5ADPH 1NMCB 3QCUL 3GBNL 3VYOA 2DI8A 4GMSL 4GUCA 4X6CF 4ERSH 3LQMA 4YX2H 1MRDH 3CCHA 1FN4A 1TVHA 5T5FH 3D69A 3KNBB 4KK5D 3R1GH 5DJ2B 2GIYA 3VG9C 2J8UA 2Y24A 4Y16B 3UJIL 3QEGH 4XXWA 2WQWA 2WVSA 3CLFH 4IM8A 4FFTA 4KJQD 4Y88A 1LP9E 4O51B 2V2XA 3K1KC 5D70H 5IMLA 4G6MH 2CGRH 5CN2A 2P43B 4LF3A 1T4KB 3JWDC 1G9NC 5D6DC 2ESVA 1L0XA 3L7EA 1N64L 1M9WA 1RLWA 1E5UI 1ET7A 1O6SB 3U83A 2R29L 2NLJB 2X9WA 3ROOB 4U7KA 3TBTB 2VR7A 3Q06A 2J4WL 1OT1A 1B0WA 3ZO0A 2YEVB 3S3PA 5CEXB 1OGAE 3PDGA 2VDRB 4Y4FC 5IHUH 2YA2A 3BQUD 4P3WA 2KHAA 2P48B 2UVEA 2CM6A 2F19H 1NBZA 4IRSC 3VVVA 5IFAL 3SDYL 3ZDXB 3A67L 2WWKT 3IF1A 5I1IL 1GMIA 1AKJD 1ES0B 4OIBA 4AC4A 1I8IA 4PJGA 1NFIA 2JI1A 1KXVA 3KPMB 4DUXA 1NBVH 3H1ZA 3MXWH 3DSFH 3CMOL 3P4OB 2MCG1 4IRZH 5I1EH 5IW6B 3RJDA 4FQ2H 2Q76A 1G4MA 4P04A 5ISZE 4CAGA 1OAYH 1PLGL 2CD0A 4Y2OA 2FB4H 3AGWA 5FGBC 1HEHC 4XN1A 3FOLA 4WI5A 5BV7C 2YJLA 3DTXA 1EZVX 4U1LB 4E2OA 1CICA 4EIBA 1NINA 4R4BB 4L8BA 2H6OA 3HNTL 4M3JA 4I3SH 3SDDA 1EFXB 3QW9A 5DC4B 4WUUB 4GMSH 1IAIM 3RTQC 3KPQB 2FO4A 4LASL 2NYKA 2ZP0T 4HS8H 3UTTA 4WW2B 4APXA 2X10A 1QFWM 4B9ZA 4ZW6A 4IJ3B 3EGDB 4U0QB 3FNKA 4RGNE 3CLFL 1U8KA 2VABA 3GMPB 2YFOA 2AXHA 4K8RC 2PCPA 3MRHA 2X6AA 3HZVB 3VG9B 3F85A 2JCWA 1N64H 4WI0A 2WTRA 1M71A 3U4EB 5C07E 1RUAL 5LO7A 4R84A 2QVMA 2R29H 4E5XA 3WFHA 3FOMB 5CZVH 2HP4A 5D1ZD 3TIDB 1KB5A 2XTSA 1HZHH 4J8RB 2HKHH 3QUXC 1EEZB 1IEBA 1TQCC 2OMVA 3N1FC 3QHFL 3KWTA 4NLHA 2IC2A 1C7TA 2BWDA 2QGEA 4GP5B 4OBRA 3UABA 5IHUL 4YL4A 2OLDA 3QUYA 3UZEA 4QRRA 4CC0A 4N5EC 4S2SA 2A2QT 3BP5A 1DSYA 4WWKA 5EU6A 5IOPA 4RRPA 2CBPA 3QYNA 4LL4A 2RALA 3MA9L 2GJ6B 2F19L 4X6BB 4AIOA 3LCYA 3PXHA 3ZTCC 3E6HB 4I9XA 2ZZUT 5HGHA 1RP8A 1HHHA 1SBBA 1TOXA 3AG4B 3T0AA 1NBVL 2DQDH 3BN9D 5I1EL 1QSFB 2WXQA 1FFOB 4KO6A 1EH9A 2NY4C 1FVCA 3IKKA 3W56A 2FB4L 5J06A 5JW5A 1SXCA 3QHZL 2JJTC 4TNGA 1FRGL 3VFSB 2ITDA 3AGVA 3A4EA 5C0AE 4PI2A 5IIEB 1W9XA 4UT6H 4ZUWA 4OLEA 5BUPA 3KL0A 3QR2A 3VCLB 3TPKA 4JO3L 3DX8B 2PLTA 1Q94B 1C5CL 1F4HA 1OTTD 3PXJA 3QDJA 3DKHA 5D4IA 5JHDB 2E9BA 3ATFA 2HG0A 4G9FA 5DUBA 1ZOXA 4ELDA 3ARDD 1BPVA 1HSAA 4DP9X 1Q0XL 5IB4B 1JWMB 4HS8L 3PHSA 3VFMB 1RJLB 3VI3A 1MHEA 2I26N 2CKBB 4L29A 2QPUA 3RI5K 1PX8A 1H6TA 3WIHH 4AQZA 5IGXH 4DSYA 4G5AA 3OQRA 2TRHA 4P23C 5AW2B 1OANA 2IV9A 1IEHA 4FEIA 2Y2WA 3ROOA 3TBTA 5BVJA 3NUKA 4O9HL 2HTKC 5D7SH 3GQFA 4EKXA 1IMHC 3BEVB 3S4SA 5ABZA 4IU2B 1UTDA 1D6EB 2ICWA 2XICA 4PYGA 2D0GA 1TTCA 2HVJA 3O11B 1P4BH 1GR7A 2CBMA 4LEEA 5SX4I 4HK0B 1HHKA 1IBGH 4WFED 2V7HA 1A21A 2JCCE 1U8CA 3BRGC 3BP7B 3O4LB 4OCSL 1Q0YL 1Q4NX 2IH3B 5SX4H 3D8MA 4XBPB 5BZDB 2HFEA 1OY3B 1A7RH 1LQSR 4Y1AD 3ZTEA 35C8L 3KPMA 4JR9L 2YPVA 3U30C 4JDTL 3QIBA 2D7NA 2CALA 1PVHA 3NQIA 4XHJD 2HUHA 3H2PA 4L3ED 5KBLA 2XV6B 4UV7H 4Y2NA 4G8GD 4L4TA 1SDAB 4P4RA 4N0YL 3UO1H 4UQ3A 4QNPE 2ZYSA 3BSGA 4LEOB 3UH8A 3FQNA 5CGYC 5JXED 4A2GA 3HUJF 4OLUH 3FTVA 1MCKA 2NQDA 1T83A 2BOLA 2F5BH 3NFPB 4UT6L 3D3VA 4N8VA 2XV3A 3SCMA 1AZRA 2FQDA 2VZSA 5F7YC 3I6GB 4PJ8D 1BXAA 1KPRA 4G59C 4NPKA 4XBGA 2GEQA 3GKZA 3JV0A 4UOQA 4OGYH 3C8KB 5AZEH 1F3JA 2IAMA 3GSUA 4E41D 2H7WA 1KJ3L 3EFOB 4V1DB 3MRHB 2YPLB 5IGXL 5J6HA 3EYSH 5IMLB 1INEH 5F9WC 4G72B 4HFUL 2BIOA 4DN4L 4Z3GA 3GBDA 4FQIL 4BQ9A 2IJ0C 1XR8A 5FB8A 1PFCA 4P5TC 1NIBA 4PTUA 3ZL2A 1IAOB 1V55B 4O5LH 3GB7B 3L16A 4ZFGL 4GAYA 4H8WL 1NGYA 2O6EA 2YBRA 2YBGA 1SJMA 2AJYL 3T0XA 3TO4D 3HG1E 3RL2A 2C4FT 1IM9A 3NP4A 2AXFB 3WO4C 3BP5B 4WWKB 2FWSA 3OGCB 3QG7H 3BHBA 3IEAA 2HKFL 5MENA 4PIRF 4X6BA 4LOVA 5FYJL 1A66A 5I17B 5I0XA 1E7VA 1A7RL 3RTQA 4LGSB 2XQBL 3ZHDA 1XXDC 35C8H 3ZTNH 1CL7H 1XAUA 2E7DA 4FYQA 2NTFB 2XFXB 4HKXA 1MFDL 5JIKA 3QEHB 5E2UH 1DDHA 4XMLL 5ALCL 2IXQB 2YEZA 4JANB 4CSSA 4GXUM 3NFNB 2VLJD 1JHTB 2JWYA 4N9GB 4UV7L 3KVQA 1U0QA 2GPZA 1C7SA 1LO5A 4KRPD 4N90D 5DYFA 2VDML 1YYLH 3CQQA 1RZJH 3FOLB 1IIKA 4N0YH 3U6RA 3UO1L 4OFYA 1N59A 3B3IA 2D3JA 4JFFD 2PPAA 4OLUL 3F6LA 3T1FB 1PSKH 4R97C 2Q6WB 3ETSA 2DIJA 2F5BL 2NSQA 5DDHB 5C9JB 5GS1A 1CG9B 1AD0A 3D2UA 3MFFA 4FNQA 1V3KA 4WWNA 1D5XB 3T3MF 5BRZD 4ZW7A 1YVLA 3O41B 3PGFH 5K39B 2R4SL 2P80A 1FP5A 4UAOB 1KG0A 1W80A 1NA8A 4OGYL 3KXFB 1YEHL 3QUZA 1AFVH 5DR5L 5HHVL 3ARBA 4Z7AA 1CD0A 3S36L 1M6OB 4YXHH 1RIUL 4XTRC 4DGUA 5HVHC 4BIKA 2G2PA 1INEL 3CNKA 2WKOA 3D7PA 4QLWA 4FQIH 4PCYA 3FT0A 4W9IC 3ULVL 5DZNA 3RGVB 5GGQH 5C7ZA 4XNXL 3D52A 1ZXKA 2HVJB 5AVTB 1SOXA 1SEBB 1O5PA 1MFCL 4X4XB 4H8WH 4OKVA 2O61A 4TSAL 1U8CB 4WO4B 1G1YA 4J8RA 5DD5H 4GXUN 5FLVA 5D1QD 4LPXA 4LARH 5DU7A 2CA4A 1KIPB 2XWXA 1YEIH 4POZC 4F7TA 4PJ6A 4ICXA 5F21B 1DYZA 2HKFH 5D7JB 3B2UC 2XACC 5FYJH 1VIWA 2PCYA 2B59A 3HKZA 3JWNC 4JE4B 4LHUD 4S1SL 4M56A 3QJOA 3S37H 3NJHA 3ZTNL 5EOQL 5FCUH 4XO3A 2JFCA 2V2XB 2FT7A 4R96A 5DUMH 5KSBE 1G1KA 1BWMA 1BD2D 5E2UL 5MERA 1JGUH 4RMVA 1S6NA 1MHCA 4OLXH 1FNEB 1N18A 2O26U 3GSQB 4NS0A 3V0EA 4Z7VB 4NP4L 3A5VA 4P46B 4DK5A 5E03A 3CN1A 1RZJL 3BWUF 5E4OA 1A6WH 5LGYA 1OAXL 3UTSA 4OZHE 4NNPH 4RFEB 3DO7B 1PSKL 3E7JA 1OGAB 4OGQC 4MA7L 4LSRL 3PAVA 5EZOL 2ADIA 4G70B 2ENYA 4BUHA 1XB6A 1DVTA 3BZ5A 3RA7L 4QOKE 2R4SH 2YPLA 1QQDB 2QSQA 3FT3A 3QI9A 5E94A 1HHIA 3RIFK 3VM5A 2DQIL 1AFVL 2EXWC 4K5OA 4NQCB 3KH3A 2V9UA 4GSRA 3S36H 4BUQA 2VQ1A 4TNVK 4U6HB 1DR9A 4PV9A 4ZMXA 3AXLA 4PRAB 3ZE1F 5I5JA 4XNXH 3JT0A 4PJ8B 4KVCL 2H9GB 4Z7OE 3DECA 3TBSB 3L4WA 2D7TL 4R5VA 2CJUL 1UWEH 4V1DE 2WLLA 2OSXA 4TSAH 1NGXB 3O11A 2AEIT 4HJTA 5JOPD 3WJMB 2ZX7A 1KJMA 2LT9A 1YEIL 1AC0A 3MX0B 2VMEA 2W9DH 2MNWA 3KPNA 2BOBA 4M6AA 4PBWD 3DX9A 5J3HC 2HFEB 4C83A 5BZWB 3T0VA 5ETUB 4YHYC 4WAFA 3EGDA 3BUDA 4JJ5B 4XVTH 3S37L 4PJ7F 3B3BA 1KUMA 5EOQH 3C2AL 4M03A 2X89D 4X9YA 4UDUB 1JTTA 2K6ZA 4KKCC 1OAZL 2DQTH 3LQZA 4P06A 5GGTA 3EO0A 1UOVA 3RFZC 4OLXL 3MZGB 4F80A 3D4YA 3CQFA 1WK0A 4D8PA 3DX1A 1IFRA 4HC1A 4HIHA 5T1KA 1RJZB 5ID1B 2WNWA 3ZIMA 5F3BB 3PIQB 2L7JA 3H3KA 3NDYE 1DQKA 1OAXH 4JO5A 5IB1A 5CLYA 4L2YA 1OP3H 4BCYA 4MNGE 1I4FB 2G60L 3O41A 2UXTA 4FFVD 1WWWX 1B0GA 3CLEL 3DROA 5J89A 3QXTA 1WFNA 1YLBB 1LE9B 3ZKSD 1JL8A 4NX0A 1C1EL 4CADB 2JTDA 3KL3A 5GZND 4XBEL 4MDJA 4HXAL 4HAKA 1DUZA 4RX4A 3K6FA 3T6VA 3I9PA 2FUTA 3VXMD 1FO0A 2DQHH 3FU5A 2WBKA 1A9EA 1U9KA 3DARA 4ZUVB 4X6FB 3KJ4B 1NANH 3F7QA 5LAXB 5TDOB 4ZXBD 3H55A 1WUNT 4WO4A 4CVUA 1Z5LB 1AS7A 2D7TH 2EIMB 3RL1B 1A02N 1QR1A 4C54A 4J3OD 4NFCA 4O58H 3CVBA 5C09A 1BF8A 1JV2A 1CXIA 3G7TA 4KROB 1IZKA 3B7UX 1SVCP 2O1AA 1P1VA 3BZFB 2YN3A 3VFUB 4CSTA 2W9DL 4R3SB 5KS9A 5KEZA 3QFJE 1ZVNA 4RMWA 4I3GA 4Z7NF 3T71A 2F15A 2OMZA 3SBWA 1ZWIB 3QZMA 4CMHB 2BFVH 3IXAA 4XVTL 2FGWH 3ARWA 1L5GB 1R1CA 2XFXA 3BJLA 3NZHL 4L1BA 3UBGA 3O2DL 3SY0A 4U2YA 4J1UA 5DK2B 2G4GA 2IXQA 1F56A 2YEZB 1BSIA 1JCVA 1TT6A 5J9PA 1NWOA 2VLRE 1F90L 4D0BB 5JMOC 2DOCA 3PNWA 3NA4A 3P9LB 4NZJA 3VI3E 1UXSA 2XWJB 2ZXWB 4AKQA 1ANUA 4NN7C 1IM3D 1ZS2A 5C0BB 5FF6A 4GRLB 3L4VA 4HJSA 2IH9A 4PRNB 4UM9A 3LSOB 2DI9A 3L2MA 1ILSA 1KC5H 1C1EH 4LSSL 1SXBA 4M93C 1GSMA 4NO3A 4ZSOE 1KPVA 4HXAH 4PJXF 5EUOE 5TH2A 3W0WD 3QARA 3NZUA 5J1SC 1DZ0A 3AROA 3DX7A 3WN5C 4E5XG 1LL1A 1D6VH 1NPNA 5CD5C 2BERA 1IKNA 1T3FB 4N1HB 5DQ9A 3S2AA 3IS0X 2XRAH 4PLOB 4QHNB 1NCJA 5LBVA 2I5YL 5F89B 1UD5A 3A21A 4ZTOH 1LK2B 1SN5A 4IBYA 5DVKA 3VXSA 3ZGHA 5KJ7E 2YD4A 4B5ZA 4M7JH 3MRNB 2H32A 2VRAA 3D9AL 2CDFB 4FQXD 3DX9B 4WWID 5EPMA 4FRWA 2FEDC 3RVUD 3VE0B 1W0VB 4YBQC 1GTNA 1AGEB 3MV7A 4HGMA 2Y6SD 1KPRB 2VXSL 4XBGB 5IW3A 1JXFA 3AZUA 3MRKA 2NY3D 2WAHA 4D8OA 1CGSH 3BFOA 3CFKA 3CHRA 3CVIH 3EOTH 3RDTC 4BZ2H 2VZTA 1F3JB 3GSUB 3LNGA 4BFFA 1KB3A 2BFVL 3E3QE 4DHLA 1BAFL 1WBYA 2KZBA 1TEYA 2OYMA 3I74A 4HWUA 5DXWA 4X7SL 5ADPL 2FJFB 4P46C 4ZOBA 3SGDI 4MCNA 3AABA 3QCUH 3AT8A 4W9GC 3BZDA 5DMGC 4LPTA 4EQ3A 4ERSL 3GIZH 2OULB 4C58B 5KWYC 4NC2B 2R9HD 1F90H 1O9VA 3R1GL 3IYLW 1R17A 2WXIA 3F58L 4PV8B 5H2BA 3C5ZC 4C57C 1TCMA 3SJVE 2EEAA 1IFGA 3QR1A 4YSTA 4EN2A 3VXTA 2YMXL 3FQ1A 5LGJA 1XGRA 4CRPA 1MCQA 4HMEA 5J8OA 1K8IB 3K5RA 4BZ1A 3B5TA 1AP2B 4LSSH 2O5ZL 1FO0B 1LGVA 5C0CB 4FTVE 4O2EB 1GYUA 1AGFB 1BG9A 3MUGB 4HX1A 3UTZA 1L3NA 5DZOA 1GZHA 1RJYB 3V79C 3NK3A 3WI9A 3IN2A 3WKYA 2Y22A 4ZFOL 3BE1H 1OK0A 3GF8A 3NCYP 1ZIBA 4MBOA 4PRAA 1NGZB 1I8LA 3EYVA 3FN9A 3HE6D 2XRAL 1N12A 1NJ9A 5F7MC 5IFAH 1J8HB 1AC6A 3TBSA 2B9BA 3K81A 1BZQK 1GIGL 3WMPA 1U91A 4QGTA 3M07A 3B5GA 4M7JL 2RD0A 3APCA 2NY1B 3DSFL 3LOWA 1ZLVH 4IRZL 5EIIA 2FQEA 4UTBA 4FQ2L 1R9FA 2CR3A 4M8QA 2X42A 4Z7QB 1PLGH 1L5GA 4FADA 2ILLA 4RAVA 4LVOC 3WY4A 4FXTA 3ZZSA 4BZ2L 1RZKL 1GYCA 2ENPA 2DV6A 2G0LA 5H37G 2HFGL 2YK1H 3OMIB 2EVJA 1T1WA 4IHOB 2BIHA 4ZNCD 3ZGIA 4I3SL 2LR4A 5D7HA 1R5IA 2F53E 3UC2A 2ZKWA 3RDTB 1JXKA 4KHXL 5IVZA 1WC7B 4LASH 4X7DC 4JRYE 4Y9GA 2EIZA 2PPFA 3BVTA 3PL6B 3GD1C 2XX0A 4QXTA 4X6CA 3LZPA 2IPKA 1RJZA 1SHXA 5ID1A 1NCOA 1UEMA 2AK4E 3LSOA 1U92B 3TNMA 4G6AD 2UY7B 2MHAA 5IQLA 3ZDZB 5GS1C 4EUPH 4BK4A 3GRWA 1HL4A 3ESOA 4JZNA 3HB3B 2MCPL 2GHWB 3TO4C 2VLRB 5DGQA 4G8FB 2QBWA 2VE6B 1J0YA 4KK9C 1MWAL 1A8JH 5CZVL 1DUZB 1HZHL 2HKHL 4NUPA 1IGJB 4MWFA 1QA9A 2ZG2A 4XNQA 1CE6A 4WKZB 3QHFH 4HWNA 5AVUB 5F1NA 4FQQB 4B9PA 4GJTB 4F7EA 3D39B 1QEWB 4WTWA 4XO9A 2EEFA 1VJSA 2EYRB 1JPGB 1MWOA 3KPPB 1UZGA 2JB5H 3MA9H 5I5RA 4J5VA 2DMGA 3B9AA 4TLKA 3GIVA 5EUOB 4OZHB 1GIGH 1SMAA 4J3BA 2CM5A 2EP6A 5LVEA 1JV2B 2EXWD 5GIRA 5E6SB 3HR5A 2E27H 4Z95H 4LRIC 5HPOA 3CVDA 2AEPH 3L5IA 3UEZA 4DW2L 2UV3A 5F3FA 1U33A 1UKTA 3D0AA 3QHZH 5IKCB 4LOUD 4FNPA 3BVWA 3LXCA 1RZKH 2FJFA 3O4LD 1FRGH 3QDGA 5EWIH 5KVGH 4WFGE 2HFGH 1UM6L 2YK1L 3FH5A 3MN8A 3U46A 5I5IA 1RUPL 3T0ED 4R4FL 5J1AB 4MQXD 3S36X 2MPAL 1DJSA 3EJRA 1TJHH 1ZLEA 2WVVA 1ZCRA 5GGSY 3GFUA 3NRQA 1WTLA 2PTTA 4HG4J 3JWNG 4P2QE 5IB3A 1N0XH 1S9XA 1Q0XH 5H8DA 4EIGB 4LGRB 5L8LB 5JLZA 1MCJA 4PMEA 5AYQA 3N44B 4HJ0D 5TJWK 1QNIA 2Z8WC 3PS6A 2NNFA 4MAYC 2AVFA 1M42A 2QL1A 3EDKA 3X3GL 1YUHB 4A66A 3UGXA 5KN5A 4O9HH 2R59A 3EFFB 3MPCA 5D7SL 3DGGA 4Z3JA 1B3JA 1FZOA 3HVNA 4NO3B 1IBBA 3LIZL 4KO5A 1MWAH 3R8QA 2Q7YA 3KH4A 2K8QA 1P4BL 2X4TB 1EFXA 4JZJC 1LK3H 1IBGL 1P5UC 3B2PA 3ZDYE 3S0PA 3RWIA 2V2TA 3RZCC 3KPQA 1Q0YH 3W39B 3ML8A 3OG4B 1SXNA 2V5SA 2XG4A 3SBRA 3ARZA 3SPVB 4CW1B 4D8PB 3ZDWA 3MA7B 2XCMC 2GBUA 3HMWH 4JR9H 3MLVH 1URZA 2AQTA 4M29A 5EIIB 4JDTH 2VABB 2YOCA 1A4AA 4WW2F 1CD8A 4FNLH 3QIUA 1KLUB 2X7LA 5C1MB 2CDFA 4H2CA 1A64A 5FHBL 5D1QC 3GHEH 2DL9A 2NDFA 2E27L 3MV7B 1D7FA 1ZT1A 1TKWA 4MLSA 4Z95L 4ETYA 3MMEA 3M17B 2XN0A 1XR9A 2AEPL 2NY4B 1W91A 1PZ5B 4NUQA 4PR5A 5D1XD 5HDBE 5L4MA 4DW2H 4X0KA 3H7BB 3WTVA 5TGBA 4MRBA 3VXMB 3B9KD 5KVGL 4P5MA 1UM6H 2W38A 3I9GL 1D9KB 2A6IB 3VRIB 4R4FH 1WC7A 2MPAH 1L9PA 1I31A 2K4AA 4YL9A 3D1MC 1HKFA 1TJHL 5C70A 3VXNA 5LAXA 4ATTA 3O8XD 3H4FA 3W3BA 2K45A 5DJDB 3CJJA 2ZCKH 5CINH 2Q10A 4D0CB 1CXLA 1HN1A 5IP4A 4YDVA 4YO0B 2W5PA 3CVHA 1O7SA 1SOKA 1UT9A 4P0DA 1K3ZA 2R69L 3K8KA 5HHQB 4NN6C 4KRPB 2W0LA 3EYSL 3EH4B 1UM4H 3A4FA 3QFGA 4G8FA 4HFUH 1FFTB 3RWJB 3FUHA 1P7KB 4K5NA 3QQNA 4DN4H 3X3GH 1YMHA 2NQCA 2VISA 2EKJA 4Z5RB 5HP5A 3DHJA 2TRYA 4OI7A 1ADQL 2PO6C 2BSTA 1JZ3A 1FCCA 3DJ9A 1DJGA 1PZ2A 2RCSH 4ZFGH 1EBPA 2BNUB 3LIZH 4U1JA 5I1LA 1MCDA 2LE9A 1RPQA 1NDTA 3GSXA 4F15C 1LK3L 4B97A 1FL5B 3QG7L 2GY7B 2ZE0A 5AB2A 2HJFA 4RSYA 3KXFD 4Z7NE 4HETA 1E9QA 2EDFA 2QHRH 1GW0A 4KX9A 3VI3B 2XWTB 4XCYA 3HMWL 4YNYB 4IBZA 2W0FA 3PQYB 4FZEL 3AADB 5I9QB 1MFDH 4PWFA 1F1AA 2NPLX 2VERN 1ZA3A 3D0LA 4NQQA 4FNLL 1Z5HA 3C5JA 3ES6B 5ALCH 5FHBH 5EBLA 5E4IA 5SWSE 3N50A 2H2SC 3AT0A 1EJ6A 3EOYG 1A2YB 3IETA 3GJEA 5FO7A 1DLHA 1XO8A 4DAGL 1ZLSH 2E5EA 3AU0A 3BUPA 4KNSA 4ABWA 2W92A 1RZ7H 3MR9B 3I9GH 2V7HB 3PWJB 4KKLC 5BXFB 3IDXL 1R5IB 1NBYA 3OJ2C 5DZJA 5KBNC 4JHAH 4E41A 2B4CC 2E9WA 1ZLUH 3TJEL 3ZMEA 3UPRB 2E8YA 2EADA 4CN1A 1D9KC 1K2DA 4LLUA 4PJEF 2F8IA 5DR5H 4DP1X 3DX3A 5F1IB 4NCC2 1UFUA 2R69H 2V4LA 4HV8A 3ZX1A 3HC2A 5IVNA 4XHJC 3BUTA 3ECUA 1HJCA 5AOKA 1RIUH 3B2VL 2VR3A 5KN5B 3SEPA 1UM4L 4EN3A 5IB2B 1CFSB 3HLKA 2JB6B 3IBEA 3TH2T 4WFHE 3D08A 3ULVH 5SX5K 3EG9A 5GGQL 2WMPA 4RNRB 4G7RB 1MFCH 3FTYA 3EYQD 3WNJA 1JZ6A 1G7PA 2G5RA 4F7PB 5C07D 3WTTA 3SCMB 3STBA 4Y19A 3U4BL 1U3ZA 4FMFA 2VDKH 2Z0BA 4DT2A 4S1SH 2QHRL 1TITA 3Q6FA 2IAMB 2IQAA 3O3EA 3E9TA 1CJYA 1ZS8A 3QDMB 3GIVB 5EUOA 5FCUL 4WKXA 4FZEH 4GBXD 4WNQB 1JGUL 4PJIE 4QXGH 5DJ6A 3LQAL 4FA7B 1CBJA 3FK3A 4J4PA 1RQ5A 2NY6B 4NP4H 4YXKH 1CD1A 1H3UA 3BGFC 4P2YA 1BFTA 1JMZA 3BPCB 5ACMA 2G4EA 3AS0A 5C0CE 2Z7WA 3SO5A 4W9CC 1HXMB 3LKOA 3KEHA 2JLPA 1GSKA 3H42L 1EAQA 1BFVL 1A9BA 1QWHA 4MA7H 4K4KA 4BGDA 3WO4B 2APVA 5BMFL 5EZOH 3NMEA 4JHAL 1CD9B 4OZFB 1J8HD 4L3FA 2NYYC 4KFZC 4MAYD 3TJEH 3ZBMA 1F4AA 2OZNA 1IE4A 3RA7H 5IB3B 3SE9L 3FTXA 3QQDB 4G9FD 1HQRB 5T8IA 1TO5A 2BCMA 5DJZA 4JBSA 2YPVH 2CLRA 2WO2B 1UWXH 1O9ZA 4QRPE 4PGEA 3Q2NA 4K73A 3NZ8B 2BW5A 3ZKNC 1N6QL 2FJSA 2VAAB 5J13B 2W81C 1IC0A 3SYOA 1U8MA 1FFPB 3LRGA 2HFFA 3C6LD 4U1NB 2FWOA 2Q20A 3GLAA 2PKDA 5C09E 4LLAA 3SZKC 1TJIH 1MCWM 3LD8C 4KRNA 4KVCH 1FYTA 1YN6B 2RMNA 2WKOF 2HT4D 1E2ZA 4YIQA 3KNBA 4FLQA 4YHKL 1BOYA 3GC3A 2CJUH 3OB8A 5I66A 1MIEL 4IRJB 5LXVA 4RZKA 2G2NA 3HS8A 4NQSA 1E50A 1AD0B 4J39A 2K9UA 2NNCA 2AQRA 2ZUQC 3U4BH 4IW4C 1JZEA 4XCYB 3FT4A 2OYLA 3SDXF 1BGXH 1FVDB 3SODB 4CW1A 2XTJC 1A4KA 1NMBH 2VDKB 2H45A 2IPKB 4FNSA 1FBIH 5F8RC 2H26A 4AL8L 3JV6A 3C2AH 3AXIA 5HD8C 1AGCA 5HBBA 3OXRB 1OAZH 4FGMA 2DQTL 4FL4B 4XR8C 3VGAC 3NRPA 1CURA 5I1CH 3LQAH 4UQEA 1U8IA 4ZTPL 1ZT1B 4GQPH 3HG5A 3HAEA 3HN5A 5ICYA 2PXYD 3ABZA 4KROD 2I27N 1HWHB 4LHQB 2VNCA 3B7TA 3MNWA 5DD6B 5IJCC 3H7BA 3L45A 4XZ4A 3UXFA 1T04A 4HFWB 3PQYE 2AC0A 3WEXA 1J86A 32C2B 1IBZA 3EF7A 4JHVA 2D7QA 2CNZA 5B3NA 1XIWC 1B9KA 1AH1A 1OEZW 4F7TB 4AQAA 2EDDA 2G60H 2BC4B 5BMFH 4DJMA 3GXDA 4AITA 3CDYA 4U05A 3V8CA 3KPPA 4OZHF 3QNYA 5C08A 4W4OA 3U7WH 1B3IA 2AABL 1DQQA 1U3NA 3D3VD 3EH2A 1DO5A 3MJ8A 4XBEH 1RUMH 4PJGE 2DQUL 3O9WD 5AW7B 1E9OA 4PJXB 3SE9H 1EJFA 2VLKE 3CVHB 2CJSA 4M9PA 1F4XH 4W1TA 1ZGLP 5HHMD 1YYCA 2YPVL 4GNKB 2DQHL 3QJFB 1N6QH 1EO8L 3E80A 3SO3C 2L7EA 5DYOA 1YMHB 3H2WA 5DZ9A 3QA3A 1Q38A 2BVQB 2DEYX 2MH4A 4CN4A 1TJIL 1ZPUA 5CD3A 3OJMB 2BVTA 1MIEH 1M6UA 4GS7B 3WTXA 1V3MA 4CILA 2F68X 5FYLE 3HS0A 4BUGA 2NDGA 4NPYB 4M7LL 3DC0A 4ODSH 1BGXL 3EJYC 3O3DA 4PVNA 4TNFA 3GK8H 5AZUA 2X4UB 1IGTB 4JFDE 3TXAA 4KDWA 1A6AA 3QQXA 4YDMA 4AL8H 1AD9B 2YRZA 3RWDA 2YPLE 3NZHH 5B8CC 2XETA 2E7HA 3O2DH 1SDDB 4HIIB 2N0KA 4P2RA 1EXHA 1XH3B 1JCKA 4U3HA 2BNRE 2L7UA 5DHVH 1BVNT 2Y3NA 5CEZE 5D2NC 1IRAY 3UP6A 1E6OH 5IM7A 3LKOB 2CSPA 4MJ4A 4O2FB 2YZ8A 5E5RB 3W9DA 4RMTA 1HCYA 4UOW0 3MRDA 5KVEH 3MZTA 3WLBB 3KDMA 2XG4B 3SPVA 3UTTE 3HG3A 3U9UB 2CGYA 3U7WL 3IJYB 3LB6C 5F70A 1KC5L 2LVCA 2NUTA 4PGEB 1XIWB 2VMFA 3KWVA 2DQUH 3CV5A 3GMOB 1KGJA 1YNKH 1IGIH 2E56A 3HS0C 4V33A 1F4XL 3CC1A 3L5JA 1BQRA 3PAYA 4I0PA 3IMVA 3F01A 3DJSA 1D6VL 4JRFA 2EH7H 4DVBA 3ASWA 5I0WA 2YGVA 3GJFB 4OJAA 1AXSB 1PG7W 4EQ2A 3SGDH 2I5YH 4B3VA 1DJXA 4Z3IA 4ZTOL 4HH8A 5C3LD 3WHE0 1E0OB 2ENQA 4I3RL 4WJG3 4N86A 4X6DB 4NO0A 1BM7A 1RAMA 3ALXA 3PF2A 1S7QB 4M7LH 5M7QA 3CVIL 4P2OC 4U6TA 3OXRA 1P1ZB 4LT7A 1QBLH 3ARGD 5JHBA 1BAFH 3BUQA 5EEUA 2J1YA 5FK9A 1IAIH 4X7SH 1OF2B 2GCYB 1PQZA 2VN3A 4XO4A 2Z93A 5HHOA 3GIZL 2D3NA 2CA3A 1AQ8A 1BD2E 1E6OL 6CGTA 3DLQR 3F58H 3FQUA 1J18A 4RFNC 3ZLQC 4CC4C 4NQTA 4FEMA 3OGOE 2Q2LA 3G5VA 1ZTXL 4MSWA 4CBZA 1LWHA 1OHQA 2EIDA 2Z0UA 1JI1A 1E3FA 4MAUH 1KXTA 3KPRD 2YMXH 4RH4A 3V6ZA 5CEZH 5KVEL 3RGVC 4N2CA 1CFQB 3GXFA 5K9JH 4FD0A 3A22A 3W0WA 3P0YH 4V2CB 4S11A 5EN3A 5JPMC 4HKJB 3ILEA 1ETZB 2W9EH 3IXAB 2CCVA 2DWDA 2XN9D 2O5ZH 5DHEA 3BDBA 4YDLB 1XEDA 1CICD 3SOBH 3PABA 1IGIL 3UL4A 2R39A 3C5JB 4WHCA 1CDUA 4WNSA 4MQ7B 1YEDA 3LEXA 4MMYB 2R2BB 3DRQA 3Q5YA 4F9LC 3FU7A 1E5BA 2VAAA 1JK9B 2PPCA 3CSYB 3QAZB 3SPCA 3ZOAA 3BE1L 4N28A 3SSGA 3TN0C 4DKDC 4WV1B 4ZSOB 5B7MA 4AQ1A 3QWOB 2OTWB 1QOKA 3RIAF 1FA4A 3WFDH 1IBYA 3WIFA 1QLRA 5I24A 1IC1A 3B83A 3PHOA 2A77L 3TVMB 1JVLA 2VZOA 3BLBA 3AWFA 4I3RH 4K5LA 4E9RA 3IGAB 2J43A 3DMMB 3QQ9D 2Q3AA 2XQ0A 4MB1A 2L3BA 4PJHF 5DRXB 4HF5H 4XXDB 4MXQD 2WSKA 4PM1A 3S3BB 3VSUA 2WQXA 3UYPA 5IOKA 1E43A 4F33A 4ZFFB 2J5WA 4PS4L 1XCTB 2X4RA 1K2DB 1SDDA 2VN7A 4R7LA 3VFOA 4J3VA 5JQHC 1K6QL 4MJ6B 2WLYA 1IAIL 2YXMA 1QR4A 3QXDB 2H3NB 3K6SB 1G0YR 5TK2A 3IJHA 1Y18A 1YC8A 4KHXH 3QORC 4HEME 3HI5H 4B9FA 3RLSA 3GLDA 1NGWA 1K4CB 2DJMA 1ZVYA 3T4AA 1NPUA 1PY0A 4MAUL 3U9UA 1D5ZB 1AGEA 3O6FD 1MN4A 4GO6B 4LDOB 3CDCA 2KYIA 1DDHB 4LCYA 3LEVH 5K9JL 1OXYA 2MCPH 1D7CA 3GMLA 2PW1B 4O2CA 2IQAB 3O3EB 5JW4R 4N68A 3STZB 3QJZA 2JJWA 3SOBL 1RUKL 1I1FB 1OGSA 1M9SA 2WINB 4LLVA 1Q9OA 1X9UA 3WKML 4TYUA 3S97C 3T1FA 3CC5B 1ZDSA 3WKPA 3L3JB 2FR4B 3KPSA 5HJGA 2JB5L 5C0DB 2J3SA 5E00B 1VGKA 3DV4A 3QNZB 2DZEA 3WFDL 4BQBA 1PLAA 3FL7A 3QUKB 5I0DA 2LQRA 2A77H 5CCHE 1SMDA 3GSNA 4EN3D 4JFSA 3WAKA 1UT2A 3NCCB 3FT9A 4ZBJA 4OUOA 4F91B 1HI6B 4HF5L 3TP4A 3T4AC 5FGCE 4TNWF 5EF0A 3QJRB 1KCSL 1MCIA 3FO0L 4U1HB 5EWIL 2P80D 2GITB 1S7TA 4WVRA 1RUPH 3B56A 3K5SA 4LSTH 5HPMB 4JHWL 3AQYA 4R5TA 3PWVA 3QDJE 4LCUA 1P2CB 3HZ3A 3CH1A 2PR4H 3NCBB 3SPGA 5IM7B 4PJCE 1FYTB 1N0XL 1YN6A 2KL6A 3ARVA 4P5SA 3HI5L 3P77A 4J3OF 3IRCA 5CEYB 1TCRB 4FQ1L 4EXPX 1OL0A 1UD6A 2Y23A 2O6PA 2ITCB 4JN2B 1Y6MR 1KCLA 4PH8A 2NY1C 4HMDA 4ODXB 5EV7A 4DP8X 5HJ3A 1RP9A 2EDWA 2ZOLB 3LEVL 1CDGA 1GKOA 5T1KD 1I1AA 4R7DB 1OM3L 2VYRE 5IF0A 4LCWE 5D7LE 4Z7WA 2MMXA 3NIDF 4MJHA 2BXZA 1AVAA 4B6ZA 1RUKH 2VRKA 4QRTA 5E56A 3TN0A 4WO0A 4AENA 3FZUC 4S1DC 2JIXD 3OXSB 2OTWA 2WWNA 4MNHB 2XNAA 3MRQA 2W0KA 3MOBL 4KV5E 4AIXA 2ATKB 1M4KA 1BX2A 2R27A 2W07A 1KGCD 3EGSB 5GZOA 2H0PA 2BXYA 3MLVL 1IBDA 4LCWA 2WZ5A 1XB3A 2GKIA 3CIQA 3HBPA 4MLIA 1INDH 2BC4A 5DGRA 4ELME 1SQ2N 3GHEL 4G83A 2DS4A 2HRPH 3VD9A 3JT2A 3GMQB 4N8VG 1BZEA 3GMMA 1N8ZB 4B0MB 4UUJA 1K5NA 4GXFA 1KLGA 4IS6A 2COQA 3M6DA 1KCSH 1QVOB 2XN1A 4E41E 3V4VB 2R1YB 5F7UA 4NIYE 5EZIH 1MUJA 2HH0H 3QQ3B 5EBMB 3L08A 4PJAA 2ZCKL 5CINL 2PR4L 3EOBB 3FCGA 4HD9A 4PRHA 1FAIL 1MJUH 2X88A 5BZWA 3ZHLA 2UX7A 4FQ1H 3TYFA 3L4TA 1NKGA 3OZ9H 2ZAGA 2G5BB 4OD2B 2QKIB 1MCPL 1RZFH 3O4OC 4LKXA 1YNTA 2B1AH 2Z8SA 4JW3A 4KX7A 4XOCA 4AVJA 4ENEC 1C08B 3QIWA 2A4ZA 2CKNA 1ADQH 4HUXB 2HVKA 4Z7UB 2LGNA 4BEIA 1YNTF 3D0VB 4BKSC 4YSQA 5DFVC 2RCSL 3AG2B 1DVFB 2P47B 4PJIF 3CC5A 2A1WH 2A9CA 5ESQA 3TNNA 2BDNH 4RBPK 1VGKB 1W16A 4QMEA 4XB7A 3RVTD 2A9AA 2BSBA 3QJVB 1UGNA 4QRBA 3MOBH 5EBWB 5L2JB 4FLRA 5JLZB 5IT2L 4JE0A 5KBMA 1OIOA 3V6BR 4HUWB 5F6IC 3P4NB 1LO0L 4YWGH 2AHIA 4L4VB 4AYDC 3Q8CA 4YGAB 2FJHB 2YSTA 1MCFA 2CWRA 4DESA 5I74C 4U1HA 4P5TD 3VMNA 4GKNA 2A4EA 4DAGH 4NWTH 1ZLSL 4LMQI 2WV3A 5AG8A 1AIZA 1H3PH 5D96B 3VRJB 1RZ7L 3U36A 5E9AA 5JIHA 5CGYD 5JXEC 3WD5H 4J3UA 5C0AA 4PYHA 1ZEAL 3U4KA 3IDXH 1P9MC 2X0WA 3GWJA 2ATPA 4GBXB 4HZLA 2H1LM 3S34L 3LYRA 4PJ8C 3BH9B 3MRBB 1EDHA 5DO2C 1J7VR 3MFFB 3RX7A 2X4QB 1DSFL 4XCEA 3T2OA 1IQWL 1T1YA 4DKAA 1KLUA 1NFDE 1M1XA 2X4NA 2E7LC 4ELMA 3POHA 3B2VH 5IF0B 1MCPH 1RZFL 1PZAA 4R6UA 3K8MA 2Y6TE 3OQ3B 3T04D 3ARBB 3RYMA 2B1AL 1LVEA 4NRYB 1U8PB 5GRUL 3ZU8A 3FU8A 3BD5A 2OL3H 1A6ZA 1PF3A 3E1ZA 3QEUB 1D7DA 2YN5A 2HRLA 5CP3H 4YDIH 3DOSA 1OF0A 3MRCA 5FPIA 5F7DA 5ILTL 1QSEE 1S78D 4KH9A 4MNHA 3V4PB 4UMGA 4XGZB 2BIMA 4ODWA 5B8CB 5G5DA 1B6DA 1B6UA 3AT9A 4GFXA 1JPFB 2DJUA 2W07B 2X28A 3EGSA 2VDKL 3OR7A 1RCYA 1BZ8A 1I3RA 5CD5D 1DZBA 2HT2D 1F8TL 1A22B 2OMTA 1Z6JT 4HWBH 5IMOA 4BFKA 3OV6A 3GRBA 2OMWA 2WWKO 4LU5H 1A7OL 4YWGL 4QXGL 5B21A 3AREC 1R75A 4QD2E 4ZO9A 4XI5D 2XKNA 3MFGB 3IKCB 3VO0A 2HFTA 3DTXB 3LB6D 2C34A 3FO9B 4YXKL 5IWLC 1H6FA 2JXMA 3QC5X 3RVXC 5I6LA 2LABA 5EC1A 4MB4A 1LEGA 2WO4A 4R90L 1H3PL 2GBAA 3H42H 4K8RD 1BFVH 2ED8A 3STLB 4WJ5B 4JFYA 4RSVA 5DVMA 2DYPA 1J0ZA 5HYSA 1AKJB 2J25A 2C9XA 3Q8EA 4WFGD 1ZHNA 2JLLA 1E9QB 4Q6YA 4WV1A 4DGVL 2AQ2A 3AQDA 1SVBA 3ZTDC 2XWTA 4MMXA 3TA3D 4YSDA 4AXWB 4NN5B 4PBDA 1GXEA 3UTPE 4BFOA 3BC9A 5C0GB 3IXTA 4JFFA 1CGWA 2EEBA 1DSFH 3B9DA 3RE0A 5E4EB 5FYKH 4L8DB 1MELA 4TUOA 4EZMA 1QQDA 1C08A 1GCFA 1RK1B 4XVJL 1AE6L 1M57B 1UZ8B 3BGMA 3GJEB 5FO7B 3ULUC 1OV8A 4HXBL 5F88A 5FV2A 5HI3D 2K70A 4R97B 3F83A 5FECB 2IDFA 5SWSA 5GRUH 2EEDA 3TIDA 1G9MC 1OD7A 4B50A 2W59A 4YHKH 3X2QB 1NAMB 4ACPA 4GQRA 1UJ3A 1NMCC 3BAJA 4QRRB 5A1AA 2NY2D 2FIKA 1B0RA 1GGIH 5B1KA 3WN6A 1YNLH 4EUPA 1UCTA 3L4CA 1J10A 3D07A 2P5ED 4QGYA 3WOVA 2CH8A 3FUMA 4I7ZC 4L3EA 1ZGLB 2H47C 1JHKL 1NMBL 4LLUB 2XN2A 1F8TH 4I13B 1FBIL 2A9NL 4QHUB 4X4ZA 4Y9FA 1XB8A 3MRFA 4FFWC 4XO5A 1JGLH 1EAPA 5HI5D 2AKRB 2H1XA 4ENZA 4LU5L 4EVNA 1A7OH 4HX1B 3RWHB 3L3OA 3ZRFC 3PGDA 5I1CL 2GIMA 3D51A 3ZQWA 3BP4A 2NOYA 5JW5B 3OBAA 3QIUD 4ZTPH 1KV3A 2PW1A 2BSED 3ILDA 5GGVH 4X5PA 4ORZC 4S10A 5DS1A 4QT5A 3QJTB 1CQYA 2J56A 1N19A 5I8CA 2NCEA 4RFOL 5CU9A 4R90H 3N41B 3GSNL 3CPLA 2E75C 1A65A 4K5PA 1KGYE 3PUUA 3T3ME 2XBDA 3IDMA 1AZZC 4JUTA 4WI9A 4DGVH 4Z3HA 5IB4A 4TUJB 2AABH 4HJGB 4M8UA 3Q8FA 1JPEA 3NESA 1RUML 1M1XB 1RVFL 2FO4B 2X4NB 4NENB 3O3BB 4LIQE 4JZJB 5FUOL 3D87B 2X1XR 4JQIA 4PGCB 5FYKL 3GBEA 4MDJB 3TA3C 3H0TA 4PCSA 5GRZA 1KV7A 4ZD3L 3LXAA 4HZAA 2GI7A 1EO8H 4XVJH 1ZXQA 2HT2C 4OLYL 1AE6H 2WXOA 3UP1A 3EXJA 2GTZB 2JELL 4LQFH 3MRCB 1GS8A 1BZ7B 2NY6C 3N1PC 4NC1C 4Z7UA 4LOFA 3S88H 1I9EA 1S7TB 3QPQC 4MMZC 4UTCA 2BS9A 1OGTA 4QRPB 1QTPA 2Y06L 3EDDA 3MRJA 1CBVH 1A6TB 3CFCH 4LPVA 1YRKA 3FUIA 5HGAA 3TZVB 1GGIL 5C3IA 5F1KC 1YNLL 4X9HA 1HH6B 4H0GA 4KJPD 2JCCF 4ODSL 4PJ9A 1ROCA 3T3PE 1W15A 3EJTA 5I16A 1TCRA 3GK8L 2CO7B 2VLKA 1I7ZB 2M2DA 5AQ0A 4AYFB 1IEAB 5C2UB 2NR6D 2VE6A 3CN0A 1KN4H 5AKRA 5HYQB 1T03L 5C2BL 5C0BE 4QLRA 3WHE1 4BH7B 3TBYA 1GZQB 4NXSA 2EH8L 4DGYH 2PYEE 4JUSA 3LDBB 1VFOA 4TTDC 2FLMA 5GGVL 1P4IL 3LRLA 4Q58C 3T09A 5EU3B 3B6SB 1JTPA 5I66B 1NAKL 4G8IB 1BCIA 1WTGT 1QNZL 4QTFA 5GGTH 1MCBA 2ESVE 5HHOD 3RY4A 1OLLA 3QDGE 1V05A 4X5XA 1JJUA 2ZKXA 2PYEA 3KAAA 4LFHD 5B1JC 3VH8G 5J12B 4HC1H 1U6AL 4UT9L 3VSQA 2EUWA 3G9AB 2OW7A 3QFJA 3OJDA 5T1LD 1YNKL 5EU7E 5FR3A 1BDYA 5KSBF 2FO8A 4YBLB 4OCXL 2PP9A 2Y7NA 1R4XA 2WLJA 4Q6IB 3U46B 2PWFA 3CDGB 4ZD3H 5IEKB 5SWSB 3L4ZA 2VQUA 1IGCH 1E8ZA 2FNBA 2EH7L 1VZIA 3MLWH 4PJHE 1PYWB 4OLYH 4Y5VA 1ETB1 2ZUYA 1UG9A 1HKLL 1G7JB 4E9WA 2Y1ZA 4CUCA 3NGBC 5IROA 4DP7X 3L3KB 1WCBA 5E5MB 2R1YA 2NT1A 3TA3B 1WA2X 1MUJB 1VFMA 2Y06H 3QI9D 3US1A 3RRQA 1RERA 2ZXCA 3UOAB 3CFCL 3IFOB 4H26A 1HL8A 1PNDA 5KANG 1HAWA 2QGBA 2VXQH 3EO1B 2MTAA 3V8OA 1CE1H 3C6LC 1RZQA 2O72A 5EPMB 1E4JA 3MRIB 1EAPB 3OZKA 1PS3A 2NY0B 4F7MB 1TU2B 1WISA 4XX1E 2HT4C 1QBLL 2Z91A 5D1ZA 3SJVD 3BP4B 4HLEA 2WYTA 4G6FB 4B9KC 1JHTA 4N9GA 2ZG3A 5C2BH 2P5WD 2OMWB 3U0WL 1AI1H 1MVUA 1MOEA 4N0UE 4P49A 4KI5F 5LQBH 2IMMA 5DD1H 3ECBA 3HRZB 3N40P 3FFCA 4WWKD 2G3ZA 4HCRA 4FFZA 4M1GH 1RSFA 1A4JA 4WF7A 1N59B 2YR3A 1R19A 3B3IB 1QPXA 2NNAA 3LV3B 1J8RA 1I9IL 5EC1B 2IDQA 2O30A 3O6LL 5JIIA 1YN7B 1ZTXH 3KCPB 3FFCE 3HCVB 1D5BA 1QNZH 5DDHA 2I9TB 3H9HB 5I6PA 1PTZA 4WWOA 5CEZL 1DN2A 1NIDA 1OTSC 2PO6A 5J13C 1LE5A 1NLDH 4WI3A 4NENA 4YHIA 3P0YL 3RUGA 5MEND 1U6AH 4UT9H 3VXTB 1YEKH 2W9EL 1AIFA 3BPLC 1AAJA 2Z6FA 4JDVA 2ICWI 2VUYA 3WGVB 4JFFB 4WSJA 3TWCH 4L1LA 3UFIA 4Z78B 4OCXH 3X1EA 4HIEB 4BZ1L 3MYJB 5K1JA 2AVGA 4WRLA 5K69A 4GKNB 3WBDA 3E2HB 3FRUA 3QJHA 1O6TA 4WEBH 3UYOD 4OKVB 1A3RL 1JE6A 3VSVA 5E23A 1IGYB 1Q9KA 1U3HB 3DV6B 5DMKA 4D9RE 3UAEA 3O6MH 5C0AB 4K5MA 5GGUA 1KY6A 1BZDA 2L0DA 3TBBA 4YPGA 4J2XA 1B0RB 2QEJA 4L8SA 4LDCA 1N5YH 1ETA1 2IANE 2YXWA 1AO7E 3ARGA 3F05A 4TXVB 1BLNA 2VXQL 1CE1L 2ZWYA 3L5WB 4PTTB 2OS7A 4PS4H 2WQAA 1I7TA 2X4QA 3E8UL 4KDTC 1MRCH 2YUWA 1IB5A 4QHUA 1K6QH 3U2JA 3B7RL 3EDEA 1I85A 1JFHA 1F13A 3H54A 1RKRA 1RJCA 3HIZA 3U0WH 1L6PA 2R0LH 3OHXC 3BPNB 3ARTA 5LQBL 5DD1L 1GA2A 3KYOB 4U3CA 2DJSA 1I9IH 3CE1A 2DWTA 4MAYA 5CMAB 1IILE 4XMTA 3WDJA 3SGJC 4L8SC 4J3XA 5HYJB 4ODBD 2ICEA 4ZMZA 3LRSA 4KI5C 3VX0A 3ARYA 4LLYA 5C9JA 2B1OA 3VTAA 5GS1B 2ZYRA 4NKDB 3HNSL 4WEUD 4D3CH 3Q8BA 4U4BA 1ZTXE 4XTRD 1CN4A 4AM0A 2HMIC 4Q6IA 1MW1A 1UC6A 3R18A 1HCFX 4NERA 2E9GA 4X6EA 1CUOA 2VQ1B 2BSSB 2O6FA 4JM0A 2BVUA 2OXGB 3WKMH 4BFEA 4BZ1H 2H2SD 5DD3H 2Z93B 4PY8I 1J0HA 3BD3A 5HHOB 2IFFH 4NEHB 3WLWD 4HCIA 1UA7A 1IGJA 4MWFB 4ORGB 3ZY7A 5EEWA 3L4UA 2P45B 5FKPB 3HUJB 2H0JA 4OGXL 4I89A 2WLLB 4YVNA 3FQYA 3VM7A 2WJ7A 1JZGA 3VGAB 5I76B 2RB8A 1SHSA 4NGHL 2WXPA 2X44D 4IU3B 3MRJB 2NY5C 3O6ML 3VXQB 1GL4B 1RPKA 4HJIA 3C6LA 4I48B 5AAWC 3TYGL 1CDIA 2OSLA 1PD1A 3SYCA 4ANXA 4BK5A 1ETZA 1Z0MA 4OI9A 4DKEL 2X3AA 4K23H 4AMXA 4TQHA 1BP3B 2JB6A 3G08B 3WU1A 3BUYB 3X14A 2JNZA 1TQWA 3FO0H 5D5ME 5DJXA 4N85A 1MRCL 1XTMA 4NN6B 2J88H 1QEXA 4LSTL 3QT2A 4XT1C 4ZS6D 4JHWH 4WGKA 3FUKA 1X5XA 4PJEA 4I18A 4WK0B 3OF6A 4AUJA 4FQJL 4XC1H 2BP8B 5I6XC 2YAEA 3PDOA 3RWFA 3QUGA 1A7PH 1CXEA 4DKTA 5JIPA 2O5XH 4M5ZH 4P3DA 2A6DA 1R3IL 2AJUH 2GVYA 4QRRE 4EUPB 2NYYD 3MBWA 4KAQL 1U8HA 3OKDB 1ML0A 3QIBD 4DUWA 2EDEA 3HAEH 3LH2L 3HNSH 1OM3H 3MTXA 4FZ8H 5IQOA 1AHKA 2D3VA 2Q3XA 1BREA 4AT6B 5IUCA 3UTTD 1HEJC 2B08A 3Q3GA 4WFFE 3KWWB 5JUEH 2X0UA 5ICZB 2DTMH 2FRGP 2CIIB 4ZQKA 1KTRL 4JN1H 2GB2A 4Y89A 5HJBA 1RSYA 2C3VA 4L0PB 5DD3L 4HW6A 2AV7A 4WU5A 1KIQA 5BRQA 2FHCA 4LVOB 5KBPA 5MEQA 4AQ8C 1IL1A 3DXAB 3W39A 4H7VA 4PJ8A 3FCSB 2RTTA 3IVKB 1F1DA 3BYYA 3QEQD 3M86A 4ZMLA 3TO4B 1CFTB 1MFNA 2HX9A 4MA1B 1INDL 4ALAL 1BQHA 4JHBA 1NGXA 3HTLX 1XCWA 4OJDH 3L5WA 2HA1A 3F00A 1DN0A 2HRPL 1U41A 2Z64C 4ADGA 1BBJB 4UBDD 4Z3TA 2IWKA 4HJGA 3E9UA 4O2CB 1SQMA 1Z9MA 2AJVL 1FZMA 1UB6B 4G1EB 4ONFL 4ZXBB 4DKEH 4GINA 5DLLA 5B3JE 3Q2VA 5CJQL 4BFJA 3V5DA 5TFSH 5IHZB 3CHQA 3L2LA 5KYNA 4PGCA 3WTSA 2VL4A 4LIQL 2DB8A 5EZIL 5IJVB 2ISDA 3MOAL 5F9AC 5TGBB 4N90E 1RU9L 5HI4D 2PXYC 2HH0L 1AO7B 2PABA 4EI5A 5MI0C 1OCWL 2EDQA 3N1MC 3U4AA 4ZUTA 2J8UF 6PCYA 1E40A 3NSXA 4HQQH 4K7PX 3WNPA 1Z9SA 4FQJH 4I77H 3ATEA 3DGDA 4XC1L 1T1ZA 2DKSA 4X99A 4OAWB 1II4E 4I88A 2VDRH 1FAIH 1MJUL 2P8PB 5D7LB 2O5XL 3T0EA 3OZ9L 5F9JA 3O2DA 4BFIB 3C9NA 5K1VA 3HMXL 3ULUE 1QHQA 4R2GD 3V5KB 3HJ0A 1B90A 1Z9NA 2F61A 4L8CA 4Q0XL 1B0GB 2LAAA 3MUY1 4JFPA 4PRIB 3LH2H 2D2CC 4M1CD 3SDXE 4NIKB 3NCYS 1L6ZA 1MWAB 5AALA 1TEFA 2IWGA 3HAEB 4OZGA 5EOTA 1RULL 1IM3B 3JV5A 3MNWB 3VTMA 2X2JA 5HYJE 4FG2A 2A1WL 3SDXA 3IM1A 4IGBC 2DTML 4OZGF 2QV4A 1S9WB 4JN1L 4HDIA 4M7ZC 1TZIA 3KHQA 4P2OB 1X5IA 2BDNL 1KPUA 2OJZL 5KVDH 1XTLA 3A24A 5IT2H 3LXUX 5FOJA 3CUPB 4H25B 3QWNA 4OLWH 5H94B 5C0EA 1P7HL 1HZKA 2PXYA 3C6LB 4Y2DC 4DZ8B 4MZ2A 3WE6B 4RETB 3DUUB 2AK4D 4N0CD 4NAJA 3OAYK 1LO0H 4TOYH 1ZHKB 3NIDE 4FHKA 4RGMB 4IIQA 4Q8BA 2EUVA 3X14B 2QQKL 4LLWB 4OF7A 2AJVH 4ONFH 4NWTL 4NXKA 4PTTA 4CGTA 2JKXA 3KDPB 5LUMA 3HZMB 5CN1A 3WJJA 2WUCH 5TFSL 4UANA 3ETBJ 3DYOA 4AGPA 4IBTA 4LIQH 4F8OA 2D9CA 1JGVH 3WD5L 4KZEH 1JGDA 1Y0LA 1ZEAH 2NUPA 4QOKA 1RU9H 5DJ8B 1EO5A 2IIJA 5D1QA 2EEXA 3CG8A 3BT0A 3S34H 3N6YA 3QIUC 4I77L 3VFVB 4P3DB 4MNQB 4YDJA 4PJ5A 5E5UB 3QRFM 3VFRA 4JVPA 2VDRL 1JK8B 4JG0L 1IQWH 1L0PA 4L23A 2ORBL 1IGTA 4W70A 3UPRA 1TYJA 2UWEE 1XGRB 3OB0K 3HMXH 2UUDH 1WZLA 5BS0B 1N8ZA 2ZONA 4MD0B 4TQEL 4XPTL 4Y2OB 1LEIB 3FQXB 2WSDA 5E7FA 4TVUA 2OL3L 4APQC 5CWSA 1ZHLB 5KSUA 1GYWA 2Z1PA 3E2HC 4YDIL 4MJ5A 4B95C 3EG9B 5ILTH 1KZQA 2R4RH 2QVFB 4XHQA 4OCYH 5KG9A 2WLNA 4DO5A 2MOQA 1DBKL 4BRVA 3HRZA 1E4KC 3PREA 4Y5VC 4L9LA 3RTQD 2ADYA 2OJZH 1TVBA 5DRZB 2Z7YA 2YSSB 1QI5A 4OF6A 4URTB 2EKSA 4OLWL 1CR9L 4HWBL 1DN0B 5EIQA 3TEXA 4LNVA 1DE4B 3P4MA 2PO6B 2VLJA 2N3JA 1PDKB 4RAVB 2CKBH 5FYJU 4WO4C 3V4UL 2EDBA 3V5DB 5IHZA 1CTOA 3FTUA 5FFLA 2DQCH 3MU3A 3ETBF 1OZUA 4G9FE 1QSVA 3BH4A 3PWUA 5C9KA 2V3FA 3L9RB 2WUCL 1UENA 4NCC1 5CFHA 2Q7NA 3BDXA 2P8MA 3FTZA 3VSTA 4M48H 1T2JA 3RU8H 2X53A 4KZEL 2AEWA 4KJQC 1MW3A 4HWZA 1NC4B 1T5XB 3A6OA 3P2TA 5AOLA 2HLFC 4DCQB 8PAZA 3DPBB 4OM0L 1S8DA 5F9JB 1U3HD 1HH9A 1HEZA 2OMXA 4YLQT 1U8QB 4PRBA 3E38A 3BAKA 4R8WL 4N2GA 4AGNA 4AEHH 1ACCA 3KGTA 1KNOB 3OM3B 4Y4HC 2WOBA 3TBWA 3V95A 1HDMA 2ORBH 1VFBB 3R7RA 4HSAC 2OR9H 3GRWH 3AVEA 1KBPA 1FFOA 3ZTJG 3RDTD 4KO7A 4OTXH 5D2LE 1SUJA 2WQ8A 1FVCB 4HXBH 3D2UD 4TQEH 4XPTH 1QWUA 1A1OA 4PY7A 5DWUL 5KYWB 3VWJD 1SLUA 1EVUA 2C4FU 3IFNL 3VRJA 3GPSA 1PAZA 1NFDB 3CX5J 2ICEC 2CO6A 1LNUA 2FT8A 3ZKXB 1CIDA 1P53A 5DC2A 4PJDB 3LPPA 4ZO7A 1QG3A 3EDJA 2R4RL 4WUKL 5D7LD 4HPYL 4ZZKA 3KS0H 1N2RB 1DBKH 1LWRA 1LWJA 1JZDC 3VXOB 2EZ0C 2QVIA 3RP1A 3P2BA 3WE6A 1ZSDB 1JHKH 2A9NH 1ED3A 3WS6A 1CR9H 1KXQE 5D1XA 5I8EA 5T3ZD 2LW3A 1BD2A 1JGLL 4IIQB 2F8VA 1BWWA 1TQVA 5ABDE 3EYUL 3PABB 5GSRB 5E1AA 3SDAB 1MXGA 2ZXQA 4PS8A 2CKBL 3V4UH 1SRDA 3B5HA 4QTHA 1AGDB 2DQCL 4FA8A 3K0YA 2ICWB 3BZ4A 1F45A 4HUCA 3DPDA 4RFOH 3VDAA 2ZP9A 2F53A 3GSNH 2OXGA