2KMWA

Solution structure of at3g03773.1 protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
b'SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At3g03773
publication title Solution structure of At3g03773.1 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kmwA01
3QORD 3QORB 4YL9A 2WJ5A 4YLCA 4PBDA 2RH0A 3QORA 4JUSA 2XCMC 3L1EA 2Y22A 4PCKA 2O30A 3GT6A 3L1FA 4RZKA 2K8QA 5DS2A 1GMEA 1WH0A 5DS1A 3AACA 5LUMA 2KLRA 2KMWA 2CG9X 3L1GA 4M5SA 4I88A 3N3EA 1RL1A 1WFIA 2BOLA 3W1ZA 1EJFA 3AABA 3Q9QA 4MJHA 3VQLA 1SHSA 2N0KA 2JKIS 4YDZA 3EUDA 3IGFA 2CR0A 2WJ7A 3Q9PA 4FEIA 2MNWA 2Y1ZA 3QORC 1WGVA 3GUFA 1X5MA 4JUTA 4ELDA 3VQMA 4ZJ9A 2Y1YA 3J07A 4YE0A 3GLAA 4YLBA 2N3JA 4M5TA
chains in the Genus database with same CATH superfamily
1KIPA 1XCWA 2P46B 4RAVA 4WW1B 3RTQA 1K4CB 3N40F 1MY7A 1Q0EA 2PXYB 2RIKA 2HX8A 4WI3A 3GKWL 1X5XA 2HLAA 4Z7VF 5I74B 2V5TA 1OP4A 2LV4A 3FPXA 3VD2A 5GGTH 1Q8MA 2FBJH 4IU2A 4NPJA 4A2GA 5DYFA 5KYUA 1IAKB 4LT7A 4MNGE 4JPQA 2WBXA 3N91A 4MJJA 4ELDA 1AZZC 3LIZH 3CVIH 2YBRB 2ADGA 5H35A 2PXYC 3GJEB 4ZG1A 1U3ZA 1I1AC 1C16A 4E68A 4JCMA 2C4XA 2WQ8A 4XBEH 3WOVA 2Y25A 3CBRA 4EMZA 2QPSA 5FO9B 1S2EA 5IB4A 4CDGC 2IAMA 1W8NA 2A73B 1HAWA 3H7LA 5F1KC 1XH0A 2HX9A 1XF2A 5I1EH 2IC2A 4BSWB 4ECNA 3IDGB 1YY8A 1MCSA 1JS4A 2DQGL 4TLUA 1S9YB 4KKBC 4ZTOH 3QQ9D 4PJGE 3NRPA 3SEPA 3B9EA 1SEBA 5F7DB 3PHQA 4P2QA 1FC2D 2AABH 4K07A 4I1RA 3VXRD 4GH7B 3KGRA 1IC7H 1JERA 5ILTH 1DO5A 1PMYA 1SYVA 3EF4A 2XETA 4UQ2A 1N64H 5I1KH 2ZXQA 3ULVL 1NPNA 3WE6B 3FQYA 4MZ3A 4PGDB 2CG9X 2YJQA 5DHXB 3NQIA 5JTWA 1G9MC 1HEHC 4J3VA 4YHZL 1E90A 2D7QA 3QUXC 2AVGA 3BDYH 1A8JH 4ZS6C 5EEVA 4KNQA 4XMXA 4O4YL 2NZ1A 3O3BA 1GPOL 4PTTB 4Q9QH 5AW1B 2X44D 3AXHA 1BWMA 3HBZA 4CSTA 4E5XA 3RPKA 2BP0B 1ZV5A 3R7RA 3UTSE 5EOQH 5F7EL 2LU3A 1SOQA 1TYEB 4FFVD 1ZK9A 4M1GH 5I1HH 4LPCA 5IB3B 2AJUL 1PYWB 3WMSA 4KI1A 3QYNA 3F7LA 3ZIYA 1AD0B 4BFGA 2VT0A 1XGRA 3WTXA 4Y89A 4AYFB 5JW4Q 1W72B 3ZE0F 2TSAA 4LPUA 3G6JF 5TDPA 2PCPB 3MNVB 4K8RD 3K2MC 2YAPA 5GRUL 3SB3A 3KWWA 4RBPK 3V7MA 5LXGL 2VLJB 3GI9H 4KKPA 4MWFB 2WCSA 5ID0B 5AVYB 4EIBA 4RMQA 1ZV9A 2WTPA 2QTVA 4GI9A 4FP8H 1RK0B 3UZVA 1VGKA 2G60H 4G5ZH 3QORA 4K9JA 4RMSA 4XP6H 4ZDHB 4M1CC 2Y7QA 3GSQA 5F21B 3KYMB 3UPCA 15C8H 2A77H 5F1SA 3RNKB 2XKNA 3ZYZA 4HQQH 1HEZB 3H7BA 4MS8D 1MW1A 4H4NA 4EBQH 5BS0D 1L9PA 2GIXA 1GHFH 1J1XL 3VFPB 3VG0H 2Q8BH 3F5WA 3L3HB 3NZ8A 3QEHA 4PJIE 3OWRA 3U0TB 1OY3B 4AIOA 2N7AA 3PGDB 4PRIB 3K4AA 1Y0LB 3V5KB 5FOBA 2X0WA 4L9LA 5D7JD 5IROD 3IXTB 1GTFA 4XODA 2F53E 1WDAA 2DWEB 2RH0A 4FQIH 1UUNA 3B1UA 4XNMB 1NCOA 2ORBH 4RWYL 4C55A 3ULUD 1IE5A 4XVJH 2W5PA 4M7KH 1JHLH 2XIIA 2AVFA 2EP6A 1MCHA 3QWQB 4KY2A 4X6DB 4CN6A 3KVPA 4ONHB 5LAXA 3JWOL 4GG8B 1UCBL 3WFCH 1MFEL 2JI3A 3WDIA 3MQIA 5F1OB 3VB8A 1F3RB 2BP8B 3D51A 1E6OL 1QZ1A 3O8XB 2PPAA 5FOBB 3G5ZA 3THML 1SOKA 2HVKA 2B20A 3IMBA 3UJJH 4ONFH 1MFUA 3PXLA 4N2FA 3IAQA 4OLYH 3WJJA 2BS9A 2B77A 4LKCA 3RWHA 3QQDB 2NY5H 4AQAB 3ROLA 1KELL 2IADB 3O8XC 3RYMA 3CPLB 4QRRB 5D71L 4YPGA 3SOBL 2XA3A 3D3VB 2F2HA 5D7LD 5C2BH 4Y2DD 5KSAB 4Y19A 3P9WB 2AEQH 3DVGA 1W2KT 1DVZA 1IT9L 3QS2A 2A83B 5T3ZL 3RFRA 1U42A 3BC9A 2EYSB 2LVEA 3AC0A 1A66A 3D25B 3CFDA 1F8TH 2HTKD 1GGUA 4CSPA 4LMQI 1OGAD 1F2XK 1X5ZA 2EDXA 3HCVB 3MRKB 2BSSA 4Z76A 2EINB 3OJDA 5GRYA 5DR5H 1EJ6A 4LP5A 2X6BA 1FGVL 3QNFA 1IJ9A 3DNKA 1AO7B 1CYXA 1KCSL 5DVPA 5HI4C 1IAIM 4N90D 5I16A 2IPTH 3GMNB 2VE6B 2XC8A 5ADOH 5I1CH 1TJGH 2G3NA 4PJ5E 4ACTA 3TZVB 1SEQL 3BVDB 3L3IA 2HTLD 3NJKA 4I2XB 2PW2B 4OQ1A 4E42B 5GGSB 4YAQA 2CO3A 5DRNB 3MI6A 2YQBA 4CW1A 1VKXA 1Q4NX 3S3BB 4AV5A 4ELMA 1RULL 1W15A 2Q3ZA 2HJLA 3BDXA 5GPRA 3IJSA 3Q8EA 4H40A 4TSBH 2HKFL 2JB6A 2H9GB 1XL6A 5D2NA 3UABA 5D1QB 1HK6A 2DWYA 3D08A 1WICA 3T2QA 5D1XC 1KJVA 1HFUA 3TZVC 4X7FC 1H15A 1JPTL 2OKMA 4U1NA 5IQ7L 4NP4L 4PP2A 5E00A 3QULB 2X9WA 1L6XA 2YLKA 1S9VA 3N41B 1BBJB 4OBRA 4XVOA 1GR7A 2C3GA 5HGBB 4GUPB 4DOHB 3MJ9A 2ZKWA 1LP9E 1TSRA 1MFCL 1XIWA 3CZJA 3H9SB 4HSCX 1YMMB 3NJVA 5D1QC 3EO1A 3A6CL 4PSPA 5IW3A 4IJTA 4ORGB 2NXZB 4LEOB 1IAOB 3VFGL 3W0WD 1I8KA 2XJKA 1TEYA 1HHHA 4KZCA 4PI2A 3ZDYB 3WTTA 1Q1PA 4HF5L 1CXIA 1TZAA 1E8YA 3M17B 4PJAF 4FD0A 4G7VL 1MZYA 2DTML 4PJBA 4JM4H 1JTOA 1KEML 4IOSD 5K9OA 5EEYA 3QFDB 2QR0A 2A6JB 2X4QB 3CXDL 3O6MH 5JDSA 4OLVH 2BY3A 3C60B 1YNKH 2XVGA 4GB9A 3BHBB 2VR8A 5GZOC 1MI5E 1JWUA 1KCUH 2IGTA 5JXAH 4H25A 4Z3IA 2FJUB 4ZMLA 1DSFH 3FUKA 1JI1A 2ADJB 3SKMA 3FRUB 4Z3JA 5TE6L 2ZOLA 4R4FL 1AHWB 3QRBA 3FO0L 3FB5B 3QJRB 2YPLE 1RVFH 3C60C 4X98B 1R6VA 4GQ9H 2Y1YA 2G4GA 3KJ6L 2FRGP 2L04A 3MJ7B 3NFPB 1AE6L 3VFMB 1G7LB 3QUZA 1WBXB 4GSDL 1JN6A 4KK9C 4MNQD 5MEPA 3P4NB 1I9EA 4R6UA 5BUPA 2PTTA 5E2UH 3CZLA 4F58H 5T1DL 1AAJA 3LKOB 1FZOA 12E8H 1E9QB 3JV6B 3V5DB 4HIEB 5EBLB 5JORB 1KMGA 3P73A 1EA9C 3ZYOA 4APQA 4FLRA 4JFEB 2OSLB 3QIWC 2YPKA 3AQDA 2E7DA 4PLJC 3MRRA 4NZTH 3T0EB 5J1TC 1KLGB 3D69B 5J8OA 1R3JA 4KI5F 1N7MH 1F41A 3MLZL 2ZAHA 3PJSB 1CD8A 4U6VL 1UXSB 4NUJA 4L3AA 4YHOH 1OGSA 3DIFB 4GMTH 4I0PC 4MMXA 1UG9A 3ZJAA 1YAIA 1J8HB 1KJ3H 2KLSA 3ESPA 1NCAL 2DQEH 3P2DA 3D48R 5ACLA 2DWTA 3RGBA 5DI8B 3T0EC 4DN3H 3VRJA 3GRWH 4H88L 4BINA 3L13A 2GC4C 1ET5A 3BPOB 3FSOA 1N5YH 2KUTA 1AXIB 2JJSA 3LIUA 3V0IA 2RBLA 5IF0B 3TYGH 2CGZA 1Q94A 3ZKXB 4CC4A 5E4IA 3LZQA 5CBEB 3DV6B 3HRZB 4GAJH 4QRPE 4NERA 2A9MH 3EAKA 1CYWA 3E7JA 4QHUB 1U92B 4BYHA 2IANA 1X5GA 2XZAH 3WKML 4HPHA 3T04D 1KJMB 3N40P 3IK2A 1CGSL 2WLHA 1HSBB 5F7FA 2AMGA 2AEPH 2QPEB 2WN3A 3OV6A 2OX5B 3D50A 5C8JA 4K5LA 4H7VA 5FB8A 2Q9OA 1JPEA 2WIIB 4PJ9B 4PUBL 2WJ7A 4RQQA 3ZKXC 5BW7A 4GJTB 2JCCF 4LGPB 2BIOA 4YHPB 4DGYL 1BZ9A 4PB9L 1QP1A 2EKJA 5F1NB 3HRZC 3DX7B 3KGSA 1JWMB 1W72L 1CIUA 1FNGA 1P4BL 4LSTH 4NNXA 5EEXA 1WV7T 2JK5B 3JSSA 4NRZA 8PAZA 3MV9A 5JHBA 4U1IA 1ZK5A 2J2ZA 4HCIA 4OAWB 4DSYA 4WEBL 1RZQA 1SN0A 4IDLA 1AP2A 3DETD 4ZMOA 2R56H 1DBAL 3IJYA 4PJ9C 4JO1H 1NJ9B 2EXTA 4QXGH 3C6LA 3BOVA 1QR1B 5BRZD 3VD0A 2N1TE 1ZS8A 1P69B 4TXVB 4PRHA 2XTLA 4Y4KD 3CAFA 1BAGA 5I76A 4PBXA 3IBOA 4WK4B 1HHKA 4FXGB 1IC5L 3C5ZD 2IGLA 5ANMB 3LPOA 3N42B 2VUOA 3EJTA 4U1KA 4XTRC 2Z91A 5E9DA 1KCVH 3DOSA 4UT7H 2VXUL 5G55A 2YRBA 3BP5B 1AFVH 1A6PA 4WFFD 3DJRA 4UNIA 5CEYB 5LB1A 3FCSB 3VU2A 3FT4B 2HJKA 1KGYE 3NH7H 5G5DA 2D2OA 3HI6L 3MLSH 4BFBD 4HIIA 1SOXA 1XF5B 4R5XA 1T0PB 4NBXB 4N2AA 1Q9KA 3RRQA 3UAJC 4HWEH 1WS8A 4Y8DC 3NJIA 4ZYKB 4CSZA 1JDDA 2P5EB 3ZRCC 4X0NA 3ARFC 3U0WL 3VI3E 5GRVK 3DUSA 3ZDXF 5JIPA 4LLYB 4QLRA 1WFMA 3REVA 5DGRA 5D2LE 3LXCA 5MHSD 3CV5A 3BP6B 1NSNH 1K8DA 2RB8A 2ZKHL 2R4RH 1WEJH 3N0PB 1ROCA 1D9KA 4H0LC 1HS6A 1M4KA 1KBKA 1EUTA 1KBPA 2A38A 3IXAA 1YEHH 3EG9A 4X80L 5M95B 1K3IA 4BQCA 1E4JA 4ZO7A 4HXBH 1T0OA 5E8DH 3JTSA 5ALCH 4X4ME 2VERA 4PJEF 2MTPA 4RMWA 3TA4D 4R4BB 4NKIH 4LDLB 3SDDD 1NINA 1CLOL 1SLUA 1QTSA 2FSEA 1KN4L 3QDGA 5EC2B 2EUWA 1AOZA 1CN4A 4Z7WF 1LO0H 3QDMD 3C5XA 3BUQA 3T0BA 5K39A 5L4MA 3KCPA 2CKBH 7FABL 5DS8B 4F93B 2H3NB 4QHNB 3RURA 3L2MA 3FSAA 4HCFA 1F6AB 4LCWE 2YKLL 1YYMH 4XCNB 4KKQA 4WF7A 4IMLA 1OF2B 1QFWL 3UTZA 1ZA3B 4HUUB 3WFHA 3D39E 3DIVA 3GKWH 4DCQB 1K6QL 2HUHA 4WLCA 2WVSA 4KOBA 5CWSB 2VKWA 2GABA 4B7LA 1LEGA 1FVEA 4ODVL 3UJTL 3HC3L 3MV7D 3K46A 2P42B 3CVBA 3WUWB 5FA3B 5ID1B 3EJYC 5C70A 5C0EA 2YJLA 2QELA 3DGGA 4PPTA 4NQDE 4NQEE 4P2OA 4YSTA 4ZUVA 1TQCB 5CAYB 4GW1A 1UD3A 4GG6E 1UM5L 4DUXA 3FDWA 4AKPA 1ROWA 4A2LA 1DUZA 3SBPA 3F7VA 3H2QA 3K1KC 4HMDA 3TJHC 3H9HA 3MBEA 4IRJB 5MERA 4L4TE 1WH0A 6PAZA 5JLZA 4OCWL 5I0WA 1M7UA 2KZWA 1HWGB 4RFEA 4XH2B 2FX8L 2DQGH 4G8GD 3D85D 4NCC2 1CBVL 4MHHI 3DDFA 3CFJA 1WISA 1XL4A 2XQYG 3DI2B 3WAKA 5KBMA 3D4CA 1CFTA 4J3SA 4FMKA 2IV9A 3OKOA 3VSQA 3WEXB 4IRJC 4M56A 5CLYA 1ZKAA 5IVXE 3ULVH 1KFAL 4W6WB 5EIIB 2FBOJ 3EDEA 3TOPA 1PCSA 5E9NA 1F11A 4KTYA 5AOLA 1LQBC 2BIQA 4NCC1 1N2RB 4YHZH 4BZ2L 4YIQB 4AE1A 2YMTA 2V3DA 3FZUD 5KSUB 4D9QD 2EC9U 1NBZB 4O4YH 1OW0A 5T1KA 4AEHL 4C83A 4P9ML 1GPOH 5ETUB 4JFWA 5BUGA 3PU7A 2ATPA 4NQVB 1NTDA 5F7BA 1HL5A 2X3AA 2UZIL 4PW9A 5F7EH 1IO4C 1M7IA 2WQXA 2XICA 4KKRA 3QUYD 2AJUH 1IFRA 2B1HL 3LEVL 2GG1A 2RQ8A 4WU5A 2A9BA 4WI9A 1CXLA 4I18B 4PV8B 4CBPA 3A47A 2J1ZA 4XNAA 1FYHB 2XZQL 4F2EA 2A4EA 5GRUH 2CKNA 2ZAGA 1FFNA 5LXGH 5LHDA 2BVPA 1G7HB 4WFHD 3ZKQD 4YLQT 1QOKA 3ARDD 3O2WL 3CDYA 3NT0A 2VJ0A 4PW4A 4NN5B 4E41B 4YBQC 2DOCA 5J12B 1KIUB 4U3HA 3BP7B 3O6KL 4NO2B 3HVNA 2PO6B 2DM3A 1ZT4B 3GJFA 4DQOL 4XNXL 1UD5A 3Q2WA 1ZGLB 5T1LB 2R8SL 5EF0A 1HJCA 2CA3A 2JLPA 5F9AC 5DHEA 3B7UX 1U58A 4GXUN 4PJXF 1FZMA 3ARGA 5C92A 4K7PY 1I85C 1UWXH 4QXUL 3EH4B 1F0LA 1H8NA 5KYNA 3NFNA 2V7NA 4PJ7E 5DHVH 3VXQB 4BFNA 5IM7A 1AC0A 1ANUA 4WV1A 5EWIL 4U6HA 4NN5C 2WIMA 2KERA 3HPLA 2Z64C 2CM5A 3QA3A 4PD4K 2NW3B 2DD8L 3X14B 5CGMA 3CLWA 3F2LA 3EBAA 2PO6C 1UXWA 1OE3A 2XN9E 2ATKA 3QT2A 5GIRB 2WOYA 1IUZA 3OLDA 4RWYH 5EZOL 1BIIB 1ZLSH 3PDOA 1C08B 3NMEA 2PYED 3S88L 4NHUA 3VYOA 5HVWA 1FO0A 4Q56A 3AVEA 4V2BA 2FWUA 2R9HD 3JWOH 1UCBH 2IALB 1MFEH 1QRND 2AEIT 3WO4B 4KKZA 4TNWF 3B9KD 1T4KB 3P4MB 4ZXBD 1KACB 1E6OH 3BSGA 1FL5B 3D2UB 3ME0A 1DJSA 2ZXGA 4TNVF 3THMH 1J5CA 1O7SA 2J3SA 2LAGB 5FO8A 1M57B 3II1A 1N6UA 4NKMA 4AMXA 3MAWA 3HAEB 4WDIA 2D7PA 1L0XA 4MA1C 1D6EB 3ZBMA 3LEYL 4GW5B 3IFLL 4X42A 5IMOB 5FS5A 4A7VA 1KELH 1XF1A 5L7XL 3O6FD 4KRPD 1SJMA 3MRFB 4R7NA 1Y6MR 3U9UA 1BQHB 3CQFA 5D71H 5D7IA 4XAKE 5C0CE 3SOBH 4L1LA 4X2UA 3IT8D 2EZ0D 3JTTB 2RHEA 4HSAC 2AJXL 3QUMH 2X4NB 4R96B 3DXAD 4ZOBA 2WXJA 1KXHA 5T3ZH 3NIFE 4O2CA 1FJ1B 3SGKA 5KOVC 4YDNA 1O9WA 1YN7A 3BPCB 5IQ9B 3TBTA 1X6NA 1JZIA 3UADA 2UWEA 2QVKA 2OS7A 3ZL4L 3HG2A 3EFDL 1A6ZB 1U8IA 3KPSB 4MLIA 3SDAA 1FGVH 1E50A 1KCSH 3ABGA 3BWAA 4N2HA 3KWTA 2Z31D 1H5BB 2VQ4A 4I3SL 5DMYA 2W0FA 1JZ2A 4S1DC 3RZCD 2QKSA 4XXDB 1JGDB 5D93B 1SEQH 4KGLA 2ZKMX 3RWEA 2WINA 3IRPX 1TYJA 3H4HA 3MODL 1H6EA 3B5GA 5IQLA 3UZQB 3ZHKA 3QRFM 4Y4HD 4GYBA 5L2KE 3FCBA 1QEWA 3V5HB 4ANUA 1W80A 1RULH 1V3MA 5FUCC 4D2NA 2X4UA 1XH3B 2FECL 4ODWA 4GIAA 2HKFH 4FG4A 4WNQA 4J3OD 3LQAC 1GKEA 1ULVA 2HVBA 1RSFA 3GD1C 1JV5B 5JNYB 3OAYH 3WFBL 2F61A 5D93C 5C0IB 3D5OF 1JPTH 5IQ7H 4NP4H 4BWTA 1U95B 3L4WA 1MCKA 4PJIF 2ARJQ 1U3HC 3L4VA 3O45B 2WZ6A 4WW2B 5KYYA 5MENE 4WGKA 4YNYB 5DQ9B 4GKLA 1ZANL 3G6AB 1D7CA 4DKEL 1MFCH 1AMXA 4JFPA 2BVUA 5E6IA 3TYFA 1UB5B 5A3ID 4P5MA 4DETA 2H6UA 3IRCA 5KG9A 3U36B 3UMTA 2D0FA 4LARL 3WY2A 2YUXA 4HH9B 3VFGH 2F74B 3MV11 3SDXB 5FGCB 3FT9A 1BOGB 4HF5H 3CSTA 2EACA 2P5WA 1V3KA 4ZW8A 4YN3A 3L4ZA 1JYXA 4G7VH 3WENA 2DTMH 1UQSB 4P23B 3HE7A 1KEMH 1M42A 2NR6D 3FBKA 3GINA 3CXDH 4U3CA 2JV6A 4HWZB 1B0GA 4JRFA 5C0BE 1NBYA 2NY4D 3CQQA 2ZSWA 2EDEA 4KROD 4C4UA 4JY6B 2VDOB 1S3KH 2CDFB 4OZGE 1KNOA 5TE6H 1FL6A 1ZHNA 3WKPA 1XD0A 1KCLA 4P23C 4R4FH 3APMA 3HB3D 1JMXA 3FO0H 1XFPA 1WRFA 1EK3A 3RVWD 3KJ6H 5BVJA 1AE6H 3QI9D 3VFWB 4LVOC 3ZK0A 4GSDH 2P80A 3LH9A 1FPTL 3OQRA 2EUZA 1CGXA 3NCJL 1REIA 5T1DH 2E8YA 4Q6IA 5HYEA 3GMMA 2VAJA 3PGCB 3CDCA 3VXUA 2RGSA 3SCMB 3QUGA 1CICD 2YWYA 2XVKA 2G75B 3E8UL 4LLDA 3QZOA 3VFUB 1JXFA 2K7PA 1PBYA 3BZ4A 1NFIA 4JJOA 5LGHL 3U2JA 4F9PC 3BZDA 3DOIA 3TH3T 2C7UA 2XT1B 3HJ0A 3GM0A 3BKJL 2G9HB 5DRWB 3MLZH 2H0JA 4G1EB 5ISZD 3HI1B 3HC4L 1INQB 4U6VH 4X99A 1AXSA 2DM4A 2ZF8A 2FBRA 4XNUL 3SCMC 43CAA 5B7FA 5IMLA 1G9MH 3OB8A 1DLHB 1YYLH 3RWGB 1YC8A 1RIHL 1NCAH 2VITB 1BQRA 4I87A 2F7OA 2VLRE 3HG1B 4PRNA 5I5MA 3JUZA 3I3BA 4KNTA 1NBVL 4H88H 2YD7A 3GQFA 1VPOL 2Y2TA 2VLME 1QFWM 3L3KA 1NC2B 3C2SA 4K5NA 1CVRA 2XFGB 3NK4A 1MF2L 4IRSA 2UX7A 5A2CA 2HN7B 5BZXA 2VDKB 4J2XA 3OPZL 5A40E 4OZIA 2CE6A 2XQYK 4NQCB 4WUUB 3RGVB 4ICWA 1JK8B 3FQWA 3GO1L 3DMMD 1PGRB 5E8NA 3KGUA 3WKMH 1IFHL 1P1ZA 1EEZA 1OP3K 2WZAA 5I5JA 4LPYA 3PXJA 1CGSH 3CVCA 4FHBD 3RA7L 1KJ2A 3FFCB 4LQ1A 4AGNA 3ARTA 1T80A 3A21A 3GMPA 3JZ7A 4PUBH 4JAMB 4U33A 2OL3L 3DJ9A 4DGYH 1L9MA 1YC7A 3GYRA 4PB9H 4PS3A 3FRPA 3LKQB 1T83A 2DQFB 2E9GA 2WXPA 4XVSL 1FIGL 1W72H 4K7FA 1P4BH 3FTGA 4MD4A 1OARL 2YLHA 4LXFA 1OSZB 4J8RB 4P49A 1IGJB 4WEBH 2Q5BA 4AGPA 4MJIA 4NSKA 5E0QA 1ZT1A 1DBAH 4OT1L 3NRQA 1DJIA 1WVZA 2LQRA 4GRWE 4UT9A 4JY4B 3BQUD 3F7YA 4WI8A 3WFDL 1CL7I 1HKFA 3T5WA 5HGDA 4FHJA 5CNHA 1IC5H 4NAQA 3KPRB 4GIOA 4LCYB 1A47A 4WI7A 1ZIAA 2VXUH 1D5XA 4XN1A 3PQYA 3C9NB 1FH2A 3GSWA 2YO3A 3D09A 3L8QA 1DQQB 3EJJX 3FU8A 5FLVA 3IETA 4C56E 2OZ4L 1UZ8B 3S4SG 5BOJA 2CCWA 4U1LA 3HI6H 2GJZA 4YDVB 2FNWA 3QAZC 2F54D 1PZ5B 2UY6A 3LKPB 1B0RB 5HTSA 5AWNL 4DT2A 1MCPL 1LO5A 2X1WL 5EUOB 4X9BA 3WELA 4HJGB 1T0MA 3RL2B 3U0WH 5JA9A 3VI4E 5DZJA 4RDQG 3Q6FB 3QR2A 3FO1A 3L9EA 5JPNA 3J8F7 3TPUA 1P9MA 3LKNA 1U4EA 1FH5L 1V7ML 2Y2YA 3NJXA 4FYTA 4U05A 5F9JB 5FR3A 1BZ7A 1EFXD 2ZKHH 3BQVA 1KTDB 4EVNA 3LXBA 3LDBB 3FFDA 3OKMA 5DJCB 5F3BB 2OBGA 4BIKA 2Y7NA 3GB7A 2DWSA 3DKHA 4X80H 5A16A 3GXNA 1LDSA 4ZFZA 1KCKA 3W9DB 1DVSA 5CFHA 1CI5A 3PWNA 2OSYA 2JB5L 3KPOB 4QTFA 4FC3E 3PABA 3KHQA 5DCCA 3SYAA 2JKIS 2XYCA 3GSOA 2GCYB 2YUWA 1CLOH 3T1WA 5G2NA 1KN4H 2QVIA 1GGBH 4OF7A 2EEAA 5FYLL 1FNHA 1M1XB 3LDBC 3LH2L 3X1NA 1NGZA 4X7CC 1J0YA 7FABH 2E27L 4TVUA 5HHOD 3BP4B 3O11B 3I85A 4XBMA 1G7JB 3OZKA 2YC1B 5CD3A 4JN2A 3K2KA 2YKLH 4Z6AT 1W0VA 4WNSA 2ZTBA 1EZUA 2HVJB 3EYUL 4XN5A 3ES6A 3TC9A 2A6KA 5IW6A 2OSWA 1EJFA 4IRZA 1N0XL 2WXQA 4YFLI 3FYIB 1QFWH 1BP3B 2WAQA 2WZPD 3TX4A 3NIGE 5B7EA 3T0WA 3NCWA 3AY4C 1K6QH 3DTUB 2GIMA 1BM7A 1SYSA 2WLLB 3LQAL 1SJEA 2DLFL 2R2EA 3T3PB 4HC1H 1T0NB 2BNRB 4ODVH 4B5EA 4QCIB 1J87A 1MXGA 4TF4A 3UJTH 3HC3H 3APDA 4WWKB 2IWGA 4XZ4A 4G80A 2YXMA 3FHEA 1RPQA 3EZJB 3IEAA 1R3HA 1NGWB 1B2WL 3II2A 3OMNB 3N50A 1UM5H 1HKLL 4PJ6A 2Z65C 4NUPA 2ZUXA 4F7KA 1EXUB 1DEEB 2EILB 1HDMA 3HZVA 5I8EA 1BVKA 1KYUA 1BG1A 3VWJD 4HV8B 1UKTA 2UVFA 4DJMA 4WWKC 4PTUA 2BSEA 2YQ2A 3CDZB 5DEFB 2AS5M 4OCWH 4HIPA 5AW5B 4PGBA 1BMZA 3QFJB 4PJFB 3M1CA 2XWCA 5DVLA 4BFFA 3BMWA 2FX8H 1FZKA 3OTTA 1CBVH 2GK0A 3QIUB 4OGZA 3UROR 1OPGL 4KKAD 3IFOB 3LQZA 4LRIC 4TV3A 3VQLA 3PP3H 1PX4A 2UX6A 4YSAA 1D6VL 3VI3F 2YRLA 3ULVE 4AT6A 2BO0A 4KZ0A 1KFAH 5EOTB 5D2LF 3K6DA 1LO2L 3FB7A 3NFSL 4DZ8B 3BWZA 4F7PA 3BUTA 5CLTA 3VW3H 5DJZB 2MOVA 3QIUC 3KR3L 4N8VG 5LG1A 3T4AA 3VSUA 3WKNA 4BZ2H 1JGIA 4NJ9L 3A6OA 2AJ3B 4Y5YB 5DLML 4B3VA 4OZHB 2MOQA 5A2FA 4UANA 4P9MH 4UQ9A 3ZT6A 3TVMD 2FCBA 4OZFG 4CA4A 3FO9B 3VFSA 1ZE3H 2VJ8A 5A6LA 3RVUC 1TQBB 4JRXA 2DQDL 3MRIA 5GRJL 2UZIH 3C08L 5BQ7B 2VDOL 1EHXA 3GMQB 4D0CB 3BEWB 3VD7A 4OIBA 2HAZA 3EGSA 1O6TA 1YEJH 4P3CH 2YAQA 4UTAA 2XWXA 4NN6B 4PG9B 1ZWIA 3QXTA 3P11L 3O4LB 4R4ND 3S36X 1D5IL 1THCA 1PZDA 3DUHA 4MJ4A 2XZQH 2QHLA 5GZNA 2G3MA 4ADGA 5IB2B 2AZAA 5DD3L 4X4XA 3VWKB 2BVOA 3AACA 3S5ZA 3ESMA 1NC4A 1D5ZA 4NWUL 3K6SB 3KPLB 3L81A 1AQDB 3O2WH 2DKMA 4AJVA 3OXSB 1MRFL 2C9PA 2V9QA 1TU2B 2BP3A 4G6KL 1QPXA 3M86A 4MRBA 3ZTDC 4DZBB 4NN6C 2BZ7A 2LW3A 3O6KH 4O02L 4HKJB 3ZE2B 4DQOH 1HTYA 4XNXH 5BVPL 2GI0A 3OMIB 1IIIA 3WAJA 2R8SH 2IMNA 1E5AA 1I7UA 5IHLB 3P2TA 4TM9A 3VXRB 2ROYA 4QXUH 2FZ3A 5C08E 1HT6A 5EWIH 2CM6A 1GJWA 4EN3D 2DD8H 4FQXA 4DP4X 3VDBA 5CEZL 6TAAA 3UBHA 3US9A 3UTTD 3WGUB 4MJ5A 4EUPA 2VRAA 3MKKA 3QQ9C 1SXAA 4OW6A 2UYLB 4BK4A 2VDQL 5EZOH 1CGYA 3PIQB 2QPUA 4IQHA 3SO3B 4GG6F 1K5NA 1CGTA 1L9SA 2OW7A 3S88H 4Y4FB 4MNHB 2IGFL 1AKJA 1EDYA 2WBJB 2VDKL 1ONQB 2EE6A 4OQTL 4M6ML 5M94B 2K78A 2QVTA 1RP8A 3DK2A 4NRXA 5GGRB 1PG7L 5C0GA 3SJVA 1UVQB 1W0YT 3VE0B 4OGXL 1A0QL 5CIPH 2GY5A 3SO3C 4ZSOA 4KMLB 3SPGA 4N2BA 1QI5A 3LEYH 3OB0H 2X1OA 2DWDB 4P0DA 4XN2A 4X7DC 4XX5A 2WBJC 3GTVA 3G08A 4FFVC 3FQ1A 5L7XH 1PZUB 3FUFA 4YL9A 3LRGA 4F57L 5TDNA 5CEXB 3BIBX 3ET9F 3MXVL 2KC0A 2KI6A 4LEXL 2HJFA 1F6LL 3CE1A 3I6GB 2VLKA 1DTUA 4HKXB 4K8RC 5EU4A 2BSCA 2AJXH 5ICUA 2RD0A 4LLVB 5DHDA 2Z0BA 1AC6A 3PFUA 4AYEC 4F2MA 5T3ZE 1OHQA 1QUPA 5BS0B 1NPJA 4DGIL 3FH8A 3KEHA 3L3GB 1WA0X 1S7QB 1E9OA 1V05A 1Z0NA 3HJEA 3WNIA 3QEQA 5IFHL 1G0XA 1UJTA 4CVXB 2XG4B 4AYID 4RWHA 3OAWA 4FTVE 3ZL4H 5D7JB 3EFDH 5A2AA 4W9FC 4QYOB 4P57B 5C09E 1A9EA 4YLCA 5HYFA 4MS8C 4YO0A 2CLZA 4I3SH 3Q2NA 3WKQA 1FL3A 1H19A 4XZUB 2GTQA 1BWWA 1XZWA 2HT3D 2I07A 5D1ZB 4FLSA 2E74C 3UERA 3MODH 3ARBA 3PNWA 5JMRA 4XXCA 1XTMA 3COOA 5IROC 5D7JC 4N2NA 5LBVA 5JHMA 3IDJA 4DP0X 5IUSA 2R1YB 1JHKL 4LE8A 1JF5A 2OAAA 2IO5A 1CS6A 2CWRA 1G6RA 1MNNA 1YY9D 1I4FB 1FNSL 3GSVB 3ULUC 4RAVB 3WFBH 3FT1A 2EDTA 5D7KD 3S35L 1KV7A 4MYPA 3MV8A 4IIZA 3ZTNL 5D1ZC 2HLAB 1Z9NA 5IMKA 4GY4A 2BVTA 4G6JL 5D6DA 3C6EA 5F88A 4PJ7F 3ASOB 3O4OB 4IU2B 1W8EA 2O6CA 1ZANH 3ERXA 4R26L 4NUQA 3WN5A 4ZMAT 1AD9A 4N0CD 4DKEH 4QYAA 5KYUB 1GS8A 3TO4D 2VABB 1N9PA 4KV5E 2H0FA 4IGBD 4BFJA 2JQAA 2NY1D 4LARH 2H0PA 4PJCE 2ZX5A 4HWBA 2PR4L 4I7ZC 5EU6D 5LCVL 2QSVA 1G1CA 4YUEL 3BZEB 3O4OC 4L1SA 3V0AC 4F7TA 1OGAB 4WTQA 1T89C 3TBSA 4DH2A 2IAMB 1OB1B 5LWYL 2M83A 2VN6A 3S6CA 1KPUB 3BD3A 5AZUA 4HS6A 4JFOA 4Z23A 1F00I 1PNCA 2NX5D 3T77A 1G1KA 3T6VA 4L3EA 3IGUA 1YY8B 4KTEL 4ZAKA 2FJFA 5HHME 3PAUA 2V3FA 3G5YB 1Y18B 3X12A 1IM9D 3JV0A 6FABL 1JBJA 2HTKC 1PVHA 4GXVL 3PHQB 1OAXL 4JFXA 3WO3B 4CRPA 5CKAA 1A6AA 2ALAA 2WBKA 1X5IA 2Y22A 1SYVB 1UWGL 2J8UA 4NAMA 4UQ2B 1BD2B 2QHRL 4D7BA 3GC3A 3BYTA 1HYSD 3QYMA 3QHFL 2XNAA 3F04A 3QZMA 1PU0A 4X5RA 3MC0A 3H1ZA 2HTLC 1BZEA 3FUDA 3QO1B 5FGRA 4EPSA 4HEME 3WKYA 1FPTH 2DMKA 3AUVA 3O3BB 1NWPA 3NCJH 5IG7A 3F62A 4E9RA 2CBMA 5CZRA 3U2SA 4GRMA 3E9TA 5E5MA 3WJLC 1TNNA 5CJ5A 3BSZA 5ITBL 1LEIB 3OKEA 5JIIA 1T1XA 5IBUG 1B3JA 4LNRA 4QNPE 1CGVA 3KHOA 1WHOA 3E8UH 3FT3B 5AEAA 4N22A 4J6RL 5LGHH 4RZKA 1OF0A 3TNMA 5E70A 4D3CL 1TZ8A 4N2DA 1FV1A 1XGRB 1MVYA 2Z9TA 2BDNL 3EH2A 5D7HA 5DVKA 5H37G 1J5OH 3L95A 3PDGA 5CZVL 2NNAA 4I1NB 4YHIA 1TTUA 2YEZA 3HC4H 4GRLA 1DDHA 3KWWB 4XNUH 1U91A 1ET8A 2ZOWA 2QV4A 5HJDA 5DK3A 1RIHH 1SFHA 4L4VD 3FOMA 1M9SA 5KAQF 5TH2B 5I0ZA 4OF0A 4YZFE 3EZ8A 2Z7YA 1NBVH 4KU1A 1ZHKA 4MCYA 2Y7QB 1VPOH 5HYSG 1ZA6A 4WFEE 4LVNB 5F2FA 1MF2H 1TEGA 3H7BB 3K2UL 2Y6TE 3SKNA 1JZ3A 3O6LL 3OPZH 3CTTA 5AALA 3L9YA 1RQ5A 4AG4L 2E47A 2ED8A 2FUQA 2HX7A 2J88L 1SBSL 3GO1H 2HZHA 4XPAL 2JTYA 3P3SA 1G7IB 3CVHL 1S9WA 4L9LB 1IFHH 4M3KB 5HGGS 4B27A 3CSBA 5DTFA 1YNTB 2W38A 2H45A 1D7DA 2IBZX 3HG4A 4LVNC 3SYOA 3RA7H 3IDUA 4TLTA 4OTXL 4MNQB 5TFSL 1LMIA 3ETTA 3UBFA 25C8L 4MD0A 5HI3D 3VAEA 2OL3H 2J6WA 3WDJA 2XSKA 4Q2ZA 4CADA 2ZWZA 3MRCA 2FNBA 5FGBC 3ZLQC 4R0LA 4XVSH 1FIGH 1OARH 3I9AA 3LZRA 4TYUA 1T66D 3K8MA 2OMYA 2HRGA 2VLJE 4QGYA 3G5ZB 4E9YA 3W37A 3WJMB 4NQSA 1WK0A 4BA8A 4OT1H 1DQJA 5C0AA 3WFDH 4R7VA 2KL6A 4LKCB 1A1OB 2AQQA 4OZGF 1VGEL 2W9DL 5AVUB 1UJ3B 2J1YA 1H3WM 1WGOA 1WAAA 4TSCL 2BLFA 5DDHA 1NEZA 3PWJB 1XSOA 2AEWA 5DQDL 3US1A 3VGDA 3HTLX 4RAUB 2DWXA 4Y19B 2OZ4H 4PRIE 3GUFA 3DVGB 1I9JL 3LPPA 4LPWA 1W6WA 3WJJC 3HG5A 4YHYB 3Q2LA 1YO4A 2BRQA 2J8HA 4KJQD 4MKTA 1MQ8A 2ESVD 4P99A 5AWNH 1MCPH 4OGQC 1UJ3C 2QL1A 2Y07L 1NCCL 2XACC 2BSSB 4Z76B 4OGYL 2X40A 4RBPH 3PDDA 2TRYA 3VFVA 2WUCL 4F7CA 5CSBA 2E8ZA 1H3XA 2GBVA 3QG6A 4JPSA 1FH5H 1V7MH 1HH9B 4YHYC 3NCYP 4NO0A 2HFTA 3NAAL 5JHDA 5TK2A 2B39A 5IJBC 3GWJA 5B1JA 1RJZA 1EZVX 3NSYA 2NMSA 3L3IB 1JNJA 3WIHA 2WWOA 4IM8A 4TQIA 5C3IA 2R2BA 3GHEL 4YDMA 5ANHA 2GI7A 4K8RL 3HAEH 3BVWA 1VKXB 1DFBL 1PG7W 5CN2A 1MJUL 1GGYA 1SLXA 2JB5H 3B7YA 2PTVA 3ASWA 5TQ0L 1SVZA 1MZZA 2H26A 4TLKA 4F8PA 4DP8X 4KKCD 1T1YB 3I3EA 5BRZB 3P02A 2J6EA 4YDKL 4YVNA 1B4LA 4U1NB 5FYLH 1C5DB 1UM4L 4PP2B 4X6CF 5E00B 3LH2H 1JRHI 5LGYA 1S9VB 4UZSA 3VYPA 1LTXA 3C5ZB 1JE6A 2E27H 4F3FA 3A3YB 2EQDA 3GRBA 2A74B 5ENWA 4G8FA 4DIXA 2EADA 3DETC 3K4DA 3EYUH 4NGHL 4YE4L 3EO1B 1KB5A 5D4HA 1S78D 1N0XH 4QRSA 4WENB 5FV1L 4OFKA 3MACL 3OBAA 4R2GD 3D30A 3BVXA 1HHHB 4DK3A 3C5ZC 4DK6A 1TPXB 2ZUYA 5EFIA 4BSVA 5AB2A 3DV4A 3LNGA 2A74C 2C3XA 9PCYA 3LQAH 3P0YL 5D1XE 2DLFH 1UGNA 4HJJL 3ULUL 1B6UA 5DEJA 1FSKB 1XMEB 2DKUA 4FFZL 2EUVA 1U8CA 4AQ8A 2QR0B 1WCQA 1E5YA 1IBGL 4JKKA 1LNUA 3H2PA 1UOVA 4F91B 3S5LG 4PREB 2MH4A 3IJEB 4Y7OC 1JWUB 1B2WH 1A3LL 5J9PB 1TPXC 4GRWF 5E1GA 3UP6A 3PUUA 1HKLH 1YAZA 4G70B 4KC3B 5CHNB 1ZSHA 4Y5XB 4ZTPL 1TCRA 3EXJA 1TQWA 2F8OA 2A6DA 3NBNA 2APTA 1BDYA 4PJDA 3SDYL 4GKZB 4W9JC 3TEZA 3SDDB 3MFFB 3ZTCC 3QUZB 5AVWB 2DYRB 1BOYA 1IGFL 1JG9A 4HCGA 2NY3B 3QDMB 4UTCA 1YMME 4XP5L 4IOFD 5E1HB 4Y5XC 1OPGH 2BWDA 1S7UA 4P06A 4F9LA 1BM3L 2V2XA 4XHQA 1U8JA 1UURA 3RUGB 4TUOA 3P73B 1D6VH 3ZDYE 3VI4F 1JZFA 2YPKB 1FFQA 2GJ6D 2D3VA 3VXMA 1RERA 3MRRB 3SDDC 1CCZA 4N5ED 3SGDH 1LO2H 3NFSH 4ONOA 4A7SA 1KG0A 2IOIA 4Y9BA 5AW9B 3NEXA 4MASA 5EZJA 5KS9B 2F0CA 2NY3C 3ATEA 3KR3H 5JIQA 4NJ9H 4NUJB 4XI5D 5DLMH 4ELME 1K5WA 3G9VA 3B3BA 4ZUSA 3T8XB 2LLLA 5D2NE 4Z7UA 1P84J 2DQDH 5GRJH 2VSCA 3C08H 5HYQB 2VDOH 1KTLA 2W95A 5E4EB 1EXHA 4X83A 3N06B 4PY7A 5JW5B 2AK1L 3VFNA 1ETB1 1LMKA 3P11H 1J9SA 5EZPA 2BC4A 1D5IH 1TEFA 3ZHLA 2QZ5A 3WLWD 2XG5A 2O6PA 5BQDA 5DD3H 3SYCA 4PYGA 4OFQA 5CZKA 2HLEB 3K6OA 4NWUH 5E4EC 2IANB 1CFVL 3VGEA 4Y1SA 4WFGE 2K1MA 1MRFH 3LX9A 2VISA 2XV2A 1PKQA 3DO3A 3C6SA 4FQHA 4G6KH 1OVZA 4H1LH 2QBWA 1N26A 2YIHA 4G8GB 1X3DA 4O02H 3CFKA 1BX2A 2GSMB 5BVPH 2GTWB 3IDIA 3NIGF 4LBEA 2D0HA 5FB8B 3B2DC 3O3EA 2EIDA 1BZ9B 2BH0A 1KYFA 1N3NA 3CFIC 1RHHA 2FWOA 5G4OA 3VXNB 4DP2X 1FNGB 2NSQA 4NNXB 3SE4A 3JWDC 3PG2A 1F58H 1FUNA 2ATAA 5FECB 2DL2A 3MV9B 3Q8BA 5H4ZA 5CJOL 1CDGA 2J2ZB 5KVEL 1SMOA 5CEZH 3NJFA 3WE1A 1J8HE 4Z78A 1AP2B 3IMRA 4QHKJ 3IJYB 4DF9A 1FYTE 1SN5A 5BW7C 1HSAA 2GEQA 5I66A 2NYKA 4PJ8D 1IM3D 3U6XS 1ZS8B 2YD2A 2VDQH 4N1EA 4Y1AD 1RFDL 2M1KA 4PRHB 4G8AC 3VCLB 4M62L 5I76B 1OOWA 5F6IC 5IVZA 1HHKB 2CRYA 1JIBA 2MNWA 3IMVA 3LN4A 4IOIA 1MCQA 4OD1L 2IGFH 5FV2A 1WF5A 1O7DC 3BGFC 4U1KB 2Z91B 3DOSB 2VDKH 1HOCA 1CGWA 1SN2A 4OQTH 4M6MH 3K7UA 3KJ4B 5DSCA 1UKSA 3AU1A 1PG7H 1N59B 1OALA 4TNGA 2FR4A 1S7RA 3D4ZA 3FZUC 2J73A 4OGXH 5G5DB 1A0QH 1PZCA 3PXHA 4GUCA 4LASL 4PJHB 4O2FA 4FQJL 1U4FA 3TNNA 4YHLL 2EO7A 1B4RA 3QUYC 4YEEA 5FKAB 4XE5B 3DUSB 4MNGA 3KJ4C 1HL4A 4F57H 4UCFA 1QBLL 3REVB 4Y1TA 4URKA 2CHDA 3MCYA 3MREB 3DWTA 3MXVH 3NJLA 4HA1A 4LEXH 4NDMB 2CJ3A 5SWSE 2XX0A 4Q0XL 5DK0A 1HVXA 4DGIH 2DKSA 2CCVA 3IXAB 1FN4A 4I9XA 3ARDC 1D5MA 4RSYA 3UEZA 5LGJB 5IFHH 4L3CB 3HBPA 4XVUD 1CDBA 3SPJA 5D5MA 3STBA 1RKRA 3IDMB 2BX5A 4OCSL 2ROXA 1AZBA 4PS4L 2OR9L 5J11B 2CUIA 2Q8AL 1VHPA 3QDGB 4PJGA 4PMFA 3Q5OA 3V8OA 1FNAA 5DC9B 2VLLA 1M1SA 2QLYA 5T5FA 4DVBA 3E80A 5K39B 1BQ5A 2PYEB 3KCPB 3O3AA 2J5WA 3EBIA 1S8DB 1QPKA 3MGTA 5E2WL 2HH0L 5F7AA 3ECQA 1PX8A 2DQUH 3G04A 4PEEA 2K7QA 3TGXA 3OSKA 3IS1X 4M4PA 4MXQD 1JHKH 4N8PA 5J11C 4IMLB 2WYHA 2JCWA 4U1GB 4QRTA 1FNSH 3UTZB 1ODAA 2P1YA 3N04A 3S35H 2KS0A 3T3PF 3V0VB 3CX5J 3ZTNH 4XO9A 5HJ3B 1JOIA 4XAWL 3HE6D 2Q76B 4V1DE 3GUTA 5JIHA 2A9DA 2VDRB 2E7CA 3AXLA 4G6JH 4KRNA 2YOAA 2NSXA 3PJLA 1G9EA 1FVEB 1IBFA 1ZCRA 3TBBA 3FN0L 3O6FB 2OCCB 4ZXBC 2FT8A 4KRPB 2D3JA 4R26H 4RA3A 5I6LA 3WUZA 3AMLA 3QNYA 4UBDC 4U1GC 2Q87A 2D7OA 4MMZA 1MY5A 1G1YA 4PGZA 5C0EB 3ZE1B 3T9WA 5AB0A 3VXPA 3DGGB 3K5RA 4J28A 4P2OB 3FL7A 4IBQA 5DA4A 3WDHA 1RZJC 4XX1E 2PR4H 1MFMA 3FW6A 3GBLA 4HIQA 4IKNA 4GW1B 5E9DE 5LCVH 4DKDC 2DLIA 3HKFA 1DUZB 4YUEH 3F7VB 2BNUA 5EDXA 3O6FC 4GSRA 5C9KA 3H9HB 4KRPC 2GUOB 3U4BL 2WGNB 5LWYH 2SEBB 1R5IB 1IGYA 1IZKA 4KDTC 2EZ0C 2I27N 5LUMA 3CFBB 4A7QA 1GA2A 3M1BA 1B9ZA 4MCNA 4N2LA 4KTEH 2E9BA 3S4SB 1Q9OA 2FLBT 3EJUA 2YA1A 3I75A 6FABH 4PJIA 4HLZG 2LFEA 3LKRA 3T8VA 4GXVH 3ZZLA 4TSAL 1OAXH 4X8CA 2CLRA 1CFTB 2JVUA 43C9A 2NR6A 3OKOB 2CBTA 2AQNA 4JANB 4JQIA 4TULL 1UWGH 1HWWA 3JUYA 1BREA 3FOLB 3A5VA 3CFMA 2B16A 2QHRH 2Z7WA 3EJZD 3M7OA 2F53A 2QEJA 1MCNA 1KIQA 2ZWSA 3DX6A 3QHFH 1R3IL 4MDIA 2E6PA 3RZCC 2VN7A 4FXLA 4XBPA 5HYJD 1R19A 2ZZUT 2VDLL 5B1AB 3VXTB 3HLKA 4TVSa 1DQMH 4Y4HC 1LE5A 1AG0A 5SX4I 1P5UA 4HK0B 5ITBH 1EAOA 1L9TA 5IFAL 5E7BA 1CU4L 1ASOA 3GTNA 1M7IB 4ZFOA 4J6RH 5B38G 4ZQKA 4FQCL 4D3CH 4W9HC 1U2CA 1ET7A 4P5KB 4JHZA 4WNJA 1Z5LB 2R0ZL 1OW0C 2ZCHL 2MWCA 3BUDA 4A6YA 5E8EB 1CICA 1CZ8L 1N67A 4CU8A 2EIBA 2B9BA 1L6PA 2X70A 4NQTA 2BVPB 4WRLA 4G2AA 5A3IC 1P2CB 3ZE2F 1UT1A 1FBIL 2Q20A 2X1XR 3SPHA 4L29A 3SKUD 2B3IA 1KGIA 4TL4A 5JHLA 3B3IB 4R9HA 2VZVA 3DBSA 2OMVA 4MS6A 5C0JA 1OE1A 3GJFB 2P5PA 4G6AD 3DVNA 1QA9B 4KXDA 2AHIA 1YMHA 3K2UH 2WY3B 4OV6F 5JOFA 5EORL 3O6LH 4GS7C 1FZMB 3ARGB 3RHWF 4AG4H 1UB6A 3NFNB 5IM7B 2J88H 1SBSH 5JDJA 2DMBA 4WV1B 1E40A 3ARWA 4U6HB 5F7NC 3WNMA 3CVHH 1QMUA 4IBLT 4KV5F 2EUXA 1KF9B 3BIKA 5GGVL 2ATKB 5HPMA 3FUMA 4PJ5A 4OTXH 1B9KA 4KROC 4PJCF 3FONB 4BQ8A 5TFSH 4OKDA 5AVRB 2JI1A 25C8H 5CSZB 3KAAA 3LV3A 1HU8A 3EHBD 3TBYB 1N10A 2ED7A 4NHUB 2DS4A 1FO0B 1K85A 4WV1C 4EDXA 3QNZA 4QHLA 1ZTMA 4RMUA 4JDVA 3PWVA 1T2XA 2OQJA 3QC6X 3RVWC 3L4UA 1OAKL 5FKPA 5I1AA 1K3ZA 2X4OA 2WWMD 1YSOA 3KM1A 5CN3A 1OCCB 2Q6WA 5FO8B 3JWDL 4HWNA 2V7HA 4NKMB 4S1QL 5F3FA 2UZYA 5ISZB 1SY6L 4E41E 4AI7A 2DM7A 4KQ4L 3AREA 2P7TB 1HXYA 3O41A 1IQDB 1JXGA 1VGEH 1LP9A 1XO8A 1ZIBA 2J5LB 1UCTA 2W9DH 4XP9L 5DK2A 3N1QC 4ES8A 1K9TA 1XBRA 4R7NB 4M6NL 4TSCH 5D7IB 2EEBA 2HKHL 4FERA 4P3WA 2YOCA 4MQSB 5DQDH 3CFEA 2VXQL 4YDJB 5GSVB 5DD6B 1FCCA 1L9NA 2W0PA 1I9JH 5T1MA 3I6LD 5DYOB 4Y5VA 4B9IA 3CBJB 1KBBA 3HZMB 4O2CB 1KPVA 2YD6A 5K1JA 4PVNA 2BNQB 2D31A 1YN7B 4IEFA 3TBTB 1NCJA 2Y07H 4QNPF 1NCCH 2PXYD 3DYPA 4XCCL 4OGYH 1U8IB 2YMXL 5ACZA 3V8CA 2WUCH 1U21A 3CSYA 4Z7QB 5A2KH 1RIVL 3NDZE 4JLRA 3MYJA 2NW2A 3BWAB 3UCRA 3GSRA 4I48A 5FDWB 1A22B 1MI5A 4FQ1L 4GG6B 3NAAH 1E28A 1N8ZA 2W0FB 5E94A 4QUOA 1C7SA 2YUZA 4HIJA 1CDYA 2IPUG 2FHFA 1KYOJ 2APWA 1OM9A 2P49B 3RWEB 1XT5A 3QQ4A 3FC8A 3GHEH 4L1HA 4L9DA 1IBBA 1MKFA 2YPLA 4K8RH 4QKTA 1QBAA 1DFBH 1QEWB 3E3QC 3GHBL 4MDRA 4EI6A 2V8MA 4K5OA 1MJUH 4KKBD 4YR6A 4L8CA 4G8IA 2UY7A 4YZFF 4F33B 1EFXA 2IWKA 4RVBA 4BFIB 1OCZB 4J7RA 5TQ0H 4WNQB 1LK3L 2OTWA 5C3LD 4UT6A 5DT1L 1KV3A 4UTBL 3FSVA 5FYLE 4AMWA 1NLDL 4JO8A 4YDKH 2HA1A 4ESKA 1A4JB 1UM4H 2E5EA 3IFPB 4LVHB 4N86A 2FDBP 4JFQA 4JPIA 2P44B 4ODHL 5D7EA 1WD9A 4OLEA 2N0KA 1QSED 1MJJA 5KYYB 3MA7B 1QAWA 2Q1EA 3F05A 4KNSA 1ZVHA 4ZS6D 1J7VR 3IWUA 4P9HC 4JFPB 5E6IB 3TYFB 4C59B 1OCWL 1I1FA 3QHTC 2AK4D 4NGHH 3VFRA 4YE4H 5L9DL 4X5WA 5LAPA 2RJMA 5SWZE 2J12B 3MRHA 4NFBA 5IEKA 3K71A 2WXOA 3BQUC 5D9SA 3DA0A 5FM5M 3MACH 3WHE0 1XF4A 4ZBJA 4LVHC 2F54B 2CMRL 1OAJA 1QQDA 4BM7A 2EAEA 1OT4A 3P9LA 3P0YH 4LDCA 3MLPA 4HJJH 5FYKD 3ULUH 1EO7A 1ETZA 1G9HA 4U0RB 3WS6A 4FFZH 3HE7B 2V9TA 2Y5TA 2AXWA 3ZT5A 2X2YA 1IBGH 2FT7A 2JIXA 1YRKA 1GZQA 4H26B 1NIBA 3S37L 4FI7A 1NBYB 2ZSWB 1A3LH 3V95A 1NDTA 5EBWA 2Y06L 2FATL 3I74A 4QRPA 5GHWL 2YAMA 1KNOB 1QSFD 4U0RC 5L8LB 1FL6B 2G3ZA 1ZHNB 3QCTL 3MRQA 4ZTPH 2QKIB 3L5HA 1RZJL 3SDYH 5KW9L 4RISH 4CJ0A 3NSDA 2VDRL 5HVGB 1DZBA 3CJJA 4XPHL 1WGVA 5BZWB 2YAHA 3KXFE 5C3TA 1IGFH 5C0DA 1X5HA 1U8MB 4FCHA 4XP5H 5JPMA 1E43A 1R5VB 1YPZE 3IN2A 4Q6IB 3GMMB 4RGMB 3VXUB 1BM3H 3IDYB 2QKIC 1FNEA 5C6PB 1C1EL 1LEKA 1NCTA 4LLDB 1M71A 1X5FA 4FNLL 4GINA 3BZ4B 5HHPA 1JV2B 1NFIB 5JYLA 5CSGA 2C7UB 1XGQB 5DRZB 5JZ7C 5GS1A 4KUCD 2GHZA 3AU0A 2CHNA 2FH6A 2R15A 5BXFA 1KFGA 5INCA 5JMOC 4X99B 1AXSB 4XCFL 1XGZA 3BN9D 4RGMC 4PGJA 4IHOA 43CAB 3C2AL 4HJEA 3O9WA 5IMLB 1MCJA 3MRNA 5F8RC 4GP8B 4OM1L 4L2YA 2H32A 1YHPA 3WUWA 4I3GA 4PRNB 2GSGA 2VM4A 1MCBA 2YXFA 2AP2A 4X6FA 4B9FA 2XWJA 3LN9A 1WFOA 1CXKA 1O9ZA 4Q4IA 3WTYA 4HAKA 4ZW6A 5MI0B 2CUAA 4R7XA 3L3KB 4F8QA 2AK1H 4IRSB 5AAMA 3P3YA 3V2AR 5IJKC 1EEYA 1ZLEA 3O8XD 3S96A 2GFBA 4WWNA 4ZFQA 1NFAA 4OD2A 3VI3A 4YJZL 1TJMA 1MLCB 4FXKB 4AZUA 3OR6A 5E8NB 5D2LA 3CX2A 3LPFA 1CFVH 5T8IA 3T0VA 1P1ZB 1L0PA 2P8MB 5MI0C 2D7TL 3FQ4A 4UV4L 2J55A 2VN4A 3EFOA 3GEFA 4IRSC 1NCHA 2P5WE 4NC1C 5EU3A 4JGJA 5H8DA 3GMPB 4FADA 4BV1A 1EIBA 1EQWA 5E2VL 5K9KA 4AYDC 4QRRD 2NYYC 3D3VD 2MFNA 3FRPB 4TUJA 3NZHH 4FXKC 1IEBB 4LKXB 1O9VA 5KSAD 4HG4K 1DR9A 3VWJC 3FTGB 4ZMXA 3QO0A 4ZJ9A 1ED3A 4X4MA 5CJOH 1U8KA 1EO8L 3MNWA 3MRPA 2E6QA 4PRPB 5CEZE 5KVEH 3DX9A 2XWTA 2XPGA 4LP8A 2DJSA 4F15B 4HEPA 3HG1E 4AH2A 3Q5YA 1YUHA 1BMGA 4KKAC 5H2BA 1XCQB 1BLNA 3NIDF 2DMCA 1RFDH 3F7YB 1AO7D 2VW6A 2XJLA 5HGDB 1EJ8A 1KYDA 4M62H 1T7WA 4O5LH 2PKDA 4OD1H 5EO0A 1QHQA 5HDQL 3LZFL 4LHQB 4JO2H 3PHAA 2QSCL 3FJTA 3GSWB 1CYGA 1JYWA 4N6RA 1M2VA 3IETB 1U8NA 3RPIA 1WCBB 3D39A 2JTDA 3MBWB 4LASH 2H6OA 3NGBB 2DIEA 4PRDA 4NZUL 5GGTA 4LLUA 2UY6B 4FQJH 3SGJC 4MBRA 3KS0H 1NGYB 4NNYA 3FFCE 4NPYA 1AZUA 5KYXA 5D1QD 4YHLH 4LLQA 1T0MB 3OX8A 1LGVA 2YQGA 3CWGA 3U46A 3ZRSA 3LIZA 5DHYB 3RIKA 3FO1B 1IBDA 4LP4A 5JPNB 4R5VA 2LTQB 3LKNB 1QBLH 3RIAF 4UOZA 4R4NC 4H2CA 4QOKB 4NQDA 1G5GA 1WJ3A 1X6LA 3ETBF 1TNMA 4HBCL 1BZ7B 3NOIA 3QDJE 3NGBC 3EFFA 4UQ3A 5J7CC 4GG6A 3E6FA 3H9SD 4ELMF 5DFAA 1C8QA 3HHMA 4Q0XH 4EN2A 1H3PL 4OB5H 1HI6A 2NXZD 3MRMB 4L4TA 4OUUB 2HXAA 5GZOD 4ZFZB 2QGEA 3F7PC 3CLFL 3HW7A 4WHCA 3ZQXA 4WTZG 4EN3B 5JPNC 4NM8L 1RL1A 2IDCA 3UJIH 3UTTB 2EH7L 5B8CC 1CD1A 3PV6A 4OCSH 1BZQK 3KPRE 3QJFB 3SPCA 3QPKA 4PS4H 1M2OA 2OR9H 5HYSB 2Q8AH 4QJ3B 1OSPL 1OP3H 1QLEB 1TVDA 3MROA 2JKNA 3DJZA 2X4SA 1NH6A 2ED6A 3OG6B 5C07D 1D5RA 3WY3A 4NB7A 1CE1L 1NPUA 4DPCX 3OXRB 4JQVA 5E2WH 5IVXA 2HH0H 4EN3C 2X41A 5DJ0A 4KK9D 5CD3B 4XXWC 3W5MA 4RH4A 1W0VB 4XPBL 1A6WL 5EUOE 4QXTA 3ES6B 3K6NA 5IW6B 4AQOA 5EEWA 4OJYA 2PP7A 1MCIA 3B2PA 5BO1L 1OP5H 2EDQA 3QG7L 5F6HI 5CCGE 1BBDL 1MELA 1RUQL 4PJBF 3WYRA 2OMUB 3IJ8A 3QDAA 4XAWH 1LJMA 3UTQA 5IY5B 1SJEB 5C0ND 5D8JL 3FN0H 2HFGL 2CK2A 1UC6A 3KBPA 1MWAL 4P2RB 4GI8A 4ATWA 1UA6L 1M05A 1TTRA 3P69A 2KZBA 1LLAA 2IVFC 4PWEA 1ERNA 5FW7A 1R3HB 2HP4A 3CDGB 4JFED 1PY9A 5F0PB 2VGLM 4X9YA 1UZ6E 2O5ZL 3VDCA 4KXZI 3T0ED 2IPUK 2ZUTA 1Q9LA 5DJ6B 3WV0A 2CDEA 3U9WA 1Q1JL 3HZVB 5ICYB 5I8EB 1BVKB 2XXFA 3U4BH 4IMKC 1AQMA 4XCYA 1MJ8L 2WLIA 4PTUB 4JRYE 3K6IA 1X4ZA 5DQJA 2WTRB 4AQEA 1PTZA 4APXA 2X5PA 3TCXA 4OJAA 4F1SA 3VXOA 3MGAA 4G59C 2A9AA 1YECL 2NY2D 3OKKA 2GK0B 2EVGA 5HHQA 5AW2B 4PY8J 1Q72L 4OLXL 4LSQL 4ZX6A 1FLRL 2BERA 1DBJL 4PJ7A 4TSAH 1YEKL 3N44F 3JT0A 1AHMA 5HY9A 1JCKA 1YG9A 4L4JA 4TULH 3UZEC 1NCDL 2IWEA 4B9GA 5EO9B 4AENA 3V6FA 1MG2C 2X4PB 2XN9A 4AT6B 3QXWA 3HN5A 5LNDA 1DE4A 1HINL 1BA9A 2HRLA 4WCYL 1R3IH 4F7PB 3DX8A 3AG2B 3HS0A 5K9JL 3BH9A 3GMOB 3KL5A 5E5UB 3T4AB 2AQ2A 2VDLH 3PAZA 3NRFA 2WWKT 2QDVA 4S1RL 4AYGA 4U1SB 5IQOA 3LRSA 4JRXB 4EXPX 3MRIB 5IFAH 3FU0A 1CU4H 1A4BA 1WSST 3TO4B 2L0DA 3O0LA 3L5IA 3WFEL 1YY9C 3I02A 1L4IA 4FQCH 1IX2A 5AD0A 3T4AC 1BXVA 2GITA 3HHSB 3KNBA 1ZWIB 3HVDA 1UYWL 4Z7IA 2R0ZH 2ZCHH 5FUZL 1CL7L 5EU6B 5FC9A 2WLJA 1AJ7L 3QFJE 1CZ8H 3PWPE 4X4XB 1CQYA 3PY9A 2BVOB 5HDOA 4JB9L 4N0CC 1UENA 1NC4B 3WN6A 3TO4C 5C0CA 5DUPL 1OV8A 3DDGA 4UIMA 5B39A 1FBIH 2YGVA 1WA2X 5J06A 4JKNA 2NY1C 2E7HA 3HN8A 4KFMA 4YDZA 4UQCA 3KYAA 4X7TA 5I75B 3KL0A 1KBWA 2OCJA 2P24A 3KPTA 5HGAA 5IR1A 1GTNA 5IKCB 1I7UB 4JFFD 5GZNC 4FFYL 4U7MA 3KPNA 5EORH 2O4EA 1WWBX 3N0AA 2E75C 2ETWA 3ECVA 4N26A 2FZ3B 4OCMC 4OZHE 4BUGA 2XKUA 3WNLA 3OF6A 3QCUL 5B1BB 4FQXB 2I9TA 2FWSA 3FAWA 2DY2A 3T08A 1I1YA 5I75C 1QTPA 2J71A 1J05B 3NTCL 4OU3A 2P5ED 4MJ5B 5GGVH 2BINA 3ZE0B 3G6JB 4EUPB 3S5LB 3EDKA 4PWIA 2COQA 5JXEA 1M7DA 1YZZA 1KIRA 2TAAA 3DSNA 1D7FA 3BAEL 3U1SL 5KBKA 3SKOA 3V0HA 3NN8A 3MLVL 2O5NA 1HH6A 5E5RB 5L2KA 2GBAA 2O1AA 3TP4A 3HMWL 4XRCA 2F08A 3L1EA 1WIPA 1X7TA 4PU2A 5GISL 4JFDD 4ELKA 4TNVK 1OAKH 1TQSA 3ISYA 5J6HA 1UFUA 1OT2A 4ZOAA 5C0GB 3QR1A 2D9CA 3JWDH 5EOCL 4S1QH 3OAYK 3TXAA 1BYOA 1SXNA 1SY6H 2W0KA 4BUQA 4X4YA 3P9MB 4KQ4H 5MENA 1B4JL 4M7JL 1NFDE 5CUSL 1FP5A 3MRGA 2E7LC 5EU5A 1A7BA 1JWSA 3EJSA 3G08B 3QPXL 1UWFA 1PFCA 4XN7A 4XP9H 3C87A 5KOMC 2E6JA 4M00A 3NPZB 2B8OT 2WKLA 4Z3TA 1S9XA 4M6NH 5DVOA 3VXRE 4MD5A 2HKHH 4CNIA 5TDNB 1S7VA 4W68A 1VIWA 1CGUA 2Z8WC 3L9RA 4JHBA 2VXQH 1TO4A 3RJOA 1JDAA 5EU4B 4A7GA 3V6ZA 2VSKB 2WPGA 1IQWL 5ICZA 1DP0A 1QX1A 2BCKA 3CZNA 2NYZA 1E9OB 4ABUA 3EJYD 5CP7A 2F19L 3CPUA 5HVHB 4U1HA 4HLJA 4XCCH 4H8WC 2YMXH 1U8LB 1CLZL 1RIVH 1OD9A 5C0BA 3QJHB 1EBPA 3EGXA 4R5TA 2CLZB 4FQ1H 2C1OA 1JVKA 1FL3B 3WS3A 4BH8A 1GMEA 4NKOA 1MUJB 3QP3A 1J8KA 2VWEC 2EIMB 4OZGA 1AGDA 5LO7A 1JTPA 2I07B 1OM3L 4UUJA 5KZCD 5HVHC 1PJ9A 1ASQA 4HDIB 4JDZA 4XMZA 3GHBH 3WUWG 2OULB 2ARJA 1SJHA 3KLSA 4U2YA 3IDJB 2X05A 1P5VA 5I73B 2CXGA 2DM2A 1LK3H 2O5XL 5DT1H 2Y3AA 3DROB 4UTBH 5F89A 4GXFA 4IRJD 1KWKA 5IMKB 1J9RA 2XBZA 4ODHH 1IVLA 4FMVA 2HLFD 1T66C 4X6BA 3BSHA 3OMZA 3N1GC 3L3JA 1B3IA 4LHUD 5BS0E 4IKIA 2OK0L 1AD9B 1IB5A 4LLAA 5I73C 1UM6L 1OCWH 3Q6GL 4JREC 3GPEA 1MG3C 4GBXA 5L9DH 2C34A 2O6DA 2VR7A 1WBYB 2CO4A 2EDWA 2ADYA 2PYFB 2MMXA 3T1FB 3LQMA 2CMRH 4PRBA 4JQXA 2EDRA 2V9RA 5AAWA 3ULUE 1E3FA 2VLRA 1XGYL 3GRWA 3DHUA 2W92A 4DP5X 5BPPA 1Z2KA 5CLZA 5FFLA 1PLBA 4JFOB 1JNHB 4B0MM 4L3EB 4ZAKB 1T5WA 4KJQC 5EULV 3S37H 3X12B 4B3EA 3QZWA 3CN1A 5SWQA 5GHWH 2FATH 4JFXB 3TH4T 1A6AB 2NUTB 3CHQA 1Q90A 4HCRL 1ACCA 1Z9MA 1RZJH 4HK3J 4IU3B 5KW9H 2VZ1A 4KWUA 2VDRH 3V0JA 2H1PL 3ABZA 2XNAB 4H44C 4ZAKC 4XPHH 3N43F 4RRPA 3ALPA 3UDWC 4BXSV 4CGUB 4WO4A 2R27A 5MEOA 3NCEB 2MPVA 2IH1B 1FHGA 4PN6A 5D7LE 1MCWM 2ZUWA 4RMVA 5IG7B 3T4YB 3TA3B 4PJAB 1NEUA 4HJ0D 2YGNA 1N5AA 4XGZA 3OKEB 1GYWA 5T1LD 4LNRB 2A4ZA 1C1EH 4NIKB 4LVEA 5EBGA 4FNLH 2X87A 1ZMYA 1OGAE 4I89A 3OHXB 4KKCC 4P4KD 3L4XA 3SYQA 3TNMB 4J4PA 4QO1A 4WZ9A 1FV1B 1TOXA 2AV7A 3T6XA 4KJYA 4BCZA 5LLIC 1NQBA 4LSDA 3L95B 3TA3C 4N90E 1IE4A 2CPCA 4YHIB 3CXHK 1L6ZA 4QXVA 4XCFH 2FD6L 1DDHB 2WOBA 2WNWA 1QHPA 3U6RA 5KBNC 3C2AH 3NJNA 5CGTA 1DJZA 3G3LA 3B5TA 4OM1H 1A4KA 5L4FA 2E9IA 2D4FA 3U79A 3FOMB 4Y2OA 1FWXA 3MDJA 3OHXC 3QUKB 4L8BA 3RY6C 1S78C 4C56A 2XV6B 1LWRA 4MCYB 4GO8A 4LOFA 4R2GC 1ZA6B 2R83A 5TF1L 5KJ7E 4RGNB 3ARPA 5I17A 1IFGA 4WU7B 3H9YA 1P6AB 2KLRA 3CHPA 3SKNB 5F71A 2V17L 2LVCA 4DAGH 3D2UD 4G71B 1TITA 2B1AL 4QTIL 1U41A 3BZFA 2XTJB 3QFGA 3VI4A 2ZG1A 4G72B 5IFJA 1FZJB 3DUUA 5FDYA 2A4CA 2X6UA 5KSVA 2CRMA 1S9WB 1XQ4A 5DTFB 2D7TH 4UV4H 4OLWL 3UBXA 4MQXD 1K2DA 5IHZA 3MBXL 4RGNC 1I1CA 1RZGA 2EYTA 2HRPL 1A8ZA 5E2VH 4QTHA 3EYOA 2F7PA 4CADB 1DCEA 5E0FA 1BJ1H 2EYRA 3HZKA 3BVNA 4LMQE 3RWFA 3P77B 4ETQA 3VGBA 3W0WE 4LGSB 1OAQL 3QRGL 4KPHL 2FEEI 2B08A 4EI5A 4OM0L 1A1MA 2MSPA 2OMYB 4KI5C 2CALA 4S1DD 5I0DA 3FTZA 5KVEE 2ZSVA 1EO8H 3Q05A 4PV9B 2CIIB 5IREA 4YHNA 3QWRD 3V6OA 3TWCL 4NQSB 1TKWA 4IOFC 3EYVA 3OLGA 2RMNA 3MUGA 1DQJB 2ZWNA 2FIKA 1RK1A 3BGMA 3KPSD 2CKBA 4FG2A 4CKVX 2GJJA 5IOPA 4GSXA 3SSGA 5D7IF 3BD4A 1PX3A 3C8KA 3MKGA 3GJFH 5EBMB 3IDNA 4AGMA 1E4KA 3ALXA 5HDQH 1JJUA 2APXA 3LZFH 1HQRB 1GZPB 1YLBB 3WBDA 2ILLA 2QSCH 4N5EC 1NEZB 1AMYA 3H9ZA 4WI0A 2IMMA 1YVLA 1X7QA 4HWUA 4UB0L 4ZMYA 4DO4A 1GYVA 2FQFA 5DJAA 4X50A 2JCCB 4WJKB 4UM9A 3STLA 1XCXA 2UWEF 3PNRB 4N0RA 5DURD 2LU7A 1T22A 3OAUL 3GSXA 4NZUH 1QFHA 1E4XI 3QAQA 4OZ4A 4AM0B 4P5TA 2W60B 4FS0A 3WNPA 2CLVA 4H0IA 1EO5A 2AAVA 4MNQE 1N68A 1ACYL 4B9YA 2ARWA 3RILA 5IHBA 1W0WA 1NFKA 3T3MF 3E2HC 5KUMA 4GSUA 1BV8A 1SLWA 1E5CA 4LNVA 3QEUA 2AQPA 3GSUA 1MHHA 4NO0B 4HBCH 5JHDB 5CGYD 4PBVC 1ZXKA 4UI2A 2EDJA 5GGUA 3L7EB 5FGSA 3K1DA 5I2IB 3IE9A 1D5BB 1H3PH 3VFTA 4I1PA 1CG9A 1URZA 2R2BB 4JFSA 4LHUG 3VM5A 3FH7A 4U3XA 1JZHA 5JIKA 5KYWA 1BYPA 3CLFH 3EO0B 4NM8H 4P07A 5FO2A 1MIML 2EH7H 1T20A 2H26B 5EV7A 2GT9A 3IMSA 1IAMA 3DBXA 1E2WA 4HT1L 4HKZA 1AS6A 4OCYL 4CU6A 1QLFA 1COBA 1JPFB 1XBDA 4P23D 3R4RA 4Y1AB 5EIIG 3TT1L 1X9LA 4BZYA 3D8MA 2YAOA 5EH1A 1CE1H 2H6PA 3ZDXB 4F3FB 4XWGL 4G8FB 1QNIA 3MUZ1 5ENWB 4RNRA 2CHWA 4W9IC 4OZFH 1A6WH 2DTSA 2P45B 1KB5B 2GEEA 3FKUS 2DQIL 2FL5A 4Z1PA 2YWZA 5BO1H 3OMAB 4RX4D 3QG7H 1RPUA 2DIBA 3DC0A 1BBDH 1RUQH 1AOHA 1CXEA 5EFIB 3V0FA 3IVKB 1UOLA 3Q2VA 4UM8A 5DJDB 4BSVB 3DV4B 5JQIB 3U0PA 3CC5A 3MGOA 4JPVL 3S34L 4M1DL 4HHGA 2XQ0A 4Q58C 5D8JH 3VACA 2HFGH 3RBSA 4PJEB 1U8CB 1MWAH 3RL1A 4KK5D 5AKTA 1UA6H 2VMJA 2HPOA 1LNUB 2NNRA 3K4ZA 5JOPD 3B9AA 2VW7A 4R83A 5C0FA 3D52A 3L3DA 5B3JF 1R1CA 3FSZA 3H3PL 1RSYA 4HUWA 2O5ZH 3KPMA 1DVFA 1HOEA 5BRZE 1P4IL 2VM9A 1K8IA 2ITCA 1Q1JH 5KAQG 1TCRB 4V33A 4JZNA 4FA6A 3QJXA 3D87B 1RD6A 1Z3RA 1UASA 2A6DB 2XVLA 3VD5A 5H94A 1U9KA 3R06B 3V55A 1MJ8H 3OPUA 5FHBL 1VZGA 2HRHA 1JGEA 1JF1B 1FLTX 1GKOA 1JL8A 2VKXA 4FAAB 3S2CA 4N2MA 4NT6B 2MHAB 4WFFE 4BQBA 4LEEA 1YECH 1BPVA 1ID5I 3L3OA 1SBBA 2J43A 2BSRA 1Q72H 1W6LA 4OLXH 4LSQH 5DHVA 1FLRH 1S7UB 1DBJH 3FU3A 3PGFL 5C08A 1YEKH 2V2XB 1NC2D 1BFOA 1U8JB 4HJTA 1NCDH 2XKSA 5F1IA 3ISRA 4UMSA 5DMKA 2PETA 3VXMB 1QWNA 4NQCD 1HINH 1KG0B 4WUUD 3BGAA 4WCYH 3RGVD 3BO8A 3HIZA 1UT9A 2YFOA 4QD2E 3GLAA 1VADA 5GGVY 3UG5A 5MHSE 4G5AA 1ZHBB 4E9QA 3HR5A 4F9LC 4D8PA 4S1RH 4H5SA 4UNVA 1ASPA 1JAEA 3HC0B 3S7GA 3MMEA 3QWOA 4JKPL 1ZLWK 4MAYA 3U7WL 4KVNL 1KTLB 3DVFA 3WFEH 1Q9WA 1XF3B 4O9HL 4PFEA 4EJ1C 1WTGT 2WO4A 1U33A 4OZIF 4PY7B 4K15A 1XHHA 4C57C 3VFNB 2XU9A 4BWUA 1JZGA 1UYWH 4PP1D 1BQHG 4Y16A 3PLYA 1SXZA 1CL7H 2EEXA 1AJ7H 4Z0BL 2V2WA 3EOAB 5JR1L 3OM3B 4N2KA 1RJCA 3LPGA 1HQ4A 4JB9H 3QDME 4X6EA 4NNPL 2EIZA 1CLVA 5HVFB 5DUPH 1SVCP 3OG4B 3ZDZE 2LOEA 4PG2C 1PKQB 3L6FA 1B2YA 3LN5A 2ICES 1W91A 5DA0B 2VO5A 3CFKB 3G5VA 1BX2B 3MZTA 3CHXA 3IDIB 4LBEB 1KLFB 1NUGA 4FFYH 2GJPA 2H0EA 3V10A 1N3NB 3P3RA 2FWOB 4UNUA 1EZLA 4FTVA 4I4WA 1RXLA 2VC2B 1U2HA 3UC0L 4KXAA 4MA3A 3H3KA 2Y6SD 2Z92B 4W9GC 3U1QA 3HR6A 5C09A 2WD0A 3T0DA 2AEOA 2C9XA 2DAVA 3QCUH 1DQTA 5E6RB 2K8QA 4RIRA 3V9CA 3NTCH 4M9PA 4DUWA 1G84A 1T1ZB 4AUJA 1AZNA 4ACPA 1WIOA 1N70A 1HSAB 3MV7E 5HYJB 4ODXB 5I66B 1GOFA 4QRAA 3MXWL 3BAEH 3U1SH 1UZ6F 5JW3L 3MLVH 3CZUB 1OQOA 2NCEA 1XB3A 3JT2A 4JDEA 5IVZB 3SE4C 2OMXA 5AZ2L 1BYNA 1SDDB 3RBGA 1PCXA 1ZVSA 3HMWH 3EJZC 1QO3A 5I8OL 1HOCB 3RWDB 5GISH 5ES4B 5K1VA 5DD1L 1VFMA 2P9RA 3SD2A 2G2NA 3SPIA 5AW0B 4O51A 1UH3A 3AB0B 5EOCH 3AADB 4WI6A 1JRHL 4UDUA 4FA7B 3RKDD 4IBYA 1U8HA 5LXVA 1B4JH 2AERT 2R56L 4G8GE 4J1UA 4M7JH 5CUSH 3TNNB 2CZNA 3MZGB 3QZPA 5JHAA 4BK5A 3QPXH 4JMNA 4NHCL 1RUPL 5JA8B 1F3DJ 4WHYG 4MNGB 1MVUA 4FHKA 1WBZA 1Z5YD 1AGFA 4L23A 2NT1A 4ZS7L 4PJCA 3TBWA 3AB0C 1J5HA 3R0NA 4K3EL 3P0VL 1IQWH 5FYJU 4WUKL 4YGVA 5DK0B 1PJWA 3QARA 3HMXL 1R34A 3MLTA 1ILSA 1D5MB 2I9LA 4D9QE 2F19H 3IF1A 3W5NA 4QRUB 5F7MC 1JXJA 4HD5A 3LKSA 1CLZH 4G6AC 2VAAB 5F9WB 2N59A 4A04A 1TQVA 1T6BX 4PR5B 4G43A 2BNRD 4PJGB 4MX7A 5JQHC 3BW9B 2VLLB 3LZNA 3RVXD 4N25A 3QJOA 5CILL 4WW1A 3CLEL 1K4CA 3GT6A 3MV01 3EHBB 3O3AB 3FCTB 5LVEA 1OM3H 1I1AA 4PJHE 2COVD 4HUMB 3NSFA 4K94C 1QW9A 4DTGL 4JM2F 5F0JB 2XWEA 3G04B 5T33H 1C5BL 4WFHE 5F9WC 4KUZL 1LILA 2YD1A 3U2IA 5AZEL 4G1MB 3LS5L 4FNQA 4MKMA 2O5XH 4QRTB 4ZNCD 4HEMA 3LVEA 4OI9A 4AC2A 4CMMA 4YSUA 2ADFL 3EHBC 3ROOB 4HX1B 1XEDA 3VX0A 3BJ91 3GUTB 3UTSB 3AXLB 3ENEA 4PH8A 5H37H 1F6FB 3GXFA 5FO9A 3QIUD 1AH1A 2WWMC 2OK0H 2EE2A 1UM6H 3QNYB 2A73A 1GSMA 5IEHA 3Q6GH 4MMZB 4M29A 4BSWA 1KLUA 2EDNA 1I8LC 3IDGA 4NJAL 2OXGA 1TETL 1S9YA 3QUXA 3D12B 5JO5B 1J48A 4ILDA 2BNUB 5F7DA 3VD9A 1XGYH 2PYEE 4LSVL 5IB1B 4G82A 5KN5B 2ALWA 4MMZC 5I8CA 5DS1A 1PW3A 2H4EA 1DSYA 5AUMA 3WE6A 1QRNE 3M1BB 4PGDA 5F70A 1PZ2A 1Q9OB 4ZFFB 1WHPA 2WQWA 5F0MB 4JR9L 1LO4L 2OZNA 2ICCA 3DPDA 3I75B 3A4DA 4PJIB 2O61B 1RI8A 2I60L 3LKRB 3WY1A 3GMLA 2A3TA 4PTTA 4NYLB 2QMJA 4XOCA 4Q9RL 2AQSA 3O4LD 4RESB 4HCRH 2YRPA 5I74C 2BHZA 2BP0A 4HS8L 2F53B 5DZPA 3TIDB 1BCIA 4Z95L 3MFGB 3UG3A 2H1PH 3HZYA 5IB3A 4MDIB 1PYWA 4GQRA 4TQ8A 1S9KC 2KHAA 1TCMA 3BFQG 4XBPB 2AJYH 3RX5A 1IZJA 3LRMA 1W72A 1NUDA 4GAYA 1QSEB 5D5ME 3FF7A 4F8OA 1P5UB 1BW8A 3DXAE 1U93A 4KZDL 2XQBL 1IC1A 2VLJA 4MWFA 1Z9OA 2F68X 4ZFOB 3V4VB 1D3CA 5MP6L 2AK4B 3PV7A 3OLIA 4EE2A 4W9ZA 5I9QB 5D4QA 3KYMA 4X9HA 4OFYA 4P5SA 3RNKA 3VJ6A 1AG6A 2VRQA 3X11A 5IB5A 2FD6H 3CN4A 1HEZA 1P5UC 1FAIL 2ZNXA 2YKKA 4AJWA 5L88H 3TEXA 1DCLA 3OR7A 2BOCA 4K3JL 2R7EB 4IBZA 3U0TA 1KGXA 3EO9L 4R8WL 1E9PB 4HUXA 3PGDA 4L29B 5I9QC 4PRIA 5I5RA 3Q0HA 1Y0LA 4AKQA 2OMVB 4Y4FD 4YOKA 3A22A 5C0JB 5TF1H 4JO4L 5HJGA 3GLZA 2WBJD 1I3RA 4W9LC 5GS0D 3DVNB 4M9OA 1X5YA 4XNMA 4B5ZA 5D1ZI 1AZRA 2V17H 2NY0B 4JM0A 4OSUL 2B1AH 4QTIH 1QSFB 4P48A 3UXFA 2V5YA 5F7HA 1UB6B 4MXWL 4Z5RA 2W65A 3DECA 4Q52A 1JUFB 2E9WA 4UU9A 3EYFB 4KO9A 4GG8A 4LLMB 1NLBL 3S9DB 1KXVC 1XX9C 4OLWH 5DLLA 4JUTA 4W1TA 5HPMB 3MBXH 3ULSB 1TFPA 1SUHA 4PJ5B 3VH8A 2HRPH 3ZTJG 2NY0C 4KJWD 1NIEA 2MOGA 1F13A 1NCUA 1CBJA 2OR8A 1P7QD 4XMTA 4EDXB 1OAQH 3QRGH 4KPHH 4QHLB 4AQAA 2FJSA 3MX0B 4PRAA 3AM8C 1TVHB 4OM0H 5IOKA 5CJXC 2OQJB 3NVQA 5DJ2A 3PL6D 5F44A 1BF5A 3MTRA 3M88A 3VXSD 3CPLA 5D7SL 4BZ1L 2FJGA 3TWCH 5LBSL 4JZJA 3NSJA 1E67A 1ZVYA 4IBSA 4U4BA 4X9IA 4ZOCA 2VH5L 2WZ5A 3AREB 4HIHB 5TDOA 1HXYB 3O41B 1V5JA 5CN1A 2A83A 5DK2B 3D25A 3K72A 3FB8A 5CZXD 3D18A 5FO7B 3ETSA 1ZLSL 1AIZA 2BRRL 1TZIB 3HPJA 3HCVA 4HULB 3MRKA 1EX0A 5D1ZD 2MCG1 3NCYS 4UB0H 4XE0A 1AO7A 3RTLA 5T1MB 3BN9C 4P46B 1ZPUA 3GMNA 2W07A 4BGLA 3UGUA 1RZKC 2QPFA 2VE6A 1T04A 2X42A 3FSWA 3OAUH 4G9FB 4X5PA 5EMYA 2YBGA 4TKWA 5D1XA 5HJBA 2NNXA 3TZVA 2OJEA 2Q7YA 3RTQD 1U8PB 4E42A 1ACYH 5DRNA 2MQGA 1I3VA 3CSYB 4Z3GA 4JLRB 1LVEA 2NW2B 4I48B 1E8WA 4NOBA 3I50L 1MI5B 4P46C 3DO7B 2JKWA 3BVUA 1E28B 5E94B 4LSUL 2BOLA 4LAQL 3IJ7A 1I3UA 4HIJB 4XP1L 1JGLL 4U6YA 1SHXA 3ZR5A 1RLWA 4QR7A 5ISZE 2J1WA 2RFXA 3QUML 1BF8A 2Y7MA 4JVPA 2YPLB 1BBJA 1ND0A 4EI6B 1NAMB 3BRGC 4L8CB 2IFGA 4G8IB 2UY7B 3QR0A 2G0LA 1MIMH 3PJNA 4Z3FA 3H9SA 2H41A 1VRSA 3DTDA 1YMMA 1SJXA 5HDBE 2IAMD 5AVZB 4HT1H 3X2QB 1OTTD 4OCYH 2HYMA 5CBAB 3FQRA 3TT1H 4UIKL 4ORGA 1J8RA 1DVXA 5KSAC 3B37A 5KJRL 4JFQB 1DQIA 1VEMA 2YSSB 1CQKA 1KZQA 4JPIB 5GZOA 4IBWA 4HJIA 3FQTB 1MJJB 4PLOB 4XBGB 3HC2A 1J18A 3QJTB 4JJHA 4XWGH 1SQMA 4WVRA 2DF3A 5IGXL