2KMWA

Solution structure of at3g03773.1 protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At3g03773
publication title Solution structure of At3g03773.1 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kmwA01
3J07A 4YE0A 1WFIA 3QORA 1EJFA 2Y1ZA 4JUSA 4M5TA 5DS1A 2WJ5A 4M5SA 1RL1A 3Q9QA 4YLCA 4JUTA 1GMEA 2MNWA 3QORC 2N3JA 3GT6A 2K8QA 3Q9PA 2JKIS 5DS2A 2BOLA 2KMWA 1X5MA 3L1EA 4PBDA 1WH0A 2RH0A 3W1ZA 2Y1YA 4RZKA 3QORB 1SHSA 2CR0A 4PCKA 4FEIA 4MJHA 1WGVA 2N0KA 2KLRA 2O30A 2CG9X 3AABA 3GLAA 3QORD 3GUFA 4I88A 4YLBA 3AACA 2WJ7A 2Y22A 3VQMA 3EUDA 4ZJ9A 3IGFA 3L1GA 4YDZA 4ELDA 5LUMA 2XCMC 3VQLA 3N3EA 4YL9A 3L1FA
chains in the Genus database with same CATH superfamily
1P5UC 2NSXA 1YYMH 3CSYA 1B0GB 3BC9A 3KYMA 4FKHA 2FB4L 3O4OB 4ODWB 5T8IA 4AYBA 4XBPB 2EUZA 1SMDA 3KCWA 1YY9D 3VXUA 5F9DC 4MNHA 5JOEA 4BGLA 4EUPH 3FUHA 2VN6A 3BHBB 1RERA 3FW6A 3TCLB 1DJWA 4U1KA 3G6JF 4YDZA 4AL8L 1PY9A 5D72H 1TZAA 4U1HA 5F7BA 3M6DA 3QWQB 12E8L 5I0VA 3F04A 4P5TC 5AOIA 3BZDA 3O11B 3SDCA 3IDNA 1KNOB 3LKPB 1D9KC 1UZ6E 1EEYB 2OL3H 4IGBC 2C1OB 3FMGH 4WU5A 3VXRA 3T8XB 3BUIA 2OMNA 5KVFL 4YBHA 4FNPA 3I6KA 1KTBA 2VITB 3MU3A 1CT8B 5CD3A 5I30H 4YL9A 3ARGA 3TTYA 3F58L 5DK3A 3MZGB 5E08L 1R4XA 3GQFA 1DN0B 1VENA 4WJ5B 1NEZG 1WA0X 3C08L 4Y2DD 4DQOL 3X12A 3LZPA 2D7NA 1CLVA 1AY1H 1EVTC 1KYDA 3SE3C 5E9DA 4UMSA 2ED6A 3NFNB 4U1JA 1CMOA 1NINA 3HR6A 1OCOB 1AQKH 5DGRA 1OW0C 3AABA 1BVLA 5FO2A 1S7VA 2PMZA 3GBEA 4H5SA 4B95C 1FNEA 3JWOC 4GW4B 2MQ3A 3GMOA 5LBGA 1K5WA 4X9FA 2X53A 5C0GB 2CA3A 1RJZA 4YJZL 1FZOB 3ZDZB 4OFKA 3K74B 3JTSB 2KS0A 2YQBA 3FRPA 2EEBA 4QD2E 2DQ6A 3CFEA 4AWJC 4L8DA 1SHMA 3KCPB 4G1EB 5E94A 4O2EA 3PL6D 3U0PB 5IMMA 3FT0A 4BA0A 4WV1B 3FTWA 3QRGH 4QI3A 2HA1A 3LZFH 2A2QT 4MD4A 2YUWA 2WBJC 3TN0A 3TNMB 1JE6A 5B39A 3LHPL 4AIZB 3PQYE 3KLLA 3RZCD 1U58A 3ARWA 1LYQA 1QEWB 2BWQA 3LXCA 1EBPA 3BUPA 2X70A 4XNAA 2JIXB 4ENEC 5K93A 4HU8A 3IDMA 3VSUA 5CEXA 1LTXA 4KKBC 4DP1X 2ZOLA 5JO5A 2EE3A 3FQTA 2VWEC 3Q48A 4PV8A 1LP9E 3RHWK 3SJVD 2F6AA 5FYJH 1Z3GH 3ZO9A 1GTNA 2AQTA 4S1RL 1M7IB 4GMTL 2NYKA 43CAB 1N0XH 3T3MF 4CGUB 3KBHE 5E8DH 1NFDF 1MQKH 1QWHA 3QXVA 3MOBH 2WQWA 1S9YB 1IC4H 3C5ZB 3MBWB 3QDGB 3REVA 4L9LB 3RDTA 4U49A 4DPAX 2AJYH 1MREL 2OTWA 1AVAA 4N25A 3U46A 5T1LD 1REIA 2DQIH 4X6DF 4QYAA 3SGJC 3NJVA 1BFOB 5CJBA 1W91A 1NBQA 1QZ1A 3GSQA 5DMKA 3E2HB 1CDUA 3RBGA 1DDTA 5DHDA 2IG2H 4GSXA 4PJIF 5K69A 3T0EA 2AJZB 1N59B 5T5FL 4D0BA 1BREA 5KYYA 4EE2A 2IBZY 1WGOA 1HFUA 1A64A 3N9GL 4MMXA 5BZZA 4BD4A 1Z9SB 1ASQA 4HLJA 4IMLA 2FBRA 2TSAA 2VDNH 4N0YL 4XXWA 5I1IH 1GYAA 4LCVA 4MXQC 4MNGB 1MSPA 4PJHB 3WFHB 2WQXA 3WKNA 3U1SL 1OK0A 4ZMQA 5L6YL 5EZJA 3H9SD 4JRYA 1O9VA 4PUBL 4WEEA 3UTSE 4E5XG 4OLUH 1KPVB 1NGPL 4JRXE 4FXKC 3WTXA 3DDGA 2YS4A 4YGAB 3V4VL 1HL9A 1KN4L 2WAQA 1AD9A 4NO3B 4WTZA 5KS9B 3MV7D 3TYGL 1JZHA 4N86A 3ZT7A 1ZA6B 4NX0A 3CXHK 3FO9B 4QIRA 4IIZA 4NKIL 3ULVH 4R96B 2B39A 3DIVA 1UB6A 2BY2A 5J6SA 4D9LL 2XWEA 3BP6A 5DLLA 2VZTA 2C3XA 2X4RB 3S8GB 1AI1L 4FG0A 2GIYA 3WIAA 1LO3L 2VDRH 1L5GA 2KMWA 2VH5L 5LAXB 2DV6A 2Y2TA 1QTYT 1T04A 1C5BL 4LPYA 4N3UA 4IRJB 4XNQB 4XOBA 5E4EB 5E1AB 4EUPA 1VGKB 1H6TA 5K1JA 4ELMF 4QLWA 3KXFD 1KENL 2MRYA 3WG7B 4EDXA 1H8SA 2EQDA 5C0BE 4KJQD 2WXLA 3JTBA 3QYMA 2BINA 4YH6A 3ILEA 2PWEA 2ZXCA 4LU5L 5T1MA 3P30H 5HDQL 4BUQA 1UACL 5CEZD 1NDGA 3CVHL 3WS3B 4BGDA 5ENWB 3E9UA 3HPLB 5KSBB 1SYSB 3W38A 4P59L 2OLDA 5A3IC 5IHWA 4Y9EA 4QRPB 1UM5L 2BY0A 4XNXL 5T3XL 1F8TH 1OGTA 4LBEA 5EO1A 2CZNA 4XVSH 5GRZA 4GIPD 1DDHA 1VLXA 1F00I 2XTJE 4OJYA 1T0MB 1C12A 1A7RL 3G5VB 3TA3C 3NABH 5TPWL 4XN1A 2Z8RA 3RGVC 5A40E 3KVDD 4NKQB 1M53A 4P4RA 4HJ0D 3RL1B 3VM7A 3VCLA 2YAEA 1V10A 2XZQL 3B5GA 2ENSA 3MR9A 4HLZH 3FB7A 4N8CL 3CAFA 4GAYB 2G75B 4TVPE 4XMUA 2MHAB 1NKOA 4FHBD 4H44C 4PCYA 2D03L 4RIRA 5EMYA 1Y07A 2RQEA 3APMA 5E8NB 3MCKA 4NBZB 4KWUA 2YXMA 3DC0A 3G5WA 3C9NA 2E8ZA 3QWNA 4PJCF 4GKZA 5FR3A 1XF2A 4JKPL 2N3JA 4GRLB 2Z31A 3ESPA 1LO4H 1BQUA 2DLTA 3H2QA 4I3SH 5GGUA 4ZYKB 5HI5C 2PWFA 5IVOA 4JN2B 3GSNH 2VIRA 1HE7A 2ZZUT 1VEPA 5K9KB 2A9DA 1BOGB 1ZLSH 2H32H 1NAKL 4OI7A 5DRNA 4Z7AA 1U41A 4KROC 2YA1A 5TDNA 4JM2B 4NNPH 4APXA 2VDQH 4KRMB 3OKKA 3BFQG 5I23A 1Q0YL 3HN3A 3KNBB 2VABA 4XRCB 1E43A 1E40A 5AW3B 4RESB 1JNHB 1LXMA 1CK0L 5FGCE 1NAMH 4DUWA 4FABL 2BWIA 4BK4A 3WMSA 2HFEB 3H42H 3DSNA 3SCMB 1GKOA 4NRYB 5DO2D 1JDCA 1HHGA 3L3HA 4J8RA 5IW1B 3WY3A 3HHSB 3VG9C 3U7YH 1Z2KA 3NSDA 1DVFD 1COBA 2IGFH 2UXGA 3R1GH 4ISVB 3HMWH 4A2EA 5D2NE 2QELA 4J6RH 1INQB 3CXHJ 3N0PB 2CDEB 4FXGA 1HH6B 2OCCB 3QE5A 4PRID 2MCPL 1R5VA 3HVNA 4HSCX 4HZLB 4LARL 1OD7A 4JHAL 1JV2B 2VO5A 1EJ6A 5ABDE 1UXWA 4FQXC 3BPLC 1NGZA 3GHPA 4JFYB 4JZNA 4MMYA 3WIFA 2OSLA 2XXGA 5C86A 5HJDA 2F18A 3EJUA 5J89A 4S1QH 4L3CA 3OKDA 4PH8A 2ZUTA 1BMWA 3GJFB 4Q7DA 2LAAA 3LZRA 1FYTE 3TO4D 4KK5C 2GIMA 2GTZA 3FTUA 3E9TA 2P47B 1I8MA 2X9ZA 4M7JL 5IFAL 4F9LC 1RLBA 2IV9A 5AW0B 3GEFA 4JHUA 3WGVB 4K9EC 4K4KA 4PJEB 1CS6A 4IM8A 5T3ZH 1DUZB 3WEOA 3ARBA 3O6FB 3QFDA 3Q6GL 3IU3B 4MRBA 1ZSDB 2I5YL 3EJSA 3EO9H 4H26A 2ATKB 2FX8L 5B21A 3SD5A 5IGXH 1YEGH 1U92A 1ZV2A 2YKLL 1QYGL 4ZTPH 2XG4B 3NPZB 3MUY1 5EO0B 5J57B 1AKJB 3S37H 5HHOA 5KSAB 4NO2B 3S4SA 1XH0A 4WKXA 2MOGA 3G3LA 4C83B 4I0PC 4QTHA 1DO6A 3RTQA 3N04A 3NSJA 2L04A 4ATTA 2FSDA 4WUUD 1KBBA 3OXRA 2R29L 2CUAA 3MLVH 1E5UI 3WEBA 1KULA 1UCBH 5JHLH 2VXUH 2GK2A 1BD2E 3H3PL 3MRCA 4PP2B 2G0KA 4LQFL 3PWJB 1J9RA 4OFPA 3MLTB 1XR9A 5BQ7B 1AGEB 1W8NA 3BGMA 3SE6A 3RBSA 2JLPA 3FT3A 1NJ9A 5F7KC 1CD0A 4HBQA 3QEUA 2O6DA 1JI1A 3LH2H 4P23B 4P5TD 3WN5A 1IFHH 4OSUH 3KLKA 3QXAA 3ZBMA 3K5SA 4OV6F 4GAGH 1PQZA 1BGXH 4FFTA 3VTAA 2H7WA 2XZCL 4GO9A 4XCCL 3PF2A 1J7VR 4JJOA 1QR1B 4Z1PA 3S6CA 3L1FA 1D9KD 1MCLA 3CSBA 4IGBD 1KDJA 3LRSA 2E27L 3TC9A 3BAYA 2IOIA 3VMOA 3IYLW 1BX2B 4U1SA 4LCWB 5JOFB 2AQ3A 5MERA 2Z34A 3GZKA 3KHOA 5D2LB 5EU7C 5F1NB 1JK9B 1VDGA 1RY7B 4FEIA 5KSUB 4X98A 3UP6A 1IFRA 4QRUA 1R3HB 2OMYA 4NWTH 1JPGA 2KQNA 4PV9B 3LAFA 1XGUA 1U8QB 4ZPTB 1YEJL 2IWKA 3V5DA 4HETA 3L8QA 1UKQA 4XN8A 2DJ4A 1NCBL 1R3JA 4TSBH 1JP5A 3U0TA 4F2MA 2IPUK 3SYOA 3NIGE 4ZK8A 2HJLA 4KKCC 4DN3H 1EHKB 1XSJA 4NFCA 2X1OA 5F7YC 1OM3H 2OP4H 2O6EA 2FLBT 3UBXA 2H45A 4LOUC 3BFWA 3US1A 2DMBA 2CIIA 4NEHB 4WZ9A 5D7JB 5F89B 3DJZA 4BQ9A 3BWSA 2X2JA 4HVBA 3C75A 2GUOA 1ETB1 4PWEA 2P5WE 3RTLA 1G7MB 4EXKA 2J44A 2ADJA 1ACYH 1NPUA 1AE6L 3QCTH 3LEVH 3X11A 1ITBB 3LPWA 4PRPE 1HYSC 5D70L 1JGDB 1PLCA 2FO4B 3QJQB 5DK2B 5FUCC 3UTTA 1X4XA 2WBJD 2AABH 1TQBC 3V9EA 2DH3A 4G42A 1RK7A 4WI4A 3GSNA 4WK2B 4JFDE 1JVLA 1R24A 1ZT1B 5FYKL 2H32A 3HR5A 5C09B 3POCA 2OMWA 3MBEA 5JPNA 4JRLA 4ENED 3RVTC 5I30L 4NNXB 2WP3T 1QA9A 3L95A 4KKBD 3F84A 2NSQA 3BOVA 2D0GA 3RU8H 2BWDA 4TUUA 1D5ZB 3FH8A 1EZVX 2OR9L 1YY8A 4NUJA 4HH9B 4CN1A 5DS1A 5I1EH 5IIEA 2JKWA 5CM1A 1NAMA 1W2KT 1TXKA 2UYLB 1AS8A 4PRNA 1MVYA 4MBRA 1A6PA 1RHHB 3CN0A 3V7AG 4A55A 5GS0L 1MJUH 2BNRD 3WUWA 3QNZB 1JHLL 1HXYA 2Q1EA 3MV11 3AG3B 4Z7WF 2RALA 1QFPA 4L48A 3OD3A 4P2QA 3VD0A 2GAZB 1YNTB 5K9QG 4WWKA 2LVEA 2KZ1B 1KYOK 1WZ1H 4MKTA 4DTGL 1SUHA 5JHAA 4RFNC 3B2DC 3NJKA 1QUPA 2CHNA 1P4BL 4HUNB 5KBNC 3IAPA 3M1BB 1AZZC 3EAKA 4DP6X 2A6IA 3LIZA 4JAMA 4ZW6A 5ITBL 2P52A 3LZFL 3M45A 2A9BA 5I6KA 1UATA 4MXQD 2FQDA 1MZZA 5KVEL 5AVZB 5HYFA 1EDYA 2OJEA 4M8UA 3ZDYB 3FO1A 3WYRA 3ETTA 2W8CA 2EIZA 5BRZE 1DFBH 3V52H 5CU5A 3GT6A 4YFLI 4ZNEE 4K23L 3SOBL 4AMXA 1AGFA 4PJDE 2JCCE 4URKA 4MQXC 5I26A 3HC3H 4M4RA 1E28B 3NJXA 4LVNC 5E8DL 2YKKA 4NUMA 2VMFA 1T5WB 3ORJA 1Q9WB 1YYCA 3MNMA 3MOBL 4A04A 2QSCH 3EYSH 1UHVA 3GTVA 5DJAA 5AVTB 4AYID 2YPKA 4LESA 2WXIA 3DUUA 4Y0GA 4HCIA 1ORSA 3G6JA 4A39A 4YHIA 3GRBA 3WKML 2AJXH 5JHLA 3N2JA 3DTXB 2HPOA 2BCKA 4AJVA 4XPFL 2A9CA 2UY7B 1L4IA 4OLYH 4ZSOE 1R75A 4IBVA 3MO1B 3A67H 1ZTXE 3VFNB 4S2SB 2ZCHH 5IHHA 3EG9B 3GSRB 4YDVA 1BAWA 3A23A 5B39G 5IMKA 1HZLA 3ENEA 1YDPA 4WFGE 4G9FE 5DVPA 4S1SL 1ND0B 1S9VA 3SODB 2VDNL 2VSMB 3LKNB 3GSOA 4U3SB 5EDXA 1TVBB 5A3ID 3SDXB 3GSVA 2QLVB 2GI0A 4M7LH 5J1SC 2G2RA 3OG6B 4PJBF 1H5BA 2LU4A 4ZODA 4TOYH 4NRZA 5H37H 4HGKC 3E7JA 1GJWA 2CO7B 5DT1L 2N7BA 4HCFA 2K7PA 3QZNA 1KGIA 2Y1YA 4U33A 4GSQA 3CE1A 5DQ9B 3GLZA 2ZAIA 3S5LA 3TA3D 4ZFGH 3WKYA 2X1QA 1I3GL 3BDXA 3ULVL 4Y2DA 4Q58C 4M3HA 4F5CE 4N2FA 2E7MA 3IS1X 3RGVD 43C9B 1FNSH 1VEOA 1HYRC 3EFDH 4OJCA 4F33B 4K8RH 1EX0A 4G43A 5EZPA 2V6HA 3HCVB 4PN6A 2GABA 1U3HC 3FJTA 4K94H 4PVMA 5IMLA 2FWUA 1K4CB 1A7QH 1FORL 3LZNA 3Q8CA 1MAML 1GR7A 4UTAL 1SBSH 2IWGA 4JM4H 1KJVA 4GG6B 1IKNC 3M1OA 3VG0H 2EP6A 2QT6A 3W2DH 5HYJA 2CUIA 3CK0H 1A6VH 3Q2NA 1OT1A 1A4JB 3K0YA 3MNVB 3N06B 1U91A 2PW1B 1OTSC 3E38A 5FO7A 5HI5D 1LJMA 3P30L 4OJFH 4QY8A 1J0IA 4PTTA 1NLDL 4LLMB 4UQIM 1CICC 3P11H 4IDJL 1BMGA 4HIQA 1HWWA 1KYOJ 4XPTL 4R8WL 4H8QA 2AGJH 4KROD 1CFSB 3LIUA 4ZFOB 4R5VA 1BECA 2BSBA 4ZUUB 1CU4L 1DQJA 2VERN 4IOFC 4WW2A 2NT0A 4KQ0A 3TVMB 1MJJA 2X44D 1PD1A 3F6LA 5EOCH 1F8TL 4PG2A 1LWJA 2F5AL 3UZEA 2XBTA 4NPJA 1F3DJ 1RH8A 1B0IA 1YMHA 4MWFA 4X5WB 2H3KA 4Z8FL 2E7BA 3M07A 2VC2H 1ZGLB 3VQMA 2A73A 1NFDA 2FX7L 2O61A 1G1OA 3AS3A 3GTNA 3KJ4B 2YMOA 2ZD0A 1V7NL 5HDBB 4NZTL 2XA8L 3FK3A 3UZQB 2W0KA 1FJ1A 1QASA 2CA4A 2W07B 5JUEL 2CSPA 1P4UA 2BVEA 4X6DA 4HJGB 4UV7H 1V3JA 2OMVA 3QHTC 4HIXL 2HG5A 2UZIH 1DSFH 4PYGA 2EE6A 5E2UH 3WFDL 4AZUA 5HVWA 1JCKA 1H9DA 2A6KA 4AM0A 1BZ7B 4L05A 4PJIA 2AXWA 5T1LA 4PREA 1PG7X 1DBKH 4AZ8B 1PL3A 3GMLB 1IUZA 2JELH 4FQXD 4MXVF 3MLSL 3FT1A 4TNWK 3UMTA 5MEND 1TUPA 1RPKA 4E5XB 2E76C 1JD9A 1HSBA 3IJYB 4L37B 3FBKA 4ZFZB 2BFVL 3IRPX 4KK5D 1LO4L 1EZLA 3GMPB 1D5MA 1P2CA 3B9AA 3RVWC 5I19H 1ZLSL 8CGTA 3K91A 3KPSE 3WN6A 4YHPA 4YXKL 3CZGA 4F80A 5C0NC 1KF9B 4AYDC 5IW6A 5CKAA 4NNPL 5TDOA 3DO3A 2A9AA 3QG7L 1C16B 2X87A 3GUTA 4I7ZC 3BD5A 5F3HA 3DBXA 4HIHA 3QI9A 1OB0A 4YQXL 2W9DH 5LGYA 3GIVB 1A9BB 4RAHA 1CE1H 5LN4A 1VF5C 1P7KB 4TSAH 1WO2A 1QG3A 2N59A 3L3OB 2SEBB 1NAML 1ACXA 1P7QA 2WHVA 3T0XA 2PCFA 3PXLA 1WUNT 5BS0D 5E99L 4NLAA 1PZCA 3BPOB 3C5SB 3K80A 2HTLC 1S7XB 1DVFB 3N91A 4I0PD 4KPHH 4PB9H 3MCLL 3U7YL 3UAJC 1OV8A 5TE4L 1T89A 1KB5H 1XHHA 2GJZA 3ZSSA 5A6MA 3DVFA 3HMWL 1Y6KR 3RNKA 2OMXB 4PRIB 2JMRA 4TXVB 2YN5A 1CGYA 2AMGA 3S35H 3UC0L 4J3OC 5TFSL 3A6CH 3OR7A 1QW9A 4ELMA 1F13A 3D09A 5SWSD 5I16A 4JFQB 1KTRL 1K85A 2EDWA 3CHSA 4ZMVA 2BVQA 4LKCA 2APVA 5E0QA 1NWOA 4GI8A 1OAJA 1R47A 4NQEB 3BO8A 2IPKB 5IJBC 5EF3A 4HIIA 2DBJA 3PWLB 3H3BC 1TITA 5DJXA 5DYOB 3UBHA 3LRLA 2DL9A 2G4GA 3LIZL 5FO9B 3UBGA 4OZGE 1QFWL 2XFXB 2HX7A 1GZHC 3PXHA 4QXUH 1T2QH 5TGBA 3ULAB 5KWYC 1WWWX 5JHMA 2QTEA 4G7YH 1X7QA 1EEZB 4WRLA 3MV9A 2ZWSA 3WNPA 2PO6A 2E75C 1MFAL 3O2VH 5C2UB 3TX4A 3VSVA 4JFPB 3IFLH 5IHUL 3C6EA 5T3ZL 1NM4A 2C4FU 1HHIB 4NYLA 1J05A 3MOAH 1I1AC 5C0CA 1YEGL 3FQ1A 2R8SL 1M7UA 3FHQA 3KVQA 3VWJC 5I1GL 2X12A 4LVHC 4PJ5B 3WO3B 4EVNB 2R0ZH 1E9PB 3H4FA 4MQTB 5C08A 4HEPG 5EC2B 4JR9L 3U79A 4UTBL 4WSKA 4PRAB 4WUUB 4OBRA 2IQAA 2P5PA 5DJZB 5JIHA 4PP1C 3G5YB 5ICZB 1YEWA 1MUJB 2DQEL 4KKCD 5ANMA 2YRZA 3BH8B 3QS2A 4LOUD 3JWOH 2AXGB 2IAMB 4PWFA 3AG4B 4J39A 4ELDA 1MNUL 3MRBA 4HK0B 4LSVH 2H1PH 5DFTA 1OF2B 2DTMH 4PJCA 3H8NA 4DP0X 2VLMD 2FYYB 3BLPX 2R9HC 4N22A 1WTLA 4OF5A 4OFYA 3EGSA 4Y5VC 5GZOC 3BIKA 3ZRCC 3OKEB 1Y0LB 3US9A 1G7HA 4JPVH 3D6GA 2DIEA 1NCWH 2V2XA 5EFIA 5G4NA 4YDKH 1BGXL 4L8CA 1HYSD 1PS3A 2BLFA 3IJSA 1JWMB 4HUXB 2HN7B 5EZIL 5EF0A 3QHFL 2ICES 4J2XA 3A6BL 2Q6WB 1WHPA 4L4VE 4H25B 1M57B 2L7EA 3NQKA 2LTQC 4IRSA 4NI6A 4IEFA 4LSTH 4S11A 4AEHL 5CHNB 3ECVA 3SYCA 1XR8A 4ZUVB 3RVTD 4U6XA 3NIDE 4JKWA 3S4SG 3BPCB 5E1GA 1QFUH 5BOJA 3I75A 5J9PB 5EC1B 3ARPA 1MOEA 3PHAA 2AEQH 4Z7QF 2FNWA 2V9TA 3EJQA 5EU3B 5GGSA 4M6OH 2FJFA 4PS4H 3GBML 4FYRA 1WS8A 2JB6A 4P5KB 1UUSA 3RY6A 4TSBL 1ZXKA 2X05A 1WFOA 4PGEA 1E9OB 1NGWA 3IPBA 3UXFA 4DN3L 4EZKA 2J8OA 1NDTA 4E36A 2ZSVA 2OP4L 4PGCA 4XC3L 2ZUXA 4OT1L 1B2WH 2PTUA 4QKXB 3FB8A 4RMBA 2TSBA 2P8LA 1EV2E 3M88A 4XCFH 2EO1A 2HPTA 5DVLA 1BM7A 2VR5A 5L2KE 1UJ3A 3P2DA 1I7TB 2NY6B 2GEQA 1UASA 1F4XL 1UADC 2CG9X 3E6FB 2JKXA 1HHHB 1RULH 2DQGH 2I25N 2R8SH 3EJJX 2A74C 1RJLB 2HKFL 4KK6C 4PJ9B 3OXSA 2CIKA 5GISH 1MCEA 4Y5YA 3TJEH 3VDBA 3BVNA 2VUKA 1CFNA 4ZUSB 5IJCC 4PRHD 2KDYA 3FUIA 3I3DA 1F6FB 2WQ8A 3X17A 1HQ4A 3NCEB 1AZUA 2XVGA 1RIUL 2A99A 2OKMA 3L4CA 3K81A 1MHCB 1WV7T 1W9XA 3JTTA 3N43F 4Y5XA 3V9FA 2F53B 2EEDA 2DYSB 4K2UH 4XMTA 3MLWH 3RU8L 5J8OA 5DJ2A 1QVOB 1QX1A 3L9EA 3BDBA 1GSKA 5HGGS 4ZMXA 5I1EL 5AVRB 4DETA 4MQXD 4YWGL 5ECGA 3DX7A 2UVFA 2RA1A 4XPBL 3CU7A 1HZHL 3QIUA 1SVCP 3OLDA 2BNRB 3MRDB 2BMKA 1YAZA 4V2CB 4X8XA 5LWYH 5H2BB 4K3JL 1IZJA 1NIDA 4DGWC 2W91A 3HTLX 4P2RB 5I0YA 4L3FA 2PYED 3Q8EA 1SXAA 2YEZB 2J71A 2NW2A 4PJXE 3LVTA 4NO5B 1ODUA 3B1TA 3H56A 2LAGB 2A4EA 2IALA 4B97A 4I18A 2PNDA 2W0PA 1U36A 1WZ1L 5SWQA 2WYZA 2XTJC 4OGXL 5JDJA 3BGFC 4AM0Q 1EZVY 4WNJA 3V4VB 5BNXD 3RURA 1JSYA 4V2BA 1OAYL 3ECQA 3D39D 4C56B 2DQMA 2BW5A 4Q0XL 1RVFH 4HKBB 2HLAA 1GS7A 2OX5A 4IOIB 5GRJH 1CZ8L 3I2CL 3X1EA 1IE5A 3SZKC 3L3GB 3CBKB 5DLML 4MCYA 4EBQH 3BQUB 1FAIL 3I9PA 5L4FA 5GS2H 3TLRA 2V9QA 4NKMB 1HHJB 4BFKA 1NZRA 5EU6B 2FO1A 4YFEA 4NZJA 4PJGF 5JQ6H 1DFBL 3Q2WA 1ZVHA 4YAQA 4GW5A 3HAEG 2QVFB 3MRHB 1V05A 4NAJA 4KX9A 4U31A 1FFPA 1FF5A 3NTCL 4Y88A 1OHQA 5D5MB 4HJ1A 3HC3L 4K9JA 3K8MA 3I9IA 4U1MB 2AQNA 3OSKA 3SE3A 2ZKWA 2AXFB 4P2CG 4A7VA 3LMJH 3TEZA 3OHXA 1AQDB 1TJHL 1U3HD 2D7TH 2VDOH 2EYSA 2YBRA 3BAIA 1RU9L 3CVHB 1U8IB 5SX5K 5L8JB 5E23A 4X2UA 1INDL 4K0OA 5JLZA 1SPDA 3D18A 1QFOA 1KPUB 4JGUA 5GJSH 2A9NL 4YBLB 3QG6B 4LQ1A 2EINB 1B3IA 3IDGA 5EPMA 1IJ9A 4J3OG 4LRIA 5EBMB 5AAPA 3APCA 2X41A 2ZCHL 2NQDA 3FONB 5AAWC 2XETA 3MRGA 5AOLA 1OTSD 5DRWA 1GGBH 2CDFB 3TZVC 2JQMA 3CSYB 3ZYOA 2VXTL 3KYMB 4HWEH 5IQ9B 1CICD 3DETC 1FIGH 3LPOA 1URLA 2ZXAA 2IQ9H 1OB1A 4LEBA 5CLXA 5D2NC 4IOFD 1NC4D 4MJ2A 4XAKE 1MF2L 2E6JA 3VXUB 5BQDA 2BS8A 1FC2D 4QHLB 3N41F 4TOYL 3VQLA 1KBWA 2I27N 4MA1B 1I75A 4HWBH 2EDJA 3Q1SL 2WWKO 3UO1L 3C2SA 3MGOA 1VGEH 1CD1B 4UT6L 1JGVL 1A7PL 2FUTA 2B2XH 5LBVA 2DWEA 2VR3A 3S3JA 4U1HB 4PJAE 2KDGA 5I73C 3UCRA 3WIIH 2OYPA 1FNSL 1I9IH 2AAAA 3EFDL 3APDA 4K8RL 3QUXB 3SDCB 5KBLA 3SBRA 2HRLA 4Z7WA 1MFUA 1A7QL 2PW2A 1AZRA 2ZCKL 3HHMA 4YHNA 1FZJB 1WZMA 1RJCA 3I6KB 4M5SA 1SBSL 4UOJA 1NFKA 4O9HH 4D9QE 5FGBA 4LEOA 5D7LD 5CD3B 1RZFH 4GQ9H 3ARGB 4RZKA 3GM8A 5CGTA 2WQVA 2VDLH 3ZTEA 2XC8A 3L9YA 2G9KA 3FOMA 4OCNC 1A6VL 3NIFB 1RUQH 5IB5B 1MIEL 3V8OA 4WW1A 1FZKB 3DJRA 3RVWD 3H2PA 4G80B 2F7IA 2D7OA 3TBTA 1RK1B 1TQCC 1ZK9A 1KT2B 2HG0A 1C7SA 2NY4C 4PQXA 4K9EH 5JNYA 5C0ND 1VIWA 3CFQA 3ZPDA 5ILTH 4JDTL 5D4QA 3PWPA 5C0JB 5DK0A 1UM4L 2QQNL 4H5SB 4FYSA 5KAQG 1XXDC 1FNEB 1ZSHA 5T5NF 3ZE2E 1L6ZA 4FXKA 1V3MA 5CF3A 1U8PB 3QWRA 3O81A 2NX5A 3O3AA 4PCKA 4CVZB 3DO7A 2QL1A 3F7QA 5FM5O 4FE9A 4L8DB 2HTLD 5E94B 1DANU 3S88H 2EVJA 4O2EB 3UAJD 2VJ8A 3W0WD 1R0AL 1NBYA 3AWFA 4HGWA 1SY6H 1OANA 1CFQA 1AGBA 2JK5A 2B20A 3ETSA 4JQXA 1NQBA 4UV7L 3OWRA 3Q9QA 4J3OD 5C07D 2UZIL 5E2UL 3ROOA 1OL0A 1E5CA 1MCOH 2YRBA 5B39B 1OAZH 2ZX9A 3QUKB 1U58B 5CS7A 2GFBA 5AKVA 1UZ6F 3DRQA 4Y4HC 1DBKL 4YDNA 5MENB 1UC6A 6FABH 5CCKH 3IDMB 1IFGA 1WG3A 4D9RD 1OM9A 3BSZA 4M5YH 2C5DC 5JO5B 2XN1A 4GSDH 4FQQA 2HLEB 4KTDL 4YDLC 1FNGA 1KEMH 2IDQA 1IGFH 2AJ3A 3EDFA 3WO4C 1VFBB 2I7SA 1MWOA 4F9PA 1S3KH 4YSDA 4ONHB 5TDPA 1V5JA 2QDWA 4PJBA 1BXUA 1YEIH 1NPJA 2WVVB 3A21A 3Q1EA 4OJAA 4FL4B 3REVB 4Z0BH 1P4LA 2R1XA 3RDTB 3BKMH 5JORB 3U46B 2AZAA 3LVEA 1I1AD 1BQHG 1NCDL 3IRZA 4WSGA 2HFGL 3MV8E 3CFUA 2DJMA 3VWJD 5HJBA 4MA8L 1FRGL 1H0DA 4ZX5A 2VN4A 2JV6A 2XZAH 2W9EH 3CFCH 3DXAE 3T0EB 1T4WA 3BZ5A 1PVHA 4B9YA 4RGNE 1QLRA 1JFQH 1QSEE 1WDAA 4D0BB 4PP1D 2YJLA 1VAHA 4P2OB 2ZX6A 3HLKA 5E9AA 1A6WH 1FC1A 2KUTA 5D7SH 5ADOH 5HHPA 3L08A 1TJGH 3TO2B 2BP0A 1W80A 2VLJE 5FHBL 2WZ0A 2E7HA 4GS7B 4KRPC 5FFLA 4UF7C 4LKXA 3UH8A 5SWSB 1IQDA 4HMEA 5HJGA 4FTVB 2NLJB 3FRUA 3VJ6A 2W95A 2YR3A 1ZEAL 2IANA 3GINA 4JRYB 4JGMA 5FA4A 5BOPA 5KTEH 1XGYL 2PCPB 5LNGA 2Z92A 4OFIA 5GRUL 5FHAH 2PXYC 1XGZA 4FI6A 3CXFA 2R9HD 4JB9H 3HJ0A 4V1DA 1AD9B 3PV6B 3DROA 5ESQA 2H0PA 4UIKH 5B3NA 4X50A 2GW5A 5EB9A 5G5DB 4ZUWB 4JCMA 3NJMA 4LHQB 4ACPA 3NN8A 3ARDC 3D30A 2K45A 4PBDA 1GS8A 1JTPA 1LP9F 2XBDA 4N90E 4XN9A 1LD9A 3P4OA 2ZG3A 3OKYA 5DHVB 5EOQL 3U9WA 4P5RA 1U93B 1T20A 2XV2A 3T9WA 3IFLL 3QB7C 3OV6A 3U4EB 2Z93A 2EVFA 4MJID 1FQ9C 1Z9PA 5TK2A 3D5OF 2Q8AL 4LSQH 2F8IA 1FL3A 1B90A 3TONA 3VWKC 1UENA 3Q43A 1A66A 5BW7C 1IX2A 2HUHA 4HWBA 2R4RH 4YX2H 4I0KA 1VCAA 3MUGA 3VNZA 1E5ZA 4KVNH 5GGTL 1QACA 1MHHA 2BPBA 1NA8A 5T1MB 1KCKA 5T33L 4X7TA 1TJXA 3GXUB 2CNZA 3SZ6A 3ABZA 1NDGB 4OIAA 3KG5A 1AJ7L 1MCPH 5I6OA 4P06A 5KBMA 1U95B 3UAAA 3PWNB 1G7PA 2QGCA 2NYZA 4HV8A 1KGCE 1UXMA 2X2UA 2QADB 3ZE0E 2F54E 3EOBA 3AAZA 3UTSD 2AF2A 3OJVC 4LSVL 2H1PL 4B9KC 2DTML 3VI3E 5HYSA 2GY5A 1A3QA 4JRXD 2P8PA 1KPRB 4LBEB 1JYXA 4F27A 5EBWA 4TM9A 4GQRA 2CM6A 2C1PA 4XNYH 1TVHA 2B08A 3Q2LA 4N85A 4FQXA 5CN1A 1D2PA 1P1ZA 2QSQA 4DVRH 3BH4A 4IKJA 2XQBL 2A83B 4UOQA 5EUKA 4K5OA 4ODUB 4KK6D 1NCWL 3IVKB 3IFPA 1AGCA 1TNNA 3MZTA 2ZUYA 5GGRY 5HVGB 2R2EA 5DHMC 2UY6B 3ARQA 3O0LA 5IF0A 1MVFA 2JTYA 3TEXA 1TZIA 1QTSA 2FVNA 5C0EA 4W9DC 3FPXA 2O1AA 3MR9B 1XXFC 1PSKH 3FB7B 1W72L 4E41E 4JDEA 4MD5A 5LN8A 2ZPKL 3N85H 2PYFA 3V6OA 4N0UE 1KFGA 3UGEA 5AL8A 4JK0D 3CLEH 2BX5A 3F7PC 3MCKB 4CMHB 1HDMA 1AO7A 3A5VA 1URIA 3EJTA 1OE3A 3C9NB 1IL1B 4M6OL 5C0BD 2R0KH 3RWCB 2NTFA 4GKZB 5C70A 3G5ZA 4FI8A 5BS0A 4L1BA 4CVUA 3NA9L 2ZNWA 4GLRI 4I0PA 2XV6B 2Z31B 5ERWB 4APQC 3G9VA 3GSXB 5GGUB 5MEQA 4E68A 1XCXA 2OZ4L 4PV1C 2VIRB 3EADA 4OKDA 1RUAH 4DKFH 5F7AA 1B2WL 3JBG7 4UAOC 5DRNB 1T21A 4BE5A 1ETZA 4KOCA 1SY6A 1FVEB 4M5TA 1M9WA 3C09C 4NFDA 5LUMA 2D4FA 4W9EC 5IEHB 1A65A 4L4JA 1MELA 2WGNB 4AVKA 4NWUL 4KHTH 2XN9A 1JNNL 2V0AA 4NQDB 2XTJD 4BH7A 3IETA 2X89D 3D85A 4KAQL 4L8SB 5FW6A 2DQGL 3KWXA 3KPRE 3KW7A 5H35A 4X9YA 1XF5A 3QHZH 4J3XA 4BZ1H 1MG2C 3IBEA 4Z95H 5GISL 3ALPA 3L3HB 3GRWH 3OAZK 3TJEL 4XH2A 4EI0A 3NEXA 4OD3H 3QEHB 3RPBA 2IVFC 3HPJB 1ZVSA 2CJUH 5C7XH 4XE0A 2EH7H 2FR4A 3MA9L 4TVPD 5E6RB 1U4FA 3TV3L 1Q9LB 3MODL 1R5VB 2EDNA 3O4LE 3RG1C 5IKCA 2XPGA 3TBSB 4E2OA 3JV6A 3EOAB 3PNRB 1BFTA 3ZDXB 1UXWB 3OKLA 2X4PB 2FJUB 2J88H 3WIFB 3CVDA 2YAMA 3EYUL 4BWTA 1JNLH 3WL9A 5KN5B 3SBQA 1CFTA 4LVNB 1WTGT 2BHZA 3IB4A 4G5ZL 5ABZA 3IDJA 5CD5C 4GIOA 4XMLL 1IMHC 3T0WA 1SN5A 3G6AA 2C4XA 4IJTA 4J27A 1EXUB 3IFNL 2PYEB 4EEEA 1I8MB 1PNDA 1IM9B 1OARH 4W9FC 4TQ8A 4RGOL 3K71B 3AY4C 1ANUA 1ULVA 1XDTT 2VDNB 4B9IA 3TT3L 1MW1A 2ESVD 5I2IA 1PYWA 2K8MA 5KEZA 1ZS8A 4AQOA 1IBHA 3BSZL 3QS3A 4IBLT 4H26B 4WO4B 1U92B 3LKQB 5KVDL 1J88A 4Y2OA 3FH5A 2DQDL 2ZKHH 4MA7H 5BV7C 5HHOB 1GHFH 4YHKH 1QD0A 3PJNA 4I89A 3TZVD 3S4SB 2VN3A 1RVFL 3GBDA 1SJEB 3SKOB 1OAKH 1QNZL 3DETD 4LSUH 5GRJL 1Q72H 4S0HA 1RZKC 2AEWA 2Y5EA 4JL2A 2NNXA 2AK4A 1TZGH 5ADPH 5FM4A 3MRCB 3DJ9A 4XHJC 3X3FH 4ETYA 5IOPB 3KGSA 5E6YA 2O5NA 1IBYA 5I6XC 2R7EA 4ONFL 4K71C 5DR5L 3FT3B 1NJ9B 3ARVA 3C60C 4FNQA 2J8UF 5EIVA 3VNYA 3WN5B 3LN5A 3QXAB 4P9HC 1FYTD 4HC1H 2YUVA 4MQ7B 4R4BB 3X14B 1PQZB 4ZS7H 4BK8A 4BK5C 3M8OL 5CMAA 3OR6A 2QHLA 4JY4A 5TE6L 4NHUB 2CLVA 3N44B 5C3TA 4ODSH 2A38A 2CKNA 4U2YA 2J20A 5F0MB 4U1SB 1V8HA 3DVIA 5MERB 3QISA 3KBEA 3U83A 1WQVT 4ZT1A 3U2JA 2V8LA 2XYBA 4X98B 5E00A 4BSWB 3QZWG 3CFBA 1FL6B 3SDYL 1TPXC 5CINH 2QPSA 2AQQA 2PN5A 3V5DB 3B7TA 5A2LH 1OTTC 4NIKB 4BBWA 4LK4A 4AK1A 3CV5A 4Z18A 3IXTA 3U0TB 1DFXA 4F2MB 1KJMA 2WO4A 3NAAL 2NY4D 1NC4B 2FLRT 1U4EA 2FECL 5CCJA 4XP9L 2P9RA 5AOKA 4MFHA 4WJG3 2VL4A 2OM5A 1BD2D 5JIDA 3FUDA 4NKOA 1N68A 3O2WL 2ADIA 2C3WA 1G6RA 4JO3L 5KVGE 4XN7A 1KXTA 5F7LB 4FFVC 3VI4F 4E9WA 3L48A 3MLUL 3B9EA 2FRGP 2GUOB 2F74B 3KHQA 3P1VA 3IDIB 4IKIA 5DYFA 3VGHA 3FTXA 1A1NA 4G7SB 2MKWA 2FT8A 3RUGF 2EYRA 3RWDB 4ECNA 4NQTA 3N1PC 5ESAA 4KOBA 1L6XA 1QKZH 4QJ4B 1NCOA 3O9WC 4X5XB 4LF3A 4AMKH 1RV6X 3HI5H 1CE6B 1LK2B 1LEKA 1A7OH 4D8OA 3KW8A 4YBQC 2B4CC 4A7GF 3B8SA 3ZUCA 4Z78A 1RZ8B 2ZX8A 4JPWL 2UWEB 1JHTA 2WB1A 4TV3A 4G42B 1XEUA 3ZDZE 4ALAC 4EAEA 4XO4A 4OI9A 5EA0L 5BVJA 1R24B 2WUBH 2DTSA 3E3QE 2NY7H 1NIFA 2H32B 3HR5B 2PR9A 4Y4HD 4JVUA 1MPAH 2OMWB 3AC0A 2WLIA 4GQ9L 2DBLH 2DWDA 1YPZB 5IB1A 2B4CL 3L95B 1WC7B 4ZBJA 1ZHBB 2G2PA 1MFEH 1XFPA 1RUQL 1A3ZA 3JVGA 1UZ8A 2JE8A 1GSMA 5IIEB 1NAMB 2CKBH 2HT2C 2UXFA 4U6HA 1NFIA 3HAEB 3QUZC 4U6VH 3ZZLA 4BZ1A 5LGHL 2BSED 1ZIBA 5ID1A 1JV5B 3GRWA 3GZPA 3HUJF 4KDWA 5ILTL 3ATEA 4M93B 4XOAA 4PJGA 2YJQA 5HHVL 4LPWA 3NIGF 1NWPA 3WFCL 3WY4A 3FQXB 4N2NA 1HTYA 2OAAA 3LCYA 4YLCA 4CDHA 1PCXA 1IGMH 2I9TA 4P2QB 3G04A 3ZMEA 5H4ZA 3AUWB 2IO5A 4JZOB 4WWKB 5HY9A 3T4AC 3VW3L 3A4EA 4PR5A 4ONOA 1HI6A 1CXLA 4AEIH 2P5WD 1T22B 3EJRA 4LEXL 1YEEL 3CPUA 3W0WB 4LMQE 4XNBA 5F6IC 4PRPD 3QDGE 3LRGA 2BNQD 2XWXA 1IKFH 1JPSH 4JAMB 3DPDA 5C07B 1H8NA 1SY6L 3EUDA 4G3YL 4KRPD 4PMEA 1TDQA 3IAQA 3TYFA 1QRKA 2FH6A 3G6DH 1HKLH 1WISA 2R56H 3L3IB 4JFDD 4MAYA 4EZLA 1K4DA 2OJEB 3GSUB 4WEBH 3F85A 4UWQB 1E65A 2HUEA 4FZ8H 4OUUA 4Y4KC 5KYNA 3MX0B 3BP4A 3QBTB 3QQ3A 2EIZB 1HL8A 2PXYD 5E5UB 3O6KL 1IKNA 4XO5A 4TQHA 4XE5B 1CLYH 2ICEB 4N9GA 1EAPA 5DHYA 3QJHA 3FSOA 4AX3A 5F7DB 2P3YA 1QO3B 4FQIH 1IT9H 2VTFA 5IB2A 1A3RH 2H4EA 4MNGE 4PJHE 1TR7A 3ARDD 5BPPA 1CVRA 4BWUA 1WIUA 3U4AA 1S3KL 2DMCA 4Q2ZA 4OFQA 3FCSB 4M1GH 3IGAB 2YPKB 4GKNB 4PJ8C 4FRWA 1Y6MR 3IDXH 5B7FA 5KS9E 1TCMA 1DLFH 2BRRH 3BKML 5E6SB 4RSVA 2J1ZA 5C0FA 1CG9B 3F12A 3VWKD 2VLKA 5IR1A 2YK1H 1PZ3A 3HNVH 2XZAL 2V5YA 5AG8A 4DP7X 1AXSA 3MRRB 4LSSL 1E4WL 4YDVB 1SDYA 5IMKB 1CGVA 3GHBH 4KGLA 4ODVH 5TH2A 5D7SL 4F8PA 1S9VB 3GMNB 3GSOB 4HC1A 5E5MA 4N2MA 2MQ0A 2GQHA 2I9LB 2YXWA 4FXLA 1U33A 1W0VA 1KGYE 5KJRH 4PS8A 5F0JB 2AQPA 1EWHA 5H94A 2G2RB 3OB0K 5F8QC 2I07A 2MPVA 4TQEH 4NRZB 2D31A 2J7LA 5KTEL 2AJSL 4O02H 1DBML 3DYOA 3UPCA 5C3LD 4A7TA 2IC2A 5D7LA 2EXSA 4ANUA 4NZFA 4OIIL 1HCFX 2B1AH 4WGKA 1A22B 1G0YR 1Z9OA 3N1FC 4KMLB 4JFXB 2GSMB 1BPLB 2XCMC 3AQYA 3QIBB 4G59C 5EN2A 3U6XA 3VD1A 3ETBF 1UUNA 4PWHA 1QAWA 5KSBE 3S36X 4HJJL 1ADQH 3E6HB 3LX9A 4QRPE 1IM3A 2WKOF 1EJOH 4R4FL 5E1HB 2LTQB 1SJXA 4FQLL 4G43B 1HHKB 4FGMA 4PJDF 3I6SA 1ED3B 2JCCF 3GMQA 4BQBA 1E90A 2FEJA 4YN3A 5LBSL 1CYXA 2FT7A 3PCYA 1OZTG 1KTKE 4KQ3H 5DD1L 4YPJA 3X13B 1S9WA 3LEYH 4XN5A 4OZHE 3NPSB 2JKTM 3NQIA 4YX2L 2R4RL 3ZTCC 5HYJB 2XJKA 3HE7A 3DGCR 4LCUB 4ZUTB 2X4TB 5DS8A 3MROB 4KVNL 1ZT4B 2X0UA 2E7LC 3QQ9C 4L2LA 5GS3A 5FO7B 1R5WA 3DX8A 1U91B 4APQD 4WFGD 4G9FD 4UILL 3UAJA 2JKIS 4QY8B 1O7VA 1MWAA 4YVUA 5JIKA 3U7AA 3L4TA 4AT6B 2VYRE 5ETUA 4FAAB 5IFHH 1XIWA 3GJFK 3NESA 2VR9A 5C6TH 1PZ2A 3SDAB 2A6JA 4OQTA 4FLSA 1RHFA 3OG4B 1DQJB 1KJ3L 4WW2B 5IQLA 4X0KA 1MJJB 2DJUA 1YRKA 3P4NB 3JWDC 2RJMA 3UG3A 1KELH 3ESUF 1MRFL 1A6AA 2EH8H 1I85A 1QR4A 3PABA 2ITDA 1KYUA 2OXGB 4GAJL 2A74B 4DVRL 1YMHB 5GGVH 4OI8A 4P2YA 1YMMD 3T3MB 3APFA 4UQEA 3VQ2C 3IU4H 1GGTA 2A73B 1NFDB 4EOWL 4C57C 1SZNA 3JUZA 1KIRA 4J12A 5E5LA 1BYNA 5HPMB 3WNOA 4A2LA 4ODBD 4OZIB 1LDPH 1FJ1B 2CKBA 3Q5TA 1TU2A 1TENA 3HNSH 2Y7MA 3CGTA 3MJ8A 1G6RL 4OLXH 2OMVB 2HG5B 3F7YA 3HRZC 2DN7A 1VACA 4G8IA 1T83C 3EBGA 4U0RC 1X9RA 4RA0C 4AUYA 4HCGA 3N85L 4PJIB 2VXVH 5JZ7D 5CEYA 1UURA 2XFGB 3VWJA 1GIGH 1JGEB 2JKNA 1JWSB 3DVGA 1GXEA 4MHHI 3EOTL 1HSBB 3HS9A 3QJUB 2BZ7A 2A1WL 1ZLWH 5CD5D 5CJXA 4YXLH 5EZOH 1JPFA 2VM4A 3NCXA 5T1KD 1D5MB 1P2CB 4FXTA 1ACZA 4Y19A 5HYSG 4JY6B 3ME0B 5KYUA 3F2LA 2DQTH 4R84A 3T4YB 2MCAA 3D06A 3O6ML 2J8HA 3V0WL 1TTUA 4RAVB 4C54A 1MI5A 5GS1B 2VQ4A 5FK9B 4GQZA 2PPFA 4HT1H 4CN4A 5IW6B 3PQYA 1OP9A 1XCQA 5F3BB 4H4NA 4UV4H 4L1TA 4HIHB 1EERB 2C9RA 4NKDB 3TS8A 1BOYA 3GMRA 3QR1A 4JQIH 2HCZX 3ZOAA 5JXAH 5DUMH 4Y5VA 4CL7A 1P7QB 1LP9A 2J6EH 1A6TB 1C1EH 2PCFB 2X9YA 3H6AA 3WLBA 3NCMA 1N67A 3GRWL 5KOMC 5KBDA 4OD3L 2YWZA 2AS5M 4PJEE 2V4LA 5I8CB 4BJLA 3FSVA 3KYKH 4HJUA 2CJUL 3FT4A 1KTDB 4NO0A 2M8XA 3IDYB 3OR7B 3VFPB 1HOCB 1DEDA 2Y1VA 3QPKA 4XHJD 3FQ2A 4ELMB 1AR2A 3BP5A 5A2FA 5I16B 2YA2A 4HSAC 8FABA 4IYKA 3ML9A 2QTVA 2BVQB 2DKSA 4LKCB 5J3HC 3C60D 3BMVA 3KL3A 3BO8B 4HIIB 2J21A 1JNLL 1RZ7L 3IKCB 3QXDB 4YE4H 1NUFA 5DJXB 4AH2B 5C9JA 1JXFA 3B9DA 2DWTA 4KBPA 1VZIA 5JPMA 4HXAH 1ZCRA 1T6VN 2D4DA 1MXDA 3TNNB 4CNIB 3OKOB 4NI3A 2Y36L 4WEMB 2BH0A 2K4WA 5TGBB 3VU1A 2DWSA 4O51B 5I1JH 3MV9B 4AVJA 1OARL 2OS7A 2PO6B 4IIQC 3PYCA 3UYPA 4QMEA 4BZ2H 4LL4A 1RZJH 1WF5A 2ZKYA 4GXUM 4YXHL 3UTSA 2K70A 4JRXA 4NQCD 4NYLB 1L7TH 1VSCA 1FFRA 5FEBA 4KX7A 1NUDA 3GS7A 4O02A 1HILA 2ZWZA 3KPPA 3MNDA 5TD4A 5C08B 4YDMA 4C59B 2WQUA 1OTTD 3RVVC 2DM2A 2MEJB 2IQAB 4JFZH 3D3VA 1OAKL 3UJJH 1J1OH 3ZMNA 4LCWE 4GO8A 4XXCC 4DW2H 5D2LE 1ADQA 2W59A 4CUCA 5GJTL 3SBPA 2ZOTA 5D1XB 2I24N 1TZGL 5D4HA 1DEEA 2WIMA 3MRBB 3L5XL 4KI5C 4QKTA 3X3FL 4FFVD 1XB3A 5I75C 3QARA 2W0LA 2Q7YB 1DYZA 4JDZB 1NBVL 2K78A 1JTTA 3GC3A 3CZSA 1U2CA 2XA3A 4WK0B 1KJ2H 3LRKA 5C0BA 1VZHA 3BIKB 3UJIH 4YEFA 5EUOF 2UV3A 3O9WD 2V2XB 4HC1L 4L8CB 2OMZA 2ROYA 4YBQD 1YEHH 4PWGA 3IMUA 2ZJSH 1CI5A 5A16A 3BAXA 5BRQA 1KBPA 3D9AL 4OZGF 2WZ5A 1P7BA 3BPNB 1TJIL 4YPGA 4IRSB 3R4DA 1EEUA 3IJ7A 3CG8A 1IEAA 5ICUA 1Z7JA 4FFZH 4ZDHA 3BWUF 1YN6A 5HGHA 4N8PA 2JF1A 4HX1A 5KW9H 1KB3A 3FB6A 3LKRA 3HZVA 4EI6A 5HYIA 3MLXL 1PBYA 1XO8A 5CINL 3EO1B 4LASL 1KIPB 3PP3H 4W4NA 2A7BA 2BSRA 1AHKA 2FJFB 2BVOA 1G9NC 1NL0H 1WD8A 1EHLL 1CDBA 2HT2D 3SB3A 2WXRA 5ALBH 3T6QC 3QUZD 3I02B 3SO5A 1F56A 3P9LA 1I7UB 2R23B 4XMWA 5C09E 3CXDL 4NJAL 4PGCB 5HI4C 3BIBX 3IJHB 2CGRH 4R7DA 2BVUA 1QWNA 3FB8B 1AXIB 3I3BA 2P8LB 4KJWC 3E0GA 5KUMA 2ZXDA 4Q9RH 1MZYA 2F8VA 4JQVC 3AS1A 1BYPA 5EZLA 2IADA 3L5WA 3L3JB 3PHOB 4MDIA 2LOEA 2BCMA 3JYCA 3ECBA 4HUWA 1IQWH 1MWAL 2QBWA 1LK3L 4R83A 3L6FA 1QKZL 4W9ZA 5ICXA 5HYQA 2LLNA 3NA4A 4AMKL 4KZDL 3C8HA 3MJ9L 2F8XC 1A7OL 3BVNB 3DIDA 5J6GB 1CFNB 4OQTL 1T66C 1BV8A 1D7DA 5LQBH 1EO7A 4IU3B 5AUMB 3KGUA 3B9KA 3FUJA 3V8CA 2WUBL 1R46A 4OY9A 3U6XS 3WGUB 4Y4KD 4D8PA 1KDIA 5D1ZC 3MJ7A 3JTTB 4J8QA 1G9MC 4U4BA 4H8WC 2DBLL 2E56A 2ZOKB 4HPYH 1L0QA 5AAWA 1RSYA 4HOWA 4PY7A 5DJ2B 2VQ1B 2X2IA 4KFMA 1NEPA 5GRVL 4JQIA 3VVVA 4OGYH 3MREA 3KPMB 1OSZA 5DXWA 1C8PA 4NHCL 4OCWH 2J6EA 1ZD6A 1S7SA 3ZDYE 1G7IA 4X5RA 3UZVA 5I1LB 2G9HA 1C7TA 1P69B 2F7RA 2J3SA 5D2NA 4PJ8D 1I82A 1WA1X 1J86A 4DGVH 3RRQA 4HK3N 3GB7B 1N8ZA 2VAJA 1EBAA 2QKSA 3QJSB 2J8UA 5L2KD 4Q97A 1IZKA 1I53A 3HE6A 5SWQB 3WE1A 1MCWW 1CURA 5EO9B 4KNTA 2JKJA 2KL6A 3QQ4A 2RH0A 4Q89A 1XD1A 3PAZA 2GK0A 4X6CB 5EORH 1JRHI 1HESA 2BNQB 2GCYB 4B5ZA 1H3XA 1FYTA 1E0OB 4I77H 2WQRA 1ZLDA 1IKFL 1YN7B 4JPKH 5AAMC 4A2HA 2FECI 1NIBA 4U6TA 2GSIA 1JK8B 3MNWB 3QZWB 3CHRA 1HKLL 2X6AA 3PWUA 4XMKH 2R56L 4MCYB 4BFIA 2OTPA 5DD5L 3BXNA 2ATPB 4DPRA 1RIHH 3NG5A 4I3RH 3BVWA 3O41A 2FJHA 4AW7A 4FZ8L 4WTXA 3S3SA 4H2AA 1CF1A 4WI8A 1K6QH 4BZ2A 3NRQA 1X6LA 4JVPA 3KLAA 1X4ZA 4GW5B 1RSFA 2CJTA 2JNZA 4JZJB 3ARDB 4I2XB 5FKAA 4KXZI 2GVYA 4QCIA 5DU7A 1CTNA 1OAXL 2AANA 4FDWA 4XMPH 2RBLA 5DZNA 3BJ91 3IFOB 3ISWA 4HZAA 3SDXE 5B7MA 3RWFA 5AZEL 4KZEH 5EF1A 1V7ML 5DRZA 3FCUB 3L3KB 3OHXB 3QDHA 2AJVH 3L16A 3MBXL 4JREB 3MV7E 3VI4A 2EYSB 2WNKA 4OD1H 4YHML 1FO0L 2BRRL 4K3EH 3SE9H 2G60L 4G6KH 4D94A 4M7LT 2FEEL 3NZ8A 3RUGA 4AY0A 3D18B 3BKJH 1CGSH 4JS7A 1KY6A 1ZTXH 2V3FA 2EVGA 4MTMA 1SHSA 5EIQA 2H6PA 4F7TB 1LO0L 4UOZA 4WHYG 2QR0B 4AQEA 3QQ9D 2V3EA 3MRGB 2EIEA 2QZ5A 4XHQA 5CKGA 2VB5A 4YSRA 5IBTH 1KJ2A 4JM0A 3VXPB 4ZMYA 1CLOL 2X4SA 4MZIA 3NGBC 4LLUA 1A2YA 4UANA 3CSPA 4FLHA 3HBQA 3JZYA 2KHAA 1DQVA 1OB1B 2CGYA 3KXFE 3QUMH 3WY1A 4GG6E 1XGPA 5F9OH 1WIPA 3T1FA 4TQEL 3K0WA 4R4NC 1H3UA 1U9KA 5MEOA 5CEZE 1W72B 4WI2A 1AHWC 3IMBA 1VKXA 2R0WL 1WWCA 3ILDA 2WYHA 1CC3A 3FQUA 4Z0XA 3TXAA 4FFZA 3MXVL 2WMPA 1RKRA 4O58H 5E7BA 3BN9C 2MNJB 3HUJA 5L7XH 1ADQL 3OMIB 5DEJA 4E42B 2YIHA 2CRZA 4TNFA 4B96A 3U7WH 2BSEA 4BM7A 1KCSH 1M2OA 4HWUA 3CFIC 4H1LH 2ZCLL 5D71H 2NUPA 5E6IC 1ZANL 2P5EA 5D6CA 3ZTDC 4MXWH 1DBAL 4LIQL 2BSDA 1KTLB 1AXTL 2K6WA 2WLJA 3BUBA 3HLAB 4JDVB 3L7EA 4JHWL 4KQ3L 4MZ2A 4UUJA 3UJTH 3NRPA 2NUTA 4OB5H 4G8AC 5KBPA 2X2YA 2YGQA 4LEOB 4QGYA 1CTMA 2BFGA 2ZXQA 5HDBE 3WCYA 1PDKB 1XH3A 3SE8H 5AD0B 5AYTA 3FU3A 4HWNA 3TIEA 5FF6A 3ARFA 4NQVB 3B7UX 2N7AA 1X3DA 3KPOA 3TBTB 1M6UA 3IF1B 4YR6A 4B3VA 3VB9A 5I1CH 3Q2VA 5JNYB 1YLBB 1T03H 1FV1B 3IS0X 4XAKD 5KZCD 3LZQA 5DURB 3MRKA 1T0NB 5E2VL 2F2HA 5EV7A 4PFEA 3UTQA 2WXHA 4M1DL 4QXTB 1S3RA 4F8NA 5HHXL 4FQ1H 1PLAA 1U8HA 4JFUA 4RDQG 1UOVA 4N24A 4QEGA 1MCSA 1SM3L 1I7RA 4XMVA 2BJMH 4XZUB 3BT0A 2WXOA 1LWRA 1F90H 4RRPA 4ZS6C 4IRZH 1J12A 1HWGB 3IU4L 3O4OC 4F20A 1QRND 2LW3A 1FVDA 3MLRH 4N8VA 1TQVA 1BZ9A 2ZF9A 3BYYA 4Y1SA 1RCYA 1NBYB 5FYLE 5DUBB 4PJAF 3VDCA 4HGWB 3Q8AA 4G7VH 2WNWA 1CFQB 1AGBB 5I8EB 1LMKA 3HBPA 3ALWA 4OLXL 3ROOB 5JZ7C 5F71A 2ICWB 2V2TA 1BBDL 4X4YA 3GI9H 2P8MA 3SKNA 2VISA 5F96L 2VXVL 3GRGA 4LEEA 3DRQB 4QRTA 1NTDA 3HFMH 2CBPA 4TUJB 2NNAA 4W9JC 4ZJ9A 4D9QD 5J3HD 3HG0A 4EIUA 3AXLB 4FULA 3C6LC 3P0VH 2ZUWA 3D4CA 1NC2B 4FEMA 4QRRD 4G1MA 4FQQB 1X6NA 4PRIE 4RFOH 4YXLL 5DWUL 5E95B 5C0AA 3J8F7 1N4XH 1MAKA 4H8UA 2AV1B 3QUYB 2ARJA 4KJPC 5KSVA 1BIIB 2FGWL 5TDPB 2DI8A 4N2CA 1JRHH 5F6HI 2VDKH 3IE9A 4Z7VB 1AOZA 4ZRGA 3QFGA 1MFCL 2B5IB 4NQEE 4W4OA 4XNUH 1GZPA 1JBJA 3SPVA 4QWWC 1I8KA 5TF0A 4NN6B 5E2WL 3K4DA 1KXQE 3GPEA 4UNTA 1B4JL 2DQUH 3Q5YA 5BRZA 4M8VA 1A6ZB 1H0DB 3ZE2F 3QORC 2J6EL 2WKOA 4ZNEA 2YD7A 1H3TA 3RVVD 1LO5B 4MNQB 1QLRB 2MQCA 3PHQA 4PJDA 4NQUA 2JCCA 3I9GH 5I71C 2ZG2A 3Q13A 4FA8A 4PLOB 2BSSA 3IWVA 3KYKL 4L0ZA 5HHPB 4WKZB 4KXZH 3NZUA 5EOCJ 4LKXB 2SODB 1IQDB 2G4EA 1QSFB 2G3MA 3VJ6B 2NNRA 4PJ5E 4KI5D 3E3QC 2FWOB 4F8QA 5FA4B 1AANA 5DCCA 3VH8A 4BFOA 3UPRA 1GTFA 4KNQA 2Z92B 2KH2B 4WUUE 3ZHNA 3C87A 1FDLL 1F11B 3P0YH 1BQKA 3DROB 4WV1C 3GFUA 3HS0A 4DKEL 2HT4C 4IHOA 2ISDA 3WUZA 3CH1A 2OZNA 1S5HA 2V9UA 1I9EA 3N1GC 1A47A 5GGRA 4HS8H 4Q6IA 3NN8B 3ZRFC 1KV7A 4APQA 4ZI8A 1J9SA 4OD2B 3BEVB 2FD6L 4LLDB 3OWEA 1DBJH 4U1IA 2DW5A 2UVEA 1S7UB 1Y7VA 1AG6A 3P4OB 4DKDC 5KVFE 5HD8C 3CZJA 4JCLA 3ET9F 4NQCB 3GBNH 4K7FB 3QUMA 1NGQH 2P45B 5GZNA 4QHKI 3OZ9L 4HISA 4BXSV 3BZFA 4HK3J 4OZFG 5IBUG 2BIQA 1FL3B 3HEIB 1SJHB 3DXAD 3MFFA 5I9QC 3MXWH 4ZXBC 3MUGB 4DUXA 3MRIA 1TOXA 3VFWA 5LLIC 4F5CA 4AQ8C 2B59B 1MHHB 1QBBA 3C5ZC 4X7TB 5DMIL 4JO2H 4L9LC 4QTIL 5HI4D 2VLJD 1T6WA 2VRKA 1I7ZA 1YJDC 2HJFA 5DD0H 1T7WA 4FG4A 4KJWD 3E2HC 3BZ4A 2ALWA 1UWEH 1MLBB 3EOBB 4H1LA 1BFVH 3HMXA 5HYSB 2K3TA 4FLRA 2ITCA 1AG0A 3QXUA 2H0EA 4WCYH 5E51A 3W3BA 3B5HA 1H15A 1PAZA 5EBWB 5BOZG 3NRFA 3V5KB 4QRQA 2ENPA 4LNRB 4OLVH 4OF0A 4KHXH 4L3EA 2OBGA 4LBAA 3O9WB 1KJ2L 4QHPA 1AQ8A 5EUKB 4FS0A 4YDJA 2YFOA 1HNFA 2ZP8A 3B3IB 3QZOA 2FJGA 5FA3A 4Y89A 1OAQL 3DOSA 2EC9U 1OLZA 3CQQA 4MX7B 5T1KA 3FQWA 1T66D 3VD4A 1YEHL 3QYNA 5AZUA 3NCFB 4N90D 2R2EB 1E8XA 2H41A 3RVUC 3U9PH 4MDJB 1PX8A 5DJYA 5DJ6A 5TF1L 3UTPE 2WSPA 3AY4A 4PWKA 3NOIA 3EYFA 1HVXA 2Q8BH 3C8KB 5D1ZD 4R90H 4U7MA 2EKSB 1OSPH 1N26A 3ARUA 2AJUL 3VFOA 3LKSA 3QXTA 1RMFL 5J06A 4JO1H 4J2QA 4XVJL 1PKQA 5KW9L 1AO7B 2DEYX 1W0YT 3BVXA 2D0FA 1T7XA 2NTFB 3CJJA 1KBGL 3QUZB 5GSRA 2FL5A 2CR3A 1OP5H 4HKJA 4IRZA 2C7UA 2P7TA 1U3JA 1EHNA 1HE8A 3ZIYA 3DSFH 4MZ3A 4IRJC 5KG9B 4HA1A 1YO4A 2F53E 1T21B 3VXTB 2DLIA 4CVXA 1GW6A 5E8EB 2HKHH 2ADFH 2RD0A 2F54D 1QUNA 1R5IB 3O2DL 4Q9RL 1KB9K 1CCZA 1E6JL 4B50A 1JERA 5DFVC 3INOA 3HRPA 3ZE0F 3ALXA 2XN9B 5IQ7H 3K6NA 2PWDA 3STBA 3IJ9A 1KZQA 4AYFA 2V17L 4NCC1 3VI3F 5IEKB 1ES0B 4DGIH 2BNRE 2XPZA 4HPOH 3D7PA 3K7UA 4UDUA 1G7LA 2CAKA 3MAWA 4W1TA 4CC4C 1E6OL 1PAMA 3VFUA 4HMCA 4P2RE 3CDCA 1JG9A 3F65A 1ETA1 1R6VA 3IWUA 5FUZH 1XBRA 2J73A 1NIAA 3GLEA 5LQBL 3KPSA 1PG7L 1PKOA 1KG0A 4Y4KB 1CBJA 1OTUC 2H26B 4OKVB 4BUHA 3K6SA 4P9ML 4E41D 1PZBA 2YOCA 3PJSA 3RFZA 1J1XL 4QJ5B 3GLAA 2CO2A 5IKCB 2CM5A 5IJVA 4W9HC 2WQSA 4C56E 3VDAA 2XIIA 4HPYL 2ZXGA 4DF9A 3WL9B 1ZS2A 3DUSB 1ZE3C 5DI8A 4P46A 3D25A 4JLRB 3L7FB 2W92A 1RUMH 4OCWL 2QSTA 1JZ4A 2VAAA 1D7CA 4POYA 3G6AB 1K8IB 4P2AA 1PU0A 2WLYA 3L4ZA 2JJSC 5EU6E 4B9GA 5F7EH 3X3GH 5BZWB 5DC9B 4XMZA 4HOZA 4KDVA 3LOWA 4DGVL 4HKZB 2KLRA 2JJVA 1TQSA 1XTMA 2FEDC 2VL5A 4WJKB 5E0FA 5I2IB 2W88A 1E30A 4U1NA 3LXAA 5CUSH 3U9UA 1ZS8B 4OAWA 4RGMB 5AVVB 4HUVA 3KYAA 4DEWA 5D5ME 4GRLC 5EUOA 2NDFA 1J8HD 4OF6A 4JUSA 4Y2OB 4CADA 1MCJA 2FWLB 4MD0B 4WIQA 5EORL 3KPRD 4O2FA 2G3ZA 4HKXA 2BIPA 2XNAB 3W9DA 5CILH 4OZGA 4MJ6A 4JG0H 1OOWA 3RKDC 2DYPD 4DOHB 1OCZB 4JM2C 4M00A 5DZOA 4DZ8A 3ZVVA 1FVCB 3HZYA 2CK2A 3FFCD 4I13B 2YMXL 1RIHL 2YPLA 3JWDH 3Q44A 2AK4B 5T3XE 4Z7QB 2ARJQ 4ZX4A 4R4ND 4EI5A 3H1ZA 4XODA 3T0BA 1I9JH 3UYRH 3LN4B 4JVWA 3ISRA 2C4FT 1WIOA 3ZTJH 1IB5A 3SCMC 4AGOA 3V0FA 5GRWA 4XOEA 4M62L 2QFRA 3BN9D 1CR9H 1UA6H 5CCHE 4OCSH 2DICA 3VXUE 3TBVB 2E46A 3QXWA 2X6BA 3ECWA 2AJVL 4RETB 2ZQKA 4OCXL 2CLVB 3GXTA 4OVVA 2CLZA 5E6ID 2W1NA 3T0AA 3SPGA 1ZWIA 1GC1L 3V7AE 1XF1A 3T8VA 1LEGB 1QTPA 2ZUQC 3CN3A 3AM8C 5HJ3B 4B6ZA 4DKTA 4F58H 5JXEA 4GXFA 5FW8A 3UAEA 5DQDH 4JUTA 1U8NB 5IVZA 3AADB 2AFNA 3D0LA 5C71A 2WB7A 3L4VA 3FYIB 4Y2NA 3RVXC 3CFBB 3B37A 2WIIA 5LB1A 2HFFB 1VRSA 1W0WA 1KIUB 1IBBA 3R0NA 1KB9J 2NNCA 5D1ZI 3QCUH 1F2XK 3IN0A 3LV3B 4YSSA 1J0HA 1JS4A 1U2YA 1N64H 1ZY9A 3GXFA 5F88A 4QLRA 4XGZA 3O6FC 5K9OB 5JMOC 3K1KC 4L4VA 3V79C 4KY2A 2DJSA 1PD0A 4G8EB 4OUOA 4AXWA 4LXFA 1BQ5A 3MRQA 4NKOB 4ZD3H 1G6RB 1R3KB 3NIFE 1S7WA 5KSAC 1P84K 5JYMA 3AS2A 2JB5H 4R7NA 1OQXA 1F02I 4ZS6D 1A1NB 2I69A 2EYRB 1A14L 5I66A 4ZQKA 4O58L 5DUPL 4YZWA 5IV2A 5ESAB 3VO0A 5LKNA 5FDWA 4PMFA 1IAII 2JKRM 4HLEA 4L2YA 3STZB 3DGDA 3EH4B 7PCYA 3HRZB 1DQLH 1UD5A 1KCSL 1KUMA 2GTWB 4Z78B 3JV4A 4FD0A 5D71L 3HMXL 5B22A 4RX4D 1JHTB 1TFPA 4PGBA 4PJ8A 2EE0A 3QDMB 1DSWA 4HIEA 1TEYA 4FN0A 3UJTL 2BIHA 5DUJA 2IH3A 2DB8A 4BFFA 5A7BA 3D2UD 3LZLA 3S3PA 1XGQB 2GTQA 1WAEA 4P23C 5L2KA 1FL5A 2JCWA 3C6LD 2XBZA 1CI3M 2YD9A 2DWDB 3VFRA 3D1MC 5I5MA 2DQCH 4FADA 1KLGA 3D87B 3KDPB 1U8MB 1NCIA 1Z9MA 3REWA 4NP4L 4XTRC 2WOYA 1JD7A 1F58L 4KJPD 4JEGB 2K9UA 4U6HB 3DIFB 1QBAA 3R4RA 2AI0H 5C0DA 3VGEA 5DJCA 3QJFA 5MENE 4PJGB 4QWWD 3EH3B 3QEQA 2NY2B 4KKZA 5F3FA 2YWYA 5E4AA 4AJWA 3BCFA 3OVUB 5K59E 4WFHD 2I9TB 1WFMA 3L17A 4FTDA 5HY9B 2HWZL 3J27A 4WI7A 1ONQB 2PP8A 1QRNB 3QORD 1HI6B 2JLLA 3BAKA 2VQTA 1MXGA 1VESA 1QATA 1PJ9A 4PGDA 2PTVA 4F2FA 1AIFA 3MLRL 1UWGL 4UOW0 1D5BB 4UZUA 1BVKA 1VFOA 2GBTA 4GEIA 4LE8A 4NZRH 4Q56A 4ZOAA 1LDSA 3WKPA 1N6QH 4Y4FA 3OGCB 5D7JC 5C9KA 3OM3B 4AITA 4G8GA 3JT2A 1B4RA 4MAYB 5JIMA 35C8L 4DZBB 5IM7B 1FPTL 3U2IA 3VFVA 3ZTNL 4GKSB 4Y16B 2R1YA 3FCGA 4GB9A 3BP4B 4QRRB 4ZFFA 3ZDZF 4QR7A 1PY4A 1H3PH 3P0VL 4IW4C 1HH9A 4G11A 2AQ2A 1EAPB 4YSCA 2HT4D 4HF5H 4OIFA 3S0PA 2IIJA 1A8JH 4K3DL 4UQDA 5IB2B 1AS7A 1P53A 2APTA 5SWSE 5I6PA 4FTVE 4LAQL 3V6FA 1HZKA 1THCA 4HCRH 4JRYE 4ODHH 4AJ0A 4PW4A 3N41B 5HD8D 3TESA 2WXPA 1QI3A 5BO1H 2PETA 2JIXD 4DO4A 3BSHA 4LPTA 3F6IA 4YNYA 1Z0NA 2GJ6B 1YNLH 2DPKA 4FNLL 3F12B 3O8XB 4HUUA 1PIFA 2VLKB 5DD6A 3APNA 3AU0A 4RWYH 3THML 1G9NH 5AW5B 5JDSA 4ZXBD 2FZ3B 2CO6A 1EMTH 4XVTH 1LHZA 2OQJB 2FHFA 3Q06A 2DKMA 1HSAA 5ACZA 4OJEH 1JF1B 5EOTA 2E7CA 2DDQH 3C5ZD 1I8IB 3QDGD 4PRDB 4JE0A 2OSWA 5TH2B 1P84J 4FHJA 2VCOA 5F1KC 2FX9H 1NCCL 3PIQA 1W0VB 4O5LH 5I75B 4QRAA 4X7DC 5AVUB 3HZMB 4UOW1 1ZHKB 5H94B 4UYPA 5AVXB 1M9SA 2I07B 1RJYA 1AFVH 2NY5H 3MMEB 2Q20A 3ARZA 1NCAH 3ZGHA 5IESL 3DRTA 3CN2A 3TL5A 3DV4A 1F2QA 1GGYA 4WFED 3FN0H 4ZO7A 2ZONA 1S8DA 4CMMB 3QJZA 1EUTA 2N56A 4L0PB 4JO8A 1IM3B 3OKMA 1RIVH 5FECA 2VLME 4X4XA 3RVUD 3OJDB 4E9YA 1B9ZA 4X6FA 1KN2H 5HGDA 3FTVA 3GMQB 5FYKE 1U8JB 2TAAA 3FQNB 1G9MH 1KEGL 1FSKB 2Y5TB 1XGTB 1CB4A 4OCMC 4HJEA 1MIMH 1CVSC 1I1YA 2AV7A 4OGZA 3SQBA 4HQQL 3WFBL 1NOLA 4F7EB 4NENA 4G7RB 2Z7ZA 2F9BT 3L9RA 1ZHLB 1ECYA 1GY1A 1QLEH 5DQJB 1U0QA 1X5XA 1MY5A 3OAUH 1D6VL 3V0JA 5E4IA 4YSOA 5DS8B 4PJAA 4UQ3B 5CJQH 1XSOA 4ADIA 4JO2L 2LGNA 4ONGL 4N0FA 1WGVA 3LB6C 1MWAB 3ZHDA 4IRJD 1YECH 4QHMA 1DE4A 2ZP0T 1AP2B 1XIWB 2A4ZA 4YHZH 2A6JB 2DD8L 3P3TA 4K7PL 1E4XI 1IAIH 4MA3A 3WJLC 4HPHA 4X0KB 3ZQWA 5DFVD 4WCYL 3WFEH 1GGIH 2FQFA 2V2WB 4DGYH 2NOYA 5DEGA 3FS9A 3BAEL 4BH8A 3PABB 3WAJA 4Q4IA 4KHXL 2ZXBA 1XBDA 4XCNB 2WTOA 4GRMB 1M4KA 1WS7A 4PY8I 3MUUA 2WKGA 4FQJH 5CIPB 3CFDA 3GTTA 2EZ0C 1PZ5B 1TLMA 2V7HA 3AZUA 3BVTA 3DVNA 2X1PA 4QRPD 3S2CA 1IBZA 2E9IA 2D3NA 4BELD 3J7HA 4H20H 3CFKB 1KMGA 2LABA 5KSBF 5KVEE 3TTSA 2XKSA 1BLNA 1TU2B 2R69A 3MJ8B 4D3CL 1OTUD 3D07A 5MP6L 1BG1A 4MCNA 3F7YB 3AREA 4KJYB 4NQDE 3IAGC 3KL0A 4QOKD 4LLQA 4R90L 1BYOA 2BIIA 4Y9CA 4LZKA 3WIHH 1FG2A 3MDJA 1FZMA 4I3GA 4X99A 5B1JA 4PJFB 1F42A 4M5ZL 1ZTMA 2A6DA 2XQYK 2GEEA 5IVXA 3AXHA 2V9RA 3DVGB 4N0CC 15C8H 3BN3B 4OZHF 4YIQB 1WD9A 2IGLA 3VXOA 1E8YA 1DANT 4H1LG 3TBBA 4Y19B 1PF3A 4KV5E 1BJMA 4NC0B 5KYUB 1EFXA 1H3GA 3T0VA 1OE2A 4QYOA 3BAWA 1MI5B 4GP8B 3ZDXE 3FT2B 2FEDD 2R0LH 4OM0H 4OTXH 2IBGA 3BP7A 3VA6A 1E4HA 1KCBA 3PQYB 1JZIA 3TOPA 2XKNA 2EYTB 4A6YH 3EDDA 5KJ7E 3PNWB 4KH9A 1SXZA 4GRLD 4IKKA 4QXGL 2FSEA 4HS3A 5IQ7L 2XLLA 2XX1A 3GMRB 2EEAA 4R3SB 2CDGB 1T1YA 1CYWA 5IP4A 2IWFA 1A5FL 2PYEE 3RIKA 4DP4X 1T80A 3B2PA 4M6ML 4B41A 3RKDD 3IGLA 5IBUB 4OZFB 4EDWH 1IGCH 4JM2D 3RWIA 5LGKA 5SV3A 4PS7A 3A4FA 5FUZL 5JW5B 2NQ3A 2Y1ZA 5D1QB 1IGIL 3TVMC 3SKMA 3MUJA 3JVFC 2CCVA 4HCRA 4JM2F 3MGAA 4LMQI 3LSOA 3VRIA 4XPAH 4ZQTA 5I1KL 3D39E 3MRJA 1TQTA 5HHOE 3MV8A 3NFPB 1FO0B 2X3CA 2NY3C 3SCMD 1A1OA 3BWAA 4ORGA 5ISZA 3MRNB 3AACA 3EGDA 3LS4H 4P4KC 1P4IH 3DXAA 3ULVE 3FAWA 1VFAB 3AQZA 5JPMB 1QSEA 2G5RA 5CR1A 2MH4A 2P24A 3UABA 4R0LA 1JXKA 3TIDA 1CBVL 3MRFA 3W9EA 5HDWA 4UQ9A 3S2AA 2LE9A 3P4LA 2X4OA 5F7EL 4X7SH 1MH5A 5FYJU 1BAGA 2EIMB 5I28A 2KQMA 5IHZB 3SHSA 1J0JA 1M71A 3D52A 2NSMA 3U4KA 5GGSY 5CUSL 3D50A 3JWNG 1J8HB 3MACL 2MOVA 2IV8A 4MKMA 5HDRA 1S7QA 4ETQB 2DWYA 4X80L 1SJVA 3BUTA 1S9XB 3RVXD 1FNLA 3HG4A 3KPPB 4UU9B 1I31A 2JI2A 3HIZA 1XMWA 2DYPB 4XP5L 4F7CA 3WJJA 4LVEA 4PI0A 4JG0L 3MUHL 2EADA 1VA9A 3V0GA 3D3VB 2DIJA 1R3IH 4TNVF 4DP5X 2QPEB 3FFCB 4OVUA 5DVOA 3U2SB 3K1DA 5CBAA 1L9RA 3O6FD 3OAZH 3NDZE 2EABA 4KVPA 3U0WH 3LY6A 4B7IA 4H0IA 1U6AL 3WTTA 2G5BA 3SQOH 2Z91A 4PJEF 2Q0ZX 1VFMA 1JYWA 1AKJD 4WVRA 3L3OC 1BXVA 3O3EA 3P02A 5D1ZA 5KSAD 1U8CA 2DH2A 5DJDB 3S36H 4ODXA 4RAUB 2B15A 2CHZA 4FMFA 3KE0A 1CUOA 5F9JA 1BIHA 4XPHL 4RCAA 2LU3A 3QO1B 1CR9L 4P99A 4UM9A 5D55A 4TTDC 5I0WA 1BXAA 4NPYA 1FH2A 5E6IB 1UM6L 4Q9QH 2R2BB 3ULSA 4LL1A 1YEKH 3WHE0 5A16B 2EDXA 2Y7OA 3C2AL 1IC5L 4XNMB 5I1HH 3PPEA 3MYJB 3OBAA 4RMTA 3B2VL 2NQCA 4FKKA 3WTYA 3GXPA 3VI3A 2WZPA 1T1ZB 4P23D 4RMRA 2YLHA 3DX6A 2V3DA 4QF1A 1N6UA 3P4MA 4JANB 3IRCA 2F8OA 4U1GB 2UZXA 4HX1B 1E4XH 2F15A 4EI6B 4EIBA 2EKJA 1CL7H 1ZA3B 5KUKA 2UZYB 3EF7A 5DHXB 4XTRD 3GGWB 2UWEE 4F7MA 1FE8L 3AU1A 3ULUL 1I8LC 3AG2B 2MJWA 5AAMA 2X4NB 4LCWD 5MEPB 1KBVA 3SD2A 4EZMA 4AUJA 4MMZA 1I1FA 3PREA 5IB3B 1OO2A 5GGQL 5KVGH 1YPZE 4XWOC 3FQRA 1FH5H 4NB7A 5D2LF 4AV5A 2R15A 4E41A 2B16A 5I6LA 3V4PA 1QSZA 4TUKH 5E4OA 3L5WB 4AL8C 1Y18A 3B6SA 3B43A 3WIHA 4ZMAT 3DV6B 1S6NA 3QJOA 1SLVA 3AY2A 4L29B 3AROA 3WY2A 4C4UA 4PLNC 2IAMC 4YHOH 2OMUA 3SE4C 1DCEA 5D7JD 5CBEA 2DMKA 1ECZA 3WKQA 2NR6A 2Z35B 4FMVA 3RQ3A 4OGQC 4P2QE 2Q76A 3D2UB 4QUOA 3EFFA 4OBSA 4R5TA 4MAUL 5LXGH 1MNNA 3IMVA 3QR0A 1G94A 2MFNA 3O45A 3C6LB 4D8PB 3I50H 1CIUA 2F19L 2WWKT 1NANH 3W0WE 1RFDH 2DLFL 3BIAX 2B77A 1SEQH 3BZEA 1LL1A 2IPTL 4A6YA 3WHE1 1JVOA 1MCHA 5K9JH 5L4JA 2WCPA 4M29A 1PX4A 2F5BL 5C07E 5FM5M 3TBWB 2O5XL 4QRBA 5KYXA 4UM8B 1C5DA 4A63A 4JFOA 4PVBA 2R69L 3FO0H 2KLTA 1OF0A 2BDNL 2H47C 5HGAA 1IAOA 1JPST 1G7IB 1ETJA 3K6IA 4WFFE 5E8OB 5C09D 3RWHA 7FABH 1LO2H 2AI0L 5DFAA 4D9RE 4DPCX 2CMRH 4AG4L 5C8JA 1RL1A 5T3ZE 4HIJB 3EXLA 3O4LA 2BSTB 4N0RA 3BUQA 3QORB 2J8UB 2D9QB 3HE6B 25C8L 3QEGH 2BHYA 4U6YB 3RFRA 4WEUD 3QQ4B 5I71B 1NGYA 3BKYL 3FO2A 1M2VB 1YJDH 2J1XA 4Z76B 5IJKC 2GJRA 3KJ6H 4NZRL 5T1JA 1SQMA 1WFUA 5EN3A 4NN7B 3T6ZA 1PLBA 1ZKAA 3RPIA 2O93L 4PJ7B 3GSWB 3PWUB 4BFIB 2Y06L 4YL4A 4WI0A 2ZKMX 3BXNB 2NY6C 3O41B 2FJHB 2IGTA 5ALCH 2D8KA 4KMTL 3RWJA 5G2NA 2EIBA 1YNTF 1PMYA 1QNIA 1YUHA 4PJ9C 3ARSA 2JXMB 5BJTA 4HF5L 2YAOA 4LLWA 3EBIA 2ED8A 4I9WE 1NLBL 5FKAB 4LCYA 1KCVH 1QQDA 3IJEA 4PJ6A 2Y07H 4TLSA 3S97C 4ODHL 4XB3A 2PTTA 1DVYA 4J4PC 2X9XA 1DTUA 4OM1L 2W9LA 2E7DA 4XBEH 2WUCL 3OX8A 4M3KB 3VI4B 1Z9LA 2N4IA 4N68A 1OPGL 1LEIA 1B4LA 5CSGA 3ZDYF 3FCTA 4CSZA 4RBPH 3NZ8B 3HG1B 3RUGB 4UT7L 5I9QB 1IBGH 4ZXBB 2QKIC 4AQ1A 2AVFA 3SKUD 4ORZC 3H0TB 3NT0A 1B0GA 1OQOA 1CF8L 1X5ZA 2H6PB 4DVBA 1TZOA 3EUUA 4ANVA 1EMTL 1DSYA 2VOTA 3LPFA 4ODWA 4KUZH 3L1OH 4TLTA 5BMFL 1KJ2B 3LB6D 4MJIE 2MNWA 4HDIB 1P6WA 1VFUA 1ZXQA 4UB0H 4PTUA 4N5EC 2FX9L 5IFJB 2E5EA 3EGXB 2C9UA 4AYMC 3BHBA 3CMOH 1OAUL 2XQ0A 3TCLA 1XGPB 4GMSH 4O5LL 3FCBA 3FYEB 4WLCA 2YD0A 5HYJE 1O6VA 4M1CC 5DHEA 3T1FB 1EXHA 3WDIA 2FT6A 3GXMA 2NY5L 3GUFA 2UUDH 4IS6A 3U30B 4Z7NE 1ZLUH 3S34L 2Z7YA 1RLWA 1E4KC 1KC5H 1XVSA 2YQ2A 4Z0XB 2VLLA 2ORBH 3BT2H 1D2OA 4XP4H 4TULH 4WQOA 4BCXA 2WLNA 2VZSA 4Q8BA 3RA7H 2EZ0D 1JWUB 3LKPA 4KVCH 3BQUC 1EEYA 5CGMA 3HUJB 3T8XA 1GYCA 1RIVL 4G6MH 3CFMA 2VITA 4DEPB 4PYHA 2XKUA 1CT8A 4PRBA 1HAUA 1VADA 5JQHC 4G83A 5FB8B 4PEEA 2P5EB 3RWGA 5AVSB 5IROC 3ES6B 3LEXB 4UUJB 1DN0A 5INCA 4Z7OF 4WJ5A 3WENA 2XWBB 1NFDE 4TNGA 5AB0A 1ZE3H 3OF6D 3KR3H 1DQDL 4X9HA 2OI9B 3H54A 1G7QA