2KMWA

Solution structure of at3g03773.1 protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein At3g03773
publication title Solution structure of At3g03773.1 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kmwA01
3IGFA 1X5MA 2N3JA 2CG9X 3EUDA 3Q9QA 4JUTA 2Y22A 2K8QA 3AABA 2N0KA 3L1EA 3QORD 4JUSA 4M5SA 4MJHA 3VQLA 3W1ZA 2O30A 3GT6A 4M5TA 4PCKA 4YLBA 2XCMC 1WH0A 3Q9PA 3J07A 3QORC 2Y1YA 2WJ5A 2BOLA 5DS2A 1WFIA 3QORA 1WGVA 1GMEA 4RZKA 1SHSA 2KMWA 2WJ7A 2MNWA 4ZJ9A 4YDZA 3N3EA 3GLAA 3L1GA 1RL1A 3L1FA 1EJFA 2KLRA 3AACA 3QORB 4I88A 4YE0A 5DS1A 4ELDA 4YLCA 4PBDA 3GUFA 4FEIA 4YL9A 2CR0A 2Y1ZA 3VQMA 5LUMA 2JKIS 2RH0A
chains in the Genus database with same CATH superfamily
4NO3A 2VIRA 5CSBA 3L2LA 1EEZA 4IHOB 4WU7A 5DTFA 3UEQA 4IU2B 3QUZD 2CHDA 4M43L 1ZT4A 3KYOB 3I3DA 5DVOA 2QPFA 4YDMA 4IRSB 5JHLH 3TBSA 4PWFA 1LNUB 1EDYA 4LEOA 3M17B 1HU8A 2WTRA 3B2XA 1MCKA 4YHYB 1CGWA 4HH9A 1S5HA 1EPFA 3QEUB 1CFVH 5FX3A 2DYPD 3FUHA 3NFNA 1QR1B 4AVIA 5EU4A 1SBBA 2WCSA 4U1KA 4AYFB 2J6WA 2Y9RT 4JRXD 3EYFB 2OQJB 3PJSB 4MJIE 4GAJH 1E6JH 3IS1X 4H2CA 1AHWC 1N0XH 4XT1C 3GSVB 3I6GB 4JGMA 4F24A 4BZ1L 2IDFA 4KK5D 4NKMB 4E41E 1RVFH 3ZX1A 4AM0A 3JT0A 4CU8A 2BSTA 1E4KC 2KZ1B 1U4EA 1H3XA 2EJ1A 5DFTA 3ULVL 2VMEA 3S7GA 1F56A 4Z7IA 3QA3B 1QLRA 2X38A 4KKCD 5FHBL 2A1WL 4BD4A 3SDAC 2JKSA 3IF1B 1OCWH 3QZWB 1U8QA 2OZNA 1NLDH 4LDEB 5ISZB 3MOAH 4DGIL 1ZLVK 3CLFL 1OKEA 3S3SA 3CN3A 1QLFA 3MFFB 1G6RA 1AQKH 3EW3B 4U6TA 4PU2A 1PGRB 2QMKA 2WQ8A 3DX7A 3LZOA 2JKJA 3FBKA 4R90L 2EINB 1L9SA 4XPTH 1IARB 3KVPA 5JLZA 4JM4H 1LE9A 2AITA 3IJ9A 1DSFL 3EO9H 3S5LB 4I0CC 1Q94B 1XAKA 1YG9A 2ZXDA 1P4LA 4F15C 2H6PA 2C7UB 3DX8A 1MY5A 2W95A 2W9EH 3MRDA 1K6QL 4JRYE 4J7RA 4J2QA 3UACA 4DH2A 2VISA 1CI5A 2ODHA 3BAXA 4LEXL 4Y4HD 4Z77A 3PWUB 4X9FA 2DKMA 5D7JD 1GZHC 3DI3B 2FJHA 4RBPK 3H54A 1K4DB 1NCWH 2ESVB 4IYKA 4KY1L 5MEPB 1QNZH 1QOKA 2C8NA 2ENPA 2E59A 4WFFD 2NUTA 2FH8A 2NX5E 1MCDA 2RMNA 3LN4A 5HGHA 3M8OL 2QSTA 4L3EE 1G0XA 3OX8A 5E2WH 2G5BB 2XY2A 3VSUA 1T5XA 3BGMB 1VGKB 4XMWA 3RX8A 4BKTC 4R8WL 2CM5A 4GP8B 4C56B 4BFOA 4GY4A 1WG3A 4XAWL 2WB7A 4HIPA 2G9HA 5KJ7E 3RBGA 3LEVL 3LXUX 2WOYA 3UTTD 5JUEL 1XXFC 3FTSA 1I75A 3KLHC 3FN9A 1L9PA 4CW1A 4K2UH 4LLDA 3VTMA 4ZUVB 4HAKA 5CEZL 4O5LH 3TBVA 1YUKB 4IBSA 4TSCH 5DA0B 5ITBH 1MW2A 2QPEB 4NO2B 2ZUXA 1IT9L 1FL5B 2X4TB 5HGAA 2NY3B 43CAB 1DVTA 4X8CA 3MLWH 3UJJL 1BX2B 5TFSL 4H13C 1J1XH 4RISH 4HUKB 4LL1A 4CBZA 2IALA 4WY7H 4KUZH 5E6IA 5EZPA 5IF0B 1E8ZA 2E4TA 4M56A 4PJCA 2NUPB 4NO3B 4DKTA 4KZDH 2OJZH 4HJIA 5EU5B 1L6XA 3SDCA 1YECL 4XNUL 43C9B 1MHHB 3UTPD 1KCVH 5FO8B 2VR4A 1G4RA 5C0RL 3GZPA 3S8WA 3FT2B 4R9HA 4MDJB 1AZZC 1MW1A 1S3KL 2H0EA 2X1WL 3BE1L 4MMZA 5EV7A 2IEPA 1LP9B 2XKNB 2FNBA 5F97E 2WIIA 3UTPE 2EE6A 1U3JA 3D2UD 3OLEA 4OY9A 3K2UH 1H9DA 4NPYA 3V0DA 1DVQA 2CO4A 2XTJD 3CH8A 1J05A 1NCDH 4JFVA 1SDYA 3V5KB 2O5NA 3DX1A 1QSFB 3COOA 2W07B 2A6IB 3EF7A 4YK4C 5E5RB 4X0KA 5EU4B 2BIQA 2P80A 3VRLE 3LOWA 5HHOD 3SY0A 4DQAA 1CF8H 2GHWB 1D5ZB 1JCVA 1WS8A 4WO4C 1MRCH 2CUIA 3CTTA 1G9MC 4DP2X 4D9RE 1PLBA 2YOCA 1WBYA 5HI3C 3TO2A 2OW7A 1A7PH 3FYIB 1ORQB 3TV3H 4MJ5A 4BK5A 5E00A 4NWTH 3MREA 4ANWA 3HAEH 3QUYD 1KXVC 2EDWA 1J9QA 2E7MA 4NM4H 5DUBA 3CFKA 2ATPB 1DEEA 1YMMD 3CXDL 2GQHA 1MEXL 2VR7A 4K71B 5EDSA 3NGBB 1DLFH 1ZVHA 1WT5A 1YMME 2A6KB 2YD7A 2AJXL 6FABL 3NT0A 1M3JA 3KH4A 2FECI 4MNQB 3IDMB 2KDYA 1H5BC 2P5WD 3NAAH 4I0PD 4L5FE 4RVBA 3SYAA 5F1NB 2BJMH 1EJOL 1UD8A 1FHNA 3NUKA 2RAMA 3ARRA 4QO1B 5H4YA 1P4LB 5D7SH 1Z5HA 3VGBA 4AYSA 1IGTA 4HKJA 3EFOA 4U7MA 1BVKB 2Z35B 2B3RA 2JCCE 3L81A 3D51A 3OG4B 1OE2A 2PF6A 3PNRB 4UOQA 4PRBA 5HYJE 3LJ3A 3B8SA 2VSCA 3SYCA 2ZSWA 3FU8A 5DK0A 3PP4H 1PMYA 5HVFB 2WNGA 3LRGA 4HSAC 2NUTB 4IQHA 4MD5B 4NM8H 3R1GH 4D0BA 5CLYA 2GCYA 2QQNL 1N4XH 3MNZA 3ML9A 5FM5O 3OX8B 1S7QA 4L1SA 5DHYB 3VRIB 3WBDA 1U21A 1T5XB 4WI7A 4WI8A 1MCLA 3ULVF 5EOQL 3H53A 1DR9A 4U4BA 3TBYA 5GRUH 3ETBJ 4KX8A 4Z0XA 2GBTA 2ROXA 4PCKA 1A1NA 4YN3A 3RVUD 4PV8A 4F33B 4HUVA 4GAAA 4BUHA 5IESL 4LVNB 1T1WA 1BBDH 5IHLB 5IT2L 2C3HA 3LNIA 4X6DA 2WCGA 4GW5A 4DO6A 1DVUA 1NC2A 4NZUL 1C9SA 5EZOL 1IC4H 4YLQT 1OOWA 5JHMA 1HINH 3I6SA 3CZKA 3PIQB 3RVXD 2NY0B 1P0SE 1RZ7L 3KWUA 2GC7C 4JFFD 4XCFL 4NHUA 4OLXL 1KZYA 3MUZ1 3S4SB 4G6KH 4ZW5A 4CSTA 1OTUC 3SCMA 2OP4L 2FIKA 1I1FB 2FBOJ 3FONA 5IVXA 2JKXA 3PFQA 5DRZA 4OV5B 2CGRH 4XPBH 4WKZB 4GRLC 3B9KC 3GJEB 5HYQB 1PS3A 3MRIA 5HJ3A 4MMZB 3HCVB 4P2RB 5L9DL 3C2AL 2YWZA 3SO3C 3MV8B 5D96B 4YX2H 1EFQA 1HSBB 1MFCL 2BNRE 3NP3A 3INUH 2OI9B 1WVZA 5DXWA 1XGQB 4NPYB 1F8TL 1VFOA 5T3ZH 2AXGB 1HHKA 3ARGC 4KVPA 3C5XA 3UCQA 3UYRH 4AG4H 3ZL2A 5KS9A 3MJ8A 4K3EL 1NGXA 4WEUD 4PB9L 4PJ9A 2AQSA 4N2EA 3TC9A 5F7KC 2XICA 5HY9A 3GBNL 4JZJB 4BK4A 5KVDE 3MRQA 5AAWC 4XWGL 3SY0B 4GSDH 3OXSB 5JIDA 4YDVA 1CD1A 4XB7A 3IFLH 1P6WA 1OP5H 2IFFH 3WAKA 1NGZA 5CGYD 1KTDB 1OHZA 4Y4FC 4CL7A 3ZDYF 3FOMB 1CIUA 1RZGB 1XF1A 3RJDA 3VG0H 1A4BA 4PLOB 1YEJL 4ZO9A 5C71A 4Z23A 5IFAH 1JPGB 4PLKC 2WINA 4IMLA 4YS4A 2W60B 1DEEB 2I07A 1QBLL 3GMRB 3TO4A 3WEAA 5JA9A 1X5AA 4GEIA 4UT6H 5H2BB 4F37K 1OANA 2QGCA 1BOGA 2R9HC 1AH1A 3UPRA 1WSST 2J8UA 1INEH 4NFCA 3S88H 2VR5A 5ESVA 1SJVA 5B1BB 4F7EA 2OCCB 2WWKT 2D7PA 4JBSA 4FX5A 4NUGL 5EBMB 4IOIB 1OAKL 4PMFA 1S9KC 4J3WA 3STBA 4Y2DB 1GPOL 2F2HA 1W9XA 4U3XA 1OLZA 3BO8A 2YQGA 3TX4A 2J20A 5DK0B 2HG0A 3FQ1A 3JVGA 2NY6C 3L1OH 4FFYL 5JW3L 1ZT1A 1COBA 2A9NL 3L1FA 4HALA 3C6LD 1WBZA 5EIQA 2ENYA 4POYA 2Y2YA 1JF6A 4XI5C 5IK3A 2CSPA 2ICCA 5HP5A 4TQIA 5F2FA 3PQYE 1NCCH 4FNUA 3T3MB 1R19A 3K81A 3O8XB 3B2VH 2G0LA 4G7YL 2DQTH 1DJZA 4Z0XB 2XN9A 3DJZA 3JTSA 2YD6A 1KYOJ 4GMSH 3KWTA 4Z8FL 1J5CA 1BZ7B 2XZAL 4L2LA 5GISL 2AK1L 4P3CL 3P1VA 5FC9A 5I6MA 4P59L 1CE6A 1OZUA 3F2LA 2FJFB 4R97B 5I8OH 5C0GB 2YWYA 2V7NB 1A8ZA 4G7RB 1L6PA 1OZTG 3MNVA 4LLUB 5MEND 1HXYB 2A9ML 4OCNC 4MASA 3K8MA 3AS2A 4LRNH 2J1XA 2EKSA 5DK2A 4PJAF 5DHMC 4PN6A 3PAYA 4PRPB 5EUKA 2FGZA 2ZAHA 3MUJA 4R7DA 5I1AA 1HE7A 3FUKA 5CU9A 2E5EA 2XPGB 1YEGL 3J07A 5KW9L 5EEUA 3F6IA 4HXBL 2FIKB 5D9SA 1WFMA 3QWRD 3TIEA 5EEWA 4LFHD 1TJIH 3L3HB 5IVXB 3X13B 4KJQC 1HEZA 4Z7VA 3E2HB 1BQRA 4QUOA 3MRIB 3PPEA 4WWKA 5HJ3B 4IS6A 1UFUA 3NMEA 3TURA 3T0DA 4DZBA 1YMHA 3UGUA 2VTFA 5D6DC 4XMPL 4JZOA 4NLAA 1K2DA 8PAZA 1I9IL 2N0KA 4M1GH 5FFOA 4BFRA 1MNNA 1FN4B 5K59E 2DI8A 1ACXA 3SDDA 3F83A 1ZMYA 2G0KA 2I60H 2JTDA 1WIPA 5AAMC 2NTSP 1OAQH 4FXGC 3QFDA 1T6WA 2X2UA 3LS5L 4PAZA 3LKQA 2YQBA 3DURB 5IB4A 4J8QA 3RUGA 3F05A 3C09B 3A21A 5LNDA 4X4XA 2DJMA 2E76C 1Q0EA 4WCYL 4F3FA 1A6VL 1QFHA 3MKKA 4UINL 2Q3XA 3MCG1 4OFVA 3HC0B 1YQVL 1UXSA 3GWJA 2ISDA 4NN6B 2FR4B 1RJYA 1I1CA 4GIAA 1QEWA 1EDQA 2JH2A 2AF2A 2WINB 5HD8D 4DJMA 4ZFFA 5HDBF 1UB6A 3IU3A 5CHNB 1JNHA 3KLKA 2MJWA 3WO4B 1DE4B 1QFWI 3QNZA 1KTLB 2WWKO 3M46A 3QIWC 4P07A 5E1AA 2PR4H 2KLSA 1DQKA 5GS0H 5I19L 4JKKA 1YY8A 4GUCA 3TYFB 4PS4L 2PCPB 1TOXA 3T2QA 4A6YA 1DBAL 2K4AA 1A3RH 2DWYA 3MXWL 4OR1A 1IVTA 3IDYB 4TPRL 5E95B 3U46A 3UAJC 4BFJA 3UJIL 4OF8A 4DGVL 1XL6A 3KPSA 4RMWA 3GMQB 3KXFB 2ZCKL 1WK0A 2XQBL 4U0QB 1YEDB 3O4OC 1FH5L 1SLUA 5KN5A 4ZPTB 4M8RA 4AUYA 2H45A 4AEIH 4QPEA 3QXAA 5D2NB 4GW4B 4IOSD 1IL1A 3UTSD 5K69A 4HWZB 4QRQA 4XCYB 5F7FA 5G4MA 3TF7C 4MS8C 3WMPA 4J3BA 4YUEL 2YEZB 1KIUB 2AEQL 4W9IC 3UTSE 3TEXA 2X9YA 1RZ8A 1EAOA 4LCVA 1V8HA 3H0TB 3TASA 4TQ8A 4JO2L 3SY6A 3KLAB 4QHMB 3CDGB 1KBVA 3QUZA 4HFUH 3IMWA 3BCDA 4KI5F 3RDTD 2XN9B 3IDNB 5BZWB 3QJVB 1KY6A 1J1OH 4IRZL 2O6CA 3UL4A 1UA6L 3IDGA 4MJ2A 4KI5C 1CE6B 5D7IE 2YN5A 5D7KD 5CJBA 5SWSD 3GRWL 5MEQB 1DZ0A 1RULL 3KYMA 3DXAD 3I02B 3IMVA 4N1EA 2VR9A 1P4IL 2VUOA 4Q9RH 1C16B 4PVNA 5BZZA 3Q8CA 2WQSA 2BSRB 2O26U 5D7KE 1SYVA 5SWSE 3ML8A 3ZKND 2DYPA 3DVNA 5DJ0B 5CBEA 4KMTH 3AM8C 3LKRA 5I1AB 3GUTA 1N5YL 3E0GA 2YKKA 2HT4C 3GEWB 1DVFB 4JRXA 5L7XL 4O02A 2EYSA 1HI6A 3V4PA 3NRFA 2DQUL 4U6XA 3TIEB 5C0DB 3QZBA 1DDTA 3HZKA 2C3VA 2FHBA 2UUDH 3CFTA 3JV4A 1KPVA 1XF5B 3MQIA 3TJEH 4PJHA 1BG1A 3OHXA 1MCFA 2DI9A 1EZVX 3Q43A 4IS6B 5IUCA 4PJ7A 3FQTA 3VXNA 35C8L 2IGFL 1J0HA 1UM4L 3ZE0E 3QDME 1NTDA 1K2DB 4I3RH 3VWJB 1EHNA 5TDPB 1TR7A 3VJ6B 1E4JA 1JE6A 3QFJE 5JW4Q 3EYQC 2DQJH 3QIBB 3FW6A 4G7QB 4UIKH 2KLRA 7TAAA 5FO9A 1VGEL 1IM3D 1V3KA 4BQBA 3DSNA 1CGUA 2QPDB 3HR5A 3M7OA 4M02A 2KKQA 3TJHC 3ZR5A 3FU9A 3H6AA 3P9MA 4MFHA 4PH8A 4Y7MA 1FNFA 1X4XA 1A25A 4NJ9H 3STLB 5JHBA 1NJ9A 4LPWA 1JERA 5CJ5A 3QG6B 1QASA 2BSEA 4OJFH 3AS1A 2H8PA 2RCSH 1AMXA 3TA3C 2UUDK 4Y4HA 4ZO8A 3N9GL 3ZT7A 2GSMB 1MHCA 1NGQH 1WEJL 3NCFB 4OZGA 5F8QC 1MFNA 4FA6A 3WIHH 1BPVA 2D31A 2XBTA 4N24A 4ZFFB 3RU8H 1SN5A 5I8CB 1JZ3A 2JXMB 1HHHA 1XR9A 3CZGA 4G9FB 4PGZA 2XZQL 4EZKA 4HZAA 4P0DA 5ENWA 1S7RB 2VXQA 5ANMB 3V0WH 1YY8B 3VFOB 1I82A 1Y6NR 2ICEB 5A2LH 2I9TA 4M7LH 4M5SA 4XNQA 2X6MA 3IJSB 5DJYB 3QQ3A 2BHZA 2DYRB 4R0LB 1TKWA 1QMUA 4MVBD 3UTTA 2V2TA 3PPSA 4H8VA 4KHXH 3WN5C 5BRZD 3U6XA 2FSDA 2EH8H 2AJYL 4JZNB 2J88L 5I6XC 3HNSL 4MA1C 4RRPG 1WFOA 1KIPA 4ZXBB 1EBPA 2ADGA 3QXAB 1XIWD 3CG8A 4QXTB 3KPRA 1DQDH 1T7WA 5D5MA 3SPIA 1IC7H 1A3ZA 2QDWA 4G43A 1UWYA 3QT2A 3GSNA 4R2GD 4BXSV 1KIQB 4KDTA 4Z1PA 1E30A 3EYOA 1OAUH 5C86A 1D9KC 1CICB 3HAEB 1HIMH 2P28B 1ZVYA 1ZA3A 4Y5YA 3WDJA 1JDDA 3UYOD 2JJTC 4Y2OA 4DNLA 4OZIA 4UTBA 2D2OA 3GMLB 5BVJB 1M05A 5EO1A 5A2AA 4GRWH 1FZKB 3RX9A 2WWOA 4ADGA 4PGDA 4NBXB 2GFBB 2XETA 4GI8A 3HC2A 3L6FA 4I9XA 3BPLB 5T1MB 4IU3A 1JXKA 1U30A 4TSBH 5BUAA 1U3ZA 5JHLL 2DZEA 3KYMB 5JOPE 4HKXA 2R83A 4P5RA 4J3OD 4HBQA 5GZOC 5IJCC 3KAAA 3GS0A 5E0QA 4BWWA 4OLZH 5AKRA 2A73A 2G2RB 4Q89A 4D8PA 3GXIA 4LCYA 4NDMB 3UXFA 3VFWA 1SNRA 1UZ6E 1WFIA 3HOGA 1CFVL 2WYHA 3GUTB 3H7BA 2BIHA 3RB5A 1GGUA 2EE9A 5HHOA 1P5UC 1LXMA 1NKGA 4ZMQA 4AW4A 4QT5B 3TWYA 5BZXA 5DZPA 5CMAB 3AU0A 3DX3A 4GAJL 1KPVB 1E6JL 1DJHA 3TJPA 4PJ5A 1N0XL 4PJGE 4NO0A 4NC1C 2PXYD 1F6LL 3D85B 3VFPA 3ZTDC 4RFNC 3HFFA 2DMBA 1WZKA 1RVFL 3AGVA 1T20B 4CVWA 3ECBB 5DD1H 1YY9D 2IMMA 4KK6C 2NNFA 3OR6A 1MCQA 1MCHA 1B88A 2ZUSA 5AVRB 4BWTA 3MUUA 2ICWA 2OMYA 1PZAA 3PAVA 1F11B 4PJ8C 3S98A 4E42B 1HFUA 2RIKA 4X80H 3JV6B 5INCA 1NDTA 4PR5A 2FLMA 1Y6MR 4WUUA 1OCWL 3VFSB 4PG2C 1NLDL 4RRPA 3IE9A 3MOAL 1HWWA 2R2HB 3ULSA 2H5UA 4I0PA 2P5WA 4G83A 3AWGA 1AQKL 2J56A 2XNAA 5DRNA 4XPTL 1VERA 2HA1A 3GSRB 4JM4L 2C9SA 1IEBB 2LVCA 3EO9L 3FUJA 4U6HB 3ZR6A 3DTUB 4J6IA 1NGYA 2XPYA 4JLRA 2APFA 1TQVA 3LHPH 2W9EL 2Y07L 3MV7A 1PLGH 3DMMC 2R1XA 4AYDC 4TRPH 2WY3B 2D31B 3EOTH 3QIUA 4PBXA 2NT1A 4HSQA 2GHZA 3SDAD 1NCWL 2J55A 1HHHB 1QNZL 4AUUA 1M3IA 1T1XA 1ZE3H 3ARDC 3MCLH 3VA2C 1R5VA 4NNYB 1QRKA 4LOEA 1CIDA 5FW8A 4A63A 4JM2F 5E2WL 5ICZB 1JWMB 3Q06A 4G82A 1XZ0A 1KG0B 5AOMA 2DM4A 2KHAA 3QQ3B 4KX7A 2QADC 3WNNA 5D93B 3T3MF 3IGAA 4JM2C 4QRUA 3OTTA 1U3NA 2FWLB 3ROLB 4TLUA 3JV0A 3EGDA 5AB2A 5ES4B 2HUHA 3CQFA 4K2UL 1UZGA 3UZQB 3F3HA 3KPRB 4O5LL 4X6CA 3GSWA 4TSCL 1TPXC 5ITBL 3L3DA 1SVCP 4BQ6A 4NHCH 4JFFA 3C6SB 4RISL 4JQIA 2ARJQ 2X5PA 1DBML 3MLSH 4WY7L 4KUZL 4QR7A 3VXSB 4JFWA 4X4MA 3TZVC 3GLAA 2F6AA 4OZIB 1PZCA 3MX0A 4HEME 5EO1B 3AG3B 3G5VB 4KZDL 1U3HD 2OJZL 5FM4A 2PW1A 4LHJB 5IFJB 2N4IA 5C0JA 1G9EA 4K9EC 4ONHB 4YDJB 5LGHH 4K0OA 1KCVL 3CFBB 2Y4SA 3ARPA 4HZLB 2EE0A 2DIJA 4FG6C 1LD9A 5C07B 5SWZB 3KW7A 5DC0A 3UYPB 3K2UL 3DRQB 3MNDA 2EEBA 1NCDL 2IANB 1DUZB 4J27A 4ZBJA 4B9GA 3D25A 4U1IB 1NDMA 1MFBH 4TUOB 4HA1A 4AXWA 1N7MH 3MACH 3MJWA 3BUBA 3EBHA 5FKPB 3SJVB 2OZ4H 2VABB 2EYTA 1NCBH 5IBLD 1MRCL 5FB8A 4NBYB 3I3BA 1KULA 1UB5A 2DN7A 3AMLA 4NO0B 1A7PL 2A6DB 2DOCA 4KK9C 3TV3L 3V8OA 1B3JA 1S9XB 4NAQA 5DRXA 3EJZC 3R0NA 2DI7A 2NXYB 4G5AA 1SOKA 4F2MA 3BP7A 3GEFA 4M9PA 3SYOA 3MJ9H 4NM4L 1YVLA 1ZV9A 2DM7A 3Q2CA 1OL0A 3HI6H 4PR5B 2PABA 4WUUB 2X4NA 5LN4A 5L2JB 2OAAA 4RESB 1DLFL 2GK0A 1CFNA 1G1KA 3J8F7 1YNTA 3I9PA 2VOTA 4KOBA 4URKA 3RWFB 1HL8A 3LD8C 4K5PA 5LB1A 2XNAB 3NAAL 4KY2A 2VLRE 5GIRA 2BJML 5I16A 4X4KA 3IDXH 3DHPA 3OAYH 4YBQC 2A9BA 3H42H 4BINA 4P9HH 5KOVC 3KR3H 1I9JL 3BW9A 3U4EA 1NLBH 3BPNB 4DERA 4Q14A 1L0XA 3D48R 3PP4L 1IVLA 1WISA 5EEYA 3KCWA 4QGYA 4LOFA 3MJ7A 4IGBC 3OGOE 5C2BH 4NM8L 3R1GL 3K4DA 3O41A 1L5GA 1SFHA 4QTIH 3HB3C 4XP1H 1N4XL 4NRZA 4QHNB 3U6XS 2F1EA 1E7UA 3KM1A 2FCBA 3U1PA 5D1XA 1WUZA 1XH0A 5GRUL 4XO5A 4PJXE 3H3PH 4NQEB 3BPCA 2JI2A 1ZWIA 2WKOA 1TZ8A 3SGEH 2XWTB 3BSZH 3T3PE 3M6DA 3ZYIA 1BBDL 1JF1A 5KVGH 2WANA 5BRPA 3HBQA 5MENA 3HRZC 1I7UA 1S7SA 2VJXA 3T09A 2JB6A 5GSRA 1IC4L 1YYCA 3N40P 3L3DB 3ZQXA 1RLBA 3EHBC 1HINL 3SE3A 3QUHA 1AIFA 1QHOA 1P6AB 4GBXC 2PP8A 1MLCA 4NCC2 2FGWH 2YUVA 4X98B 4K7PX 4G6KL 2AW2A 3IMRA 3MLUH 1ETA1 3PHOB 3VFTA 3GM0A 5CR8A 2CGRL 4XPBL 5SWQB 3GIVA 1R17A 1PPIA 4OLYH 1NKRA 5J9PB 4OVUA 4ZNCD 4P2QB 3ZUCA 2OXHB 1S9VB 5EEXA 4JN2B 4KGLA 5TE4H 2IG2H 5E51A 2JKTM 1P1ZB 1QO3B 2WNKA 4YX2L 4B6ZA 3ILQD 5HYEA 3LZFL 4XMZA 3INUL 4C59B 2YPVA 4V1DD 4JY6B 5T3ZL 3UYRL 1MFVA 2QZQA 4FG2A 4AG4L 5B4MC 5FW6A 3IETB 4QF1A 1AG6A 2LT9A 3D25B 3O6FC 2ENQA 3QXDA 4WNQA 1EVUA 5HVHC 2ZXAA 4V1DE 3DJSA 1S9WA 4YXHH 1OTUD 4UIMA 4OLUH 3WKYA 2P46B 2X6VA 1MI5D 3L9RB 4JPVH 1CYWA 1IBBA 4GSDL 3DETC 1X7TA 3B9KD 3P9LB 3ZE1B 2FWSA 5FB8B 3FSOA 1UB5B 4PSRA 3IFLL 3ULUF 1MI5E 1U8JB 2IFFL 3RTQC 4OM0H 1QUNB 1VFAB 3BLBA 3MBWB 1ZTXH 2ED8A 2EDFA 1N2RB 1JXJA 2R2EA 3QDGB 1AI1H 3QQ9D 2PO6D 3KYKH 3U79A 4F9LC 5KAQF 3VG0L 3ULUC 3VAEA 5EF1A 5TK4A 1QZ1A 5KS9F 1DCEA 4YL4A 4I3SL 4O2EB 5IFAL 1DQQA 2YD4A 3HHRB 2DWEB 5FYLE 3B7RL 2FTAA 2MQGA 4I1RA 3VGAB 4LCUB 5JOFB 2H0PA 1UUNA 2H32A 1HHGB 4L0ZA 2ZOWA 4UT6L 3QCTH 4N26A 2V37A 5J13B 5AVQB 4YHMH 5SX4H 4NYLA 2J3SA 3T6WA 1USZA 1INEL 3S88L 4U05A 1MJ8H 5LGJB 3ARQA 3MOQA 4BKLB 2ZF8A 4NQXA 4FOMA 1MW3A 4AJVA 1E40A 4ZS7H 1Z9MA 3CFUA 5I16B 4HOZA 1T6BX 1MVUB 4BZ2A 1FYTD 3WJMA 1AR1B 2V3FA 2X3AA 1SQ2N 4GRMB 4L8DA 4PLKD 4MNGE 1J1PH 1FUNA 3NJNA 3WENA 4JDTH 2IH3B 3ZZ1A 4NN7C 4QCIA 4U0RB 3L1OL 1JN6A 2WKLA 3CZSA 2YD2A 2DD8H 3VI3A 1U93A 5DFAA 5FYKE 3FQRB 4G6FB 5DMIH 3ATDA 3UTZB 3O45A 2QFRA 2Y3AA 1IAIM 1ROCA 3T0EA 2FL5A 2IDSA 4ZSOB 2NZ9C 2HFFA 4POZC 3E9UA 1NCCL 4LLMB 5HYSB 2QPUA 1G94A 3B2VL 2YARA 2RQEA 5B3JE 1ZK5A 2DQTL 4LT7A 5H37H 4MMYA 1I3RB 4HCIA 4JFXB 4Q6IC 3EOBB 4AQ1C 1OHQA 4GMSL 5AFAA 3B2DC 1N5AA 5IMLA 3BXNA 2VKWA 4XPGH 1TJGH 2I9LA 3X14A 5A40E 1JF1B 2UWEF 3Q01A 4MD0A 3DXAA 3F65A 3GYRA 4JCWA 2NY6D 2Z93A 1A47A 1KJMA 5D2LB 4NOBA 3EH4B 2AP2A 2Q0ZX 2X7LA 5EWIH 1IV8A 4LRNL 3WOVA 3D33A 4B50A 4ZMPA 2ZUWA 4O2FA 2VZ3A 4W6YB 2R1YA 4K7PH 2IAMB 1IBFA 2PYEB 1CD0A 1IC0A 1UASA 1X5MA 3IBOA 4CMMA 1BBJA 1TJIL 2EDTA 4BFFA 5DLLA 4FERA 1ZHKA 2CDEA 1MY7A 3H55A 3T77B 1HYRC 2VUYA 4LLYB 5HI5C 1WWBX 4F2EA 4WW1B 4MMXB 1R1CA 4Z7WA 1VEMA 5CSGA 4C83B 2OMUA 3OD3A 4ZNEA 5FA4A 5GZNC 1TJXA 3VFUA 2XN2A 32C2A 5DHEA 2F7IA 4M1GL 4MDIB 2EDYA 5E8NB 1GYVA 3VQMA 5ABZA 3O4LE 1VFBA 1KCRH 2KI6A 2WGXA 2I60L 1IM3A 1N59B 3ZZSA 2GEEA 2P7TA 1OAQL 5EC2B 4L05A 4E9VA 1DLHB 3K5RA 5HDLA 3KPLB 4WGVB 3CX5K 5FV1L 1EO7A 3O3EB 2IFGA 4PJAE 4TVPD 3UMTA 2BOCA 2RFXA 3ISYA 4RX4A 3EJRA 3K0YA 2J57A 5C0AB 1UJ3C 2R2EB 3STZA 3D7PA 4TVPE 3NIDF 4HS8L 4GRWB 5I1KH 1XD1A 1QR4A 3K8LA 3T6QC 3MRMA 3F8UB 2CG9X 3P77B 4JKLA 2DDQH 3BUPA 4WTWA 4PJEF 2P9RA 5FO7B 4JFTA 2Z6FA 2PR4L 3E80A 3VM5A 5GS0L 1KYDA 4QAMB 4TLKA 1N64H 2Z31A 1HTYA 4FA8A 1KV3A 2I24N 1A3RL 4O51A 4R26H 4DCQB 4DKEL 3DV4A 2WQAA 4O4YH 2JJSA 3HVNA 2XYBA 5DVKA 5BRZA 1LILA 1FVDB 3OSKA 3PWPD 4RGND 3S96B 3FU7A 4BSVA 4M7KH 1J0YA 1MZZA 3WS6C 5GGVH 2XG5B 1A6WH 2AMUA 1BFSA 4QRRD 4O2CA 5F7AA 2D7QA 3QJOA 3S5ZA 3FFDA 5F0PB 3WY4A 1WHOA 3FHQA 5EA0H 2EDNA 4QRRE 3ZDZE 2CHZA 5E9DD 1BV8A 2Z8RA 4MD4B 2F7QA 4LVOB 3VI3B 3WJLA 2AQNA 4EZMA 3MRHB 3RY6A 4XX1G 3V4VA 4GW1A 2CAKA 4Y4KA 5E9DE 5KBLA 3OKMB 3IDIB 3O45B 1CT8A 4N6QA 1ACZA 4WKXA 3ARSA 4TNEA 2H6OA 4D2NA 4HOWA 5HDBE 1KNOA 2EIEA 1KPUA 4HFUL 2EADA 3ZHKA 3B37A 3FBQA 1WTLA 1EAJA 1KFAH 3F5WA 1JTTA 5KSAD 1UH4A 5DA4A 3WFZA 1J1OL 5D1QD 2F8IA 3W0WB 3NJGA 5C92A 1T7VA 4F20A 1L4IA 2V5TA 4XO8A 4HJGA 4FQCL 4J8RB 2I5YL 1JVOA 4LKXB 4O9HL 2Q7AA 2BHUA 4MS8D 1S7XA 1RHHA 4JMXA 4QRAA 3T0AA 3QJHA 3WDIA 2YGQA 4Q9RL 1G7MA 4ONFH 4QHLA 2PCXA 3BUTA 4PRID 4NCDA 3HN5A 3T8XB 4JKMA 1M7DA 2X7LB 3PWLB 1TQBB 2JSFA 3BEVA 4LARH 4KMTL 3WEOA 2GSGB 2ZCHH 2NYYD 4PRIE 3MLYH 4A2MA 2BZDA 2Q2EB 2ALWA 2R1YB 2GTZB 3Q8EA 4DUVA 2JJWA 4P46B 1BBJB 2PXYA 1LJMA 3OJDB 3TJEL 4BUGA 3VXRE 3K3QA 1BHGA 3QXVA 3JWNH 5D4HA 5F1KC 4X4YA 2WJ7A 2ARJB 3LXBA 3B5GA 4H25A 5DYOA 1P1VA 1CFSB 2KUTA 1D5BA 5FA4B 1G7PA 4ZI8A 2EQDA 3ARWA 4WU5A 4I3RL 2WO4A 3UG3A 4Y16C 5DC4B 3Q5YA 3ERXA 3H9ZA 4UNIA 3L5WB 1VFBB 3FU5A 4GT0A 1FORH 1IAMA 2FSEA 2BP5M 1F2XK 1MUJB 2DQJL 3P4OA 4MJHA 4UIKL 4TUJA 3MOBH 4R7XA 4IEFA 5HI4C 5IMOB 4M93C 5FOBA 4KROB 1K8DB 1R3LB 4YPGA 5KUMA 1ZJAA 2V3EA 3BT0A 3AY4A 2Y5QA 3ABGA 5JDJA 1BGXH 1KB5H 4LSDA 4NJ9L 4NQCB 2BOCB 2F54D 2ZE0A 2YA0A 2CA3A 5EPMB 5AVWB 4V11A 4OJFL 2RCSL 2NYZA 4M4RB 4OFYD 3REWA 3STZB 3LKNA 1N19A 3GRGA 1FYHB 4F58H 1NGQL 4P23B 1AGCB 2J43A 3IPFA 5DD3H 3B9AA 3WIHL 3D39D 2ZOTA 5JPMA 5L8JB 3G04B 2DH3A 3CFNA 2GY7B 1TITA 3RU8L 4L9LA 3EYQD 4FFWD 1MH5B 3FH7A 4DOHE 5JPNA 3KD4A 3V79C 1CS6A 3V0WL 2HKAA 1QRND 1U8IB 1LM8V 4M7LL 4B3VA 3L3OA 1AO7B 2CZNA 3CSTA 3LRSA 3PL6C 1WD9A 3PV7A 3H9HB 4YDIH 1JK8A 4D94A 1SMAA 4HK0B 3LXAA 4AZ8B 5B22A 1XAUA 2F5AH 1A64A 3TA3D 4KHXL 4K5NA 3KL0A 5KVEH 5C0CE 2EH8L 1CGYA 1K9TA 2IWGA 3MLXH 2ZUQC 1A6UH 1PG7X 3CFCH 3FFDB 4N5UA 4OFDA 1L9TA 2ZPKH 4UYPA 2J73A 4DPCX 4KXZH 5J11B 1DQDL 1PKQA 3OKOA 5JIKA 3S3DB 1FL3A 1IC7L 4XZ4A 5J56B 4ZMYA 5B38G 4ZW3A 5FDWB 4KKPA 2L8AA 4M7JH 3ORJA 2BWDA 2JWYA 4GW1B 1BYPA 1OAUL 3D1MC 5E8EA 4LLVA 4POUB 1HIML 4OLWH 2P49B 9PCYA 3GI8H 2YSSB 4YO0A 1PFCA 1MCRA 1U3HA 2RR3A 2YBRA 5DSCA 3AXHA 2DTMH 2NY5L 5IROA 1CYXA 3UAAA 2OTUB 5AVUB 4Q58C 1FA4A 4HBCH 3OZLA 4L1LA 4NQVA 2QQKH 2WQXA 2ATAA 4TSBL 1EXUA 2VN5A 3WFHA 5T3XE 4LOVA 5IREA 3BDXA 2BSCA 1A9VA 5CIPA 4X2UA 5IJBC 5GRWA 2UZXA 1WICA 3UMNA 2W9DH 1PU0A 2BIMA 3N5AA 4OLZL 3ZN6A 1QATA 2YD3A 3V5HB 2F19H 1BAWA 3CDCA 1FSKB 4H8HA 2VERA 4L8SB 5AVSB 3GMNB 1D9KD 4E9SA 4PJIA 4LE8A 1EEQA 2IDTA 2YGNA 1UKTA 5IVZA 4IIQC 1OOAA 2Y1YA 1CLVA 2NQCA 4ZODA 1KJ3H 5GSVA 3RVVD 4IDJL 3VFGL 1PZ5A 4OCRH 3ZE1F 4HZ1A 1BWMA 2BS9A 4LL9A 2RHEA 3BP6B 1TTUA 4V2CB 3W11C 4RCAA 4J28A 5I0XA 1U33A 2DQFB 2NY2D 5DD1L 2WYTA 2A4ZA 5BQDA 3HZ3A 2Y06H 5GZOD 5JQIB 2WXHA 4JPIB 3WNLA 3TN0B 2VR6A 5GGSB 3OQ3B 1UD3A 4UDTB 3ZKMC 4RAUA 3IGLA 1S7WA 3OLGA 4X80L 5C3TA 5EIIA 5B3NA 2VITA 4UTAH 5JMRA 2Z92B 2FSEB 3P4OB 4FE9A 5K9OA 1OALA 3RG1C 1C5DB 3T0XA 1CZ8H 1J5DA 4ZMAT 3VGDA 3AUVA 2AK4B 2ERJC 3QNYA 1I8LA 2RALA 2W80C 4W81A 3QVAA 2HH0H 4Q6YA 3TGXA 4P5MB 1P2CA 5MEOA 2Y1ZA 5I1DA 5B38A 1HZLA 5DQ9A 1BQSA 3O11A 2MTAA 3CUPA 3LHPL 1ED3A 1OP3K 1ES0B 3NCXA 4NC1E 5EOTA 1NEZG 1PLGL 3NG5A 5IG7A 4QXVA 2ED6A 4U3CA 3HPLB 4PJ8D 5KG9B 1W6LA 4TRPL 5F8RC 5JPMB 3EOTL 2Q87A 1JGVH 4ISVA 5BUGA 2FYYB 2X4QA 4PV9A 4L9LB 1IEAB 4GSUA 4XBGB 3HHSB 3MCLL 2GAZA 4M1DH 3GKWH 3N3EA 4RNRB 4P4KC 1BZQK 4PREA 4FMKA 5I6LA 4PSPA 1FVCB 5G4NA 5I1LB 4IRJA 5GQBA 1CK0L 2O1AA 2Z4QB 4H26B 5F0MB 1DN0B 4HPYH 1NGPH 2F74A 4F57H 4LLWB 1D5RA 4I18A 3APCA 3AUWB 3MTRA 5HYFA 2DLTA 3DMMD 4Q4EA 1KLGA 3VDCA 3GO1H 3L95A 2ATKA 1HQRA 5EBGA 4OAWB 3I2CH 4Q74A 3EUUA 4M3JA 4PGBB 4IMKA 1YPZF 4AH2A 3ARDD 3HFMH 1Y1DA 4NHCL 1M53A 2ZKWA 4QRPE 4JAMB 4PGCB 5DK3A 2PTVA 4J3TA 2OL3A 5JR1H 3ZYZA 2CDFA 3PWNA 4QHUA 3MLSL 1S7TB 4A1RA 1I8MB 3LTVA 1X6LA 2PETA 3LB6C 5J0BA 3X2QB 1YUHA 2AQPA 4HDIB 2UX7A 3DOHA 3UABA 2VLKA 3VO0A 5HTSA 5I2IB 4Z7UA 5J7CC 1OSPH 2VZVA 5DS2A 5LGHL 3NEXA 4NQVB 5IHZA 3QQ4B 2ZZUT 1XSIA 4XPAH 1EXUB 2M8XA 2ZOKA 1J7VR 4J23A 4EKJA 1EIBA 4B0MM 3EO1A 3PU7A 3IDUA 4XGZB 5DQJA 3NN8A 3IFOA 2UZXB 3KDMB 2P5EB 1KYUA 1DQLH 5LAXA 1GRWA 2E7LA 5DD5H 3MRJA 4MRCA 4WI9A 1ETJA 5J12B 1TTRA 1DQMH 1MFBL 3OKKA 4QI3A 1G7QA 1N7ML 3MACL 3CFEB 2GI0A 5IVZB 4AIZA 3MLZH 3QDJD 1SXZA 1AGDB 2BVQB 2OZ4L 4ZG1A 1EXHA 2BFVH 1NCBL 1WCBB 5D71H 1W8NA 2WD0A 5JHDE 3APMA 3L08A 3PWJB 4EDXA 4N2BA 3RIAK 2ITFA 2YEVB 1EUTA 1HOEA 1CTNA 3IN0A 1ZVSA 4WI4A 2GKIA 4FG6D 3HNVH 4KOCA 3JYBA 3FZUD 1C8QA 5I82A 5IP4A 4LKCA 4X5LA 4WHCA 2LW3A 1KJVA 1ZSDA 3M07A 4CKVX 1SOSA 4EDWH 3LH9A 2VSMB 4MJJA 3MJ9L 2IO5A 2AXHA 4HHGA 4Y8DC 3WL9B 4I48A 5EIIB 4Z18A 3EDJA 3HNTH 3HI6L 4BDVB 2CE6A 4A7GA 2BIIA 1FV1A 2D3JA 1FVEB 3HUJE 4IBYA 3E1ZA 4NI6A 2YPLA 4WW2C 4ZQKA 3JSSA 1GOFA 3RPIA 3SGKA 5CR1A 4N87A 4L5FH 3Q44A 4IBUA 3DHUA 5IKCA 1ERNA 4MAYB 2ZXWB 4ZW6A 1A3QA 1NCOA 4PJFF 4GKLA 1FYTA 4TL5A 2NY1D 3NH7H 2VLJB 4MCMA 5E6RB 3CDYA 1I7ZB 3IDXL 1T0PB 1X9UA 4UQBA 4AQ8A 2HTKC 1C12B 3H42L 4KK9D 5K39B 2YK1H 4P9HL 3EJZD 3KR3L 4CILA 5E4EC 2J7LA 4APQC 3U4BL 2ZX5A 3HZYA 5BW7C 1NLBL 3MZGB 2WXPA 2F53D 3V55A 2MQ0A 5EN3A 1IU1A 4DPAX 1LO2H 3VGEA 3EYVB 1HH9A 5EOCH 4BH8A 4OI9A 4FQXD 4YSTA 3VFRA 3G5XA 2WXNA 4DK5A 2V0AA 5D7HA 5ECGA 4UV7L 5C2BL 3EGSB 4HMDA 2WVTA 3EO0B 1D7FA 4KUCF 1QQDB 4PREB 4QTIL 4XP1L 4IRJB 4J3XA 1HILB 2FK9A 4RMSA 2PTUA 1T22A 3BWUF 2CO3A 2K6WA 2QVMA 2BXYA 1JZHA 2GUYA 3CMGA 4AW7A 4BRVA 4MZRA 3KPNB 2BNUA 3B2PA 4YBQD 3H3PL 1RK0B 4RQQB 1BF8A 3CVBA 4UDUA 3BWUC 5TGBA 2Z91A 3OWEA 3ARYA 3BSZL 2HSIA 4HJSA 2ZXEB 4MQTB 2HVKB 3SKOB 5C0ND 1RL1A 4PW9A 3FQ2A 5KYYA 3VCLB 4RWHA 3ZQ9A 4FI8A 1SF3A 4IGBD 3FO1A 1FJ1B 5IB2A 1VA9A 3QO0A 1UC6A 3QHZH 5IMKB 4FTVD 3CJJA 1MFAH 3HB3D 4YC2B 3QI9A 3RAJH 4EI5B 1W0VB 4XNDA 3M1BA 3F12A 4HJTA 1KTRL 3TPUA 2FGWL 3MO1A 4NIKB 4JO3H 4OKDA 3RFZB 5HDQH 1FFPA 3MLUL 5TH2B 4OSUH 5DJDB 4OJCA 4G80B 2B5IB 4DEPB 1JK9A 4OD1H 3FOLA 4FYQA 4YIQA 4GXFA 3ETSA 4OLYL 4WSJA 2NY4C 2WP3T 4U6YB 2HVJA 1IQDA 4HIJB 3UZVB 3AAZB 1Q9LA 1ZE3C 2IG2L 4KKBC 4OZ4B 2YXVA 2WLIA 4WFED 3TF4A 5DQJB 4L0YA 5J4MA 3IFOB 3L2MA 1MHPH 2NLJA 1TFHA 2R7EB 5LAXB 1A1MB 3NIFB 4B9PA 3IDJA 5IB1A 5FPIA 1LMKA 1MOEA 4MQ7A 4WV1C 4CADB 4EEEA 5EORH 1USQA 1WJ3A 3OC5A 4X5WA 2BOLA 2ENJA 5KVDH 2KLTA 4HG4J 4Q9BA 4YXHL 4OLUL 2OMTA 3D0VB 1AJ7H 3TLRA 5J89A 4JPVL 2XWDA 3HG3A 4TL4A 1XX9C 4WFHD 4FNLH 1UM5H 1AD9A 2NCMA 2NW2A 4PJBF 4HCGA 1UJTA 4MWFA 3RHWF 2OJEA 3WU1A 2MRYA 5JW4N 1Q9WB 1IGJA 1L6ZA 2B59A 3O3BA 2C1PB 1ZTXL 3JWOH 3KPPB 5JO5B 1BZ9B 1AI1L 3KYKL 1NOLA 3UZEC 1O6SA 3ZTNH 1J48A 1YN7A 1KJVB 5DGQA 1P53A 2A6JA 1BMGA 5J6HB 4KDVA 3HS0B 1XCTA 1LO5A 2E0PA 4Q0XH 1UQSA 1CDHA 1WDAA 2P3YA 4EUPH 3UBXI 3TFBA 3KS0J 4KKQA 2W65A 3QCTL 4L4TA 4ZQKB 2AABH 3UDWC 4M8UA 4YHML 2EXYC 1B4TA 4PGEA 2WSPA 3BZDA 1E27A 3WAJA 1IGYA 1MJ8L 3PWPA 3N44B 3RTQD 3TVMB 3WFCL 3FCTB 4ZS7L 5CZRA 2OTWA 4CN4A 2APVA 3GSQA 5IBUB 4NIYE 3QCVH 2G5UA 5AUMA 1MCWW 3OKDA 1BJMA 3NDYE 1J1PL 2J5WA 2M26A 4JDTL 2YKLH 3RWEA 5C8JA 5ETUB 3ULUE 1T7ZA 3X3GH 1EVTC 3ESUF 1WIUA 1NICA 1X5KA 2FX7H 4U3SA 4WHTA 4HETA 5INDA 2DD8L 3OGCB 3TOPA 2BSBA 4HUUB 5BZDB 3LQAH 4YSPA 1P7QB 1JGUH 5KS9E 5DMIL 3Q6FA 1XBDA 3NK3A 1Y6KR 2O6FA 1T22B 1B0GA 2Y72A 2B1AH 4E9YA 5AW2B 5JHAA 5KSAA 1JXGA 3IVKA 2D4DA 3L4ZA 3P11H 3V6FA 3WUWG 4AKQA 1Z3RA 5TGBB 3SDXE 5JMOC 3FT1A 3IS0X 4X6EB 3VD2A 5AQ0A 2XXMB 1XF3B 4GI9A 25C8H 2CGYA 2P47B 1GSKA 4AV0A 4XPGL 1TJGL 2GJ6B 2HKFH 4F91B 3L3JB 4MCZB 4JO1L 3ECUA 3VH8G 4TNWF 2NYKA 1KB5B 1E6OL 2EACA 2XV2A 1JZFA 3A24A 2I25N 1OSZB 3QZMA 4UNTA 4ILDA 2CJ3A 3QEHA 1OO2A 3KPQB 4FNSA 4K71C 5C09B 1JGEA 3T4AA 1SLVA 3P3RA 3MNWB 3DNKA 1E90A 5F3BB 1KYFA 5EWIL 1NC4D 3NGBC 2C3WA 4U1MA 3QI9B 3L4XA 4ZUUB 1O0VA 1F3RB 2ZYIA 3MO1B 3MV9E 3NZHH 3UBGA 4K7PL 4N0UB 4AX3A 1HNYA 2V5RA 4L3EA 4NS0A 4ES8A 1R5IB 5F9JA 1HQ4A 5D6CA 1J88A 3QEQA 3FJTA 3ILPB 4K8RC 3LKSA 5M94B 3H3BC 3ZOAA 4Z3GA 2HVJB 1IQDB 2DLHA 2GT9A 4LSRH 5KSBB 4EPSA 4G6AD 2WLIB 5BS0E 4CJ1A 4QOKD 4FXKA 1YEEH 4ODWA 4XCEB 1MZYA 4AYBA 3ATBA 1J11A 1IBDA 1MLBA 2LTQC 1E9OB 4B9FA 4K5LA 4M5ZH 1KCRL 2BOBB 1TEYA 3OF6A 4RMQA 1VADB 4QOKE 5KYXA 3CN2A 4GLRH 2UWEE 1G9NH 4LDLB 1XGPA 1NL0H 3S97C 5MI0C 1U42A 2E6QA 4FJ6A 4PP1C 1SBSH 5CU5A 4NSKA 1RZQA 1A6PA 1WAAE 2AJ3A 3TH3T 5L2KB 2F54A 3H2QA 1SRDA 2UZPA 4U2ZA 1HZKA 3ECWA 3ATFA 1QSEB 4NN5C 5HI5D 3ZHNA 1U0QA 3BMWA 1G7JB 3O3BB 5A16B 2YUZA 4NUJB 4N9GB 2MPVA 1I3VA 3FAXA 1J8HD 5CGBA 4RGMB 2QR0B 3D39A 3CPLA 3PUCA 3VXMA 5I1KL 5HDRA 4W9CC 1I7RB 1YN7B 3WS3B 4FFZA 4YPJA 4FQHB 4BFKA 4ZJ9A 4Y19E 3LS4H 3SSGA 5AWNH 4PJCF 2VWEC 2DDQL 2P52A 3WUWA 3MRKB 5HGBA 2X4SA 5HHMD 4JFEE 3AWFA 4L4VD 2EUVA 4ODSH 5E6IC 1QRNA 2Y36H 2W65B 4L4TB 3NDZE 1FFOA 1N64L 2HRPL 3L5HA 2J1YA 1IBGH 1TZOA 2DJUA 1E27B 1MAJA 3FS9A 4L4VE 5HHME 1DBBH 1IGYB 3MLTB 2EABA 4KJPD 4R26L 3SDCC 3UTQA 2VB5A 3IXTA 4NPJA 4O4YL 1SMOA 5DZJA 1CXFA 2P24B 4JB9H 4D9QE 2OTWB 4MMZC 4GKZB 4QRTA 4CVZA 3F62A 1MWAH 1NOAA 2VW4A 4M7KL 5LWYH 5GGVL 1T4KB 1A6WL 1KCLA 1OF0A 3BVDB 4MJIB 1OCZB 3N43F 5AUMB 4C4BA 4DKDC 3QORB 4ELME 4AMKH 3WTWA 1U8MB 4Q2ZB 3D3VA 4E41B 3POHA 1MWOA 1CYGA 5AD0A 1T1YB 3MBEB 5I73C 3FO9B 3ZMRA 5IQ9B 2ED7A 2QKIA 2VXVH 4JGJA 3WKPA 3NIDE 3ZMNA 1A0QH 3GTNA 5IB3B 1O9WA 4BFGA 2VW6A 4P3DA 4X8JB 2LV4A 1C08B 3WLBA 4OCXH 4PRNB 4GUPB 5FECA 1GCFA 12E8H 3QXTA 2DF3A 2FWOB 3IVKB 1KFAL 4OQTA 1M7IB 3OXRB 4PBDA 1P7KB 1CXEA 2WLJA 3B3BA 5I74C 4ZFOB 4D0CB 3T6VA 4R7VA 1TZHB 3G6JA 4BK5C 3F6LA 4FQQA 5HHNB 1ETZB 1YLBB 2FE0A 1E8XA 3N1GC 4ZDHB 4LLQA 4ZMOA 3BUDA 4K7FB 3Q5TA 4JRYB 3DDGA 2G4EA 4NXSA 4ONFL 5EF0A 4AIXA 2VSDA 4LARL 1WT5C 3MTXA 3CZLA 4KRPB 2ZCHL 1OSEA 4E5XB 4FN0A 5JZ7C 3MLYL 5L8LB 5AOLA 2VL5A 2V5MA 2NX5B 2CBPA 3WEMA 4L3EB 3V4LA 1SGKA 4BFNA 3US9A 4ES9A 3QEQB 2WXKA 3B6SB 2Y3NA 4IJ3C 5ICXB 4P9MH 3BIKB 4U1LB 3DIVA 3RGBA 3BQUA 3T0BA 4EXPX 1E9QB 3ARFA 1N9PA 3C8HA 5CFAA 4GSQA 3RPBA 4WI6A 2LQRA 3LN9A 4AGMA 4QXUH 3BYYA 1ZJBA 5FCUH 2F58H 1FORL 3P4MA 3ULAB 5CN2A 1T80A 5B1CA 3DPBA 3MOBL 3U2SA 4MHHI 3UBHA 1QBBA 2RH0A 5ACZB 1ADQA 3DO3A 3PV6B 2IOMA 5ERWA 3E7JA 4X6DF 4JUSA 3X12A 1BGXL 1KB5L 3FO0H 4G42B 2EDKA 1DUYB 3IWUA 3TESA 2R2BB 1MQKH 2YGVA 5HVWA 7FABH 4BK8A 2FATH 2KMWA 4MNHB 1S7VB 2AV1A 5GGUA 4F58L 2FEDD 1I4FB 5DD3L 1U8OA 1ZGLB 2WQVA 2HX8A 5HBBA 1SEBA 1CWVA 3LZRA 5IQLA 5AENA 4UQ3A 3HMWH 3BP4A 1KBBA 4X7SH 5KJRH 5T1KD 3NPSB 1AS6A 5HI4D 3I9IA 3WI9A 5A2CA 3SCMC 5CP3H 4ZAKB 3UO1H 3FB6B 4JY4A 4CC4A 4XOEA 4LSUH 3D2UB 2VXUH 1EFXB 1RZFH 4YSRA 4YDIL 5MERB 5ITFB 4Z6AT 4XP9H 3T6ZA 5CCHE 2OX5B 4NQDD 2F5AL 1HVXA 4CVZB 5KVEL 5JORB 3SQOH 1NOFA 1U91B 2CKBH 3MLXL 1A6UL 1HKFA 1TTBA 3BVTA 1G0YR 1GZQA 3CFCL 3PNWA 2L7QA 5F9WC 2ZPKL 4Y8AA 5EN2B 1F1GA 5AB9A 4LVHB 5F89B 5EH1A 4PJ9C 5J8OA 3ARED 3N41B 4KAQH 4LEEA 5BJTB 2Q76A 4MX7A 4K3DH 4M7JL 2FT8A 1W0YT 3FRPB 4KZCA 1I1AB 5IEHA 1K5WA 3CFJA 3QS2A 7PCYA 2WXOA 3PL6D 4N0CC 3GI8L 1BXXA 3BHBB 2A83A 3QUYB 2DTML 3BZEB 2EC9T 1YMMB 2Q86A 2XACC 5TPWH 4ODBD 4LCCA 4HBCL 5FYJD 4G59C 1YDPB 3OC8A 3OPUA 2QQKL 3MBXH 2W88A 4KV5E 1JNLH 5KJ4A 1QW8A 4A68A 2NY7H 5FYJE 1R3KB 5DRWA 1NFDA 4A04A 2H7WA 3BGFB 4TM9A 2G75B 2JCCB 2W9DL 1SOXA 3FN0H 3LMJH 4H8WC 4UT9A 2J8UF 2JQMA 3NFSH 3TO4C 5AALA 5KYWA 3RJOA 4J3OH 2NDFA 3NIFF 5CINH 4C57C 1KXQA 2F19L 4JFPB 4X6BB 4D7PA 1F00I 5HYJB 4H0IA 4NENB 1NANI 4WHDA 3QDJA 5AL8A 3MUY1 4M6AA 4MKTA 1I3GH 3H9SE 2CDGB 3CDFA 4K5OA 4BIKA 4DP1X 3V5DB 3LDBC 1KJ3L 5AVXB 4Y1AE 3QUMA 1ZT7B 4GAGH 4Z7AA 4OCRL 2FJSA 2L7UA 5DEFB 4H1LH 4G8GD 3VFVA 2IWEA 3X11A 2FO1A 3SE9H 4JO4H 1ZAGA 1AZNA 1JPSL 3HTLX 4N2KA 1NAMH 4JPQA 4QWWC 2BC4A 2Y5TB 2Y7LA 4P8QA 4G8GE 2TSBA 3JVGC 2Y06L 1FFTB 3CCHA 3M45A 3BKCH 3Q1SH 2NT0A 4Z9KB 2ZWZA 3Q13A 1X44A 4WDIB 2E56A 1QFWH 4UTAL 4IDLA 3QUKB 5F88A 5EU6D 2DICA 1CZ8L 2W38A 3O3DA 1Z9SA 4ZFOL 3FULA 4PS8A 5I6KA 1MG3C 2HCZX 2HH0L 4M8QB 2O5YL 4GAFB 4L0PB 1S4IA 5TQ2H 1BVLB 2HTLC 1WBXA 2E6PA 3N44F 3JVFC 1IAOB 3TNMB 3UCRA 3W11D 1QWNA 4QRSA 2GG1A 3N42B 4HIHA 4RDQG 2LHAA 1KTJA 3OQRA 4YXLH 3OZ9H 3T0VA 2AV1B 3ZKXB 3FT3A 2J6EA 4FQXA 4WLCA 3ZKMD 1NCIA 2H26A 3MYJA 5TQ0H 4FC3E 3WIIH 1IKNA 2F5BH 4UQDA 2XC8A 2BNRB 4M1DL 3GKWL 5ICYA 4UMGA 1CGXA 4Z7VF 3TEYA 5B1JA 5EF3A 4FKEA 4MA7H 2G3MA 4NQTA 4OZHA 4YR6B 3C5JB 4OIIH 4E0RA 5T1LA 2EIJB 1QD0A 3K6DA 2EEFA 4HPYL 5F96H 1NGPL 4M7ZC 1EJFA 3IBEA 4WWKC 4Y9BA 1LHZA 1HJCA 2A9CA 4BHUI 4HUNB 3O9WB 5G5DA 3CU1A 1MKFA 3DLQR 1Y0LB 4I2XE 1CURA 5F0LB 3GO1L 4YGVA 3I2CL 1TQSA 2PWHA 2ZKXA 5EBWB 5A2FA 4HGKC 3ARBD 3SDDC 4FTVA 3CH1A 1V55B 3HFML 1FFNB 4HUCA 3T4YA 5J1TC 1CCZA 3RGVB 1JZ5A 1LO0H 2WWMC 1SVZA 1ZA6A 2VERN 3C2SA 5HGDB 1RJLA 5B8CB 3HE6B 1NMAH 3AB0B 5IW6B 2EICA 1JD7A 5ID0A 2GVYA 3FFCE 4HUXA 4EUPB 4XC1H 4RFOH 4P05A 1OSPL 5T1JA 4PCSA 2ITDA 3A23A 4HISA 2Y7SA 3O3AB 4XPAL 3FQXB 1JWUA 5I18H 4X7DC 3IPEA 2DM2A 5D7LD 4HCFA 1VEOA 3FQYA 1DQLL 3ALWA 3ZTEA 2DB8A 5CEZD 3VXOB 2ZX8A 5C08E 5DD5L 3EJTA 3S3JA 4C8XA 1Q9OB 4P4RB 2W8CA 2X1OA 2LU5A 1DQML 3L4TA 5E4IA 2X1QA 2XFGB 3IGFA 3EFDH 1WAPA 1YPZE 1F90H 3MLZL 3FTUA 2BFVL 1HAWA 3QUMB 4WNSA 5DVNA 3RZCD 2NDGA 3C6LB 2XXGA 2OMWA 4G3YH 4XBMA 3SEPA 2ZKYA 3PQYB 2VZSA 5EZIH 5DDHB 5GS1B 3HNVL 3AG2B 4PWJA 4GINA 3VMOA 1U58A 3VXUA 2UY7A 4WGWB 3SPVB 2XBDA 4EDWL 1WIOA 1MF2H 3OMAB 3I75B 4YFLF 4EIZC 3ESVF 3OB0H 2C26A 4UWQB 3BWAA 5TF0A 3W81A 1A6AA 1A4KA 3HNTL 4GKSA 4NKOB 3WELA 1BQ5A 4N20A 2X4UB 3ZY7A 2JKNA 3B9VA 4RFEA 5EU7C 3U9PH 1EO8L 3QUZC 1AACA 3Q7JA 4L5FL 5GGTA 3NSDA 2HLAB 1P6FA 4X9GA 3ZZLA 1UVQB 2DLIA 4HOXA 1JPFA 2X70B 3LQZA 1A2YB 1SHXA 3VWKA 2P26A 1A1OA 1O6VA 1G9MH 2VJ8A 1YEKH 3HJEA 3KMDA 4I3GA 4L3AA 2YK1L 1OAJA 2Y2WA 3DX6A 3NP4A 3LNEA 3IMUA 4NNXA 2DQGL 4UUJA 5HHPA 4MA8H 2H6UA 1IM9D 2X2JA 1CDBA 3B8YA 3QDHA 1CDYA 4PP2B 1NEPA 2NNXA 3V7AE 3ZKSD 1HHJB 4DKAA 3HN3A 3ZE2E 2ZG3A 3DHJA 4PJHF 3GSOB 4G72B 4XMKH 1XF2A 2K3TA 1PYWB 3I85A 3HRPA 4PJ7F 2UX6A 4PRHA 1JD9A 1A9EA 1L7TH 3DJRA 4KK5C 4JDZB 3OHXC 3O81A 5KSUB 3NCCB 1THCA 4QLRA 5ADPH 1R24A 1ZXKA 5D7EA 3ZMEA 3TH4T 1FNEB 4APQD 4X7EC 4X99A 1N8ZB 2AI0H 3QR2A 3EBAA 4KTYA 1QEXA 3G5YB 4WRLA 4AV4A 3PGDB 1EBAA 4PJFE 4HCRH 2Q7YA 4YSSA 3OPZH 3HE7A 5DUMH 4Q97A 3P69A 3QHZL 2F08A 5CBAA 4KQ4H 3T4YB 2F9BT 4KXDA 4R84A 3RAJL 3BX7C 1FL6A 4GO8A 2ZJSH 4OKVB 3TS8A 5C7XH 1SJHA 5EC1B 2HRGA 2VO5A 4JO3L 5L0QB 5HDQL 4OUUB 1S78D 2OL3H 1I7TA 4OSUL 2WWNA 3RGHA 1Q72H 4OD1L 1OCRB 3TBTA 4Y4HC 4X7TA 3IJHB 1NUFA 5AG9A 4JN1H 3ARUA 2WHVA 5F7WC 2CIIB 5I8EA 5L6YH 4IKKA 5E8OB 2GTWB 1H3PH 3LIZH 3BOVA 2ZP0T 3KJ6H 5FA3A 1MHPL 2EVFA 3L3IA 3NSYA 4F37F 4N3TA 1MWAB 4DZ8A 5ISZD 3MRPA 2I27N 3KBEA 4A67A 3QDAA 1AXTL 4UILH 5AVVB 2D0HA 5EORL 5KBMA 1OV8A 3PHQB 4AQEA 1F6AA 5KVDL 4YSDA 1ZPUA 3EDDA 3T6XA 5DHDA 3WUZA 3G08B 2UZYB 3UTSB 1AJ7L 1YJDC 3MRNA 4HQQH 1TCRA 4FNLL 1UM5L 3MLVH 5IGXH 4PHXA 3QUXA 4Q9QH 5EUOA 4U1HB 5DC2A 2R59A 2NY4D 1O9VA 3GB7B 1EJ8A 1BAFH 3VI4A 3R06B 1J8HA 2L7JA 2FQFA 4J2XA 2MIZA 3JWOL 1T5WB 3VXUB 4YL9A 2NOYA 1PQZB 4UOW1 5KSVA 1AYRA 3ZTNL 5FYLH 4CJ0A 4OZFH 1DQVA 3B9DA 4TLTA 3IXAB 4ZFQA 3RX7A 2X6AA 3RDTB 1UZ8B 3BP5A 4Q0XL 3BWAB 3VGHA 4KDTC 1OM3H 1A7QH 1VJSA 4Y5YC 4QY8A 4GH7B 3U82B 4GXVH 4XX5A 5GGRA 2MCMA 3WE6B 4X5XA 5SWSB 4XCNA 4RFEB 2R4RH 1FLRH 2H41A 4RZKA 4S2SA 1MFEL 4BGLA 3FUMA 2OXGB 4JL2A 3CVHH 3K80A 3UBXG 4WUKH 3LQZB 2XWJB 4LP5A 1ZLWK 2AHIA 4GT7A 5AB0A 1JP5A 3VRLF 4WGKA 3TBWA 3QCVL 3QULB 1S9YA 1MCSA 2GUOB 2XTJC 4NNXB 4P5TA 1EA9C 4LVEA 1OD7A 4O58H 4Z0BH 2AJSH 2DJSA 4XNMA 2WBJB 2YKLL 3LV3B 1AOHA 2PW2B 3X3GL 2A77H 5FYKH 3ZE0B 3MMEB 2FX7L 2VMCA 1KWGA 1ZDQA 2BP8A 3P0YH 3QDMB 1FE8H 4AQAB 3ARTA 2AFNA 2ICWJ 3ME0B 4MLSA 1EZLA 2E75C 1NSNH 4ZUTA 3LQAL 2EDDA 2V9UA 3L3KA 1JGUL 1RZJC 2A9DA 4A7QA 3QFJB 3NZUA 4L1TA 1NCAH 4YHIA 1PZSA 4N90D 5FGRA 2B1AL 2FEEI 2V9TA 1FCCA 4FL4C 4ZMZA 1XGRA 3P11L 2BIOA 1OW0A 4ZYKB 4HX1A 4N90E 4JFSA 1N0LB 4UQ2A 1HXMB 4TN9A 25C8L 1T04A 3DUSA 1IGCH 2HKFL 4FNPA 5EZLB 3Q6GH 1KYAA 5CAYB 1AQDA 2CLVB 5FWQA 5C0IA 2Q7YB 4B96A 4ZO7A 1QSFD 1MJJA 5ECJE 1NFIB 3FC8A 2K0RA 2RACA 3ZSTA 1UOWA 4WSGA 1ZLUK 2BNQE 5CCKH 1U8PB 3I6LD 1ZV5A 4I0PC 4AOFA 5EU3A 1SEQH 1F4WH 3NZHL 1ZCRA 3F7LA 1BM3H 2WNXA 4PVMA 1T89A 3I6LE 1KEGH 4FLSA 1RIUH 4HF5H 3PHSA 3U30C 3WHE0 2M1KA 4Y5XA 2APTA 3FCGA 3II2A 1HL4A 2QTEA 4WJG3 1XV8A 2PPDA 2Y5EA 3TBTB 1XCQA 3FT9A 3D4YA 4TUUA 2O61B 4LSRL 5JQHC 2Z8SA 5CNHA 2X89D 2FO4B 2XQ0A 3QIUC 3P40A 2BM3A 1NQBA 3BVVA 3BFWA 4R4BB 5KVMC 1KTBA 1TO5A 5IQNA 8CGTA 2APSA 1W72H 3WKMH 1NGWA 4M5ZL 4FHJA 1CLOH 2CKBB 2DIEA 2PWDA 5K9KA 2Y1AA 4B3EA 2ZYSA 1G9NL 3EDEA 4MNQD 5E08H 1YEIH 1S3RA 2XV0A 1NL0L 1ZKAA 1XIWB 2JJVA 1GZHA 4OD2B 5EO0B 2EIZA 4GG6A 1SBSL 2FECL 4OGZA 2A5UA 3RVUC 4XPHL 6TAAA 4RZCA 1MCCA 3C5ZB 4KJWC 5KYUA 4K8RD 2R39A 4PY7B 4X6CF 2KL6A 3PG2A 3B43A 4TVPH 3SBWA 4JPSA 5T5FH 5FF6A 2Y7OA 5KZCB 2UXVA 2R69A 1BCIA 5DJ6A 5CZXD 5FUOH 4LOUD 2HFEA 4G8AC 2FIRT 4ZMVA 2ZP9A 2XOTA 3LRHA 3RVXC 3LS4L 2X4OB 5AWNL 1U8KB 5T1KA 3P3UA 1EGJA 1XCXA 4NFBA 3N04A 3ABMB 2OSYA 4ODSL 1XGUB 1V54B 3WG7B 5GGRB 2Y36L 4PP1D 2P8MB 4XCNB 5D1ZA 4C4UA 2AMGA 3EJYC 2VO8A 5JA8B 1IBGL 2C4XA 5HHQA 1G7LB 1DBBL 1O5DT 4AL8C 4NQDA 5I0WA 1EK3A 4JB9L 2IGTA 1MWAL 5LWYL 1WA0X 5KVGE 1U36A 1D5XA 4PJGB 4P2AA 4NC0B 1EEYB 1QFPA 1PLAA 1AOZA 3CLEH 4JE0A 4PJDA 2E3VA 3AREA 2NY0D 4H1LB 1D5MA 3WY2A 3V0VA 1LEIB 3NOIA 2H4EA 4FYSA 2Z0BA 3EFFB 2IXQA 1X5LA 2VWEE 1NAMB 2VXVL 3P4NA 2W0FA 5BQ7A 1A0QL 1QPXA 1RJZA 2O4EA 5F70A 3TT1H 3U0TB 4DAGH 4DESA 2IH1B 3TCXA 4XXDA 3SDCD 1QHQA 3FRUA 2WXIA 3DROA 4OCXL 1TEFA 4PJCE 4PPTA 1CD9B 3QWOB 4YWGH 12E8L 3IMBA 2GIMA 3FK3A 3DO7A 2XWXA 3T2NH 3U36B 1KCWA 4CA4A 1DJWA 4P2RD 3Q2LA 4FADA 3QK0A 3AU1A 3BLKA 5GJTH 4YXKH 2G9KA 4LDCA 4OJDH 1N68A 5K9JL 4KVCH 1G7HB 3WHXB 5L4IA 1HESA 2EYRB 1F4AA 1AHWB 1NUGA 4YVUA 1YNTF 4NUMA 1MJJB 2ZSVA 4JREC 3VGAC 5GGTL 2A99A 4ZFZB 4N28A 3BN3B 3V6BR 3U7YH 2B0SH 5CILH 2GBVA 2PR9A 3EUDA 4YLCA 4CKQA 1GGBL 1JV2B 3EJSA 1TNMA 3PP3K 4S1RL 5CP7A 3UG4A 2AEIT 3Q8FA 5JDSB 3SDAB 1M6OB 2VZTA 4GQZA 1EWHA 3AXLB 1UEMA 3CBKB 5B39B 3NQIA 3T2PA 1MCWM 4P9ML 1IQWH 4XH2B 3SPHA 4ZTOH 4E9RA 5IVOA 4JFOA 1A6TB 1NIDA 3BFOA 3E3QC 1MCBA 1DQJB 3W5MA 3IKCB 3S6CA 4XHJC 1T0NA 3I6KB 1T5KA 1NPJA 2EUWA 3RY4A 4F15B 4G9DB 2R2CA 4JHWH 2BMKA 5AB1A 4QXUL 1AYOA 5EU6A 5FCUL 2F58L 3QO1A 2KBGA 4ABUA 4BFEA 1BXAA 2WQRA 4UQ9A 3RTLA 2J2ZB 4L1BA 4GS7B 5A6MA 3V9EA 2NSQA 2EIZB 2MNJB 5D1XC 2J5LC 5IJVA 2TAAA 5E94B 2XLLA 4Y2DD 5DJCB 4GKOA 1GIGL 1FZOB 3FO0L 3L8QA 5TE6H 5DT1H 2QVTA 2CBOA 2PKDA 5E1IA 1FNHA 1M56B 2VQ4A 4BZ1A 1MQKL 5I1EH 3OG6B 7FABL 2V2WB 2FATL 1DZBA 3IJEA 3L5XH 4U1NB 1HHIB 3SE3C 4ETQB 3EJQA 1RU9H 3QH3B 4TOYH 3HA0A 1GJIA 1IGFH 2ARWA 4X7SL 4UM9A 5KJRL 3BRGC 1QNIA 3D07A 3NIGE 1HZHH 1TTAA 5FGBA 4DUWA 1F2QA 4DGUA 3O8XD 3UO1L 4HP5A 2G5RA 5K59F 1KTCA 4LSUL 2HN7A 4JS7A 2VXUL 4FA7B 1RZFL 2HJFA 3N0PB 2ZCLH 1LVEA 4XP9L 4OF6A 1RKRA 1XH3B 2WSKA 3W1ZA 1S8DB 1NWOA 5ALBH 5I6NA 4JE4B 4ZOCA 3SQOL 2CKBL 1KELH 1PVHA 4HJUA 2BVPA 4KJYB 1TU2A 3Q2WA 3ARBA 4X6DE 2CR6A 3H4FA 1X7SA 1D5MB 2WZ6A 4PRPD 4ODXA 4ZX3A 3E8UL 1HWGB 4KAQL 2E47A 4W9LC 2CBTA 3W38A 1Y7VA 4K3DL 3DVGB 5CD3B 5DURB 3AZUA 1RJZB 2A74A 5TDNA 5SV3A 4XXDB 2UXTA 3RWHB 1T1ZA 4LCIL 4YFLI 3V52H 4E9QA 2ADYA 4J1UB 1EX0A 4JNXA 2UXGA 2GBUA 1AGFA 1H0DB 3ESOA 1DTUA 5T3XH 5TPWL 1GCYA 5EO9B 1R3JA 2CJTA 4YK4B 2FNWA 2YRPA 3MBXL 5IFHH 2VLRB 3FTGB 5D7LA 2NR6D 3SE4A 1ORSB 1NUNB 1PJWA 2NY7L 3NJHA 4PRAB 3DV6B 4FLQA 4WO4B 3VFGH 3MGTA 3LKPA 4PJ9D 3FN0L 3LMJL 3HG1A 4LAQH 3NFSL 4HUWA 2CPCA 3FHEA 4Y4FA 3Q0HA 3E9TA 5CINL 2A7BA 2EDMA 3GXDA 2EUZA 4N0CD 5SV4A 2GW5A 1GY2A 1I3GL 1A66A 3S34L 2V5SA 4Y89A 3RZCA 4JHAH 5AKSA 1LO3H 1L3WA 4GAGL 5IW1B 3LKOB 5DZVA 4OW6A 3TNNA 1MQ8A 1QA9A 2FJGA 1G1OA 3BUQA 5IV2A 5I26A 3VXTA 3CFDB 3SE9L 4JO4L 4QEGA 3BVXA 2G60H 3QG7H 1W8EA 4ZX6A 1NAML 4PJXB 2IDQA 2YD9A 2BVOA 3MRCA 1H5BB 2WPGA 3BKCL 3Q1SL 2H3XC 3UP1A 1IKFH 3VTAA 1K5NA 4FHBD 3VFMB 1QFWL 2BMKB 3B7SA 1H3VA 4CN1A 4EIGB 5DO8A 4A2EA 5D7IF 4LL4A 4XC3H 3N6YA 1FZMA 1ZS8A 2NTFA 1O7VA 3TIDA 4EVNA 3T0EC 2VKXA 1NBYB 1R5WB 2R1WB 3DIFA 2Q7NA 3F7KA 4OUOA 4MS6A 2J8UE 4OGXH 4DPBX 1E4HA 5IJVB 1AZBA 1TQUA 2MPAH 3KXFD 1SXCA 1KTKE 2MQ3A 4XCCH 1KENH 1Z5YD 5TQ2L 4LPTA 2CK0H 3IFPA 4JFHE 3UH8A 1ACCA 4D9LH 5JNYA 4LSPH 4ONOA 5IOPA 1N8OE 3BFQG 2YRBA 4QWWD 2OA9A 4YXLL 3OZ9L 1IM9A 2X4PB 2RTTA 3LHAA 4MDRA 3S5LG 2F1AA 3ZKNC 1U41A 2YN3A 3U9UB 2AQ3A 4YEEA 5TQ0L 3HC3H 5EB9A 4KKLD 3WIIL 3HI1A 2C3GA 4DPRA 2V2XB 2F5BL 1Z3GH 4NZDA 2D7MA 5EFIA 4UM9B 2I7OA 4JG5A 2HP4A 3CD4A 4IHOA 4UNUA 4IU2A 5CWSB 2E86A 3KYOA 4FZ8L 4OIIL 3OJMB 2XN9D 4MCNA 1IC5H 1LK3H 4OLEA 4IRSA 2HTLD 3KHOA 4V1DB 5F96L 2DL9A 2DIBA 1LNUA 1TNNA 4F27A 2XN9E 4OBRA 4G6MH 3ZT6A 4EN2A 1WTGT 2KQNA 4PJAA 4F8QA 4KTEH 3QEUA 2ZWSA 1JYNA 5I66B 3F6JA 1CXLA 3CBJB 4GRLB 3B9KB 1QR1A 3B9EA 1XT5A 1CTMA 4UAOC 2HJLB 4B95C 4ODXB 4XVSH 3CU7A 4U2YA 4F5CA 5HGGS 1HDMB 2CK2A 4AYFA 4QYAA 4Z78B 2PN5A 3EYFA 1LO0L 2OQJA 3PJSA 3SO3B 2IBGA 4GNKB 4OZFB 2B39A 3AMKA 2W94A 3ASNB 3GSVA 4KDWA 2VN7A 3I6GA 2JVUA 4AGOA 3GXTA 1NMAL 1UXWB 4NKMA 2JI1A 3ARGB 1CFTB 3VD9A 4JANB 2EZ0D 1VFMA 3ZRCC 4NPKA 3QS3A 3Q3GB 4PWIA 4RFOL 4XC1L 4Z7VE 2W91A 2WXJA 4FF9A 1U8CB 4L29B 1VDGA 2VH5H 1TQTA 1EAPB 3VWJD 4ORZC 3GMOB 3CVHB 2WBWB 2WBXA 3IF1A 4AYMC 3QZWA 4ZPVB 3LKPB 5ISZA 4P2OA 1KXTB 5KBPA 3APDA 2R23B 3QIBD 4HUWB 2J4WH 5TDOB 3EADA 4Y4FB 2AKRB 3MFFA 1CR9H 3U9WA 3L13A 5LBVA 4PYGA 2WWMD 4N86A 4M61B 4MNGB 4WF7A 4RDBA 5M7QA 1K3ZA 1MELA 1JJUA 2Z31C 3CDZB 2GEQA 1R3HB 4B27A 5I0DA 1Q94A 3B4NA 2DYSB 3CN4A 3EFDL 2JJSC 3V9CA 2C7UA 1F90L 2F0CA 4BCXA 4LXFA 2L04A 3RUGE 4TVSa 2G30A 2CNZA 1ZY9A 1QA9B 1BDYA 3PWUA 4G3YL 4K9EH 4EXKA 5IV2B 1X7QB 3VXTB 5EZIL 2LU7A 5E99H 4YBLC 2ESVA 1IIKA 4D7BA 4R2GC 1N18A 2ICWI 4B7LA 2XTSA 4PCTA 2G5BA 1MF2L 4RGOH 3WJLC 3L16A 4AZUA 1NH6A 3BGMA 3EGXA 3RY6C 1SQMA 1J10A 1P4BH 1OARH 2AEPH 2BVYA 4Y4KC 3ZYOA 4C56A 3U0WH 5E70A 1F3DH 4PRDB 4EVNB 2EO1A 4LU5H 4YMPA 4WJ5B 2YHGA 2NNRA 3U9PL 4YHOH 2NY6B 4ESKA 3T04D 4LRIA 4J3OF 3UP6A 4HLZG 4UM8B 1C5CH 1PY4A 3SGDH 3BPOC 3KPSE 1G9ML 4ZUVA 1YEKL 4ZXBD 2EILB 3BESR 2YAMA 1S5IL 2W9LA 2WJ5A 5GHWH 5HPMB 1RIVH 1FL5A 2X4TA 43CAA 5I1GH 1WGOA 1GC1C 2KC0A 4AGNA 4MA8L 3CE1A 3DVIA 4V2BA 1UTDA 2JKWA 5DFVC 3GC3A 3VXPB 1MPAH 1L0PA 4BE6A 1CICD 3NRQA 3SYPA 2A4CA 2NUPA 1T0OA 4OFPA 5EU5A 5F7YC 1AGEB 43C9A 1MHHA 2DTSA 2UYLB 3BJLA 3O4LB 4HPOH 4PY8J 4XMKL 4AYID 1A5FH 5FO8A 2IH9A 1W72B 3FT2A 3M7FB 2PXYC 4MDJA 1L7TL 3GXUB 5EU7E 4K5MA 1N6QH 1LP9A 4LHUB 2XKNA 1ZHLB 2ADJA 1PZ3A 5CSZB 1YY9C 3C5SB 3EJJX 3UBFA 3MRRB 5ADPL 4AEHH 1EHAA 2BY1A 4H0HB 2AI0L 4MJ6B 3LN5B 1HK6A 4PJAB 2HYMA 5CGTA 4HXAL 3V5KA 4GXUN 1QSFA 3DUHA 3AS3A 3CK0H 2W07A 2A6IA 3V0IA 2PYFB 3HC4H 5DO2D 1IE4A 4DT2A 5DUML 1GOGA 4FFYA 1OT2A 1C5BH 3FN3A 4PM1A 3N91A 4KQ4L 3BC9A 3ET9F 2AJZB 3S35X 1KOAA 1XB6A 1AC6A 5IJKA 2EDBA 1D5ZA 3IMSA 4CC1A 2ZJSL 3CHRA 2WLKA 5C7XL 1FO0A 2B1HH 3AY4C 1BLNB 4EZLA 5KZCD 2OMXB 1FDLH 4JRXE 2NNAB 3WIFB 1TZGH 1Q1JH 3D85D 1ORQA 4EQ3A 1PZDA 2OMVB 3KPMB 4M5YH 3S4SG 1Q72L 1G7IB 2F8OA 3C60A 1JZ8A 1RUPH 5T5NG 4PJHE 5L6YL 4JN1L 1AKJB 4FXGB 1RD6A 1KBGH 2OLDA 2X89A 1H3PL 2ATPA 1HL5A 4PJ7E 4S0HA 3HG2A 1NMCC 3PRZA 3KJ6L 5DS8B 1OB1B 1CBVH 1KUMA 4P2OB 4L9LC 3HS8A 2Y24A 2A6KA 5JPNC 1TSRA 2ZOUA 1PFOA 3JZ7A 3H8NA 4W4OA 3U0PB 5IVNA 4UILL 3K1DA 1SHSA 4MNQA 3IDMA 2Q8AH 4QRRB 4WHYG 5F1NA 3ZDZB 3L3OC 4E2OA 5DJXB 3ATEA 2LE9A 1C1EL 4QO1A 2XKSA 4UMSA 3RVTC 2KH2B 1V10A 1BVKA 2Z35A 4WI3A 2BSED 1DP0A 4HQQL 5IGXL 1IE5A 5C70A 2IV8A 5E9DB 4Q9QL 1ZVNA 3QIWB 4LESA 5JW5A 5HDBB 2MCPH 5A2JH 2WO3B 3OM3B 3MA9L 4AIOA 5GGQH 4MD5A 5FYLL 4OZGE 1SY6H 2VR3A 3T0WA 1DYZA 5CLXA 4MZIA 1OAZH 4UTCA 1OAYH 5DHYA 3VRIA 4WFFE 3EGXB 1YN6B 2CLRB 2V7HB 1E3FA 3DI2B 3O4OB 2A2QT 1OM3L 1A7QL 1S6NA 2DL2A 2VDMH 4XR8C 5F9AC 3L7EB 3ETTA 4GXVL 4D0DB 1U3HC 3OKNB 2D73A 5IROC 1FLRL 3E6FB 4F33A 4CGUB 4G2AA 3CVHL 1VENA 4W70A 4PRIB 4WUKL 2X28A 3VSVA 5I75C 1LQSR 4N2HA 3HW7A 5EBLA 3UTTE 4ZD3H 3GINA 4BSWB 2CO7B 5LG6A 1PSKL 1QP1A 3MUGB 3WIAA 3KPRD 2APXA 3QHTC 1AG0A 1JG9A 1M2OA 2VN6A 4PBWD 2GK2A 3QJZA 3VXRB 2FZ3B 3PIQA 4B97A 1J86A 3ULUH 3DUUB 1NIEA 4O58L 5DJAB 3B1UA 4Z0BL 4KWUA 2AJSL 3KPRE 5D5ME 2HFGH 2A77L 3TCLB 1JS4A 2YGOA 4JFDA 5FYKL 3S4SA 3EXJA 1FGVH 3P0YL 3NESA 1FE8L 2QFPA 3RE0A 1I1FA 2CHWA 1W0WB 3P54A 1NSNL 2YPKB 3SD2A 4OV5A 5I17B 4WKZA 3GJEA 1DN2A 1LL1A 4TNVF 5IBLC 3PJLA 4EI6A 5CCJA 5HYQA 1NCAL 2VLLB 1VZIA 4PBVC 4OZIE 1IJNA 3HCVA 4KVNH 1YA5A 2ADJB 4NJAH 4P2RA 2MCAA 3MV8A 2BP0B 4HFWB 3CZEA 1HSBA 5C07D 1ODUA 5TK2A 1R9FA 1A8JH 3TONA 1XGQA 5B7MA 2AXGA 1N67A 3M1CA 4QYOB 4ZMNA 1IGCL 3G5ZB 2XKUA 3Q6GL 3CX5J 4XNBA 1GKOA 2WUBH 2XTJE 2IWFA 1XH2A 3SKJH 4XPFH 3S8GB 3HVDA 5AW1B 2WMPB 5H8DA 2Q20A 1JI2A 2DPKA 4NZ8A 2ZNXA 3GMPA 4JZJA 1Y1UA 1I8IB 1KDIA 4XP6H 4K3GA 5CCKL 5KTEH 4WSKA 2ITCA 3C9NA 3OXSA 3SJVD 1I8LC 4BRJA 2E6JA 3MPCA 1FO0B 1SEQL 1F4WL 3P9WB 5HHOE 4K94C 3WGUB 4DOHB 1BM3L 1I8AA 1KTDA 4BXVA 4PJ5D 4NO0D 4XN8A 3FOMA 3RIFK 1KEGL 2QPSA 5G55A 1FNLA 1HKLH 4HF5L 1RZGA 4G71B 1N3NB 4UZGA 4JK0D 1B2YA 2BDNH 1U4FA 3C60B 4EN3A 4PJ5E 2BY2A 4CGTA 1BEYH 1ADWA 2Z7WA 1E2VA 1JPGA 4A7UA 1AQMA 4IRZA 2NXYD 4AWJC 3HBPA 4OIFA 2W60A 2YFNA 3BJ91 3GMRA 1OF2A 2DIAA 4PJXF 3VH8B 5H2BA 3W3BA 5C0CB 4WUUD 3GRWA 4IIZA 4JDVB 4GLRI 3GDCA 3M1OA 4HW6A 3T3PF 1W72L 3WKML 1B9ZA 2P42B 3RB7A 5DD0H 1B0IA 3TA3B 4EKXA 1CLOL 5CN3A 1HOCB 1IFHH 2OMNA 4MB5A 4WUUE 4ABWA 5IHWA 4XNZC 5IHUH 4HIEB 4U7KA 4YBHA 5E08L 1YEIL 1UENA 4ZT1A 5CJQH 5EBMA 4IOIA 2FX9H 3FSZA 3MODH 4FP8H 5IB5B 2P5WE 1UWXH 3BAYA 4FQIH 4Y2DA 4YHNB 5EEZA 1ZEAH 4I18C 5HJGA 5A43C 4IHBA 4ZMWA 1HAUA 1ONQB